1TV5A

Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
409
structure length
371
Chain Sequence
b'FESYNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Structure of Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor.
pubmed doi rcsb
total genus 149
structure length 371
sequence length 409
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2004-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv5A00
1I8JA 1VYRA 5FF2A 2ZZ5A 3UQNA 1Y0EA 3B04A 4ICNA 3JRKA 3STGA 1FUYA 4GE8A 3EWZA 3W1PA 1YLVA 1QPNA 3C2OA 1FCVA 3W7DA 3IIPA 1QO2A 3KRUA 4TIMA 5LGXA 1I2NA 2VEIA 4L4LA 4LRTA 4Z08A 1EUAA 2DZUA 5C55A 1J4EA 2PE4A 2ZA2A 4JYDA 4FX7A 1K7FA 3CEUA 3DKLA 3NGJA 1GZGA 1FXQA 2GOUA 2W0UA 4BWLC 3NQ2A 3HPXA 4UTLA 4DQWA 1W37A 3DFQA 3GDMA 3BK0A 2BZNA 5AHEA 2Y61A 3QEZA 3TQKA 3BLFA 4JY9A 3L2IA 3ZWSA 4OU1A 4JEQA 1GWJA 2JKEA 3EWXA 3GAYA 2FB2A 4P61A 4RX0A 3E9AA 1W5OA 2X1RA 1LTDA 1UASA 4HPXA 1BWKA 2WSQA 1QAPA 3GIYA 3NEVA 4Y90A 2ZZ6A 2TMDA 3DZ1A 2IQTA 3U6WA 4YCPA 4ZQCA 4LS0A 4ZZ9A 5FF3A 3A21A 3SGZA 3NA8A 1K8YA 2B0MA 3OBKA 1SR9A 4NXSA 5G2IA 3RLUA 3W75A 4FF7A 4UTTA 1WOAA 1H7NA 5CPNA 3V1PA 3G22A 2YX0A 1CW2A 3KXQA 4NZFA 4UMCA 3GAKA 3LBCA 3MHFA 5HUPA 2X30A 2H6RA 1Q6RA 4TMBA 1QFEA 2C6QA 2RDUA 4JYEA 4LNYA 3G1YA 1DBTA 1MEWA 4QSHA 3G0XA 2H90A 2O7QA 3ATYA 3HO8A 4LU0A 4ZQNA 3L66A 1ZHAA 4FIRA 5KMYA 1SO6A 3TUUA 3EKZA 4Z0JA 3QRHA 1L6YA 3DAQA 1G67A 4PODA 4EOUA 4FB7A 2ZTKA 2YR1A 1GVSA 1RQHA 1TPDA 3B06A 4PEKA 1JCJA 3IVUA 4K39A 3RU6A 4EF9A 2R94A 1OFAA 3LBMA 1KBJA 2YPIA 2HS8A 1DJNA 3W71A 3W72A 3DXIA 3EXTA 1Q45A 1VGAA 3DKJA 3M16A 3TW7A 3HF3A 3TA6A 4UFJA 4MY1A 2ATSA 2YFNA 2B7QA 1P4CA 3W7GA 1KFCA 2H8XA 4WZHA 2HMCA 2ZZ4A 3MJYA 5CZSA 1ADOA 1GOXA 3HB9A 5A5WA 1DJQA 1NF7A 3L5MA 1MSSA 3THQA 1M7PA 1GVFA 2WSRA 2ZRUA 2ABAA 3BLEA 1Q6OA 5G4WA 4TMCA 4UCGA 1RQEA 3L9CA 4HIBA 3TCEA 5HWMA 3NG3A 3NYZA 3W87A 5DXXA 2JBMA 2CZ5A 5L9FA 1F05A 3NVTA 4WQ6A 3MWAA 4O8RA 2I9EA 4S2BA 3RK8A 1OX5A 2CLIA 4C1LA 2OCZA 3WK2A 1VCFA 3HGJA 3PWAA 5D02A 4JGDA 1KFBA 5FF4A 3IGXA 3GXTA 4A29A 2YSWA 1NSJA 1XXXA 2PRMA 3FS2A 3LDVA 1W5NA 2C15A 3ZR4A 3C2EA 1TQJA 3PSWA 4O53A 5E1QA 3LOTA 3E02A 3LHZA 2JGQA 1RZMA 1OHLA 2PC4A 2V5BA 2C13A 5K9XA 3USBA 3LM7A 3N19B 4LWWA 5F2MA 3NZ1A 1TPH1 1XBXA 1L2UA 1XBYA 3HQ1A 3LHUA 1BEUA 4N9CA 2H3DA 4N4QA 3IGUA 1TPUA 4YXGA 1KLYA 4JS3A 5HNRA 1W8SA 2NXGA 2NX9A 3T7VA 1XM3A 2QAFA 4POCA 1H7OA 3PBVA 2CLKA 4E38A 4AHOA 1PV8A 3C8FA 2Y6ZA 2QCLA 4N6EA 4Z1DA 3B05A 3CTLA 4TO8A 3TW6A 1F6KA 4BI7A 1H1YA 4KWWA 4RXGA 3PBYA 1PE1A 5D2TA 2DZXA 3M0ZA 2Y63A 3LLFA 3S8HA 3P8JA 3PUDA 5D2YA 4ALDA 5G2HA 1DV7A 1FWTA 4AMAA 2FPVA 4YLWA 3NL5A 3NL6A 3KAOA 2YZRA 3NPVA 4IMCA 4A21A 3NQEA 4I7UA 4MZYA 3W1QA 3L0GA 2QR6A 3B4UA 1DHPA 3O07A 4O12A 3HG5A 3M1ZA 4WJEA 4Q4KA 2NV1A 1XC4A 2CLMA 2H8ZA 3TSMA 5TIMA 2EHHA 2J9ZA 3FLUA 3NQ6A 1FCQA 4AHQA 2A85A 1HFBA 4Z1AA 4K36A 4RZ5A 5F2LA 4UTWC 3PC0A 4AAJA 3TNOA 1FY6A 3GKFA 5LNUA 3QW3A 1QMLA 2GVGA 3M43A 1A5BA 2RKXA 4GXMA 3W2MA 4DF2A 2X1UA 1SW0A 2NXIA 4NU7A 4UTWA 3LCGA 3R13A 3PR2A 4IOTA 3M5VA 3HPZA 4FXSA 5I3FA 4P2VA 4RR4A 1CI1A 1SW3A 4DELA 1YTDA 1EX5A 1PIIA 1I2RA 5LSMA 3W1NA 2QKFA 4UTHA 1SO5A 3GLCA 5F4SA 3NPUA 3N14A 3CIWA 3TMLA 3W83A 1SW7A 4UFLA 1PS9A 2V8ZA 1F74A 1QDSA 1Z44A 3F03K 3L0NA 5F4WA 4OHQA 4A22A 3UZ5A 3W1AA 5J5DA 1LLZA 5F4XA 1G4TA 2XN2A 3LTSA 3LCHA 4MUZA 2E5DA 1MEHA 3UY8A 2RH9A 5AOUA 2NX3A 3Q58A 1TPEA 2A7PA 2DU2A 2F84A 3M9YA 1LLWA 3M5YA 3TJLA 1AMKA 1TV7A 1HG3A 2WPBA 4O1DA 1X6UA 4JTGA 2I1OA 3DHFA 5K9CA 3G3DA 4MY9A 4FNQA 4EWND 1GG1A 5BMXA 1D3HA 3W1XA 3L5AA 4HNVA 2RHGA 3GNDA 3CT7A 3MBFA 1FXPA 3TQ0A 1JR1A 1SU5A 3TFXA 4GRSA 1YTEA 3S5YA 4UR8A 1K7EA 4AHPA 6TIMA 3C61A 3LCXA 4UTUA 4ZQMA 1LBLA 3DHDA 2Q8LA 4DBDA 8TIMA 2VKZG 1M7OA 4MJMA 3I65A 1TJRA 4LY8A 2A6LA 3P60A 4UXDA 2X1TA 1XUZA 1MEIA 1G69A 1A53A 1UB3A 5U4NA 3S5NA 1XBZA 1LOSA 3BGJA 3TK7A 1D9EA 4LS2A 3QF0A 4LVDA 2A6NA 1ICPA 1PCWA 3LV5A 5HWNA 1OYCA 1XCFA 1F76A 3O6YX 4LUJA 4ONVA 1A5CA 1P0NA 4YWIA 3KFTA 1S3HA 3MI3A 2ZZ2A 3W7EA 5HR7A 1ZNNA 1DOSA 2ALDA 4R7JA 1LORA 1P0KA 4JTEA 3STEA 3NZRA 3W9ZA 2V2CA 4JTKA 4O14A 4N02A 3IEBA 1M6JA 5AHIA 2QCHA 1WOBA 3GNNA 4ADSA 5DN1A 3GZ3A 3QW4B 1TTPA 4RZ4A 3KVJA 3N2MA 3JS3A 1VHNA 2E6AA 3PUOA 4JR5A 4KFOA 4IMGA 3TH6A 1XBVA 4PH6A 1LP6A 3W7PA 4WOZA 4O0KA 3R12A 4XQ6A 1W3IA 1SSDA 3ABQA 2CZEA 1OFEA 1MZHA 4HSOA 3W76A 5LKYA 2QCGA 4YL2A 3C6CA 4OT7A 2ZZ1A 3TU9A 5LHEA 4HSNA 4J9JA 1ICQA 5D2XA 4ZQOA 4WD0A 2RFGA 1OJXA 3G8EA 1UJPA 1HUVA 2DJLA 2C3ZA 2QJGA 2NX1A 4EVZA 3NNTA 2QUUA 1Q3NA 2TPSA 2I14A 3W2KA 2YGYA 2CLOA 4UFHA 1C29A 1YXDA 3W23A 4UTKA 1OFPA 4ZVJA 4ORIA 2CLLA 3M44A 3PS7A 2KZHA 3HJZA 1L6SA 3S9YA 4DO4A 4UFIA 1ZALA 3L5LA 1GEQA 3G1FA 4QNEA 2E1DA 3EX3A 4O57A 1W31A 4S1FA 5DBTA 4IMDA 2ZBTA 3DI1A 3OVRA 3GB6A 4RCXA 2C14A 3T4CA 3C2VA 4JTLA 4R53A 5DXYA 1B9BA 2F7FA 3VE9A 3EXSA 1EP3A 5AFDA 3AJXA 2H3BA 3MMTA 2DORA 2BWGA 3TAOA 3W70A 3NL2A 3SFKA 4Q32A 4XBKA 3I7RA 3LCIA 4FNPA 1KTBA 4GUJA 2VFEA 3U2OA 3L0KA 3IV3A 3EWUA 4DF0A 3F4NA 3EX4A 3DENA 2EAWA 4N2YA 1LRTA 3O15A 5DBUA 3MI2A 4LV4A 2C1HA 1I4NA 5D32A 3OHIA 1K02A 1WBJA 3GKAA 