1TV5A

Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
409
structure length
371
Chain Sequence
FESYNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
publication title Structure of Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 149
structure length 371
sequence length 409
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2004-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv5A00
3ABSA 5CPOA 3GDTA 2QCNA 5D2VA 1S5WA 3P82A 2NZLA 3NL5A 4BK9A 1RQEA 1AL7A 1RQHA 1YXDA 5LNRA 2B4GA 4LWWA 1G4EA 3THQA 4ORIA 2VOMA 2V9DA 1BKSA 1WXJA 1VC4A 4P2VA 3V75A 4XKYB 1G67A 3QRHA 3TV8A 3S1UA 5IBXC 1EIXA 3E12A 1V5XA 3PC0A 3M43A 4GUHA 4UFJA 2A6NA 1VYRA 3RLUA 4U28A 4ADTA 2WNQA 5CG7A 2FLIA 4JTUA 4AF0A 1L6WA 3LHZA 3W7KA 3HOJA 4Z0SA 1LCOA 3VFLA 4ZQNA 1W5PA 4IUOA 3U2OA 3O16A 2WQPA 3T55A 3CM4A 4WD0A 2P0OA 4FXSA 1FBAA 1SZFA 1JUKA 2JKAA 1LOSA 1JR1A 3P67A 1LDCA 4LS1A 4MVAA 1OHLA 1F5ZA 3TQKA 3GIYA 2WPBA 4JX4A 3STGA 4RCXA 4O8RA 4HNVA 4G1KA 3MJYA 3IEBA 1K7EA 5KZEA 3DHFA 5AFDA 1R2RA 3BW3A 1I2OA 2C14A 3TUUA 1W0MA 1LLZA 2X1TA 5D04C 1FXPA 1OABA 2A4AA 1VLWA 4MLJA 1MO0A 4L4LA 3BG5A 3IGUA 4M7SA 3N14A 4YCOA 1T99A 1ZFJA 3GB6A 2E5CA 3QC3A 2WNZA 2GQ9A 2GPTA 1MEWA 4LW7A 2A7NA 2JGQA 5CSRA 4CNOA 3W2JA 2D73A 4LT9A 1EP2A 3BO9A 4PEKA 3BLIA 1ICQA 5AHEA 3MP5A 5I3KA 3DKJA 5CZTA 3UPBA 1TPEA 4PL2A 5DY3A 3TX9A 1TMHA 1IIHA 1Z41A 3M9YA 3L5LA 2RKXA 3GVGA 4QIUA 3DFSA 1IXPA 2DZVA 3S9YA 4TMCA 4RZ4A 3W74A 1JCYA 4JNMA 4QAIA 1W5MA 2FPTA 5CZSA 5HINA 1FDJA 2P10A 5KTLA 3MP3A 2Z6IA 1DKWA 4NNBA 3MBFA 3W7CA 2Q3OA 4QNWA 5AC8A 3R5EA 1FDZA 4IMGA 4JN6A 1FWWA 2IQTA 5EPDA 1VHCA 1VQTA 1T8XA 1TTQA 3EX2A 3A5FA 3NQFA 3NEVA 4TX9A 1LP6A 1FWNA 4DBEA 4K7YA 3EX4A 3OHIA 1SQ7A 1H7OA 3QMTA 1C29A 3EWBX 5HMSA 1TPH1 1H1YA 1YTDA 1OG0A 2ZZ1A 4CNNA 5BNKA 1SW7A 1P0KA 3E02A 1GPWA 1SZGA 3B05A 2WKJA 4O0ZA 3DBPA 2WSQA 3TR2A 2ZZ7A 1TREA 2NXHA 3HIJA 3N9SA 5L6UA 4I9AA 2I1OA 3FA5A 3G0UA 1OX5A 3O6YX 3E96A 1ICSA 1KTCA 5G4WA 4JTLA 2NX9A 3NXFA 3TH6A 1KA9F 1WYIA 3O06A 3A5VA 4A2RA 1Q6OA 5FESA 2Q8LA 1VS1A 2C3ZA 2YFOA 2CLKA 2YR1A 4ADUA 4O57A 1Z48A 1NFBA 4JYDA 1JCNA 3CEUA 3USBA 4UTIA 1QPQA 1KM5A 2EAWA 2H8ZA 2ISSA 3EX6A 3FOKA 4DQWA 3NL3A 5D03A 4N6FA 4PTNA 4O53A 3G0SA 1TJPA 4RZ6A 3U8GA 3DI1A 1JVNA 2UV8G 3P74A 5HNRA 4IX2A 4FF7A 3IVSA 3LV5A 4WZHA 1PCKA 4PC8A 4M6VA 5A5WA 2WOQA 3KVLA 4IMCA 4OE7A 3OA3A 1D3GA 4UTWC 2JKEA 4H3DA 4LRSA 1OX4A 4WOZA 5HUOA 3W2MA 2QDGA 4HSNA 3C52A 4ONVA 3NA8A 3W1MA 4TU1A 2R94A 1VH7A 4IGHA 1WOBA 1IF2A 4JR5A 1IXOA 4UTLA 1W54A 3W7JA 2F7FA 2GVGA 4BWLC 4JTEA 2FJKA 2W6RA 4NNAA 4A3UA 2CW6A 4RKAA 3L2IA 1W3TA 4IOTA 1ALDA 2A7RA 3NQVA 3R2GA 4KFOA 2Y7DA 2PCQA 1V7YA 2E5DA 1HL2A 1PCWA 1VCVA 3DXIA 3LTSA 4NUWA 3CTLA 2ZZ6A 1XKYA 1THFD 1QOPA 4LNYA 1OK6A 4GRSA 3TC6A 5K7JA 1A5AA 3HB9A 4X3ZA 1T0OA 4Q33A 4LV4A 4O1CA 3PG8A 3CIWA 1OFEA 3UWZA 3L68A 4KWVA 3STEA 4GWEA 3TXVA 3G1HA 4WQ6A 5CSSA 4JS3A 1FWTA 2NV2A 5BRBA 5HR7A 1S3HA 4K37A 2PRHA 4NJKA 5CZ0A 4A22A 3ATZA 4K6AA 1KM1A 1YPIA 3RK8A 3W3OA 3INPA 2Z6JA 3G18A 3BW4A 3W2KA 1F6PA 4DEFA 1H7NA 1W8SA 2I14A 4O28A 3K30A 5LNVA 1JJKA 3UWQA 5FF4A 5D32A 3MI6A 3UPWA 3NM1A 3YPIA 4EIVA 1GJPA 1Q6LA 3EXSA 4JY8A 5D2TA 2Y61A 1A5BA 3SI9A 4WY0F 1GYNA 1S5VA 4JY9A 2ABAA 2Y7GA 2ZZ4A 1XUUA 1OJXA 5LNWA 1KBIA 5I3JA 1FCBA 1FWRA 4XUGA 1C8VA 1DHPA 2V2CA 3MBDA 4R33A 3MHUA 3TMQA 4NJHA 1B9BA 1XC4A 4OBTA 2Q8ZA 5DY2A 4E0CA 2TPSA 3LRLA 4WOQA 3OEXA 1TSIA 1W5NA 2QJHA 4LY8A 1F05A 4MZYA 2J9YA 1JCLA 1K7XA 1Z42A 3NVTA 5D2WA 2A1YA 3MWAA 1BTMA 4R34A 1QMLA 1GG0A 1HO1A 4MFDA 1LM1A 4S2BA 3B4UA 4NXSA 3PSWA 1K8XA 3JS3A 1WQ5A 2QEZA 4XTDA 3F4WA 3TIMA 5A8GA 4GNJA 3R12A 2CZDA 2B0MA 3QEZA 2QJGA 3VCRA 3S5OA 3LDVA 2ZZ5A 2YYTA 4MJMA 3UYCA 3JR2A 1SU5A 4UTWA 4NJJA 3HPXA 3NPXA 3M1ZA 3LERA 4JD4A 4GXMA 1W5OA 3C2OA 4UFKA 1SFJA 4QQ3A 1XL9A 3NPUA 5AHLA 4AEOA 3EWUA 2ZZ2A 1TJRA 1DV7A 3I7SA 1KV5A 3KRUA 3C2FA 4UTJA 3H53A 3LHUA 5F4XA 4BWLA 1KFLA 3IIPA 1H7RA 1XBVA 3KVJA 2ABBA 4Z08A 3BARA 4H6KA 1BEUA 5D37A 3UD6A 1XBXA 8TIMA 2DZXA 4ZQOA 3GKAA 1KFKA 4MIMA 5FI8A 4TIMA 4O13A 3E9AA 1GVSA 4FNPA 1W37A 2C6QA 5D02A 3S1XA 2TYSA 3B04A 2C0AA 1JQXA 3W88A 1DVJA 1N7KA 4IMEA 3GAKA 4QNEA 1W3IA 3GR7A 3G1SA 1GWJA 1GTHA 4W9TA 2E09A 4QSHA 5TIMA 5D05A 2YYUA 5F2MA 4O16A 5G2WA 4ZMGA 5AYZA 3TE9A 2QCDA 3QM3A 5DELA 4BI6A 3PR2A 4YL2A 3PB2A 2V30A 1KM0A 2ZFAA 3EEGA 3P5YA 4PFMA 4QM1A 4ZZ9A 1UUOA 2VC6A 4ZVJA 4ALDA 3UY7A 4R53A 3W2LA 1JUEA 4NXKA 3NQMA 4RLIA 3R89A 3TW6A 1MZHA 3CWOX 4WY0A 5EBUA 1PE1A 4IWWA 1U83A 3HF3A 3F03K 3L0KA 2EGZA 1O94A 1XFBA 3I7QA 3LCLA 2QCCA 1J2WA 1H1ZA 4IQLA 3LCFA 4OWGA 5FEPA 3TJLA 2VELA 4FHAA 5TQLA 4EF8A 5K9CA 1KM6A 1I8JA 1B4KA 4FX7A 2QCMA 3N9RA 4HPJA 1VYPX 4ZQRA 5AHFA 4AB4A 5BMWA 1GT8A 2XFWA 1H62A 3QSRA 3P5ZA 3W1RA 1LRTA 3TK7A 1ZCOA 5AYXA 1R2TA 4Y90A 5KSWA 5AHIA 2DP3A 3QW4B 2V2HA 1PV8A 1TPUA 3GDMA 4J9JA 1ONRA 4MY9A 4CCDA 2C15A 1J4EA 3C6CA 2X1UA 5HWJA 3S0CA 3G0XA 1HTIA 1S5TA 2W0UA 4O0KA 5L9FA 3HGSA 3T7VA 1VJIA 1TPVA 1EEPA 2FTPA 5DCEA 5F1VA 5D30A 1EA0A 1LBLA 3NQ8A 1SSGA 3C2VA 1OFPA 4FNTA 1HUVA 3W72A 1SO4A 3G22A 1K8YA 4N4QA 3LM7A 3P80A 3I68A 