1BEUA

Trp synthase (d60n-ipp-ser) with k+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbon-oxygen lyase
molecule keywords TRYPTOPHAN SYNTHASE
publication title Cryocrystallography and microspectrophotometry of a mutant (alpha D60N) tryptophan synthase alpha 2 beta 2 complex reveals allosteric roles of alpha Asp60.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 98
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1beuA00
3W1TA 2Y89A 3FJ6A 2G97A 3MP5A 5FF2A 4GUFA 2YFNA 3LI1A 3NZRA 4XQ6A 3CLMA 1XBXA 2Z0IA 4QAIA 3SFKA 2HMCA 2V2CA 5FI8A 3BG3A 2RDUA 4XTDA 4FHAA 1TYGA 1TJRA 1DJNA 4JTIA 3W7JA 2EAWA 5DELA 5H91A 2FQIA 2RFGA 4UTWC 3E49A 4QNEA 3UQNA 1TJPA 3NEVA 1G7VA 3IV3A 1W56A 3W1XA 5H2ZA 1ZCOA 2DU2A 4XBKA 3QSRA 4FEZA 2ZRUA 1W3IA 3LTSA 4YXGA 4BF9A 2I9EA 1AK5A 3W22A 4O28A 2HS6A 1L6YA 1YDNA 2ATSA 2Z2UA 3MW7A 4QNWA 1G7UA 2J24A 3T44A 2YZRA 3TJXA 3C6CA 2A7NA 4TO8A 4O4VA 5D38A 5F2IA 2E6DA 2W79A 2PRMA 3WFAA 4DF1A 1OFOA 1AW2A 1OYAA 1LBFA 3NZ1A 3B04A 2RDWA 4LOCA 1T96A 1GVQA 5KINA 1KM1A 5HQEA 3UY7A 3O6DA 3HGRA 5K4ZA 1QO2A 5BMWA 3O63A 3NPVA 4FB7A 3P80A 4PC8A 4M5PA 3TC6A 3E0IA 5F1VA 3OG3A 5D2WA 1F6PA 5F2LA 1GYLA 4MY9A 1VR6A 1L6SA 5LHFA 3W2LA 3V1PA 4CCEA 1QPRA 2E5BA 3DH7A 2C18A 4IMDA 3M0ZA 3S0CA 5AHLA 5J5DA 3M9YA 1H7WA 3TXVA 2ZDRA 1FWSA 2NV2A 3GR8A 1PL9A 1TPH1 3EX1A 2GQAA 4FXSA 3L5AA 4Z0JA 2ZRWA 4XWUA 2WSYA 2X1SA 2Y63A 4LVAA 1SPQA 1HL2A 1M7OA 3QF0A 4MLJA 3NQCA 4O18A 1DHPA 4JX6A 4UTUA 2XN2A 3NQDA 2C16A 4Z1DA 2ZZ2A 6ALDA 4O54A 1T99A 1H51A 1D9EA 4A2RA 2TPSA 4AHOA 3B8DA 3QEZA 4XZ9A 2P0OA 3UPBA 4FNQA 2QAPA 1XBYA 5HNRA 3W1MA 3CEUA 2WQPA 2VXNA 4UTKA 3EX6A 3EX3A 3P8JA 4NUWA 3O16A 3EKZA 4PTNA 2B7NA 5L9FA 3FIGA 3DFNA 1K3UA 2F84A 4UTTC 1SO6A 2VEMA 2CZ5A 2NUXA 1LBMA 1KTNA 2OJPA 1W31A 1UUOA 1IGSA 2FDSA 3NPXA 1B57A 1IXPA 2ZZ5A 4JXCA 3A9IA 3LBMA 1Z42A 1GT8A 1RD5A 1MSSA 2J9YA 2XFWA 1KM4A 4LWWA 3NL5A 1J2WA 1O95A 5L6UA 4P2VA 1H60A 1GTHA 1KFKA 2B4GA 5KZMA 5DY2A 3O1NA 4MVAA 2BLEA 1VCFA 2Z6IA 2E09A 1M7PA 1VPXA 3EWUA 4MFDA 4KFNA 3GLCA 3C3NA 5IM51 1I2QA 1LTDA 3TK7A 2F7FA 3IVUA 2C3ZA 3WK2A 1KFEA 3OA3A 4RX0A 4Y8FA 3HPXA 4UCGA 3ZWSA 1H50A 4X3ZA 1YADA 5EPDA 4E2DA 5CZJA 4JY9A 4B5NA 3HG3A 3C2FA 3KRZA 1WV2A 3NPWA 1XKYA 3M5XA 3THQA 1DBTA 3LDVA 3TV8A 3DI0A 3LLFA 3F03K 1Q3NA 1VHNA 1B3OA 3RU6A 5AC7A 4QITA 4YL2A 1ZAIA 2YX0A 4DO6A 5LHEA 4JGDA 1D3GA 3HMJG 4GUIA 2OX1A 1N7KA 1F2JA 1K8YA 4L4LA 3UWQA 1JR1A 1JUKA 2GVJA 4PODA 2QDHA 1BWLA 2FIQA 4O19A 3EB2A 4YCOA 2VKZG 2A6LA 2H8ZA 5C6MA 4O50A 4UFMA 4UNLA 1UBSA 1WDWA 2ISSA 3MMTA 5F2GA 2ZBTA 4MY1A 1SO4A 2QKFA 1AL7A 1F5ZA 3BLIA 4IJBA 1VZWA 3E9AA 4MJMA 1L2UA 3G24A 3DFSA 3UXAA 1XM3A 3M5ZA 3GNDA 4JTEA 4N2YA 3S1XA 3KXQA 4Q33A 1KTBA 4K8HA 3SY5A 3W88A 4MPQA 1SZFA 1ZENA 3G1SA 4NX0A 3A21A 1IXQA 3GZ3A 1SO5A 1JCMP 1OK4A 1VHCA 1JULA 2AQWA 4IX2A 5AHMA 3WJWA 4AH7A 4GFSA 1SFJA 1XC4A 4CCCA 4E0CA 1H7PA 3DFQA 1DV7A 4K36A 3BARA 2TYSA 4E38A 4K39A 1LRQA 4P61A 4LT9A 2QR6A 2B7OA 1GVRA 1ICQA 4ZL1A 4JS3A 4NXSA 2A7PA 5HULA 1O5KA 2R91A 8TIMA 3UWVA 5F4SA 1G4EA 3VE7A 4KKXA 3S8HA 3KX6A 2KZHA 2ZFAA 3BW3A 3I65A 1P4CA 3FLUA 1CX9A 2DZSA 3C2RA 2DZUA 2WJZA 3LXAA 1PCWA 2YYUA 2Y7GA 2HTMA 3W75A 1Q6QA 4MJZA 2FB3A 2R8WA 5LZLA 2ZRVA 1F05A 1Z41A 3NOEA 2YGYA 3C0JA 3UWYA 2GQ8A 4WY0B 2A85A 2DZXA 3T55A 3NQAA 3WJXA 1KW1A 2X30A 1HO1A 1QPOA 2J88A 1U5JA 3N19B 4AWTA 1ZAJA 3N14A 4N9CA 5AFDA 1A5BA 3NQMA 5K2ZA 2ALDA 3OEXA 1AG1O 2WSRA 3I6RA 2V30A 5BW6A 4OHQA 1DOSA 5MHBA 5I3IA 3W74A 5D2VA 1OHLA 2FLIA 2LLEA 4IX0A 1FCBA 1VCGA 2JGYA 1PHQA 4J9JA 5HUPA 1PS9A 5I3HA 1TPC1 4HKPA 1GQNA 4AEOA 1YYAA 2ATMA 4RZ6A 3TE9A 3H53A 2CZDA 3DXIA 3GAKA 1ICPA 2E5DA 4O52A 2H6RA 1TPUA 4HNVA 4WX2A 4XTIA 3O6CA 3LV6A 1LOLA 1O94A 3W7LA 3W7RA 3P60A 1B4EA 3L65A 4FNRA 4EIVA 2CU0A 1B4KA 4UTHA 1FDYA 3PBVA 4JTGA 1KTCA 2R14A 1SSDA 4N9EA 2A4AA 4IMFA 4LV9A 4UTTA 1TPB1 1UJPA 3NNTA 4LW7A 2QJGA 4O12A 1VLWA 2G95A 5SWUA 5E0KA 1P0KA 1FY6A 4NNCA 4OT7A 1XDMA 3MP4A 3SSJA 1EA0A 4JIPA 4CNPA 1YLVA 2G5WA 3C61A 1QPQA 3W6YA 1Z44A 1G67A 1X6UA 1WOBA 3N2XA 5LNSA 5DN1A 4K6AA 1JCJA 1JCXA 4XUGA 3UY8A 3I7RA 3QC3A 2YR1A 3E02A 3G3MA 3PSWA 4O15A 4ZQCA 2BX7A 3LRKA 5D33A 4AF0B 1BEUA 3GXTA 5F4XA 5G1YA 3TR2A 4N9BA 2V8ZA 3STEA 1H1YA 3LOTA 3UZ5A 3UWUA 3M6YA 3JRKA 1KLZA 4GWEA 3PULA 2QCCA 1A50A 1D3HA 4DXVA 1P0NA 4X22A 3CHVA 5HR6A 4EF9A 7TIMA 1FCQA 4FXRA 2EF9A 4MZ1A 1VYRA 1XUUA 1FXPA 3C8FA 4WUIA 4CLMA 5K9DA 1ICSA 3B0VC 2J27A 3KVKA 4GRSA 3W7HA 4JEQA 4AB4A 1A5AA 1WBHA 1WXJA 3M5YA 1DJQA 5CZSA 1AW5A 5EMUA 1KLYA 3G1FA 5AYXA 2VOMA 4CQ8A 4UIOA 4ONVA 1GJPA 1TRDA 3W83A 2A21A 3HG4A 4Y6GA 4LUJA 3PUOA 3A5FA 2H3DA 2ZZ6A 3O05A 4M6VA 1OF8A 4AWUA 4LS1A 3W9ZA 3KOFA 5EBUA 1AW1A 4A2SA 3W85A 4R53A 4RV8A 4CNOA 3QW3A 1XCFA 1FUYA 3GYEA 2CLOA 3IIPA 1SFLA 3R13A 5EA9A 3I7SA 2O7SA 2OT0A 4JTJA 3QFEA 1Q6LA 2GUUA 4UC5A 4ZQRA 3HPZA 3EXSA 1LYXA 3BLEA 4ORMA 1VLIA 1A5SA 3EX2A 3Q2DA 4UXDA 3NYZA 2X1TA 5FF3A 1WOAA 2E77A 4BI5A 3MYOA 4AHQA 3LBCA 1O4UA 1OABA 4I7UA 3U6WA 5A5WA 2WKJA 2VFDA 3EXRA 1NAL1 3TQKA 3TH6A 4GE8A 1DORA 1FDJA 4ADSA 3B06A 4JICA 1FDZA 1NVMA 4QJ1A 1U83A 3FA5A 4ZZ9A 