5JH1A

Crystal structure of the apo form of akr4c7 from maize
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
262
Chain Sequence
ARHFVLNTGAKIPSVGLGSWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKLFEEGVVKREDMFITSKLWNDPEDVPEALNDSLNDLQLEYLDLYLIHWPFPATWGAMEKLYDAGKARAIGVSNFSSKKLGDLLAVARVPPAVDQVECHPGWQQTKLHSFCQSTGVHLTAYSPLGSPGTTWMNGNVLKEPIIISIAEKLGKTSAQVALRWNIQMGHSVLPKSTNEERIKQNLDVYDWSIPDDLLAKFSEIKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparative structural analysis reveals distinctive features of co-factor binding and substrate specificity in plant aldo-keto reductases.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Aldose reductase, AKR4C7
total genus 98
structure length 262
sequence length 283
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5jh1A00
1US0A 3GHUA 3GUGA 4PUWA 2PDNA 2IKGA 3FX4A 4XZNX 4DBWA 4GABA 1AH0A 3Q65A 4F40A 2FVLA 4JTCA 2BP1A 4XVEA 3GHRA 2DUXA 4LBSA 2IQ0A 3UYIA 3GHTA 4XZMX 3UWEA 3GHSA 4DZ5A 1ADSA 2PDYA 4GQ0A 1T41A 4GIEA 5M2FX 4ZFCA 5C7HA 3H4GA 4WEVX 3V0TA 4WRHA 3BURA 1PZ0A 3R58A 2FGBA 3S3GA 3UZXA 4QX4A 3P2VA 4JTDA 2IKJA 1M9HA 4GA8A 2HEJA 4L1WA 4AUBA 2HVNA 3UZYA 4ICCX 4XO7A 4XZHA 2HDJA 2IPFA 5HNUA 3Q67A 1AH3A 1Z8AA 3LBOA 1VP5A 2NVCA 3UZWA 2HV5A 1MZRA 3O3RA 5KETA 1RALA 4WDXA 2ACQA 1XF0A 3UZZA 4JQ1A 4YVVA 2AGTA 3G1RA 1AZ1A 3BV7A 2IPGA 3WG6A 2PDQA 2F38A 2PDXA 2ACRA 3WBYA 1K8CA 3LQGA 2ALRA 3LNMA 3EB4A 2J8TA 1IHIA 1EF3A 1RY8A 1OG6A 4NKCA 1QRQA 1AFSA 2DUZA 3M0IA 4FAMA 2INZA 1AH4A 4RPQA 3UG8A 2PDJA 3LUTA 4H8NA 2PDWA 3N6QA 1X96A 2ISFA 4FZIA 1JEZA 4JIHA 1AZ2A 4GQGA 3U2CA 2PDKA 2PDGA 4JIIX 3H7UA 4JTRA 2PDLA 4YU1A 4EXBA 3FJNA 3VXGA 1LWIA 1S2CA 1FRBA 2IQDA 2IPWA 3O0KA 3WBWA 2PD5A 2DV0A 3MB9A 3R8HA 1YE4A 4LAUA 5AZ1A 1VBJA 2PDPA 3T42A 4H7CA 3RX3A 3QKZA 4JQAA 2F2KA 1Z3NA 4PMJA 3DOPA 1ZQ5A 3G5EA 2HE8A 2NVDA 1Z9AA 3BCJA 3F7JA 1MRQA 2R24A 2C91A 3CAVA 4XK2A 1Q13A 4OTKA 4XZLX 1EXBA 4Q3MA 1IEIA 2INEA 4XVDA 1YNQA 3RX2A 4IJRA 3LZ3A 1Z89A 3R94A 4I5XA 4WDUA 4JTAA 2R9RA 3M4HA 2PZNA 1T40A 5LIXX 3V35A 4QR6A 1ZUAX 3R8GA 1R38A 4DBSA 4PR4A 4XAPA 2FZBA 2BGSA 1GVEA 2P5NA 4LAZA 3V36A 4GACA 1PZ1A 3C3UA 4LBRA 4QBXA 1A80A 3BUVA 3LD5A 3B3DA 4PRRA 2WZMA 3CV6A 2PEVA 3LQLA 3H7RA 4IJCA 4JQ2A 4Q7BA 4QXIA 3LEPA 1Q5MA 2WZTA 3ONCA 2I16A 3ERPA 4FA3A 2PDCA 4ASTA 4G5DA 4PUUA 3N2TA 1C9WA 2IKIA 4MHBA 2FZ8A 4LB4A 1S2AA 3R7MA 4EXAA 4JQ4A 4HMNA 2I17A 1HQTA 1X98A 3V0UA 