5F4SA 1TIMA 1VGAA 3KVMA 4UNKA 2OZ0A 3LBCA 1X6UA 2B7OA 4AHPA 4O4VA 4UTUA 5BMXA 2BTMA 3W7QA 4FNRA 3LI1A 3P8JA 4JXCA 1EP1A 1XDLA 1WV2A 3W70A 3U6WA 3PSVA 1TTIA 1LROA 1F73A 3CU2A 3KXQA 2Z1BA 1R30A 4YCPA 1LLWA 1EX5A 3M5VA 2KZHA 3DFOA 1PS9A 4Y96A 3C56A 3W7GA 3QPZA 4CNPA 1UASA 1UJPA 3CWNA 3MHGA 4O54A 3W1QA 4BI7A 2FB3A 5LKYA 1T96A 3S1WA 1VYSX 3UQNA 2G96A 3A23A 3R8RA 1QR7A 3WK1A 3R13A 4YXGA 2PC4A 2WO5A 3C3NA 1WBJA 3B8DA 6ALDA 5CZJA 4MY1A 3GKFA 1TV7A 4CCEA 5I3GA 3LXBA 1OFOA 5G4EA 1ME8A 3LLDA 3MI2A 4RV8A 3HG2A 1OX4B 4IPIA 4JX6A 1YPFA 4M7TA 1F76A 3NOEA 3L9CA 1D9EA 4NNCA 1LYXA 3CT7A 1GEQA 1KLYA 1L6SA 3P84A 3LX9A 1X8FA 1L9WA 1K02A 4JX5A 4N9CA 3UWYA 1JCJA 2AAMA 4TO8A 4DELA 2NWRA 3PBVA 2ZRVA 1TV5A 5AOUA 2EF9A 3DH7A 4UR8A 1XM3A 2ALDA 4XWUA 3TW7A 1M7PA 1YXCA 2O7QA 2A85A 3O6DA 5DXXA 4NT0A 4HN4A 1KTBA 4N02A 5CPLA 4RR4A 3MO7A 2CWNA 4MLRA 2V5LA 4UXDA 3FYPA 4WX2A 1O60A 3VE9A 3W7PA 1ZY9A 2E5BA 3A21A 2EKCA 4LC6A 1TO3A 1UUMA 2ZDRA 4M6QA 3P81A 2RFGA 4MPQA 3M44A 2QCLA 4AXKA 4Z1DA 3NAVA 2X2GA 4BF9A 1FXQA 4IXXA 5G2HA 1OF8A 2BX7A 2E6AA 1LRQA 4UMBA 1I45A 3LXCA 4PH6A 1WA3A 1AMKA 3W71A 5FF7A 2NXGA 1LRNA 3W6YA 2PRMA 3GDLA 2DZWA 5LZLA 3EXTA 3TAKA 1H63A 2QUVA 4IJBA 2NWSA 2FPVA 1EB3A 3S6DA 4KWWA 3FLUA 4JYEA 1VRDA 5IM51 5ABTA 4RZ5A 4LV9A 1A50A 1SPQA 1XDMA 3FS2A 4S1FA 4LU0A 2C18A 3W87A 4OU1A 1BWKA 1ME9A 3PUEA 3TFXA 4FX8A 3G8RA 3P61A 3C2RA 4I7WA 1W3NA 3MUXA 4JDYA 4UTTC 3W83A 1R46A 3OBKA 2FFCA 3MHFA 2ISWA 1DQWA 3F4NA 1G6CA 1SFLA 3GX9A 3W1UA 1RVGA 1KLZA 1F74A 1MXSA 2WSYA 4O1BA 1OFQA 4K8EA 1TV8A 1KM2A 4WXYA 4HHPA 3CPRA 3N2MA 5IBXA 2Y6ZA 3NPWA 5FF3A 4PCFA 2BZNA 3LHYA 2C1HA 4O10A 5HWMA 1ZJIA 2E6YA 2CZEA 2YX0A 2DZUA 2GUUA 2TMDA 1PIIA 3RU6A 3W7IA 4BI5A 3PS7A 3KRZA 3RNDA 4TMBA 2HMCA 1M5WA 3NGJA 5HJLA 1NAL1 3S5YA 5LGXA 7TIMA 2RDTA 3RFAA 3STCA 4MUZA 2Y7EA 4MYAA 2ISVA 3OVRA 4LRTA 1HFBA 3OIXA 4HKPA 1GQNA 2CLIA 3HGRA 2Y89A 4N9EA 4MYXA 4YMZA 2FDSA 1AW5A 3TXZA 4LUIA 2NUYA 3TJXA 4JTJA 4HNUA 1B4EA 3DHDA 5I3FA 5LSMA 3S5ZA 3KAOA 1OF6A 2JGYA 5LGZA 2GJLA 3O6CA 3G1DA 3NQ2A 4UFLA 1TTPA 4XQ6A 3P7YA 2E6DA 3STFA 1QCWA 2QUUA 3P60A 1KW1A 1Q6QA 2VEIA 2BWGA 2VFEA 4GUGA 3SR7A 3UXAA 2PRLA 1H7WA 4NX5A 3W1PA 2Y88A 1B3OA 4Q32A 3IIVA 4O11A 2ZYFA 1GZGA 3B03A 3VKJA 3Q58A 3AJXA 1EWDA 3SIZA 2CU0A 1K3UA 4FO4A 4QISA 3QSTA 4DXVA 3W7OA 3GK0A 5H2ZA 4UTHA 3HGJA 3GAYA 1OFDA 4NVTA 3C0JA 3QPYA 3W76A 4AH7A 4IMFA 4JIPA 1QNVA 1I2NA 3MI3A 2G95A 1FUYA 1JULA 3HG5A 3GXPA 4A29A 1NSJA 3W7HA 2QAPA 1H51A 3LTYA 2QCDB 1H7XA 2Q3RA 4ORMA 2WNNA 2QCHA 5DBUA 3H54A 3W07A 3TMLA 4FNSA 4E2BA 1K03A 4UCGA 3SJ3A 2ZTJA 3LI0A 3ELFA 2J88A 4FX6M 2VFGA 3TA6A 4WY0B 2OCZA 2EHHA 4LS2A 1X1OA 3TSBA 4FB7A 4MJZA 1TB3A 3ABRA 4OGZA 2GJNA 3O8AA 5FEWA 5FF0A 2ZCGA 1RV8A 4YWIA 3CQ0A 1QWGA 2A5HA 3GYEA 2NX1A 2ZRWA 4N6EA 3L0GA 2BLEA 2H6RA 1QPNA 1G7UA 3QZEA 3DFQA 3B0PA 3M0ZA 3O07A 3DFNA 4ZQMA 1IXQA 2WSRA 1U5JA 2F84A 2FQIA 5HUPA 3W7MA 1KBJA 5EL1A 1AW2A 4H4IA 3ATYA 3LHVA 2Y63A 2Y62A 3G1VA 3Q2DA 5G2IA 4X22A 1WBHA 2VXNA 3NQDA 2JKPA 2ATMA 1PHQA 3FJ6A 3B0VC 2YZRA 4XZ9A 1FDYA 2QAFA 1TRIA 1ADOA 4UC5A 2ZA2A 4OQVA 5D09A 1TCDA 4RXGA 3M5XA 5C54A 1YDVA 3L65A 4I7VA 4GUFA 2QDHA 5KZMA 2QF7A 5U7SA 2B7QA 4UNLA 1EUAA 2A6LA 2CLFA 3DZ1A 1SO3A 2Z0IA 2XN0A 2CLLA 3LOTA 4JTSA 4O19A 5G5IA 1TPC1 1SZNA 2DZSA 3LRMA 2DZTA 3NQGA 5C2XA 1O95A 5AC7A 3HGOA 3OVQA 4LS0A 4DF2A 4N9BA 3B0UX 3HPSA 1UB3A 2GQAA 4EWND 1P1XA 3EKZA 4LTSA 4D2JA 1A5CA 2X1RA 1OYBA 3MYOA 2RH9A 4AF0B 3W22A 1OFRA 4JGDA 4HNTA 3HMJG 5HULA 3S42A 1IXNA 5D2YA 2JBMA 2NV1A 1AG1O 3PBUA 1R2SA 2WJZA 5CPNA 3PM6A 3QJAA 3PULA 3LHTA 3NDOA 3SY5A 1AL8A 1SW0A 3QQ0A 4MOZA 2H90A 1YADA 2AGKA 1EWEA 2CLOA 4CLMA 3LCXA 4R7JA 3W73A 4AMAA 4UIOA 3PUOA 2E77A 3JRKA 1ZHAA 1F2JA 3TCEA 3L5AA 3W7RA 3CLMA 3UXDA 5G1YA 2R8WA 5AB3A 2BXVA 1H50A 3OVPA 3W7EA 1G4TA 1GVRA 3VE7A 2X16A 3UWUA 4AWTA 3GLCA 1MEIA 4LC8A 4K36A 5C55A 5EKYA 5LHEA 1O4UA 3WJWA 1OX6A 4GUIA 2DZPA 4DO4A 3N19B 3EX1A 3SGUA 3LB0A 1JUBA 2Z2UA 4YLWA 1CW2A 5DCDA 3EWXA 1ME7A 4RX0A 4POCA 2X1SA 3SFKA 3TDFA 1YTEA 1RPXA 3W7DA 1FWSA 2Y7FA 5D2XA 3GR8A 5KMYA 5F2LA 3SSJA 2GQ8A 3EKLA 3O1NA 3E49A 3W9ZA 4ADSA 3IRDA 1QO2A 3PWAA 3FEMA 4HNNA 3NR0A 3C61A 1ZALA 4FIRA 1DBTA 3S8HA 1K8ZA 1O5KA 1OVDA 2ZQ0A 1BWLA 4HIBA 4FNUA 3UNDA 1SSDA 2A7PA 3W7NA 3LCHA 3KVKA 4WJEA 3NG3A 4K8HA 1QPRA 2ZA1A 2VEPA 5FEXA 5DBTA 3UY8A 1YTKA 1L6YA 4AWUA 1B57A 2YPIA 3QW3A 5D33A 4GBUA 2VFFA 2QUTA 4EF9A 4LVDA 4ZQCA 3KFTA 4ML9A 1GVOA 4UTKA 3V1PA 5LNUA 2V0TA 1GG1A 4TR9A 3QMRA 4M19A 4Z1CA 4LUJA 1SW3A 1VCFA 3BPWA 5F2IA 3LCWA 1L2UA 2ZBTA 4RJEA 3BLEA 3FIGA 1Q45A 4E2DA 1TYGA 3I65A 1RD5A 1X1ZA 2QJIA 1E51A 3A22A 3LCGA 5GVJA 3PAJA 5DN1A 2J27A 3WJYA 3EWWA 4CCCA 4ZL1A 4O17A 1ICPA 3WK2A 3LGEA 1N8FA 3TKFA 3EB2A 4U4MA 3FKKA 4M5PA 5K9XA 3TNOA 3HPZA 1AW1A 2CFFA 3M5YA 2VENA 4DPQA 4A2SA 3LTPA 2V81A 1DQXA 2HTMA 3W84A 3EXRA 1GVFA 1G4SA 4NQ1A 1GOXA 1TRDA 3KHJA 3TSDA 3EX3A 4Z1BA 3I6RA 3L67A 1HG3A 3G1AA 2NX3A 2FPYA 5AHNA 1RR2A 2A2IA 1HO4A 3GXNA 3BK0A 3NQCA 2J9ZA 3QFEA 4N4PA 1H5YA 2DU2A 1QDSA 5EA9A 2C16A 5DXYA 1TQXA 1VR6A 4LVGA 1XBZA 3TFCA 1I2RA 3T44A 1WX0A 3IV3A 5C5YA 