1BEUA

Trp synthase (d60n-ipp-ser) with k+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryocrystallography and microspectrophotometry of a mutant (alpha D60N) tryptophan synthase alpha 2 beta 2 complex reveals allosteric roles of alpha Asp60.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Carbon-oxygen lyase
molecule keywords TRYPTOPHAN SYNTHASE
total genus 98
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1beuA00
4LY8A 1YXDA 1WQ5A 3TW7A 1JVNA 2CZ5A 4IX2A 2G5WA 1L6YA 4Z08A 1T0OA 3DFSA 1LYXA 3HGOA 4XBKA 1PS9A 1LRTA 2DZSA 2FB2A 1XCFA 4YCPA 3HG3A 3PB0A 2G97A 3KFTA 2A0NA 4UTTC 1XUZA 2AQWA 2HTMA 4HPJA 1LCOA 5EKYA 1XKYA 2A21A 4HN4A 4KKXA 4XBSA 2ZTKA 2G96A 4RXFA 3C2OA 1XM3A 3M47A 5KTLA 1XBYA 3W1RA 5K9XA 1H1YA 3R89A 3NL3A 2TMDA 2QEZA 2PRMA 3LHWA 1Y0EA 1AG1O 4R33A 4N9DA 3IVTA 3YPIA 4MLJA 1ZCOA 1KLYA 5LNVA 3OHIA 1O5XA 4M5PA 2ZA1A 3W74A 2BXVA 1TTQA 1VYRA 3M9YA 4PTNA 3KVLA 3P5YA 1LLZA 3G1XA 1AW1A 1FWTA 1NAL1 1H62A 3UYCA 2X16A 2JBMA 3G1DA 3N9RA 2XN2A 3TDFA 5LNUA 1KLZA 4A22A 7TIMA 2VFHA 2ZYFA 2YFNA 1T8XA 4LNYA 3B03A 3FLUA 1SFLA 3UD6A 1VRDA 4I7WA 3WJYA 2FJKA 5I3JA 1JCLA 1B57A 1WX0A 5D2TA 3C52A 1DQWA 5AB3A 3EEGA 2JKAA 1FUYA 5CPNA 3W7NA 5E1QA 2GJLA 3RK8A 2E68A 1JCNA 2HSAA 3OVRA 3PSVA 3PS7A 3WJXA 3LHVA 3CWNA 3HPSA 5FF4A 2ISVA 4FNTA 5AC6A 1P0KA 2Y70A 5K3VA 2EAWA 3B4UA 3EXRA 2RDTA 4MYXA 4IGHA 2VFDA 3NM1A 1JRBA 4LTSA 5CSSA 3R8RA 1L2UA 2PE4A 2EGZA 3FKKA 3MP4A 4CCEA 5HR6A 3O1NA 2Z6JA 1D3GA 2QCFA 3IGSA 4LWWA 4RZ5A 1O60A 1G7UA 2DP3A 3GDTA 4CQ9A 1DOSA 3TQVA 3T4CA 1SR9A 3KRZA 1AK5A 3QMSA 4JTHA 5FEPA 3W85A 4WUIA 1A5BA 4R53A 3EWWA 3W7PA 2YCEA 3ABQA 1GG1A 4TR9A 1H7OA 2J9YA 3BLEA 4WY0F 3DU0A 3E02A 5AHLA 2ISWA 4CQAA 2NWRA 3W84A 4ADUA 5D05A 1I45A 1H60A 2FB3A 4KWVA 5GVJA 5E0KA 5D09A 4IPIA 2V82A 1ZY9A 3TR2A 4ZMGA 2NV2A 3BV4A 2ISSA 1ZHAA 2ZRWA 4WOQA 5C5YA 1VJIA 3QQ1A 1H5YA 1LBFA 2ZZ3A 4O18A 3ABRA 3GNDA 1FDJA 3AO0A 2FPTA 3DI0A 2ZRUA 3C2FA 4U28A 1QNVA 3B04A 3VKJA 5AFDA 1IF2A 3DI1A 5D2YA 5EBUA 1DQXA 3EXTA 1LOSA 3TROA 2QF7A 1WBJA 4DBEA 4JTJA 3TC7A 4MUZA 4J9JA 4S2CA 2Y7EA 3R2GA 2ALDA 4NX5A 2H8XA 1G4PA 4GC4A 1ZAJA 3W7EA 5TBOA 3C8FA 3IGXA 4ZZ9A 3CU2A 4GNJA 1P0NA 3GYEA 3W1LA 3SGZA 3TXVA 3ZWSA 1TTPA 2EF9A 5KINA 1JJKA 5IBXA 3C6CA 1JQVA 4NJGA 3LXAA 4XQ6A 5G4WA 5HQEA 1OFBA 3O8AA 3NL2A 1B9BA 1UCWA 1TO3A 5AHNA 4AWSA 1QPRA 3MJYA 3NGJA 3M0ZA 4EVZA 1WDWA 5K4XA 2QCEA 2W6RA 1X1OA 3BW2A 2J9XA 2G95A 2ZZ1A 3QW4B 2HS8A 3P67A 3O06A 4N9CA 4WY0B 3W7HA 1ME8A 3LLFA 3LRKA 4W9TA 3LTPA 3NR0A 4U4MA 4WXYA 1XI3A 2Z0IA 4PEKA 5AC7A 4JICA 1TSIA 4DQWA 4EWND 4CCCA 3W1UA 1T99A 3O05A 4LS1A 4RXGA 4DBDA 4NXSA 4FNRA 3NDOA 5A5WA 3G1HA 2QUUA 2QDHA 3LV5A 4K36A 3FIGA 3I65A 4FNQA 3AJXA 3SZ8A 1SPQA 3SIZA 3EWUA 2NX3A 3Q37A 3BO9A 3GXTA 1VCVA 4Z0SA 4A29A 1XBXA 2WSQA 5LZLA 3H53A 3OIXA 4OWGA 5CZSA 3L21A 2VEMA 3TFCA 5CPLA 4Z1CA 1PIIA 1VGAA 3B0VC 3CIWA 3L5MA 3W7RA 2YW3A 4K8EA 1TPUA 3PVFA 4WY0A 3VFLA 5LHEA 4S2BA 4O54A 4UTWA 4JR5A 1VZWA 5D38A 3QH2A 3T55A 1U83A 2Q8ZA 3W7DA 2QUTA 4N4QA 4YXGA 2C16A 1K7FA 3W1NA 1VQTA 1TRDA 2QCGA 4NJKA 1OFOA 3THQA 3HIJA 3A21A 3SI9A 4CNOA 3SGUA 2VFIA 2VFGA 2VFFA 1O94A 2ZZ6A 1RR2A 2P1FA 4JDYA 4PFMA 3IVUA 4A2RA 1R2RA 1LROA 1Q6OA 4XTDA 3N2XA 4PC8A 4RR4A 2A6NA 3ZS4A 4EOUA 4WX2A 4LRTA 4EIVA 2BWGA 3LI0A 4A2SA 4O4WA 2GVJA 3G3MA 1P1XA 3V1PA 1ME9A 2Q8LA 4ALDA 3BLFA 1KBJA 2ZZ5A 3THAA 3RFAA 5K9CA 1L9WA 1F6KA 3LCFA 1XXXA 4AF0A 3W1QA 3GZ3A 4WXZA 4UTMA 2B7OA 3M5YA 3GAYA 3QRHA 2Z2UA 3HO8A 2Y88A 3MI6A 3HBLA 2QKFA 2B7QA 5DY2A 2A1YA 1R2SA 4RZ4A 2ZRVA 3RNDA 5CZJA 3QMRA 3WFAA 3IIVA 2J27A 1OYCA 4DPQA 1XL9A 1TREA 4BF9A 3CEUA 4R34A 2E5CA 3G0XA 1EA0A 5DCDA 3LBMA 1OF6A 1W5QA 5LKYA 1G4EA 4MKNA 2VENA 3W7IA 3TE9A 4AHOA 4O0ZA 4X2RA 1VCGA 1FWWA 3ZWTA 1R2TA 3M41A 4IUOA 1VLIA 3NQFA 2RKXA 3STGA 3GKFA 3PY2A 3CC1A 4O14A 5SWUA 3UPBA 1AL7A 1LBMA 4QISA 3S0CA 4JX4A 5G1TA 3P7YA 5TQLA 1LORA 2RHGA 1U5JA 5FESA 3DFNA 1DKWA 4P61A 3E0IA 4FIRA 3C3NA 4D2JA 4ZQOA 3C56A 4HKPA 1I2QA 2NZLA 1JCXA 4N9BA 1AL8A 3DBPA 3NA8A 3PBYA 4UIOA 3NQEA 3GLCA 2FPVA 5DN1A 4LVFA 3ABOA 1TTJA 3W7KA 1HO1A 4NUWA 4PCFA 4GUFA 3NZRA 2V2CA 1PE1A 4JTEA 3R5EA 1ZALA 4QIUA 2F84A 1IIGA 3NYZA 4LUIA 3OA3A 3BW4A 3RLUA 3NZ1A 3S9YA 4BWLC 5G4EA 4IMDA 1RQBA 5KMYA 3DGRA 4UTLA 5KITA 3NOEA 2J6XA 1W3IA 3GVGA 4YLWA 4JN6A 3BPWA 3PM6A 3O63A 6TIMA 4HIBA 1SZGA 5A8GA 1ME7A 1D3HA 4LW7A 1WV2A 4Z1BA 1FDYA 3VCRA 3W1PA 2E6DA 2DORA 2EHHA 3HPXA 3IIOA 5E93A 2VOMA 3WJSA 3QJAA 3PF3A 2YZRA 3HQ1A 5D30A 3DZ1A 4RX0A 1AW2A 5DY3A 1M6JA 5BMWA 3CPRA 3NQ6A 1MO0A 1JUEA 4XZ9A 4JTLA 1H7WA 2Z1BA 4I7UA 2PRHA 2P0OA 5LGZA 4TX9A 4JX6A 3BGGA 1O95A 3EWXA 4C1KA 1F74A 3SJ3A 4LRSA 1H51A 1R47A 3LV6A 5AHIA 4EF8A 1KW1A 2WV8A 5EYWA 3W2NA 4UCGA 1OX4B 3I68A 3LI1A 4K38A 2A7RA 3NEVA 3P62A 2V9DA 4AWTA 4DPPA 4M6QA 3W2LA 3W72A 3L66A 4HHPA 5C54A 1GG0A 4M6PA 5F4SA 4K6AA 4LT9A 2ZZ2A 1SSDA 3C2EA 1QPNA 5AHFA 5AOUA 2WNQA 5F4WA 2VEIA 2ZRYA 2H6RA 3MYPA 4GE8A 2JGQA 3A9IA 4AXKA 4BWLA 4XUGA 2C19A 4IMGA 3P61A 3S1XA 3TJLA 4E38A 4XWUA 4ZQRA 3KAOA 5HNRA 1LRNA 3MI3A 1SSGA 3HF3A 3CHVA 1ZNNA 3MP5A 3T78A 1GYNA 3TA6A 2JKPA 