5FEXA 3NXFA 3HGOA 5FEPA 2EKCA 3SIZA 3R5EA 1I8JA 4WXZA 2Y85A 3LTYA 1TTQA 3LCHA 1AL8A 1NF7A 3SI9A 4K8EA 3QQ1A 4W9TA 1EEPA 3LGEA 4AXKA 1R46A 4UTJA 1YTKA 3W7MA 2NXIA 3DKLA 1S5TA 2E68A 1EB3A 3QJAA 4C1KA 3G18A 1P5BA 2CLEA 4FF7A 1C8VA 4ADUA 3CWOX 3L9CA 4UNKA 1IXNA 3NPUA 3W23A 4BFAA 3O6YX 4AAJA 2QUVA 3AO0A 3BLFA 3TQVA 4H3DA 4DBEA 1TSIA 3A5VA 3ABOA 1W3NA 5CSRA 3UWZA 4N4QA 3EX4A 3QM3A 3S5OA 1TTIA 3NL2A 1JVNA 4O0KA 1M5WA 3OHIA 3QW4B 4BWLA 3ZR4A 4ML9A 3ZS4A 5F1UA 1PV8A 4IXXA 4UFJA 3O8AA 2ABBA 1OFQA 1BKSA 1G4PA 3JR2A 2FFCA 5BMXA 1JCLA 3GXPA 1G4TA 6TIMA 3UD6A 4O10A 3HOJA 2NX3A 5EYWA 3EWXA 3R8RA 2A2IA 3BW4A 1FCVA 5KSWA 4N9DA 1JJKA 1H5YA 3TFCA 5AHFA 4NJJA 1XL9A 3UWWA 1XI3A 2CLLA 2OT1A 5KMYA 4NXKA 3O06A 3AJXA 3N3MA 4IMEA 3CM4A 5CPMA 4EWND 1N8FA 1FWTA 3TJLA 4O17A 4LC6A 3H55A 2NZLA 3L2IA 1A5CA 4FIRA 1SZGA 3LHWA 2Y61A 5BNKA 3R89A 1K8ZA 4M19A 1QNVA 4IPIA 4UTIA 4YWIA 3S6DA 2YW4A 1VYSX 5K3VA 4A29A 1FQ0A 2ZA2A 1YPIA 3G22A 3CQ0A 4HHPA 1ZHAA 3VI2A 4O11A 3SGUA 2PC4A 1UB3A 1G4SA 3BO9A 4YMZA 3S5ZA 3W2UA 4HN4A 2JK2A 4MYXA 4UTLA 3QZEA 1XBVA 3SW6A 2Q3OA 2O7QA 4A22A 2ZZ3A 5AHNA 1OX4A 4DF2A 1I4NA 1VCVA 3NVTA 2GOUA 3LXBA 2A1YA 2JKAA 1MXSA 4H4IA 4RZ5A 1RQEA 3SR7A 1OFRA 1O5XA 4YCPA 3L21A 1K03A 2FJKA 2NXGA 1W5PA 1W8SA 3TAKA 5U7SA 4JTHA 4OU1A 1DVJA 2ZZ4A 3TX9A 1LORA 1VH7A 2ZTJA 2RHGA 1YTDA 3GDRA 3LHZA 1WA3A 3BV4A 4R34A 2H90A 3HJZA 5A8GA 4UR7A 2DJXA 4Y90A 4I9AA 4JTSA 4JD4A 5LNVA 2QAFA 3S5YA 3G8EA 4BK9A 3LERA 2JBMA 1OFBA 3QQ0A 2VENA 3RK8A 1F76A 3L5MA 1R47A 2GVLA 1EP1A 1PE1A 3CB8A 2H3BA 3DHDA 1ZALA 3RLUA 5I3GA 2QCMA 1H7NA 1TV8A 4FX7A 3TC7A 4NNBA 5AC8A 3U8GA 5K7JA 4POCA 4U28A 1FWNA 2Z1BA 1GPWA 1RQBA 3A22A 1YTEA 3WK0A 2D73A 2V81A 4ICNA 3TMQA 1VGAA 1J5TA 4O4WA 1ZFJA 2NX1A 4NJGA 5D32A 3TNOA 1QR7A 3FYPA 1J4EA 1S5VA 3S5NA 2ZTKA 3QRHA 3ATYA 5HMSA 4OE7A 3PAJA 5C54A 4HIBA 3PBUA 1NFBA 4BR1A 2QJIA 3N73A 5D2XA 3E96A 4L4MA 1OYBA 2ZRYA 5TQLA 2QCLA 1THFD 4O1DA 3RLVA 2WSQA 4LV4A 1G6CA 3KVMA 4UFIA 1DQXA 3TIMA 2NUWA 3E12A 1R2RA 4M7TA 3W1RA 3O07A 1KA9F 2NWSA 3M43A 3PC0A 5AHEA 3L5LA 4OV9A 1ALDA 4IGHA 1JCYA 3G0XA 2QCDA 1FWWA 4PCFA 2A7RA 2V5LA 3VE9A 3DFTA 1K02A 4UMBA 1SZNA 5TIMA 2V2DA 3G1DA 3W7NA 1DL3A 5F4WA 3Q37A 2ISVA 3PG9A 3M5VA 1OFEA 1TPDA 1HO4A 2C14A 3N9SA 3MBDA 4UTWA 1FWRA 5K9CA 3QMSA 1FX6A 3W71A 3HB9A 3M44A 3EEGA 4ZMGA 1EP3A 2I1OA 2VEPA 3RNDA 4DQWA 3MWAA 5LNRA 2Z6JA 4NQ1A 3HBLA 1KV5A 1QWGA 3LB0A 1Z48A 5HINA 3CPRA 3BK0A 1XBZA 3DZ1A 5DXYA 2QCEA 5DLCA 2B7PA 2GJLA 1HG3A 3B4UA 4IOTA 3BG9A 5KITA 4FNUA 4K7VA 1OFPA 3TA6A 4BI6A 4O1BA 5HUOA 3BPWA 1OJXA 4U4MA 3BGJA 2V2HA 4GUGA 5AYZA 2QDGA 5FESA 3IGUA 4PA8A 4JY8A 4MUZA 2EGZA 5K4XA 3IEBA 4O53A 1X1ZA 1YXYA 3LHUA 3EWWA 4JDYA 3DAQA 3PG8A 4GUJA 3W7IA 1X1OA 3UZJA 1SW0A 4XKYA 2Y62A 1SQ7A 1QOQA 3FOKA 2A5HA 1KFBA 4FO4A 5IBXC 2P1FA 1SW3A 4Z1BA 5KTLA 1TPFA 3U2OA 3HQ1A 5CPNA 3H54A 4ALDA 2C6QA 3DGRA 5DCDA 3G1XA 1GYNA 3TW6A 1I45A 2ZZ1A 1GZGA 3CT7A 1ME9A 3P84A 4LVBA 4NJIA 1H1ZA 1ZNNA 4LUIA 4M6PA 3WK1A 4MZ8A 2BTMA 4LVGA 1K8XA 3NQ8A 2CLMA 2J9XA 3CTLA 1LZOA 4I7WA 1GVFA 3EWZA 1A53A 2W6RA 2XN1A 5EY5A 4DPQA 4AWSA 4DELA 5E93A 3M47A 1OK6A 4EF8A 5HWNA 3K30A 2YDAA 2QEZA 1OX4B 3PB2A 3N9RA 3ZWTA 1JUEA 3S1VA 1LROA 2Y7FA 4MY8A 4S1FA 4PH6A 1B9BA 4JYDA 1S5WA 2GQ9A 5KZEA 3P8IA 4ZVJA 4BI7A 4R7JA 5LNUA 3TSBA 3MI6A 2J6XA 3WJZA 3GKFA 5I3JA 1W0MA 4QSHA 1P1XA 3QYQA 3LCLA 5CZTA 4IMCA 2ZYFA 1GG1A 1W54A 3F1QA 1I2PA 3LHTA 1ADOA 1ONRA 3OVQA 4LVFA 4KWWA 3IGSA 3N34A 4HSNA 4JDBA 4S2BA 3W76A 4G1KA 4H6KA 1C29A 1RV8A 3M7WA 3NR0A 4HT3A 4LS0A 4X9SA 4WY0F 4ADTA 3C4UA 1W5QA 1KM5A 2E6YA 3GVGA 1T0OA 1F73A 1QCWA 2FPVA 4M7SA 3C2OA 3MI2A 3BGGA 5HR7A 1EPXA 3DENA 3C52A 1W37A 5EKYA 1GEQA 4C1LA 1H7RA 1CW2A 1KV8A 3W7EA 4NNAA 2QCGA 3PUDA 2YPIA 2BSLA 1F74A 3QMRA 1EIXA 3ABRA 5HWJA 1R2TA 3USBA 3N2MA 4NJHA 2Y70A 5AC6A 1XDLA 1H7XA 1Q6OA 2TMDA 4JTKA 4JNMA 3P62A 1TV5A 3PR2A 3W2NA 3PB0A 3T78A 3F4NA 4OV4A 2RKXA 2VFIA 2WOQA 3EKLA 4UMCA 2QCDB 2NX9A 2QF7A 3L0GA 3RMJA 4UMAA 4DF0A 3DFPA 4O57A 5FEWA 3TXZA 4IXHA 5GVJA 4S2CA 2ZRZA 2QUTA 4WZHA 2E6FA 2IQTA 2JGQA 3KVLA 1MZHA 2WNQA 2YYTA 3G1AA 4OWGA 1LDCA 5DBTA 1VYPX 2C15A 3R2GA 3W73A 2NXHA 4DEFA 1E51A 3IIZA 1R2SA 4E2BA 4RJEA 1LRNA 2DZPA 3LCIA 4DBDA 4O0ZA 1C9DA 1GVOA 1LBLA 2YCEA 3W1UA 2C13A 2CW6A 2YXGA 5G4WA 1TPVA 3S1UA 1WAUA 3HO8A 3LI0A 1OF6A 4HPXA 3LM7A 1KM3A 3GR7A 3QH2A 2TRSA 3G3DA 3NQ2A 2Q8LA 1PCKA 3SZ8A 2UV8G 5D2TA 2P10A 3WJYA 3W7GA 2NWRA 5FF4A 3LRLA 4RK8A 5LGXA 4Q32A 1TB3A 1LRTA 1K7EA 4KFPA 2Y7EA 1Q6RA 3LCGA 4NZFA 3O15A 1OYCA 2DP3A 3A23A 3WK3A 4RLIA 3G8RA 4LU0A 4WD0A 3M1ZA 3UPWA 4RXGA 3NAVA 3MBFA 3THAA 5T26A 2B7QA 1T8XA 2QUUA 3OVRA 4RCXA 2ZZ7A 2CZEA 3RFAA 4DO5A 4ORIA 3FKRA 2PRLA 5FF7A 3KHJA 2AGKA 1EUAA 1TTPA 1EX5A 1H63A 4WOQA 1TQJA 5G2HA 1MO0A 4QIUA 3W7OA 4XKYB 3FKKA 4FIQA 1BTMA 1SW7A 1RPXA 2CLHA 1JRBA 3BG5A 4MYAA 4IWWA 3EWYA 3GX9A 5DY3A 2X1RA 4PFMA 3DKJA 2JKPA 3CEPA 4I7VA 3W1LA 5I3FA 4O1AA 3A24A 5IBXA 5D04C 3I68A 3VFLA 3S42A 1GVSA 4MZYA 3GB6A 2Y6ZA 2CWNA 3GDMA 1SU5A 3IGXA 3LXCA 5CSSA 5DCEA 4N6EA 3F4WA 2E5CA 3W07A 3RF9A 3QPYA 5I3KA 4NJKA 1YXCA 3LCFA 1W5NA 1QAPA 