4NJIA 3SECA 2C19A 2CLMA 3NQ7A 4JTIA 5E0KA 3IGSA 3QMSA 2O7SA 5E93A 4UFHA 4AVFA 2QR6A 1OFBA 6TIMA 4JTFA 3B06A 5CPMA 3UWWA 3W23A 2OX1A 4MFEA 3HQ1A 2H8XA 1LOLA 3Q94A 2J24A 2ZA3A 4AHQA 1WOAA 2GVLA 4O14A 1N55A 3M6YA 1I2QA 1GYLA 2PE4A 1JCMP 3KOFA 3FJLA 1P4CA 1PHWA 3W85A 3ANYA 2DORA 1TPFA 4DF1A 3BG3A 4GE8A 3FKRA 1XBYA 1W31A 2QCFA 2TSYA 2ZZ3A 3E0IA 3TSMA 1NVMA 1OYAA 1Q6RA 1XCFA 4N2YA 4XTIA 4XBKA 1LZOA 3W75A 3QQ1A 4N9DA 1QO5A 1KM3A 3L21A 2J6XA 1JQVA 3NL2A 1Y0EA 2DJLA 2OT1A 2FB2A 2RHGA 5K4XA 1FCUA 2E1DA 1GVQA 3L0NA 1EP3A 2E6FA 5EYWA 1QFEA 1XI3A 4L4MA 1OYCA 4KKXA 1KFJA 2B7PA 3CB8A 3GNDA 5AC6A 1SR9A 4KFPA 5CKSA 3T78A 3IVUA 3UZ5A 1ML1A 3PY2A 1CX9A 5I3IA 4UMAA 4B5NA 4GUJA 4XKYA 2NLIA 1A53A 2QCEA 3N34A 3G24A 3SGZA 3W1AA 4EVZA 1KFBA 1LORA 3D0CA 3L66A 3PBYA 1PL9A 4UFIA 3GDRA 1M6JA 3DAQA 4AWSA 5AN7A 2QCGA 3NZ1A 3G3MA 2CZ5A 2YW3A 3UWVA 2OT0A 1Q3NA 4EOUA 3AO0A 4HPXA 3SW6A 2X30A 5SWUA 3LCIA 4HT3A 4DO5A 3THAA 3HG3A 5TBOA 3QF0A 3ABQA 3NZRA 2WV8A 2V2DA 5C6MA 1YYAA 3C2EA 3BGJA 5DLCA 3GXTA 5KZDA 1AK5A 3G3DA 4JTTA 1P0NA 5K3VA 1NF7A 1EPXA 3QYQA 2NXIA 4NJGA 1H60A 2QKFA 4K7VA 3BG9A 5G1TA 1DL3A 1YLVA 3TQVA 3MW7A 1TQJA 2AQWA 4FEZA 5BOOA 3G1YA 1XXXA 5K2ZA 3L5MA 5U4NA 3O15A 3PG9A 2TRSA 2YW4A 1YDOA 4IXHA 2VFDA 1JCXA 2H3DA 1GTEA 1NEYA 4WXZA 3RLVA 4O52A 1C9DA 3LV6A 2ZTKA 3F1QA 5J5RA 5LNSA 1SZEA 3IIOA 4UUIA 2VEKA 4FNQA 4IX0A 1UCWA 2DJXA 4OHQA 2GOUA 1RQBA 2HS8A 3FYOA 4O12A 1EUNA 4NU7A 1IIGA 5HQEA 2R14A 3NO5A 4K39A 3C4UA 4S2CA 3EWZA 1QPOA 1W5QA 3FFSA 4O50A 3NL6A 3CIXA 1VLIA 3CEPA 4PA8A 2ZRXA 3DI0A 1I2PA 5KITA 3CC1A 3ZWSA 3NYZA 2VEMA 1H61A 3KX6A 2HS6A 3DU0A 3HBLA 4QITA 4X2RA 3VNDA 1G69A 3MMTA 1LBFA 3W1NA 2R91A 4NZJA 2JK2A 1G7VA 3RF9A 4OT7A 3MP4A 4AHOA 1LBMA 1WAUA 5FEZA 3WJZA 2HSAA 1KV8A 2XN2A 4X9SA 3P62A 4UR7A 1KFCA 5J5DA 4MZ8A 2Y70A 3W86A 2FIQA 4PL1A 1LOQA 2A21A 4JYFA 4Y6GA 3TROA 1J5TA 1MEHA 4UTTA 1KTNA 3N2XA 1RZMA 2XN1A 1TPDA 1OK4A 5AHMA 4GFSA 3T4CA 2C13A 3WFAA 1K7FA 5D38A 3TQ0A 2OJPA 4FIQA 4HSOA 4JEQA 1FX6A 3GDKA 4KFNA 5CGQA 1G4PA 3UZJA 5BW6A 5FF2A 2LLEA 4LVBA 4PODA 3BV4A 5DCBA 3ZFHA 3TAOA 3KRSA 1KFEA 1M7OA 2EPHA 1NF0A 2CLHA 4CQ9A 2VFHA 3W7LA 1YXYA 1UBSA 2YXGA 4UTMA 3WJXA 3NQEA 3W2UA 4DF0A 3DGRA 3G1FA 1ZAIA 3BVJA 3W1LA 4UMCA 3NNTA 3HG4A 2H3BA 3LXAA 2RDUA 5F4WA 3OG3A 3PBWA 5K9DA 4IPJA 1QOQA 3WJSA 1R47A 3G1XA 1TPWA 5HWNA 2CZFA 4AAJA 1SO5A 4Z1AA 3M47A 1JRCA 4A21A 1H7PA 2GVJA 2VFIA 2CLEA 4GC4A 1ZENA 1XUZA 3ZWTA 3DFPA 4OV4A 2YSWA 3G8EA 3TC7A 1DJNA 3M5ZA 3S1VA 3EWYA 3MYPA 5MHBA 3PVFA 5F2GA 2VKZG 4QJ1A 1FY6A 4C1KA 3A24A 1SO6A 4RK8A 2YFNA 3HO8A 3P8IA 1YDNA 4Q4KA 1LTDA 1F7BA 3BGGA 3PF3A 3S5NA 1PVNA 1I4NA 3LRKA 3VI2A 4O1DA 2J9XA 1CI1A 4Z0JA 3BLFA 3A9IA 2BSLA 2YGYA 1O5XA 4C1LA 2RDWA 4P61A 2PURA 4OV9A 4LVFA 5AYYA 4BR1A 3W1TA 2G97A 4JTGA 3PUDA 4Y9AA 4LOCA 1W56A 2ZRZA 3NPVA 2A0NA 1MSSA 3M16A 1IGSA 3N3MA 1VPXA 4GJ1A 4MY8A 3W1XA 4DPPA 1Z44A 3LBMA 4K38A 1F6KA 4XBSA 1FQ0A 2ATSA 2E68A 4JTKA 1VCGA 4Y8FA 3O05A 4O4WA 1P5BA 3IGXA 2V8ZA 4JICA 3PB0A 1W1ZA 2Y85A 5I3HA 3H55A 5HR6A 4MKNA 3DKLA 3ZS4A 4IMDA 2ZRYA 2V5BA 3DENA 3IIXA 3GNNA 3CHVA 4NX0A 1VZWA 1TTJA 3LLFA 3WK0A 1X7FA 4ICNA 3C8FA 4E38A 3N73A 3DFTA 2P1FA 4CQ8A 2NUXA 3ZR4A 4ZQPA 3HJZA 3W2NA 1D3HA 3O63A 5LHFA 3TU9A 3M7WA 1SUXA 1FCQA 4DBDA 5E1QA 3QH2A 3SZ8A 4JIQA 4O15A 1JRBA 1OFAA 2YCEA 4JDBA 3I7RA 5K4ZA 4WUIA 1DJQA 4BFAA 3ABOA 4LVAA 1FCVA 1DOSA 4MZ1A 4NZFA 4CQAA 5EY5A 1DORA 2NUWA 5KINA 5F1UA 4RXFA 3IIZA 4O1AA 3WK3A 3T40A 4M6PA 4DO6A 1ZAJA 1WDWA 2V82A 3BW2A 1ZAHA 3RMJA 2OMAA 2G5WA 1VHNA 2ZRUA 1A5SA 3NQ6A 4I7UA 4JTHA 4O18A 4FXRA 4UFMA 1KM4A 1QAPA 2YDAA 3GZ3A 3M41A 2W79A 5H91A 3Q37A 5T26A 1TPB1 2I9EA 1ZNNA 3IVTA 2B7NA 5EMUA 3NM3A 3LHWA 3NQAA
chains in the Genus database with same CATH superfamily
1V8EA 2PDFA 1V02E 3P82A 4BK9A 1RQHA 1YXDA 2B4GA 3MSRA 4LWWA 4ORIA 2VOMA 1R7AA 2PMQA 1WXJA 3H4XA 4F9DA 5CC7A 1G67A 3QRHA 5IBXC 1EIXA 4JFWA 4NP7A 2W3ZA 5JUVA 2BGSA 1H4PA 4UFJA 2A6NA 1QBBA 4ADTA 1TWIA 2D3NA 2FLIA 4U10A 3SM0A 3LHZA 2P50A 3SCNA 1LCOA 4DYKA 2AQVA 1W5PA 3SRDA 4IUOA 1Q66A 1WXZA 3O16A 3WDJA 1YEYA 1JUKA 2JKAA 1JR1A 1LDCA 4LS1A 1OHLA 1VFTA 3WLRA 1PDZA 3A64A 2G50A 3B3DA 2FJUB 4BKNA 3KCJA 4OJYA 1CGTA 2WM1A 4CN1A 1LLZA 1YKWA 1DTNA 2X1TA 2A4AA 4QG9A 4L4LA 4NZCA 1M41A 1ZFJA 1E6RA 3QC3A 5I23A 2WNZA 3AMCA 3VDCA 3L4YA 4GGHA 2GSEA 1F8IA 3N9KA 4RW5A 3ZIZA 4CNOA 5M03A 2D73A 4ZA0A 1I1WA 4WKAA 5BXSA 4PEKA 4L61A 3AU6A 1R3SA 4HN8A 3LPGA 1Q85A 5CZTA 1TPEA 3K4AA 4PL2A 1FA2A 1ZJBA 1XRSA 2WNWA 4W85A 5H6HA 3CGTA 4TMCA 4RZ4A 1PX8A 2IPJA 1HJXA 3MP3A 4IT1A 2Q3OA 5AC8A 1EOMA 2IQTA 2FZMA 1C3FA 2PD5A 1P48A 4CCZA 2UY5A 3NJ3A 4K7YA 2QMKA 4Q8UA 3OHIA 2OXNA 5DT7A 5HK4A 1VPYA 3EWBX 5J8LA 3RPTA 1SW7A 3OLEA 3THCA 4D1IA 1GPWA 1LWIA 1V6WA 4XZBA 2VZVA 2D20A 2ZZ7A 2NXHA 1OC6A 3N9SA 1FWIC 4I9AA 4U33A 3CL7A 1KFWA 3R0DA 3G0UA 1OX5A 5PTDA 3BLKA 4D6HA 4JTLA 4C6KA 4KWUA 1CB2A 1KR0A 3MTWA 3NXFA 2D1ZA 3A5VA 1HKKA 2XIJA 2XG9A 2YFOA 4ADUA 1RK6A 1YBQA 2ZUNA 2XFFA 3USBA 1QPQA 2NQ5A 2NQHA 3EDKA 4GVIA 5D03A 5DMMA 4Q8QA 1MUCA 4EPDC 5GNYA 4MMWA 2BVWA 3IVSA 3IJDA 2VUYA 4PC8A 