4JDBA 2CLEA 1A50A 2WOQA 2WO5A 4HT3A 4JICA 1UBSA 3LI0A 2YCEA 2DJXA 4Y8FA 1FDZA 3CWNA 1GJPA 5DCDA 2HTMA 3HG3A 4ML9A 2BSLA 3NQMA 2OZ0A 1DQXA 3R8RA 3GDRA 3P74A 1XDMA 1ZENA 4O13A 2EPHA 2ZZ7A 1SPQA 1G7VA 1I2OA 3UWZA 1QR7A 3N2XA 2FDSA 3W07A 2Y7FA 5I3HA 4XTIA 3B8DA 1YPIA 2VELA 3LCWA 3VCRA 2YYUA 2VFHA 3KHJA 3P82A 1WXJA 1OX4A 4PA8A 1G6CA 1QPRA 4EIVA 5AHFA 1EUNA 1TTIA 3HGSA 5E93A 3IIOA 4K7VA 3NQ8A 1WV2A 2FTPA 3BPWA 3R89A 1TV5A 3TIMA 2A0NA 3BW2A 3P5ZA 1JRCA 2XN0A 4LVBA 1WDWA 3LTYA 4O11A 3MP3A 5U7SA 2NXHA 4QQ3A 3W7LA 3ABSA 3ZS4A 1YDNA 3WK1A 1JUBA 3DFTA 3UWQA 2W79A 1O60A 1T8XA 3UPBA 4MIMA 2Z2UA 2NV2A 4M19A 3DFOA 1SZEA 2Y88A 3W1RA 3QPYA 4UTJA 3LV6A 3BG5A 4PTNA 3HBLA 3PB0A 3RMJA 4CQ8A 3I68A 3CM4A 5KITA 1ME8A 3W2NA 3JR2A 4AB4A 3VE7A 5LZLA 4NNBA 1GPWA 1BKSA 2CW6A 4JYFA 3NQFA 5AYXA 3DBPA 3BLIA 2NWRA 4OGZA 4CQ9A 2Q3RA 3L68A 3EXRA 1N55A 2Y7GA 3GXPA 2X2GA 5FEPA 4HKPA 3LGEA 3W6YA 4MLRA 3HIJA 5D09A 4IUOA 1EWDA 2WNZA 4NQ1A 4UTMA 2ISSA 4MFDA 5F2GA 5LNSA 1B57A 3TV8A 4AWTA 3GVGA 1TPWA 4B5NA 5AC8A 3PB2A 3CPRA 5G1TA 3GDLA 3E12A 1K3UA 4JTSA 4X22A 2XN1A 2C0AA 3SECA 3MYOA 1D3GA 2FJKA 4GUGA 4JTIA 1Z48A 3GYEA 1PHQA 2OJPA 4O52A 4K8EA 3PBUA 2ZQ0A 4MZ8A 1J2WA 1HO4A 3W85A 3UWYA 4PC8A 4AF0A 4QITA 3OEXA 3KRSA 2JGYA 2ZFAA 5EBUA 5KINA 3SR7A 3HPSA 1TPC1 2QJIA 1EB3A 4OV9A 1SFLA 1OFRA 1VYSX 2DZVA 1F5ZA 4JXCA 2Y7EA 5BNKA 2A21A 3QMSA 3TC7A 3L21A 2QCDA 4NJIA 4OE7A 1W5QA 1OK6A 3QZEA 5DLCA 2R14A 3CWOX 3EX2A 5EL1A 3W7HA 5FF0A 4UR7A 2VENA 1FWSA 1K8ZA 5D04C 5ABTA 5K4ZA 1O5XA 1XL9A 4UNLA 1SO4A 1V7YA 4HNNA 4NJKA 4ADUA 2CWNA 2GVJA 1G4EA 1AW1A 2C18A 3O05A 1ME7A 3FYPA 6ALDA 5F1VA 3EWYA 1KTCA 3KRZA 3BGGA 4ZL1A 3G1VA 3G1XA 1KA9F 3K30A 3RNDA 1TJPA 1C9DA 3CB8A 3LRLA 1YDOA 3FOKA 1IXNA 4TR9A 4LOCA 3S42A 5CPOA 3TR2A 4O1BA 2QUTA 1EP1A 3M41A 3W7OA 4UC5A 4X3ZA 4QAIA 3GDTA 3LB0A 4JY8A 5D2VA 2A7NA 3W3OA 2TRSA 3S0CA 2NUXA 3SSJA 1JULA 1ZFJA 3GR7A 1O95A 3LXCA 4Z1BA 3SIZA 5SWUA 5AB3A 4NXKA 1B4KA 4NUWA 3E0IA 4CNPA 2QF7A 5DY3A 4OV4A 4O18A 5HWJA 1TCDA 1A5SA 3P84A 7TIMA 2WJZA 3C0JA 3P8IA 1TRIA 3LLDA 3S6DA 1TYGA 2NUWA 5DELA 1SQ7A 2YDAA 5H91A 3P62A 1OFBA 5HULA 1KFKA 2ZRYA 5MHBA 1UUMA 1YPFA 3UXAA 4WXYA 2V2DA 3DFNA 3TFCA 3HG2A 1OF8A 2DZWA 4FO4A 3G1DA 3NDOA 3ANYA 1KV5A 3W1TA 5TBOA 1I2PA 4LT9A 1WQ5A 1OYBA 1Z41A 2LLEA 1RPXA 2V82A 2OT0A 3W74A 2Y85A 2NZLA 1GG0A 1L6WA 2ZDRA 3O6DA 3W22A 3TQVA 4DBEA 3SZ8A 3W1LA 2V2HA 3B0VC 2VFIA 3G18A 1KM0A 4FX6M 3QSRA 5I3GA 3RLVA 1U83A 3KVKA 5TQLA 1LRNA 2NUYA 1QO5A 4N6FA 3RFAA 1MXSA 3PY2A 1YADA 1VCVA 4E2BA 3IVTA 1ML1A 4XZ9A 5AYYA 3GDKA 3T55A 1IIHA 1BWLA 2QAPA 5HJLA 5HUOA 4IMFA 2E6YA 3PF3A 5D38A 4RK8A 4K38A 2ABBA 1DQWA 4UUIA 2J9XA 2W6RA 4R33A 2Z1BA 4BFAA 1OK4A 3DGRA 5G5IA 3FYOA 4HHPA 3PAJA 2CFFA 3A22A 4JD4A 1XKYA 1O4UA 4DO5A 5K7JA 2A7RA 1T96A 2QCCA 5GVJA 1GVQA 1S5TA 1SO3A 3BV4A 4DXVA 3EX1A 4MYXA 5C6MA 4W9TA 3BW4A 1W5MA 2VEMA 3MUXA 4K7YA 3G0UA 5CSSA 1W1ZA 3QPZA 1EIXA 2ZA1A 4NVTA 4DO6A 3LI1A 5D03A 2J6XA 3UWWA 4PL2A 1S5WA 4O1AA 5LHFA 3E49A 3A5FA 3W7MA 5J5RA 4JX5A 1LZOA 5D30A 3Q2DA 1JRBA 3KVMA 3LTPA 5BRBA 4AXKA 3IIZA 3UYCA 2QCNA 1G4SA 1ME9A 3SJ3A 1ZAHA 3S5ZA 3S1VA 1R2SA 4MPQA 5C2XA 1Q6LA 1AG1O 2Z0IA 4FNSA 2AGKA 1LM1A 3W7IA 3NL3A 1VH7A 4HN4A 4JIPA 5C5YA 1H1ZA 4MFEA 2WQPA 3FKKA 3S1WA 4WY0F 2ISWA 3EWBX 3W7RA 3EKLA 1IXQA 3I7SA 1YXCA 1O5KA 2QDGA 5CKSA 1JUEA 3P7YA 2FB3A 5AC6A 5LNRA 3T78A 1THFD 5CZJA 1LYXA 5DCBA 3STCA 1B4EA 4RLIA 2EKCA 3QM3A 1LROA 1K8XA 4QJ1A 4HNUA 4PFMA 1EWEA 4LV9A 1WA3A 3PG9A 2QCFA 3U8GA 1RQBA 5D2WA 3O63A 1KM3A 1F2JA 4JIQA 4JDYA 1Z42A 1V5XA 1U5JA 3B0PA 2VFGA 4O4WA 1UUOA 3N73A 4JTTA 5G4EA 1GYNA 2FPTA 3ABRA 4FXRA 4QIUA 3UNDA 4WY0A 3NOEA 5IBXA 1KM2A 4WY0B 3WK0A 1WYIA 1DVJA 5LNVA 4XKYB 3TSBA 1R30A 2VFDA 4M6PA 3ZFHA 3MP5A 2FIQA 1PL9A 3VNDA 2DZPA 5HR6A 1F7BA 4LS1A 1IGSA 2EGZA 1VLWA 2VC6A 4IX2A 3TXZA 1OG0A 1SUXA 2E6FA 2CZDA 2P1FA 1R2TA 1NFBA 3M7WA 2O7SA 2GQ9A 1B3OA 1W3TA 2FPYA 3WJSA 2J9YA 1JCXA 4IJBA 1RD5A 3FIGA 3NQ7A 1RVGA 4GBUA 3GXNA 3S1UA 4K6AA 4ZQRA 5K4XA 4LUIA 3IIXA 3QMRA 2B7OA 2B7NA 1R46A 1KM1A 2VEPA 3DFSA 4IXXA 1YDVA 5A8GA 2Q3OA 1OABA 4M7SA 5BW6A 3O6CA 1OX4B 1ZY9A 2QUVA 2CLFA 3V75A 3LHTA 5KTLA 3TMQA 4RJEA 2ZRVA 3KX6A 5BOOA 1JUKA 1FWRA 3C56A 4IPIA 3HOJA 3QQ0A 1P5BA 1VR6A 4UIOA 3SY5A 5EPDA 5T26A 3LX9A 1H7PA 5AHMA 4UTIA 4OWGA 4NJGA 4QM1A 5D37A 3M5XA 5LNWA 4E0CA 4CCEA 4WXZA 4FEZA 3QJAA 1P1XA 5K3VA 4DEFA 4CNNA 4LRSA 3SW6A 5DY2A 1TPFA 3A23A 3G24A 4WOQA 4MKNA 1RV8A 3GR8A 1FDYA 5G2WA 1VCGA 2GJLA 1NVMA 2E68A 1SZFA 3S5OA 4MVAA 3PM6A 4MOZA 4OQVA 2JKPA 2QEZA 3TXVA 3TX9A 2AQWA 3P81A 1N7KA 1W3NA 5G1YA 1M5WA 4O16A 1XUUA 3MYPA 3NQGA 1LDCA 4QISA 1WAUA 3MW7A 1FDJA 4O15A 4I7VA 4LTSA 1FWWA 1AW5A 3F1QA 2X16A 3N34A 4NJHA 4DPQA 2P0OA 3RF9A 3W1MA 3BG3A 1OFDA 3C3NA 2YW3A 2GQ8A 1K03A 4IWWA 1W0MA 3INPA 1X1ZA 1KM6A 4JN6A 2ZRXA 1DL3A 4UNKA 5CZTA 1A5AA 4LC8A 4GJ1A 3W86A 4AH7A 3P67A 3ELFA 3NQCA 4RKAA 1LCOA 5HQEA 3SI9A 5AHNA 1QCWA 4O50A 3E96A 4A3UA 2V0TA 3LCFA 3DU0A 1F73A 3W7KA 1HTIA 4MY8A 4K37A 1JJKA 1TIMA 3CHVA 2UV8G 3MI6A 3T40A 1IXOA 4X9SA 3NXFA 2V81A 4N9EA 1EP2A 1VHCA 2Y89A 3KOFA 4H4IA 1FWNA 