4JTUA 1ZY9A 1SUXA 5TBOA 1RR2A 4MIMA 3BW2A 4JTFA 5HWMA 2HSAA 5LGZA 1S3HA 2EPHA 3Q94A 3B03A 2RH9A 4ZQOA 1UCWA 4WY0A 3W7CA 3PY2A 4JYFA 3D0CA 3TUUA 1YDVA 4GC4A 2YSWA 3JS3A 2NV1A 1IXOA 1EP2A 4WOZA 1O60A 1OFDA 3IIOA 1VC4A 3G1HA 1TREA 2A6NA 1MEWA 4TR9A 2OMAA 2WO5A 4O16A 3R12A 5CZ0A 1AMKA 4AMAA 3NDOA 3C2EA 1W1ZA 1WX0A 4OBTA 2CLFA 4K38A 3P82A 3FYOA 3B0UX 5CKSA 1N55A 4DPPA 3TROA 1M6JA 4PEKA 3T7VA 3KAOA 4GXMA 5G5IA 3ELFA 1TPWA 2VC6A 4JIQA 2VFFA 4UR8A 1TPEA 3CIWA 3W2JA 1W5OA 1QMLA 1QDSA 4LRSA 2X16A 2HS8A 1I2RA 5CPLA 3SGZA 5ABTA 4XBSA 4GUHA 3LRMA 4FNPA 2GVGA 4O13A 3GAYA 5U4NA 1WQ5A 1KFJA 3G1YA 3UNDA 3PVFA 2BWGA 2VEKA 4QISA 1VQTA 2PE4A 1BWKA 1IIHA 2ZCGA 1ML1A 1L9WA 3CC1A 3TCEA 2XN0A 4NT0A 4RKAA 1IIGA 2A0NA 4NVTA 1KBJA 2VELA 3P5YA 4MKNA 1TO3A 3BVJA 3OVPA 1OVDA 2V0TA 2E1DA 4HNNA 3W87A 2GPTA 3IVSA 4EOUA 3ZFHA 3GDLA 3LHYA 3NGJA 1UASA 2WNZA 3MP3A 3P7YA 3HF3A 4JX4A 3NQEA 1UUMA 3HG5A 4LS2A 5K9XA 3W1AA 3NL6A 3M16A 3GK0A 1VS1A 1GOXA 2DZTA 3IIXA 2GJNA 4CCDA 1F6KA 4Z1CA 2FTPA 1GWJA 3GXNA 3MHUA 3P81A 1TCDA 4AHPA 3GDTA 4AF0A 4UUIA 3ABSA 4N02A 3L68A 4WJEA 2BZNA 3T40A 2PURA 1TRIA 3TAOA 3NQ6A 5BOOA 4JX5A 1OX6A 1LOSA 1KFCA 1W5MA 3W2MA 4A21A 5D05A 1DKWA 1HFBA 4GNJA 3C2VA 4FX8A 4WXYA 5D03A 2DORA 1NSJA 1XXXA 4QQ3A 3STFA 3W72A 1SSGA 3L67A 3TFXA 1I2OA 1KFLA 2Q8ZA 2JKEA 1HUVA 2Q3RA 4X2RA 2DZWA 5C5YA 4LVDA 4LC8A 2C0AA 4TMBA 4Z1AA 5C55A 3P67A 2FPYA 3IRDA 3ATZA 5G2WA 3OIXA 2FB2A 3M41A 3TW7A 4IMGA 3TQ0A 1LCOA 3GDKA 2V9DA 4FNSA 4YLWA 5HJLA 1WBJA 1QPNA 1R30A 3OBKA 2YFOA 3LCXA 5LKYA 1ME7A 1OX5A 4HSOA 4PL1A 2X1UA 3W84A 1RQHA 2CZFA 3ANYA 3W1NA 3MI3A 2G96A 4M6QA 2X2GA 4MOZA 3MHFA 4RR4A 2I14A 4JTTA 5AYYA 1H62A 1KM0A 5DXXA 1KBIA 4JYEA 4QM1A 5DCBA 4ZQPA 1FCUA 3INPA 3LCWA 3NO5A 3GNNA 3TSMA 1TMHA 5FEZA 3ABQA 4TMCA 3UYCA 1ZAHA 2WV8A 2RDTA 2ABAA 3NQVA 2R94A 3W70A 5G4EA 1TV7A 1MEHA 5D2YA 1JQXA 3STGA 3W7KA 1OG0A 1QFEA 3GIYA 3PSVA 3P61A 3MO7A 2ZA1A 4JR5A 5CPOA 3LLDA 3NA8A 3DHFA 2V82A 5J5RA 2PCQA 4Y9AA 1LLZA 2VEIA 4FX6M 1RZMA 3PUEA 3UXDA 3WJSA 2CLIA 5CGQA 3NM1A 2DZVA 3S1WA 3TU9A 4IPJA 1JUBA 5FF0A 3V75A 4N6FA 3DBPA 4JN6A 2QJHA 1PIIA 5AOUA 3NM3A 5F2MA 5D37A 4K37A 1JCNA 1QO5A 3FJLA 1QOPA 3EWBX 3LX9A 2VFEA 1FXQA 1V5XA 1VJIA 1Y0EA 5LSMA 2CFFA 1H7OA 2ZA3A 4UFLA 3TMLA 1YDOA 5D09A 3TDFA 3L0NA 3TSDA 2FPTA 1SZEA 2YW3A 3MYPA 2OZ0A 1EUNA 3NG3A 2BXVA 5AB3A 2WNNA 1K7XA 4IQLA 1W3TA 3STCA 2EHHA 1JRCA 4BWLC 4PL2A 1FBAA 4KWVA 5DBUA 2J9ZA 4Z0SA 4GJ1A 3W2KA 1LP6A 1EWEA 1ME8A 4IUOA 4K7YA 2QCNA 3LV5A 2H8XA 4EVZA 5G1TA 1L6WA 1K7FA 3NQFA 4LRTA 5E1QA 5EL1A 4WQ6A 1XUZA 2TSYA 4JTLA 1OFAA 3SJ3A 4UFHA 3VNDA 1GTEA 1HTIA 1TTJA 4HNTA 1DQWA 1PVNA 3KVJA 4NX5A 4GBUA 5D02A 3S9YA 4O8RA 1NEYA 2Y88A 1V7YA 4NZJA 4DO4A 3NQ7A 3NL3A 1MEIA 3PWAA 5KZDA 3FS2A 4FNTA 5CG7A 1X8FA 2V5BA 3W7PA 3VKJA 4A3UA 3DU0A 4RZ4A 3IIVA 3EXTA 3FEMA 4HNUA 4MFEA 4LTSA 3NQGA 4UFKA 4CNNA 3W3OA 4TU1A 1CI1A 5AN7A 5BRBA 3HIJA 4Y96A 2ZRXA 1G69A 4AVFA 3HGJA 3CWNA 2ISWA 4KFOA 1GG0A 1YXDA 4OGZA 1TQXA 3G0SA 2Y7DA 3W7DA 2AAMA 3DI1A 4O14A 3TKFA 1ZJIA 1LOQA 3VCRA 3QPZA 3CIXA 1VRDA 3T4CA 2VFHA 5LNWA 3LHVA 2C1HA 3IVTA 1WYIA 5G2IA 3G1VA 3I7QA 3W86A 1RVGA 1PHWA 2ZQ0A 4ZQMA 4RXFA 4CQ9A 3P74A 3W7QA 3DFOA 5D30A 2VFGA 3PF3A 1X7FA 4OQVA 2QCHA 5C2XA 4LY8A 3PBWA 1KM2A 4Q4KA 4ZQNA 2OCZA 1SO3A 1Q45A 4MLRA 3KFTA 3W1QA 1H61A 4O1CA 3YPIA 4UTMA 4N4PA 3SECA 3C56A 3HG2A 1SR9A 1JQVA 3CU2A 1EWDA 3B05A 3KRSA 4CQAA 3B0PA 4NU7A 3P5ZA 1KM6A 3G0UA 3Q58A 3L0KA 3QSTA 4D2JA 3MHGA 1YPFA 2B0MA 2DJLA 2QCFA 3PS7A 1LM1A 3MUXA 4LNYA 4R33A 3LTPA 1XFBA 3GKAA 1IF2A 2NLIA 3MJYA 3QMTA 2CLKA 1I2NA 3FFSA 1TIMA 3PBYA 2E6AA 3HGSA 3PM6A 4TX9A 1NF0A 4HPJA 4Z08A 3HPSA 3L66A 2PRHA 5AHIA 1F7BA 2NUYA 4TIMA 2C19A 3W1PA 3KRUA 1LLWA 2W0UA 2WPBA
chains in the Genus database with same CATH superfamily
3W1TA 3FJ6A 5A8OA 2YFNA 1Y8BA 3VABA 1E3XA 3FV9A 3NZRA 1EJWC 2FTWA 3C3UA 4MDOA 3KCOA 3UZZA 2GFTA 2RDUA 2XH7A 3UZXA 3SGGA 1TYGA 4JFWA 4PTVA 1B5TA 3GNRA 2WC3A 4JTIA 4D71A 1XYBA 4B3LA 2W9MA 4EK7A 3V3WA 2ZUTA 4QNEA 2DUXA 3LA4A 1TJPA 4QE5A 3IV3A 1W56A 3B8WA 3ZT6A 5H2ZA 1IWPA 3QSRA 1CYGA 4C60A 2ZRUA 3WLLA 4Q3MA 3GVWA 3RYSA 1HVQA 1AK5A 3W22A 3WO8A 3BANA 1L6YA 3F4DA 5HOSA 5HMEA 3CQJA 2Z2UA 2P0IA 4ZO7A 3LGDA 1UWRA 2E6DA 3CZJA 3BLPX 1DXEA 3RHGA 1AW2A 4EPDC 3P14A 3B04A 2DUAA 2PGFA 2RDWA 1T96A 1E6XM 1XX1A 1GVQA 4AIEA 1Q6FA 5KINA 3T0AA 5HQEA 3UY7A 1TJ2A 3HGRA 4UB9A 5K4ZA 1Q66A 4DM1A 3R4IA 2OZ8A 3I10A 4FB7A 3ITGA 4PC8A 5F1VA 3OG3A 5D2WA 1B2YA 1LJYA 5F2LA 4AY8A 2VOTA 1VPYA 4J1OA 4CCEA 5IDIA 5E0FA 2PTXA 3QOKA 2C18A 3WMSA 3S0CA 1SVDA 3HV9A 1H7WA 5C7HA 2ZDRA 2OWCA 1XLHA 3ZSTA 3WX7A 3Q4DA 3U9IA 4D72A 4FXSA 3A12A 2QULA 1GQLA 3LK6A 1PWMA 3PZVA 1HL2A 1M7OA 4GISA 3QF0A 2ICSA 4MWAB 2X1IA 1DHPA 2E9MA 3NQDA 1J6OA 2C16A 2VZTA 2ZZ2A 5C9RA 1POKA 3IJ8A 4HK5A 1NOUA 3LM3A 2P0OA 5BOEA 1TR9A 4FNQA 2QAPA 1NWSA 1W17A 2VXNA 4UTKA 1K1DA 3WQ5A 1OWQA 3EX6A 3EKZA 4PTNA 5EMMA 2B7NA 5CAHA 5D9NA 4WGHA 4UTTC 2F84A 1TVPA 3LNMA 2VEMA 4V27A 1LBMA 3ZLHA 1UKPA 1UUOA 4AX6A 3NPXA 1B57A 1IXPA 2OYLA 3FJ4A 3WQDA 2E4TA 1KCZA 1Z42A 4JTAA 4W7UA 2J9YA 4QX4A 5JBDA 2D1ZA 