4WDTA 5LIKX 3LZ5A 1PYFA 3WBXA 2PFHA 3UGRA 3V0SA 3WCZA 4XO6A 3KRBA 2HE5A 5HNTA 2IS7A 5JH2A 1LQAA 2PDUA 3R6IA 4JTQA 2PF8A 4WGHA 1XGDA 2BGQA 2VDGA 1X97A 2IKHA 3ONBA 3UFYA 1PWMA 2PDMA 1J96A 2FZ9A 1RY0A 2ACUA 1SM9A 4PRTA 4GCAA 5LIUX 3LN3A 4R9OA 2ACSA 3D3FA 5DANA 3CAQA 3DN5A 4JIRA 4YVPA 3EAUA 2PD9A 2HVOA 2CLPA 2FZDA 4JQ3A 1EL3A 1EKOA 5AZ0A 3M64A 2PDHA 4LB3A 4YVXA 2A79A 5JH1A 3NTYA 4IGSA 3COTA 1HW6A 3CMFA 3UP8A 2QXWA 3EB3A 5LIYX 1YE6A 1PWLA 4DBUA 4XZIA 3MC5A 1S1PA 1XJBA 5LIWX 3RX4A 2PDFA 1QWKA 3LENA 2IPJA 2PDBA 4L1XA 1UR3M 4HBKA 4FALA 3CASA 1ZSXA 3R43A 1ZGDA 5HA7A 1S1RA 2PDIA 4YS1A 4WDWA 3CV7A 1MI3A 1YNPA
chains in the Genus database with same CATH superfamily
1OFPA 2J27A 4YWSA 2Y1HA 2V82A 3EX6A 4Z0JA 4F9JA 4HQVA 4NZFA 5AFDA 1JDAA 3KOWA 5AHMA 3FKRA 4UR8A 1QFEA 2NVAA 1A5MC 2RJHA 2WWDA 3GR4A 3LXAA 5I07A 4XVEA 4LBUA 3N3TA 2VX5A 3FEMA 1UWQA 4HT3A 2QCMA 2VEMA 2VFHA 1GEQA 3VNJA 5C6MA 5DMYA 3SSZA 4S2CA 4QTGA 3PR2A 4OBTA 4KCWA 1YTEA 1WKFA 2QKFA 2FGBA 3GDLA 1K77A 4KWUA 3LCLA 5J5DA 1CB7B 4NSBA 2VZTA 4U10A 4B2DA 4L1WA 4JTLA 1GQIA 4TX8A 2TODA 4HMEA 1E0TA 4LAMA 1HL2A 3ZMRA 2OQHA 1I2PA 1CBGA 1Z8AA 4IP5A 3SRFA 3LBOA 3STEA 4OT7A 1XH2A 4Z2KA 2I7GA 4AISA 3UBPC 3TW9A 1XYAA 5LXXA 3VOHA 3D6NA 5F2MA 2X0YA 3L68A 2WVUA 1TJ0A 3MA8A 3TOPA 3EWWA 4KRTA 3UJEA 1UP3A 3RNDA 4X0NA 5G1YA 5FJOA 4JN7A 1IGWA 3RLGA 3EB2A 2OYKA 4DELA 4AXNA 2JKEA 3TW7A 3QMRA 3NQBA 3JR2A 5KEZA 1C8XA 3FJLA 3TQ0A 2DUZA 4MJZA 3QHMA 1HO1A 2ZA1A 1P5BA 3CUFA 2ZX9A 3RK8A 1EPXA 1I2NA 1GQJA 3OZOA 2QF8A 4Z1DA 1UKTA 4DXXA 4RDYA 1CXKA 4HHLA 3FN9A 1ML1A 1NIUA 3TSDA 3QLDA 3N4AA 1QOQA 4HNLA 5I3KA 4KFOA 1YYAA 2PDKA 3DDMA 2PCEA 3HPAA 3RXZA 3O6AA 3VZXA 3K4DA 1BXCA 4N02A 3T0BA 1AG1O 2Z2BA 5FEXA 2E1DA 3BE7A 4RX0A 2BOGX 3WD2A 4N9CA 5A8MA 4UQEA 3W7GA 1A0DA 1D3CA 3RX3A 3WF1A 4JQAA 2F2KA 3SRKA 2DZXA 2Z4GA 4ZQCA 3EEZA 1V77A 2VGFA 3UNTA 1BSIA 2C71A 4WKAA 1D7KA 5K4XA 2ZRWA 2VVNA 3WLNA 5AC8A 4HMDA 1ZPTA 2OSXA 3NVDA 2FJKA 2Q3OA 5BWFA 5C5YA 4GY7A 2H8ZA 3GFXA 3CZ8A 3ZLFA 4AF0B 5CLTA 1YNYA 1E6QM 5MHBA 3ITVA 3IGHX 3VINA 4UFLA 5K3VA 1W9PA 4LYPA 5BROA 3LZ3A 5GNXA 2JEPA 1UMLA 1XLKA 5H8MA 1I1WA 1CGVA 1YHTA 3FNDA 1W3LA 3L65A 2BDQA 4DF2A 1E72M 5LIXX 4BHYA 1YMYA 4Q7NA 1JULA 1AMYA 4ADUA 1MNSA 3LPFA 2WZHA 5JIWA 1LF1A 3EKLA 3EWCA 3B9NA 1WBHA 2CHRA 3T07A 4IUOA 4O14A 3STGA 1J2WA 4IZGA 1ONEA 4GNKB 2Y5JA 3UG4A 4DUOA 1N8FA 1JGMA 3GFZA 3SCRA 4J2PA 1EA9C 2YXOA 2RKXA 2OWXA 