1T99A 5CPMA 1GT8A 1ZJIA 3IIVA 4YCOA 3NM1A 3IVSA 4Y6GA 3UPWA 1FCUA 5AC7A 3IGSA 3UZJA 2QCMA 1F6PA 4AF0B 3O16A 4LC6A 2WSYA 5KZDA 1H7RA 5FEZA 4Q33A 3LHWA 2BTMA 5LGZA 2VEKA 3W88A 4A2SA 5CZ0A 3W7CA 2FLIA 1R47A 3BARA 1NAL1 3N9RA 1XI3A 1GTEA 3NQDA 4AWUA 4KKXA 4XBSA 4CQAA 5EYWA 5C54A 1VZWA 1XDLA 4E2DA 3UY7A 3C2FA 4O4VA 2YW4A 3M5ZA 4KWVA 3HG4A 3TAKA 4OBTA 1X8FA 2FQIA 4IXHA 5FEWA 4LVFA 3G0SA 5L6UA 3NM3A 4AWSA 5I3KA 3ZWTA 4Y9AA 1IF2A 1PVNA 1ALDA 3W7JA 1KM4A 3R5EA 2VFFA 2YYTA 1N8FA 4G1KA 3R2GA 4WX2A 5H2ZA 2QCDB 1L9WA 4LVGA 4FNRA 3HGRA 3WFAA 3CLMA 1CX9A 3N9SA 1KW1A 2ZZ3A 1PCKA 5CSRA 4FNTA 5AHLA 4O0ZA 1VJIA 2RDWA 3W73A 2Z6IA 3NO5A 4TX9A 5EMUA 1DKWA 1GVRA 3UWUA 1KFJA 3W2JA 4Y96A 1IXPA 1PHWA 4DPPA 1OFQA 1H60A 2JK2A 1I45A 4GUHA 4ORMA 3PG8A 3QSTA 3LXAA 3FJ6A 4Z1CA 2A1YA 3CQ0A 3CEPA 3Q94A 4JX4A 2GPTA 4GNJA 1ZAJA 4O28A 1JCYA 4ZQPA 4GUIA 2GQAA 1ZAIA 3G1HA 1TB3A 4JTHA 4CCDA 3VI2A 1KTNA 1J5TA 2HS6A 1TPB1 1TRDA 4WUIA 2GJNA 4M6VA 3QC3A 4HPJA 3TC6A 3WJYA 3P61A 3TKFA 3C2RA 3WK3A 1KLZA 2G95A 5D33A 5E0KA 1KM5A 3FEMA 1R2RA 1H7XA 1TQXA 1GTHA 2NLIA 3NQAA 1VYPX 2V5LA 3O06A 3UWVA 1JVNA 5K2ZA 1VQTA 2Y70A 2JKAA 3A5VA 1TPVA 4AVFA 3GK0A 1LBMA 4CLMA 3C4UA 3MHGA 1YYAA 4EF8A 3NQVA 3LHYA 1TTQA 2G96A 4IPJA 4CCCA 4NX0A 4GFSA 3A9IA 5I3IA 1EPXA 3I6RA 1SZGA 4K8HA 4BI5A 4M5PA 3O8AA 1MO0A 1QOPA 3M47A 2E6DA 2ZRZA 4MZ1A 3OG3A 4NNAA 1GQNA 3BW3A 1W5PA 3C52A 2V30A 3SGUA 3P5YA 4RZ6A 1FQ0A 4KFNA 1DORA 3PSVA 3WJZA 3WJWA 1XFBA 3NPWA 1EEPA 1EA0A 4GWEA 1Q6QA 4NT0A 4KFPA 3QQ1A 2DP3A 4MJZA 2HSAA 3M6YA 2CLHA 2BXVA 3QMTA 4IGHA 4NX5A 1JCNA 5D05A 1O94A 3F4WA 1TREA 1LRQA 4FIQA 4FNUA 4M7TA 5KZEA 5AYZA 4XWUA 1OVDA 4BF9A 5BMWA 1WBHA 5KZMA 2AAMA 5EY5A 5IM51 3CC1A 2E5BA 2YXGA 1G7UA 4I7WA 3B03A 1QNVA 4JTJA 2D73A 1C8VA 3T44A 4ZMGA 3KVLA 2A2IA 1HO1A 4U4MA 1I2QA 3ATZA 3AO0A 4O1CA 1KV8A 5FEXA 3UXDA 3MBDA 3THAA 3LRKA 5F1UA 3IRDA 4U28A 5FF7A 3W7QA 1VRDA 1K7XA 1JQVA 4O10A 4XUGA 1OF6A 1GYLA 3TJXA 4HNTA 3G1SA 3TSDA 1NEYA 3FJLA 4XTDA 4NJJA 2WV8A 5F2IA 2XFWA 3A24A 3L65A 1H7WA 4YMZA 1VC4A 4N9BA 4C1KA 1LOQA 2ZA3A 4UFKA 2NWSA 2OMAA 3OIXA 4UMBA 1JCLA 3EWWA 4RV8A 4XKYA 4PL1A 3W1UA 3MHUA 4BR1A 1TV8A 4LW7A 1VPXA 4M6QA 1HL2A 5CG7A 4FX8A 4RXFA 2X1SA 5FI8A 2ZRWA 4R34A 3Q37A 4PCFA 1ICSA 1QOQA 3TROA 5FESA 1VLIA 1H61A 4O54A 4N9DA 2P10A 4O17A 1KFLA 2EF9A 2A5HA 2Z6JA 4JTUA 4O19A 1W56A 3L67A 2PRLA 3W7NA 1SZNA 2PURA 4IQLA 1UCWA 1LOLA 3W2UA 1T0OA 1YTKA 1S5VA 3I7QA 3PBWA 5EKYA 5I3JA 1ZCOA 2RDTA 2BLEA 4H3DA 2Y62A 3O1NA 1OYAA 3S1XA 4GUFA 4Z0SA 4IMEA 1H62A 1IIGA 3HMJG 3G3MA 4LVAA 1NF0A 3D0CA 3NPXA 3EB2A 1YXYA 2C19A 4I9AA 1H51A 3H55A 3MO7A 1JQXA 1RR2A 1FCBA 2QDHA 3STFA 4GC4A 2WKJA 4A2RA 1H63A 3W2LA 3UD6A 5DCEA 1W54A 4DF1A 2PRHA 2CZFA 3H53A 2E77A 3QFEA 3P80A 2DZTA 4NZJA 5CGQA 4JTFA 2ZYFA 1SSGA 3N3MA 1KBIA 1H50A 4D2JA 2R8WA 2R91A 2OX1A 3CIXA 3TE9A 3W84A 3YPIA 1WX0A 2WNQA 3B0UX 2J27A 1E51A 3CU2A 2G97A 3G1AA 2QCEA 3DFPA 4BI6A 4MYAA 4TU1A 3ABOA 1SFJA 1TMHA 3OVQA 1AW2A 4N4PA 2GUUA 3VKJA 5HINA 2Q8ZA 4H6KA 2BX7A 4JNMA 4AEOA 1FBAA 2ZTJA 4FHAA 5K9DA 2Y7DA 3OVPA 5IBXC 2G5WA 3NR0A 2V9DA 3PULA 3GX9A 2J24A 3LCLA 3TDFA 1X7FA 3LRMA 3FFSA 3BVJA 1H5YA 1OFOA 1LBFA 2C16A 4X2RA 2ISVA 3OA3A 4JX6A 5HMSA 2E09A 2A4AA 3PUEA 3QH2A 2VXNA 1TTJA 2B4GA 1AL8A 2QJHA 4L4MA 2TSYA 1G4PA 2TYSA 3G8RA 3WJXA 4BWLA 3QYQA 1QPQA 1VS1A 2B7PA 5AN7A 2J88A 4QNWA 3FKRA 3BG9A 3LHVA 3EEGA 2DZSA 3NAVA 2WNNA 4UMAA 2CU0A 3DH7A 1TSIA 3MP4A 2ZCGA 4UFMA 4UTTC 5KSWA 4S2CA 3EX6A 1KFEA 1ONRA 1BTMA 3PVFA 1QWGA 3VFLA 3DI0A 1FX6A 2GVLA 4IX0A 2OT1A 2E5CA 3LXBA 1TO3A 4MLJA 1OX6A 3HGOA 3FA5A 2PCQA 3LERA 4ADTA 1JCMP 3BO9A 1GVOA 4CNOA 4NNCA 2VOMA 2YFOA 1AL7A 2FFCA 1QPOA 1AK5A 2ATMA 4BK9A 1X1OA 5CPLA 5EA9A 3H54A
chains in the Genus database with same CATH superfamily
1OGGA 4WGXA 1VYRA 3M64A 2YA2A 5FJPA 3UQNA 3STGA 3V0SA 4GE8A 1GOMA 1QPNA 4RPPA 2YB1A 2WC3A 3T0TA 1I2NA 4RZBA 4Z08A 3GTIA 2ZA2A 3N6QA 4KT2A 5T9BG 4JYDA 4FX7A 1K7FA 3CEUA 3NGJA 2OLSA 1GZGA 1EFZA 3UESA 4KF1A 3OYXA 2WHLA 3A13A 4GVFA 2W0UA 4J28A 3B9OA 3B0YA 2VD8A 1UR1A 3WUEA 1E5JA 5E70A 2NQJA 1W5OA 2X1RA 4P8VA 3FJ4A 4XZIA 1U1JA 3E38A 2OODA 4NG3A 1Z3NA 3AHXA 3PZOA 2ZZ6A 1WPCA 4XV0A 2E40A 1IT7A 5AC5A 3A21A 2FH6A 3NA8A 1K8YA 3LENA 3ONBA 2B0MA 3OBKA 3O2LA 5G2IA 3W81A 3F7JA 4NY2A 1IR2A 3V1PA 3G22A 3ISIX 3KXQA 3S6OA 4NZFA 4UMCA 1QW9A 1UP2A 1BG4A 3MHFA 2H6RA 3DERA 3SAZA 5G1MA 4LNYA 1Q6FA 3G0XA 3GHRA 1EO7A 4Q8VA 1KB3A 1ZHAA 4RE0A 4GINA 1MW1A 1EHNA 4Z0JA 4TV6A 4DYEA 1IYXA 2PC8A 4EOUA 2ZTKA 1XPGA 3E5PA 1J96A 2IPWA 1RQHA 1TWZA 4PEKA 1JCJA 3RX3A 3IVUA 4K39A 3RU6A 1W3JA 3GUWA 4H9UA 1KBJA 2YPIA 1FKXA 1AUSL 2WPGA 1DJNA 1TWDA 3W71A 3DKJA 2IUZA 4QR6A 3R7MA 2A3AA 2XVLA 1RPKA 2B7QA 1P4CA 3A3XA 3W7GA 1KFCA 4C6QA 3UXIA 4NYYA 2PWGA 3AWNA 3HB9A 2MANA 2HWGA 1BG9A 1NF7A 3BJFA 1MSSA 3AMCA 3L5MA 3THQA 1EJVC 2WSRA 2ZRUA 2OG9A 4UCGA 1RQEA 3L9CA 3TCEA 2E9MA 2YBVA 5E9XA 3DHPA 3NG3A 4Q3MA 5DXXA 4GH3A 2JBMA 1OD0A 3F2BA 3W25A 3EOOA 1PZ1A 4IG2B 5L9FA 3R10A 3MWAA 2A3CA 3GHSA 4RPQA 1XLDA 1Z7AA 4HZMA 1H11A 4NASA 2OCZA 3WK2A 4JGDA 4IP5A 1ISXA 1KFBA 5FF4A 3TR9A 5LA0A 