1BEUA

Trp synthase (d60n-ipp-ser) with k+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
253
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Cryocrystallography and microspectrophotometry of a mutant (alpha D60N) tryptophan synthase alpha 2 beta 2 complex reveals allosteric roles of alpha Asp60.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Carbon-oxygen lyase
total genus 98
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1beuA00
3NZ1A 3I65A 1KTBA 4R33A 3FJ6A 3SW6A 1YXYA 4K6AA 1KV5A 1SO4A 3GR7A 1OX4A 3W7RA 1XBYA 1HG3A 1LOLA 4ICNA 1TJPA 1P1XA 2E77A 2NUYA 4XBKA 3C2EA 3TKFA 1PHWA 1EA0A 3INPA 4FHAA 1FXQA 4NZJA 2OMAA 1W5NA 3FOKA 3G0UA 5AHNA 1F5ZA 4ZQOA 3BG5A 1PIIA 3N2XA 4R53A 1MXSA 4LW7A 4O4VA 1MZHA 1W0MA 3NZRA 2V2CA 2GQ9A 1H1YA 1RQEA 2KZHA 1MEHA 4G1KA 3NQCA 1KBJA 4RXGA 2X16A 1KM5A 3GB6A 1WYIA 3TROA 4MYAA 1TREA 4N4PA 3BG9A 5D37A 1TTJA 5ABTA 1ONRA 5AYXA 5A5WA 1OFPA 1LCOA 3QJAA 1S5WA 2DJXA 1SR9A 4O1BA 1THFD 3SGZA 3TC6A 5BOOA 4WOZA 3NM3A 1B57A 5K4ZA 4DO4A 4UXDA 3W1MA 2J27A 3L0NA 3MHFA 5DXYA 2WO5A 3TX9A 3VFLA 3UWZA 1OFOA 1LZOA 4Z1BA 4AHPA 3UY7A 3G0SA 5K3VA 2V5BA 2LLEA 1XDLA 2YYTA 2Y89A 3HBLA 1K8XA 4AB4A 2AQWA 3DI0A 4MJMA 2DZTA 4N9EA 4OWGA 5MHBA 3M9YA 4BFAA 4O18A 3S5YA 1Z44A 4GE8A 5F4WA 3CEUA 2ZRYA 5IBXC 3STCA 4MOZA 4GUFA 2TMDA 3TAOA 2NWSA 1I2OA 4OU1A 3MI6A 4NT0A 1TIMA 1ZALA 3PULA 3GKFA 1A5SA 2NV1A 2Y85A 1F05A 4E0CA 1TSIA 2W0UA 1TPFA 5CGQA 1A5BA 2NUXA 2ZA3A 3P84A 3W7DA 2EF9A 3F4NA 3O07A 2QKFA 5HJLA 4GUHA 4HT3A 3NQGA 4N02A 3W9ZA 1VR6A 2I1OA 3QH2A 4YWIA 1DOSA 4RK8A 2JK2A 1WAUA 1Q3NA 4K37A 1PHQA 1L2UA 4N6FA 3P82A 1I45A 4CNNA 5D04C 3QM3A 3WJWA 2VEIA 1JQXA 3PG9A 2RDUA 4LWWA 1XBXA 2ZRVA 3A21A 3B04A 1UB3A 5AHFA 2HMCA 1JULA 1F76A 3PVFA 2Q3RA 1KM2A 4N9DA 4BK9A 4NNCA 1ICQA 3GDRA 1DJQA 2WOQA 3HPSA 3UYCA 3P67A 1OABA 2E5BA 1F73A 5LKYA 3VI2A 2NUWA 3NL5A 5FF0A 3QPYA 2EGZA 1G6CA 5HR6A 2ISVA 3THQA 5LNRA 2JKAA 1GVSA 3BO9A 5TQLA 1ICPA 2PRHA 2WSRA 4RKAA 4GBUA 4Q33A 1M5WA 3EWXA 8TIMA 3IRDA 4EVZA 3C56A 4CQ9A 2D73A 2Z6JA 3P5ZA 4M19A 5C55A 1H63A 4HN4A 3NGJA 4O12A 4Z08A 1AG1O 1G67A 3TK7A 3LTSA 5LNWA 3ANYA 3B4UA 3LX9A 1S3HA 5CZ0A 2CLMA 4XTIA 5AHEA 2FJKA 3W1NA 3NL2A 2ZZ4A 5DBTA 1EWDA 3VE9A 1WX0A 3FYOA 3LCIA 3UXDA 4UFMA 1DV7A 5AC8A 1QPQA 1T8XA 4GC4A 1S5TA 2TRSA 1K03A 5FEZA 3UZJA 3NA8A 5HULA 3TU9A 1DBTA 4DF1A 3HGRA 3P74A 1JCJA 1FY6A 1EIXA 1DHPA 3LCGA 4CQ8A 2YZRA 3R2GA 4NJGA 1NVMA 1TTPA 3S1WA 1PE1A 1A53A 1C9DA 2J9YA 3VCRA 3S5ZA 3SJ3A 2CLEA 4N4QA 1H7WA 4YLWA 4L4MA 4M7SA 1A50A 3NQEA 2VENA 2C0AA 3N14A 1AW1A 2CLHA 1W3TA 2C16A 2YDAA 2RDTA 4UNKA 4LV4A 1YYAA 2B7PA 1T99A 3E12A 4W9TA 3S1VA 1IF2A 2XN1A 2Y7FA 3PUOA 4BWLA 4U28A 4PEKA 1WOBA 3TA6A 3LCFA 3WJZA 3RU6A 1F74A 3LI0A 1EX5A 4UTWC 5FEWA 3O63A 3OG3A 3CU2A 3TXZA 4P2VA 1UASA 4NZFA 5EPDA 5D32A 3R13A 4RR4A 2A2IA 3DHDA 4TX9A 5LGXA 4M6VA 2E1DA 4O53A 4HHPA 3PSWA 2E6DA 2CLLA 2J88A 3TMQA 4IX0A 1F2JA 3M5VA 4UR8A 2E09A 4MFDA 4IPJA 2GOUA 4JYFA 1KW1A 3IIPA 2GQ8A 1VZWA 2DZXA 1YLVA 5K4XA 1LOSA 4JD4A 4LUJA 2Y6ZA 3IEBA 3NQ2A 3T7VA 1VYRA 5J5RA 5KZMA 5CZSA 1HO4A 3JR2A 1DORA 1W5MA 4OGZA 3G18A 3PBWA 1SSDA 3UPBA 3MW7A 3A9IA 1IIGA 1G4EA 4QISA 1ZENA 3P61A 5K9DA 3IIVA 3TJLA 5EYWA 1M7OA 3IVTA 4IWWA 3PB2A 5AYYA 4LC8A 2WQPA 4WY0B 1LROA 2JKEA 2H8ZA 4GNJA 2VFEA 5CPMA 2QCLA 1EUAA 2FQIA 4KWWA 4JIPA 4BI6A 3TV8A 4MY8A 3E02A 1L6WA 4NU7A 4O17A 4JX5A 3C61A 3NDOA 4WXZA 3I7RA 1DKWA 4UMCA 4DPPA 1SU5A 5F2LA 1SZNA 1KM0A 5FEPA 4HPXA 4FB7A 4IMDA 2FFCA 2ISWA 1VLWA 5LSMA 2GPTA 5L6UA 4IQLA 3NAVA 1J4EA 5G5IA 2QEZA 1OG0A 4FX6M 5J5DA 1RZMA 2ZFAA 3Q37A 1GVFA 4NX5A 3S9YA 1VHCA 2B4GA 2ZZ5A 1TCDA 1PVNA 3GXNA 1W31A 3GNNA 2PCQA 4BI7A 2DZPA 4I7UA 1ALDA 1BWLA 5G2IA 5DN1A 3ZR4A 4WUIA 4LT9A 2RH9A 5D2VA 3KX6A 1QFEA 3E49A 1B3OA 1GG1A 5FF3A 3RLUA 4KFOA 2DZSA 4MVAA 3C0JA 1ADOA 4FX7A 3M0ZA 5KZDA 3EKLA 1Q6OA 1O60A 5BW6A 1OF6A 3PB0A 3L2IA 4ADUA 4LVDA 1LLWA 2FB2A 3HIJA 3GR8A 4O16A 4ADSA 4QJ1A 3PC0A 4IOTA 3NQVA 5I3GA 3TAKA 4UFLA 4RV8A 4ZQMA 3I6RA 4AAJA 1B4EA 1TPDA 3PG8A 3TH6A 2WSYA 5HR7A 2YCEA 5HINA 1W3IA 1RD5A 4KWVA 1RQBA 1YXDA 4UMAA 2Y88A 2NZLA 5H91A 1FDZA 1VCGA 5HUPA 2HTMA 1JUEA 4XTDA 4UTMA 4NX0A 4XKYB 1NSJA 3H53A 1PS9A 3EWUA 4RZ5A 1TV8A 5K9CA 1FQ0A 2CWNA 3GDLA 1QO5A 4AMAA 4A2SA 1HUVA 4FEZA 5DELA 3KFTA 4JTKA 1VJIA 3PY2A 1I2QA 3G1SA 1LTDA 4HNNA 3THAA 2FPTA 3C2RA 5LNSA 2X1TA 5KITA 1OX6A 2EAWA 4FNPA 5F2IA 3G1HA 4O8RA 1N8FA 3KHJA 2PRLA 4POCA 4NJKA 3L66A 1H62A 3S42A 1GVQA 3FKRA 1XCFA 3QFEA 1GTEA 4K39A 3M7WA 4PA8A 4ZMGA 1QO2A 4KFNA 3GYEA 3O15A 3SSJA 3CC1A 4ADTA 4AWTA 4MJZA 4E2DA 2H6RA 3TC7A 3R89A 5C2XA 3F4WA 5DCDA 2QCNA 3A5FA 5D2XA 3NEVA 4K8EA 4NXKA 1KM3A 3G24A 3QYQA 3NYZA 1T96A 3CHVA 3IGUA 3QRHA 3ZS4A 2AAMA 2ATSA 4HKPA 1VPXA 3MYPA 5G2HA 1D3GA 4HSNA 4ZQRA 1NF7A 3HG3A 1TPEA 3LXBA 3DFOA 1G69A 5K9XA 3EX1A 3LHTA 4FXRA 3B0UX 3BVJA 3HPZA 4X3ZA 4Z0JA 2A1YA 4WZHA 3UPWA 4X22A 2EKCA 1SFJA 1LP6A 4UTIA 3SR7A 3NNTA 1PCKA 3TSDA 2QCDB 3F1QA 3BW3A 4AF0B 1OFRA 1VGAA 4LVBA 3DKLA 1TTIA 3C3NA 5FF4A 1KFKA 4DELA 5C5YA 4TMCA 3FS2A 4GWEA 3CIXA 4WOQA 3QSRA 4ZQPA 1G7VA 4R7JA 1QWGA 4A22A 