4H7VA 3KVLA 2ZKMX 4UTWC 2JKEA 1E4IA 3ANVA 3DERA 4LRSA 1OX4A 3W2MA 1QK0A 4Z2GA 2FMOA 1GZJA 2VZSA 1BTCA 1WZKA 2R94A 1XLHA 3BZGA 4LFYA 1JNEA 2XVLA 2Q71A 4JR5A 3W7JA 5LIUX 2GVGA 4BWLC 3CV6A 4A3UA 2P53A 2CW6A 1Z69A 3L2IA 1W3TA 4IOTA 1FHUA 2A7RA 4PMUA 3R2GA 4KFOA 2FHFA 1V7YA 3LTSA 3CTLA 2ZUUA 4DYJA 1THFD 1QOPA 3GQYA 2E67A 2G3NA 5K7JA 3HB9A 4ZE4A 1KGUA 3DN5A 4B2DD 4K2SA 3PG8A 1XLAA 1MXDA 1XIEA 4TX8A 5HMDA 1W1IE 1E0XA 3AS0A 1IT8A 2VURA 4NJKA 4A22A 4EP8C 4K6AA 4DWSD 3ISIX 3BW4A 3W2KA 2WJDA 1KKOA 2I14A 4UB9A 2A3CA 5LNVA 3W4RA 1JJKA 3II1A 5BXTA 1CZ1A 5FF4A 5D32A 3MI6A 2OGJA 3NM1A 2WMIA 2RUSA 3RX2A 1CIUA 3R11A 1V51A 2CBIA 1W9XA 3TWAA 4JY8A 3FK4A 5D2TA 4DUXA 2UZ9A 1A5BA 3CQKA 3DIPA 3TR9A 1KB3A 4Y9NA 2X0YA 1GYMA 2ZZ4A 4C6EA 3ALFA 2ACQA 1PZ1A 1FCBA 3AWNA 3TLQA 3H2CA 2V2CA 3HZ3A 3DECA 1UUQA 4IH3A 2Q8ZA 1ECQA 1XG3A 1OGSA 4WOQA 3KDNA 3QQWA 4XIMA 4ERGA 3KTSA 1V3MA 1XGDA 4MZYA 2J9YA 1LWHA 2HRWA 4PULA 4JHZA 1P6WA 3BSGA 3MWAA 4XX6A 1BTMA 1QMLA 1LM1A 3NGFA 3JS3A 1WQ5A 4NZ1A 4XTDA 2QT3A 3UR8A 2CZDA 2B0MA 4BF7A 1JPDX 1KRMA 7REQB 4MJMA 1C7SA 3QR1A 1SU5A 1SM9A 3W29A 1E1CA 2VI0A 2XWEA 3M1ZA 3PJWA 4JD4A 1GQKA 4GXMA 4QQ3A 1XL9A 1Z8AA 3EWUA 4Z2IA 2QPSA 3WEOA 1A0CA 2Q6ZA 3I7SA 4RDWA 3E2SA 3N2BA 3KRUA 3H53A 1UKOA 5BRQA 4KRZA 2VR5A 4CVWA 4AVNA 5DO8A 1XBVA 3KVJA 1GCYA 8TIMA 4MNMA 3GKAA 1KFKA 5FI8A 3E5BA 3WUGA 3VAVA 4HJFA 1W37A 3S1XA 5I77A 4J40A 4PFHA 1W3IA 3GR7A 2P0IA 1J0YA 1RALA 1EGVA 1F8MA 3G1SA 4GO9A 1GWJA 4O0QA 4QSHA 3KLLA 5F2MA 1IEXA 3DHPA 2EEXA 3TE9A 4GYPA 4E4UA 1DWJM 4MAZA 4X0VA 2HQAA 2VQUA 4JQ2A 3PB2A 1PB0A 1W1VA 2V30A 4AD1A 3HV9A 4QM1A 1MFVA 4R9XA 4ALDA 4R53A 3GVQA 3OYZA 5CPQA 3NQMA 3RRAA 4PB5A 2PZ0A 1E0VA 4DJDC 4WY0A 1VJZA 5EBUA 2QJMA 2CZVA 1DWGM 3HF3A 3BH4A 5JBEA 1E0WA 4GA8A 8RUCA 1QU4A 2V5JA 1W6TA 2WMFA 1HQTA 2CKSA 1BSLA 3TJLA 4D6JA 2VELA 3QLDA 5TQLA 4J3UA 3WSUA 1KM6A 1B4KA 1EBHA 1TCMA 4AB4A 1E6SM 5HQMA 3MJMA 1VF8A 4A8RA 3PJTA 1QHOA 5AYXA 4QDPA 4Y90A 3Q45A 5KSWA 3W24A 4NILA 4AISA 3GU2A 3GDMA 2C15A 2X1UA 4IIBA 3G0XA 4O0KA 5L9FA 3HGSA 1EEPA 3EA2A 5D30A 3VKDA 5CXPA 1NTHA 3UWEA 1R6WA 4C6IA 3W72A 3VOHA 4PZVA 1B90A 5F4SA 4ZB5A 4WLCA 2OZ0A 3LBCA 1EXBA 4UTUA 4B5SA 3LI1A 3H70A 1F61A 2XGBA 3GH5A 4JXCA 3GVRA 3MZNA 3AALA 3WFLA 4OIFA 4JAWA 1F73A 1QNSA 3K13A 1VIZA 1MW1A 3U7VA 2C0HA 3FSTA 3PZIA 4EAYA 3C56A 1KCKA 1R3YA 3QPZA 2QPUA 3TN3A 4ILSA 1YBQB 3CWNA 3MHGA 4O54A 3W1QA 1HGWA 3ONCA 1GHSA 4YVVA 3RM8A 1XDJA 4YXGA 3SQMA 2PC4A 2WO5A 4PUUA 1POJA 4GLEA 1JFHA 4GFIA 4IHCA 2DUAA 3MV11 1TA3A 5E09A 1GOIA 1OX4B 1BD0A 1TIWA 5A3HA 4IPIA 4JX6A 4AZHA 3G2GA 1R9ZA 4BA0A 2W9MA 4NNCA 4UQEA 1LYXA 3PZUA 4D72A 1XFCA 1X8FA 4ZFMA 4JX5A 1JCJA 4TO8A 4DELA 2F6KA 4MB1A 2ZRVA 5AOUA 2EF9A 3B0YA 1MRAA 3TW7A 4A3RA 1EJUC 4I6KA 2Q09A 2OB3A 1KTBA 4P7NA 4IFKB 3ZQ9A 3FYPA 3T07A 1JNDA 1O60A 3AS1A 1TX0A 3IUDA 3A21A 3WQDA 2EKCA 1UUMA 4WJXA 2OZ3A 3M44A 4GNVA 2NW0A 5CH9A 3H22A 2PGEA 4IXXA 3IJ7A 3UZYA 4PRRA 2V5KA 3DDMA 1FWDC 3WNPA 5CGMA 1E6PA 1L2QA 1AMKA 2NXGA 1LRNA 3W6YA 3NTYA 2DZWA 5LZLA 2QIWA 4D6DA 3N6JA 3V5CA 2QUVA 2XM2A 2NWSA 2E8YA 1EB3A 1Q7MA 1EJRC 1KWKA 5IM51 1IEVA 4B5VA 1UMLA 4FMVA 4LV9A 2WMIB 1B54A 3WD1A 3FS2A 2VMFA 1UD4A 3IK4A 1BWKA 1W3HA 4R5EA 3PUEA 4HNCA 3G8RA 3P61A 3C2RA 4I7WA 1W3NA 4S3AA 1H1NA 4J7RA 4F0KA 4UTTC 1R46A 2FFCA 1Z9AA 2DSKA 3F4NA 1GQIA 4CU8A 2XDFA 4N42A 1KLZA 4WXYA 4HHPA 3V5FA 1PZ2A 2FVKA 4PCFA 2PTZA 2PWVA 1VFHA 1ZJIA 5IFTA 4J3SA 1K9EA 4TQTA 4F0HA 3H2MA 5HJLA 1NJJA 1FWHC 3VGEA 1UWAA 5LGXA 1S2CA 3RFAA 3MDUA 4MUZA 1TWDA 3COTA 2FMNA 4MYAA 3ITVA 1W1B1 3RM9A 4GINA 2Y89A 4MB4A 4N9EA 4MYXA 1Y7VA 1S3TC 3LNMA 1GOQA 4JTJA 4HNUA 5LSMA 1OF6A 1XH2A 4E5TA 2GJLA 4OOZA 3O6CA 1VFSA 1E1CB 3CLWA 3K1DA 3RLHA 3P7YA 1QCWA 2VVNA 1KW1A 2VEIA 2Y5EA 2BWGA 2VFEA 4GUGA 5IOBA 3GVVA 2PDLA 1J0JA 1RLCL 1H7WA 4HMEA 1VP5A 1B3OA 2DIKA 3OHMB 2ZYFA 4GH1A 3B03A 3ITGA 3Q58A 1EWDA 3SIZA 1K3UA 4FO4A 3QSTA 4PMVA 5CSYA 3H21A 4UTHA 2GGJA 3WO8A 1OFDA 2Z27A 2VJXA 4NVTA 5HXMA 4R9OA 3VCNA 4LH8A 2VC5A 4UBPC 1FUYA 4L6DA 3HG5A 3GXPA 4A29A 1TV3A 1H51A 4RNJA 1JZ5A 2V69A 2QCHA 2WHJA 4N0RA 3TMLA 2ISDA 3VPLA 2QW5A 4UCGA 1TE1A 1V3HA 3AFBA 4JEJA 1P0EA 3SJ3A 5I0DA 3ELFA 4FX6M 3TA6A 4WY0B 4IP5A 4R27A 2EHHA 1X1OA 3DYOA 4U5KA 4AG0A 3ZJ7A 5M3WA 4D6CA 4L4PA 5FEWA 2ZCGA 3K8KA 2ZRWA 2X7VA 4N6EA 1QPNA 5DRCA 3DFQA 4CD8A 4ZOCA 1UBPC 4ZQMA 1IXQA 2AMGA 1U5JA 2F84A 2WSRA 2ZX7A 5HUPA 4YYCA 1AW2A 3LHVA 2Y62A 4X22A 2BS9A 2VXNA 4LGXA 1PHQA 3B0VC 3POCA 4FPSA 1TRIA 1M1BA 1ADOA 1XIBA 1IHIA 5D09A 3S6OA 2EPLX 1H41A 3M5XA 3CIVA 3UERA 3WMCA 3R43A 4HTYA 1YDVA 1DIKA 1OGGA 4GUFA 7XIMA 5KZMA 3AYRA 2QF7A 5U7SA 3E1F1 4W89A 2CLFA 3CJPA 1SO3A 3RAOA 3VX0A 4JTSA 5G5IA 3P6LA 2DZSA 1EGZA 1Q6FA 3LRMA 3WZ0E 3VXGA 5AC7A 3OVQA 4LS0A 2J75A 4N9BA 4NI3A 3CWHA 4FLOA 4DBSA 3B0XA 2GQAA 3SBFA 4DWSB 3RGTA 2VP8A 4F2BA 3WBXA 1L6GA 1GVIA 4AF0B 4JGDA 3F2BA 5HULA 3S42A 2PU0A 4RPPA 1ZJAA 3TTEA 1DP0A 4RE2A 2WJZA 2DVXA 3QJAA 3QR0A 3NFUA 4NAFA 3LHTA 3SY5A 1E9IA 2PTYA 3URNA 5CAHA 2AAAA 4MOZA 2DEPA 3M0JA 2H90A 4CLMA 1B30A 4MB3A 4UIOA 3RO6A 2E77A 4E8CA 5AY7A 3KEHA 1ITCA 3W7RA 4PMQA 