1W37A 2OJPA 3DFOA 5FEWA 5CKSA 3PUEA 3LHUA 4TU1A 2XN0A 2ZA2A 1OJXA 3W22A 4KFPA 1KFJA 1WAUA 4BR1A 2NLIA 3O15A 1QPOA 3TK7A 4IWWA 1RD5A 4UNLA 3P8IA 2NX9A 1YYAA 2Y6ZA 2KZHA 4NJHA 4MPQA 1Q6RA 4IPJA 3QQ0A 3JRKA 3PSWA 5BW6A 1RVGA 2I9EA 1KTCA 4KFNA 4Z0JA 3P84A 4LVDA 2ATSA 4UTHA 3VNDA 3G1AA 4JIQA 5I3IA 3M16A 2Q3RA 3QW3A 4NNAA 2BLEA 1OFQA 2V5BA 1S5VA 1C29A 4Q4KA 3EX6A 1TV5A 3MYOA 3TC6A 1SW3A 1LP6A 3QC3A 3NXFA 1K7XA 4JY9A 4AVFA 3N14A 3K30A 2ZCGA 3PUDA 3HPZA 5D04C 3MBDA 3UXDA 3B0PA 1DVJA 3M5VA 3KVJA 1TV7A 2QCMA 4RJEA 3STFA 3DH7A 3W7QA 1ML1A 1PV8A 3H54A 3C0JA 4GUIA 3CB8A 4IQLA 1CI1A 1SUXA 1JQXA 4WOZA 5KZEA 4NVTA 3MBFA 3I7RA 1CW2A 2YR1A 3EKLA 5EMUA 1EUNA 1ZAIA 3W1AA 5BOOA 2Q3OA 4O57A 2BZNA 1M7OA 2VELA 5KZDA 3PG9A 3I7SA 4GUHA 3NQVA 4AMAA 2C14A 3MO7A 3LX9A 1L6SA 3LRMA 3DHFA 4JTFA 1X6UA 3KVKA 4NU7A 4PA8A 3WK0A 2XFWA 3C61A 4DXVA 2YYTA 3QFEA 1K7EA 4O50A 3G8EA 1NVMA 4FXSA 1TPDA 1YDNA 3E96A 5HMSA 1H63A 1XC4A 4YMZA 3O6YX 1IXOA 4EF9A 4TIMA 5LHFA 3A24A 4QM1A 4FX6M 4RZ6A 1TPEA 1W8SA 4UMAA 4C1LA 5H2ZA 3TW6A 3TQKA 3PWAA 1VS1A 4O0KA 3IGUA 1EB3A 1QO5A 4LOCA 4LS0A 1DORA 5HWJA 4PODA 1GEQA 2WQPA 4GBUA 2QCCA 3V75A 4ICNA 1PHWA 3MHUA 3P8JA 4QQ3A 2Z6IA 3B06A 3LDVA 1JCJA 1F5ZA 3RU6A 2WNNA 3BK0A 4E0CA 3NPWA 4LV9A 1RV8A 4ZQCA 4O13A 1KM4A 2A7PA 4ADSA 5LNWA 2VXNA 4QJ1A 3HJZA 3TJXA 3W1XA 3WK2A 3NL5A 3FYOA 1W3NA 2B0MA 3GB6A 2J88A 3LHTA 5G2IA 2CW6A 4O10A 3HGJA 1FWRA 4OU1A 3BW3A 2ZZ4A 3W2JA 4TMCA 4Y9AA 1TCDA 1K8YA 4PH6A 3EKZA 4HNVA 5KSWA 2GPTA 1Q45A 4M7SA 3B0UX 1QMLA 4WQ6A 5LNSA 2EPHA 1O5KA 4QSHA 5EY5A 4RLIA 5TIMA 1XDLA 3MWAA 3G22A 1OFEA 3IIZA 2RFGA 3TMQA 4UTIA 1KM1A 1ICPA 3QYQA 4DEFA 4L4LA 1DV7A 2VC6A 1L6WA 1TJRA 5D2XA 2X2GA 3PC0A 4DO5A 4FNSA 1D9EA 5I3GA 4M19A 4GWEA 4IMCA 3N73A 1I2NA 1YLVA 1AMKA 3LHZA 3TXZA 3FOKA 5HWMA 3WK1A 1H7NA 2GQ8A 1Q6QA 2CLKA 4FF7A 1NF7A 1UBSA 1S5TA 3MHFA 4FO4A 5C2XA 4LVAA 1GZGA 3UXAA 2CU0A 3QM3A 1G4TA 3LERA 1KM5A 1QPQA 3NPUA 2WNZA 5DLCA 1X7FA 2Y7FA 1YDOA 1KA9F 4HSOA 2RDUA 3P60A 4R7JA 5DCBA 1UASA 1NEYA 5CPOA 3SY5A 1VYPX 3PR2A 3DFPA 4Z1DA 1QR7A 3LTYA 1Q6LA 2DJXA 3JS3A 3RLVA 1F73A 1KV8A 4X22A 4AEOA 3DKLA 3MP3A 3M1ZA 2C15A 2GQAA 2CZDA 4YL2A 3S8HA 1FWNA 4S1FA 1PHQA 4O4VA 1M7PA 1QO2A 2FFCA 4QNEA 4IXXA 1HL2A 5HJLA 2R8WA 1IGSA 1VHCA 5AYXA 5DBTA 3VE9A 4NX0A 4K39A 1GVRA 1WOBA 2Y61A 3W07A 4MZYA 3FYPA 1I8JA 1FWSA 4K8HA 1RQHA 5AYZA 2FIQA 4JYDA 4B5NA 4GUGA 3NO5A 3A5FA 3TX9A 1W5NA 4XKYA 3UY8A 1MEHA 3GDMA 1IXNA 4OT7A 1XBVA 2UV8G 4RV8A 3N9SA 2V2DA 1RPXA 3GDLA 3MUXA 1FBAA 4N02A 3W7OA 4O1CA 1YDVA 3FFSA 4O16A 4FXRA 4K7YA 2J24A 5CZTA 5F1UA 1I4NA 2X30A 4H4IA 4ML9A 5G1YA 4X3ZA 4UR8A 1EX5A 1PCKA 2FLIA 3UWQA 1RQEA 1W5PA 2V0TA 2VFEA 4ONVA 4FNUA 3NM3A 4A21A 2XN1A 1EIXA 3GX9A 1I2RA 2CZFA 1ZENA 5K9DA 3W7JA 3LGEA 1V7YA 4OE7A 4LV4A 3CT7A 3KXQA 3DKJA 5F1VA 5I3FA 3W88A 3W83A 5HR7A 1SQ7A 3S5NA 3STEA 5HWNA 4JEQA 1LDCA 2RDWA 2V2HA 1UB3A 2NX1A 1BTMA 3NQ8A 2GJNA 3W86A 5D02A 3QF0A 3BVJA 3G0SA 2X1SA 1GPWA 2FPYA 5D37A 1TRIA 1BWKA 1S5WA 3LOTA 1SZFA 3N2MA 1AW5A 1EP3A 5K4ZA 1JR1A 1KFLA 1TMHA 4YWIA 1XFBA 4UFIA 3LB0A 2W79A 3W3OA 1P4CA 2ABAA 1F2JA 2NV1A 3S42A 5LGXA 2QCNA 3UNDA 5U7SA 1FCQA 1EWEA 1W1ZA 5LSMA 5FEZA 4UTWC 1N55A 5AYYA 4E2DA 8TIMA 2GVGA 2NUXA 5DBUA 3W2KA 2B7NA 3P82A 2PRLA 5G2WA 1LZOA 3DXIA 3CEPA 3GDKA 3NQCA 1WXJA 4QITA 4P2VA 1SZNA 2YYUA 1LOLA 1G69A 4GRSA 4Z1AA 3OVQA 3FJ6A 5AHEA 5CG7A 3CQ0A 5D03A 3M5XA 3S5YA 1DJQA 2CWNA 1W0MA 3QPYA 5CSRA 3F4WA 3NG3A 3HG2A 3G1FA 2JK2A 1Z42A 2HMCA 3EX2A 3M7WA 1OX4A 3A22A 2CLEA 4PL2A 4UFHA 2C13A 1GYLA 2QCDA 1G7VA 4JNMA 3KX6A 4FHAA 1VCFA 4CQ8A 4H3DA 2CLHA 3E12A 3FA5A 4RCXA 2AAMA 3FS2A 1T96A 5T26A 2VKZG 1SFJA 4O1DA 4LVBA 2H90A 1UJPA 1LRQA 2NUWA 3QSTA 4UMBA 1J5TA 1GVQA 5HUPA 4NJIA 2QDGA 3W73A 3SECA 4NQ1A 1H7RA 1WBHA 3MI2A 1A5SA 1B4EA 3L67A 3TAOA 3L2IA 3ELFA 3NAVA 2D73A 5F2LA 3NNTA 1GJPA 1H7PA 4N6FA 2A7NA 1TTIA 2TSYA 1K8ZA 1YTDA 3T44A 4FX8A 3NPXA 1OX6A 3RMJA 3UWUA 1OX5A 1TPWA 3F03K 2CLFA 3GIYA 3U8GA 4POCA 2NXIA 4JTTA 2HS6A 1TPH1 2X1UA 4KFOA 5EA9A 3DAQA 3R12A 3GDRA 1BWLA 3S1WA 3Q94A 5FF7A 4ZQPA 4UTJA 2QAFA 2IQTA 3E9AA 3L0GA 2CLMA 4UTUA 3WK3A 5H91A 1NSJA 1F76A 1PCWA 4IJBA 1QFEA 3STCA 4M7TA 2E5DA 1JUBA 4HNUA 4GJ1A 1UUMA 3S1UA 4ORIA 4JYFA 2YXGA 1G67A 3N34A 1J2WA 4JS3A 2A85A 4Y96A 5HINA 1E51A 3L5LA 4NJJA 5U4NA 3KHJA 1TYGA 1QAPA 2Y85A 3ATZA 3WJWA 3LCXA 1GVOA 1IIHA 1S3HA 4ADTA 3ABSA 1PL9A 2ATMA 4RKAA 4CCDA 1ICSA 1QOPA 5KZMA 1HTIA 5G5IA 4DO6A 5HUOA 1ONRA 3FKRA 4K37A 4UFKA 4WD0A 5F2IA 2ZRZA 2E5BA 2C1HA 3G1VA 3L68A 3M44A 1A50A 1DBTA 4OV4A 1VHNA 5L9FA 3Q2DA 2R91A 3I7QA 2C0AA 5HULA 1FCUA 1QOQA 4LC8A 1JCMP 3NQDA 4OGZA 4K7VA 4AHQA 3CTLA 1IXQA 4GXMA 1SO6A 2CZEA 1OFPA 3KRUA 1Q3NA 1LLWA 2PC4A 1NFBA 5FF2A 1ADOA 3O6CA 2CLOA 3CIXA 2J9ZA 4O1AA 4JDBA 1GOXA 2H3DA 1P5BA 4O28A 5FF3A 5F2GA 4N4PA 3DFQA 2YFOA 3G3DA 1IXPA 4O52A 3PBVA 4UTKA 3GR7A 1A5AA 2QR6A 4ZQMA 3KRSA 3EB2A 3EWYA 3UWWA 3W7CA 4FB7A 3DENA 5C6MA 1XDMA 3GAKA 1KM3A 1EWDA 3LHYA 4MY8A 4LUJA 1B4KA 1OG0A 1OVDA 4HNNA 5J5RA 2GUUA 3W7MA 1UUOA 3W7LA 1C9DA 3TFXA 1VYSX 4NNCA 1K3UA 4L4MA 3CM4A 3QSRA 1VR6A 2CFFA 3OEXA 1DL3A 