1I8JA 4DEFA 4UNLA 5AHMA 4JTIA 3HPXA 1TQJA 1TV5A 3DAQA 3W7JA 1JCXA 2I9EA 2CFFA 4JS3A 1TV7A 2VFDA 3GNDA 4UTLA 3KVJA 2Q8ZA 2QDHA 4O4WA 1QCWA 2WPBA 3B0PA 2RKXA 1ZCOA 4LVGA 5AHLA 3OIXA 1JUBA 1SSGA 3Q94A 3GXPA 3UWWA 2H3DA 3W7PA 3KOFA 3QMRA 3UZ5A 1ZAIA 3M5ZA 3W2KA 2YXGA 3MMTA 4EOUA 5EA9A 2NXHA 4OV4A 2E6YA 3PUDA 4H6KA 4Y96A 4JIQA 4MY9A 4IUOA 3HOJA 1ZAHA 1I2PA 2P10A 2VFGA 3LRKA 2P1FA 3C6CA 1VRDA 3NPVA 1I2NA 1Q6QA 1W1ZA 3B0VC 4ORIA 1WDWA 3DXIA 2V2DA 4YL2A 3G22A 2OJPA 5EBUA 2QCCA 3T55A 2NLIA 3TJXA 2X30A 2O7QA 2E5CA 3BG3A 3TR2A 4K7YA 1TPC1 1Q45A 3GDKA 3P80A 5CPNA 4UC5A 4YCPA 3GDMA 5FESA 1M6JA 4MIMA 3B03A 2QCHA 3U8GA 3WK1A 2TYSA 2V2HA 5I3HA 3ATZA 2Z1BA 2C1HA 3G1FA 4NUWA 2OCZA 1K02A 2Z0IA 4MUZA 5C54A 1G4TA 3FIGA 4JYDA 4LS1A 4EF8A 2NXGA 3R5EA 2H3BA 3UD6A 1TJRA 2EPHA 2VC6A 3STFA 2ZCGA 1ZNNA 2J6XA 2FTPA 2QCEA 4WJEA 3DBPA 1UBSA 4Y90A 1I4NA 1VLIA 1BTMA 4PL2A 3O6YX 3W2UA 4GUGA 1LRNA 1WA3A 2FB3A 4JN6A 2C15A 1S5VA 1FWTA 5SWUA 2A7PA 1R2SA 4CLMA 1H50A 2X2GA 1E51A 1M7PA 4NNAA 1J5TA 3T40A 5TIMA 2F7FA 5E93A 3M6YA 5DXXA 4UFJA 3I7QA 3HGSA 3TDFA 3OBKA 3LCWA 1BWKA 1KFBA 5G4WA 4UTJA 4Q32A 1CW2A 2HS8A 2PURA 3PWAA 3O05A 3HG5A 3W6YA 1SFLA 4JTSA 1W8SA 5FF2A 1Z48A 5I3JA 5AFDA 4FO4A 1FWSA 1KM6A 1MEWA 3MHUA 4QITA 3ATYA 4QQ3A 3LRMA 5DCEA 4OE7A 1JCLA 2X1UA 1K7XA 3DU0A 3JS3A 4NJIA 3LTYA 5F1UA 1TQXA 1K8YA 5U4NA 2GJNA 4OV9A 4JXCA 4UTHA 4GFSA 2YFOA 4QNEA 5L9FA 3W84A 3M43A 2A6LA 4HSOA 1HTIA 3BLFA 3LHYA 5H2ZA 3W7LA 1AMKA 1GJPA 3NXFA 4LVFA 2V0TA 5AOUA 1A5CA 1GYNA 1Q6RA 1FCVA 4LTSA 1FUYA 4AHOA 2QJGA 3E9AA 2QAFA 3L0KA 2DZWA 3CPRA 1ZJIA 3TFXA 2XFWA 1JRCA 4NJJA 2CZEA 1PCWA 4MZ1A 1TO3A 3FKKA 5CZTA 3D0CA 4LUIA 2VEKA 2ISSA 2YFNA 1DL3A 2HSAA 2V8ZA 1XL9A 2W79A 4JY8A 3SY5A 4DPQA 2YSWA 3GVGA 3KVKA 2NXIA 5K7JA 2J24A 3W75A 5CZJA 4Z1AA 1FCBA 1GTHA 4DO6A 4K8HA 4WQ6A 5T26A 4D2JA 3A5VA 4QM1A 1XBZA 1LRQA 4MYXA 1TPWA 2QCFA 1IIHA 1QDSA 3W7OA 4IGHA 3W7GA 3ZWSA 3P62A 2A5HA 1QMLA 3WJXA 4M5PA 3ABQA 1LM1A 1I2RA 5HNRA 3EXRA 1ZAJA 3MWAA 5D03A 3GKAA 1UCWA 4O54A 4UFHA 4L4LA 1NF0A 1XI3A 4DF2A 1WOAA 4O0KA 3W7KA 1KA9F 4IMCA 1SW0A 4N9CA 4JEQA 3YPIA 3T4CA 3WK3A 1NAL1 3HG2A 3R12A 4O10A 1X1ZA 5G1TA 1EEPA 4N2YA 2R8WA 3V1PA 2B7NA 4FNQA 2C14A 3G0XA 2QF7A 4JNMA 4M6QA 1DVJA 2A0NA 3LXAA 4JYEA 2C3ZA 2BXVA 5F1VA 3W2MA 2DU2A 3P8JA 1YDVA 4HPJA 1OFBA 2JBMA 1W5PA 3SECA 5D05A 2W6RA 2P0OA 1XC4A 4GXMA 4NXSA 4YXGA 2GJLA 5FEXA 1OJXA 1FWNA 1DJNA 4IJBA 2OT0A 3USBA 4FIQA 1GEQA 2CLKA 4UFIA 1K7EA 2CLOA 3N2MA 4LOCA 4WX2A 2I14A 1MO0A 4PTNA 4ALDA 3S1UA 2WNQA 3LM7A 4H3DA 1OK6A 4GUIA 3C8FA 3GLCA 2V81A 3W22A 5HWMA 2E6FA 4IMGA 1LOQA 3N73A 3DH7A 3MJYA 3TMLA 1K3UA 2C13A 2VFIA 4UTTA 2HS6A 3IGSA 3DHFA 1CI1A 1VQTA 2F84A 3TW6A 3TUUA 1VYSX 4OBTA 5D30A 1ME8A 4JTJA 4FNTA 3CWOX 3G3DA 4N6EA 5CKSA 2RDWA 4MPQA 1MEIA 5DCBA 2J9XA 5D2YA 3PBVA 1Q6LA 1SZGA 1O5KA 3W1RA 2Z2UA 4IXHA 4XZ9A 3M47A 3W1QA 2CZDA 2C18A 2Y70A 3I68A 1KM1A 3QEZA 1FCUA 3U6WA 3SIZA 5CPLA 3W85A 1H7XA 1DQXA 3EX2A 4TO8A 2V5LA 1LYXA 5I3IA 2ZYFA 1YTDA 3NQFA 3C52A 4PCFA 1SUXA 2X1SA 3Q58A 3L65A 2VELA 3W7MA 3M5YA 3G1YA 2NWRA 3O8AA 3L5AA 2FDSA 3PM6A 3LLDA 3N3MA 3W07A 2QUUA 3IGXA 4NNBA 3I7SA 1GT8A 4X2RA 1XDMA 4BWLC 3GXTA 1R2TA 3LCLA 4MZYA 3NPWA 3BW4A 2G96A 3EB2A 4CCEA 4R34A 3CLMA 3W76A 3HQ1A 3ELFA 4LVAA 3NR0A 3CEPA 5LZLA 2B0MA 3RFAA 5E0KA 3CB8A 2JGYA 4XKYA 2Q8LA 4EIVA 3NQMA 2ZTJA 5EKYA 3ABOA 1FDJA 4AWSA 1OVDA 4RJEA 3LCHA 4LS0A 4B5NA 1TRIA 1EPXA 4Z1DA 4CCDA 1XFBA 1YDNA 4C1KA 1P4CA 2GVJA 1EP1A 2ZA2A 1X1OA 3DFQA 1UUOA 2H90A 3NQAA 3SI9A 3E0IA 3W7QA 1L6YA 4H4IA 3TW7A 5CSSA 3F03K 4GUJA 1JCYA 2J9ZA 3C2VA 4X9SA 3L5LA 2VFHA 1GG0A 2RHGA 3LBMA 1AW5A 2WSQA 2XN2A 2GQAA 1LRTA 3BPWA 3DFNA 1SO3A 5BRBA 2WKJA 4CQAA 1XUZA 2A21A 4JX6A 3CWNA 4UR7A 3LOTA 1V5XA 3QC3A 4UFKA 3AJXA 4HIBA 2BX7A 1GVOA 1TYGA 1YADA 3NQ8A 4BR1A 2ZA1A 3NQDA 2FPYA 1N7KA 5LHFA 3A24A 4Z1CA 1Z42A 2VOMA 3GK0A 2Y7GA 1SZEA 3NG3A 3PAJA 3G1VA 4LRTA 3W1XA 3PBUA 3FJLA 1JCNA 4S1FA 1O95A 2VEMA 4N9BA 3W87A 1IGSA 4O0ZA 5U7SA 1K8ZA 3CTLA 2Z6IA 3IV3A 5C6MA 3LHUA 2FLIA 4OQVA 2ZZ7A 4O1DA 2JGQA 6ALDA 3R8RA 3S0CA 1BKSA 5IBXA 1SO6A 4E2BA 5BNKA 4YCOA 4AF0A 3TCEA 1L9WA 5G4EA 5HMSA 3HGJA 3LV6A 3DFSA 2V9DA 5D09A 1V7YA 1OYCA 1SW3A 3OA3A 2V82A 1PL9A 1QPOA 3L67A 3S5OA 3W2LA 1VCFA 1L6SA 5KINA 4K7VA 1H7PA 4IMFA 4AHQA 3OVQA 4Y6GA 4NQ1A 3UNDA 4A3UA 4O14A 1KTCA 1JVNA 4DO5A 3KVLA 4QAIA 3HMJG 3TQKA 1KLZA 4EF9A 4I7WA 4RLIA 4NVTA 3W1AA 1H60A 3RF9A 3W3OA 5D02A 1YXCA 3PF3A 3NM1A 3O06A 1ZHAA 3RNDA 3G1XA 1B9BA 1AK5A 3RMJA 5D38A 3PS7A 1HL2A 4HNTA 4IPIA 2DZUA 3G3MA 2Y63A 3ABRA 4JX4A 1YDOA 1JRBA 4MKNA 3M5XA 3EX4A 3FFSA 3ABSA 1QNVA 3KVMA 2NX3A 3PR2A 3SZ8A 4XWUA 3W2NA 4DXVA 1RV8A 1EUNA 1O5XA 1EP2A 3FLUA 4ZL1A 1B4KA 2ALDA 1KFEA 4ORMA 4A21A 5DBUA 4LV9A 1OF8A 3W71A 1UJPA 4NJHA 1R47A 5K2ZA 3LTPA 1OX4B 3O1NA 4TIMA 4GRSA 1U83A 4S2BA 3EWBX 4HNUA 1T0OA 3BGGA 5CSRA 1FWWA 1X8FA 1FCQA 1R2RA 3M44A 3P81A 3STEA 3W7HA 2QUTA 3DI1A 4JTFA 4LU0A 1GYLA 1FXPA 4PODA 4Y8FA 3TQ0A 3VKJA 1OFDA 1SW7A 4LRSA 2YPIA 4K38A 3LGEA 4AH7A 4MLJA 4I9AA 4TMBA 1O94A 3TXVA 3N9SA 2QUVA 5D33A 1GWJA 1MSSA 1N55A 2G95A 2Q3OA 