3AMDA 3ICJA 1ZB5A 1WDQA 3AHVA 1EIBA 3RF9A 4UFMA 1FDJA 5DMNA 1B3WA 2DZWA 4ZO9A 1UOZA 2BHYA 1YXYA 4FA3A 3CO4A 4S3AA 1LL6A 1PUDA 2GGJA 1YLVA 2VFDA 1EHAA 3ES7A 4J3VA 1E5NA 3KHJA 1WP6A 4JBRA 1Z7AA 2C13A 4KEVA 2XIMA 1S3TC 3BCFA 4GJ1A 2B4GA 3MUAA 3WQ8A 2PWGA 2QGHA 4G2DA 3VDGA 3MI2A 4CD4A 3LMZA 1TA3B 3WBXA 3W87A 4BF7A 2GFTA 5IOBA 2J7HA 1KKOA 2J25A 1UC4A 3TNBA 3UXKA 4CQ9A 3AHYA 3WLQA 1CGUA 1O12A 4C7GA 1ZBKA 4JIPA 4E8GA 4MOZA 4X63A 3WH9A 1FXPA 1XICA 1XISA 2WLYA 4IWWA 4K38A 2WSKA 3U57A 1W1TA 1OX5A 2FDMA 2JQXA 1E4LA 2Z26A 3S6DA 4FNPA 4UTWC 4DPPA 2W3ZA 1XLCA 2Y7DA 1MXSA 4UR9A 1OEPA 3I4EA 4IISA 2V0TA 3W75A 4GRSA 4DQWA 1Z6KA 5ABFA 4MADA 1A5UA 3AXMA 1GZ1A 2XGZA 1O1HA 1O5QA 3FY1A 5AC4A 4M3PA 3R10A 1V6TA 3LCGA 3IGSA 1ODZA 2DQXA 1XLLA 4QAIA 3AALA 2CLKA 4J3WA 4O0ZA 1TPUA 3KRUA 1YPFA 3WIJA 3CIWA 3V75A 3VDAA 2A3EA 3BCDA 2YXXA 1UR4A 2PDBA 4R7OA 4GZ7A 3S4TA 4GI9A 3URNA 1F3EA 4AQLA 1J2BA 1MQQA 1FVPA 3HFTA 1N8IA 2ZXAA 3BAKA 2PDIA 3BV4A 3U3HA 4U4MA 3WK2A 3O6YX 3W07A 1CGXA 5LNRA 1GOOA 2PDNA 2A4AA 4YNGA 3HGRA 2V63A 3RGTA 3M5VA 1XS2A 1XWYA 4LTSA 3L66A 4F40A 4DWSC 1MW0A 2ZUUA 3JW7A 5F4WA 4K7YA 3R0UA 3POCA 1R7AA 2QIIA 2YGYA 2G3JA 3S46A 4OV9A 3GTNA 3UWEA 3Q58A 3UR5A 5AHNA 4JCLA 3LHTA 5CH9A 1KTBA 1JCXA 3QRHA 3S5SA 5DMMA 4C1NA 2DW7A 1G0CA 3S6TA 5HATA 1R5YA 1M9HA 2VZOA 1XSIA 1I60A 4AUBA 1DYSA 4S3GA 4LNYA 3VO0A 4NASA 2QDEA 2ZADA 2DSKA 1TQXA 1AH3A 2A2IA 1EYEA 3EOOA 4O53A 1QK0A 2Y5EA 2HV5A 4DZHA 4GNJA 4ZB2A 4ECLA 1G4EA 3DHUA 4IL2A 3GW3A 3NOEA 1TVPA 2VRQA 1T99A 2FTWA 3M0YA 3NO5A 3HMJG 3NEVA 5I23A 4EIVA 3MUY1 2PDXA 3ECQA 1W0MA 2ZIDA 1UB3A 3OQEA 1EJ7L 1DKWA 4GXMA 4HCHA 5ABHA 2PU1A 1CENA 3N17A 7ENLA 5AHEA 1GJUA 2TPSA 2VR4A 2BVDA 3KWSA 5DN1A 1PS9A 4TU1A 3UCQA 1UR0A 2DSZA 4J3TA 5EPDA 1X38A 2FB3A 3RG6A 3ABRA 4O18A 4KFNA 3R4IA 2PGRA 4GQQA 1RBAA 2YIHA 4W7UA 3A9IA 2ODOA 2PDLA 1ZAHA 1LWIA 4PUDA 1S2CA 4JTFA 2QIWA 4N0RA 5J5RA 4N6FA 3MB9A 5I3JA 3NFUA 4D8LA 2Z1SA 1J0IA 2BODX 1GOWA 2GVGA 2GUYA 2Q02A 2EPHA 4UOZA 2E67A 2XJ7A 4RNFA 3VKBA 5BW6A 1AQ0A 4CNNA 2QDDA 1VFOA 1VQTA 1M7PA 3WL0A 5E09A 1CB2A 1WDRA 4RXFA 4RNIA 4QNEA 4P61A 4W84A 1E4MM 4Q3MA 3PG9A 3MUCA 4XVDA 3S9IA 3EX4A 1CLVA 1DIDA 4H6EA 1VLWA 1JGIA 4FNSA 3ZT5A 2OQYA 2E7FA 2I56A 4NAEA 3E2SA 3NYZA 5HQEA 1UCWA 2XIIA 5D2YA 2AOSA 2FIQA 2VL4A 1GUVA 3DH7A 4LS2A 5A5WA 4B5NA 4HU4A 5F7UA 4O19A 5BRPA 3PJUA 4LF1A 2BTMA 4RL3A 5D2TA 1D3HA 4IGMA 4D6IA 4KWWA 1Y5WA 3APYA 1KV8A 1TA3A 