2YSWA 1NSJA 3LDVA 1W5NA 2C15A 2WJEA 3ZR4A 1NFGA 3C2YA 1TQJA 3W53A 1OHLA 4EKJA 2UY4A 1TJ0A 2VRJA 1WAWA 1XW8A 4Q7BA 3NZ1A 3C8NA 1L2UA 1XBYA 5ECVA 5H8UA 3LHUA 1BEUA 2D22A 1HJUA 2GWNA 3TP4A 3WQWA 2NXGA 1XM3A 1WUEA 1H7OA 3PBVA 5I5RA 2CLKA 4E38A 4LSBA 5GJMA 2J25A 2Y6ZA 2QCLA 2BBFA 3T2OA 3CTLA 1UKSA 4TO8A 1RK6A 4TX8A 2HXTA 3K13A 1RD6A 3H4WA 3JVAA 5D2TA 1Q66A 2DZXA 3S8HA 2Y63A 4ALDA 2BGQA 4M81A 4XZWA 1JI2A 4YLWA 3NL6A 3KAOA 3NPVA 5D8ZA 1UR2A 5AVNA 3WEZA 4FXJA 3UG4A 2ZUVA 3O07A 2CLMA 2H8ZA 3ARRA 4XAZA 4U3CA 3KHDA 4IIEA 4AHQA 1AMYA 5CGTA 2WCGA 3WF4A 1XICA 5XINA 3PC0A 3GKFA 4GABA 1XLCA 4HVXA 2GVGA 1V0KA 4ASTA 2PU0A 1GNXA 1WKEA 1SW0A 2OLAA 2HVNA 3R13A 3ZVHA 3O9NA 5I3FA 3S47A 3ME3A 1EZWA 1YTDA 1EX5A 1PIIA 1B0IA 5DX7A 3FW6A 1EBGA 3BMXA 2IQDA 5M3WA 5F4SA 3W83A 4UFLA 1PPIA 1QDSA 1Z44A 3SCSA 5CJNA 3KTCA 3QOKA 3MV11 3KTXA 1G4TA 4MUZA 5A6JA 2W62A 2B81A 3TTQA 1AZ1A 4JCMA 2NX3A 5AOUA 2A7PA 3M9YA 4XVEA 3M5YA 1TV7A 4O1DA 1X6UA 4HMCA 3DHFA 1JF5A 5XIMA 3G6LA 3GZAA 4EWND 1GG1A 3NCOA 4HNVA 4LBUA 2YZ5A 4JTAA 3UXLA 3CT7A 2VUYA 4NF7A 1W3KA 1K4GA 1YTEA 2W3ZA 3NTYA 1UZDA 5IDZA 4YN5A 1XHGA 5A6MA 1LBLA 3DHDA 2Q8LA 8TIMA 1M65A 2VKZG 4PMQA 1EPVA 2W9MA 2PBOA 4B92A 2A6LA 2V6AA 4FR1A 2BDQA 1OGBA 4DRSA 3GVQA 4IH3A 3V5FA 3S5NA 4M1BA 5A6BD 3QZ6A 1XBZA 3VUPA 1J11A 1ZCCA 4YTRA 5IDIA 4GZEA 3QF0A 3VVGA 3E2RA 3W6MA 5IHSA 3WBXA 3UA3A 1TE6A 1OYCA 2DIEA 4IFOA 1OADA 4L1GA 1S3HA 3MI3A 2BVTA 3STEA 1SMAA 3CGTA 3WL1A 4DAFA 1GJUA 4N02A 3MUIA 1VBUA 2AL1A 2UY2A 5IRPA 1DJZA 4LANA 1UMYA 4ADSA 1E0VA 3H23A 3VGFA 2PDGA 4BHYA 2VWSA 4W86A 3C86A 4CU7A 3JS3A 1VHNA 2X0YA 4KFOA 4IMGA 1ZJBA 1LG1A 4F9DA 1E55A 2F61A 4PH6A 3W7PA 1M3UA 1W6TA 4FR6A 3SCUA 1SSDA 4QCEA 2CZEA 2I57A 1OFEA 2XIJA 5LKYA 2QCGA 3C6CA 4OT7A 1MW3A 3WQ4A 3UG5A 5LHEA 4HSNA 4J9JA 4L80A 3T8LA 4WDXA 3BLOA 2ZWYA 2RFGA 2VVSA 1UJPA 4F3HA 4UOJA 3SN4A 3SIMA 4A4AA 3OIHA 1R3RA 2HQAA 4UTKA 3W23A 4ZVJA 4REQB 2EG8A 3M44A 1SJDA 1L6SA 3S9YA 4MADA 2R1LA 4IUGA 3SBFA 3EX3A 1W31A 3E74A 2BOEX 2NVCA 4ML4A 1TV3A 3DI1A 4HCHA 1T6MA 2C14A 3T4CA 3N25A 2PTDA 4LX4A 3EXSA 3E0WA 1EP3A 4HYWA 2QVNA 1C90A 4Q4SA 2DORA 4D71A 3SFKA 1RSCA 1JPDX 3V35A 3I7RA 4FNPA 1KTBA 4GUJA 4HA3A 1K77A 3F4NA 7REQB 3DENA 2EAWA 3K8LA 3O15A 4N2YA 5DBUA 3MI2A 4LV4A 4FOKA 7ODCA 1RK5A 1IR1A 1WBJA 2WOQA 1BYDA 1UBSA 3H7VA 3U2ZA 3FEQA 3LI0A 1JXKA 1ITUA 2DJXA 4Y8FA 1MFVA 1NOFA 2EPLX 2WZMA 1V02E 3G6MA 1E70M 4HCLA 1A3XA 4LNCA 2FGZA 3P74A 1GVYA 1XDMA 1VIWA 4MTVA 2GVYA 2GYIA 2FDSA 1DE5A 1DWJM 4W88A 7ENLA 2XWEA 4OZOA 3LCWA 3GTHA 2XG9A 3I4KA 1G6CA 4Q4PA 3RDKA 5AHFA 1EUNA 4LUSA 1TTIA 3UJRA 3HGSA 4K7VA 3OBAA 4V1XA 3R89A 3GFZA 1TV5A 2YIHA 3CHEA 2AAAA 1JZ2A 2XN0A 8CGTA 4EANA 3M46A 2EO7A 3BCFA 2XIOA 3ABSA 1YDNA 2GQ3A 3MSRA 2XDFA 3VX0A 1B2YA 3WLSA 3UPBA 1HKMA 3AFBA 4M19A 1S38A 3DFOA 2D24A 3AZSA 3ARPA 1OC7A 4UTJA 1IZCA 1E6RA 5C0QA 1WZKA 1ME8A 3W2NA 4HU4A 4IQJA 3VE7A 5LZLA 3AXIA 1YBQA 3MUZ1 5ECUA 3DBPA 3GU9A 3BLIA 3FN9A 3S83A 1XYBA 3UZYA 1CZ1A 3L68A 3EXRA 1JYXA 4JOMA 4MLRA 3HPAA 5D09A 3CQJA 3AZRA 4HTYA 4AVOA 3CZLA 3TN6A 3EEZA 3D3AA 1LT7A 3ITXA 2ISSA 3WQCA 4MFDA 1WKYA 2AQOA 2BHZA 4B5NA 1TPWA 3WNLA 2BHYA 2WYSA 5HBFA 1K3UA 4LUSB 4JTSA 1P6CA 2XN1A 2C0AA 3SECA 3PP7A 3TN4A 1Z48A 2QT3A 3EDEA 1TUFA 2CXEA 4IJRA 5LIWX 3BMWA 4QITA 2FZ8A 1ZPTA 2ZFAA 1E1CA 3WLMA 5HMEA 3HTWA 1SFLA 2CKSA 4XX6A 1OFRA 4RL3A 3IJLA 4JXCA 1CPUA 2XH0A 5BNKA 3CUHA 1E5NA 3QMSA 1W5QA 5DLCA 3OVGA 3CWOX 5EL1A 1V93A 2VENA 5ABTA 5K4ZA 4DN1A 3BZGA 1XIHA 4P7NA 5A6TC 5REQB 4WVXA 4UNLA 5FAJA 2CWNA 3MVTA 2GVJA 1G4EA 1P0BA 6ALDA 1XV8A 3KOXA 3SSZA 5MKGB 1BVWA 4IIBA 1JDEA 5DMYA 3CO4A 4ICMA 1JF6A 5BZAA 5JBEA 4CEXC 2PODA 1TJPA 4AISA 4V28A 3UR5A 3IK2A 3N1AA 2P0IA 5FJOA 2J7EA 3B8VA 4H6RA 1YDOA 3WUFA 4P8XA 4LOCA 3L4YA 3MZ2A 3WZ0E 4EPDC 3KEHA 1TR1A 2E9LA 1EP1A 4QAIA 3GY1A 4JY8A 5D2VA 2JEPA 3W3OA 3SQLA 2TRSA 3DOPA 2HK0A 4I6VA 2XIBA 4J3VA 4AC7C 3S0CA 3R0UA 3SSJA 3GXDA 4ENLA 1JULA 2AMGA 1CWYA 2EPKX 1B4KA 2J62A 2DQWA 1YPXA 3GRIA 3E0IA 2CWXA 5E0CA 2GGJA 2HEJA 5HWJA 1XSJA 1TCDA 2POTA 1R3YA 5GNYA 1O6IA 3BAWA 7TIMA 1TZ7A 2YCKX 3P8IA 1TRIA 2FHBA 2DGAA 5DELA 1OFBA 1XYLA 4PCNA 1BYBA 4IL2A 1QI2A 4AX6A 1YPFA 3AHZA 4IQDA 4W93A 2ZE0A 2R9RA 1OF8A 1ONEA 3PWIA 1E0WA 4FO4A 4MF4A 3ANYA 3W1TA 3JU2A 5I07A 1B90A 4YVVA 1K9TA 2OXNA 4Q8MA 4J3XA 1CGWA 2NZLA 4DBEA 3SZ8A 2CNCA 3DYMA 3W1LA 3WQ8A 3TONA 2HROA 1XIIA 4WHBA 1JNEA 2ODOA 1BTCA 4FX6M 3QSRA 1V6UA 3MWCA 4GH1A 3RFAA 1YADA 3BCJA 3OQ8A 1F61A 3VYLA 3AIRA 3GNRA 5BRQA 1VCVA 4E2BA 4PRRA 1ML1A 1XRFA 1ZP3A 4G7EA 1IIHA 4HJFA 3ZJKA 4E5TA 4PUJA 4IMFA 1RY8A 4NAEA 1EDQA 3T9PA 2ABBA 4KCWA 4UUIA 3EPNA 3PN8A 2GSJA 4BFAA 3FYOA 4HHPA 1RBOB 4JD4A 1XKYA 2AL2B 5KZ6A 4OKDA 1XG3A 1GVQA 4UTFA 1S5TA 1ZL1A 1BD0A 3K4DA 3ITVA 1R3WA 4MYXA 5C6MA 4JHZA 3BW4A 4C6CA 3MUXA 4K7YA 1US2A 1S2VA 2OGJA 2PDBA 2X42A 3EMZA 3WLQA 2VRKA 4JX5A 1JIBA 1LZOA 5D30A 2CHRA 4X63A 3Q2DA 3QHMA 3KVMA 5BRBA 4AXKA 5FA5A 3UYCA 1K6WA 4QE5A 3CUJA 5H6HA 3GG1A 1ZAHA 3S1VA 4MPQA 3AJ7A 2C0HA 1K70A 1YRRA 4EX4A 1LM1A 3W7IA 1VH7A 5F7UA 4MFEA 1K8CA 1W3LA 3FKKA 3TYUA 4L65A 3NO1A 3EWBX 5JUVA 