2GVLA 1LORA 1IXOA 1QPNA 4XBSA 2ZZ3A 3L9CA 5G2WA 5BMWA 2BLEA 4YMZA 3W74A 1H61A 2O7SA 4LS2A 1AL7A 3EEGA 3DZ1A 2BSLA 5I3FA 3PSVA 1EP3A 5E1QA 2A7NA 3BV4A 4FXSA 4TU1A 1FWRA 3BW2A 4FNSA 4TR9A 4GJ1A 4WY0F 3TIMA 1H1ZA 2R14A 2VEPA 3CIWA 1HO1A 2V30A 4M7TA 5D2TA 4KFPA 2ZRUA 4ZQNA 3P7YA 1W54A 3FYPA 3NOEA 2TSYA 4Z0SA 5IM51 4EWND 3QQ0A 4O28A 1KLYA 4FIRA 4MFEA 3NPXA 3MBDA 3S8HA 1VH7A 4RXFA 4ZZ9A 2E68A 3C4UA 4LY8A 1F6PA 1OFEA 1GVRA 1KFLA 3NPUA 5F4XA 1JCMP 4UTWA 1SPQA 2VKZG 5FI8A 2QCMA 1ICSA 1OX5A 1VHNA 3KAOA 3N19B 1NEYA 3LERA 3BLEA 4AVFA 1RR2A 3O6DA 3S1XA 4JTHA 1H7RA 1ZY9A 3UWVA 2Y61A 2OX1A 4FNRA 2R94A 3QZEA 3WFAA 3NL3A 5D2WA 4UTUA 5A8GA 4MLRA 3QPZA 2G5WA 3M1ZA 1TPUA 1Y0EA 3LDVA 2Y7DA 5TBOA 3DFPA 1IXQA 5HWJA 4JDBA 3UWQA 5AC7A 2H8XA 3QQ1A 2CZ5A 3AO0A 5HUOA 3DENA 5I3KA 3C2FA 4I7VA 3UWUA 2QAPA 3EWZA 3W70A 3EXTA 4QSHA 1X6UA 4E38A 3TE9A 1R46A 2QJIA 1ME9A 5CG7A 3W7CA 1C8VA 2GVGA 2ZRWA 1FX6A 3ZFHA 4O15A 2CLIA 3MI3A 3L21A 3BLIA 1GZGA 3DFTA 4O57A 5F2MA 3HF3A 3CT7A 4HNVA 1XKYA 2DZVA 3B05A 1IXNA 1R30A 2NX9A 3EX6A 4P61A 4RX0A 1A5AA 3KRUA 3CM4A 1LDCA 3NQ7A 3NL6A 2ATMA 1WBJA 3W1PA 4IXXA 2TPSA 2JKPA 4IMEA 1TRDA 3Q2DA 3B8DA 4UCGA 1WV2A 4FF7A 3WJSA 5F2GA 4O19A 2ABBA 3QW4B 1GPWA 2EHHA 5DLCA 2G97A 3EKZA 1ZFJA 1JQVA 1GOXA 4DBEA 1RQHA 3W1LA 3QW3A 3OHIA 2NX1A 1GQNA 4BI5A 3MHGA 3G8EA 3QMSA 3NQ6A 2E6AA 3HG4A 3PBYA 4OT7A 4AWUA 1QOQA 3GAKA 3G1DA 3MP4A 3W1UA 3RLVA 3UXAA 2ZBTA 3P5YA 5LHEA 1LLZA 3MP3A 3W7IA 3MUXA 1FDYA 5CPOA 4PC8A 3LRLA 3IIXA 4JR5A 5KZEA 3U2OA 3W88A 4KKXA 1CX9A 4WXYA 5LNUA 1UUMA 5G1YA 1KTNA 2QJHA 5HQEA 4FX8A 1QAPA 4WY0A 3W23A 3BARA 5AHIA 1QPRA 4UUIA 1KFCA 1WQ5A 2QCGA 1RPXA 4DF0A 3L68A 1D9EA 4OHQA 3MO7A 5AYZA 1XUUA 1OFAA 3CQ0A 3PUEA 2YW3A 3LHWA 1JUKA 3LLFA 4QNWA 2BZNA 1H51A 2ZDRA 2YR1A 3IIZA 2Y62A 1Z41A 3LHZA 4FNUA 3FA5A 3LHVA 4S2CA 4XQ6A 2GUUA 2R91A 4J9JA 3C2OA 1OHLA 3OVRA 3WK2A 2E5DA 1YTEA 4PFMA 3S6DA 4AEOA 3W2JA 2BWGA 3W86A 2OZ0A 5DY2A 2A6NA 4ML9A 3IIOA 3IVSA 3P8IA 4A2RA 1JR1A 1WBHA 3LBCA 3BK0A 4U4MA 3LB0A 3W7NA 4QIUA 4UMBA 1TPB1 3N34A 4O11A 4O1AA 3JRKA 3L0GA 1D3HA 1EWEA 2WV8A 1C29A 2C19A 1LBMA 2ZRXA 4WD0A 4PL1A 4O13A 3E96A 1AL8A 5EMUA 1H7OA 4RZ6A 1OFQA 1KBIA 1KM4A 1NFBA 4UTKA 3LXCA 4Y9AA 3N9RA 1KFJA 2DJLA 3TFCA 3W1TA 1VC4A 2RFGA 3GIYA 4A29A 3QMTA 1G7UA 2YX0A 1VS1A 3EWWA 1ME7A 3EX3A 1XM3A 3RK8A 2OT1A 4O1CA 3QSTA 5GVJA 1F7BA 2NV2A 3W7EA 3EXSA 4JICA 1AW2A 1TB3A 2A85A 5LNVA 2ZZ2A 1SO5A 2VFFA 1PV8A 3QF0A 1W5OA 3TSMA 2YGYA 3ZWTA 1P0KA 3KRZA 3GX9A 1W3NA 4O50A 1P5BA 3UQNA 3M16A 3GAYA 3TQVA 4DBDA 4ONVA 5AN7A 2PE4A 4JTGA 1XBVA 3WK0A 1LBFA 2A4AA 4AXKA 4XUGA 5EL1A 2CLFA 1TMHA 1QOPA 3HO8A 3FEMA 5KSWA 1TPH1 5LGZA 3VNDA 2UV8G 2ZTKA 1SQ7A 3UWYA 1KV8A 1OYAA 1RVGA 4MY1A 1XXXA 3A22A 4M6PA 2DORA 4UIOA 4RZ4A 3MBFA 5EY5A 3W83A 3B06A 3K30A 2ZRZA 4JTEA 3T44A 4C1LA 2CZFA 3LCXA 1LBLA 1W37A 3GDTA 1BEUA 4JTTA 5BMXA 4JTUA 4ZQCA 2B7QA 1DQWA 3MI2A 1YPFA 1HFBA 1WXJA 5KTLA 1OK4A 3SFKA 3S5NA 3NO5A 1H5YA 4BF9A 1P0NA 2A7RA 2FPVA 3HJZA 1YPIA 3T78A 3VE7A 1ML1A 4JY9A 2WNNA 3O16A 3KXQA 5KMYA 1F6KA 1W5QA 1YTKA 4ZVJA 2X1RA 3TNOA 2BTMA 2IQTA 3DGRA 4LNYA 5AB3A 4UTTC 4CNPA 4O52A 1VYPX 3OVPA 3H55A 3LI1A 3W73A 5F4SA 3GZ3A 7TIMA 3MP5A 5DY3A 1IXPA 1G4SA 2XN0A 4DQWA 5FF7A 3STGA 2Y7EA 1X7FA 2PC4A 5HWNA 2DP3A 3G1AA 3IVUA 4Q4KA 1VCVA 3A23A 3TSBA 3HGOA 3UY8A 2YW4A 2QDGA 3MYOA 3HB9A 1FBAA 2B7OA 2C6QA 3NVTA 1JJKA 2VXNA 3SGUA 3L5MA 4MZ8A 4K36A 3W72A 3H54A 2CW6A 2YYUA 4JGDA 3WJYA 1SZFA 2QCDA 4LC6A 3BGJA 2WNZA 3DKJA 1TPVA 2ABAA 3OEXA 6TIMA 1G4PA 1TTQA 4CCCA 1EB3A 3LV5A 3P60A 2FIQA 1K7FA 3KRSA 3M41A 2ZZ6A 2ZZ1A 4CNOA 2WJZA 1QR7A 4PH6A 2ZQ0A 5AC6A 2CU0A 2PRMA 2QR6A 1OYBA 4RCXA 1J2WA 3G8RA 1O4UA 1H7NA 4IX2A 4JDYA 2AGKA 3O6CA 1W56A 3EWYA 1U5JA 3V75A 4JTLA
chains in the Genus database with same CATH superfamily
3NZ1A 3I65A 1V3LA 1L0PA 4XO6A 4PUMA 2FDMA 1SO4A 1LOLA 3RIKA 2YBTA 3DOPA 3GTFA 1TJPA 1UWIA 4CNSA 3TOPA 1P1XA 2E77A 4XBKA 4IH3A 2DIKA 4XAZA 5M03A 4U3AA 5CQ1A 2VRQA 1VKFA 1FTXA 5AHNA 4E3TA 1XYFA 2NQHA 4F8XA 2OQYA 1MXSA 1ONXA 1MZHA 3R58A 1EGMA 3NZRA 1SJCA 2V2CA 1RQEA 5A94A 3WBEA 2BBFA 1QNQA 2DT1A 4QSFA 3PJWA 3LU2A 4HMDA 2X16A 3GB6A 1WYIA 3TROA 4C65A 1TREA 4N4PA 2NQ9A 1UIOA 2G50A 3EOSA 1EBGA 1YHTA 4O1BA 2GGEA 1VEOA 3SGZA 5BOOA 3NM3A 1B57A 1YQ2A 2J27A 5DXYA 2WO5A 2W4XA 1XIHA 1D7FA 2ZVRA 3UWZA 2YLLA 1LZOA 4AHPA 3UY7A 1J0IA 3G0SA 5K3VA 1XDLA 2AQWA 3DI0A 5E70A 2CEQA 3BLKA 4OWGA 4DZIA 3M9YA 4RDYA 4HNOA 4AWEA 3BMXA 3GW3A 1Z44A 2E4TA 3AXMA 3L23A 2J7HA 3RX2A 2TMDA 4DZ5A 2NWSA 2PLMA 3SO7A 1IWPA 1TIMA 1TWWA 4GJIA 5FL0A 3GKFA 2Y85A 3ARWA 1UH3A 4E0CA 2Y4SA 1FWEC 1A5BA 2ZA3A 3W7DA 2EF9A 3WLKX 4CU6A 3L4UA 4XD3A 4HT3A 3NQGA 1LL6A 2HRWA 4C5YA 1XLKA 1EGVA 1WAUA 1Q3NA 4KQNA 3LM3A 4ACZB 4F9DA 4F0RA 1JAKA 1V77A 4RDWA 4P7LA 5ENLA 3HU7A 4LJ3A 1HGYA 3A3HA 1F76A 3PVFA 1KM2A 1RLCL 4NNCA 6PTDA 1IWAA 4IFKB 3B0XA 4CN6A 2WJDA 2AL2A 5BCAA 4ATDA 2WMGA 1WDPA 2IKGA 3NL5A 2ZWZA 4AZ5A 5FF0A 2ISVA 2WYSA 1KCXA 5LNRA 3AIWA 4U5IA 3THUA 2PRHA 4RKAA 3U5YA 1UWQA 4GBUA 1XRTA 2PDIA 8TIMA 3FDKA 2VGIA 4EVZA 1CGYA 3EPNA 3C56A 2D73A 3P5ZA 2V3GA 3UR5A 