1XPGA 2QV4A 3A24A 4GX8A 1UP2A 4FHAA 4UFIA 3GVQA 8RUCA 3C3NA 1SU5A 3NR0A 4Y9MA 5D2WA 5EB8A 3C0QA 3C2EA 3MO4A 4QNWA 5CPQA 4H6RA 2RDWA 2Y6ZA 1RQHA 3B4YA 4DYKA 3W2UA 1L6YA 3G8EA 2PRLA 3MY9A 4I6KA 3VNIA 4I9TA 4ZSTA 3GNNA 1GONA 3YPIA 3QY7A 2VHLA 4YIWA 1IT0A 2DDXA 4LAOA 5A6KA 4FNQA 3PANA 4X9SA 4ACZA 4DPQA 3UCCA 1JQVA 1NOFA 3SIZA 3NQAA 3VE7A 3K1DA 4B90A 4Y9AA 1JPHA 4MWAA 1V3MA 3W84A 3L4TA 1GZJA 2Y62A 2ZZ5A 5JIPA 4PH6A 1V03A 3RPTA 3CHVA 1RCXB 3KL0A 4QJ5B 3DG6A 1TPVA 2TYSA 3OJGA 1ZS2A 1QAPA 3WLSA 2G5WA 2QUNA 4AD5A 3AMLA 1TPB1 2PDUA 3U2ZA 1JCTA 1RHCA 4JPGA 4E3TA 2O7QA 4AWEA 4MNLA 3WQEA 1RBOB 2IXUA 5L6UA 3NXLA 4URIA 3M41A 3MDWA 4GXPA 3CL8A 3NURA 3W53A 2CHNA 5IFTA 1Q7ZA 9CGTA 3N18A 1H7OA 4BWLC 2QMKA 5T91A 3LMYA 4LCRA 3L4WA 4UTFA 3RPDA 4E8DA 3S8HA 3M5XA 3CHFA 2RHGA 4Y8FA 3RM4A 1E4IA 5HMEA 1REQA 2GUBA 3CB8A 1PKNA 5CPTA 1YE6A 3BLKA 2O9RA 4LYQA 4S3KA 5EKYA 3MC5A 1J6OA 2QV5A 1W5NA 5EYWA 2D22A 3EMQA 3E9AA 1HKIA 5BXSA 3W1MA 4ROPA 3F2DA 4TR9A 2VWSA 4QLKA 3R43A 4LH8A 4HKPA 5CLWA 1Z32X 1W1IE 4LPCA 4DY1A 2EG7A 2BASA 1A49A 2YDRA 3P84A 4LUTA 3VM5A 4DBWA 3OLGA 3LI1A 4R34A 3B06A 4QEHA 2O4MA 3EWBX 1KA9F 5EMUA 4B5SA 3UZJA 4H1ZA 3L21A 1KXHA 3QFWA 4HB7A 4MY8A 2BP1A 4RE2A 1G4TA 4HU8A 1FWNA 1NDWA 4LEQA 4LOCA 4NL1A 3E0VA 4M51A 2JFEX 1AW2A 2YA2A 2PSNA 1ZJHA 3AWOA 2CLFA 4M0XA 5A6SA 4UOQA 3WH8A 1JPKA 2QJNA 5LNVA 3V0TA 4FR6A 1FY6A 3G1XA 5K9CA 1JRCA 5CKSA 4Q7IA 1DWIM 4QX4A 2VZVA 2OLHA 4LYKA 2YJQA 5TIMA 4A3UA 3WZ0E 3VKDA 3PC0A 4XD3A 3SCPA 3S1XA 3UR7A 1B2YA 3VILA 5A3HA 4L5ZA 4ICCX 2B0MA 1W9VA 1VPXA 2HDJA 4PMYA 3MMDA 4JD4A 2Z0IA 3TEVA 5M1TA 4A4AA 5CC5A 1FA2A 1K8YA 1T8QA 1TWZA 3XINA 3VM7A 4CU7A 2PBGA 1XX1A 3IV3A 2G37A 1BVNP 5D09A 1PKYA 4XBSA 3KOZA 4YVVA 1LQ2A 5A6LA 2CLHA 4FX6M 2DVUA 1N8WA 1ZP4A 1CPUA 4OOUA 1ZP3A 2DQWA 1VFSA 1XBYA 4KRZA 2OSWA 2QT3A 5CZTA 1Q6EA 3PULA 3ZVHB 1PKMA 1H4PA 4TV5A 3LU2A 2X0SA 4YJ5A 5LKYA 4NG3A 1GOXA 4RPQA 3WH6A 3BW2A 3I7RA 5D38A 1QO2A 1Q66A 4QCFA 3SRHA 2YA0A 4ATWA 1NDYA 4X9YA 1BYAA 3W02A 3H70A 3G18A 3KDNA 3AS1A 1BF6A 4IPIA 1AD1A 4NRSA 2VRKA 4G56A 4GKLA 3RITA 3CL7A 4EXBA 2V69A 1FWAC 1FRBA 1BF2A 3FAWA 3W26A 3GDTA 5HOSA 3WLJA 3R8HA 3RILA 3M5YA 3ARYA 3WLIA 4JEJA 4LAUA 4RZ4A 3QR3A 4OVXA 3DU0A 1VBJA 3APTA 4H8HA 4L9XA 5E6ZA 3QKZA 1MQPA 3KFTA 2FJUB 4EANA 2GZXA 1V02E 2GOUA 3W83A 4AMCA 2PF0A 2P50A 3ARXA 2NXIA 3HA1A 4EE9A 3F7JA 4GH1A 3GC2A 3GDKA 3GC5A 4RV3A 4I7WA 2BVYA 2I1OA 5CBJA 1KRMA 2B31A 