3IJIA 5JBEA 4DWSC 4LYPA 2B4GA 1D8WA 3H4WA 4TUFA 2D2GA 1VCFA 4QCEA 4MFDA 4KFNA 3ZSSA 3GLCA 3C3NA 4JIEA 4NAEB 3S1GA 2QUNA 2WKLA 3IVUA 2C3ZA 3WK2A 1KFEA 3HPXA 4UCGA 5EPDA 1YQ2A 2F6XA 3HG3A 3R58A 4NI3A 3NPWA 4XG1A 4RW5A 3M5XA 4QGCA 2EEXA 5AY7A 2VX7A 3VCCA 3FXYA 1D3GA 4HU3A 4GINA 4L4LA 4PODA 1PKYA 2WWCA 1MFUA 1HXJA 2ZUWA 2ZXDA 2JF6A 1XSJA 4ZO8A 4JPGA 1UWIA 2F2HA 3GZAA 3S6OA 5JH1A 2A6LA 5C6MA 1UBSA 2VUNA 2ZWYA 4PUJA 5F2GA 3RCNA 1C3FA 2I5GA 1VZWA 4GVFA 3G77A 2DSVA 3GR4A 3G24A 3UXAA 1XM3A 3M5ZA 3GNDA 3H2EA 1TIWA 3KCLA 1IT0A 1KTBA 1SZFA 2J77A 4H9VA 3ITVA 4L9ZA 3GZ3A 2F61A 4NYUA 3K8KA 2Y5SA 4S3FA 1CTNA 1JCMP 4DNHA 5ABFB 2GL5A 2AQWA 2PFHA 3KBVA 4GFSA 3S9ZA 3SFWA 5CLWA 2TYSA 4K39A 4P7QA 5HQLA 4LT9A 5AYBA 1WDQA 3LZ5A 4WF7A 1B3XA 4JS3A 5HULA 2R91A 4PMNA 4DZHA 1A5KC 1FWEC 1G4EA 3B9NA 4N0RA 1W91A 2FH8A 3NJ3A 5KETA 4GVIA 3EZ4A 3QKEA 2DZUA 3BUVA 2OWXA 3GNXA 2FB3A 4RDZA 5LZLA 3T8LA 1F05A 1CDGA 2YGYA 3C0JA 5CPSA 1VFSA 1QTWA 2WMIA 3WJXA 4JN7A 1KW1A 2X30A 1HO1A 3ES8A 1JNEA 1U5JA 4AWTA 3CZEA 1W1B1 5AFDA 1A5BA 2ALDA 4REQB 3WLOA 5M3WA 3TW9A 4D1IA 1W1A1 1DOSA 5D2VA 3FK4A 2FLIA 2VYOA 4IIGA 1JYVA 2ZC8A 1FHVA 1EO7A 1FCBA 3B0YA 4UQEA 2XIQA 2AL1A 2VDGA 3QR0A 1PHQA 5A3HA 1TPC1 1EC7A 1F3XA 4RPPA 4HMDA 1YYAA 1OGSA 3S6TA 1AH3A 4GZEA 1HKWA 1UROA 3II1A 4V33A 1ICPA 3SCQA 2Z1XA 3GSMA 2DT1A 3AIUA 3U7VA 1FDYA 3PBVA 3S2LA 1KTCA 4FSAA 1SSDA 1IR1A 4N9EA 3IJDA 2Y5JA 3VIKA 4YVVA 1TPB1 1Q6GA 3NNTA 2QJGA 4O12A 2YXXA 4GJJA 2G95A 5DQPA 4UOJA 3C0QA 4NNCA 2HE8A 4R5EA 3SSJA 4JIPA 1E6PA 4CNPA 1XYAA 4GVHA 1Z44A 1G67A 3N2XA 3EGJA 4EWJA 3C0LA 4INFA 4Q22A 3PPGA 3VNJA 3T0DA 4IIBA 2V69A 2YR1A 3PSWA 5BXRA 2O56A 4ZQCA 3VCNA 3LRKA 1BEUA 4KWUA 3GXTA 4L5ZA 3N6HA 1XS2A 3LOTA 3UNTA 2OQYA 3T0CA 4LPCA 5E70A 1V3LA 3AMCA 1MZRA 1D3HA 3LPPA 2V67A 4X22A 3CHVA 2EF9A 4Q4RA 3IUIA 3UFYA 2XIIA 4GQBA 5K9DA 3EMQA 3B0VC 3W7HA 4JNZA 3W26A 3ZOAA 4JEQA 1WBHA 1JYWA 1DJQA 1AW5A 3BC9A 3TTOA 1KGXA 1JXKA 5IHSA 1EJTC 4CQ8A 1DEDA 3SCRA 5GJNA 3W29A 4DWSD 3PUOA 2H3DA 1FH7A 1PWLA 4B5VA 3VGFA 3EDDA 5M03A 4M6VA 5CC3A 1PYFA 2DW6A 4YS1A 2BBFA 4LS1A 1US2A 5EBUA 3AIRA 2J7HA 4HHLA 1QNRA 1OEPA 1TWSA 1XCFA 3RLGA 3IIPA 1SFLA 3R13A 4WJXA 5EA9A 3I7SA 1KXTA 2O7SA 2OT0A 4UC5A 1CWYA 4ZQRA 3P0XA 4S3JA 1H0GA 1VLIA 2XINA 2QLYA 3Q2DA 1J10A 3AS3A 4HPHA 2FZBA 4BI5A 1XF0A 3H2AA 3H8AA 4I7UA 2DW7A 3EXRA 1NAL1 1B54A 3TQKA 3TH6A 4GE8A 1FWJC 1DORA 3AWOA 4CD6A 3B06A 1TV2A 4TX8A 2INFA 3FA5A 4ZZ9A 2INEA 5FEXA 1UMYA 3NXFA 5FEPA 2EKCA 1E71M 4EACA 7TAAA 3N6QA 4L4OA 4I3GA 4AMCA 3B8VA 1TTQA 1V4YA 2VRQA 2VWTA 3QQ1A 4GO9A 3PANA 4AXKA 4UTJA 4LUTB 4GQQA 2AQOA 4C1KA 5BXSA 3GG0A 3G18A 2DSWA 4FF7A 3CV1A 1C8VA 4QTGA 1RJQA 3WH5A 1EDTA 4F66A 1H2JA 2PBGA 4DWDA 3BZJA 3AO0A 2WM0A 1GOWA 3VAVA 1LQ2A 1C7SA 1GOKA 1IZKA 1P0DA 1WCGA 3KL5A 5CSRA 1XWYA 3OB8A 2UZ9A 4N4QA 3QM3A 4Q4MA 1HF6A 3AWNA 4BQ2A 4O0KA 1M5WA 5GNYA 3VIJA 2DSZA 5F1UA 5I02A 3TYBA 3O8AA 3SRHA 1BKSA 1G4PA 3JR2A 2FFCA 2BY3A 5HBFA 3RXZA 3EWXA 2A2IA 4NHVA 5A8QA 3GU1A 4A8LA 2E0PA 3R1ZA 3TN4A 1H5YA 4NJJA 3UWWA 2CLLA 3AJXA 5CPMA 1VPQA 2YOCA 4EWND 2UY5A 4U31A 4C6OA 1W1VA 2DFAA 3Q65A 4MHBA 4LC6A 2DPEA 4B9ZA 2X7WA 2NZLA 2OSXA 4YHEA 2WWDA 5HNTA 5I03A 1W9XA 4PUUA 3LHWA 3ZT7A 4M19A 4BEUA 3TYAA 1QNVA 2YDRA 3MUY1 4UTIA 4M3PA 5K3VA 4A29A 1FQ0A 3PBGA 1YPIA 3PFMA 4NAFB 3G22A 1ZHAA 4O11A 1G4SA 3BO9A 3S5ZA 4HN4A 2JK2A 2KX9A 4B92A 1XBVA 1DJXA 1BGAA 4CN6A 2Q3OA 1JD9A 4A22A 2ZZ3A 5AHNA 3FXGA 1VCVA 3NVTA 3L7RA 4F0HA 3AIEA 3LXBA 2JKAA 3AMDA 1J01A 1UIPA 3BV7A 1E4IA 1QNSA 1OFRA 2PUZA 4KEZA 4PRWA 1YTDA 1AZ1A 2NW0A 5BU6A 3VOGA 1F4AA 8XIAA 2G50A 2H90A 4HK7A 3HJZA 2DJXA 3ZM8A 1EYWA 1MW0A 1RP8A 1KKOA 1GW9A 2IQDA 4KCTA 3VDGA 3MSGA 4BK9A 3LERA 2HV5A 2A3EA 4PCTA 1E72M 4PUKA 3DEQA 1F3EA 4GYJA 1VBUA 2DGAA 2FVKA 5I3GA 2EJAA 4QEEA 3APTA 3TN3A 1NELA 1YTEA 4FOJA 4U3AA 3DOPA 3TMQA 2YZ5A 3SDOA 1ZRQA 2FJUB 1QR7A 3FYPA 1J4EA 4WSJA 1S5VA 2Z27A 1XG3A 4P5UA 4A3HA 3R8GA 3UWEA 4MM1A 3QRHA 1V3JA 3ATYA 5HMSA 4OE7A 3N18A 5C54A 3CQIA 4BR1A 3T1GA 1LWIA 3V5OA 1VEMA 2G3FA 4O1DA 2D3LA 5FOOA 3RLVA 3OQEA 1RK6A 3KVMA 3TIMA 1DQXA 1IZJA 4IICA 4O1EA 3R94A 4MNLA 1VFFA 3V0UA 3HJEA 1KA9F 3M43A 5AHEA 4DBSA 1JCYA 3G0XA 2QCDA 1FWWA 4JFVA 5DFAA 2V5LA 4DUOA 2WVUA 3CQHA 2QIWA 1WXYA 1K02A 3BAJA 1DL3A 3NXLA 1PDZA 2GJRA 1KR0A 1TPDA 4ASTA 2ZOXA 4I6VA 3V5FA 3QR3A 4UTWA 3CV6A 1EZWA 2OYMA 1FX6A 1AJZA 4XISA 1TWWA 2I5IA 3M44A 2GK1B 3E2SA 1OT1A 3MWAA 1V0NA 3HTWA 4DXXA 5LNRA 2Z6JA 2OOGA 5EMKA 1KV5A 4IFKB 1Z48A 4LFYA 1XBZA 3GVVA 3BLKA 3VNYA 3SJNA 4K1WA 2QT3A 4HA1A 2VEGA 3URQA 4O8AA 4FXJA 4GY0A 1G94A 5LIUX 8RUCA 1CGUA 1CBGA 1RP9A 3BPWA 1OJXA 3N1AA 4MTVA 2V2HA 1UPPA 4GQRA 4MUZA 2EGZA 1CGWA 2PI6A 2UY4A 1X1ZA 3O9NA 3LHUA 3DAQA 4GUJA 3UZJA 2OSYA 3ISIX 2Y62A 4PMRA 3B3DA 1SQ7A 3BCFA 3M0XA 1XD1A 1WZMA 1QBAA 3EB3A 1PIFA 2P1FA 1SW3A 2C91A 2PD9A 3A3HA 4FPSA 5KTLA 4ZSTA 3QLLA 3U2OA 5CPNA 3H54A 4I8YA 2VZUA 2C6QA 3DGRA 4UWMA 1GYNA 4AD1A 2POTA 1YNQA 1I45A 1E1CA 1GZGA 1ME9A 4HMEA 3FYYA 3P84A 1GZJA 2OOFA 1ZNNA 1VFMA 1XIEA 3WK1A 4P8XA 2BTMA 1K8XA 4GO8A 1Y5WA 3CV2A 1U1HA 2BXYA 1A53A 2W6RA 3AYTA 4IF2A 