1N2VA 1G5AA 3NO1A 1GKPA 3RPDA 1NDWA 3ANYA 2VNCA 4HNLA 4XTIA 5LXXA 2ZZ4A 3WY1A 1EWDA 2PEVA 3D47A 3VE9A 3AICA 4QG8A 4L4PA 1QPQA 5C7VA 4Z42C 4DAFA 5M5DA 2QZRA 1S5TA 2TRSA 3VPLA 3MB9A 3EEZA 3OODA 1TG7A 3AS1A 2UY4A 4KCTA 3ARPA 3P74A 3FW6A 1BVWA 4LX4A 4EAMA 4FOUA 3OZPA 4LYRA 4K2SA 4GYPA 4LAMA 1A53A 1C9DA 1XSJA 3HMCA 2J9YA 3SJ3A 2Y8UA 2PGRA 2GGIA 1IZCA 3ERPA 4L4MA 4OUIA 3VD4A 3N14A 2W9MA 3SCTA 1W3HA 2INZA 1K77A 8A3HA 3VGEA 4LV4A 1ITXA 1OD8A 1FWHC 3V7PA 4W9TA 4X63A 1FFQA 3OGRA 4CU8A 4PBGA 3PUOA 4BWLA 3U4FA 4U28A 3N2BA 1AQHA 1DXIA 3LCFA 3WQVA 3RU6A 3WQGA 2XGZA 3C0LA 2DSUA 3OG3A 3RM9A 1UASA 4WKFA 2D3LA 3CHDA 5EPDA 2ZVIA 5D32A 4RR4A 1XLBA 4TX9A 2Y2WA 2E1DA 3G6LA 1IEWA 2E6DA 2CLLA 2J88A 3TMQA 3W00A 4UR8A 2ANUA 4MFDA 4ZTXA 2Z2AA 5HMFA 3ITVA 3STPA 1KW1A 1R5YA 4LUJA 5ABFB 2Y6ZA 4XZLX 2DEPA 3T7VA 4BF5A 2FVLA 2XVLA 5CZSA 1PYMA 4OGZA 2VZVA 1PKLA 4JQ1A 2I17A 3TZFA 1IIGA 1BYAA 4DZHA 2QW5A 3PP7A 4XZHA 3GR4A 4TUFA 4LYKA 5HXMA 3CUGA 3P61A 5H8UA 1JI1A 3PZNA 2DIJA 2PDQA 5EYWA 5CG0A 4JIHA 1Y5VA 5AVNA 5HNTA 4LC8A 5ECUA 1XF0A 3BTNA 2WQPA 4GNJA 5CPMA 2FQIA 3WQ4A 1XH0A 3F2DA 1L6WA 4JX5A 3NDOA 3I7RA 4UMCA 4DPPA 4NI8A 1SZNA 4L65A 3RR4A 4H8NA 2FFCA 1IQ8A 1VLWA 5L6UA 3A3XA 4YTRA 1J0KA 3SADA 4FX6M 5J5DA 1XYBA 4NX5A 4DXXA 2W61A 1KR0A 1RK6A 2DPEA 3W29A 2B4GA 2WCAA 2Z1KA 5A95A 5CC3A 4FPSA 1W31A 1ALDA 2XGIA 1QW9A 3FV9A 3KRBA 3VIKA 4JTAA 3AXHA 3NTYA 3T8LA 3ZR4A 4GKLA 3R10A 1MUMA 3KX6A 4AZHA 4M8UA 3GXDA 4KFOA 5JBFA 3CUXA 4MVAA 3GYCA 1M01A 4DM1A 1Q6OA 3PB0A 5XIMA 1TWIA 4GQRA 4NI3A 2A3LA 3W38A 3SUVA 1KXVA 1RVKA 5I3GA 1XINA 3TAKA 3T0AA 1AH4A 3T2QA 1WXZA 2FZ8A 3ZIZA 3R1ZA 3PG8A 3NWRA 4M82A 4PUNA 1NP2A 3FJ4A 5HINA 5TAOA 5GNXA 4UMAA 3ONCA 2NZLA 4QFUA 5H91A 3W53A 4QX4A 4I5XA 2F6UA 1JUEA 4NX0A 1H2JA 1NSJA 3VILA 1ODUA 2C1GA 3EWUA 1TV8A 2XH4A 2WLYA 1VFSA 3M0LA 3GH5A 5DO8A 2XVPA 3GDLA 5FAJA 1A47A 1VJIA 2DSVA 3H8AA 1LTDA 3OLEA 3L4YA 2WBKA 3ICJA 4QR6A 5KITA 4JPGA 1OX6A 2OX4A 2QDEA 2EAWA 3G1HA 1N8FA 3KHJA 4V1XA 2P53A 1X39A 5FA5A 3UGVA 3FXGA 4Q4RA 3ZT6A 4IICA 3C8NA 1GVQA 1XCFA 3QFEA 3AHVA 4PA8A 1QO2A 3SSJA 3GYEA 1WKEA 1TMQA 1CXIA 4US5D 2WJFA 5E5CA 4G7EB 4GLEA 4E2DA 1FH7A 3DC0A 3R89A 4IT1A 4H9XA 2O92A 5DCDA 5JBDA 1TWSA 4K8EA 4NXKA 1KM3A 3NZPA 3NYZA 3GZAA 3QRHA 2C7FA 2ZUWA 3FX4A 3MYPA 5I06A 3OBAA 4ZQRA 4DX3A 1G69A 1EL3A 3JZEA 2PWGA 3LHTA 4RV3A 3B0UX 3VABA 4WZHA 3UPWA 3WH7A 2EKCA 1HW6A 1X96A 1JPIA 4UTIA 3NNTA 3M0IA 3H4GA 4LVBA 2UY5A 2ACQA 3KEHA 1TTIA 3C3NA 4AMCA 2GZXA 5FF4A 3K8MA 3WNPA 1J6OA 3DHPA 4TMCA 2HXTA 4GZIA 1UD8A 1EZWA 4WOQA 1O66A 2PU1A 2QUMA 1U1UA 3AJ7A 4UNLA 1R9ZA 1TQJA 2FMNA 3WEZA 2O4QA 3N3TA 3DAQA 3W7JA 1J0JA 1XD0A 2I9EA 4DUOA 4JS3A 1TVLA 5H6HA 2PF0A 4U31A 1OC7A 2VT0A 2WPBA 3GIPA 3B0PA 2RKXA 4LVGA 5AHLA 3R0DA 3H21A 3GXPA 4C90A 1X7IA 4OVXA 2VOTA 3W2KA 2YXGA 4NZ4A 3MV01 4IUOA 4DI8A 2WMIB 4MAZA 4KCWA 1HJUA 3WQCA 1I2NA 1W1ZA 3FK4A 1XRSA 1NQKA 1WDWA 5EBUA 3PAOA 2NLIA 2X30A 1XLMA 4ZO6A 1TPC1 4B16A 3LPOA 1PDYA 4MIMA 3NEHA 2V38A 4XD6A 5I3HA 3URBA 4AC1X 3G1FA 4Q8WA 2OCZA 1UP3A 3SCVA 2YB1A 4AEEA 1PXGA 4MUZA 4A8IA 3FIGA 4CN1A 4LS1A 2NXGA 3WBWA 4WGHA 5I02A 2VC6A 3STFA 4O1EA 1KGXA 3PBGA 3QR3A 4W89A 5GJPA 3FVMA 2QLYA 4P7NA 3VVGA 2QCEA 3EDEA 3VGDA 2GK1B 4WJEA 4NKCA 5DMNA 3S47A 1UBSA 1I4NA 3B8SA 4EXQA 3OQEA 3W2UA 4NASA 2VWSA 1B3WA 5JUVA 3HN3A 3N4AA 4X61A 2FB3A 4JN6A 2GSJA 4B2DA 2G3JA 5SWUA 2A7PA 4JCLA 2R1MA 5MKGB 3CQIA 2X2GA 3IARA 1SJBA 1M7PA 2RAGA 4NNAA 1E1CB 3EBVA 4B9ZA 3Q4DA 4L5ZA 3KWXA 5E93A 5DXXA 1UPMB 4D8LA 1QK2A 1US2A 1I6NA 1CW2A 2HS8A 3PWAA 2PP1A 3DYMA 3MHUA 4QITA 1VFFA 2YCJA 3PWGA 4OE7A 3E0LA 5CLTA 4OJYA 1ZTVA 1WZMA 3JS3A 5F1UA 1KRAC 1PYFA 4OV9A 4NIRA 1HJWA 2OZTA 2CXGA 4ZO8A 1MZRA 1LWHA 2A6LA 4PMUA 3BLFA 4OFCA 1IV8A 2OSYA 2OOFA 4GISA 4LPCA 6A3HA 1FCVA 1FUYA 3L4ZA 1OBAA 3QKEA 4J4KA 4NP7A 1ZJIA 1CYGA 5HA7A 4NJJA 1XIFA 3BJSA 1DJYA 3FKKA 3IJLA 4LUIA 1XL9A 3VU2A 3GVGA 2NXIA 4DN1A 2AL1A 2C91A 2J24A 3W75A 5CZJA 4K8HA 2RJGA 5T26A 3PPHA 4XAFA 2UY2A 4I9JA 3QBUA 4PB3A 1TPWA 4D6HA 1IIHA 4W7VA 4Y9OA 1D8CA 4RNIA 4GYFA 3W7OA 4IGHA 4GINA 3KBMA 3W7GA 3ARSA 1QMLA 5IOBA 3IJ8A 3WBAA 3GKAA 3AAMA 1W9XA 4UFHA 5ABFA 1Q5MA 3VIMA 1WOAA 3QHNA 1E55A 2EBNA 3W7KA 2QVHA 4IMCA 1SW0A 4N9CA 3KL0A 3UWEA 1JF6A 2OZ3A 3MVTA 1EEPA 4RW5A 2R8WA 3V1PA 2C14A 5CC7A 2W62A 1EZ2A 3IWPA 4M51A 3M46A 2HISA 3EMQA 3LXAA 5CAHA 2VZTA 5F1VA 3W2MA 3DDMA 3TZNA 2OSXA 4PSPA 5JBEA 2PDFA 2PFHA 2Q01A 2FZNA 4GXMA 3MWCA 2GJLA 1R38A 3GG8A 1BVZA 2X0SA 4AY7A 3USBA 2I14A 1MO0A 4PTNA 2I5IA 3S1UA 4GUIA 4O8AA 3GLCA 3N73A 3H2AA 6REQA 2UWFA 4ENLA 1A5OC 3L4VA 4JKLA 4QJ5B 3IV8A 4W87A 1CI1A 1VQTA 3TUUA 2PLKA 1ME8A 2PD9A 4NYUA 4N6EA 5CKSA 3EDJA 3ARTA 3PBVA 1Q6LA 4DWSA 4R85A 1XLCA 3W1QA 1RHCA 4FF5A 2C18A 5BXSA 3AS0A 4FOJA 3PPCA 2R24A 5I3IA 2QPXA 3WEOA 4PCFA 1P7TB 4DRSA 8XIMA 1H0GA 2VELA 3T07A 1XQLA 2VD9A 1Q63A 1IE7C 4XZIA 2X05A 3O8AA 4J35A 3BMVA 3MDWA 3CV6A 4J5NA 3A4AA 4WDXA 5B80A 1KQYA 1VF8A 3VM7A 3KTCA 1JIBA 3GXTA 1FWDC 3RX4A 4H9YA 2E25A 4IIGA 1DJZA 3VGFA 5CJNA 5EB8A 4CCEA 4B2DD 4R34A 3UXKA 4DNHA 3NR0A 1DWHM 2QMJA 2E1WA 3RFAA 1ZU8A 2JGYA 3VNKA 4CN4A 