4PMOA 2Z29A 4IPJA 2XN0A 3P5YA 2G0WA 3ZJ8A 4XK2A 3WQFA 4PL1A 3AQUA 1KFCA 4NX5A 4AEEA 3ZLGA 4YN5A 3EX1A 1UUOA 2WW5A 3PBUA 3O07A 5LNUA 3WNNA 5MKGB 1PTGA 5AC7A 3F5LA 2PZNA 3FVDA 4MZYA 3VGHA 3VIFA 3TN5A 4BCEA 2YR1A 4E6MA 3VKKA 3AJXA 4CGTA 1TX2A 4CVUA 2BHZA 2C79A 1P48A 5JQ9A 3NQ6A 1CXFA 1XLMA 3UYCA 5AC5A 1W5MA 3BOXA 3BW3A 4RZ6A 5A1AA 2QYGA 3N3MA 2XH7A 4QM1A 3CUIA 1OYCA 4H9VA 1Q7MA 3WELA 2F6UA 2ZVRA 4E3VA 5JBEA 5EMKA 1JI2A 4NZJA 3DFQA 2UY4A 3PZMA 4JR5A 1MEWA 2I9EA 2OU4A 1LRNA 3STCA 3STFA 4M19A 4LUSB 4QQUA 4DBDA 4A22A 4ZXOA 4O28A 1B90A 4KESA 4JTGA 2ZZ3A 4ICMA 3WQOA 4PUUA 3T2QA 1DIKA 4PCFA 2P8CA 4DN1A 4LU0A 1E3ZA 2A6LA 1BQCA 4G9PA 4FO4A 2YLAA 3VIIA 4ML9A 1PDZA 1WZAA 2WO5A 3UA4A 2OWWA 1Y8BA 1IWPA 3DZ1A 5DCDA 5AOUA 5I3HA 3W7OA 1VPYA 3PZIA 3KEHA 4XKYA 3QBUA 4MYXA 4A3HA 1WDDA 4Y9NA 1EJVC 2OEMA 3M44A 2B7NA 1D2KA 2D2HA 3K4AA 4FR1A 1GPWA 1VHCA 3PPFA 4YWIA 3GH5A 4Q8PA 3MJMA 1H61A 2NUYA 4DM1A 1OCNA 5AY7A 1X6NA 4O50A 5C0QA 4IFKB 1ICSA 2NLYA 4IX2A 1IIHA 1W8SA 2A3LA 3NPWA 2XM2A 2OLSA 1EWDA 4O12A 2DZSA 3FYPA 1V3JA 4K8GA 1QJWA 3F03K 4PTNA 3MJYA 1XLIA 3FGCA 3B9DA 4V15A 4C6CA 3WKZA 1TJPA 3NM3A 1Q8JA 2O4QA 4OZOA 1QHPA 3HPFA 2D73A 3SGGA 2WC7A 3WQVA 2ZFAA 2ZRUA 3G1SA 4G6CA 4NZ4A 5ABEA 4Q4QA 3H26A 2R14A 2BFGA 2E4TA 3MUZ1 3R12A 4UNLA 4EWJA 1PO9A 4IUGA 4FALA 5DX7A 1SZFA 2ZC1A 1XQKA 2R94A 4LCSA 4TVCA 2CLOA 1OYBA 2F8QA 5ABFB 3DFPA 4W85A 4U31A 2V2DA 1T7LA 3V16A 5HWMA 5AB3A 2MNRA 2DFAA 1MSSA 1MNZA 4NJJA 4JNZA 3ZIZA 4D6CA 4IQDA 4BQ5A 4E8CA 1NARA 1THFD 1A3HA 3IK4A 1XIGA 1VC4A 2H9AA 4HA0A 1DE6A 2AQWA 4XZMX 3HURA 4ZMGA 1F5ZA 2OO0A 2ZX8A 1EOKA 1MW2A 2Z7GA 3WQGA 3PAJA 2FHFA 4KIRA 1Q4WA 4IGNA 1OFQA 2XWEA 1T41A 5D9PA 1VIZA 3TA9A 3ZOAA 4L1GA 2FVMA 4WEVX 1TMHA 3HPSA 4MWAE 4D72A 1J5SA 2AL2A 5H2ZA 1KGXA 1QUMA 3KTSA 4LYRA 1GVFA 3C56A 4PODA 1E40A 1RCOB 1S38A 1MXDA 1GHRA 3WUEA 4MFDA 3DKLA 1K9FA 1WOAA 3KP0A 2O92A 4LUYA 2AKZA 3W7NA 5I00A 4MB1A 4W4QA 3O3RA 1V6XA 3BAYA 4RKAA 5DY3A 4C90A 1J6PA 2J79A 2WMIA 4RW5A 3AUJA 3WLKX 4K2SA 1SFLA 2AL1A 3WLLA 6ENLA 4FOUA 1GTHA 3UY7A 4HA3A 3TROA 1KTNA 3BG5A 4KWSA 1A4LA 3M7WA 1MDLA 1GCYA 4KEMA 3UZ5A 1UPPA 1QPKA 1LROA 1J8VA 1AFSA 4FAMA 2EXOA 3N14A 4D6FA 4V1YA 4JKMA 1QO5A 4MB4A 2J24A 2Y8KA 5T9BG 2C1GA 4FX8A 1AA1B 1UR1A 1EGMA 3DAQA 4GYFA 1J18A 2QVNA 1C8QA 1ZL1A 1A5KC 1DWJM 3KVJA 1G7UA 3QH2A 1E73M 4JTRA 4KETA 4M7TA 4PUNA 2NQHA 2WJZA 4FP1A 5FL0A 3PPGA 4WKHA 1JQXA 4Y9PA 1U2YA 2D23A 2YFNA 