2REQB 4CKQA 5E0CA 4X2PA 2D2HA 4CNUA 5E93A 2NLYA 1OK6A 4EF8A 1GORA 1B30A 1OX4B 3GH7A 5ECVA 3PB2A 3L4TA 3ZWTA 1I0BA 1JUEA 3MKKA 2Y7FA 4MGGA 3E0VA 4JYDA 2GQ9A 4PUDA 2ISFA 3PJXA 3ITTA 4TXEA 3TSBA 3LQGA 2D2OA 4GMEA 3WJZA 3GKFA 4CQBA 5CZTA 3E0FA 1W54A 3LHTA 1ADOA 3N34A 3GE7A 1RV8A 3M7WA 3NR0A 4HT3A 4X9SA 4WY0F 4ADTA 2IPWA 4U3CA 1HN1A 2GGJA 2QZRA 2PAJA 2EPMX 4NYYA 3E74A 4KH2A 5IXEA 2WM1A 2DIEA 1VFTA 3M07A 4AIOA 4TTGA 4L9YA 2VR2A 1A80A 3DENA 4ECLA 2XVLA 3NQBA 2GWGA 4C1LA 4XVDA 3EOOA 2I56A 2BSLA 2EQDA 1F74A 4JQ3A 1EIXA 4KCUA 5HWJA 4FR1A 1PBGA 3PFRA 2VX5A 1Y5VA 3QYSA 1R3YA 2BXZA 4GZIA 2TMDA 3KWSA 1JG9A 3P62A 1QHOA 9RUBA 4CN1A 1TWIA 2H9AA 2RKXA 4PCSA 4UMCA 2J6VA 1T6MA 2OPJA 4E3TA 2XVKA 2NX9A 1EJRC 4GPNA 3TXZA 4S2CA 4WZHA 2E6FA 2IQTA 3FVDA 4J3SA 4AZCA 3R11A 3GNPA 3D3AA 5DBTA 2YXOA 1P43A 3M7SA 1VYPX 1B3WA 4PTWA 2NXHA 1E51A 4DM2A 1WDPA 5ABHA 3OZOA 1R2SA 1XH0A 3AHTA 4DBUA 1F8MA 4Q8VA 1K9DA 4I9MA 3LI0A 2HNHA 1CGYA 3QH2A 2TRSA 3G3DA 3SZ8A 4HP5A 5MKGA 3W7GA 2NWRA 2G3IA 5FF4A 2ZADA 1LRTA 1H41A 1EJUC 3WLIA 4NZFA 2VUYA 1AQ0A 3G8RA 4WD0A 2IQ0A 3UPWA 1M7JA 3NAVA 3B97A 1JZ5A 4RZBA 1XLDA 3AFBA 2B7QA 4NZ1A 1EDQA 3GIQA 3OVRA 4RCXA 2ZZ7A 5CC5A 4W86A 1XPYA 3WQ4A 5ENLA 1TTPA 1H63A 4YJ5A 1MO0A 3RR1A 4F0RA 2VR5A 3W7OA 4FIQA 4K1GA 1RPXA 1JRBA 4QLJA 2GLKA 3EWYA 3OOQA 4OECA 3WLKX 4DO7A 3CEPA 4ERGA 2QJMA 4O1AA 3WZ0E 4KRUA 5IBXA 2EG7A 3RX2A 1KGWA 3BURA 1GVSA 3CS2A 2Y6ZA 3IGXA 2VC5A 3SO7A 4H9UA 4N6EA 3F4WA 1W3KA 2E5CA 1M01A 4GIAA 3NZQA 3QPYA 1JDEA 5I3KA 4Q7IA 3H4XA 1YXCA 1C8YA 3OHMB 1W5NA 5DEZA 4JOMA 4JTUA 1DHKA 1K6AA 3ZJ7A 2QPXA 4MIMA 5HWMA 5DX7A 1ITCA 3B03A 1K9FA 2RH9A 1R3RA 4ZQOA 3OGRA 2Z26A 4JYFA 3R10A 5REQB 4GC4A 3TZNA 2YSWA 1AJ2A 4K8GA 2NV1A 3PP7A 2YKKA 1JYNA 3K1GA 1OFDA 5EMYA 3G1HA 2XGBA 1UH2A 2OMAA 2WO5A 2XG9A 2Y0FA 5CZ0A 4IISA 1W1ZA 2O55A 2CLFA 3P82A 1L0PA 3KP1A 2G8ZA 2DT2A 3BXWA 1TPWA 2VC6A 1E6RA 3W2JA 1S2AA 2CPUA 5LXXA 1I2RA 2JF7A 4PTXA 4JQ4A 2GDQA 3H2OA 4OTKA 2UBPC 3LRMA 1KFJA 3G1YA 2PU0A 1VJSA 1QK2A 1X97A 3IUHA 1IIHA 1XYZA 1EIBA 1ZB5A 3CC1A 2XN0A 5BZAA 4NT0A 3OLIA 4NVTA 1PSCA 3BVJA 3OVPA 1U1JA 4ACZA 5CH9A 2PWHA 3W87A 3W28A 4EOUA 5T8GA 1UD4A 1K8CA 2WNZA 4YU1A 4H8UA 4KMQA 3NQEA 1UUMA 2PDMA 3W1AA 1DJHA 4GNVA 4QLKA 3SURA 1VS1A 1GOXA 1M7XA 3SCSA 4S3AA 4Z1CA 4HJWA 1MW3A 1GWJA 3MHUA 4BQ4A 1TZ7A 2AQVA 3AC0A 3AXIA 1HJSA 1KO0A 2ZX8A 1MNSA 2PWVA 4PRRA 4XSLA 4OJYA 4XB3A 3ABSA 3NYDA 4QLLA 3UG8A 1R6WA 4GX8A 3FSUA 2YL8A 2J7FA 4JFTA 5BOOA 2FZDA 2G41A 2WBGA 3HMCA 3OGVA 4R7OA 1HFBA 3VGGA 3C2VA 4GYPC 2HCVA 1RALA 1W3JA 4AX7A 2FGBA 3ZJ6A 1I2OA 2Q8ZA 3E5PA 4KESA 3RRAA 4X2RA 5C5YA 4LC8A 5CBJA 4TMBA 1XLKA 3P67A 4UQCA 4IHCA 3ATZA 4MUPA 3MZNA 1LCOA 1V6TA 5HJLA 1LG2A 2J13A 2GQ3A 1OY0A 3OBKA 2YFOA 3A4XA 3CHFA 3DYMA 3NIYA 1YBQA 5A6AA 1ME7A 2CNCA 1W1YA 4ZR8A 4GI6A 5I6SA 3W37A 2GDVA 4W8AA 4DLMA 3DECA 4YNGA 2HPIA 4M6QA 2X2GA 4MOZA 3MHFA 4Y9MA 1J9YA 2I14A 5AYYA 2DZAA 4C5ZA 3OYZA 1PB0A 3KRBA 1A0EA 3UJEA 1TMHA 1KFWA 3IANA 5FEZA 3V16A 1N82A 2WXDM 1ZAHA 4QDMA 5LIXX 2RDTA 2RAGA 3NQVA 4HU8A 2VD8A 1R3SA 5HNUA 1JQXA 2QDDA 3GIYA 1D7KA 2Z1KA 4E2OA 2OG9A 1KD0A 4JR5A 2ZA1A 3NA8A 1GVYA 4Y9AA 4ZO6A 2VEIA 1EH9A 2WNWA 4IPJA 3ZZ1A 3V75A 2QJHA 1PIIA 4BA0A 5FD0A 2POZA 4IJRA 5D37A 4GX9A 1JCNA 5FCZA 1S2UA 2VFEA 1C91A 1VJIA 1BF2A 1Y0EA 4XIAA 3W4RA 3DGBA 1YDOA 3L0NA 3KE0A 5A6SA 4XAYA 2BVYA 3UP8A 1SZEA 4TV5A 1Q65A 2BXVA 3CBWA 3LD5A 3LSCA 1TR1A 1GUVA 2YCLA 3P93A 3BDKA 3AIWA 4KWVA 4IUOA 1XG4A 2EG6A 4GI8A 3LV5A 1AD1A 4EVZA 4C6KA 1XIDA 4XUYA 3SCTA 4WQ6A 2TSYA 5I7GA 1RCQA 6CGTA 4UFHA 1GTEA 4HNTA 4AUBA 4IQDA 1A3HA 1DQWA 1PVNA 3GG7A 3TA9A 1CECA 3KVJA 3H7UA 2J8GA 5EBAA 2C7FA 1UKTA 3N9KA 2Y88A 4RDYA 4NF7A 3VIOA 3SRFA 3GM8A 3NL3A 3PWAA 1JDAA 3WQFA 2G0WA 4DAIA 2CBVA 5CG7A 1JPIA 2FGZA 1X8FA 3MWCA 4MSSA 3W7PA 4GI4A 3L12A 2BASA 4A3UA 5M17A 3IIVA 2TAAA 4LTSA 3MA8A 3USZA 4YTSA 3I3EA 1UWAA 3GIPA 1RH9A 1G69A 4Z2KA 5M5DA 1EX1A 3WBXA 2Y7DA 1RBAA 2AAMA 2WCAA 3ALFA 2JALA 3GHSA 5E6YA 1LOQA 3DCPA 3G6MA 2D69A 3QPZA 5CCZA 1PTDA 1NARA 4XD6A 4LAZA 4BHYA 5A2CA 3I7QA 5CLTA 3FNDA 2VHLA 2AL2B 3H24A 2ZQ0A 3ZT5A 1ZGDA 5D30A 5JBFA 1A3XA 1IE7C 3UA4A 1WB0A 3I6EA 3PBWA 2I9UA 4BF7A 2XGZA 1KM2A 4PMXA 4Q4KA 4ZQNA 3BOFA 4MLRA 4O1CA 2VVSA 3CO4A 3EPNA 4N4PA 4G7EA 3L4VA 3N3TA 2BOFX 4LXFA 3B0PA 1GJWA 2GJXA 3QSTA 3S46A 2JE8A 4AD5A 2OXNA 2ACUA 3PS7A 1DTUA 4I6KA 4EXAA 3JZEA 3LTPA 2E3ZA 3KWXA 4LCQA 1I2NA 4HCDA 7ODCA 2CESA 1Q4WA 2FDMA 2E6AA 3PK7A 3HGSA 4AD0A 3L4ZA 3REQB 5AHIA 5D8WA 2C19A 3KEHA 3KRUA 4PMQA 2WPBA 3PBMA 4KGJA 4LX4A 3LEPA 4GUFA 1CEOA 1HX0A 3CQKA 3CLMA 2FFIA 4QSFA 5FIPA 2WVTA 3MKVA 4M1RA 1XISA 4IG2B 3MMWA 2OLHA 3MUZ1 3QOMA 1DE6A 1H4PA 1PTAA 3AYSA 4XTDA 3RPTA 2XPKA 4IJCA 1I1WA 3KM8A 2WC7A 3QQWA 2XH2A 1F8IA 3W7JA 5DELA 2FVLA 4UTWC 1I9CB 2WHKA 3AXHA 6PTDA 2P3ZA 3WCZA 3NEVA 1G7VA 3OZYA 4ZXOA 5A6BD 2HDJA 4XBKA 1W3IA 1SGJA 3FY1A 4YXGA 2V68A 3AYRA 4O28A 1MMFA 4C6EA 1EF2A 1RUSA 4GKTA 1YDNA 2BGNE 1Q7QA 2OGYA 2O9OA 3DHPA 2YZRA 2WZMA 5PTDA 1EKOA 3NZGA 1L8NA 2XVNA 2YDSA 3QHOA 3EOSA 3WFAA 1OFOA 1FP9A 3AUOA 4NZ5A 3VD7A 1LBFA 4GQGA 3V18A 3NZ1A 1CIUA 