1F6YA 3AQUA 3NQMA 4NAFB 3BXWA 5EKYA 1XIGA 2G8ZA 4PSRA 4S3FA 1FDJA 1Q6GA 5EMKA 3TYUA 3TVAA 4UBPC 3B8UA 4XIAA 4AZCA 3VOIA 1X1OA 2RDXA 2WM0A 4J3WA 2B81A 1OZQA 1XLIA 4S23A 4HU8A 4GNKB 3VIFA 2XWDA 3TJIA 5HOSA 1L6YA 4KMQA 1Q7ZA 3TW7A 1WPCA 5CSSA 1R7AA 3RM8A 2J9ZA 3C2VA 2OODA 4QTGA 1GG0A 2WSQA 1T8QA 1LRTA 1GONA 1HJVA 3WMLA 3CAVA 4JX6A 4UR7A 3QC3A 3AJXA 2PP0A 3QV9A 4JQ3A 1GVOA 1TYGA 4R5EA 4BR1A 2HV5A 2ZA1A 2YKKA 1GOMA 1JZ6A 2D22A 4W85A 4AD4A 3RG6A 1POJA 3VYLA 2Y7GA 3G1RA 3PAJA 3AU2A 3RUBL 1J2BA 3GG7A 3W1XA 2PTZA 3PBUA 1BGGA 1JCNA 2CBIA 4WK9A 3ITYA 3W87A 4FSAA 1IGSA 4RNHA 3CTLA 4O1DA 1R8LA 3AUOA 4FMVA 2BXZA 5E9XA 2YDQA 4YCOA 1E3ZA 1WB0A 1CTNA 3E2VA 1BXNA 1R3QA 3DFSA 2OWXA 3CV1A 2G3MA 5E6ZA 4LALA 1ITCA 2AMXA 4LBUA 2GJRA 1OYCA 5EU9A 1E0TA 2C71A 1VFTA 4GK8A 5KEZA 4PCNA 3N4EA 3REQA 4D8ZA 4Y6GA 2WHKA 1J10A 3W24A 4ZOEA 1R3RA 4EF9A 1JEZA 2IS7A 4E2VA 5FJUA 1T40A 5D02A 3P0WA 1F8MA 2PZ0A 1JPDX 2QPUA 3QGKC 3NM1A 3O06A 2IXVA 3RNDA 1B9BA 2F8QA 3I10A 1OCJA 2DZUA 2PDMA 2OO0A 3VK5A 3ABRA 1J0ZA 4JX4A 3GNOA 4AZGA 1OCBA 3BJFA 1TCMA 3K4AA 2F6KA 4Q4MA 4DXVA 4YYCA 1EUNA 1O5XA 1YKWA 4ZL1A 1B4KA 2WMIA 4XZNX 1EJRC 3FYYA 1UMYA 3UCCA 1XLAA 1P43A 4A21A 4LV9A 1OF8A 1W17A 2BHZA 1EJWC 1B3YA 1R47A 2O56A 3LTPA 3WUGA 3O1NA 4S2BA 3A47A 1CPUA 1E71M 4REQB 3P81A 4E8DA 4P7RA 2DY3A 4JTFA 4PODA 2YBUA 2GDQA 4CQBA 1CENA 4IPLA 1C8XA 2VJXA 4DJDC 4QDPA 4GCAA 2XG9A 4I9AA 1PEZA 3QY8A 5LIKX 3N9SA 2QUVA 4XK2A 3OZOA 2DQXA 2G95A 1LL4A 3B8WA 4A3RA 4LYPA 3L9CA 4I6VA 5G2WA 2X0YA 3PZTA 4YMZA 1H61A 1OWQA 3EEGA 2BSLA 4C6LA 4OUEA 4WEVX 4MHBA 1E72M 2DZBA 4KT2A 4FXSA 3ANUA 3VINA 1MDLA 3ZJ7A 2VEPA 5GNZA 3VAVA 5D2TA 1CGXA 3G77A 2UBPC 3AOFA 2ZRUA 3P7YA 1W54A 3URAA 5BXPA 4EWND 3H26A 1AA1B 3F2BA 3GFZA 2VO5A 2D69A 1KLYA 5IDZA 3WH9A 3NPXA 3E0WA 4GJJA 4LY8A 5CBBA 1F6PA 3M0KA 1XLHA 2WMFA 4CVUA 4UTWA 5FI8A 2QCMA 3OG2A 4KERA 3S5SA 4BQ4A 3O6DA 3S1XA 1ENUA 1H7RA 1YE6A 1ZY9A 1XDJA 4ZB5A 3UWVA 4HJWA 1GVIA 1WCGA 1Z7AA 1NOFA 4H6RA 2OKOA 1KWGA 2J8TA 3IUIA 3SUWA 5D4YA 1EH9A 3LDVA 1R3YA 2WVSA 2OYMA 5HWJA 1TZZA 3BLLA 4JDBA 3UWQA 3MKCA 2GYIA 4Z2HA 4ZODA 3QFWA 3RN6A 2YIHA 2DV0A 4D8AA 5AYBA 3C2FA 3VX1A 4I7VA 4WRHA 1KKRA 4ZGYA 1X6UA 3I6TA 4E38A 3DG3A 3AALA 1PKNA 4D6EA 4DYEA 1EKOA 2GVGA 2BB0A 4CNTA 4TV5A 2GSEA 5EFDA 3EDDA 2CLIA 3L21A 3BLIA 1GZGA 5JH2A 4O57A 3TLLA 3GQYA 2HXUA 1TUXA 4GGHA 3VD7A 3PZ9A 5BOFA 1Q85A 2PSNA 2I56A 2AQVA 2VWTA 2YCLB 1JF5A 1C92A 4G1NA 4XAYA 4JFTA 3GH7A 2JKPA 4F79A 1GW1A 2VDGA 1FRBA 1TRDA 1FWJC 3AYVA 4PMYA 1FHVA 4Q22A 3WJSA 1ZPTA 3FNDA 5F2GA 4O19A 2X41A 3KUMA 5DLCA 2QJMA 4A3HA 3B8TA 3USZA 3P6LA 3N6JA 3OHIA 3LPPA 4V28A 2O0TA 3MHGA 3G8EA 2C8NA 3GBDA 3QLLA 1X1NA 4GKTA 3G1DA 4HCLA 3W1UA 2XM2A 2ZX8A 4BQ2A 3UXAA 1Y5WA 1CLVA 5LHEA 1V79A 2E7FA 4KIEA 3MUXA 2ACSA 3BLDA 3IJDA 1FDYA 4KIRA 3TNBA 1JI2A 1Q66A 1XGEA 4U3CA 4KKXA 5G1YA 1KTNA 1AFSA 5HQEA 4WY0A 5AHIA 4H9UA 4UUIA 4IISA 4DF0A 2FTWA 4L64A 2J25A 3MO7A 1OFAA 3H2FA 1N82A 2HJPA 2FH8A 2BZNA 2ZDRA 1F61A 2YR1A 1QW7A 4XQ6A 2R91A 4J9JA 4M24A 3GTHA 4OTKA 4BS0A 3RMEA 4PFMA 1BFNA 3WQWA 1FWAC 5DY2A 2A6NA 3SGGA 3IVSA 1OC6A 1JR1A 1XRVA 4W8BA 4UMBA 2VZUA 1Z9AA 1P7TA 2WW5A 1C29A 1TV3A 1H7OA 4RZ6A 1XIDA 2OQLA 3LXCA 4Y9AA 4CD6A 1KFJA 3TFCA 1VC4A 1I60A 2QIIA 2YX0A 3N2CA 3IACA 1ISVA 1XM3A 4H9TA 3WLNA 4XVDA 1KFWA 3QSTA 3WDPP 2XISA 1F7BA 3W7EA 1EF3A 3E0VA 1B3ZA 1W5OA 1ZCCA 3QF0A 4JAWA 4MWAE 4Q7NA 5BROA 4PBEA 3AMGA 3UW6A 2YGYA 3ZWTA 3GX9A 3UQNA 3TQVA 3TOYA 4D6JA 3UG4A 1XBVA 4AUBA 1KO0A 1V02E 1OINA 1ADDA 4AXKA 1E9IA 1QOPA 3HO8A 3KP0A 4HA3A 3RM4A 1TPH1 5CZKA 2VEFA 2UV8G 3P93A 2ZTKA 1KV8A 1RVGA 4JKKA 1HKJA 2BGNE 4ZOAA 4Y9NA 1V6VA 3SQSA 3K2GA 2CBJA 4JTEA 3T44A 3LCXA 4JTUA 1H09A 3WQOA 3QQWA 4ZQCA 1RBAA 2B7QA 4E3VA 1YPFA 1MVYA 5EMMA 1UWUA 4IF2A 3APGA 4WDWA 3PPFA 4JTRA 2HDJA 1SR0A 1YPIA 4Q4OA 1PPIA 2VUYA 1ML1A 3C2YA 2IQDA 1W5QA 3O2LA 1X6NA 4H2HA 3TNOA 4ERAA 5I7GA 5CXPA 4H8HA 5AB3A 2XM1A 4LNYA 4CNPA 4C6QA 4AIOA 1WDSA 3CS2A 2NVAA 2R82A 5DY3A 1G4SA 2Y7EA 4UZSA 5I24A 4AD1A 4HOXA 5HWNA 3G1AA 3IVUA 4ICMA 4Q4KA 3T0BA 3A23A 3D5HA 3UY8A 3MYOA 3PZVA 4MZ8A 2CW6A 3WLOA 4JGDA 3WJYA 1SZFA 2QCDA 4B5UA 3AI0A 3WNKA 1GCYA 3DKJA 3IJ7A 1O68A 1TTQA 3P60A 2R1KA 4M80A 2FIQA 3R6IA 4MNMA 1K4GA 2EKGA 1P6WA 4CNOA 1QR7A 3IJIA 1L8NA 2CU0A 2QR6A 4CKQA 1J2WA 1O4UA 4YYFA 1JPKA 4IX2A 2VC7A 4JDYA 2YZ5A 3PN8A 4AVOA 4JCMA 4U2YA 3V75A 4JTLA 4L6OA 4UWMA 3SW6A 1W1A1 1B2YA 1YXYA 1FKXA 3ENLA 1UKPA 3SCNA 1JDDA 3F7JA 1S1PA 3W7RA 3WDIA 1VRXA 4F0KA 2RGLA 2NUYA 1OADA 1NDYA 1ZS2A 3ONBA 3T09A 1EA0A 3VIJA 1FXQA 3LGDA 4NZJA 3H22A 2OMAA 1W5NA 3G0UA 2X0HA 3R4IA 3FJNA 4IQEA 2XDFA 1W91A 5M17A 4JL1A 1Q4WA 4RE4A 9XIMA 3CGTA 1GPFA 4QEHA 1H1YA 4C6OA 1OGBA 4ZB0A 5EGRA 1DIKA 4RXGA 1GHRA 2J77A 2PDPA 1OCNA 1TTJA 4AZIA 3CMFA 2CZVA 2OVLA 1ONRA 1E6PA 1XLGA 3DESA 5MF5A 3QJAA 1S5WA 1THFD 4WJXA 2E3ZA 4WOZA 5GJNA 1EOMA 3BAYA 4DO4A 1US0A 3W1MA 4BCEA 3DERA 2VC5A 4LCSA 4RDZA 1AJ0A 3BZJA 4Z1BA 1XIMA 2IPFA 1QI4A 3GVQA 3HBLA 1K8XA 5LIWX 4HK7A 4PCSA 2DZTA 1PWLA 1BRLB 2XYLA 3U9IA 1OGSA 2BHUA 2UY3A 5HJXA 3S5YA 2JIEA 3CEUA 3QY6A 3STCA 9CGTA 1J12A 3KBJA 