4I9JA 3OU8A 1M68A 1KBBA 1AODA 2IUZA 3EOSA 3GNRA 2NX3A 3I3EA 2Y89A 3KLLA 3IJ9A 4J3ZA 3QN3A 3RLVA 1XRFA 3SCUA 4D6DA 6ALDA 3I6RA 1IXOA 4OBSA 1UQYA 1SZNA 1KM4A 4LSBA 4G7EA 2P8BA 2D69A 4H7ZA 3KTXA 4AWTA 3I4KA 4JTSA 1EF2A 1NDVA 1MRQA 1QPRA 1KFLA 4UMAA 4LUJA 2DZVA 4YLWA 2I14A 4E4UA 3OW1A 4DF0A 1OX6A 4D9PA 1IR2A 2CBJA 2VUNA 3DCPA 3TU9A 4GIYA 2W67A 2G4JA 3REQB 3W29A 4HTBA 4DZIA 1K02A 1QI0A 4JTAA 4C6LA 2E8YA 4RZ5A 1FH8A 2GUUA 4LX4A 3IVTA 3OYXA 1Z69A 4AZ6A 4N9DA 4M24A 1VD6A 1XIBA 1S2WA 4UFJA 1E1FA 4OGZA 4MMWA 3STPA 4LV9A 1M7OA 3A23A 2PI6A 1AMKA 1GYLA 2UZ9A 1U1HA 3JS3A 2CBIA 4PRRA 4FF5A 3VIMA 1MYRA 4CN6A 3CV6A 4OBRA 4BQ3A 4B92A 2NLIA 3H7RA 4F48A 3N6HA 3O06A 4I7VA 2NQZA 3EDFA 1XSKA 3K30A 5H6HA 4YXGA 1GZGA 3PSVA 1UR2A 3DFHA 1F61A 4Q22A 1ZCCA 3T2PA 4UXDA 3PFRA 1SW7A 4C6BA 4HTYA 3W1UA 1DV7A 3BTNA 1R8LA 3IRDA 4JN6A 4FNUA 4BEQA 4UQ9A 2PGEA 2QS8A 4ALDA 3VIPA 4Z1CA 1XFBA 5G5IA 3KL5A 3NQ8A 4WIWA 3T7VA 1X98A 1LWJA 4ZTXA 9XIAA 3CPGA 3E0WA 1JIBA 3BZGA 1JR1A 4UTJA 1R3YA 1A3WA 3V0SA 1TKKA 3WCZA 3P61A 5I02A 1IE7C 1L8PA 4O52A 3L4ZA 2ZA2A 4F0RA 2PF8A 5IDZA 4AZCB 2RDXA 3L5AA 1VCFA 4C7DA 5M17A 3CQ0A 3DXIA 4AWSA 4U3CA 3VVGA 1KQYA 3TOYA 4F2UA 2E1WA 2X05A 2ACUA 1MQRA 3LN3A 4H9UA 3LHWA 3U0HA 3A9BA 3CHEA 3TC7A 3S5OA 3XISA 4YYFA 5FOOA 3MCMA 2HVOA 2CLPA 4GKTA 5A8OA 2FZDA 1EL3A 1C3FA 2PTZA 3QFEA 3M64A 3HO8A 4FNRA 1Q7QA 3QTPA 1NU5A 3KUMA 1GKPA 3IV8A 4I9MA 1VEOA 4DBUA 4XZIA 1UJPA 4AIBA 2ZDSA 1DWHM 3QQ0A 2CIPA 3GIYA 3N6JA 1ZBCA 4XV0A 3NPXA 3BLEA 3MVTA 1UR3M 1P0EA 2ZVIA 3MWAA 2JBMA 3GAYA 4WDWA 3CV7A 5B7YA 4Q32A 2KAUC 2PZ0A 1MI3A 2HSAA 3SUVA 3Q4DA 2ABAA 1WZKA 4IICA 3IJIA 2VR5A 4BZYA 5KZEA 4GABA 3P0XA 3NVTA 4U5KA 5G4HC 1EX1A 1UD6A 2QGYA 2YCLA 4WR3A 3N15A 3UYIA 3GHTA 2J75A 2VEFA 3BLIA 4XD6A 2GK1B 1HGWA 4HU3A 3EWYA 5ECVA 4KEZA 4BF9A 1QNQA 3C0SA 1KNWA 2PU0A 4UOJA 3VK5A 2E09A 2PURA 5HR6A 1CLXA 3UQNA 4LW7A 4IIHA 1PTDA 5D8ZA 1OFOA 2Y7FA 1TFVA 2WOQA 2GJLA 2H90A 4UZSA 4F79A 3IK2A 5CJNA 3DYOA 5JXQA 4PMZA 1PX8A 2ALDA 2FPYA 1V0NA 3DESA 4XAZA 1QVBA 2ATSA 1B30A 3H54A 4J28A 2VEGA 1H7WA 2PTYA 2DZUA 4S3EA 4IQLA 2WCSA 2QJMA 3DGBA 3GXIA 6PTDA 3AROA 1V6WA 4IQEA 4RZBA 1JCMP 3DHFA 4S1FA 2ESCA 1GJWA 2YW3A 3G6LA 3T8LA 3SW6A 3O05A 3VOIA 5E6YA 3TXVA 3GNOA 2F38A 4A35A 2ACRA 3WBYA 3L2IA 1RSCA 2YPIA 1QNPA 3TSMA 3M0LA 3QPZA 4WKFA 2OYLA 1OG6A 2QUTA 4MPQA 4S3DA 1J0ZA 1W1VA 2PPGA 3NZGA 4R9XA 2NSOA 5HMFA 3EXRA 3W73A 4QEEA 5TNVA 4BI5A 1A5NC 