2QMKA 2XGBA 3VX1A 3EKLA 2P88A 1NY1A 1KXVA 2OSWA 2W91A 4YYCA 3MSDA 4H8UA 5CKSA 2WLZA 2FB3A 1J93A 5DCBA 1THFD 1B4EA 3QM3A 1LROA 2VX7A 1O1ZA 4LV9A 1WA3A 2QLYA 4HPHA 2ASHA 2QCFA 4QG8A 3N73A 5HJYA 1KQYA 3KTSA 4MNJA 2F6KA 1HIZA 2FGLA 4FMVA 3I3BA 3UNDA 4WY0A 2VP8A 3NOEA 5IBXA 1KM2A 4YJ5A 5LNVA 3UYIA 4HOWA 1VKFA 4M6PA 4HYRA 4HCDA 3UJSA 1PL9A 4E3TA 5HR6A 2PA6A 1R87A 3ARXA 4LS1A 1EQPA 4RV3A 3BURA 3S9IA 4IX2A 3N2CA 4PTWA 2CZDA 3SCWA 4GZJA 3GYCA 2P1FA 4XO7A 4JFSA 2O7SA 1XGEA 2YBUA 2PDLA 3BQ6A 2J9YA 2J7CA 1CECA 3FIGA 3NQ7A 4S3FA 4J4KA 1AZ2A 3ARSA 3W28A 1PX3A 3CMJA 2GGIA 2WC7A 6TAAA 4PB4A 2VWTA 1F8IA 3QHNA 5E5CA 2ZRVA 4IL0A 3KX6A 3VAVA 3W4RA 2JF7A 1VR6A 4E6MA 4UIOA 4ZXOA 1PYMA 2VMFA 2A3HA 5AHMA 3G1RA 3VIPA 4UTIA 4H83A 2ZX7A 5LNWA 4CCEA 1DIDA 5K3VA 4N42A 1EYEA 2VEGA 3RCMA 2V3GA 4HZ7A 4IM4A 9XIAA 3VMPA 2WMIA 3UWEA 1TPFA 3G24A 1I60A 1CYGA 1K9EA 4H2HA 5G2WA 3UVIA 1NP2A 3VOGA 1SZFA 4L4OA 4MVAA 3PM6A 3M07A 2G3JA 2JKPA 4OQVA 4DUWA 2G3FA 3TX9A 2AQWA 3B8IA 1LQ0A 3H7UA 1ZSXA 1N7KA 4FSAA 1PYFA 4V1YA 2UY5A 3A3HA 3KDOA 3NQGA 4LCSA 2ACUA 1E6NA 4QISA 3E0FA 3VOFA 1FDJA 4I7VA 5EB8A 3VZYA 1AW5A 1IWPA 3F1QA 3N34A 3V3WA 2WMKA 4G2DA 3BG3A 1NOWA 3C3NA 1J01A 1W0MA 4S23A 1X1ZA 2PPGA 4JN6A 3NEHA 2HJPA 1PTAA 1R85A 1A5AA 2DIKA 4HQVA 4LC8A 3P93A 2TODA 1PTDA 3W86A 1UOZA 1KQZA 3ELFA 3U7VA 1QTWA 3NUKA 3SI9A 3W38A 1QCWA 2BMBA 4O50A 4YU1A 3CZKA 3LCFA 4LB3A 4MY8A 4H1ZA 1XYAA 3CHVA 3BLDA 1OD8A 2V81A 2ZUMA 1Q2RA 1GOKA 2RJGA 1HZYA 1VHCA 4HK6A 1RCQA 4U2YA 2E25A 4PTXA 1FWNA 5AECA 3IIVA 3B40A 4YCOA 4IISA 5BXPA 1FCUA 1LT8A 2DPEA 5DMLA 1XLIA 3WNKA 3AICA 3WMBA 2WSYA 5KZDA 2KX9A 2A79A 4ZFMA 4R27A 1U1UA 1YIXA 3ZYZA 4A2SA 4LYQA 4PUUA 1Q6CA 3W7CA 3QV8A 3BARA 2G50A 1XI3A 1GTEA 4JQ2A 4XBSA 4NZ3A 5EYWA 3C2FA 3B97A 2YW4A 4L1WA 1Y8BA 4IXHA 6ENLA 4LVFA 5L6UA 3ZWTA 1JGMA 3B8WA 3WH5A 2R1KA 4LB4A 5BWAA 2RGLA 2B31A 5FL1A 4DM1A 2YYTA 3SQMA 1N8FA 4G1KA 5H2ZA 2QCDB 1JAEA 5A1AA 1CLXA 4Z2IA 3HGRA 3WFAA 4G5DA 1CX9A 4DI8A 4U3AA 4MMWA 2ZZ3A 3RG6A 3WEOA 3ALGA 1IEIA 2RDWA 1S46A 4R5EA 5EMUA 1DKWA 1GVRA 1KFJA 3W2JA 2Z00A 4DPPA 5A3HA 1W1TA 1K9FA 4R9OA 3BAJA 3WF1A 3EB3A 4PFHA 3GHUA 4Z1CA 2A1YA 3CEPA 2ONEA 3LBOA 2Y0FA 5FKYA 1C8QA 1TB3A 1KTNA 1J5TA 1LL4A 3RM8A 4ICCX 1FWGC 4J40A 4WUIA 2GJNA 4M6VA 3WD2A 3CJPA 4DJDA 5JBFA 1YQ2A 1XDJA 3WJYA 1MQRA 3P61A 3KCJA 3QR1A 3K4AA 3C2RA 4ERGA 2VGFA 1KLZA 2XHYA 2G95A 1LWJA 1KM5A 3FEMA 1R2RA 3LY0A 3ZSSA 4D6IA 1OB0A 4JFUA 4IJCA 3U0HA 2PD5A 2V5LA 3O06A 3BAIA 1VP5A 3UWVA 1G5AA 1V8EA 2YDQA 3KS5A 3N11A 3TVAA 4IF2A 4AVFA 4HHMA 2A3BA 3GK0A 4DNMA 3W6LA 1YYAA 1R38A 4JFWA 1DWGM 1E1CB 1TTQA 4LF1A 4CCCA 5I3IA 4HK5A 1BFNA 4EE9A 2GUYA 1GOQA 2QPSA 4AEFA 2YJQA 3WQPA 4BI5A 1QOPA 2E6DA 5HNUA 4IIGA 4OBRA 5I2UA 3OZYA 2ZRZA 4B5WA 3C52A 3AQUA 3IJIA 1FQ0A 1J0YA 3N4AA 5H8MA 1V3IA 3WJZA 2WNWA 3WJWA 1XFBA 2XZ7A 2HRWA 1DWFM 4ZB2A 2E9BA 1I1XA 4B5UA 3U4FA 4M51A 3M6YA 1Q6DA 4GIEA 1OCNA 2WSPA 2VGIA 3AIWA 1KXTA 3OZOA 4TVDA 4XWUA 1OVDA 2VZTA 2EQDA 3S6TA 1XLBA 1Z6KA 2E5BA 4ZO8A 4I7WA 3G77A 1NFPA 4JTJA 1EDGA 5A8MA 2J8FA 4D6FA 1HVXA 5FEXA 2YA1A 2BHUA 4NZ4A 3THAA 4LCQA 4WRHA 5FF7A 5M2FX 2RGMA 1VRDA 1K7XA 3HV8A 3R25A 2WZHA 4XUGA 2C1GA 3WSUA 3E5BA 2ACQA 2XFWA 3CL6A 3QLLA 3L65A 1H7WA 4C1KA 4N9BA 3AC0A 4JTQA 2ZA3A 4W8AA 2X7VA 4UMBA 3SJNA 3DCPA 1JCLA 3EWWA 4HTBA 3VA8A 2V69A 2VDHA 4AIBA 4F8XA 1CLKA 1HL2A 1FHVA 2ZRWA 4PCFA 4EK7A 3TROA 5FESA 1VLIA 3P14A 5JH2A 2R1MA 4CVUA 4O19A 2PRLA 1EHAA 1RLCL 3VIGA 3I6TA 1LOLA 3M0KA 3W2UA 3QC0A 1YTKA 1S5VA 2FFIA 1OCBA 3CQKA 3I7QA 5EKYA 5I3JA 4B2DD 1ZCOA 2RDTA 5AC4A 4F0RA 5C2CA 4CNTA 4MAVA 4I9TA 3TZFA 1UROA 4IMEA 4C65A 4DWSA 4AWEA 5AYBA 3IJ7A 3EB2A 1DXFA 1QNQA 3RITA 2WHMA 2WCAA 3U7BA 1PUDA 1RR2A 4ZTYA 4PSPA 5CBJA 3CV6A 3VIIA 3WQVA 3GIQA 4YS1A 2CZFA 3QFEA 3WCZA 3P80A 2DZTA 4QSFA 3TZNA 3VIJA 1QNOA 4AIEA 3CIXA 4JL1A 5CPQA 3W84A 1UR8A 3YPIA 2WNQA 2FTYA 3A12A 3DFPA 1KWKA 3HZ3A 2YKKA 1CGVA 2OQLA 3OVQA 3M0HA 3DX5A 4LUTA 3WN6A 4IHCA 1MZRA 2L5HA 4H8VA 1XGZA 1W1YA 5HINA 2Q8ZA 4JNMA 2PF0A 4YNGA 1M1BA 2EEXA 2P8CA 2YBTA 1EKOA 3T81A 2BV9A 3PZUA 2V9DA 4FP1A 3GX9A 2O9OA 1D3CA 3MANA 1XIGA 1H5YA 1LBFA 2C16A 3QH2A 1ZTVA 2WJDA 2B4GA 3WJXA 4BWLA 3QYQA 4A3QA 3VKDA 3H2EA 4AZIA 4P7OA 3V5CA 2DZSA 1X39A 5A2AA 3QLDA 1IEXA 1F3EA 4A35A 4AVNA 2OVLA 2ZUNA 3A9BA 5CQ1A 1TSIA 4UFMA 2ZCGA 4GZIA 2BXYA 3V36A 1XQKA 1KFEA 1V08A 1EOKA 1ONRA 1ZUAX 1FX6A 2GVLA 3H2OA 2W92A 2PWEA 1FHDA 2E5CA 4EP8C 1TO3A 3MB9A 5C9UA 3PZTA 3ZLFA 4PEEA 1CXIA 2VOMA 2YFOA 1AL7A 2FFCA 1QPOA 2I17A 3GR4A 5AZ1A 1HNYA 3H54A 5EA9A 2OSXA 1KGXA 4H2CA 5FF2A 3L4VA 2ZZ5A 1Y0EA 3B04A 4ICNA 1VPYA 1FUYA 3VD5A 3EWZA 1VFUA 3C2OA 3W7DA 3AHTA 3AXKA 4L4LA 4LRTA 1EUAA 3UZXA 5C55A 1J4EA 2PE4A 5D9NA 3GSMA 1KD0A 4TUFA 4DB7A 1F3TA 1FXQA 4QLJA 3WFLA 5CGMA 3T2QA 1XCXA 4UTLA 3BK0A 2BZNA 5AHEA 2Y61A 3TQKA 4JY9A 4DJEA 3GAYA 1PIFA 5A2BA 3QGVA 2FB2A 1KRMA 4P61A 4RX0A 4A8LA 1LTDA 3IUDA 1KO0A 1XH1A 2XZ9A 1UASA 2XWDA 3QFWA 2VURA 3H2FA 3NEVA 1FWCC 4B5XA 5DT5A 1QW7A 1WCGA 2XTKA 2XYLA 4LS0A 4ZQCA 3SGZA 2PDPA 3CZGA 1UWAA 4XSLA 3VIKA 2P3ZA 2WLYA 4UTTA 5CPNA 2BB0A 1FVPA 1UWUA 2YX0A 