4OU1A 3MI6A 3V0SA 1BYCA 1Q8AA 4L1XA 2G41A 1Z3NA 5XINA 2FGBA 2OEMA 1XYZA 1F8IA 1F05A 1TPFA 3P0XA 1O5RA 3O7UA 4XZWA 4AYSA 3JUGA 4QCEA 3CQKA 1UD6A 5HJLA 4JOMA 3EOLA 4GUHA 1GOIA 1ZLPA 4GXPA 2CERA 3VNJA 3W9ZA 4MNLA 3QH2A 4YWIA 3A9BA 3AXKA 4RK8A 4DO7A 3P82A 4CNNA 3GUGA 4G7FA 2VEIA 1CNVA 3AXXA 4WKAA 1XBXA 2V3DA 4P7QA 4XD4A 4GIAA 4BK9A 4UZUA 1DJQA 3MSGA 5G4HC 3UYCA 3P67A 4ROQA 2E5BA 1F73A 3VI2A 4CNUA 4HA0A 2J7GA 1YBQB 2EGZA 1G6CA 5HR6A 1PUDA 1XP3A 1H3GA 3THQA 1JGIA 4B5VA 1E4IA 2BASA 4I9TA 3OPSA 3K46A 4Q33A 2QUNA 3ID7A 1M5WA 5FJJA 5BXTA 1P0BA 1V93A 1OM0A 5HDRA 3BCDA 2RGMA 5C55A 1H63A 1R86A 4HN4A 4PMOA 3W28A 4E8GA 1UD4A 4Z08A 3VNLA 2ZC8A 2YCLA 3TK7A 3LTSA 4S3JA 4HZMA 2CLMA 4FOKA 2FJKA 3NL2A 4QGCA 3GWQA 1WX0A 4LBRA 2BOGX 1JDCA 3LCIA 4IZGA 4M81A 3M7SA 4QDWA 5LA2A 4XBJA 3CH9A 3W26A 5HULA 3TU9A 2YXOA 1DBTA 4DF1A 3HGRA 3BV7A 5IRPA 4XISA 4R9OA 1EIXA 4J3UA 3LCGA 4YTUA 9RUBA 1BHGA 3KWSA 1LQ2A 1X6LA 1NVMA 1TTPA 3NUKA 1PE1A 4R9XA 4GBDA 4I6KA 2QVNA 3ZJ6A 1VIZA 5A6BA 4N4QA 2OWWA 1DE5A 4YLWA 4TVDA 3JW7A 2YDRA 4M7SA 1JPHA 1OZMA 1A50A 5IDIA 2I5GA 2C0AA 2J4GA 4C7GA 4QRNA 1AW1A 4M6UA 1W3TA 5CAKA 2P50A 2JF7A 1O7AA 5HQLA 3S2CA 2V3FA 3CTTA 1YDYA 2Y7FA 4IJRA 4LAKA 3T42A 2NV9A 1JPMA 1F74A 3LI0A 5FEWA 5CEWA 4QS6A 3CU2A 3TXZA 1FP8A 4P2VA 1GQLA 2L5HA 3R13A 3AIEA 3LEPA 4H83A 4O53A 1WDDA 1MQPA 4IX0A 4LSBA 2E09A 4IPJA 4ZSTA 5E09A 3URQA 1V0MA 4JYFA 4C6KA 4D1IA 1LT8A 1VZWA 5K4XA 5AYIA 1FWIC 3GH4A 4YWSA 1VYRA 2FZBA 1JL8A 3JR2A 3PBWA 1HZYA 4F48A 1JD7A 5BOEA 1FA2A 2PAJA 3BLPX 2XUCA 2AGTA 4QQUA 5JIPA 1HP5A 3TJLA 1L8PA 3D3FA 3EGJA 3HPFA 1LROA 2BMBA 4Y9MA 3ZZ1A 5TD4A 4JIPA 4BI6A 2GLKA 3OVGA 4LUSB 4O17A 4NU7A 4QJ4B 3D6NA 3TYDA 1XJBA 4M1BA 4WXZA 2VR5A 2J7FA 1DKWA 1SU5A 1K6WA 1KM0A 5EFFA 3LENA 2CPUA 4IMDA 2ISWA 4HCHA 5I77A 2GPTA 1F07A 3NAVA 5I00A 1R0MA 4M3PA 4MWAA 4HZ7A 3Q37A 1EC9A 2WXDM 3UP8A 1TCDA 1QNPA 1PVNA 1E1EA 1MFVA 2PCQA 1V02A 5A6MA 1W2VA 3GHTA 3V1HA 2W63A 2VQUA 3E5BA 1WDQA 2H9AA 8RUCA 4PCPA 1E5NA 1XGZA 5J8LA 2Y5JA 4I5UA 4R7WA 2HVNA 5KZDA 5GPRA 1EDTA 3EKLA 2PZNA 5E6YA 3OOQA 3CLWA 3L2IA 4FR1A 2FB2A 4QLJA 1EC7A 4RE2A 4UTFA 3VM5A 4QJ1A 3CUHA 4IOTA 3NQVA 1EOKA 1JNDA 1XSKA 4PUDA 3ZMRA 1YNPA 4AAJA 2WVVA 3ECQA 3EMCA 5JVLA 1W3IA 4A8RA 1RD5A 4RZBA 1NQ6A 3WH6A 3FA4A 1FDZA 2ZXDA 4WIWA 5HUPA 2HTMA 3SAZA 4OECA 4UTMA 3RJYA 4MB4A 1WO2A 1GJUA 1PS9A 4RZ5A 2G3NA 2RUSA 4AIEA 5K9CA 4IL2A 4A2SA 1HUVA 3KFTA 1XIJA 4J1OA 3PY2A 2MNRA 2CBUA 5I03A 2GGJA 2BODX 2FPTA 3C2RA 5LNSA 3VD3A 3AYRA 3ITTA 1I0BA 1QBBA 3POCA 4O8RA 4GIEA 4WSJA 4EPDC 2PRLA 4POCA 1X38A 4DYJA 3L66A 1H62A 3S42A 2OYKA 2WC3A 2ESCA 3M7WA 1EHAA 4KFNA 3O15A 3WN6A 4CGTA 1V3IA 4Q6XA 3CAQA 1VBRA 5C2XA 3F4WA 1Q6DA 2QCNA 3A5FA 4ZSUA 4HOWA 3VD5A 3EPMA 2PC8A 3RPMA 1LWIA 1J8VA 3QHMA 4QLKA 1CGUA 5G2HA 4PB4A 3F4VA 1GOQA 1NF7A 3LXBA 1S2CA 3DFOA 3W0KA 3EX1A 4FXRA 4PMVA 2DW7A 3HPZA 2PP3A 1V6UA 1SFJA 1S2VA 3T0TA 1PCKA 4Z1YA 3F1QA 2GVEA 2FVMA 4J7RA 1W9DM 1VGAA 3AC0A 4C6MA 4DELA 4D6IA 1ZBWA 1EO7A 2BGQA 3FS2A 4XZBA 3S6OA 2PB1A 4QCFA 1TVPA 3BOLA 3BOXA 3CL7A 1I8JA 2W91A 3M0YA 3UU0A 3MS8A 3HPXA 4GY1A 1TV5A 2GGGA 2CFFA 2QIWA 3BL3A 1TV7A 2PUZA 1RBLA 4UOJA 1IEQA 3MVIA 3GNDA 4UTLA 3W02A 2QDHA 1QCWA 1UKSA 1UD2A 1ZCOA 3NVDA 1JUBA 1SSGA 1EJ7L 1EJXC 4AZ7A 3NSMA 3KOFA 4A3QA 1CXEA 1BRLA 3M5ZA 3V3WA 4EOUA 3LQGA 2NXHA 2E6YA 1TIWA 4DIAA 4Y96A 3QLDA 4O1FA 3VCNA 3HOJA 1ZGDA 1WKYA 2X40A 4ZCWA 2CLPA 1Q6QA 4JL2A 5G1MA 1EDQA 4ORIA 1KCLA 4HCDA 1TMLA 2V2DA 2QYGA 4YL2A 2PDGA 1QI0A 4GVHA 2OJPA 1TJ1A 4FK9A 1IT0A 3T55A 1HNYA 3TJXA 4AFYA 4MWAD 2V67A 4K7YA 1Q45A 3GDKA 3IPWA 1M6JA 3H2OA 3B03A 2V2HA 1REQA 2Z1BA 1PSCA 4G9PA 4NUWA 5C9RA 2Z0IA 2J8GA 3GVVA 4KRUA 3KHDA 4QEEA 3KL5A 2PDHA 1Q6EA 4JYDA 3IS4A 3L4WA 4YPJA 2V63A 2H3BA 3UD6A 3AIBA 3NXLA 2ZCGA 2J6XA 2ODOA 2FTPA 2EPMX 1BVNP 5LYRA 4B5XA 4MDOA 1V3JA 3O6YX 4GUGA 1LRNA 2HBVA 2V69A 1S5VA 3LYEA 1R2SA 3B8VA 2F38A 1WKFA 5A8PA 1E51A 1AZ1A 3SBFA 4GIRA 4QG6A 4NZ3A 3T40A 7PTDA 5TIMA 2OQHA 3MA8A 4UFJA 3I7QA 3QV7A 3R7MA 3HGSA 1JDEA 3OBKA 2PCEA 3LCWA 3BURA 3QY7A 1KCKA 1XQKA 4HU4A 4UTJA 4Q32A 3H6OA 3PNZA 2PURA 3O05A 5FF2A 1Z48A 1LF1A 3RYSA 5AFDA 1FWSA 2J7EA 3TA9A 1KM6A 3AYSA 1MEWA 4HQVA 3PPGA 1K8YA 2IUZA 2WNWA 4NZ5A 4G56A 2VUNA 2AL2B 3NIYA 2YFOA 3SCQA 3RILA 2PWHA 4CQCA 1E56A 3B8IA 4KRZA 2NVCA 3LHYA 5H2ZA 1AMKA 2V0TA 1WXYA 2INEA 4Z2KA 1A5CA 4B91A 4LTSA 4BF7A 4PTDA 1W1B1 3RLGA 5CSUA 3GE7A 2QJGA 3OP2A 1S2AA 3L0KA 2BG5A 1LL7A 2DZWA 3VC6A 3A12A 3QZ6A 5GJMA 5ECVA 2CZEA 1TO3A 5FJOA 4HA4A 2V8ZA 2W79A 1ISXA 1V0NA 2XGBA 3EZ4A 4YU1A 2D0HA 4Z1AA 2BFGA 4DUVA 4LCQA 4GH3A 3WNLA 5LA0A 2XIMA 4MSSA 2QCFA 4MB1A 5CCZA 1QDSA 3GD6A 4ASTA 4BKNA 3CUZA 3ZWSA 3P62A 2A5HA 1TJ2A 3WJXA 2EPOA 3EXRA 4PZVA 3MWAA 5D03A 2PWUA 4PMJA 1CDGA 3UG5A 1NFGA 4GQBA 4DF2A 4O0KA 2WZEA 3CBWA 2REQB 1POKA 4JEQA 3YPIA 6XIAA 1NAL1 1NTHA 3HG2A 2I9UA 4N2YA 4DXKA 4LYQA 3PANA 1JXKA 3G0XA 4NRRA 3MTWA 4L6DA 1UZDA 4GXWA 2WCGA 1MMFA 2DU2A 1V8EA 1YDVA 2PTXA 2J8FA 3G5EA 3AMCA 5A2BA 3MSYA 1XC4A 2OOGA 4Q4QA 5FL1A 1OJXA 4LUSA 1UG6A 3A64A 2P5NA 4AY8A 1SMAA 1YW1A 5DT7A 4GH1A 1V7AA 1WUFA 4FIQA 4QXIA 