1YDNA 3KOYA 4IQJA 1BSLA 4HNTA 3VKJA 4HNNA 3U9IA 1QOXA 3BAXA 4A3QA 3RO8A 1K4HA 1WYIA 1L2UA 1EJTC 1UD5A 4PZVA 1XLFA 2BOFX 1US3A 3CQIA 2MANA 1V6UA 4C1NB 3EX3A 1R30A 3U4AA 2V2HA 2ZDRA 3THCA 1CXEA 3VNYA 2PDPA 1GVQA 3ANVA 3GG7A 2NZLA 3EXTA 3B8TA 4P8WA 2ICSA 4E0CA 2QJHA 3BCJA 4JFVA 1OFEA 1UIOA 1XM3A 3HJEA 2C91A 4FXSA 2W62A 2J6XA 4K7VA 3M43A 2POTA 1Q13A 2FB2A 3SN4A 4UMCA 1PX3A 2INEA 4RUBA 4IIDA 1PBGA 3ZLHA 1E9IA 2PE4A 3IARA 4PSPA 3AIUA 3W86A 3ATZA 4MAVA 4RNHA 3SQLA 3AFBA 4FSAA 3GM8A 3MHFA 3NZQA 2WK2A 3T44A 3WD3A 3ZT7A 3VIOA 1UD3A 5C2CA 3M4HA 3FW6A 1KW1A 4A3YA 1AQFA 3WYZA 3URBA 4R3UA 3VOJA 4OIFA 4GH3A 2GJXA 3SADA 4NJGA 4HSNA 1RJQA 2PRHA 4XAPA 3ZSTA 5KTLA 1I2OA 3BQ5A 3W2NA 4GACA 3N12A 2YCIX 4D71A 4GJIA 5AKQA 1EX5A 3L4YA 3MP5A 2PWDA 5BU6A 1UWAA 1YIXA 5C55A 3WQ6A 2J6VA 4GBDA 3ZVHA 1GYNA 3ARSA 4NI8A 3S9YA 2Q01A 1JL8A 3H4XA 5FF0A 4GC3A 5CSUA 4OJYA 1ZJIA 3ERPA 1KWGA 3KBMA 3TFCA 1B54A 3CXOA 4Q4OA 4AZ5A 4F4RA 1XRVA 5DQPA 4XQ6A 3WLTA 4MB3A 3E2RA 3TLLA 4CD8A 4LVGA 1NSJA 1JDCA 4JQ4A 3RCNA 1ONRA 2AL2B 2CLIA 3GLCA 4L4LA 1FHVA 4C6NA 3W7KA 1F3TA 4I7UA 1W9XA 5LIKX 4ZQOA 3M16A 1V3KA 4AX6A 4QSHA 2WSQA 4DZAA 3ID7A 3NNTA 5DCBA 3TZNA 4U5IA 4XKMA 5DT5A 3KCOA 5A8PA 3GDMA 1Y0EA 4UQAA 1CECA 3L0NA 2D24A 1XLGA 3IACA 3GYCA 1M6JA 1J96A 3GU1A 3USBA 1K7FA 2BHUA 2GWNA 2POZA 3ARTA 3G1HA 1EXPA 5HDRA 2FZ9A 1H7XA 3M1ZA 1UKQA 1RY0A 4PRTA 4GCAA 2E9MA 1HJWA 5DANA 1X8CA 1Y5VA 4W7WA 3VMOA 4AVFA 1XLEA 3DN5A 1FKWA 4OFCA 3A5VA 4OHQA 3NZRA 3PZVA 3CEPA 2FFCA 2PD9A 1W1ZA 2VCBA 3RCMA 2DZPA 3GNPA 2BY0A 3DFTA 1EKOA 5A95A 2WVVB 4FLRA 2OEKA 1C7SA 3UJRA 5A6MA 4REQA 2V6AA 2YL9A 1U1JA 2ISWA 4YTSA 3U8GA 1QNVA 3B8UA 2RDUA 3HGSA 5FJPA 1ZY9A 3WK3A 3GS6A 3WMBA 3L7RA 4FF7A 5I3GA 3BANA 1HGYA 3SN0A 4HBKA 3OG3A 3IUIA 2QJJA 1FXQA 3VIKA 3NDYA 2A0NA 4BKNA 3ZWTA 4BEUA 4YS1A 4MJ2A 3EPNA 5EFDA 4QRNA 2XWDA 1RP9A 2Z1BA 2QCCA 1ZJAA 3HF3A 3GAKA 2P3ZA 2GDQA 3TQPA 1XIDA 3MKVA 2XISA 1AH0A 3Q37A 1S5TA 3LPOA 3LV5A 3RLHA 4QQ3A 1F9CA 1GOQA 2E6AA 1UUQA 2PWFA 2GVYA 2J66A 3T05A 2OMAA 5D05A 3S2LA 1XINA 4ZO8A 3OB8A 3WQ5A 3UG3A 1BWKA 2ZWZA 4CQBA 3FHQA 3NGFA 1KBLA 1WBJA 1XYCA 2F6KA 1BHGA 2VUYA 1E0XA 2Z27A 1KCZA 2QCNA 1UH3A 2XIOA 2XSBA 4QJ1A 1H11A 3TTSA 6A3HA 3NYDA 2O56A 1QW9A 4MPKA 4B16A 3AIWA 1MW1A 4B3KA 1WUFA 1X1NA 1TCMA 1OC6A 1ZNNA 4ERGA 4WQ6A 2YW4A 3ALFA 5KETA 1TELA 1R3RA 1ZTVA 4FLOA 3KBNA 4XZWA 2YCEA 4QDMA 2VD9A 5T26A 1UC5A 4MDOA 4LY4A 1DJQA 4ADSA 3MP4A 