2R14A 1LOQA 3TKFA 3W6YA 3TH6A 3TQ0A 4O12A 1TQXA 3LTSA 3R13A 4JYEA 2C18A 2QJIA 2YGYA 2DU2A 4O17A 1M5WA 3NQ2A 4JD4A 4FIQA 2E09A 2BSLA 3W71A 4HT3A 4DF1A 1FCVA 5J5DA 4TO8A 1OHLA 4BFAA 4OBTA 4JTIA 1Z44A 4WZHA 3M6YA 3EX1A 3E49A 3GXPA 2ZFAA 1ZAHA 1OFAA 1SO3A 2TPSA 4UC5A 4BI5A 3HMJG 1OK4A 2DZVA 4PL1A 3UY7A 1OABA 5AHMA 4JTSA 4N6EA 1KM0A 4BK9A 5DXXA 3GK0A 3W2UA 2GQ9A 1BKSA 3N19B 2E1DA 1HFBA 1KTBA 3MHGA 2WPBA 4AF0B 1SO5A 4IX0A 1SZEA 2QJHA 5DXYA 4UFMA 2WSRA 3DHDA 3W1MA 3TSMA 1R46A 4DO4A 5EL1A 3GNNA 2Y63A 1H1ZA 1ZFJA 1XUUA 1K03A 2DJLA 4UR7A 5FF0A 3PB2A 1H7XA 3NQ7A 1GVFA 4OQVA 3ZR4A 1GTHA 3S5OA 1EP2A 3P74A 4NNBA 2VEPA 1CX9A 3ZFHA 3W23A 1B3OA 2P10A 2OT1A 3TUUA 1A5CA 3OBKA 3TV8A 4NXKA 3G24A 2DZUA 1F6PA 4QAIA 4RK8A 3TAKA 4MFDA 3OVPA 1TPVA 1I2OA 1KFKA 3W1TA 3S1VA 5FEXA 2QJGA 3GXNA 4ZQNA 3TMLA 4GUJA 4CNPA 1VC4A 1XBZA 3O6DA 1MSSA 2YW4A 4DF0A 1OFDA 2V30A 3IV3A 1YTKA 5D33A 1SO4A 1SU5A 3IRDA 2NUYA 3N3MA 4NZFA 4AH7A 2C6QA 1HUVA 5K7JA 3IEBA 5EPDA 5LNRA 4ZVJA 2QCLA 3LCWA 3FEMA 3A23A 3B05A 2E77A 5C55A 3SR7A 2FDSA 2TRSA 5D2WA 4DELA 1GT8A 3L9CA 1YXYA 2AGKA 1KBIA 3FJLA 4MIMA 3B8DA 4N9EA 3BGJA 2I1OA 3QMTA 3W2MA 3P81A 1VPXA 1K02A 4UMCA 3BG3A 1TQJA 1FCBA 3UWVA 1KV5A 1X8FA 3CWOX 3PBUA 1GTEA 2QCDB 1LBLA 5ABTA 3C4UA 3SW6A 1PVNA 4IMEA 2YDAA 1ICQA 3TU9A 1J4EA 3HG5A 4Y90A 1R30A 4UFLA 4NZJA 1G4SA 2VEKA 3QPZA 4Q33A 3W75A 5IBXC 4H6KA 3LCHA 2ABBA 5IM51 2H3BA 1GVSA 3KOFA 3G0UA 2ZTJA 5CPMA 2OMAA 1QCWA 1FX6A 4OHQA 4UFJA 2V81A 2F7FA 4HPXA 3G8RA 5F2MA 3TNOA 1JCYA 3INPA 4QNWA 1ZJIA 4JXCA 2A5HA 2CLIA 5G2HA 2JKEA 3HG4A 3LXBA 3PAJA 3BLIA 4CLMA 2FTPA 1KTNA 2V8ZA 2R94A 1W5MA 4IOTA 3VI2A 2WKJA 3ANYA 2DZPA 1YTEA 1KM6A 4MJMA 4JTUA 4O15A 3W70A 4GFSA 4N2YA 2A6LA 3C2VA 2ZZ7A 3BARA 2YSWA 3M43A 4ZL1A 4MY1A 1NF0A 3M5ZA 2B7PA 3I6RA 3HB9A 3MW7A 1W5OA 3O16A 4E2BA 2O7QA 1GQNA 1JUKA 2OZ0A 1TPFA 4MY9A 1N7KA 1BEUA 3UPWA 4MZ8A 2LLEA 1OK6A 1EPXA 5DCEA 2NXHA 2O7SA 1YADA 4JTGA 2V5LA 3LCIA 3LCLA 2QCHA 3OG3A 1H61A 3F4NA 3LRLA 5MHBA 3EWZA 4XTIA 4O53A 1ALDA 5DELA 4FX7A 3T40A 3U6WA 3W87A 4AAJA 2WOQA 4X9SA 3VE7A 4JX5A 4ORMA 1LM1A 4JTKA 1MEIA 3SFKA 1K8XA 2YX0A 4JY8A 1EUAA 1LTDA 3O07A 2JGYA 3NQMA 4UNKA 2ZA3A 4NT0A 2WO5A 1TPC1 2WSYA 3W9ZA 3A5VA 3F1QA 5AC8A 2QUVA 3USBA 3PBWA 3KVMA 2ZBTA 3TIMA 4BI7A 2PCQA 1MEWA 1MZHA 2OCZA 2Y89A 3UWYA 5BNKA 1KM2A 2WJZA 1Z41A 1Z48A 2BX7A 4AHPA 4DF2A 5FI8A 5CZ0A 4MZ1A 1DJNA 4UUIA 3C2RA 3D0CA 5BRBA 2EKCA 2FQIA 3W7GA 4Y8FA 4A3UA 1EEPA 1H50A 4LVGA 1FXQA 2OT0A 3IVSA 1TB3A 2X1RA 3LXCA 3PG8A 3NL6A 3QEZA 2DZXA 2GOUA 4JGDA 1WYIA 1WOAA 2BTMA 3TCEA 3TSDA 4AB4A 4Y6GA 1TIMA 3LBCA 4O19A 1G6CA 1F7BA 1THFD 3P5ZA 3NVTA 3TSBA 3MMTA 3P80A 2GVLA 4MJZA 2QAPA 2E6YA 3UZ5A 1I2PA 3L5AA 2Y62A 1C8VA 1TJPA 2Y7GA 4O1BA 4HNTA 2E6FA 2DZTA 5L6UA 2W0UA 3NQAA 4I9AA 1A53A 4I7VA 2NWSA 4CNNA 5K2ZA 1WA3A 3G1SA 3U2OA 2RH9A 4UXDA 1X1ZA 1MXSA 4G1KA 3JR2A 5AN7A 1TV8A 4AWUA 1W31A 1W3TA 3H55A 3EWBX 4Q32A 3PUOA 1HG3A 3BG9A 3HGSA 3IIPA 4JIPA 2ZDRA 3SSJA 3UQNA 3EX4A 3L0NA 4IXHA 3L0KA 3ATYA 1YPIA 2CLLA 2E6AA 4TMBA 3IIXA 3WJZA 3EX3A 4MYAA 1KFCA 2OX1A 3S6DA 2B4GA 3GKAA 1OFRA 3HGRA 3PULA 1O4UA 4O11A 3HOJA 1OYBA 2PURA 1GWJA 3QZEA 2C3ZA 3S5ZA 2A4AA 2NXGA 4FNPA 2DZWA 1SW0A 5CGQA 5I3HA 4LS2A 3LM7A 3UWZA 4OV9A 1QDSA 4KWWA 4WJEA 3Q58A 4MOZA 1KFEA 3T7VA 5D32A 4UTTA 2A2IA 1FY6A 1QWGA 1VH7A 4BI6A 3EXSA 4MVAA 1YPFA 1JRCA 1SW7A 1YXCA 1JULA 3NPVA 2X1TA 4MLRA 1VLWA 3LLDA 3LCGA 4M6VA 1V5XA 3DFTA 2I14A 4FEZA 1N8FA 4LU0A 1RZMA 1EP1A 5D2VA 1OF8A 1W56A 3G18A 2ZRXA 1OYAA 1W54A 3NQGA 4HSNA 4MFEA 2ZQ0A 1FDZA 6ALDA 2YPIA 4XKYB 1KFBA 4IMFA 4YCOA 1TPB1 2Y7DA 1DHPA 5F4XA 1F05A 2TYSA 1FXPA 3CLMA 4O8RA 1FQ0A 5BMXA 3W76A 3RF9A 1HO4A 4LC6A 3GR8A 3UZJA 3L65A 2H8ZA 3BG5A 5I3KA 3G1YA
chains in the Genus database with same CATH superfamily
4LY8A 4AY1A 1YXDA 1POKA 5AY7A 3T05A 2G5WA 1L6YA 1WZAA 2X7VA 2WNWA 2CBVA 2FB2A 3MPGA 4GHRA 3WKZA 2WC3A 3PWGA 2G97A 3KFTA 4DYKA 4XBSA 2VGFA 4JQAA 4H8NA 3NZPA 3C2OA 3VD9A 5KTLA 1XBYA 5K9XA 2XH0A 1H1YA 1RUSA 5A2CA 2X0SA 1KFWA 2QVHA 1Y0EA 2Y5EA 4Q3MA 1AG1O 4R33A 3WENA 4QJ4B 3H26A 1JEZA 4F2BA 3W74A 3M9YA 1HN1A 4PTNA 1XISA 3P5YA 1CGWA 4IQDA 1MMFA 4ZOAA 3G1XA 4HNLA 4XZIA 3QV8A 1BYCA 1OC7A 4LUSA 3L4YA 3TDFA 7TIMA 2VFHA 1JD7A 4LNYA 4S3FA 1J18A 4ICCX 2OKTA 4WIWA 1CTNA 2VEGA 4I7WA 5I24A 2BGNE 1R8LA 2FJKA 5DT7A 3TR9A 2G0WA 1ISYA 4AQLA 3OB8A 5FJUA 3EEGA 3WUFA 4LBSA 1PTDA 4GVGA 4TTUA 4AZGA 1JCNA 3K13A 2HSAA 1GOWA 3CWNA 2YL6A 2UY2A 2Y70A 3UG5A 3E2SA 2QPUA 3DG7A 4CNSA 3UVAA 3H4WA 2RDTA 1RPKA 3NM1A 5CSSA 3UU0A 1JZ2A 3R8RA 4JTQA 2EGZA 2HXUA 3FKKA 3HTWA 3K8MA 2QCFA 3IGSA 1WCGA 3FSUA 1O5RA 2DP3A 4KT2A 4GXPA 3SRHA 1JF6A 4L65A 5C8BB 2Z7GA 4XX6A 9RUBA 3SADA 1TCMA 3KRZA 1AK5A 3QMSA 4AZBA 3SGGA 4WUIA 3IANA 3N6HA 4R53A 5FAJA 2CNCA 3WLNA 3W7PA 2YLAA 3DIPA 3T0TA 4UWMA 1GG1A 3WLRA 2J9YA 1FP9A 2PUZA 2OO0A 1XKJA 3E02A 4AD5A 5AHLA 2ISWA 4CQAA 3CQIA 5D05A 1AODA 4OBSA 3TTQA 4KWVA 3WH6A 1TWWA 3U48A 1BYDA 3IRSA 3DC0A 1ITCA 2FVMA 3BV4A 2YL9A 1JD9A 1ZHAA 3BMXA 2ANUA 2W66A 2XVLA 4O18A 3GNDA 3AO0A 2ZRUA 3N29A 3C2FA 3VKJA 4H00A 3T09A 5IRPA 3M0XA 4L6OA 2VEFA 