3TNBA 3T2QA 1GONA 1UOZA 1KM1A 4BKNA 1D3CA 4L1GA 1XSKA 1C8QA 3O63A 3NPVA 4X63A 3EDJA 3E0IA 3SM0A 1F6PA 1XLBA 4QG6A 3AXXA 2PDFA 2DH3A 3QVQA 2E5BA 2DUZA 2OU4A 3OJGA 5AHLA 3M9YA 3TXVA 1M03A 1FWSA 3GR8A 4YTQA 3C86A 4F0KA 4MADA 1PL9A 1TPH1 3VM5A 2WQDA 4XWUA 4LVAA 1XHGA 2A79A 4R9XA 4IMAA 5I2UA 3ZVHA 4Z1DA 6ALDA 1T99A 1D9EA 4KEUA 2TPSA 3H6OA 3B8DA 3UPBA 3QR1A 1XBYA 3CEUA 4LH8A 5HNNA 3O2LA 2PP3A 3EX3A 3P8JA 3THDA 1VFUA 5L9FA 3FIGA 1SO6A 4AG0A 1TUXA 2J7CA 5FSEC 2OJPA 3OLGA 2ZXQA 1IGSA 2PB1A 5E5CA 3WBWA 2WAGA 2ZZ5A 1JZ7A 3VDCA 3LBMA 2DVXA 4CEUC 2XFWA 3HQPA 3NL5A 4LJ3A 5L6UA 3W6LA 2J62A 3NSNA 1H60A 2PTZA 4IGMA 3VD5A 2IXUA 4C1NB 1R9YA 1W1PA 3O1NA 3L2MA 4MVAA 1V0MA 2E09A 3CO8A 1VPXA 3EWUA 3V35A 3QV9A 3ARZA 4HQVA 1I2QA 5C9WA 4S39A 4RNHA 3TK7A 2VZSA 3AXMA 5IFPA 2H9AB 1V79A 1QNOA 2B31A 4E2DA 1E9IA 5CZJA 5CBIA 4BJHA 3C2FA 4AZIA 5JH2A 2WMGA 2Y5EA 5EMLA 4LBSA 2FZ9A 1DBTA 3LDVA 1K70A 3U5YA 1QI3A 3F03K 3K8LA 4I5RA 1C9WA 2X2YA 1VRXA 5LA0A 4RL3A 3SUSA 2YX0A 4JGDA 5HQMA 4GUIA 2OX1A 1F2JA 5MF5A 3UWQA 1JR1A 2GVJA 2EPOA 2Q6ZA 1UZHA 3G2GA 1BWLA 1Z7AA 4YCOA 4Q8NA 1Q85A 2H8ZA 1V03A 2C1GA 4O50A 3VPLA 5A8PA 1WDWA 2VQTA 3GBDA 2ZBTA 4MY1A 4LYRA 1H5VA 1F5ZA 3UR8A 3PTKA 4LGXA 2FZNA 3BCDA 2CC0A 3AS1A 3KDOA 4MJMA 3CUGA 3DFSA 5IFTA 4NRRA 1TA3B 1R5YA 2CCRA 1WE5A 2JIEA 2OFJA 3LU2A 3W88A 1ZENA 1HVXA 3VMNA 2XWDA 1IXQA 5D9PA 2E1WA 1Z6KA 2CHOA 1UD6A 1VKFA 3CXOA 5CJ5A 1GHRA 1VHCA 1J0IA 4IX2A 3WJWA 4AH7A 2YA2A 1XC4A 2QVNA 4CCCA 4E0CA 3BARA 5D9OA 1S38A 2QR6A 4NKCA 4F79A 2B7OA 4ZL1A 3MMUA 4NXSA 2A7PA 3QXBA 5F4SA 4H8NA 1XYLA 3Q45A 4KKXA 3S8HA 3NFUA 2ZFAA 3BW3A 1O5QA 4OFCA 4ACYA 3FLUA 2DZSA 1X6LA 5BRPA 2WJZA 4E8GA 4LCSA 1PCWA 2YYUA 1HIZA 1V02A 2Y7GA 1NWTA 2HTMA 4MJZA 3K4AA 3UWYA 2DZXA 1XGZA 4GK8A 2NQZA 1VFOA 1S5MA 2P8CA 3MU7A 3N14A 4N9CA 4FF5A 3OEXA 1AG1O 1OADA 5BW6A 1RPKA 3M0IA 4OHQA 3U5UA 4YIWA 3THUA 1PS9A 3W27A 1MXGA 3WNOA 1GQNA 4PMZA 1MRQA 4H8VA 4AEOA 3RX3A 5BXTA 2IPGA 4JZ5A 4RZ6A 3H53A 4WKHA 1RA5A 2HXTA 2CZDA 3DXIA 2I5QA 4GJIA 3TYUA 1TPUA 4TVCA 4M1BA 2PTYA 4FLQA 1BLIA 3E3HA 4J4KA 4XTIA 2R1LA 3O6CA 2FTYA 3VZXA 4Q8MA 1E5JA 4HU4A 1PJ9A 1HKKA 3OLDA 1IT8A 2VTFA 4LV9A 1LWJA 4UTTA 4HA0A 1VLWA 5HPCA 1ZU8A 1P0KA 2YB1A 3UU0A 4EPBC 2PEVA 2HJPA 1Y7VA 3MP4A 1EA0A 5HDRA 1YLVA 2G5WA 1PKMA 1WOBA 2D3NA 1XQKA 4J5NA 1FWIC 3N29A 2DDXA 3WENA 2ZX7A 3N6JA 3VO0A 3G6LA 2JQXA 5G1YA 4V2XA 1H1YA 2XM1A 3PNUA 2WZHA 4B16A 3UWUA 2Y8UA 1ZBKA 1KLZA 4GWEA 3PULA 4P8UA 4LUYA 4DXVA 3M0MA 4EF9A 3T08A 3E5BA 7TIMA 3WQPA 4AIBA 2AMXA 1BXBA 1KQYA 3U3HA 3C8FA 4RNFA 1EBHA 1RXOB 3F5KA 4CLMA 3KL3A 1XLAA 3SUUA 2OLAA 4JTRA 4JTDA 2J27A 3KVKA 1A5AA 1WXJA 3M5YA 4XZWA 1E0WA 1OC6A 1D2KA 1SFSA 3B8IA 5EMUA 1DIEA 3A3WA 2OYKA 1XIHA 3S5SA 4ONVA 1GOOA 1IWBA 1GJPA 4IL0A 5I78A 2CKSA 4QR6A 2A21A 3HG4A 1NP2A 3FSTA 1E0UA 2WKGA 4L64A 1Q8JA 3O05A 3F7JA 4AWUA 4IUGA 3KOFA 1AW1A 4A2SA 2PU1A 1FA2A 4RV8A 1E1EA 4C6BA 3CAKA 4CNOA 3AJ7A 4KWOA 3C0SA 5DRIA 4JTJA 2GUUA 4PTMA 3PTDA 4Z2IA 3CUIA 4E6MA 1LYXA 3RPDA 3BLEA 4UXDA 3NYZA 4G5DA 1OC5A 2PF8A 4K3ZA 1XYCA 3MYOA 2I17A 2PMQA 2QW5A 5FJRA 5A5WA 2W5FA 1CLVA 2VFDA 3VZYA 4FALA 3A4JA 1ISWA 1FDJA 1UZDA 3UJSA 3AIVA 4JICA 1FDZA 2W3ZA 4QJ1A 4DZAA 2Y8VA 3SIZA 3PTQA 2W4XA 5CJMA 4WXZA 3LTYA 5C70A 3WDIA 3FGCA 1XLCA 3IK2A 2VL4A 4W9TA 1EEPA 2AKMA 3LGEA 5HJXA 2P88A 2FMNA 3QJAA 1A49A 3IRSA 2G4JA 3HFYA 4ADUA 3OQ8A 3L9CA 4V1YA 3VNIA 4AXNA 4EXQA 1XRSA 1V0LA 3BLLA 2Y4SA 3CAWA 1TSIA 3ANVA 2YCLB 1HKJA 2O4MA 2VI0A 3IAPA 3S5OA 3EX4A 2QYGA 3UG5A 3BSGA 4DUXA 1P0EA 2HVOA 4BWLA 4ROQA 1E15A 4D6JA 1PV8A 3UVIA 1OFQA 1JCLA 3UD6A 4O10A 3HOJA 2NX3A 3R8RA 3VIGA 2PS2A 2Z00A 1AUSL 1JJKA 4QDPA 4C6IA 4ZB0A 1XI3A 3U57A 5KMYA 4B5UA 4H6RA 2J78A 1CLXA 4DHGA 2CXGA 3IWPA 1FWTA 1F3TA 4UTFA 3H55A 2F38A 1DJZA 5TNVA 2OB3A 4UZSA 4YWIA 3FA3A 4JCMA 1QHPA 4AFYA 5B80A 4HHPA 3CQ0A 4DX3A 3N04A 4FXFA 2PC4A 2JEQA 2PZ0A 1U30A 4MYXA 2WZEA 2VT0A 1M9HA 2XDFA 1I4NA 4HYVA 2HE5A 3PJTA 4W7VA 3OW1A 2A1YA 1OZMA 4RZ5A 1RQEA 3SR7A 1UD3A 4C6MA 1K03A 1GNXA 4M56A 1BVZA 3TAKA 2PA6A 4JTHA 1OB0A 4Y8EA 1LORA 1VH7A 5E09A 3VOIA 4R34A 2Z25A 3UJRA 1JGIA 2PDCA 4JTSA 3EDEA 2Z7KA 3W01A 3VDBA 5LNVA 1PIGA 2JBMA 3BZGA 4H9XA 3QQ0A 3VIFA 1FKWA 3P3BA 1YE4A 1F76A 3L5MA 7REQB 3H70A 1R47A 2GVLA 1EP1A 1PE1A 4US5D 3BJSA 1B3ZA 3CB8A 1QW9A 3KBJA 2PGRA 4WIWA 1FFQA 3RLUA 1H7NA 4W5ZA 2DZBA 1J0YA 5AC8A 2WCSA 3U8GA 4G6CA 5K7JA 3MVIA 4POCA 1FWNA 3KOWA 4MB4A 4YWSA 3NSMA 2WHMA 2Z1BA 3A22A 5A8NA 4ICNA 4KPLA 1S5NA 1R87A 1XCWA 1J5TA 3GXDA 2NX1A 4O4WA 5D32A 1L6FA 1ODUA 5LA2A 1B3VA 2ZTKA 4XO6A 1BYBA 2QJIA 3N73A 5D2XA 3E96A 4L4MA 4LUSB 3VK5A 2QCLA 1THFD 1YRRA 1FTXA 5I07A 1DP0A 4UFIA 3U2CA 3E12A 3W1RA 3O07A 2ISDA 1NM9A 4PCFA 3CB3A 3VE9A 4ICMA 3DFTA 3CL7A 3ZIZA 4UMBA 1SZNA 2V2DA 3G1DA 5F4WA 3Q37A 3PG9A 3M5VA 1UKQA 1MUMA 1OFEA 1HO4A 3I3DA 3N9SA 4QXIA 1FWDC 3EEGA 1EP3A 2ZUVA 5GJPA 5IRPA 1BVWA 5FACA 4CU7A 4GIEA 5HINA 3CPRA 1F3WA 2UY2A 4X0NA 3LN3A 3WMLA 5DLCA 3EOUA 2ZVRA 4XZLX 4LB3A 3GS6A 2P76A 2PDJA 3H2CA 5A1AA 2GSEA 1OFPA 3H23A 3ARUA 1BVNP 3AALA 5XINA 5AYZA 3WF4A 2QDGA 4QEHA 4PA8A 4JY8A 1W9DM 1OD8A 1XLIA 