1CW2A 3LBCA 2X30A 3N04A 1EXPA 2RDUA 4JYEA 4C6FA 1DBTA 1MEWA 4LEFA 2Z7GA 3EA3A 4AD5A 3IV8A 3VC6A 2H90A 3ATYA 3RLHA 4FIRA 1SO6A 1CCWB 1G67A 1UOKA 3BLKA 4FB7A 2YR1A 2Y2WA 3UF9A 2PFHA 3AXHA 3LBMA 3DGBA 4GHRA 1JPHA 4H04A 1QHZA 2HS8A 2WK2A 2AKMA 4GYPC 4GA8A 3EXTA 1VGAA 3CIVA 3TW7A 1EDTA 3SCVA 3AIVA 5EMLA 3TA6A 4ZXLA 3BAYA 4E4FA 4EXBA 4J5NA 2YFNA 4ES4A 5TF0A 5CZSA 2OZTA 1ADOA 1F4AA 3FJNA 5A5WA 4LUTB 3TN5A 1M7PA 1GVFA 4F2UA 2ABAA 2HE8A 4ZE4A 4TMCA 3ARWA 3GBEA 4CNUA 5HWMA 1S5MA 2REQA 4A8NA 1HW6A 3RCNA 4GXWA 3NYZA 4JNZA 1RP8A 4FLQA 4YVXA 3AZTA 1XIFA 4IPNB 4Y2WA 4WQ6A 4O8RA 3AMGA 2I9EA 1T7LA 3MO4A 4S2BA 2R6OA 1AQMA 4A3YA 4F0SA 4BY3A 4C1LA 4C6MA 4GYKA 3FAWA 3N2TA 1VCFA 5CZKA 1HKVA 3PWAA 4RW5A 4OUEA 3TA9A 5I24A 3PPGA 2GDQA 2ZIDA 3BV7A 1UA3A 3GE7A 3FS2A 2X09A 3L23A 1UKTA 3C2EA 1A0EA 1JYVA 3PSWA 3VNJA 4KS0A 6XIAA 3CV7A 5E1QA 1ZBKA 3LHZA 2JGQA 1PWMA 2V5BA 1E6PA 3UNTA 5K9XA 1NWRA 1R3TA 3LM7A 3WEMA 3ZIZA 2O55A 1OT2A 5F2MA 4Z2KA 1B9ZA 1XBXA 4GC3A 4S3EA 1DJGA 3THDA 2BG5A 4J2PA 2IMRA 1KLYA 4JS3A 2GGEA 1HGYA 1KNWA 4OJYA 1ISYA 4NSBA 4POCA 1AJZA 1ISWA 2PUZA 4CVWA 4YTTA 4XVDA 2Z29A 1MDLA 2ACSA 4Z1DA 4N6EA 4ECLA 3B05A 1CENA 1US3A 1JZ5A 1EH9A 1M41A 2UZ9A 4MSSA 1PE1A 2CC0A 3M0ZA 5D2YA 3LQGA 1FWTA 4AMAA 3UEQA 4ZA0A 1ZZMA 3WLKX 2QVHA 4IMCA 4A21A 1XYZA 5FJTA 2PGRA 3NQEA 2C1IA 1DHPA 1O68A 4GFIA 2UWFA 4WJEA 4KCTA 5H1WA 3W82A 3FLUA 3NQ6A 4US6A 2FGBA 4WLCA 1TKKA 3NXLA 4Z1AA 3FVMA 1RA5A 4UTWC 3SCRA 4AAJA 1PWLA 3TTOA 1MFUA 1L6GA 2WZTA 3TWAA 4DWDA 4YIWA 3W2MA 4DF2A 2X1UA 2KAUC 4RNFA 3MTWA 4LH8A 5G4HC 3LCGA 3APYA 4IOTA 2Z1XA 3M5VA 3BJSA 3HPZA 4FXSA 4S3DA 3VM7A 4RR4A 1CI1A 3VKBA 3EAUA 4H7VA 1I2RA 5LSMA 1TZZA 2Y4SA 4YHGA 3GLCA 1RH9A 3CIWA 4NYUA 2V8ZA 1F74A 7CGTA 3QTPA 3W1AA 1ECQA 1BLIA 4U2ZA 2E5DA 2WMFA 2RH9A 2PDJA 1TPEA 3Q58A 2F84A 4NP7A 3WQDA 3TJLA 1D8WA 3ONCA 3PFMA 2I1OA 3RPDA 4HZ6A 4QQUA 4QRNA 1UIPA 4BEQA 5BMXA 5I77A 2RHGA 1PZ2A 3VGEA 3TFXA 1M9HA 3MT1A 3GS6A 4GRSA 2VCAA 2ZWZA 4UR8A 1H09A 1K7EA 4YYFA 4QEEA 2Z25A 3C61A 3LCXA 4X2PA 4UTUA 1CGTA 1GHRA 3OG2A 4DBDA 3GH5A 1K4HA 1BXBA 4HU3A 3LMYA 5A8PA 3IS4A 3D5HA 4UXDA 1BKHA 1MEIA 1G69A 1W9UA 4LGXA 1ISVA 1A53A 1UB3A 5U4NA 1HKKA 3AYSA 4F0MA 2I7GA 3KDNA 3KBVA 1E0TA 1JDCA 4LVDA 2A6NA 1AA1B 1PCWA 1U33A 2GGHA 4YTQA 4DUXA 4GNVA 3PPCA 1F76A 5AKQA 4LUJA 4ONVA 1IQ8A 4N0RA 3KFTA 2ZZ2A 4DZAA 2ZVRA 4TTGA 3VILA 1O1HA 5B7YA 3W9ZA 3SB0A 4JTKA 4O14A 1D2KA 3IEBA 1DIOA 4AY1A 1M6JA 5DN1A 2J8TA 1TTPA 3KVJA 2GK1B 2OQYA 4KIEA 5XIAA 1WDRA 2XVGA 2HDJA 3CH9A 3NZQA 1XBVA 1LP6A 4DJEC 1MI3A 1WKFA 1W3IA 4H9TA 2NQ5A 4HSOA 3W76A 3GVRA 4PCPA 4GY1A 1QHOA 3WNMA 2ZZ1A 2XVPA 1J0IA 3EB4A 1CGXA 1ICQA 5D2XA 3AAMA 5CC5A 3MCNA 2XU2A 2VM8A 2EJAA 4QLKA 3MMDA 1HUVA 2C3ZA 4EVZA 3NNTA 2QUUA 4HP5A 1O5QA 2TPSA 2CLOA 6XIMA 1DJHA 1ENUA 3TEVA 3SY1A 1E9LA 3LG3A 4J35A 2FJUB 1H0IA 4DUVA 2WB5A 1LG2A 5C7VA 2Y5JA 3L5LA 4QNEA 2E1DA 2NSXA 4O57A 1U1HA 5DBTA 1GYMA 3OVRA 4PMUA 1C93A 1MRAA 4RCXA 3CXOA 5ABGA 3C2VA 1RJRA 3HQNA 4PCSA 4R53A 2ESCA 1B9BA 3UU0A 3VE9A 2H3BA 1R5YA 3MMTA 3VZZA 2ISDA 1E6ZA 4ZCWA 4XBKA 3LCIA 2BVWA 1O5RA 4PBEA 1PKYA 3IV3A 4M6UA 3PJWA 1A5NC 3EX4A 3V5OA 2DUZA 3UP8A 1LRTA 1KR0A 4HPNA 2PDNA 4Q8OA 1I4NA 5D32A 2C71A 3OHIA 1PBGA 4JDBA 1QI5A 1DJWA 4HT3A 7TAAA 4XIAA 1DJXA 4I3GA 2VVNA 4ZFCA 3SCTA 3HG3A 4ML9A 3KL0A 2OZ0A 4KCVA 2GGGA 4O13A 4PYSA 4WSKA 2Y8VA 3UWZA 1QR7A 3VDAA 1UH4A 1X98A 4JZ5A 2Y7FA 2WVUA 5I3HA 2O0TA 4XTIA 4F40A 2VELA 1MWOA 4Y9PA 3VCRA 2YYUA 5CAHA 1B5TA 1WXJA 4PMVA 2CBVA 1OX4A 1QPRA 2NQZA 4EIVA 4CQDA 4GY0A 4AY7A 5E93A 3IIOA 4PUNA 3NQ8A 1EF3A 5CXPA 1GZJA 3MCOA 1VJZA 2IQ0A 5EU9A 1WDWA 5EMKA 2NXHA 5GNZA 1KCLA 1UR9A 2Y8KA 3V0TA 2WW5A 3S2JA 1O60A 1DWAM 1T8XA 5HPOA 2VOTA 4L61A 4MIMA 3MSYA 2Z2UA 3CAVA 2NQHA 2FVLA 3DG3A 1SZEA 3MC5A 3QPYA 1UIOA 3JZEA 3LV6A 2WCSA 3BLPX 3PB0A 3RMJA 1QW8A 3CM4A 3I68A 4FPSA 4AB4A 5FIPA 4NNBA 1BKSA 2CW6A 2NVAA 4JYFA 3NQFA 4CD7A 1WDPA 3II1A 4OGZA 3PNZA 4K3ZA 1D7FA 3URNA 5FEPA 3ZLHA 4DJDD 4Z1YA 1XLMA 1WZMA 3H6OA 4ZE5A 1MYRA 1BF2A 3WF3A 3HIJA 1NDWA 2WNZA 3N9KA 3KBNA 5F2GA 4XZHA 2CERA 4DAIA 1CXKA 1B57A 3TV8A 1A49A 3PB2A 1RP9A 3CPRA 4DIAA 3GDLA 5CLWA 2JEQA 3MYOA 2FJKA 4GUGA 4JTIA 1W91A 2FZBA 5FAGA 5M03A 2JIWA 4DLMA 3W85A 3UWYA 3OEXA 3KRSA 1EXBA 2XISA 4URIA 3HPSA 1AH3A 3VIOA 3VZXA 1IZJA 2G37A 2A21A 4H00A 4JHMA 8XIAA 3L21A 3SFWA 3QZEA 3UXKA 1YEYA 4CN6A 1RXOB 3EZ4A 2VC7A 1XL9A 3IJ6A 1SO4A 3AALA 3LSCA 4NJKA 4ADUA 3FYYA 4W84A 3O05A 1ME7A 3FYPA 3GTNA 3R11A 4WSHA 3NSNA 1AH4A 3EWYA 1CNVA 3UW6A 4GX9A 1KA9F 3K30A 1C9DA 2REQB 3LRLA 4S38A 4HNLA 2IW0A 4O1BA 4UC5A 3UGVA 3LB0A 3SN0A 2HBXA 3BLLA 4LCRA 2E1WA 2WHKA 4CD8A 2F6XA 3ITLA 4WGHA 4BQ3A 3LXCA 4Z1BA 4DBUA 4F0HA 3WG6A 1YE4A 3ZQ9A 2P5NA 5AB3A 2WM1A 4NUWA 4C6NA 2BXZA 4CNPA 3BOFA 4C1NB 4O18A 2QUNA 4QX4A 4H7CA 3GXMA 2RAGA 4PMYA 1A5SA 1YHTA 2XH4A 3AS0A 3W01A 1XLEA 5JVLA 2WJZA 4JCLA 4B9YA 3LLDA 2IKGA 3S6DA 3OP2A 2OEMA 3BUVA 4PTDA 3P62A 1BVZA 5HULA 2WWDA 2QV4A 4FK9A 4QG9A 3DFNA 4HMDA 4PUWA 3HG2A 3DEQA 2DZWA 3UG3A 2QPUA 2QJMA 3NSMA 4LT9A 2DH2A 3WDJA 1OYBA 4BQ5A 2V82A 2OT0A 1KBKA 3W74A 2Y85A 1GG0A 