1KQYA 4GQ0A 1ZZMA 4S2CA 2Y7EA 1BYBA 2H8XA 4L1WA 3W7EA 5JIWA 1E73M 3CU2A 4E2VA 3CPGA 3GYEA 2Y8UA 3SGZA 3CGTA 4F0KA 2BNJA 2QNEA 4PMVA 1JPIA 1HQTA 4DUXA 4JFSA 1OFBA 1UCWA 1TO3A 3BH4A 3MJYA 3XINA 4EVZA 1EOKA 3TN4A 3PZUA 1KCXA 5CAKA 5C9RA 2J9XA 1PIGA 1W3JA 2GYIA 2ZZ1A 1VBRA 1HL9A 4IMAA 2EEXA 4PUWA 1E9ZB 3NFUA 3O06A 3FY1A 2HVMA 3UGRA 4U4MA 3NR0A 1XI3A 3BUVA 4JICA 4XZWA 1NJJA 4DQWA 4EWND 3BJTA 1K4HA 2AMXA 1N8WA 1T99A 2J7EA 2Z1KA 2V6AA 1VBGA 4RXGA 2V3GA 3SSZA 4NXSA 4C6KA 2WMJA 3CMGA 5A5WA 5C70A 3GFXA 3PJUA 3FIGA 3SZ8A 3PNUA 1SPQA 1CNVA 3EWUA 2NX3A 4AD1A 3Q37A 3GXTA 1VCVA 4XAYA 1WP6A 3VKAA 3OOQA 5PTDA 3H53A 1OGBA 3MS8A 4K1WA 4XZBA 3QLDA 5CZSA 2VEMA 1BFNA 3HPAA 4IIGA 3TFCA 4Z1CA 1T7LA 1VGAA 2DV0A 3QR0A 4UZSA 3W7RA 2YW3A 4K8EA 4WY0A 3ALGA 1CCWB 3ONCA 1LQAA 1BG9A 4UTWA 4M82A 1JAKA 4YVVA 3WLHA 3QH2A 3T55A 1U83A 2Q8ZA 4HPHA 4N4QA 4YXGA 1DJXA 1OFOA 3L12A 3A21A 3V35A 2VFFA 1D2KA 4MADA 2F6KA 3BAJA 4JAWA 2ZZ6A 2P1FA 4IFOA 1E6QM 2VGBA 4A2RA 1Q6OA 1TZ9A 4NZ1A 1KGWA 1EYEA 4QRNA 1NOWA 3IGHX 4YIWA 1JXKA 1J01A 1C90A 4O4WA 2GVJA 4GFIA 3G3MA 1ME9A 3UG3A 2ZZ5A 2NQ9A 1L9WA 3GNPA 2AOSA 4WXZA 2YL5A 3M5YA 4RW5A 2BGSA 3QRHA 5D9NA 3V3WA 3HBLA 5DY2A 2B7QA 4I5XA 1R2SA 3UXIA 2ZRVA 4ZSTA 1W91A 2AL2A 2DZBA 3IIVA 2WZTA 1EBHA 1EO5A 4XUYA 3AMLA 5GNYA 4BF9A 3BMVA 4R34A 4D8LA 1CWYA 4F8XA 3LBMA 4Z2LA 1OF6A 1W5QA 4QE5A 3W7IA 2VENA 3TE9A 3ORWA 3ZWTA 3KTXA 3VFCA 2R1KA 3NQFA 3ARWA 3I6EA 5E0CA 4LYPA 4DHGA 5SWUA 3P0WA 3K1DA 4JX4A 4DIAA 4B15A 1OC6A 2CEQA 1W8GA 4JEJA 1W9XA 2POZA 3C3NA 5FJRA 3B9NA 1JCXA 3DBPA 4Q22A 2PDFA 1FKWA 1UUQA 3OBEA 2BMBA 2FYMA 3ABOA 2UY4A 3UJRA 2D2GA 2PODA 4FZIA 4HNCA 5CZKA 1QVBA 2V2CA 2QUNA 3E3HA 1ZP3A 2F84A 1WNOA 2ZADA 4JFUA 1IIGA 4AMCA 3DC8A 4LUIA 3MMUA 1HNYA 3ZSTA 3S9YA 5G4EA 2AL1A 3DGRA 3LYEA 1UKPA 1SZRA 1BTCA 5I03A 4AVOA 6TIMA 3CZKA 2VT0A 1D3HA 3NYDA 4Z1BA 1UD4A 1UKSA 3VCRA 4ACYA 3HPXA 5E93A 3ZSSA 2VOMA 2ZX6A 2V3EA 1EXPA 1QK2A 2ZUTA 2QPSA 2VHLA 3AXMA 6TAAA 5DY3A 1EQCA 5BMWA 2J7BA 1I1WA 1JUEA 3WLLA 4JTLA 1H7WA 2GSHA 2P0OA 3N6QA 3EPOA 4JX6A 1O95A 1T40A 3SJ3A 4HZMA 2YJQA 1R47A 4G8TA 1A5OC 1IWAA 2A3HA 3W0KA 5AHIA 4GJIA 1KW1A 3I68A 4IICA 4ZOCA 4LAZA 1PZ2A 1UWSA 4K38A 2A7RA 3WYZA 3NEVA 2V9DA 4AWTA 1JDEA 5HANA 4DPPA 4M6QA 2DVUA 3AIBA 3W72A 3L66A 4GINA 1Q4NX 4QLLA 1GG0A 4NZ5A 3RN6A 3APYA 2EKGA 4LT9A 3TWBA 3C2EA 1QPNA 2GJXA 5AOUA 2WNQA 3BLPX 1OD0A 2Z1SA 3CXOA 2JGQA 2WVVA 2VX4A 2INEA 4BWLA 2C19A 4MF4A 5AVHA 5FL0A 3VM5A 5B7YA 1MW3A 4DJEC 3BQ5A 3P61A 2HBVA 3TJLA 4RE3A 3WNPA 1S3TC 3KAOA 5HNRA 1LLOA 3MI3A 1SSGA 2XG9A 4O1EA 3MP5A 1GYNA 2JKPA 1W37A 5I2UA 2FVKA 3B9DA 5H8MA 3W22A 4CVWA 1KFJA 3VC6A 3AS0A 4QX4A 3P6LA 1AD4A 3TK7A 3SCOA 1IZJA 3CQJA 4MPQA 4PBFA 3EPMA 2OG9A 3FJNA 3QQ0A 3JRKA 2Z00A 3PSWA 1BAGA 1AJ2A 3KOZA 4KFNA 5E6ZA 4WJ8A 4UTHA 4RZBA 3V18A 3WQ6A 2Q3RA 3LENA 5RUBA 3PBMA 2BLEA 3UVIA 1OFQA 1GZJA 4YWSA 2SFPA 3WZ0E 4Q4KA 1UZ1A 3EX6A 1XIDA 2WCAA 3ID7A 3TC6A 1SW3A 3QC3A 4AVFA 5IDZA 2I5GA 3UA4A 1TUXA 4GYKA 1GQKA 1RH9A 3G6MA 3MSYA 3MZNA 3MBDA 2PU0A 4RV3A 1EJTC 4WRHA 1OY0A 1H11A 4HU3A 2DUXA 2QCMA 4BEQA 3F2DA 3C8NA 3A4XA 3HMCA 4QJ3B 1JQXA 5HA7A 4WOZA 5KZEA 1K9DA 4JIEA 5EMUA 1ZAIA 1FWCC 3OVGA 3BOXA 3I7SA 3CZJA 1J9YA 2XINA 3MO7A 3M0VA 3LRMA 1X6UA 4NU7A 2XFWA 4M8UA 1ZSXA 4DXVA 3QFEA 3HFYA 3G8EA 4J3WA 4FXSA 2F61A 1TPDA 2L5HA 3E96A 1GEHA 1R9YA 2OGYA 5LHFA 1YX1A 3A24A 5C2CA 4FX6M 1K77A 4AU0A 2PU1A 2VRJA 1OZQA 4WVXA 4MDOA 2ZUSA 5H2ZA 1UWQA 3TW6A 1XG4A 3PWAA 1A80A 1VS1A 3CV2A 2A3BA 4O0KA 4UQEA 4LS0A 1QTWA 4GZEA 4E4PA 3QVQA 1PHWA 2D20A 3KOXA 1HKJA 4HYWA 4BQ3A 1OB0A 4JOMA 3B06A 4W85A 3MANA 3AMDA 5HMFA 3RU6A 2HQAA 4AFYA 4E0CA 3VIMA 4ZQCA 4O13A 3CIVA 5LNWA 4QJ1A 3HJZA 2W5FA 3TJXA 3W1XA 4J28A 4GY7A 2B0MA 2GVYA 3II1A 4O10A 4OU1A 4Y9AA 1IZCA 3VNMA 3EKZA 4YHGA 1XG3A 4QP0A 4M7SA 3RRXA 1KO0A 5BYWA 4WQ6A 2EPHA 2HJPA 1UD5A 4GI4A 3GC4A 1G0CA 4ZO6A 5FA5A 3MWAA 2HE8A 3K4WA 3TMQA 4H7CA 1DV7A 3FEQA 2VC6A 4Q7IA 5D2XA 4FNSA 1D9EA 3N73A 1I2NA 1XS2A 1A0CA 4JFVA 5HWMA 1H7NA 3FVDA 3UP8A 1UR2A 2CLKA 1JZ6A 3VGHA 2V38A 2HE5A 3GE7A 3LK6A 2IKJA 2CU0A 1KM5A 4C65A 1YPXA 1HKKA 3NPUA 1X7FA 4H04A 1R7AA 1D8CA 3CQHA 4GI9A 4X61A 3UR5A 1XPGA 4LF1A 2E7FA 4PUJA 4BS0A 4Z1DA 3RG6A 2DJXA 5A6LA 4BHYA 3MUCA 2NQHA 3DKLA 1P6WA 2C15A 2CZDA 3ITXA 2BP1A 3SBFA 2OSYA 1QW7A 2JEQA 4S1FA 1M7PA 1OADA 4QNEA 4IXXA 2R8WA 5AYXA 1KRCC 5DBTA 5REQA 1W9DM 1YRRA 1NU5A 3IWPA 2PCEA 3M64A 4GKTA 4QGCA 4QR6A 2J78A 1I8JA 4W4QA 2ZXAA 5AYZA 4IL2A 3A5FA 3CO4A 1W5NA 3S1GA 1MEHA 3NTYA 2UV8G 4RV8A 2WHMA 2OR2A 4O1CA 3LZ5A 2H9AB 4K7YA 4DUOA 5IXEA 3WQ5A 3QFWA 2GUYA 4W87A 5G1YA 3HU7A 1YBQA 1W5PA 2V0TA 2QUMA 2XN1A 1W32A 1UJQA 3GX9A 3BV7A 4AC1X 2CZFA 1ZENA 1I1XA 2V5KA 3VGGA 3G2GA 4LQ1A 3W83A 1MWOA 9CGTA 1FH9A 3STEA 4B4HA 3L4WA 3VZXA 1BTMA 5G1MA 1OT2A 3URBA 4XO7A 2E9LA 3BVJA 2X1SA 1S5WA 3N2MA 3CHEA 4IGMA 1JYXA 1UR8A 1KFLA 5DMLA 1XFBA 3H12A 1P4CA 1F2JA 3S42A 2DSVA 5LGXA 2XGZA 2OEJA 4WJXA 5U7SA 1WDRA 4Z42C 4UTWC 1OM0A 1NDZA 2D24A 1N55A 3CTTA 4E2DA 3ARZA 8TIMA 4BA0A 3W2KA 2B7NA 3PWIA 1J0ZA 4D6IA 3NQCA 3MWCA 1G69A 3FJ6A 1M53A 1O12A 5LYRA 3WDRA 