4LYKA 4MKVA 3OBAA 1FHDA 5CAKA 1PXGA 1XSIA 1SW0A 3QKZA 4DYKA 3FOKA 2YIHA 1R3VA 1UD5A 2HRWA 3U2EA 2PLMA 4MB1A 2RGLA 1WKYA 1PTGA 1TPFA 2GGEA 4FLRA 2PLCA 3KDNA 3K2GA 3LUTA 1T40A 1JPKA 1B0IA 4NJIA 1H1ZA 1YEYA 4YPJA 2WVVB 5AVNA 4LUIA 4M6PA 4HOZA 1WZLA 1Z32X 2ZKMX 3OA5A 4LVGA 3NQ8A 2J9XA 4WHBA 3AOFA 1LZOA 4I7WA 1GVFA 4ZB5A 1XDJA 2XN1A 4A35A 4DPQA 1J0HA 2ESCA 4R85A 4DELA 1EQPA 4IP7A 3M47A 1DYSA 3QV6A 5HWNA 1EGVA 1TJ1A 2ON3A 2QEZA 3N9RA 1H3GA 4Q8OA 4AY1A 1LROA 4S1FA 4JL1A 5JIWA 4ZGYA 1HT6A 1IHIA 2J7EA 1M65A 3P8IA 3QFWA 2QGHA 2BY2A 4CD7A 5I3JA 4QBXA 2OGJA 4QSHA 1P1XA 3QYQA 4D6CA 4IMCA 2YB4A 5I0DA 2G3JA 1I2PA 1ONRA 1J8VA 3OVQA 4LCRA 3UYIA 2Q71A 4XIMA 4JEJA 5GNXA 4HSNA 4JDBA 4C7FA 2O0TA 1C29A 4EPKA 3XINA 1W5QA 4GBDA 1KM5A 4WK9A 3KS5A 3VXGA 3EA1A 2XIJA 3M0LA 3ME3A 3ARXA 3THCA 2FPVA 3V5CA 3EB4A 2XU2A 4M7SA 5TD4A 3MI2A 4EX4A 2WMHA 5HA7A 1OT2A 3UR5A 5EKYA 1XH2A 3DFHA 3P2VA 1QOXA 4NNAA 3BTNA 4Q8WA 3GU2A 3PUDA 4W8LA 3W38A 4QCFA 3QMRA 3ABRA 1R2TA 2DT3A 3USBA 1XLLA 3N2MA 4NJHA 2Y70A 3PTMA 1XRTA 4AY7A 2HQAA 1Q6OA 1PO9A 1TV5A 2AMGA 3PR2A 3W2NA 5H6HA 3F4NA 4H9TA 1XIMA 4F8XA 4TQTA 2WOQA 3EKLA 4B91A 3GTIA 1OSEA 4MWAE 3DFPA 4O57A 1E0VA 2VC7A 3NDYA 4AZGA 1QRQA 2W91A 1WP6A 4RNIA 2BB0A 4H19A 4KW2A 1HGWA 3SADA 3R2GA 4KWSA 1K4GA 1UC5A 2DZPA 4DBDA 1ZP4A 4HZ6A 5G4WA 1TPVA 4PCPA 1WAUA 2ZXAA 2BVTA 4A8IA 2XTKA 3N4FA 1TVNA 5C7VA 2Q8LA 3NQ2A 3CUZA 3UW6A 1ODZA 1X1NA 3B8UA 3CZGA 1E6ZA 1E1FA 3GXIA 3QHNA 3I4KA 1ZTVA 1K7EA 4KFPA 2Y7EA 3BQ5A 4ICCX 3O15A 1OYCA 2DP3A 1LT7A 1V6YA 1QI0A 2BVWA 4TX6A 3UA3A 3THAA 5T26A 1R9XA 1T8XA 1JYXA 2QUUA 1O66A 3AISA 4M80A 2PRLA 4MDPA 3GD6A 5JIPA 2CHRA 2YCKX 1TQJA 5G2HA 4XKYB 3FKKA 1B90A 1AVAA 1BTMA 3DDMA 4AZHA 1K9EA 6REQB 2PWGA 3BG5A 1BQCA 2CETA 3AIBA 4QJ4B 2X1RA 1L6GA 3RCMA 2BHZA 3WD2A 4W87A 3BOLA 4AZBA 3VFLA 3S42A 3CK5A 3UPMA 4QHRA 1V51A 3LXCA 1SU5A 3HM7A 3AS0A 1UHVA 5I3DA 4C5YA 3W07A 3FVMA 1QAPA 5TBOA 3TLLA 3BW2A 4JTFA 2HSAA 3PUGA 1S3HA 3Q94A 3GFXA 2VC9A 2P53A 4WY0A 1KR1A 2Z1SA 4KGLA 3W6MA 3ICJA 3VM7A 3GNOA 4WOZA 1LG1A 1O60A 2RUSA 1FVPA 3R12A 4HVXA 3WLQA 1ECQA 4AMAA 3LPGA 4Z2JA 5JU6A 4DAFA 4W89A 3WQWA 4K38A 4W8BA 1N55A 1M6JA 1E4MM 4PEKA 4NI8A 4UQAA 4GXMA 1UA7A 3ELFA 2VFFA 5D9MA 1W5OA 4HBKA 1MDRA 4DWSB 3CH9A 1QATA 5E9AA 2VQUA 1N8WA 3A47A 2GWNA 2VRJA 1MUCA 4D6EA 1VIWA 3BSMA 4E4UA 4XK2A 3PVFA 4F3HA 2BWGA 2VEKA 1VQTA 1BWKA 5RUBA 1IIGA 2A0NA 4KEMA 2IKIA 2VELA 3C5QA 3P5YA 2WB5A 4FLOA 3F2CA 4PB5A 2V0TA 2E1DA 3DC8A 3TYZA 4HD5A 3ZFHA 1UASA 1XQLA 3P7YA 1OQFA 4KF1A 4LS2A 3NL6A 5FL1A 3N17A 4D6FA 2DZTA 1XYFA 2GJNA 1REQA 2FTPA 3P81A 4ES4A 1TCDA 4AHPA 4XX6A 1PKLA 4J3TA 2EKGA 1LUCB 4AF0A 2CKRA 3L68A 1OG6A 3CJPA 1TRIA 3NQ6A 2XSBA 4JX5A 3UCCA 1AJ0A 1OX6A 4A21A 4H83A 3PNZA 1UR1A 1VENA 5A94A 2VJXA 4FX8A 3URNA 4WXYA 1NSJA 1XXXA 4QQ3A 1BXNA 3W72A 2IS7A 1Q7MA 2DQXA 3PZMA 4JIHA 2PDUA 4Y2WA 3RO8A 2XH4A 3SCUA 1A47A 4GIYA 2PDXA 2Z1VA 1MXDA 1F9CA 2FPYA 3TW7A 4IMGA 2BP1A 3KL0A 3GDKA 4I9TA 4YLWA 4Z17A 1WBJA 4HNCA 1QPNA 1R30A 1S46A 4D6DA 2YCIX 3LCXA 5LKYA 4HPGA 2YBVA 5BOFA 2OLSA 3W84A 4B5WA 4GHRA 4MMWA 1POJA 4S3CA 3IPWA 2G96A 2BY0A 3S2CA 3GTHA 1W1TA 1FH8A 5LYRA 1H62A 1KBIA 4TMCA 3UYCA 2VNCA 2WV8A 2ABAA 2Q8XA 2R94A 3M0KA 5G4EA 1ISZA 4EE9A 1O68A 3RLHA 1OG0A 1W6TA 3U4FA 1C92A 3UXIA 4A6GA 3KBNA 5CPOA 3MO7A 2XIMA 4P7NA 2CYGA 1LLZA 3VFCA 2XHYA 4FX6M 3PUEA 3WEOA 2CLIA 4MNMA 4HA3A 5I24A 4N6FA 3DBPA 1GOMA 3S9IA 2E7FA 2EJ1A 3OLEA 3TTYA 4M24A 1VF8A 3DBNA 3GQYA 3EWBX 1M53A 1QNQA 2MANA 5I09A 1H7OA 4H2HA 5C8BB 4D6IA 1X7IA 1CLKA 3GVRA 5CC6A 2D0GA 2HWGA 4HU0A 3A9BA 4LAOA 3MYPA 2NVCA 3FX4A 3N2CA 1X39A 1CCWB 1SMAA 4HK6A 1Z69A 4KETA 3S3GA 1JF6A 3STCA 2EHHA 2ZVIA 4PL2A 1ZL1A 4BWLC 4YTTA 4NZCA 4Z0SA 2C71A 1ME8A 1EWEA 5I00A 4K7YA 3TC3A 2OELA 2H8XA 1ISXA 2QVHA 1L6WA 3KTSA 3EDFA 3ABXA 1A3WA 2F9RA 3NQFA 4LRTA 1W9PA 1OCBA 3UGRA 2QDEA 1WDRA 1R8LA 3IGHX 1DIDA 4NX5A 3S9YA 1DWGM 2OX4A 3GYCA 1V7YA 7CGTA 3NQ7A 5CGTA 3PWIA 5KZDA 3TN6A 3GHUA 3PPCA 5BWAA 1JZ8A 1GKPA 3FS2A 1YNYA 4ZCWA 5XIAA 2V5BA 3UGVA 3VKJA 1UJQA 3DU0A 5CGMA 3H2NA 4XZMX 4DZ5A 6XIAA 4YYFA 4MFEA 3NQGA 1UH4A 3CMGA 4TU1A 1CI1A 5AN7A 1UZ4A 3DG6A 3IS4A 3CWNA 1V08A 2ISWA 4KFOA 3S2NA 1GG0A 4OGZA 1PX3A 3W7DA 1XLGA 1U1UA 4WDXA 1NQKA 1ZJIA 4H8HA 3CIXA 1VRDA 3VTRA 3QV8A 2D22A 4OOUA 3LHVA 4LQ1A 2C1HA 3IVTA 3BLOA 3G1VA 1E0TA 1RHCA 1H49A 2O92A 3QY7A 4CQ9A 4PSPA 3W7QA 3UZWA 3NCOA 1QU4A 5C2XA 4LY8A 3R6IA 3UEQA 4ENLA 2OCZA 1SO3A 3BSHA 4S3DA 4GG9A 1Q45A 4NG3A 4PMDA 4WVXA 3OIHA 5FAGA 1H09A 3C56A 3HG2A 4JIRA 3K46A 3VKBA 1P7TA 1JQVA 4GYPA 3B05A 4Y9OA 2OZTA 2XWEA 4NU7A 1P6BA 3G0UA 3Q58A 3L0KA 4D2JA 3D47A 3KHDA 4HOXA 3ES7A 2QCFA 1PZ0A 1LM1A 3MUXA 4LNYA 2VO5A 3WLJA 1IF2A 3H2MA 3MJYA 1ZCCA 3QMTA 1WZKA 2CLKA 4KIRA 3PZGA 3OO2A 3PM6A 4I90A 5HANA 5A6BA 3UR2A 3XIMA 2E67A 3WLPA 2D2JA 3W1PA 4UFKA 2Y89A 5C9XA 1Q7ZA 5XIMA 3T4WA 3NO3A 1X96A 3LI1A 4AVNA 1XIBA 2GSJA 2VCAA 4XQ6A 3N2OA 4QAIA 3SFKA 4AZ7A 4HMCA 2HMCA 3WF0A 3AZRA 5FI8A 1JF5A 2Z29A 3V4BA 3LS9A 1QBBA 5FJUA 4C7DA 3RCYA 1TV3A 1TJRA 3VC6A 1WXZA 2DVUA 4L6DA 2EAWA 2X40A 1GCYA 2RFGA 4ZBCA 3TQPA 1J79A 4AC1X 