1JDDA 3UXDA 1DWAM 5G1YA 3VOCA 2GJXA 3MS8A 1TA3B 2J7DA 4GX8A 2J13A 4L65A 4NRSA 1IWAA 2O9RA 1F4HA 1JZ2A 4JFTA 2ZDSA 1IT0A 3CL6A 2ISFA 1POKA 4XD6A 4S3EA 1MEIA 2ODOA 2OOGA 3KBMA 3UYIA 1XH1A 4DHGA 5LHEA 1O4UA 3RIKA 3ZJKA 4DO4A 2XIQA 2DZPA 1I0DA 1XG4A 1ZGDA 1KXQA 3EX1A 1FWFC 1JUBA 2Z2UA 2CEQA 3HN3A 3AXXA 3VNLA 4QAWA 3VA8A 3EWXA 4RX0A 4JTQA 4G56A 3D46A 4RE3A 1XPYA 4QE4A 5FL0A 4KERA 1P6BA 5F2LA 3SSJA 3NR0A 4IQJA 2R1KA 4KEZA 2X09A 1OVDA 1BWLA 3UNDA 1CXFA 2A7PA 3DEQA 1MFUA 2BHYA 1CXEA 1HW6A 1ISVA 2ZA1A 2NVAA 4PUDA 1I60A 4V27A 5DBTA 3ZLGA 3O3RA 1V3LA 4CKQA 2ZICA 4W93A 3WF2A 3TYBA 2YPIA 1JF5A 4GBUA 4EF9A 4IP7A 1AJ2A 1XYZA 5C9RA 4ZQCA 3KFTA 2O9TA 5A2BA 1IE7C 2HJPA 3QC0A 3KBNA 1EJXC 1Y5WA 3U4FA 2V0TA 4TR9A 3N15A 3THUA 3M07A 4V15A 3BPWA 1CXIA 3LCWA 3EMCA 3WBEA 3BLEA 2BFGA 2FZ8A 1Q45A 1TYGA 1RD5A 3BSHA 4CD7A 4NAEA 3MB9A 3A22A 3PAJA 5DN1A 2E25A 3OU8A 1OD8A 3BE7A 2ZWYA 4O17A 3S46A 3TKFA 4AU0A 4U4MA 3FKKA 4XZIA 1AW1A 4DBWA 4DXXA 2XZ9A 3CHDA 5DF0A 3W84A 3L4VA 1FTXA 3OB8A 1UR1A 3TSDA 1HG3A 2NX3A 3AZRA 1NP0A 3IJLA 4B5UA 3RCMA 5A6BD 4HYVA 2VZUA 4S39A 3ZYZA 2VX6A 3NQCA 2J9ZA 3QFEA 5D8WA 2DU2A 5EA9A 5DXYA 1VR6A 3KBWA 1ZB5A 2G41A 4IQEA 3UJEA 1J11A 3QTPA 1WO2A 1GQLA 4UR9A 1X39A 3RRXA 3F2CA 3VYLA 3WFZA 1B9ZA 3KL3A 3H7VA 3SECA 4P7OA 4X63A 3NQ7A 4J1OA 3QN3A 4P8UA 4FLRA 3ITYA 2O7SA 2QR6A 1OFBA 1US3A 5JBFA 1GJUA 2VDGA 4NYUA 4DAFA 2H8XA 2J24A 1NOUA 2ZA3A 2BVTA 4O14A 2EJ1A 3LPFA 1UD8A 1I2QA 4TVDA 1E4NA 1JCMP 2OEKA 1XINA 1P4CA 3W85A 1LL6A 5C9XA 1PSCA 2DORA 1AMYA 1XF0A 2UY4A 1YX1A 4V2XA 2ZZ3A 1UZDA 3TSMA 1NVMA 4N2YA 2FGBA 3G77A 4B91A 4N9DA 2J7EA 5DQPA 3FCPA 5ABGA 1IZJA 1K4HA 3L21A 3B8UA 1OEPA 1ONXA 2OODA 5HQLA 3NL2A 4QX4A 2OT1A 1BYAA 9XIMA 4U31A 2V68A 2CETA 2E6FA 3RN6A 1K9DA 4L4MA 1OYCA 3VC6A 1PKMA 3GHRA 4KWSA 4XO6A 3W02A 4B4FA 2WSPA 5GPRA 3B8WA 1VEOA 4GUJA 1JL8A 4J2PA 2NLIA 1JD9A 3N34A 3R4IA 1KFBA 1LORA 3D0CA 3L66A 3AIRA 1VEPA 3GDRA 4ACZA 1TR1A 1M6JA 1W91A 1XIDA 1ZL1A 3G3MA 4ZOAA 2OT0A 1Q3NA 3H4WA 2RAGA 3UESA 4F3HA 1EXPA 2BVYA 2HZGA 1FHLA 3JVAA 4H8UA 4GQGA 2VR4A 1IEWA 3CMGA 1J18A 1EC7A 3NO3A 3ABQA 2WV8A 3C2EA 2PP1A 2R1MA 3G3DA 1OADA 2ZE0A 3EWDA 2X41A 3GZAA 4HQVA 2Z1WA 2QKFA 1N2VA 2ESCA 4DZ5A 1LUCA 5C9ZA 2VM8A 1TQJA 1Q2RA 5BOOA 1W9UA 3IPWA 3GVWA 5DANA 2OO6A 3PG9A 2TRSA 5JH1A 4GI9A 3O9NA 4IXHA 1JCXA 1H3GA 1XHGA 2H3DA 3R10A 1QI0A 1NEYA 4WXZA 1NWRA 3TTYA 3LV6A 5I78A 2ZTKA 5J5RA 4C7DA 1UCWA 1XYFA 2OKTA 5BOEA 1OSEA 1RQBA 5DMLA 2HS8A 3FYOA 3VX1A 3EDDA 3IK2A 3KW3A 1BXBA 2QMJA 1UH2A 4H41A 3NURA 1REQA 4NAFB 1W5QA 1Z7AA 2QYGA 4O50A 2IUZA 3NL6A 1VLIA 4KGLA 1NDYA 5IHRA 1DHKA 3ITLA 2VEMA 3FDKA 4J5NA 4QJ5B 4HZ8A 1OT2A 3VNDA 3LD5A 2GJXB 2DSZA 4HU4A 4DRSA 1JIBA 2INEA 3SCOA 1OC5A 3RF9A 4AHOA 1LBMA 2WC3A 1ENUA 5TD4A 2VDIA 4PB3A 3HPAA 3QKEA 1SFSA 2FIQA 5HMEA 1LOQA 3ALGA 5AC4A 3OW1A 3RG6A 2X7WA 1BYDA 5AHMA 4GFSA 1A0EA 1LG1A 2C13A 4PUMA 4V28A 5D38A 2VC9A 1T6MA 3TQ0A 4ZXOA 5FJIA 4Q4SA 4JEQA 1DJIA 4KFNA 5CGQA 1HXJA 3BV4A 3N11A 4WRHA 3DC0A 1KFEA 5LXXA 1NF0A 2HBXA 4QP0A 3W7LA 4JN8A 4PSRA 2YXGA 4H8VA 3TJ4A 8XIMA 3W2UA 3DGRA 3G1FA 3RX4A 1EOKA 5FKYA 3CB3A 4UMCA 3W00A 4R7WA 1LT7A 2H3BA 3BAYA 4TXEA 1GZ1A 1XRVA 4JKMA 3WJSA 3VD4A 4AMCA 1R47A 3G1XA 4C7GA 2XIOA 1R3TA 2HK1A 1U5VA 3A3HA 2BY3A 4Q7BA 2OWWA 2C8NA 2GZXA 2GVJA 2CLEA 1RY8A 3MQTA 2XSXA 1DE5A 3WKZA 3DFPA 4OV4A 2YSWA 4IGMA 2DSWA 4NAEB 2VHLA 2V3FA 3MYPA 3PVFA 2AL1A 2VKZG 3TTOA 2AQOA 4JKLA 3W53A 4RK8A 3PBMA 1LTDA 1H0IA 3BGGA 3S5NA 1I4NA 3TTQA 1EQPA 2P88A 1ZBWA 4F2UA 2IXUA 4NZ3A 1O5XA 1TFVA 2PURA 4JTGA 3M64A 3ARPA 2R6OA 2CITA 2ZRZA 2V3GA 4EACA 3WY1A 2G4JA 3KBVA 1RD6A 2J79A 4GABA 4K38A 2YXOA 4GH3A 4I5XA 4S3JA 2F6XA 1VCGA 4OOUA 5A8QA 2NQZA 2V8ZA 5JQ9A 4LB4A 3BZJA 4WSHA 5I3HA 3IJQA 8A3HA 1BHGA 1DWIM 4IGNA 3EMQA 1MUMA 1VZWA 4DLMA 4E38A 3N73A 1RP8A 2P1FA 4CQ8A 2IKIA 1D3HA 3TU9A 3NIYA 3M7WA 3SZ8A 3PHAA 4O15A 1JRBA 1OFAA 4EPBC 1GHRA 1RBLA 5K4ZA 3I7RA 4WUIA 1R3VA 1DJQA 2CXEA 4BFAA 2PWDA 1DOSA 4MZ1A 2QPXA 5EY5A 5F1UA 4RXFA 3IIZA 3QYSA 3DG7A 2REQA 1ZAJA 2V82A 2X05A 3FW6A 3RMJA 4CEUC 2IPWA 2G5WA 4US5D 1GEHA 1A5SA 3NQ6A 1B3YA 1M53A 2Z4GA 4FXRA 3TEVA 1QAPA 1I75A 4QXIA 1JGIA 5T26A 3VIMA 2WQDA 3H2EA 3GFYA 3EOUA 4I9TA 3TZNA 5FD0A 4I5RA 2QCNA 4UQDA 3N17A 5D2VA 3PWIA 1S5WA 3WNKA 2NZLA 3FVMA 1S38A 5LNRA 3U0HA 1G4EA 3THQA 4ZB2A 1BKSA 1DJGA 1XLMA 3RILA 4P2VA 3V75A 3S1UA 3MUZ1 2R24A 4QEHA 4N7QA 1HJQA 4DIAA 5CAKA 2HE8A 4FXJA 1BQCA 4ACZB 1L6WA 3W7KA 3ZVIA 3URAA 4EPEC 3VFLA 2OQHA 2PODA 3R0KA 3WELA 1BVNP 1OCQA 3VNYA 1SJCA 1LOSA 3P67A 4WJ8A 1W8GA 4L80A 2WPBA 3STGA 1MW3A 4D8ZA 3QY7A 4ZO6A 1WUEA 3IEBA 3C86A 1K7EA 5AFDA 1EJSC 2VZTA 3TUUA 4F79A 4EK7A 1W0MA 1NDWA 2E9BA 2VGFA 1US0A 3AUJA 5D04C 1D8CA 2OO0A 1KQYA 4MLJA 3BG5A 2ADAA 3N14A 4ZFCA 2GPTA 1MEWA 1LUCB 4XIAA 4Q8WA 4GI8A 1C93A 3BO9A 4M29A 1A80A 2WBKA 1JPHA 3B8VA 2NQ9A 4NASA 3BLIA 4I9JA 5EMKA 1CLXA 5AHEA 3WLLA 3RPMA 1XSJA 3DKJA 3BMWA 4IP4A 3TX9A 1WXYA 1A3WA 4C6BA 1TMHA 3VMPA 3HJEA 3M9YA 3L5LA 1OT1A 2RKXA 3GVGA 4CD6A 2XPKA 3S9YA 3AMGA 2O9PA 4AD5A 7TAAA 2EQDA 4JNMA 4QAIA 1EHNA 5KTLA 4GACA 4C6PA 4D6FA 4GQRA 2Z6IA 