5CG7A 4IUGA 2INFA 3PFMA 4B3ZA 1H09A 4MAVA 4RDZA 2CWNA 3WBWA 1M03A 1JDDA 1IQ8A 1Z32X 1RCOB 3F4WA 3BL3A 4UFHA 2P5NA 4JNMA 2PDIA 4FHAA 4Y2WA 4H3DA 4HA1A 3CHDA 2YCJA 2HZGA 2DT1A 1UJPA 1LRQA 2NUWA 3OBAA 3QSTA 1GVQA 1EJVC 4KBXA 1WBHA 3NJ3A 4KEUA 1B4EA 1QBBA 3L67A 1X8CA 2EPOA 3ELFA 3T4WA 3NNTA 1H7PA 1WKFA 4N6FA 4WCJA 1TTIA 2TSYA 1K8ZA 4Q6JA 1ISVA 1PUDA 2DT0A 3RMJA 4HZ7A 1V79A 1XYLA 4POCA 3ITCA 3UZZA 1B90A 5LA2A 3DAQA 4LEFA 1F3EA 3TTSA 1MUWA 4E4FA 4CUCA 1EDGA 3EKGA 1V3IA 3TA9A 2OOGA 1F76A 1PCWA 3ERPA 1QFEA 1A3XA 3B40A 1JUBA 4HNUA 4GJ1A 1TV4A 1V02E 3S1UA 4PMXA 4AG0A 2YXGA 1NP0A 3E38A 1J2WA 4JS3A 3M6DA 4Y96A 4DWDA 1E51A 1TYGA 1UROA 2VJXA 1EJSC 3GRIA 4PE8A 2Q8XA 2QMJA 1S3HA 5DQPA 4ADTA 4LBRA 2I5IA 5KZMA 1HTIA 3ZZ1A 3LSCA 4DO6A 1JZ3A 1A49A 3VNKA 2OQLA 4F0HA 1J0JA 3M44A 4OV4A 1SR0A 3MVIA 5L9FA 1X98A 2J6VA 3GG8A 2R91A 1JAEA 3I7QA 4EXBA 1FCUA 3MUY1 3BAYA 4OGZA 2OTDA 2PP0A 3IJLA 1Q3NA 1LLWA 4NZ3A 4V1YA 2REQA 1UWRA 5JVLA 3CIXA 4O1AA 4JDBA 2ESCA 3W27A 4QDPA 1MDRA 4O28A 4N4PA 1IXPA 4O52A 5HJYA 4BQ4A 2QR6A 4ZQMA 2VZVA 3M7SA 1X39A 1XDMA 1KM3A 3LHYA 5E70A 4C1NB 1B4KA 1OG0A 3D3AA 2JEPA 3H8AA 3W7LA 1KRMA 1C9DA 3TFXA 2J79A 4NNCA 1HJVA 2EPLX 4D1JA 4UOZA 2CFFA 2CZVA 3MQTA 4JIRA 3TQ0A 4J40A 1OEPA 4O12A 3R13A 4ECLA 1XLMA 2WMFA 3E0LA 4NAEB 4PMNA 3RPTA 4DBWA 2BSLA 1V03A 2Z1XA 1Q85A 1VFOA 4NRRA 3UG4A 4L80A 4OBTA 4JTIA 4GVHA 1J0HA 3AOFA 3UBPC 3E49A 2WSPA 3GXPA 2ZFAA 3U0HA 4UC5A 3WX7A 5I02A 3URNA 3TTEA 4GPNA 3N17A 1XLDA 4JTSA 3QV6A 2X42A 2E1DA 3NDYA 2F9RA 2BHYA 1OSEA 2FZ9A 1HFBA 1WB0A 2V5CA 1PTAA 4GLEA 3MHGA 4NIRA 4HMEA 4IX0A 5DXYA 3VOIA 4UFMA 3EGJA 4PUMA 3AS3A 4Y9OA 3H2CA 4GQQA 2ZUMA 4QXIA 2X09A 3WSUA 3A13A 7REQB 1S5MA 4WSHA 4Q8VA 1J6OA 1KCZA 3WLKX 2IS7A 3PB2A 5IFPA 3OGVA 4QAWA 1GVFA 1WAWA 1E6PA 1GTHA 2EG6A 4MPKA 4L1XA 1CX9A 2YB4A 3ZFHA 3W23A 1B3OA 3LPPA 2OT1A 1UR4A 3QY8A 3JZUA 4QAIA 3UXKA 4B4FA 2BHUA 1PKMA 3OVPA 1R3WA 5M03A 3S1VA 5FEXA 4ZQNA 4F0LA 1MSSA 4DF0A 1XGEA 1ISXA 4A05A 1OFDA 2V30A 2R82A 3A9BA 3IV3A 1SO4A 3IRDA 3N3MA 3AHTA 3EOLA 4AH7A 1FWIC 5K7JA 3GVRA 4NSBA 4GA8A 3J7HA 1HXJA 3CV6A 4ZVJA 3AYRA 2QCLA 3LCWA 2GJXB 2E77A 3QKZA 2FDSA 4J3ZA 4DELA 5BROA 1BVWA 5HBFA 3B8IA 5I77A 3QGAC 3GR4A 4JHOA 3NSMA 2I1OA 3W2MA 1K02A 4PFHA 1TQJA 4IJRA 3BCFA 1X8FA 3CWOX 1EH9A 5ABTA 4HJWA 4LYRA 3R7MA 4HPNA 2AMGA 1ICQA 3U7BA 5GJMA 1RD6A 1J4EA 3ZVHA 4Y90A 2B81A 4Q6XA 1FKXA 3QPZA 4J3XA 3LD5A 3SO7A 4LY4A 3OTRA 1AH3A 7A3HA 2FHBA 2V81A 5F2MA 1F3TA 1JCYA 3INPA 5T9BG 2BXYA 5A95A 2E0PA 2I5QA 4JXCA 4UQ9A 3FW6A 2A5HA 3S2JA 5G2HA 5AZ1A 6ENLA 3HG4A 3BLIA 4CLMA 3RILA 2FTPA 1W5MA 4IOTA 2DZPA 1YTEA 1KM6A 2TODA 4R27A 3KOWA 4JTUA 4O15A 2BASA 4TOQA 4S3BA 3RLHA 1MQRA 4BKNA 1XINA 4GFSA 4N2YA 3LNPA 4ZTXA 3M0LA 2YSWA 3M43A 1RP8A 3P3BA 2JF6A 3UETA 5A94A 1RHCA 3GXMA 1FWDC 1I0BA 3I6RA 3O16A 1GQNA 3FGCB 3IJ6A 1EPVA 4XIAA 1H41A 4QROA 4PRRA 1O5QA 2BY2A 1TPFA 4DM2A 4HJFA 1HP5A 2LLEA 1EPXA 3KS6A 4R7WA 3QR3A 1NQKA 1BHGA 1YHTA 3LG3A 4WLCA 4LNCA 3OG3A 3F4NA 4MKSA 5FJJA 1DWGM 2PF0A 3T81A 4XV0A 3VPLA 4AD3A 1XLFA 3UG8A 2E4TA 3H24A 3OP2A 4ZOEA 3SFKA 1J11A 3CUXA 4RE4A 2C71A 4IF2A 4F3HA 4FR6A 4GISA 4XG1A 2VVNA 1Y5XA 3VCNA 2QUVA 1E1FA 2ZBTA 3TIMA 1MZHA 2Y89A 2WJZA 1F3WA 3KCJA 4AHPA 5FI8A 4MZ1A 2I16A 2ICSA 1L8PA 3DYPA 5CBIA 4A3UA 1H50A 4LVGA 4E8CA 2ZWZA 1TB3A 3LXCA 8A3HA 1IEXA 1BQGA 4NHVA 4J4KA 2FFIA 4JN8A 4GZIA 3B8VA 2BTMA 3TCEA 3TSDA 1XHGA 4AB4A 4KS0A 4Y6GA 4C6EA 4S3JA 2WHLA 4Q8NA 1F7BA 2FJUB 1THFD 2VOTA 3MMTA 3P80A 2GVLA 1E40A 2PD5A 3UZ5A 1TWDA 1TJPA 5L6UA 1M04A 1P0BA 1P6CA 2W0UA 1TWIA 1A53A 4I7VA 3THDA 2GDQA 1XRFA 1JIBA 4G1KA 4R9XA 4NILA 2FH8A 4B2DD 1TJ2A 1UH4A 3MKKA 3TYUA 3SSJA 4ZO8A 4AZ5A 2AGTA 3U57A 4QCEA 6PTDA 3IIXA 3H2FA 2OX1A 3ENLA 1KRAC 1OFRA 3HGRA 4O11A 1OYBA 3SUSA 1L8NA 3GTIA 4YPJA 2DZWA 2VCAA 1EJWC 2PGEA 5CGQA 4DRSA 2QDEA 3LM7A 4BQ2A 1KFEA 1AH4A 3T7VA 3WQDA 1LG1A 2A2IA 2PSNA 1IT7A 1OGSA 3EEZA 4DWSC 1QNPA 2Z28A 1JRCA 3WH9A 2X1TA 2PBGA 3UR2A 4H19A 2FTWA 1V5XA 2PDMA 2DUAA 3CB3A 4GZJA 1RZMA 2J47A 1EP1A 3FN9A 1W56A 1G9HA 4YU1A 3KDNA 4HSNA 3GC2A 1XIJA 2J13A 2YPIA 1BWVA 2OU4A 4YCOA 5H1WA 1DHPA 3UCCA 4U3AA 1FXPA 2AQVA 2J7DA 3WNNA 4LC6A 3TN3A 1S2WA 3GR8A 3UZJA 3BG5A 3G1YA 4HCHA 4IX2A 4NI3A 3CBWA 1UP3A 3FAXA 4Z08A 1LYXA 3HGOA 4XBKA 1PS9A 1JG9A 2Q02A 1KXVA 1UOZA 3PJWA 3FXYA 3HG3A 3PB0A 1S46A 2FMOA 1XUZA 2HTMA 4HPJA 5EKYA 3T8LA 4HN4A 4KKXA 1XM3A 3W1RA 4XVDA 2OZTA 3R89A 3NL3A 4F40A 4DJDC 3REQB 1EOMA 3IVTA 1ZCOA 2YBVA 1KLYA 3A4AA 4OZOA 3B3DA 3EWDA 1O5XA 3D47A 2ZA1A 1AA1B 1OCNA 3FYYA 2RJHA 2BXVA 3TP4A 1MYRA 3SQLA 1LLZA 1JI2A 1F07A 4QHRA 2ASHA 4YTTA 1H62A 3UYCA 4CCZA 2G3NA 3EMQA 1KLZA 3B8TA 4L64A 1UR1A 3E6EA 3BSMA 4W5ZA 2YFNA 4YTUA 1UOKA 3CQKA 1EGMA 6REQA 3FDKA 3I3EA 3ITVA 1OD8A 1JCLA 1WX0A 3UFYA 2OFJA 2R1NA 4J2PA 2JKAA 2ZX5A 5CPNA 1RY8A 1MDLA 5BRPA 1DIDA 1ITXA 3EDDA 3GHRA 3UCQA 3M46A 5FF4A 3RM4A 2GGGA 2ISVA 1P0KA 1ZJHA 5K3VA 3WD0A 3EXRA 3VNLA 1M9HA 2DW7A 4IGHA 4DAIA 2XUCA 4FMVA 3SCUA 5CQ1A 3MP4A 5EB8A 2WB5A 2QHAA 2Z6JA 1ODZA 4LWWA 1N2VA 2WSKA 1O60A 1G7UA 4CQ9A 3A3WA 2EPMX 3SRKA 3WDIA 3TQVA 1WXZA 1QJWA 4F9DA 