3E49A 3UQNA 5AVHA 3F2BA 2X41A 1VFHA 3CIVA 4F9DA 1ZCOA 3RX4A 3LGGA 2VGIA 1GQKA 4QFUA 3PZUA 1EJSC 3PN8A 4LYQA 2I9EA 2HS6A 1I0DA 2J8FA 4LSBA 4KS0A 2PBOA 3UCDA 3B8SA 2YJQA 3MW7A 1A4LA 1G7UA 2J24A 4RE2A 3TJXA 3PZQA 2C8NA 3C6CA 2A7NA 5D38A 1BSLA 5AYIA 1JDCA 4L80A 1GQIA 4JHMA 2PRMA 4DF1A 1OYAA 4PRTA 3RDKA 1R38A 4IIDA 5M1TA 4MAZA 3WMCA 3O6DA 5BMWA 2VD9A 4JKMA 1DJYA 4A3YA 1GVEA 4GD0A 4OKDA 3TC6A 2E9LA 1RY0A 1GYLA 3T9PA 1G01A 3IJQA 3EWCA 1VR6A 2RJHA 4PBFA 1L6SA 5LHFA 4XD3A 3BWWA 3V1PA 1A5UA 1QPRA 1V3HA 2BGSA 1UH3A 1V0KA 3M0ZA 4JHZA 4IPLA 2MNRA 4YYCA 2GJPA 5BCAA 4PE8A 3EX1A 1E56A 3CLWA 4Z0JA 4F2BA 2ZRWA 2WSYA 2Y63A 2ZE0A 1SPQA 8CGTA 4MLJA 5FJPA 2E25A 4JX6A 4UTUA 3AMLA 4B5XA 1H51A 3UR7A 2GVEA 2GVYA 5JXQA 1O1ZA 3W1MA 4NUWA 3O16A 3STPA 1XW8A 3W24A 4H7ZA 2BV9A 3DFNA 3NEHA 2CZ5A 1PX8A 4X0VA 1KTNA 2A3CA 1XINA 1JPDX 2FDSA 4X60A 2QMKA 1GT8A 2ONEA 4CEXC 2QPUA 3VGBA 3QTGA 4QE1A 4C91A 1UWQA 4JKLA 1KFKA 1MQRA 4H6EA 3DIPA 4M8UA 1C90A 4ZODA 1KNWA 3CUHA 5DY2A 2PTDA 2QHAA 2PODA 4AEFA 1AQFA 1BKHA 3WNLA 3MS8A 4AU0A 5DMMA 3OA3A 4Y8FA 4X61A 4D8AA 1I60A 4B5NA 4FOKA 5TF0A 1FWHC 1EF3A 1HJWA 4C6CA 2PWEA 2WSKA 4B15A 1XKYA 1TZ9A 3B0XA 3THQA 3DI0A 3UESA 2FH6A 4KERA 2R1NA 4LBRA 3O0FA 3VKKA 1B3OA 5AC7A 4QITA 1FWCC 2G37A 4TV6A 4DO6A 5LHEA 3DYOA 4PMUA 3HMJG 3CV7A 4HZMA 1K8YA 2CBJA 3E2QA 1JUKA 4JFSA 2JEPA 1YE6A 2QDHA 5A69A 4QQUA 3BICA 4UFMA 4DYJA 5BRQA 3T2PA 1SO4A 1AL7A 3BAYA 1US0A 3S47A 1E3ZA 3VOHA 3E9AA 2AOSA 1HGYA 4ROPA 4DY1A 1RK5A 3TR9A 1ZQ5A 4N2YA 3S1XA 3M64A 1CT5A 4K8HA 4MPQA 3AHXA 3BAXA 3A21A 1CXEA 4GCXA 3RJYA 2GDUA 2GZXA 1OK4A 3IAQA 3SN4A 1JULA 1HJQA 3VKDA 1SFJA 4O0QA 4E2VA 3DFQA 2VWSA 1DV7A 4K36A 2PDWA 4E38A 4DI9A 4P61A 5HAOA 1ICQA 4D1JA 1YMYA 4MAVA 3ARYA 2PDKA 1O5KA 3KX6A 4PR4A 1RVKA 1X6NA 2OTDA 1IGWA 4UBPC 4GA8A 1P4CA 5EMJA 5BROA 1CX9A 3C2RA 2XVPA 3LXAA 3A6OA 4LUTA 3V36A 1YHTA 2R8WA 3WL1A 1PAMA 1XPGA 3NOEA 1UP3A 1IV8A 2IKHA 3ITLA 1M68A 1JFXA 1BHGA 1V93A 3ZJ8A 4IP4A 4WY0B 2A85A 3T55A 3NQAA 3MC5A 3O0KA 4U5KA 1TV4A 9XIMA 1ZAJA 5K2ZA 1R3QA 3NQMA 1TMQA 1UWSA 3I6RA 3VGEA 2PLKA 2V30A 1M3UA 5MHBA 5CPQA 3W74A 5I3IA 4GABA 1QK0A 2LLEA 4CUCA 1QVBA 1VCGA 2BDQA 5HUPA 2XUCA 2BNJA 1KBLA 1AQMA 2WSPA 1YIXA 5DT7A 2E5DA 4O52A 2H6RA 4IFOA 3GG8A 4HNVA 1CGXA 7A3HA 4WX2A 4TVDA 2EG8A 2GSHA 3W7LA 3W7RA 3P60A 3L65A 5HXMA 2CU0A 1E6QM 4A3RA 1VBHA 1NWUA 4IMFA 1CB2A 1UJPA 1KCLA 1M1BA 2YL9A 5ABGA 3WBAA 5E0KA 2Z28A 1W2VA 3KW3A 2ZX9A 4OT7A 4KRTA 1KRMA 4HNLA 1PZ2A 2ZX5A 1QPQA 3W6YA 1X6UA 4US6A 3I4EA 4C6PA 4H9MA 1JCJA 1JCXA 4XUGA 2Q01A 3PJWA 3UJ2A 3QC3A 3GC4A 4H9ZA 4B90A 2QNEA 4N42A 2OQLA 4O15A 3T05A 2BX7A 4AF0B 3FAXA 4LF1A 4C6JA 5F4XA 3TR2A 2V8ZA 3STEA 3UZ5A 3M0VA 4AEEA 5LA1A 4I8DA 3O6AA 2QCCA 1A50A 3IJ7A 4LALA 4S23A 3GO2A 5HR6A 2Y24A 1EHNA 4DN1A 4FXRA 5T91A 1VYRA 2J7BA 4P7LA 1FXPA 3VX0A 4WUIA 1TELA 1ICSA 2QF8A 3H21A 4PEEA 2NSOA 4H04A 4L61A 1J0JA 1KLYA 3GTFA 3G1FA 3UXKA 3CAVA 1TRDA 5CEWA 3W83A 1BQGA 4Y6GA 3VKAA 1FWFC 2ZZ6A 3HFTA 3W9ZA 4B3KA 4EP8C 3M0YA 1O1HA 3BH4A 1DQUA 2WW5A 3QW3A 1KBBA 3H7RA 2CLOA 3QFEA 3GTXA 3HPZA 2XISA 2WLZA 2XVGA 1RLCL 1A5SA 3EX2A 2FKPA 4DLFA 4HSHA 1FWAC 1ONEA 1XLFA 3IJ9A 1NDZA 4DXKA 4W5UA 5BXPA 2E77A 1SM9A 4QROA 1O4UA 3U6WA 2WKJA 1Y5XA 3EPMA 4DJFC 4C7GA 1R7AA 4HJFA 1VD6A 2FGLA 2INZA 4ADSA 1J93A 1U83A 4WSKA 3HGOA 1CXFA 1NFPA 3P0WA 3OBEA 3SY1A 3R5EA 1I8JA 1MNZA 4UQBA 3RN6A 3K8MA 3LCHA 2IPJA 2GK1A 3MUAA 3CHDA 2NXIA 2BVDA 2WMFA 3DKLA 1S5TA 3PZOA 1EB3A 4GGHA 1DIKA 4CU6A 4IFKA 1ADSA 1VIZA 1P5BA 4AZ5A 2OODA 3CWOX 3APGA 4UNKA 2WMIB 1Z9AA 1HL8A 4AAJA 3BLFA 3KTXA 4H3DA 4DBEA 3WQ6A 3A5VA 3ABOA 4XAGA 2ASHA 4MB5A 4DVOA 2FVMA 3N25A 3KOXA 3R7MA 1T8QA 3MJMA 3AROA 4H1ZA 1XC6A 1TTIA 3GU9A 2PZNA 1LLOA 1J12A 1JVNA 2P5NA 4L1XA 1UR8A 2YDQA 3QW4B 3ZR4A 3GWQA 3TN5A 2GUBA 4J40A 4IXXA 4UFJA 1AMYA 5CJNA 2NQHA 1JD7A 6TIMA 3OTRA 5EYWA 3BW4A 1A5MC 4NZ3A 2OO6A 1EC9A 3B9DA 5AHFA 1XL9A 5B7YA 2V5JA 2OT1A 4NXKA 4W7WA 3N3MA 1J0ZA 4IMEA 4S3KA 3CM4A 3WDJA 2G4FA 1UR3M 1BGGA 2PDGA 3BJTA 3TJLA 1ECEA 4J28A 3SEPA 3L2IA 4IIHA 2WANA 1V6UA 4FIRA 4CCZA 2ALRA 1SZGA 1AODA 1OIFA 3F5JA 3OYXA 5BNKA 3WF2A 3B4YA 4IPIA 1L2QA 2E9BA 3ARWA 2X0SA 4IPPA 2YW4A 4KCVA 2ZA2A 2X0HA 2PDIA 3VIPA 2REQA 4PMYA 4Q8PA 3VI2A 1XGDA 1UB3A 4L56A 4W4QA 3W2UA 3WUBA 3WEZA 4US5A 1HJXA 1M04A 3SW6A 3WMBA 3PWGA 3W00A 2O7QA 1OX4A 4DF2A 3COTA 1MQQA 5CXPA 1RBOB 3SQMA 4HGXA 1MXSA 4H4IA 4WRHA 3PZNA 1O5XA 4YCPA 3K1DA 3PPHA 4MWAC 2QUMA 2FJKA 2PDPA 4ZTXA 3VOJA 5U7SA 1V6VA 2ZZ4A 3TX9A 2ZTJA 3GDRA 1VAHA 2RHGA 3AZSA 4H41A 1WA3A 3T0BA 3WH6A 1QT1A 1P7TB 3EEZA 1HW6A 4H01A 1OCQA 1J0KA 3QHMA 2BHUA 4BQ3A 4JD4A 2IKJA 2QAFA 3S5YA 4UQDA 4DIAA 4WJ8A 2VENA 3FHQA 1KXHA 5AZ0A 1IWAA 2A3LA 2X7VA 2OKOA 2H3BA 1ZALA 3F5LA 4OUEA 4LEQA 9XIAA 4C90A 2NVDA 1VEPA 5FJIA 1XCXA 2XFRA 4NNBA 4EPEC 4TTUA 1VBJA 4UZUA 1ISVA 3BGAA 5B7ZA 2D73A 3B9OA 3DESA 1UR4A 1O5RA 1VGAA 3TNOA 1D8CA 3WELA 2PP1A 3S5NA 4NILA 4WKFA 3PAJA 3KBMA 3PBUA 4LB4A 2IKGA 2J8TA 1OYBA 4U2YA 4AD4A 2WSQA 5A2AA 1G6CA 2NUWA 2RJGA 4M7TA 4XAPA 3EMZA 4J2PA 2NWSA 3PC0A 1F6YA 4K2SA 2CXEA 4IGHA 2AGTA 3UVAA 2A7RA 3VOFA 3TOP