1L6WA 3EOEA 3KP1A 4M0XA 5C9ZA 3WD4A 5BU6A 3M0VA 2F9RA 1R3SA 1OZQA 3VGGA 3T07A 4GI6A 1M7XA 4B15A 1U83A 2ZXAA 3DECA 1Q5MA 3BJTA 1Y65A 5DRCA 5TQLA 4ZO6A 3D6NA 3KWXA 3CMFA 1VENA 2HXUA 4N6FA 4HMNA 4UQAA 1DPMA 3IUHA 3WQGA 3A4WA 3GDKA 3T55A 1I0DA 2CBJA 1BWLA 5HJLA 3ZSTA 1XSKA 3PF3A 4KQNA 4RK8A 1LUCB 4K38A 3AIQA 1UA7A 4WJ8A 2ZUWA 2J9XA 2W6RA 1TJ1A 4ATWA 1XRVA 4P5UA 1OK4A 3DGRA 1Q8AA 2CFFA 3A22A 1O4UA 1B31A 4DO5A 2A7RA 1D8CA 2QCCA 5GVJA 2CCRA 1PXGA 3BV4A 4DXVA 4DYKA 1JL8A 4L56A 2FKPA 4E2OA 1M68A 3HU7A 3P6LA 3VD9A 1J18A 1W1ZA 1EIXA 4NVTA 4DO6A 2J6XA 4D6JA 3W7MA 4Z2GA 4JIHA 1KKRA 1ONXA 3IIZA 1ME9A 4MB4A 1R2SA 2P50A 2Z0IA 1J9YA 4R3UA 1PX4A 4HN4A 1H1ZA 5EFFA 1F3WA 4WY0F 2ISWA 4W89A 3H21A 1V7AA 1EYWA 1IXQA 2G4FA 4FA3A 1VEMA 3KRBA 5CPSA 2DT0A 2Q71A 1BPLB 3B9AA 3L2MA 2J8GA 3I7SA 1YXCA 2I56A 4CU6A 5C71A 3WH7A 2PD9A 3R1ZA 5A6SA 1C8YA 3STCA 1Z69A 4RLIA 4QDWA 1KRBC 1PKNA 2Q8XA 3PG9A 3LNPA 2UY3A 4TQTA 3U8GA 4JDYA 4XZNX 3VNLA 4IFRA 1XQLA 1U5JA 1I0BA 4O4WA 1HX0A 4P7QA 5DMMA 1WP6A 2E7FA 3S5SA 2G3NA 4DNHA 1OEPA 5BXRA 3WK0A 1WYIA 4XKYB 4P8UA 2RJHA 4TX6A 1H5VA 3TSBA 4JKKA 1CXLA 1BVNP 5EGRA 2YLLA 3U57A 3QV7A 4BCEA 3VNDA 4K1GA 3T0DA 2DZAA 2Z28A 2QXWA 1VLWA 1MUWA 5IOBA 3BAKA 1R2TA 3M7WA 1B3OA 4FLSA 3ARTA 1QK0A 2IXVA 2X05A 4K6AA 4ZQRA 5K4XA 4LUIA 3IIXA 4OECA 3QMRA 3WQ5A 1R46A 5LIKX 3DFSA 1OABA 1BXNA 4M7SA 5BW6A 3QY8A 3O6CA 2WMJA 2RUSA 3KS6A 4J3ZA 2QUVA 2CITA 2CLFA 4JTCA 4DJFD 3IWPA 4PULA 4FOJA 5BOOA 1TVNA 3N3TA 4E2VA 3WX7A 3HOJA 4IPIA 3QQ0A 1P5BA 3QKEA 5T26A 4KIRA 4ZO7A 3LX9A 3SCNA 4OWGA 2NSOA 4NJGA 4XZMX 3T0CA 5D37A 3M5XA 2PWDA 4E0CA 3LZ5A 1E3XA 1IGWA 2HK1A 3QJAA 1P1XA 4DEFA 1QBAA 4PCTA 3K2GA 3SW6A 1OBAA 2IKHA 3A23A 2PP1A 1GUVA 3I10A 2D69A 4MKNA 5FACA 3GR8A 1HT6A 1R8LA 3CL7A 4GO9A 4WDWA 3ANVA 3S5OA 4S3AA 4GK8A 4MOZA 2HCVA 3TXVA 1W9BM 3C3UA 5A69A 5LA1A 1M5WA 3AMDA 4O16A 3L2LA 4MNMA 3MYPA 1HQTA 1LDCA 1BSLA 3CUGA 5A6KA 3VPLA 4I8DA 4QS5A 4NJHA 2P0OA 3RF9A 1NM9A 1QASA 2WAGA 1OFDA 3GW3A 4AZ6A 2GQ8A 4LALA 3INPA 3RX4A 4GY7A 4UNKA 1WNOA 4GJ1A 4P8WA 3AS2A 3R8GA 1DIKA 3NQCA 4RKAA 5HQEA 3PBMA 5AHNA 2POZA 1IEQA 3WD0A 4OOUA 3AUJA 5HA7A 1JJKA 2EG6A 3FAXA 1E6XM 4BA0A 3T40A 3BMVA 4N9EA 2WBGA 1XINA 1F9CA 3ZJ7A 1ZJIA 3CZEA 3M0XA 1UQZA 3NM1A 1MNZA 4Y6GA 5AC7A 3IGSA 1REQB 5LIUX 5AYIA 4PZVA 2FZNA 4AF0B 1H7RA 4AD0A 2FHFA 5FEZA 1OG6A 1Q63A 4Q33A 2BTMA 1JPKA 1WE5A 2VEKA 1DXEA 3W88A 4R7WA 4IFKB 3N4FA 1NAL1 3ANUA 2ZADA 3NQDA 3AS3A 5H8PA 1TV4A 1DYSA 4QE4A 4P7RA 5C54A 1XDLA 3JW7A 3UY7A 2DV0A 3TAKA 1E9IA 1X8FA 5FEWA 2XFRA 3NM3A 1OQFA 4R88A 4Y9AA 1PVNA 3GFXA 1OGSA 4IGMA 1HKWA 1B3ZA 1KM4A 5GPRA 4ROQA 2VFFA 3AMLA 4LVGA 4FNRA 9XIMA 1KW1A 3HMCA 4FAMA 3IAQA 3VK5A 3W73A 4JQAA 4DX3A 3RMEA 3UWUA 1OSEA 4Y96A 1PHWA 3EPOA 1OFQA 2JK2A 4YPJA 3LXAA 3FJ6A 3TC3A 2JFEX 2GWGA 2QW5A 4JX4A 5HNTA 3QY7A 4O28A 2DUXA 3CAWA 4CEUC 3WNOA 1IHIA 2EG7A 3OGSA 3SM0A 3OZMA 2HNHA 4W7UA 3TC6A 3TKFA 5BWFA 1XPYA 3SEPA 4X0NA 4LBRA 2J47A 2XVNA 3NQAA 2BOFX 3PPHA 2Y70A 4GFSA 4PRTA 2HVMA 3REQA 3REQB 1SZGA 5I7GA 2CBUA 2V68A 2J6VA 3QR3A 1JD9A 3ARZA 4KRTA 3UPMA 1GQNA 3VGDA 3WH6A 5CBIA 1CXEA 3SGUA 1VJSA 3P5YA 4R85A 1DORA 3NPWA 1PX8A 1NWTA 4C91A 4GWEA 1E1FA 1Q6QA 4NT0A 4JTRA 4KFPA 3QQ1A 2QJJA 4MJZA 1IV8A 1XRSA 2GSHA 4C7DA 4PMNA 2CLHA 1RLDA 1UBPC 3O0FA 4IT1A 3QMTA 3TTEA 4IGHA 3MVIA 1HJWA 5CC3A 1O94A 3F4WA 4MAZA 6PTDA 4FIQA 4FNUA 1RHCA 5KZEA 2FHCA 5HDRA 1WBHA 2OFJA 5D4YA 2YXGA 3B03A 2D73A 2D2HA 4U5KA 3T44A 3PJXA 1Q2SA 1LJYA 1OZMA 3AOFA 3AO0A 4O1CA 4D1JA 3UXDA 3MBDA 4EXQA 5ABHA 1Z8AA 5F1UA 1J0HA 2VT0A 4U28A 3R43A 1W1VA 3A4AA 5DF0A 4E4UA 1OF6A 1GYLA 3GTXA 3TJXA 2YA0A 1GQJA 2FH8A 4XTDA 3A24A 3VCCA 1VC4A 4NI8A 1LOQA 4BF5A 4IZGA 1KBLA 2QUMA 1SVDA 3TJIA 3GC2A 3W1UA 1TV8A 3MKCA 1VPXA 1XLLA 4IP7A 3LA4A 3AI0A 4O17A 2A5HA 2ZXBA 4ERAA 4RE2A 1A3HA 2V5JA 1DQUA 1UCWA 3PZGA 1FOBA 3U5UA 4H3DA 1H1NA 2Y62A 1TCMA 5JH1A 1FP8A 1WXYA 3WH9A 4CGTA 1H62A 2PTXA 4AZHA 3G3MA 2EPOA 1NF0A 3NPXA 2PWUA 4GVGA 1E15A 1V02A 3ZO9A 3LNMA 5I00A 3E0VA 1V77A 3PPFA 3H55A 1ODZA 4EACA 4HK7A 1FCBA 2QDHA 4GC4A 4GYFA 3KOYA 4A2RA 3LYEA 4BEUA 1J0ZA 2PRHA 1LUCA 3D47A 4Z17A 3H53A 3WF0A 3BH4A 4NZJA 4XSMA 3LN3A 3LK6A 4JTFA 3N3MA 1HXJA 4D2JA 2R8WA 2R91A 1PDZA 1EJSC 4PTMA 1WX0A 3CU2A 3URAA 2G97A 2GVEA 1JZ7A 4DJDC 3QQWA 4BI6A 4KPLA 4B4HA 3BZJA 3URQA 2DSZA 3NURA 4TU1A 1SFJA 1AW2A 3A3WA 2Z2BA 2GUUA 3VKJA 3M0IA 4H6KA 2BX7A 3OTRA 3OVPA 3RRAA 3GW0A 4ZOAA 2ZE3A 3EPMA 5E9AA 2V3EA 1ZP4A 3WNPA 1GVEA 1HJQA 2X8RA 3FFSA 4UOQA 4PSRA 1OFOA 1J5SA 2HNEA 3QTGA 4X2RA 2ISVA 3HA1A 2E09A 3PUEA 1AL8A 5IHRA 4JKLA 1XKJA 3ID7A 4ZGYA 1B3WA 1QPQA 1VS1A 2YCJA 5AN7A 5BOFA 3FKRA 1NH6A 5I23A 4MDPA 3R6IA 4UMAA 2V38A 1SM9A 3EA2A 2CU0A 3DH7A 1ZQ5A 2H9AB 2W66A 3SY8A 4UTTC 5BCAA 1F4HA 1P1MA 4RE4A 4WR3A 3GBDA 3ZM8A 2VD9A 3EDFA 4DO7A 2VO5A 1OX6A 3DBNA 3HGOA 3FA5A 2PCQA 3LERA 4AQLA 4AY8A 1A80A 1NARA 2BY2A 1JDDA 4CNOA 2J77A 1DTUA 3H8AA 2ATMA 4NL1A 1R0MA 5CPLA 1E43A 1QBBA 3GC5A 8XIMA 4Q7IA 3NIYA 4RDVA 1WDSA 2OTDA 4N7QA 3JRKA 1MUMA 4UCFA 1CGUA 4KETA 3H2MA 1JGIA 1C9WA 4AC1X 1QO2A 2IKJA 2IS7A 4TIMA 5LGXA 2VEIA 1P7TA 