3EZ4A 5FEPA 1A5BA 2YDQA 4MB4A 2YCEA 1H7OA 1EJ7L 3AYTA 3DU0A 1GKRA 2DDXA 3V0UA 4M51A 5JBEA 3IPWA 1H60A 5GVJA 4Y9PA 3ABZA 4G7EA 4K68A 2G41A 1ZY9A 2F2KA 3VAVA 4ROPA 2YZ5A 3WBEA 4WOQA 1Q4WA 2ZX8A 2WC7A 1VJIA 3RR1A 3QQ1A 4PZVA 4UOQA 4PCNA 1LBFA 2ZZ3A 3ZR5A 4X60A 2FPTA 3GTNA 1OCBA 1I6NA 1E0XA 4U28A 4GGHA 3DI1A 1CLKA 2XFRA 5D2YA 2Z2BA 3EXTA 4DX3A 3LM3A 4CVUA 2QJNA 1WBJA 4J9JA 1NFGA 1ZAJA 4GYPC 3C8FA 4ZZ9A 1IZKA 1MUCA 3VX1A 3LS9A 1Y5VA 4E8GA 4R9OA 5GPRA 3O8AA 3WDQA 1B9BA 2EG8A 3GFZA 4UOJA 3VOFA 2X2YA 2Y24A 3M0ZA 3NGJA 3TJIA 5D9PA 3WQPA 2E9BA 2W6RA 1X1OA 2IPWA 3BW2A 2W91A 3BAWA 2G95A 3U7VA 1BKHA 2OO6A 3OLDA 2HS8A 3UZWA 2F2HA 1P6BA 4CU8A 4WY0B 3W7HA 3LLFA 4W9TA 1UIOA 4WXYA 4LB4A 2PDPA 2Z0IA 2A3AA 1TKKA 4IIBA 5AC7A 1JGIA 2VR2A 4URIA 3FXGA 3CH9A 3W1UA 4LEQA 1R0MA 3URQA 1IGWA 4FA3A 3PZQA 3GTHA 3EB3A 3LV5A 1HJXA 3AJXA 3CAWA 4P8UA 1EO7A 3HV9A 2EJAA 3T0AA 4A29A 1XBXA 2WSQA 3WIJA 1CPUA 5AECA 2QJMA 1PIIA 3TYAA 3CIWA 3L5MA 4C7FA 4S2BA 1EYWA 1V4YA 4JR5A 3DHPA 5HK4A 1VZWA 1V8EA 3E74A 2D2HA 4KCVA 1K7FA 2RAGA 2J8FA 1JF5A 3ES7A 3HIJA 5EFDA 2ZKMX 1I75A 1R3VA 3MTWA 2VFIA 2PF8A 4QG9A 1RR2A 4JIIX 1K9TA 4DO7A 1R2RA 4PC8A 3D46A 2I9UA 4U10A 4EIVA 2BWGA 3U2ZA 4PYSA 4HMCA 4A35A 1P1MA 1Z89A 3OA5A 3V1PA 4ALDA 3BLFA 3THAA 1F6KA 5JIPA 1XXXA 3ZT6A 3W1QA 3GZ3A 4UTMA 3IV8A 1XIEA 4GMEA 3GAYA 3LA4A 4GO8A 3T2OA 3APGA 3MI6A 4BF7A 5CZJA 1F61A 4E8DA 1GHSA 1XLJA 4W8BA 3VKDA 4RNHA 1XL9A 1IR1A 3KBJA 4C7DA 2E5CA 3FHQA 1ZRQA 3B8SA 1VPQA 4MKNA 1AJZA 5HJXA 4X2RA 1VCGA 1CLVA 3KLLA 4IUOA 4IG2B 4AISA 1VLIA 2XDFA 2RKXA 4A3RA 3STGA 3GKFA 4D72A 5CBJA 2DPEA 3CC1A 1AL7A 1LBMA 2FDMA 1O66A 3GY1A 3HN3A 3P7YA 5TQLA 4OVXA 1NH6A 4C6CA 1XWYA 2RHGA 3AS2A 3PZOA 4NY2A 4PBEA 1U5JA 1FH8A 1QNQA 3TEVA 4D2JA 4FIRA 4ZQOA 3T0DA 2PDWA 3ZJ8A 1AL8A 4H9XA 4KPLA 4HOZA 5LA0A 5BWAA 3C0SA 2DVXA 2WMGA 3NQEA 3R0DA 4LVFA 4LPCA 3DFYA 4PCFA 4GY0A 3BZGA 1RCXB 2GOKA 3BOLA 1PE1A 4JTEA 3R5EA 4QIUA 1W6TA 3GIPA 1QHZA 4AD2A 1VFLA 3RLUA 3NZ1A 4TV6A 1XH0A 1RQBA 1SM9A 1XR2A 4I5UA 3NOEA 2OYKA 1W3IA 2V69A 2ZX7A 3IK4A 1PX8A 3PM6A 2OWWA 3O63A 5A8GA 1BRLA 1WV2A 4HU0A 3FNDA 1BD0A 3W1PA 3PN8A 1MW0A 2EHHA 3EMZA 4Z1YA 1AQMA 3N15A 3Q45A 5A6SA 4Q8TA 4LAUA 4ZB2A 5C9ZA 5ABFB 1AW2A 3KCOA 3AU6A 1Q66A 4X0VA 4YJ5A 2QIWA 1GJWA 3CPRA 1MO0A 4XZ9A 1E0TA 4G56A 4I7UA 1PO9A 3QOKA 5LGZA 1KBBA 3WL0A 3BGGA 1JI1A 2HROA 1ZUAX 1SFSA 3LV6A 3KUMA 4HMNA 3C0QA 1LWHA 4UCGA 4JPGA 1OX4B 1EXBA 2XSBA 3T07A 4C6BA 4L9XA 3UT0A 1YBQB 2Z1WA 3DUGA 1CBGA 1J8VA 2W62A 3W2LA 3POCA 2VTFA 4W88A 1XGDA 3AMGA 5I07A 4K6AA 4GIEA 3AI0A 1SSDA 3R25A 4US5A 3NQBA 1ZBCA 5AHFA 5F4WA 2VEIA 2H6RA 3A9IA 1PBGA 1Q65A 2D0HA 3N18A 5D9OA 2X1IA 1DIEA 1X96A 1N8IA 4GNVA 3NGFA 3GW3A 3KZPA 4IIDA 3HF3A 3CHVA 4CQDA 2ON3A 1X7IA 1A5NC 5A3HA 2EJ1A 1W3LA 1HKIA 2PP3A 2C7FA 4B5XA 2WHKA 4HCLA 3V0SA 4F2TA 1G94A 1QPOA 4KEMA 5M3WA 5XIAA 3LY0A 2J4GA 2D69A 1RD5A 4UNLA 2NX9A 1YYAA 3U2EA 3M4HA 2MNRA 1Q6RA 1I0DA 4C6LA 3KBVA 2P3ZA 1M3UA 2XHYA 2OEMA 2EPNA 4MNJA 1KTCA 5E9XA 3RLGA 4CKQA 4Z0JA 5E9AA 2D1ZA 4LVDA 4H9VA 3VKCA 4TV5A 2PP1A 4NNAA 4CD5A 2WM0A 2V5BA 7PTDA 1LQ0A 4LAMA 2OWXA 1TV5A 2YA2A 3MYOA 1A3HA 4IGNA 1U1JA 3N14A 3K30A 5CJNA 1EX1A 1B3XA 3ECQA 2HRWA 4LJ3A 3B0PA 2BBFA 4GX9A 4ZA0A 1R3RA 3C0JA 2Z25A 1DHKA 1R86A 4GUIA 4LF2A 1CI1A 3QKEA 4M81A 1SUXA 4IPLA 4NVTA 2X0HA 3EKLA 4AIOA 1EUNA 5C9WA 1DP0A 3CZLA 4GKLA 4O57A 3AHZA 1KR0A 2BZNA 1HT6A 4IM4A 2QVNA 4AMAA 2C14A 1L6SA 1V0MA 3QQWA 2WW5A 4WSJA 2E25A 1TWSA 1QATA 3KVKA 3PAOA 4PA8A 4Q4SA 5CJ5A 4O50A 1NVMA 4YYFA 1EGZA 5HMSA 1H63A 4EPBC 4GG9A 3WEOA 3O6YX 3MO4A 1I9CB 1RVKA 3C0LA 1UWIA 4LX4A 4YTSA 4UMAA 3WY1A 1GQLA 1E9IA 4WDXA 3TQKA 1IE7C 1PWLA 1ZQ5A 4QG6A 4RPQA 1GEQA 3BLKA 3IJ8A 1W9BM 3GQYA 1W1TA 2QCCA 1JYVA 4FLOA 2PDQA 3AIQA 3MHUA 4FI4A 3O6AA 3P8JA 3SQMA 4L9ZA 2VQTA 2Z6IA 3LDVA 3EBVA 1F5ZA 1V08A 1V3MA 2WNNA 3BK0A 1ZS2A 4KETA 4MAZA 1R3SA 4LV9A 2GZXA 2DFAA 1NWUA 2C1GA 2W27A 3STPA 3WELA 1Q8JA 3OU8A 3FYOA 1BGAA 2D3NA 2J88A 3LHTA 1XJBA 3IJIA 5G2IA 5FOOA 2CW6A 3OW1A 2E8ZA 2NQ5A 3BW3A 4GC3A 1XP3A 2ZZ4A 2YA0A 4L6DA 3W2JA 4GH3A 1E6NA 1LL6A 1REQB 4HNVA 4D6FA 2GPTA 3S2CA 3M0MA 2VP8A 5LNSA 2GDVA 4RLIA 4QE4A 4L4OA 1X1NA 3M0IA 5ABEA 4YN5A 1NY1A 3IIZA 4XZNX 4QCFA 3QYQA 1DEDA 1FHDA 3W25A 4P8WA 3PC0A 4MKVA 1EA9C 1NARA 4LCSA 4PUKA 1XD0A 4G5DA 1ENUA 1AMKA 4XD6A 1MRQA 4PGLA 1XF0A 1ITQA 1W1IE 1UBSA 5C2XA 3MHFA 4LVAA 1GZGA 5I23A 4ATLA 5I3DA 1PB0A 3KOYA 2ZVIA 1PXGA 1YDOA 4HSOA 1A3WA 4R7JA 4TVCA 1XIFA 4ZODA 3SN1A 4PUNA 3V5OA 2BG5A 5CC5A 2ISDA 4JIHA 1NEYA 3ICJA 1UP2A 3SY5A 1E4LA 5JMUA 1QR7A 1AQHA 3JS3A 4CU6A 1GKPA 3T0BA 3S9IA 1TMLA 4YYCA 3GC5A 4X22A 4AEOA 2PWVA 1BSLA 4AYGA 3SCVA 3EOOA 2OZ8A 4W7WA 1QO2A 3AUJA 2ZOXA 5AYIA 2NLYA 1VHCA 1CXEA 2ACSA 3GSMA 3KZSA 1QXLA 1GQIA 1WOBA 3W07A 5I0DA 2XH4A 1JZ8A 1SJCA 4WKHA 3FYPA 2FZMA 1TA3B 2RGLA 2FIQA 4B5NA 3NO5A 3TX9A 4XKYA 3UY8A 1IXNA 4OT7A 3BURA 4GACA 4EP8C 2OQYA 2WZIA 3N9SA 2C0HA 3GDLA 5I79A 1RBLA 2WWCA 4N02A 1CXHA 3WMLA 1YDVA 3AU2A 4O16A 3FX4A 2DSUA 5F7UA 5F1UA 1EC8A 4D9PA 4X3ZA 4UR8A 1RQEA 2VFEA 5FJOA 3NM3A 5J8LA 1EIXA 3EDJA 1H3GA 3AHVA 1I2RA 4PRTA 