1DKWA 1REQB 2DSVA 4PEEA 1JD7A 3QV6A 1NM9A 5EPDA 1VHCA 4PUJA 3F5JA 3MCMA 1VQTA 4YHGA 1T8XA 1TTQA 1EZWA 3EX2A 4TX9A 1KBLA 1FFRA 4GK8A 1FWNA 1PWLA 4DBEA 3UR7A 4LAZA 3EX4A 1PTDA 3QMTA 5HMSA 1TPH1 1OG0A 3GUGA 2ZZ1A 5BNKA 3DHUA 3DBPA 2WSQA 3TR2A 3I3BA 4BHYA 1TREA 2GUYA 4MG4A 4GG9A 3H24A 5L6UA 2CHRA 4C60A 1BG9A 3O6YX 4RDYA 4DI9A 3GXFA 4H19A 2BOFX 1ICSA 1KTCA 5G4WA 5AYBA 2G0WA 3EDFA 4JTAA 3O06A 2WVTA 2UWFA 5FESA 2C3ZA 1EYWA 2CLKA 2YR1A 3H23A 1Z48A 4PUNA 1NFBA 2Z2AA 4JYDA 3ARRA 1UKSA 1IWBA 1PKLA 4C6CA 3EX6A 4LXFA 2WZHA 3EB3A 3WLSA 3DI1A 2UV8G 3P74A 5HNRA 3VO0A 4IX2A 4FF7A 4HGXA 1UYQA 4ZOEA 5A5WA 4IMCA 1UQZA 4OE7A 3OA3A 3UT0A 1XLDA 3KE0A 5AVNA 3C52A 3CUGA 3ERPA 5E5CA 3W1MA 4TU1A 4IGHA 1IF2A 2XVKA 4UTLA 3PAOA 1UWQA 4DX3A 2F7FA 3MSDA 1ALDA 4MWAA 1PUDA 2Y7DA 3LMYA 4HOWA 1PCWA 4NUWA 4E2VA 1V4YA 4A8LA 4LNYA 4GRSA 1I0BA 2FTWA 4S3DA 1J10A 5FJOA 1FH8A 4Q6JA 4DI8A 4GXWA 4KWVA 5JH2A 1AA1B 4L7ZA 3T8QA 1PKNA 2WWCA 4WQ6A 2YB4A 1JZ4A 1FWTA 2OPJA 4YVXA 4GYPC 3LQLA 5BRBA 1J2BA 5HR7A 4K37A 1RA0A 4CEXC 3QGVA 3V0TA 4DJFA 4LUTA 1V6TA 3W3OA 3INPA 4K68A 5BROA 3G18A 5LA1A 1F6PA 1H7NA 1W8SA 4O28A 4C6DA 3V7PA 3UPWA 2WB5A 1NP2A 4LJ3A 3B97A 1WKDA 2YA1A 3YPIA 4EIVA 4G6CA 4HTBA 3WDHA 1R9YA 3LK6A 2EJAA 3QY6A 4GZ7A 2E3ZA 2ABAA 1RP9A 3HQPA 3KS6A 3WD0A 2BDQA 3CZEA 4G7FA 5LNWA 1KBIA 1FWRA 1U1UA 1DHPA 3R0UA 4YU1A 4C7FA 4R33A 3LSCA 4ASTA 1KR1A 1UR4A 4NJHA 4A3QA 1HX0A 1XC4A 4GCXA 2TPSA 5I06A 3OEXA 4IICA 2REQB 3NYDA 3QR3A 1F05A 1Y65A 2IXVA 3MCNA 1NFPA 3IAPA 4PCNA 3MUAA 1WZMA 3NVTA 4PMRA 5D2WA 2WWDA 1UP0A 3TYAA 3EDEA 3WQ6A 3QV9A 1Z89A 3ZLFA 2A3BA 1GG0A 4MFDA 4S2BA 3TN6A 3PSWA 2QEZA 1C8YA 1AD1A 1FRBA 1ADDA 1EF3A 4DUWA 1LL7A 3CZKA 3APYA 2QJGA 3VCRA 3EGJA 2GSHA 1YDYA 3L7RA 4PCTA 1DIOA 3JR2A 2QXWA 4GKTA 3WLTA 4NJJA 3NPXA 1W5OA 2FDMA 2PU1A 4UFKA 1SFJA 3NPUA 4AEOA 2XWDA 1DV7A 1KV5A 4EX4A 3PPHA 4UTJA 4C5ZA 1MDRA 3G5EA 3PN8A 1A5LC 1L8NA 2TODA 2Y2WA 3LA4A 1UD5A 4Z08A 4J3VA 5D37A 1E5JA 2GVYA 2XVNA 4KEMA 3VDAA 1Q7ZA 4TIMA 4LUSA 4FNPA 4C91A 2I7GA 1QHZA 2VEGA 2TYSA 4WDUA 2C0AA 1N7KA 2PWEA 2WMGA 2P5NA 2VX5A 4Y9MA 4W9TA 4WKHA 5D05A 4JIHA 4O16A 4CD4A 2FZBA 4XAFA 5DELA 3MT1A 2NV9A 1C90A 4YL2A 1KM0A 3EEGA 1UUOA 1XLGA 1E4LA 4ZVJA 3D3AA 1EBGA 5EFDA 1JUEA 1W1TA 4RLIA 3R89A 3TW6A 1MZHA 3CWOX 2E0PA 4Q3MA 2ZX9A 4HU3A 1U83A 3F03K 2YJQA 1LG2A 2EGZA 4W8LA 1FHVA 1XFBA 3SUVA 3WNMA 5CLWA 4PYSA 3K5XA 5FEPA 2Y8VA 2HROA 4EF8A 3OZMA 3IV8A 4QJ3B 4FX7A 2QCMA 3SJNA 4FF5A 4ZQRA 5BMWA 3GW0A 1XD1A 1UR3M 2DGAA 1H62A 1PJ9A 3CZJA 4NZ5A 3OO2A 3KBSA 2JEQA 1XYBA 3TK7A 3UGVA 1R2TA 3BJTA 1GQJA 1F3TA 3WF1A 2DQXA 2DP3A 4EKJA 3LEPA 1PV8A 3KHDA 4MY9A 1AH0A 5HWJA 3S83A 4AY8A 2PI6A 4GGBA 4H8HA 1S5TA 3VIGA 1YE6A 1HIZA 3W6MA 1VJIA 2BB0A 3SAZA 3NQ8A 1SSGA 4G2DA 1DPMA 4KWOA 1HUVA 4QE5A 4YYFA 1GGOA 3G22A 2GGEA 1K8YA 1ZUAX 1AUSL 1D7KA 3R6IA 1UPMB 4WDWA 3LM7A 4GY0A 2XYLA 4HPHA 1TIMA 3KVMA 3AJ7A 8CGTA 3L4WA 2CKRA 2B7OA 4AHPA 4H83A 4O4VA 3APTA 3G1RA 1GVYA 2BTMA 3RO8A 1JZ8A 1EF2A 3CYJA 3SGGA 1A3XA 3EOOA 1EP1A 1WV2A 1CGVA 3PSVA 3AHVA 4DXKA 1LROA 3A9BA 5HDRA 6XIAA 1VBJA 1TX2A 4LAOA 1UASA 4CNPA 1UJPA 2VCBA 1UWUA 3E3HA 3W37A 1J0IA 3S1WA 1EZ2A 3R8RA 2YOCA 2P8CA 4J2MA 4K1GA 3LU2A 5CBBA 1KXTA 3ARYA 6ALDA 3E2QA 5E6ZA 4MY1A 1FP8A 3GKFA 1TV7A 1K70A 3PBGA 1JGMA 1OFOA 5G4EA 1ME8A 3CV7A 3MI2A 5H1WA 3BL3A 2NQJA 3FV9A 2W67A 1V0MA 1F76A 3NOEA 3NO1A 3S9IA 4LEQA 3CT7A 1CTNA 1L6SA 4GD0A 4REQA 1YNQA 4N9CA 2NWRA 4HU0A 4MUPA 2ALDA 3NUKA 4XWUA 4MWAB 3UR5A 3PZNA 2O7QA 3O6DA 5DXXA 2YDQA 2QGHA 4ZSTA 5CPLA 4FLSA 4RR4A 5EFFA 4MLRA 3PJXA 2OSXA 2XH0A 3VE9A 3LG3A 3WLHA 4S3CA 2XM1A 1TVNA 2QHAA 2ZDRA 1EYEA 4F0RA 4Z1DA 1GOWA 1Z3NA 2E6AA 3A4JA 4LCRA 3QY8A 3WQ8A 1XLIA 4S3KA 5FF7A 4R88A 2OWCA 3VZXA 1F3EA 2PRMA 1QI2A 3EXTA 3UP8A 4LUTB 4IJBA 4KS0A 2PD9A 3CL8A 3FLUA 4JYEA 3RDKA 4AFYA 1TVLA 4RZ5A 1V79A 3LN3A 3W87A 2C18A 4DLFA 4DN1A 1ME9A 1BGAA 1J0HA 4MKVA 4PBGA 1Q5MA 1CDGA 1MW2A 5A8OA 2HXTA 2A3AA 4G7EA 1NDZA 1CYGA 4ECLA 3OBKA 3EBVA 1OB0A 2HVMA 5JU6A 1SFLA 1RVGA 2HE5A 1Q8JA 2P3EA 1P0BA 3CPRA 3N2MA 5IBXA 3WEMA 4LANA 3LHYA 2C1HA 2CHNA 3VK5A 5HWMA 2E6YA 3KBJA 2YX0A 3V1HA 2GUUA 1EJWC 1QASA 2TMDA 1IR2A 2ZE3A 3W7IA 4BI5A 1M5WA 3NGJA 1UOZA 1FH7A 2F8QA 3MUCA 7TIMA 1XP3A 2VNCA 2Y7EA 2ZWZA 3VIFA 3OVRA 4HPNA 4LRTA 4HKPA 5C9WA 1MWOA 3AIQA 2FDSA 3TXZA 4HCLA 1F4AA 1RSCA 1B4EA 5I3FA 3S5ZA 1E3XA 4HK7A 1MXGA 3VIPA 5C9UA 1KCLA 2ICSA 4ACYA 1OCNA 4WKFA 3EA1A 2HK0A 3DGBA 1KCXA 3QOMA 3URBA 2PRLA 2QUNA 4GYFA 3GG8A 3W1PA 4F40A 2Y88A 3CTTA 4Q32A 3GRIA 2AL2A 5FL1A 2HCVA 2BY0A 4U5IA 2CU0A 3DFYA 4QISA 1FWEC 1RCXB 3NOYA 4EXQA 5H2ZA 3CXOA 1ISYA 5HPOA 4PTDA 4B9YA 3AXMA 2NVCA 4IMFA 4P8VA 1A5KC 1RBOB 3MI3A 3S1GA 4XV0A 4M24A 4PMOA 5C8BB 1TJ1A 4Z2HA 1JULA 2QNEA 2INZA 1G94A 3W7HA 3H26A 2QAPA 3FAWA 4XZNX 1KO0A 2WLZA 5CJMA 1H7XA 2Q3RA 4ORMA 3PTDA 2WNNA 4LF2A 4P7RA 1VFUA 3F5LA 4FNSA 1ELSA 4E2BA 2L5HA 2D22A 2J88A 1O1ZA 2OCZA 4LS2A 5DEZA 1WPCA 1WE5A 4FB7A 1SJDA 4OGZA 3BMXA 5FF0A 2QLYA 4W7UA 3CQ0A 1GONA 2R9RA 1XICA 1UKQA 1KGWA 2H6RA 5KZ6A 3OLIA 3QZEA 3FHAA 3B0PA 1L8PA 3S9ZA 1KBJA 3U2CA 3RYSA 4PMJA 1KRBC 