1K7EA 4ALDA 3A13A 4H3DA 1OK6A 2QT3A 2V81A 4IMGA 2WLZA 7A3HA 3H2EA 3EWCA 3MJYA 1J79A 3TMLA 2C13A 4P8XA 2HS6A 4XX6A 3T81A 3TW6A 1GQIA 4OBTA 2J79A 3G3DA 1PJ9A 3BICA 3SRDA 2ZX6A 3EYPA 5D2YA 1JDFA 1O5KA 3W1RA 3M47A 3W81A 3I68A 1KM1A 3SIZA 4D6CA 2FHBA 1LYXA 1MFUA 2ZYFA 1YTDA 3NQFA 1SUXA 2X1SA 3DUGA 2TAAA 4IJCA 4IQJA 4HK6A 3W7MA 3M5YA 4HNCA 3VZYA 4BJHA 4C6NA 4ZFMA 4TQTA 4C1NA 2FDSA 3W07A 3N3MA 3AU6A 3UG3A 4BWLC 3NPWA 1RD6A 3MKVA 3BW4A 1R3WA 4YNGA 1BG4A 4EE9A 3EB2A 2IXUA 3CLMA 1RH9A 3IGHX 4MADA 3PJXA 3KLKA 3CEPA 2ZUSA 1P6CA 2PBGA 3UF9A 3CZEA 3RPTA 2ZTJA 1TZ7A 3ABOA 4AWSA 4MNKA 4KGLA 4D6FA 4M1RA 4Z1DA 1PB0A 2PWVA 1XFBA 1P4CA 2C0HA 3R8GA 1EP1A 2ZA2A 1EFZA 4EAYA 4GVFA 1UUOA 2H90A 3NQAA 5HK4A 3GU1A 4H4IA 3OLIA 3TTQA 4GUJA 1TX0A 3F03K 1E4NA 3WNMA 3L5LA 2VFHA 3SUTA 1ISYA 3KCOA 1SO3A 5BRBA 2WKJA 3AMLA 1XUZA 3LBOA 2QNEA 2A21A 4B3ZA 1RJRA 1UZ4A 1V5XA 3NOYA 2BX7A 1YADA 1CGTA 1P0DA 3CUJA 3CZJA 4A3YA 4F2BA 2DZAA 2FPYA 5IHSA 1Z42A 3H12A 3E1F1 3NG3A 3MCMA 4LRTA 1H5VA 3RJXA 4TX6A 4W88A 3FJLA 4LAOA 5U7SA 2Z6IA 3SCWA 1ITQA 2FLIA 4S3KA 2JGQA 2G0WA 4J3XA 5IBXA 3F5LA 5G4EA 3HGJA 2XJ7A 4ATWA 1V6WA 2Z00A 3LV6A 1C91A 3VKAA 1JG9A 3COTA 3LK6A 2JFEX 2HZGA 4EKJA 3OA3A 3L67A 3S5OA 4G2DA 2GWGA 1VCFA 1H0IA 1L6SA 2BV9A 4U2ZA 5LXEA 3UNDA 4A3UA 4O14A 1KTCA 1JVNA 3LNMA 1IGWA 1B90A 1TV4A 3KVLA 4QAIA 1KLZA 1CLKA 4I7WA 4RLIA 4NVTA 3KOZA 1H60A 3W3OA 2FMOA 3PF3A 4L7ZA 2XVKA 3WKZA 1SJAA 5AECA 2Y8VA 4AD0A 3CQHA 1JRBA 3FXYA 3M5XA 3L2MA 4JZ5A 5D9MA 3ABSA 2FKPA 3KVMA 4GO8A 1BXBA 3LZ3A 3PR2A 1M03A 1B1YA 2QHAA 1B3VA 1UJPA 1A0CA 5I23A 2NQJA 4ATLA 1L6GA 3ABZA 4D71A 4Z2IA 1OX4B 1RK5A 4GRSA 4HNUA 4H1ZA 3EWBX 1T0OA 1RJPA 2RJHA 2AOSA 5CSRA 1FWWA 1MDRA 3BCFA 3M44A 5I09A 4AISA 3RCMA 3AHYA 3DI1A 1V6XA 3EDKA 4ERIA 5FIPA 1SW7A 4LRSA 2YPIA 2IQ0A 4JTQA 4AH7A 2WHLA 3B40A 4MLJA 4Q4PA 5BWFA 4TMBA 5CH9A 3TXVA 1NWUA 3S83A 3OQ8A 5D33A 1GWJA 1N55A 3AZRA 2GVLA 2XSBA 1LORA 1IXOA 1QI2A 3KZSA 5C70A 3RAOA 4QP0A 2ZZ3A 2BLEA 3ORWA 4LS2A 1A3WA 3DZ1A 1UWRA 3B3DA 7TAAA 2A7NA 2WSKA 3BH4A 1FWRA 4DHGA 4D1JA 3DCPA 2VX4A 1DTUA 4M7TA 2ISDA 4KFPA 2Z27A 1UIPA 3FGCB 5IM51 3WH5A 1X98A 2W27A 4AZBA 3IJ6A 5DMMA 4FIRA 5A6TC 3S8HA 1V3HA 3GXMA 1IHIA 3CAWA 4C91A 4K68A 1QU4A 5F4XA 1JCMP 1K1DA 1Y7VA 3KAOA 1QVBA 4ZXOA 2Q8XA 1FH8A 1OCQA 2J13A 1RR2A 1XCXA 1XLDA 1S39A 1XH1A 2F6XA 4JTHA 5HMDA 3QZEA 3N25A 1US3A 3RCNA 5B7YA 5CJ5A 2I57A 4UTUA 2PDLA 1M7JA 1E0XA 3QPZA 4MLRA 4HPGA 4ERGA 1DIOA 2ONEA 3UERA 2Y7DA 3DFPA 4F3HA 3KS5A 4AX7A 2CZ5A 5IHRA 3DENA 3ZLHA 1KXQA 1G94A 3THCA 3UWUA 3W70A 2ZKMX 3EXTA 3TE9A 2CIPA 4P7OA 3WQDA 3W7CA 1C8VA 4WSKA 1OC5A 4JTCA 5F2MA 3GXFA 1XKYA 1PO9A 2DZVA 2ZE0A 4JIEA 1R30A 3EX6A 3WYZA 4IIEA 4RX0A 5EBAA 3B9AA 2HPIA 2ATMA 4ZO7A 4Y9PA 5A6KA 5A6JA 1JCTA 4IMEA 3VUSA 1E40A 2D20A 3ARRA 4H2CA 2REQA 3B8DA 1WV2A 4FF7A 4MAVA 2PDXA 1LJYA 4GY0A 1GYMA 2CYGA 3QW4B 1GPWA 1S5MA 2PWFA 4C6DA 2G97A 3BOFA 1C90A 7CGTA 2IMRA 1IR2A 3BDKA 3EOEA 1FKWA 5GQBA 4AD3A 1RQHA 3W1LA 1SJDA 3QW3A 4IPNB 2VZOA 1KR1A 3GG0A 5T8GA 4AWUA 2E6AA 3HG4A 1VFMA 5HAOA 2CKSA 1QOQA 3MC5A 3GAKA 5DMLA 2DVTA 3CB3A 3RLVA 2HROA 1LG2A 3W7IA 3UFYA 3MUCA 2YBVA 3IIXA 5KZEA 3BSHA 4KH2A 4XB3A 3U2OA 3W88A 4WXYA 1CX9A 7ODCA 1AQFA 1UUMA 3VGHA 1LUCB 5ABHA 1V51A 4FX8A 2CHRA 3W23A 3U7BA 1QPRA 2QCGA 1XHGA 3LD5A 1BSLA 5JH1A 3L68A 1D9EA 4OHQA 4ZXLA 2IKIA 5AYZA 1XUUA 2J7DA 3LHWA 1TUFA 3BJTA 4P8VA 4H04A 1KNWA 1B5TA 3W37A 1VFOA 3GG1A 1T41A 4ZA0A 4W84A 3FA5A 4HOZA 4GZEA 1HT6A 2ZUNA 1GNXA 1FH9A 5PTDA 1U30A 3S6DA 1EBHA 1R87A 1XIIA 1LLOA 4GVIA 4ML9A 3IIOA 1DWIM 5FSEC 3LBCA 3M07A 3LB0A 1H4PA 3N34A 3HURA 4H7VA 3WQFA 1O5QA 1D3HA 3L0GA 1HVXA 4PMNA 1AL8A 2ADAA 1KM4A 1HKMA 4PGLA 3HPAA 1F3XA 1J9YA 3GTXA 3GIYA 2I7GA 2VD8A 1DQUA 5JU6A 1U22A 4ZB2A 1QUMA 2BVWA 4PB5A 2OT1A 1W32A 3AROA 6REQB 4GX9A 4JNYA 5FCZA 2POZA 3WG6A 1AW2A 1TB3A 2A85A 2VMFA 2OEJA 3UBPC 4U33A 3UT0A 3SCRA 3V5FA 1UR9A 1VBJA 1TR1A 4MG4A 3VOCA 3VOJA 1A5KC 1U1JA 1RBOB 2DSKA 1A0EA 5AN7A 4DWSB 4FR6A 3W25A 3JZUA 1AQMA 3UJEA 3I3DA 3FEMA 4ZBCA 3GNRA 1ZJAA 1SQ7A 2VI0A 3E74A 4EK7A 1XXXA 2IKJA 1Z89A 5CC5A 3A22A 4PMQA 3ALGA 3MMWA 4UIOA 2XVNA 4RZ4A 3MBFA 3W83A 3K30A 1SM9A 3TP4A 3GDTA 1BEUA 1PTDA 5BMXA 2EG6A 5EMJA 4WGXA 4RNJA 2YXXA 1HFBA 3AIUA 1WXJA 5KTLA 3PZOA 3UESA 4GI6A 1P0NA 2WZMA 3VA8A 3SB0A 2PS2A 3N9KA 4UNIA 3IAPA 1XIEA 5H8MA 1NFPA 2UZ9A 3CO8A 2Y0FA 5KMYA 3GC2A 3A4JA 5BZAA 1CBGA 4CD4A 1U33A 3UETA 3VOGA 1MUWA 4A6GA 4AZCB 1JFHA 7TIMA 2E9MA 3MP5A 4HMNA 1Z8AA 2FVKA 3VZZA 3OJGA 1HKWA 2OEKA 5FF7A 3STGA 2YA1A 1QRQA 4DWSC 3TYCA 1EIBA 2ZUTA 2V3EA 2YW4A 1D7KA 3EA3A 1FBAA 2HE5A 2B7OA 3NVTA 3ZSSA 1HJSA 1HKKA 3H54A 1WNOA 3BGJA 2WNZA 2YCIX 4TV6A 3KCJA 2XIJA 3OGVA 3PTKA 4CCCA 2XH7A 1JYNA 3M41A 2ZZ1A 3IK4A 3EB3A 2WJZA 3D3AA 2PRMA 1OEPA 1OYBA 5REQA 3ITLA 1Y65A 1GOKA 1UWTA 1Q7QA 1KXHA 3RO8A 3O6CA 3WQ5A 4IPPA 4GGBA 5TF0A 2VP8A 2INFA 3UJSA 1KTBA 1VB9A 5T91A 1OD0A 8CGTA 2VTFA 3H4XA 1KV5A 3GR7A 1OX4A 1HG3A 3LQLA 3OLGA 4NAEA 1I0DA 5C9WA 4KEMA 1M1BA 3INPA 4FHAA 5B7ZA 1DJIA 2XIBA 3KOWA 1A3XA 3FOKA 1DTNA 4A05A 1EHNA 3CV2A 3QOMA 3REQB 4HJFA 3BG5A 1PIIA 2OZ8A 1BYBA 