2WMIA 2OKOA 4NP7A 1E3XA 4OE7A 3CT7A 5REQB 4C6JA 3DKJA 3C86A 3W88A 1SQ7A 4I6KA 3AIUA 2WVVB 1U30A 1UD6A 1XLHA 3NQ8A 1NWRA 1VIWA 2HV5A 4I5RA 3UJ2A 5D37A 1TRIA 1BWKA 4R3UA 1AW5A 1EP3A 3VNYA 3N4FA 5K4ZA 2WQDA 1JR1A 1NP2A 1XSKA 1K8CA 3W3OA 4GABA 2NV1A 1BRLB 1B30A 3TYEA 1EWEA 1W1ZA 3WFZA 4G7EB 4DJDD 2PWDA 3CUIA 1VFTA 1Z9AA 4M80A 1RJQA 3F2BA 1WXYA 2PRLA 1IEQA 1IEVA 3CEPA 3GDKA 3MC5A 1LOLA 2PB1A 4Z1AA 4PB3A 4GYFA 1C93A 1O68A 3CQ0A 3RJYA 4CN1A 3S5SA 3ITLA 3M5XA 4C7GA 1DJQA 1UW9A 4RNJA 1OWQA 4C60A 5CPQA 2PBOA 4IQJA 4PN2A 5CSRA 1E9YB 2HCVA 4MJ2A 3G1FA 1BXCA 3M7WA 5LXXA 1OX4A 2CLEA 4PL2A 3OPSA 2QCDA 3GNRA 1MQQA 1A4LA 1G7VA 3BQ6A 1NDWA 3FA5A 4BEUA 4PB4A 3W02A 1NDYA 4KERA 2QT3A 1T96A 3WQ8A 1CGYA 2YCKX 4OECA 3CT2A 2H90A 3NSNA 1IWBA 1EEXA 4P7NA 1QI3A 5HUPA 3NVDA 1SGJA 4YVPA 2QDGA 3SECA 4GH1A 3IAPA 2WANA 4WF7A 3UZYA 9XIAA 3NAVA 5F2LA 3W38A 1HZYA 2AAAA 1XIGA 1YTDA 4CN4A 3NPXA 5GJNA 1A5UA 1RJPA 1TPWA 2CLFA 3U8GA 1TJ0A 5D8ZA 4K2SA 1DJYA 1Z69A 2HS6A 2UBPC 4KFOA 3WF0A 4PMDA 3Q94A 5FF7A 1R9XA 3OLEA 1Q63A 4EPEC 2IQTA 5M5DA 1IEIA 3E9AA 1FWJC 4CEUC 4UTUA 1KGUA 3IK2A 3SUWA 3STCA 4M7TA 3VIJA 3VD7A 3KTCA 4UR9A 2DIEA 3PNZA 4ORIA 5DEZA 2EG7A 4KRTA 4UBPC 1TVNA 3N34A 3PZIA 4AY8A 4M1RA 4RDVA 1JL8A 4GNKB 3AZRA 2A3CA 1AQFA 2A85A 4H2CA 1QAPA 2WHJA 4M0XA 3LCXA 1GVOA 3EYPA 3ABSA 4N0RA 4PB5A 2W67A 1ISWA 4IHCA 3SY1A 5T8GA 5HUOA 4K37A 4PTDA 4AZCA 3WBAA 4E2OA 2E5BA 1EZ2A 4DJEA 3L68A 4MTVA 1CB7B 1TUFA 2VX6A 3Q2DA 3HJEA 2C0AA 4HYVA 4K7VA 5A6AA 4GXMA 1OFPA 3KRUA 4C6QA 1F4AA 1NFBA 4FALA 3GUGA 3LUTA 4NZ4A 1O1ZA 1VF8A 3O6CA 1JYWA 2J9ZA 5DT5A 4DVOA 2H3DA 1P5BA 2E40A 5FF3A 1PZ3A 1GOOA 3G3DA 4UTKA 4HU8A 1A5AA 3EOUA 8RUCA 3UWWA 4MHBA 4UQAA 4F0SA 2X0YA 3UF9A 2NQZA 1HKVA 1P7TA 5A8MA 5J5RA 2GUUA 1UUOA 2CBUA 5A6BA 4L4MA 3CM4A 3GBEA 3OEXA 1LOQA 3B4YA 3TKFA 1XIIA 1V02A 2J7GA 1TQXA 4C5ZA 2GGIA 1XLIA 2C18A 1CZ1A 2GDUA 4M56A 4JD4A 1MW1A 2OSWA 3W71A 4HOWA 3EOSA 3RX2A 4BY3A 5J5DA 3CNYA 3CO8A 1QBAA 4MNLA 2IMRA 3VOJA 4KGLA 3M6YA 4C90A 3HURA 2OEKA 4C6NA 5FAGA 5FSDC 2IKHA 3UW6A 1XLBA 2Z24A 2JF7A 2WMHA 1REQA 3WH5A 2HK1A 5AHMA 3SJNA 2VNCA 1GCYA 4BK9A 1ADDA 5C2GA 3W2UA 4CD6A 1BKSA 2Z26A 2P8BA 3NURA 2WLYA 2YCLA 3PZMA 3ZOAA 1KTBA 2ACUA 2WPBA 1SO5A 3VD5A 4NI8A 4ERIA 2V67A 3DHDA 3TSMA 1R46A 1C9WA 1J96A 3GNNA 3B9OA 3PJXA 2Y63A 1H1ZA 2PWUA 2WM1A 4L1GA 5CLWA 4GBDA 1YNQA 2DJLA 4UR7A 1XRVA 4EPKA 2CXEA 5FF0A 4GK8A 4PUUA 1VEOA 1DXIA 3AAMA 2NQLA 1ZP4A 4OQVA 3ZR4A 3QY7A 3S4TA 3UGVA 3UJSA 4IFKA 4B2DA 1TFVA 3K4AA 5HOSA 4PCTA 4BF5A 1KWKA 1K6AA 3QBUA 4IJCA 4ROQA 4B9YA 4NXKA 3G24A 3ARQA 4ZOBA 4RK8A 2GWGA 2R9RA 1B0IA 2C1IA 3AZTA 3TYBA 3UESA 3GXNA 4GUJA 4CNPA 1CXKA 2PLJA 4H6QA 1P48A 5D33A 4L56A 5C7HA 1WDPA 4YVXA 3MDWA 2IW0A 2C6QA 1HUVA 4IPNB 3WMBA 1EKOA 3VDAA 1FOBA 4J3TA 3DECA 3SAZA 3QHMA 1GVIA 3D5HA 5LNRA 3FHAA 3A23A 3B05A 3AHXA 1SVDA 4DUVA 3JZEA 4HVXA 1GT8A 2FH6A 3SRFA 5D9MA 3F4DA 4R7OA 4MIMA 1XYAA 5HPCA 4N9EA 1JPHA 2PDHA 3QMTA 3VILA 1ZU8A 3P81A 1VPXA 3TLLA 4GD0A 3BG3A 1PDYA 3OGSA 1BF2A 3PBUA 4DLFA 1GTEA 1LBLA 1CXIA 5I09A 2CC0A 1HIZA 3TU9A 1AMYA 3HG5A 4M1BA 4WDUA 4JFTA 4Z2GA 2WMIB 2WBGA 4UFLA 4NZJA 4GI8A 1BPLB 5IBXC 3LCHA 4ERGA 1GVSA 3G0UA 3ONBA 2OMAA 1QCWA 4J2MA 1R5YA 1FX6A 3R0UA 3GUWA 5EMLA 4UFJA 2TAAA 2F7FA 3TNOA 3TZNA 1FHUA 1AVAA 3VABA 1J79A 2JKEA 4MM1A 3AC0A 3BLLA 2O9RA 1VENA 1TV2A 3W4RA 1T5AA 2R94A 5CCZA 2WKGA 2WKJA 1E4NA 4M6UA 3N4EA 3ANYA 5BXRA 3WH7A 2UY3A 1XH2A 4AIUA 3R4IA 2BDQA 3ZVHB 2XFFA 3C2VA 2ZZ7A 4S3CA 3PANA 1OQFA 1V3KA 1F6YA 3ZR6A 2DZAA 1EJUC 4MY1A 3S2MA 4NF7A 3BLDA 3MMDA 1NF0A 2B7PA 1EC9A 1KRBC 1W1VA 2XIQA 4E2BA 2YXOA 1PEZA 1BVZA 1TX0A 2VX5A 4FPSA 4C91A 1XIMA 1ECEA 4MY9A 5T91A 1MFUA 1BEUA 1WZKA 2BVTA 2CBJA 4MZ8A 3UPWA 1R85A 3ZLHA 2VGIA 3FSTA 1OK6A 4EXAA 2O7SA 5EMKA 1LUCB 2Z7KA 1YADA 4Q7NA 3VIIA 2V5LA 3LCIA 3GDBA 4NZCA 2WK2A 3A64A 2Y8KA 1G5AA 1H61A 4JQ1A 3TWAA 4WSKA 1BLIA 4J1OA 3MV01 5HDRA 4O53A 1E6ZA 4EANA 5DELA 4FX7A 3T40A 4H1ZA 1HGYA 4AAJA 3PBGA 3K5XA 2XGIA 3VE7A 4JX5A 3QV9A 2CHOA 1DWIM 3OYZA 1MEIA 1XIHA 1RBAA 4LANA 1EUAA 2X40A 1ESWA 4H8HA 4UNKA 2O0TA 2ZA3A 4NT0A 4UB9A 2WSYA 3PFRA 4H83A 3F1QA 5AC8A 3PBWA 4BI7A 4V15A 4I9MA 1LL4A 4FR1A 3UWYA 1Z41A 2BX7A 3QHNA 4INFA 5CZ0A 3QN3A 4UUIA 3C2RA 3AICA 2BS9A 3SN0A 2FQIA 2OQHA 3W7GA 1QRQA 3RJXA 3CV7A 1UG6A 3GH4A 2X1RA 3T2PA 3QR1A 3CASA 4D6GA 3NL6A 2DZXA 4JGDA 4XSLA 3PPHA 1FWEC 1E6XM 1G6CA 1KBKA 4H8VA 3WEMA 1JCTA 3MUZ1 3L5AA 2Y62A 4BZYA 3UJFA 3KCLA 4HNTA 2BOGX 2V3DA 3E0WA 4NKCA 2EXOA 2OXNA 2OSXA 2NWSA 5K2ZA 1UR3M 4UXDA 1MXSA 1W31A 1RY0A 4AZCB 1W3TA 1TIWA 3H55A 3EWBX 4S3KA 3OIHA 5DMYA 3PUOA 4IP5A 4JIPA 3UQNA 1J93A 1C8YA 4IXHA 3ATYA 2CLLA 1W3KA 4PMUA 3O0KA 4WHBA 3WD4A 4MYAA 1KFCA 2B4GA 1UP0A 1O4UA 3PULA 3L7RA 3HOJA 4I3GA 4WGHA 1GWJA 1UA3A 2R24A 3QZEA 3I6TA 2QYGA 4FNPA 1NIUA 4LS2A 4W8LA 1W1A1 1MFVA 3GZAA 3MV11 4KWWA 4OUEA 4LUTB 4WJEA 4ACZA 3GNOA 1VH7A 3EXSA 4KWSA 1JULA 4MDPA 4ASTA 3S47A 3LCGA 2QIIA 4FEZA 2OWCA 1J2BA 3ZLFA 3VTRA 1TELA 3E0VA 3EAUA 2ZRXA 1W54A 3NQGA 1E43A 3PTKA 1CT5A 4XKYB 3LEPA 1TPB1 4QFUA 1F05A 2ZVRA 3REQA 3H4XA 4O8RA 3WN6A 2CIPA 3W76A 