2Y63A 2JKPA 2ATMA 3FJ6A 3S3GA 3LPOA 2YZRA 4LEFA 4W84A 5BXPA 1BPLB 3CHCA 3CV2A 4OQVA 3MMUA 3NEHA 4DJDD 5C54A 1IZCA 3E38A 2UBPC 1UOKA 3BAKA 2R1PA 1EUAA 1RK5A 3RXZA 3DZ1A 3KUMA 5BOFA 4MADA 3KP1A 1TPC1 2J6VA 3NQBA 4E8DA 2VRQA 3VM7A 4W7VA 1O68A 1O95A 3HGOA 2W91A 2DH3A 1NOWA 4IMAA 5D9PA 1SMAA 4W7WA 1OYBA 3MYOA 4GZEA 4W88A 4D8AA 2W4XA 1JDAA 3T0BA 2X2YA 1AQHA 1XLCA 3WMLA 1AZ2A 4AYSA 1R2SA 2ZX6A 4ATWA 5MKGA 1W9PA 1JXJA 2QVNA 3UJ2A 4Y2WA 1RAKA 1AL8A 4UQ9A 1SW0A 4TV5A 3WIJA 3STPA 1A47A 4AMAA 3SEPA 5LIWX 1XW8A 1K77A 2VR2A 2D0FA 5EGRA 1RXOB 5DFAA 1E9YB 5AB3A 4L6HA 3E2RA 4Z2JA 4LNCA 3BQ6A 1GVRA 2X16A 4AWTA 3U57A 2YLLA 4LC8A 1K6AA 1NWSA 2HBVA 5EKYA 2IW0A 1E56A 1V3JA 1OX6A 4GUIA 1BAGA 1XX1A 3SGUA 3LB0A 4ZO8A 4W4QA 3GG0A 5A6TC 2X1SA 4IL2A 1V6UA 4L9ZA 3JZUA 3EOLA 4H9XA 1GPFA 2QV5A 2PTDA 3GR8A 4M6UA 2WK2A 4TTGA 2PTXA 2GQ8A 2XINA 4OKDA 3O1NA 4YJ5A 1QO2A 3PWAA 3FEMA 4HNNA 4XO7A 2POZA 1ZALA 1DBTA 3S8HA 4AIOA 3F4VA 3TJIA 3I10A 3W26A 3BLOA 5I79A 3NG3A 2PGRA 5FEXA 3GH7A 3HPFA 4AZ6A 3UY8A 4V1XA 4AWUA 2DVUA 3QW3A 5D33A 4XKMA 3GM8A 2YDSA 3R79A 2BNJA 1MYRA 2IMRA 2NT0A 1QI4A 1R5YA 4Z2LA 1PIGA 4GPNA 4UTKA 3SRFA 4A8IA 3F4DA 2OYMA 2C1IA 3V1PA 1ITQA 2MANA 4LUJA 1MNZA 1SW3A 1S46A 1VFOA 5I24A 7REQA 3SO7A 5F2IA 1V0KA 4GHRA 5DMNA 4HMNA 5LIXX 1W2VA 3FIGA 3B9OA 4CNTA 3I65A 3UG3A 2GGGA 4G7EB 1X1ZA 1NQ6A 2PDHA 4NY2A 2PDWA 4G5DA 4EAMA 3ITTA 4ZL1A 1ICPA 3WK2A 2MUCA 3EB2A 1CGWA 2VQTA 3TNOA 3M5YA 4KMQA 3T05A 5JBDA 3SIMA 3VIIA 2HTMA 1GVFA 4NQ1A 2FHBA 1GOXA 4QROA 4BCEA 3KHJA 3B9NA 5A6AA 3I6RA 1MVYA 1NDVA 2PDGA 4PSPA 2VGGA 3WUEA 5HNTA 1TZZA 1I6NA 3SQLA 3GXNA 3O6AA 1SGJA 5M5DA 4N4PA 1H5YA 1QDSA 2C16A 2WC7A 1ZRQA 3V4BA 4LVGA 4HZMA 3ZJ6A 3Q67A 1HZYA 3LGGA 1I2RA 1CBGA 3SUTA 2CLMA 2PDXA 2G37A 4EXAA 3DYPA 1CNVA 1K1DA 1F3XA 5E93A 2PFHA 3GO2A 1Q4WA 3TN4A 4JTFA 2IPGA 2XZ7A 1M3UA 3QHNA 3FSUA 3Q94A 1WOAA 2AL2B 5DRIA 1LT8A 1M68A 3CS2A 1N55A 3G6MA 3WH7A 4QEEA 1GK8A 2W61A 2PE4A 3KOFA 3FJLA 8XIAA 1PHWA 3QHMA 4XZLX 3ANYA 2OQLA 4R85A 4RPQA 2XGIA 3VM5A 4RZBA 2JE8A 5JMUA 4XZWA 4YIWA 4AZGA 4CNUA 3T0AA 1XBYA 3AHXA 1W31A 3H12A 2QCFA 2CCRA 4W5ZA 9XIAA 4GKLA 2TSYA 3E0IA 4OFCA 3QQ1A 2WHLA 3E6EA 2J6XA 5K4XA 2ANUA 2PA6A 5H8MA 1EP3A 3QOKA 5EYWA 1X97A 3TTSA 4DVOA 3H2AA 3RR1A 4KKXA 1KFJA 4XD4A 2B7PA 2QIIA 3GNDA 3MKCA 5AC6A 3E0VA 3T8LA 4F0SA 3UGRA 2CESA 5ABEA 1W3KA 3UZ5A 1EJ7L 3O0FA 2Y1HA 5I3IA 4WVXA 1MW0A 4UMAA 4E3VA 2VUNA 3G24A 3BXWA 4CD5A 2YCJA 4LCQA 3BICA 1MQRA 4S23A 5LIKX 4XB3A 1EDQA 1L6FA 2DIEA 3WDQA 2YW3A 1MQPA 2IQ0A 1JAEA 4FZIA 3WQEA 4HPXA 1JDFA 1E4MM 2XGZA 4HT3A 4BQ2A 1SMDA 1HVQA 4H6QA 3HG3A 5TBOA 3ZJ8A 3KWSA 3QF0A 4JQAA 3NZRA 3WQFA 2PC8A 1ZU8A 4C6NA 2Y8KA 1YYAA 3AU2A 3H2NA 4IFRA 3HFYA 1AK5A 1P0NA 3V16A 3UG8A 1HJSA 3SY8A 1EPXA 4NJGA 2NXIA 1A5MC 4K7VA 3BG9A 1ZQ5A 1WCGA 4DJEA 4KCWA 1YLVA 2J7GA 1UKTA 2J7BA 4CU7A 1HP4A 3BMVA 3JU2A 2W63A 3AQUA 3M0LA 5C2CA 3G1YA 4QR6A 1SVDA 2BGQA 1TWSA 5K2ZA 5U4NA 4HZ6A 1JDEA 1NOFA 2EG6A 1FWJC 1EO5A 4KW2A 4O52A 1C9DA 5BU9A 4IFKA 3WX7A 5LNSA 5G4HC 1SZEA 3IIOA 4UUIA 2VEKA 2J74A 4IX0A 2GOUA 5CPSA 3P0WA 4IIGA 1EUNA 4JL1A 1D7FA 3MMDA 4NU7A 4JTDA 2WVSA 5MKGB 3EWZA 1QPOA 4Q4MA 1RBAA 2V6AA 1OBAA 4C6LA 3DI0A 4NIRA 5KITA 3CC1A 3OIHA 1QXLA 4Y8EA 3WQWA 1XH0A 2OEJA 1VJSA 1AQMA 3DU0A 4X2RA 1G69A 3OZOA 3WLPA 3E74A 4H04A 4PRTA 4IIHA 1G9HA 3AAMA 2R91A 4ZTXA 1G7VA 2PEVA 1AJ0A 1PBGA 5FEZA 4DUOA 2HSAA 1OC7A 2NVDA 2BP1A 1BYCA 1EJVC 4UR7A 1KFCA 3EAUA 2OX4A 1R3RA 2Q01A 1C91A 4MZ8A 4XISA 2Y70A 4L5ZA 3W86A 2JIWA 2EKGA 4Y6GA 4UTTA 1KTNA 1YNYA 1H2JA 3C8NA 4XSMA 1OK4A 2ZADA 1YMYA 4WR3A 5B7ZA 3DX5A 3WFAA 3BOFA 3M0HA 1G5AA 3CH9A 4GVGA 2YA2A 3ZXWA 5IFPA 2OJPA 4XAGA 1AQFA 1AVAA 4HSOA 3GDKA 4GQ0A 1G4PA 3UZJA 5BW6A 4I6VA 4XSLA 3GIPA 2WMKA 4IPLA 3S2CA 3CYVA 3OGSA 3KRSA 4C90A 1FOBA 1MZRA 4FLQA 1YXYA 4HNOA 6A3HA 3RLGA 2DSUA 2PDQA 3NQEA 4DF0A 4HA3A 1QNRA 3W1LA 4MGGA 3U5YA 4R3UA 3WN6A 5F4WA 3WD2A 3WMBA 1QOQA 4PTMA 3DUGA 3BCJA 1TPWA 3ITCA 4PMDA 4D71A 5C7HA 1U2YA 1SO5A 3GYCA 3M47A 4A21A 1M7XA 4TVCA 3VCCA 1XUZA 3ZWTA 5M2FX 3A4XA 4H6EA 3FN9A 2I17A 5MHBA 2PBOA 1ZS2A 1ISWA 1OIFA 2PGFA 4XUYA 3CQHA 3NSMA 3OZPA 1SO6A 3HO8A 3P8IA 4JPGA 1XIHA 1YDNA 4US6A 2CXGA 3AROA 1F7BA 3ME3A 3PF3A 1MMFA 3LRKA 3J7HA 5M17A 2E4TA 2J9XA 5GJNA 3WH6A 1CI1A 4Z0JA 4H9TA 3R8HA 2YBTA 2BSLA 2YGYA 4C1LA 4P61A 4PUWA 2W66A 4BR1A 3N2CA 3LY0A 2G97A 3PUDA 5D9NA 3T4WA 4LOCA 3BAWA 4A3YA 1S2TA 7PTDA 2WMHA 3M16A 1IGSA 3N3MA 3MUIA 3DBNA 2JF6A 1VPXA 4GJ1A 3W1XA 1UIOA 4M80A 4XBSA 2ONEA 1FQ0A 2ATSA 1Q8AA 3FAXA 3O05A 1RA5A 5TNVA 4C1NB 3H55A 4B9ZA 3UFYA 5HR6A 5XIAA 2ZRYA 1GKPA 1UJQA 1E1FA 4NX0A 3OLDA 2WJFA 3WK0A 1X7FA 4A3HA 3N13A 2WLYA 3TWBA 5E0FA 2HISA 4ZQPA 3HJZA 1JCTA 2FZ9A 1FCQA 3MV01 1QHPA 3CO8A 4HYRA 3UJFA 3ICJA 1FCVA 3UZXA 1JPKA 4NZFA 3VC5A 4CQAA 2Z29A 2Z28A 3GFXA 4M6PA 1WDWA 3F7JA 4OZOA 4QE1A 4ATDA 3MKVA 2W62A 1D3CA 4LAKA 1XRTA 4GX9A 4O18A 3U7BA 3IACA 1X96A 2BODX 3WDPP 4QFUA 4JFSA 3GZ3A 3VOGA 3M41A 1DWHM 2W79A 5H91A 2VYOA 3GG7A 2EPMX 3XISA 4ROQA 3R94A 3NQAA 3ABSA 2INFA 5CPOA 3GDTA 3GFZA 3WLNA 5E0CA 3NL5A 3USZA 1RQEA 1H5VA 4ZO9A 3AIVA 