3WMBA 1V08A 3KL3A 3HJEA 3CXOA 1W0MA 1UQZA 2GQ9A 1HN1A 1PZ1A 3EB4A 3TYZA 1XW8A 1QI5A 2ON3A 1MEHA 3CYVA 2E67A 3NQCA 1KBJA 5CPTA 1Q4NX 4MYAA 1QNRA 3VNZA 3BG9A 5ABTA 5A5WA 1OFPA 1LCOA 1MWOA 3HQNA 1EX1A 1JYXA 2DJXA 3UZWA 1SR9A 2OPJA 1DEDA 2I5QA 3UA4A 4NRSA 5K4ZA 4CUCA 4UXDA 4H9ZA 3CK5A 3L0NA 3MHFA 1W1IE 2GUYA 4NF7A 4P5UA 1QASA 2YYTA 2Y89A 2WCSA 4AB4A 4MJMA 3FGCA 4N9EA 4F40A 2VX5A 4I3GA 1AMYA 2GSHA 1FHUA 4BFAA 1CCWB 2ZRYA 3WUFA 5LIYX 4MOZA 1E9LA 1UR1A 4GUFA 3TAOA 1TZ9A 1I2OA 1A3HA 3VDGA 3VC5A 3V16A 4HP5A 2NV1A 2PDBA 3TTSA 3UYIA 1TSIA 4A8NA 2W0UA 3AZTA 1HKVA 5CGQA 1IT8A 1YPXA 2NUXA 2QF8A 1F3TA 4QJ3B 2E8YA 3RRAA 1M41A 4N02A 3WD4A 4BA0A 1VR6A 2I1OA 1DOSA 2ZE3A 4JQ2A 4K37A 1PHQA 1PZ2A 3I6EA 1I45A 5D04C 4WDTA 1JQXA 3PG9A 5A1AA 4QAWA 4JEJA 3A21A 3B04A 1UB3A 5AHFA 1JULA 4MKVA 2HVMA 1WZKA 1ICQA 3GDRA 3TEVA 2WOQA 1VEMA 2D23A 3HPSA 4J3TA 1ECEA 5LKYA 2WM1A 2NUWA 3LG3A 4GFIA 4C6CA 3SRKA 2P3ZA 2JKAA 1GVSA 1J93A 1ICPA 2WSRA 1EEXA 1JYVA 1J5SA 5CJMA 3EWXA 3HV8A 3IRDA 1ZBKA 2BS9A 4HBKA 2Z6JA 1ONWA 4S39A 4O12A 1AG1O 1QHZA 1G67A 2P8CA 3KOYA 1G01A 3B4UA 3B0YA 1S3HA 3ZLFA 3UR8A 5AHEA 1NOWA 1IEXA 3MUY1 4UFMA 1DV7A 3SIMA 4UQDA 4GC4A 3UZJA 3U7VA 4BQ3A 4S38A 3MU7A 3MMDA 2PDKA 2WQDA 2OGYA 2D0GA 3BANA 1JCJA 3GW0A 1NDVA 4CQ8A 2PWDA 3R2GA 3VMPA 4HGXA 4XUYA 1S1RA 1BXCA 2QJNA 5DX7A 1AD1A 1MRAA 4NG3A 1W3JA 2YDSA 2IKHA 1VPYA 4Q8QA 3NQEA 2HE8A 2X2YA 3WBXA 2RDTA 1LUCA 3TTEA 3WZ0E 3QPEA 1YYAA 2B7PA 1T99A 1NWRA 1UQYA 3HFTA 3QZAA 3M64A 1WOBA 3GY1A 3AZSA 2QULA 3HQOA 2ACRA 4UTWC 3O63A 4F0MA 4JBRA 4ROPA 4LY4A 2OXNA 2AQOA 2XTKA 3TONA 4GVGA 2A2IA 5LGXA 4M6VA 4HHPA 3PSWA 3FHQA 4GNVA 4Z2LA 4PULA 1SGJA 5A8MA 2GOUA 4QE5A 3H7RA 1RY8A 2GQ8A 1K70A 1QW8A 4LAZA 4ILSA 1A0DA 3IEBA 4GYJA 2WWDA 2YL6A 1HO4A 2R1PA 4LCRA 1W5MA 4GIYA 3UPBA 4B3KA 3BAXA 2R1NA 5C9ZA 1G4EA 1KBLA 3GM8A 1ZENA 2GVYA 5K9DA 1IZKA 3J7HA 1M7OA 1GVYA 3IVTA 4IWWA 3PB2A 5ABEA 2BP1A 3GC5A 4WY0B 4CCZA 2JKEA 3LNPA 2VFEA 3M0XA 2QCLA 1UKOA 4MY8A 1MI3A 4WDUA 1J18A 4HTBA 3WCZA 1K6AA 3C61A 1DJGA 1GVEA 3PZQA 4UOQA 2OSWA 4B5WA 3U0HA 5FEPA 4HPXA 1Z32X 3S2MA 2EPNA 1KC7A 1ZZMA 3R43A 3B4YA 1J4EA 2X09A 2QEZA 2DFAA 1RZMA 2ZFAA 4IGNA 3VOHA 2D1ZA 3S9YA 1VHCA 6ENLA 3GXNA 1BWLA 5DN1A 2ZXQA 4YIWA 4LT9A 2RH9A 5D2VA 2XZ9A 1GG1A 2DT0A 5FF3A 4R88A 4S3EA 1U5HA 2NT1A 3WF2A 4DUXA 1AJ2A 4QE1A 2DW6A 4B5TA 4O16A 3IJQA 1VFUA 4ADSA 3KBWA 1B3XA 2CITA 3NCOA 4JIRA 2A79A 1E5JA 4MM1A 3UGRA 4JFVA 3NSXA 4ZQMA 3NFUA 5FJIA 1B4EA 4X9YA 1TPDA 4HHMA 1AUSL 3TH6A 1DWGM 2GQ3A 3IK2A 5HR7A 2YCEA 3W82A 4A4AA 2Y88A 2PA6A 3OU8A 4B15A 1YEYA 4XKYB 4ZR8A 1VJZA 1FQ0A 1M04A 4UB9A 2D2GA 2CWNA 3O0KA 4AMAA 1VENA 1FWCC 3ISIX 4WF7A 3THAA 1O12A 1PBGA 1AODA 3UPMA 2X1TA 2FHCA 4FNPA 2DSZA 5F2IA 3JU2A 4GI8A 4IM4A 5BYWA 5IXEA 3AIQA 4JIIX 5C2GA 4J27A 1NWTA 1FFRA 3FKRA 3GO2A 4LFYA 4ZMGA 4JFSA 3CC1A 4GO9A 1E9YB 1W2PA 4AWTA 4MJZA 3NZGA 5A2CA 1NU5A 2H6RA 3TC7A 4S3BA 3VTRA 4L56A 3GS6A 1I9CB 5D2XA 3QR0A 3NEVA 3ZLGA 4C6JA 3TN6A 2PLJA 3QYQA 5FOOA 2G4FA 1T96A 3RLHA 4NZCA 2ATSA 2AAAA 1VPXA 4CVWA 4HSNA 1RA5A 3HG3A 1W9PA 3GBEA 2QJJA 4FLOA 3M0HA 4D72A 2OLAA 4X3ZA 4Z0JA 2A1YA 3GNPA 3NZQA 4X22A 2EG8A 3UCQA 1LP6A 1GORA 2QCDB 4AF0B 3BW3A 3Q45A 3ZOAA 5BXRA 2DT2A 4H01A 1UP0A 2GJXA 2ALRA 1UP2A 1KWKA 3C0QA 1NARA 3QSRA 1FVPA 3CH0A 3GHSA 4MB5A 1G7VA 4R7JA 1OY0A 5AHMA 1B54A 1NP0A 1JCXA 1IEVA 1WAWA 2VFDA 4V1YA 3ES7A 1L2QA 3KVJA 1J6PA 1EO5A 2Y8KA 4O4WA 3FSUA 2WBGA 3QC0A 5HJYA 4Q4SA 2VCCA 4R3UA 3UWWA 1WUEA 3WNOA 3CIVA 3VMNA 3AHZA 3UZ5A 1ZAIA 5DMYA 1TV2A 3MMTA 2QPSA 1DWFM 1E6ZA 4I8DA 4OV4A 3V0UA 1H49A 4R7OA 2VFGA 3LRKA 3TYAA 3U2EA 1BF6A 2DGAA 4S3AA 3C6CA 4ES4A 3UR7A 3B0VC 1V6YA 3DXIA 4IIDA 2QCCA 4DWSD 4AD2A 2VZSA 3DG7A 1JAEA 3BG3A 4UC5A 4YCPA 3GDMA 3GC4A 4YJ5A 1TA3B 2VEGA 5H8PA 4WHBA 2TYSA 2XH2A 2C1HA 2ZADA 3MUIA 4PUUA 1L6FA 3K13A 1V0KA 3UXLA 1Y8BA 3G2GA 3TWBA 2ZX7A 3GU2A 3APYA 1G4TA 5AZ0A 1DXEA 3W6MA 4OBRA 4IGSA 1Q13A 2EPHA 4OBSA 2WHMA 1R3TA 1BTCA 3BE7A 3U5UA 1PX8A 3R25A 1DPMA 2FTYA 2IPWA 4IP7A 3DBPA 3N6QA 1VBHA 1XLJA 3Q65A 4Y90A 1VLIA 2CC0A 2CHNA 7REQA 4EPEC 2C15A 3VKDA 1HQTA 1FWTA 2DUAA 3FAWA 1XG4A 2YA2A 4MGGA 4LUTA 4C6EA 4W7UA 1ISWA 3IAQA 3N2TA 1OQFA 3M6YA 2OTDA 1B9ZA 3TDFA 1BWKA 3EAUA 3QKZA 4B4HA 5G4WA 2YLAA 4GI4A 3IRSA 3ARZA 3W6YA 3HG5A 5I3DA 5I3JA 4AZ6A 4CEUC 4XVEA 4DLMA 1A80A 1LQ0A 2E40A 3ATYA 4QQ3A 3LRMA 3CHEA 1JCLA 1EC8A 3DU0A 3LTYA 5U4NA 1A49A 3EA2A 3KBSA 4LQ1A 4P8WA 1ZSXA 5JQ9A 1DIDA 4JXCA 4DWDA 4GFSA 4QNEA 5L9FA 2WJEA 3W84A 1HTIA 2ZUUA 3VDCA 1JZ3A 3TR9A 3W7LA 3NXFA 5AOUA 2HBXA 1GYNA 3MJMA 3S2LA 3MO4A 4ACYA 1EJUC 2WMHA 5D9NA 3E9AA 3WLLA 1DIEA 2QAFA 1DJXA 1K9TA 1SFSA 5HNUA 2ZDSA 1HVQA 4US5A 3E2SA 1JRCA 1PCWA 5CZTA 3D0CA 2VEKA 1DL3A 2HSAA 2V68A 4DPQA 4RW3A 2YSWA 3KVKA 1MQRA 4N7QA 1FCBA 1GTHA 1JYWA 4DO6A 2DVUA 1CEOA 3QN3A 1XBZA 3CPGA 4PUJA 2ZUVA 3N12A 2J7CA 2Z29A 3ABQA 3CPUA 1BLIA 1T5AA 1I2RA 1LM1A 1HJXA 1ZAJA 1I75A 2WB5A 1E6RA 4QG9A 1QI3A 1NF0A 1XI3A 3CV7A 4JHOA 3CUIA 1KA9F 3N13A 3VNMA 4LUYA 1F4AA 3GTNA 1BSIA 1VJSA 1X1ZA 5G1TA 2P76A 3NJ3A 3ARQA 3ZR6A 5C0QA 4FNQA 1HKIA 3GSMA 5C8BB 4JNMA 4M6QA 3XISA