3RF9A 1HO4A 4LGXA 3L65A 5I3KA 1JFHA 4I8DA 1WQ5A 4G2DA 1GOMA 2CZ5A 1T0OA 3B8WA 1XRTA 2J7CA 3VDHA 2ZUWA 1B3WA 2A0NA 4UTTC 2A21A 1WKEA 2ZTKA 4J35A 2ODOA 5LIWX 3K2GA 4PMOA 1W2PA 3BDKA 4IG2A 4DUWA 3NOYA 2QEZA 3GVVA 2RGMA 2PRMA 1E9LA 5XIMA 1FHLA 1WDQA 4UQDA 4N9DA 3YPIA 4MLJA 4LYKA 3DYOA 3KM8A 2XPKA 4W5UA 4HTYA 2J7FA 4FP1A 2J74A 4N7QA 4C6OA 3A3HA 1AW1A 1BXBA 2X16A 2JBMA 4DYJA 3U4FA 2XN2A 3DDMA 3L4ZA 4B5SA 3U3HA 1LT7A 2ZYFA 3LBOA 1T8XA 1Y65A 2O9TA 3FLUA 1JDAA 3UD6A 3P14A 2WBKA 3WJYA 1DWJM 2GLKA 1B57A 3H2EA 5ENLA 3R58A 3NO3A 5EGRA 1DQWA 5AB3A 2E8YA 1CDGA 1FUYA 3V5FA 1UD8A 4XZLX 2XVKA 2Y5JA 3VZYA 3CZ8A 3BICA 4W7VA 3B8UA 3OVRA 1DWHM 1R3TA 2GSEA 3LHVA 3HPSA 4FNTA 1UKOA 4KQNA 2EAWA 3B4UA 3VNJA 1HF6A 5JU6A 4R5EA 2VFDA 2VM8A 4LTSA 1C8QA 2R1MA 5HR6A 3O1NA 2EPKX 1AJ0A 3VMPA 3FGCA 1UZHA 4P7OA 3GDTA 3ARXA 4GZ7A 4ZE4A 3S2LA 3W85A 4AZIA 3ABQA 4PTXA 2XM1A 3S6OA 4EKJA 3BLEA 4WY0F 1OIFA 3F4CA 4G9PA 3QZAA 2NWRA 4ADUA 1I45A 3LZ3A 2FB3A 1O1HA 5D09A 3C5QA 1RXOB 2V82A 3TR2A 4ZMGA 3GG7A 3CUFA 2NV2A 3B0XA 2ISSA 1CGVA 1GW9A 4L5ZA 2V5DA 5C5YA 3KP1A 5H6HA 1H5YA 3BMWA 2QGHA 3B9EA 3SDOA 1P43A 3ABRA 3DI0A 1QNVA 3B04A 5AFDA 3IUHA 3K46A 1IF2A 1DQXA 3WDPP 1LOSA 4JTJA 3TC7A 4AEFA 2BY0A 4NX5A 1G4PA 4UCFA 5TBOA 3IGXA 1P0NA 4NAFB 4KH2A 3ZWSA 3PP7A 2ZXBA 1UYQA 1TTPA 2EF9A 5KINA 1JJKA 5AC5A 3C6CA 1JQVA 4KIEA 3LXAA 5HQEA 5G4WA 3UPMA 2FVLA 3NL2A 4Y7EA 5AHNA 4AWSA 1QPRA 3H2NA 1AH0A 1R6WA 3B9AA 2Z27A 5MKGA 1WDWA 3LN3A 3ZIZA 1JNDA 1UMLA 2XVGA 3DBNA 4AIEA 5K4XA 5KETA 2IQ0A 4A3QA 4ATDA 3AALA 4DJFD 5ECVA 4LH8A 3N4AA 4KESA 3UWEA 3H7UA 4A8RA 3UA3A 1F8IA 3KL5A 4TVDA 3UR7A 4JBRA 1T6MA 2G3IA 1EJRC 1DPMA 1TSIA 4FOKA 1X6NA 2DSWA 1NWTA 3N2TA 3O05A 4C5YA 3VINA 3ZXWA 4FNRA 3G1HA 3GNXA 4H6RA 4JTDA 4HK5A 4H2HA 1C3FA 1PYFA 1DWAM 4LBUA 3TJ4A 3BO9A 4QDMA 2QF8A 1UMYA 5LZLA 3MSRA 3MVTA 2ZICA 4XB3A 4J5NA 4KRZA 5HNNA 1NFPA 4AC7C 5CPLA 3MDUA 3LSBA 4C6DA 2XGBA 3VIOA 4D71A 5M2FX 5LHEA 4O54A 4K1GA 3SCTA 5EMYA 1UH2A 1TMQA 5D38A 4J3UA 4QS6A 3W7DA 6A3HA 2C16A 5G4HC 3CYJA 3V4BA 1VQTA 1TRDA 2QCGA 4FLQA 1TR1A 1XYMA 3FDGA 3THQA 5JBFA 1QNSA 1US3A 4CNOA 3ZO9A 1Z8AA 4O8AA 1O94A 1F8MA 1PDZA 4PFMA 4JDYA 3IVUA 4AD0A 4XTDA 4D6CA 3K4DA 3N2XA 2A6NA 1R3YA 3RUBL 4EOUA 4WX2A 4MNKA 2BVWA 4P7LA 3LI0A 4A2SA 4KCUA 1WPCA 3S9ZA 1E0VA 2Q8LA 3DERA 3UEQA 4Q4QA 1EDTA 3LCFA 4V1XA 3RCYA 4XISA 4AF0A 2B7OA 2Q71A 2Z2UA 3HO8A 2AQOA 2Y88A 1JDCA 1HJUA 2PPGA 2PWEA 2QKFA 4RZ4A 3RNDA 3QMRA 4JTCA 2J27A 1OYCA 1XICA 1E4MM 4DPQA 2GVEA 4YTRA 2FTYA 3GWQA 3A6OA 1TREA 2XIJA 3CEUA 4B92A 1UZDA 2CHNA 1SMDA 1XRSA 5DCDA 4HQVA 5LKYA 4M29A 4AHOA 3FCPA 4O0ZA 3CL7A 3M41A 2JFEX 4TVUA 1UHVA 4W86A 3PZ9A 3T1GA 1C91A 4O14A 4CNUA 3M0HA 3LPFA 3PZGA 1A0DA 3SURA 4Q8UA 4DXKA 2OLAA 3TONA 4B5UA 1LORA 3BANA 4QLJA 4CQCA 4GO9A 2IUZA 3DFNA 4B3KA 4QG8A 4ACZB 3VIGA 3C56A 1PKYA 1UR9A 3AYSA 1TVPA 2KX9A 3PBYA 3VGBA 4UIOA 1F3XA 3GLCA 2FPVA 3W6MA 4N42A 2ZC1A 3W7KA 1J12A 4C6MA 3AXKA 4GUFA 3R94A 4KW2A 2Q01A 3OLIA 1ZALA 3DESA 4IT1A 1J6PA 2G4JA 4Q4OA 3NYZA 3BW4A 2D0FA 4IMDA 1TG7A 4UTLA 3SN4A 5KITA 3TTOA 2VO5A 1VBUA 3VGDA 2A3LA 4YLWA 4JN6A 3BPWA 4HIBA 4GYJA 2ALRA 1FDYA 3BTNA 1VBHA 2DORA 4NG3A 3QJAA 4E5TA 4D1IA 3H22A 3OZYA 2YZRA 5D30A 1EHAA 3DZ1A 4RX0A 3VVGA 4MG4A 2XIMA 2F8QA 1G1YA 2GFTA 2VDGA 3NQ6A 2Z1BA 7ODCA 2OB3A 1T8QA 3POHA 2BFGA 1KGXA 5AYBA 1F74A 4GIRA 1BGGA 3OQEA 2WV8A 4G6CA 3G77A 4CNTA 1ZBVA 4L61A 3LI1A 3SCQA 3GG1A 1A5KC 1KCLA 1OZMA 3VU2A 1XLAA 3WNMA 1TVLA 1GONA 4D6DA 3EMCA 4HHPA 4B16A 4J7RA 4H9MA 2PDJA 2J7HA 3KP0A 1PZ1A 3BAKA 3HZ3A 2ZZ2A 2IKIA 4XAPA 2ZRYA 3MYPA 2ZUVA 3MCNA 4AXKA 5A6JA 5FJIA 2ZWYA 3WF1A 3S1XA 1KXQA 4E38A 2FZNA 4XWUA 4AW7A 3W00A 4ZQRA 1LRNA 1ZNNA 3T78A 3TA6A 4V27A 4F66A 2OJPA 1MNSA 1FP8A 5FEWA 4AWEA 3PUEA 5A2AA 4TU1A 2ZA2A 1OJXA 4KFPA 5HXMA 3GW0A 4B5VA 3QXBA 3WQWA 3OZOA 1VEPA 1M1BA 4NJHA 2OZ3A 4J3VA 2QMKA 4JCMA 5BW6A 1CXLA 1RVGA 2I9EA 3GO2A 2D3LA 3G1AA 1VP5A 5I3IA 1UBPC 1DTUA 1TR9A 4JHMA 3VIPA 4AZ7A 4P7RA 2OYMA 4JTAA 3NXFA 3PTDA 1K7XA 3EOEA 4JY9A 4IIEA 4HHHA 1UKTA 3PUDA 4ZFMA 1HP4A 3RITA 3UXDA 3ZJ7A 1DVJA 1GOQA 3M5VA 4JL1A 1VFHA 3CH0A 3KVJA 1TV7A 2YBUA 3MT1A 4MWAD 4RJEA 3STFA 2HEJA 1TZZA 4K3ZA 3KDOA 4PMRA 3W7QA 3W82A 1PV8A 3H54A 2CERA 3T9PA 1HL8A 3CB8A 3RYSA 3I7RA 1CW2A 2YR1A 5BOOA 2Q3OA 1M7OA 4GY1A 1GK8A 3HFTA 5CSYA 3WNLA 4GUHA 3W6LA 3R8HA 3JVAA 4Z2HA 3DHFA 1XQLA 3WLOA 4IGSA 3OZPA 1C7SA 4X0NA 4I9TA 1K9FA 3R10A 5D4YA 3T0CA 3WK0A 3TN6A 2XU2A 3OJGA 3URAA 2YYTA 4NAFA 3CUGA 1K7EA 1Y5WA 1DE5A 2Z4GA 1IR2A 3ARRA 2P50A 3GVQA 5GQBA 1A5LC 1E1CA 1WDDA 1L2QA 4C1NA 1IXOA 2VRQA 3PZTA 1EQPA 4QM1A 3EDKA 1TPEA 2WWDA 2DT2A 4Y8EA 4C1LA 5H8PA 3WLTA 3B97A 1XD1A 3WD2A 1QO5A 4LOCA 4MGGA 1WZMA 4M24A 2OVLA 4F0MA 1UD3A 2ZE0A 2WQPA 4GBUA 4HD5A 1Z6KA 3V75A 4IIHA 4BQ5A 3SM0A 2Y5SA 2ZUNA 2UZ9A 1DE6A 1RJRA 1KKOA 3JU2A 6CGTA 4PCPA 1RV8A 1QASA 4HNOA 1KM4A 2A7PA 4ADSA 3OO2A 2VXNA 3BLOA 4JZ5A 3WK2A 5I06A 3GB6A 1N82A 1OBAA 3HGJA 1FWRA 1TWZA 5TAOA 4PTWA 2XFYA 4E3VA 1QI2A 4TMCA 1K8YA 4PH6A 4U5IA 3W37A 4ZB5A 3CL6A 5C9UA 1Q45A 3LMZA 4LUYA 4HA3A 3EB4A 4W7UA 1O5KA 4MB3A 3ALFA 1RCQA 2CETA 5TIMA