2DZUA 2ZVIA 1VD6A 4IGSA 3DKLA 4XD4A 1ZJHA 1QHPA 4B2DA 2F2KA 4XKMA 4B90A 2GOUA 3NQ2A 2QNEA 2V63A 1W37A 2X7WA 3GDMA 1YMYA 1XLFA 3QEZA 3ZWSA 4Q4RA 4OU1A 4JEQA 1GWJA 3EWXA 3U2EA 3UETA 3H12A 1BWKA 4XD3A 5JBDA 4O1EA 3GIYA 3VNYA 4HJWA 4AX7A 2VQTA 3VMOA 1UPPA 2TMDA 3QOMA 3DZ1A 2IQTA 3U6WA 3VNIA 1IEVA 4QFUA 4ZZ9A 3KP0A 8RUCA 3A47A 2PTZA 1VBGA 2ZXQA 4QS6A 1KCKA 4ZOBA 4NXSA 1Q8JA 3MUY1 5AY7A 3U5YA 1WOAA 3WO8A 3MMUA 4W8BA 3USZA 4P7LA 5HUPA 1Q6RA 1QFEA 2C6QA 3I4EA 4H01A 3DFYA 3G1YA 3S46A 4QDPA 1CXFA 4FF5A 3FSUA 1C7TA 1ISZA 1AJ2A 3HO8A 3E2QA 4ZQNA 3L66A 1TMQA 1V79A 5KMYA 3FGCA 1IEWA 3EKZA 3OA5A 3U4AA 1L6YA 1TX2A 3SUVA 4PODA 4F79A 5MKGA 4V2XA 2YL6A 4LYKA 2O4QA 2C7FA 1TFVA 1GVSA 1CB7B 4C90A 2CBIA 1N2VA 1P6WA 3WF2A 1OFAA 3H26A 4H6QA 5C2GA 3LU2A 1PEZA 3W72A 3N17A 1Q45A 1XLKA 3M16A 3HF3A 2VCBA 4UFJA 4MY1A 2ATSA 3NJ3A 4L4PA 3B9DA 2VX5A 4L6OA 3CNYA 4QCFA 2H8XA 4WZHA 2HMCA 3UZWA 3HN3A 4HPGA 1GOXA 1K9DA 3UR2A 1DJQA 4YVPA 1LL6A 4B4FA 1UHVA 3ZMRA 1JAKA 3PBGA 1JYNA 4HIBA 3ZVIA 2VUNA 3NVDA 1SZRA 4PUEA 2J75A 3GU2A 3OZPA 5I0DA 5LYRA 3W87A 2E3ZA 1NDZA 3EOLA 3K4WA 4JAWA 3VABA 3VDHA 1BRLB 1F05A 3FCPA 3NVTA 2V5CA 5GQBA 1XLAA 1FWFC 1OX5A 2CLIA 3CUFA 3GNOA 3WLOA 1JPMA 4GXPA 3HGJA 1R6WA 1ESWA 3FHAA 3GXTA 4A29A 1XXXA 2PRMA 5EMJA 1XGDA 1VF8A 3LOTA 3E02A 1RZMA 1MDRA 3GFYA 2PC4A 4Z2LA 2C13A 4F66A 5A6BA 1A5UA 3N19B 5I02A 3F4CA 1TPH1 2G8ZA 5DRIA 2PTWA 1HJVA 3CQHA 4HA4A 4N9CA 3IGUA 5EMMA 2QF8A 4YXGA 1VFSA 1X7IA 3VKAA 1ZBVA 1X1NA 4TOQA 5C9RA 3MY9A 2Z7KA 3R4IA 4PBGA 4MB1A 3CUIA 3TW6A 3WYZA 4CU8A 1W9VA 4O0QA 4BI7A 1TA3B 4KESA 4RXGA 3PBYA 1V6TA 3N6JA 3NZGA 3P8JA 3PUDA 3MS8A 4QJ4B 1DV7A 2QQ6A 4GQQA 1TIWA 2FPVA 3GH4A 3NL5A 7REQA 4PMZA 4ACZB 3W1QA 3L0GA 2QR6A 1N8WA 4O12A 3P0XA 3M1ZA 4Q4KA 3T2PA 1XC4A 5HMDA 3TSMA 2EHHA 4Z2HA 2BASA 3EDDA 2J9ZA 3XIMA 1HGWA 3XISA 3SGGA 1HFBA 1W1A1 3JZUA 4JL2A 4K36A 2GJXB 2QHAA 5AVHA 3HJEA 4PBFA 5F2LA 2J7FA 3IJ8A 1FY6A 3TNOA 3M43A 1A5BA 4GXMA 1OY0A 4XIMA 3UZZA 3L4ZA 4F2BA 2D1ZA 4UTWA 4TV5A 3WMSA 2EXOA 4P2VA 3H4GA 3VIHA 4DELA 3WDQA 4ROPA 4DY1A 2QKFA 4D6EA 3NPUA 3N14A 4E8DA 1NJJA 1SW7A 1PS9A 2GDUA 4C1NA 3VO0A 2F8QA 3UZ5A 1WUFA 1LLZA 3UGRA 2PLCA 3LTSA 5JIPA 3UY8A 4Y9MA 1F6YA 1AMKA 4GQRA 1UWSA 1BYAA 4D8AA 4IICA 4FLRA 5K9CA 4MY9A 5BXSA 3L5AA 1UPMB 1XH2A 1UR3M 3GNDA 5HOSA 1WZAA 1FXPA 3TQ0A 1JR1A 2I9UA 4DBWA 1GHSA 2AMXA 2J66A 4AHPA 3K1GA 4Z2JA 3BTNA 4HHLA 1TVPA 2WZIA 4S3KA 1BQGA 4MJMA 3I65A 1TJRA 3WDHA 2BS9A 1SMDA 4ZENA 1UP3A 2DH3A 4GGHA 4AUBA 2IPFA 2JALA 4M29A 3CO8A 2ANUA 5CJ5A 3UERA 3BAXA 1LOSA 4C5ZA 1A47A 3TK7A 3UG8A 1ADDA 1UD2A 1W2PA 4Z42C 3CYJA 2Z26A 1NDVA 4XD6A 1ICPA 1XF0A 2XIQA 3DG6A 3LV5A 3VM5A 4GI8A 1XCFA 3VOJA 4L5ZA 1A5CA 3IGHX 4MB5A 3TYEA 4TVUA 4PTVA 1RCOB 4Q6JA 3W7EA 4MJ4A 1ZBWA 1ZNNA 3KBMA 1DOSA 2ALDA 4R7JA 1LORA 3B8UA 1P0KA 4JTEA 1C7SA 4US5D 4NAFA 3F4VA 4KWUA 5AHIA 1E73M 3GNNA 4E4PA 4MPKA 3DYOA 3GZ3A 3AU2A 4GYJA 2WM0A 4RZ4A 1V6WA 1YNPA 3N2MA 1W8GA 2PDXA 2E6AA 1IWBA 3N12A 3VDBA 4JR5A 3DHUA 4S3JA 1UP0A 3EWDA 4HGXA 3MJMA 1TV2A 1KC7A 4XQ6A 3COTA 1AVAA 1MZHA 1HVQA 1HN1A 3B9EA 4GQ0A 3TU9A 2EKGA 2ZDSA 4RE3A 4AD1A 3VNMA 4GYPA 2NQ9A 3WD3A 2VRQA 4ZQOA 4KH2A 4G7EB 4WD0A 1C92A 3G8EA 1T5AA 5FOOA 5C8BB 2DJLA 2PWFA 1Q3NA 3W2KA 2YGYA 4Q8PA 2PAJA 4UFHA 1C29A 3H2AA 4PB3A 2CLLA 3PS7A 3HJZA 4WKHA 1YW1A 1ZALA 1GEQA 2PLKA 3D3FA 4XAGA 1XLGA 3MUAA 4S1FA 4IMDA 2ZBTA 3P3BA 4ZSUA 1LL7A 2CETA 4U5IA 3PTDA 4HB7A 2CKRA 5AFDA 1FRBA 3TAOA 5LIYX 3A64A 3OPSA 4H9XA 5C70A 3O6AA 4RNIA 2VFEA 4UNIA 4L6DA 3EWUA 4R7OA 4U33A 4Q8WA 1X8CA 2C1HA 1XD1A 1K02A 5FJIA 3WUGA 3GKAA 2VR2A 2CLEA 4XO6A 2WO5A 4W7WA 1XR2A 1QT1A 1ZGDA 2YCEA 4I5XA 3VOHA 2E28A 1Q13A 3C0LA 1OIMA 1CGYA 2HTMA 1HL8A 1BAGA 1ZENA 1FH7A 3M0YA 2EPHA 4IIFA 2ZZ7A 4X61A 3N6HA 3L7RA 1I2OA 4Q8TA 4PUDA 1VBHA 4ILSA 3VC5A 5AZ0A 2D0GA 4I5RA 5FL0A 1XFCA 4OIFA 1GW1A 3KHJA 5ABEA 3P82A 4M8UA 4ZOEA 3PZVA 1NOUA 3OGRA 3S2NA 1I75A 4HD5A 4QROA 1PJ9A 1U22A 3H70A 2FTPA 1DHKA 3BPWA 3TIMA 2A0NA 3BW2A 3E2VA 4IGNA 4LVBA 1JPIA 5A2CA 3BOXA 3TYZA 5U7SA 4QQ3A 3W7LA 3WK1A 1JUBA 1IT8A 2W79A 2QGYA 1US0A 3PZIA 5A6AA 1MXDA 3CUXA 3CH0A 4HU8A 3QN3A 3ITTA 4MWAB 1AODA 1TVLA 3HBLA 4H8NA 2PP0A 5KITA 4GACA 1E40A 1GPWA 3DG7A 2XUCA 2XPKA 5AYXA 2NWRA 2YDSA 4CQ9A 3QY6A 2QIIA 3DC0A 2Y7GA 3GXPA 2X2GA 4HKPA 5EBAA 3ZLGA 1YKWA 1B1YA 4D9PA 3CPGA 4W7VA 4IUOA 1EWDA 5IXEA 3B4YA 3AMKA 4UTMA 4KEUA 2GLKA 4L7ZA 1UD4A 3M0LA 4AWTA 3GVGA 3JUGA 4W87A 2DW6A 5G1TA 2GSEA 4GVIA 2DSKA 1DP0A 1QUMA 3GYEA 1PHQA 2OJPA 4AMCA 1PAMA 4K8EA 1F07A 3HQPA 1JFXA 2PBGA 1MW2A 2PDCA 4PC8A 4AF0A 5EBUA 2G3MA 5KINA 1Y5XA 2EPMX 3CV2A 3UR8A 1TPC1 2FMNA 1EB3A 3NDYA 1A4LA 4OV9A 4ACYA 5D8WA 3VNKA 2YL5A 4LAUA 3CL8A 4EPBC 2Y7EA 4OE7A 1OK6A 1R3VA 2R14A 4MG4A 3EX2A 3TW9A 5T9CE 2D3NA 4UR7A 1G0CA 1FWSA 1K8ZA 5D04C 3I3DA 4M56A 4FLOA 1ADSA 1V7YA 1Q4NX 1AD4A 3CHCA 4I5UA 4JQ3A 4ZB5A 1UUQA 2C18A 4H19A 3QYSA 3IUIA 4DYJA 3KZSA 2VDIA 3VMNA 2WBKA 4ZSTA 4OTKA 4AD2A 3G1VA 3RNDA 3AUOA 1VFOA 5HANA 1EC7A 4Q8NA 4G9PA 3CBWA 3VD3A 3OJGA 1IXNA 3C5QA 2VZSA 2JQXA 3RJXA 3S42A 5CPOA 4BJHA 2QUTA 3MMWA 4MWAC 3PZQA 2XFYA 3M41A 4DHGA