3C0SA 4Z2KA 1XJBA 3QLLA 3RJXA 2V9DA 3U3HA 1QI5A 3E12A 4M81A 1V5XA 5FACA 3M43A 1E3ZA 4GUHA 4DWSA 1CECA 5EMYA 1VYRA 2WNQA 4JTUA 4QCEA 3TLLA 4AF0A 2J4GA 2GLKA 5KETA 2YL9A 3UG5A 1X98A 3VMNA 3U2OA 1A4MA 4QLJA 2ZVRA 3PZOA 2WQPA 2E8ZA 3CNYA 4ES4A 1FBAA 4QHRA 4JOMA 4E6MA 3VD5A 4HNVA 4G1KA 2VGIA 3AMLA 1HJUA 3DHFA 1I2OA 4I5UA 3A6OA 3LZ5A 4MNJA 2F2HA 5AZ0A 5A8MA 1FXPA 1OABA 1VLWA 1TMLA 1MO0A 3S2NA 2ZC1A 4GOAA 4YCOA 3WF3A 1T99A 2E5CA 2PSNA 4IF2A 2GQ9A 4LW7A 4CN4A 1QUMA 1RH9A 3W2JA 4LT9A 1O6IA 4PUEA 2FFIA 3ARXA 3O2LA 4PR4A 1BWVA 3U9IA 1PAMA 3UPBA 3CUIA 1UC4A 4ERAA 4D6EA 3OA5A 1U1JA 2VVSA 3CZGA 3M0IA 1IXPA 1A4LA 3W74A 1JCYA 2ZUWA 4MDPA 4U3CA 4CNSA 1W5MA 5CZSA 2BHUA 1TZ7A 1FDJA 1GVEA 2P10A 3VINA 5EMLA 1V02A 4NNBA 4XK2A 1CB7B 3WEZA 1FDZA 3T6CA 1HT6A 1FWWA 3VNMA 3A5FA 3NQFA 4IGSA 4FI4A 1LP6A 4ZCWA 3LM3A 5I03A 2FTYA 2AMXA 1K9FA 1C29A 4UOZA 4TV6A 1PZ0A 3E02A 1N82A 2OSWA 3B05A 2WKJA 4I9MA 4CGTA 4O0ZA 4ZTYA 1S2AA 4LCSA 4ZSUA 5HA7A 3T0CA 3KRBA 4P8WA 4HBKA 2A3LA 2PLJA 1XYAA 4B3ZA 1EDTA 2I1OA 3FA5A 2VC7A 3E96A 3RX3A 2NX9A 2GYIA 1K6WA 1QBAA 1KA9F 2XHYA 4FK9A 1VS1A 3VNJA 1R38A 1JAKA 3UF9A 3FJ4A 5I6SA 3CEUA 1KM5A 2H8ZA 3FOKA 2DFAA 4PTNA 2PWUA 3OLGA 2QV4A 4RDZA 3LV5A 4ERIA 4WZHA 3B8SA 5A6LA 4M6VA 3ZSSA 4OBRA 1D3GA 3WLOA 2XU2A 1EHAA 3ZO9A 4H3DA 4OTKA 2QDGA 4ONVA 3NA8A 1QRQA 2BBFA 5HJXA 3GDBA 1IXOA 4HP5A 1W54A 3SDOA 2O55A 3W28A 2PLCA 5CC5A 4MM1A 4NNAA 2FJKA 2W6RA 4UQCA 1NWTA 2YDRA 1U30A 4RKAA 3BLDA 4L6OA 3NQVA 1P43A 2PCQA 3CMJA 3L4TA 2WXDM 3DXIA 1VCVA 1LQ0A 4XD3A 3WLMA 2YL6A 2BASA 4HCHA 1OK6A 3TC6A 1A5AA 1PWMA 2Z1SA 4X61A 1HJWA 4O1CA 2G3MA 1OY0A 5B80A 2HV5A 4MAVA 3BCDA 1OFEA 6REQA 3JUGA 3PTMA 4UQBA 1S3HA 4IM4A 4KBXA 1H0GA 2GVEA 1YPIA 5A8NA 3GXIA 4L56A 4ZE5A 4GJIA 1HGYA 3VNKA 3PUGA 1MDLA 9CGTA 4AQLA 5C71A 3SUWA 3U4AA 4O1FA 2I16A 1GJPA 1Q6LA 4QSFA 3V5OA 1TR9A 1A3HA 3RJYA 1UD6A 1S5VA 1UWRA 5A69A 2OLAA 2Y7GA 3PZQA 3KCOA 2NQLA 1OJXA 3GXMA 3SCPA 2QJNA 4H9MA 5I3JA 1RLDA 1C8VA 2Z2BA 5DX7A 3MBDA 4H6RA 4AWEA 4JTCA 2OVLA 3TMQA 1B9BA 5J04A 5DY2A 3WQ4A 2E9LA 3LRLA 3F4CA 4CQBA 4LYPA 1PZ3A 3RCYA 5F7UA 2Z24A 1TSIA 2CERA 1W5NA 4LY8A 1IGWA 3BV7A 3HURA 4JKKA 1TUFA 1QW7A 2PF8A 1Z42A 2WBGA 4XZHA 2AGTA 1K4GA 3PNZA 4F2TA 4MSSA 1RUSA 3CK5A 4R34A 1XLEA 1JXKA 1HO1A 3GE7A 3B4UA 1N8WA 1QI3A 3AHTA 1XC6A 1TWZA 2XSAA 3E5PA 3F4WA 4QLLA 3TIMA 3ZR5A 1WKEA 4PTWA 1E6XM 3IS4A 1TWWA 3QEZA 1VPQA 3S5OA 3E0LA 3UYCA 4YTTA 3HPXA 2IQDA 3BGAA 3LERA 1WDSA 2Z7KA 4HU8A 5A94A 5ABFB 3C2OA 1DEDA 2ZZ2A 1TJRA 4AY7A 1AJZA 1R0MA 4LAUA 5CGTA 3LHUA 4JQ3A 4BJHA 1KFLA 1O5RA 2I5QA 3IIPA 1H7RA 3AC0A 2ABBA 3BARA 4KETA 5BRPA 1Q63A 2DDXA 5EU9A 2DZXA 1GVSA 1PXGA 3FA3A 1GUVA 2DW7A 1JQXA 2BV9A 3GAKA 3N1AA 3BAIA 2PLMA 4S3FA 3TVAA 1FFQA 4GISA 4F4RA 2YYUA 5G2WA 5IXEA 3BJFA 2QCDA 3QM3A 4BI6A 1Q6GA 4Y9OA 3HQOA 2ZFAA 3ARWA 3P5YA 4PFMA 4ZZ9A 2O9OA 2CIPA 5JIPA 2DY3A 3KTCA 1EC9A 1F9CA 1NFGA 4IIFA 3W2LA 3B8IA 4NXKA 1O12A 3SCQA 2V67A 1GOMA 2GK1A 2QUMA 3L0KA 5CPTA 1YNPA 5LYRA 3KL0A 3LCLA 1TJ0A 2QCCA 3H8AA 4OUEA 2D23A 4IQLA 3LCFA 2XVGA 4OWGA 4LBSA 2OZTA 3LS9A 5K9CA 2RGMA 1I8JA 2OG9A 4GC3A 4J3TA 1FH9A 4DJED 1VYPX 5AHFA 3FNDA 1GT8A 2XFWA 3B9EA 4LPCA 4UWMA 1B3WA 3P5ZA 3WQPA 4IPPA 1XLLA 3W1RA 1LRTA 1ZZMA 1UH3A 3EPOA 2VD9A 3AIEA 4PMNA 5HANA 1J4EA 4WHBA 4MNLA 3S0CA 4GIEA 2YCKX 3T7VA 5CG0A 2FTPA 5DCEA 2I5IA 5F1VA 4PB4A 4Y7EA 1LBLA 1DJWA 2R1LA 3C2VA 3S47A 1S2VA 3N4FA 3VUPA 4YTRA 1T41A 4H2CA 5FJJA 5I2UA 3VIJA 4GI4A 4N4QA 3CHFA 2P76A 1WKFA 2PWHA 3I68A 1VGAA 5LA2A 3FVDA 1O1HA 4C6OA 4E8GA 3TYCA 2BY2A 2F6UA 5HNUA 5JVLA 6ENLA 4O8AA 4ZO7A 3OGVA 3QPEA 1A5NC 5GNZA 2RDXA 2FZDA 4GJJA 2WCAA 1TTIA 2W5FA 2Z1BA 1R30A 4JNZA 1LLWA 1EX5A 1T7LA 2GJPA 3M5VA 2KZHA 4CU6A 1X6LA 4Y96A 3W7GA 3T08A 1IZKA 4HCDA 2FB3A 4OBSA 6XIMA 1CXHA 3NZPA 5LKYA 4PTVA 1VYSX 4Z1YA 1WKYA 2F61A 2VD8A 1QR7A 3DG6A 3PJUA 3WK1A 1CT5A 3R13A 1G0CA 3B8DA 5CZJA 3V36A 2ZXAA 4CCEA 5I3GA 4RUBA 1LF1A 3LLDA 3GC2A 3HG2A 4JIEA 1YPFA 3L9CA 1D9EA 3ZLHA 4FP1A 1GEQA 3AXHA 2PGWA 3P84A 3SFWA 3LX9A 1K02A 2J66A 5IDIA 3UWYA 1HKJA 1BFNA 2XIMA 1E6QM 3PBVA 1TV5A 1XKJA 3DH7A 4UR8A 2A85A 4MKSA 4NT0A 3SRHA 4HN4A 4N02A 2DT3A 1TV2A 2V5LA 2V5CA 4UXDA 4B5WA 2GWGA 2PAJA 4GIRA 1YRRA 1UD3A 2E5BA 1XIMA 4LC6A 1L0PA 1PKYA 1TO3A 4ZENA 3P81A 2DT1A 1UMYA 2RFGA 4LBUA 4BF9A 3NAVA 4AD3A 3MDWA 1FXQA 6REQB 3C0QA 3Q4DA 3EYPA 5G2HA 2BX7A 1LRQA 4UMBA 3WBYA 1R8LA 3T09A 1I45A 4AZCB 3ABZA 1DXEA 2D0GA 3LXCA 4PH6A 3W71A 1HN1A 1DTUA 4D6GA 1JYVA 2J8GA 3TAKA 3VD9A 2QJJA 1QNQA 4KWWA 4HK6A 3RR4A 5TF0A 1UROA 5ABTA 4F66A 7A3HA 1YPXA 5TAOA 1JDCA 1SPQA 1XDMA 1MI3A 5GNXA 3ZT6A 3MUY1 3LYEA 4FX8A 1ZBVA 4BZYA 3OYXA 1JYXA 4JDYA 1WZAA 3MHFA 4LSBA 2ISWA 5IHSA 3GBDA 3GX9A 2ZUVA 1TUXA 5EMJA 3W1UA 2WSYA 1F74A 1XV8A 1OFQA 4Z42C 1FWAC 1KKRA 4DUVA 2Y6ZA 3NPWA 5FJRA 5FF3A 1S2UA 3KWXA 3LGDA 3WH9A 3TYEA 2GGHA 1CWYA 2BMBA 4AC7C 2DZUA 2PDIA 2PPGA 2C91A 1PIIA 3RU6A 2HEJA 3KRZA 3RNDA 4TMBA 1J01A 5B7YA 1QT1A 4MPKA 3VUSA 4Q8TA 3S5YA 4DAIA 2YXXA 1SFTA 3O7UA 3STCA 1B0IA 4TX6A 4YHEA 1ODUA 2ISVA 2PDYA 4ZGYA 1KCZA 1HFBA 3LLXA 4B3LA 1GQNA 3PPFA 5CC3A 3IAQA 3KS5A