3NZPA 2GPTA 3NIYA 1IHIA 2GVLA 4MY9A 3WEZA 3QKEA 4MZ1A 4OOZA 3PJTA 5BMWA 1K1DA 4ZODA 4P7NA 5D4YA 3E49A 5F4SA 1H49A 3OG2A 1XRSA 1IIGA 1JZ6A 2ZC8A 4L7ZA 3VIJA 3UG8A 1XIFA 2PDWA 3VD3A 4MWAB 2FGLA 5E5CA 2VOMA 4OUIA 3EOUA 2GGIA 3W4RA 4WOQA 3LTPA 5A8NA 1KFEA 4ACYA 4DM2A 7ODCA 4U3AA 2NX9A 4ZL1A 2QULA 4UTUA 3VMPA 1IEXA 1VCVA 1NVMA 3KVMA 1E71M 4JIEA 3ZT6A 4O8RA 4NJKA 1JJKA 4HOWA 1Q6OA 3C2YA 1BG4A 2IQDA 1GVSA 2IPWA 2HNHA 4EWND 3B05A 3CU2A 3P6LA 3VIHA 2G3IA 1KTCA 2ZUWA 1I45A 3LCFA 3O2LA 3O1NA 1HIZA 4TX9A 2YX0A 1VFTA 2W6RA 3N1AA 1OT2A 3VU2A 3IEBA 1MWOA 2PCQA 2JK2A 5DFAA 4XAYA 3QC3A 3B8VA 4PMQA 5AC6A 3BLPX 1IGSA 2VGGA 4M1BA 2X2YA 5BWAA 3J7HA 3SCSA 4PE8A 3TTQA 4OTKA 1EXBA 5C8BB 3CZJA 4FXFA 4FNTA 4DXVA 2X1UA 4KT2A 4AYGA 1E6ZA 3HPXA 2DH2A 5C2XA 5CAKA 2XH2A 3GDRA 1SO3A 1FH9A 4JAWA 4AAJA 4C5ZA 2XH4A 3F5KA 3NSMA 2PWEA 1DEDA 1V5XA 2QVHA 3PZOA 4MWAC 1V02A 4PUKA 3NDZA 1ZUAX 4QJ4B 1UYQA 4EK7A 1WV2A 3GTIA 3N2XA 2VGBA 2VURA 3IPWA 4LBRA 4GXWA 1E9YB 2EQDA 4U28A 4Q4KA 4NRRA 3CMGA 2QDHA 1TPEA 3T2OA 2VZSA 4UTHA 1ZENA 5T8GA 3UXDA 3M47A 2C1IA 4INFA 1LOLA 3QVQA 4L6DA 4GZJA 1O5KA 5I03A 4HZ8A 3KZPA 3ABSA 3E6EA 1EDTA 2I16A 3ABZA 1BYBA 1I8JA 4O0QA 3EA1A 4O10A 3B8IA 1WO2A 2DT2A 3UXIA 4ASTA 2QJGA 1EO7A 4GLEA 4NI3A 5DRIA 6REQA 3MP3A 3SFWA 2XDFA 3TN4A 2VI0A 3IIPA 2NSXA 2JF7A 2Q6ZA 3DBNA 3L0GA 3LXBA 2CERA 5GNYA 4AU0A 3BQ6A 1HQTA 3G0UA 1F6KA 3H12A 3UPBA 3AUOA 2PTXA 4CCZA 2WQPA 2NV9A 4Q8OA 5FJRA 2DJXA 3H55A 3P14A 3II1A 3DUGA 3UGRA 3RMJA 3UWQA 2PP1A 4JYDA 1DBTA 1LQAA 1LM1A 3KHDA 3U7BA 5CEWA 3UU0A 4ZB5A 1OFDA 1P6WA 3W72A 3KE0A 3OBEA 3CTTA 5BXPA 3BPWA 5CAHA 1H62A 3O63A 1E1EA 1R86A 1O94A 3CJPA 5IBXA 1NOWA 2NXGA 4R9OA 3FYOA 4FIQA 1OX4B 1JCJA 1HJVA 3S42A 1S2UA 3HU7A 4Q8UA 2OR2A 3LHUA 5AZ0A 1CIUA 3WUGA 2IMRA 3U5YA 4LUSA 1NWUA 4O1DA 1A5OC 4GD0A 2BY2A 4GISA 4JHMA 4L4PA 2ZUTA 2VEPA 5FJTA 1DP0A 1GGOA 1XJBA 3CUXA 3PUEA 2PDFA 2C0AA 2YSWA 3GIQA 4ZXLA 1A50A 2CKRA 5HBFA 3GDBA 3O6DA 4ZQMA 2CLLA 2RGLA 4UWMA 4QG6A 3LS9A 4WJ8A 4Z2JA 5CGQA 1XQLA 2YBUA 3W25A 3WDJA 2EPKX 3IANA 4IPLA 5GQBA 4PUWA 3U48A 3ITLA 2BNJA 4E2VA 2FVLA 1LRQA 4M80A 3GXDA 1ITQA 3R5EA 1NJJA 1IWAA 2WBGA 4WJXA 4CNOA 3GZ3A 3PBVA 1PIGA 1S3HA 3B0XA 4TMCA 3L23A 1Q6FA 1CYGA 1ADSA 3T78A 3AZRA 3LCXA 1OX4A 3A3HA 2VC6A 1HZYA 3E38A 3PM6A 1TZZA 3W3OA 1M7XA 3P7YA 1UHVA 4EPBC 4PRWA 4NXKA 1OCBA 4CNSA 4B2DD 1CXIA 4Q4MA 4JTJA 3IVUA 4AXKA 4AC1X 5C9XA 3ARRA 5FAGA 4NXSA 1WZMA 2BWGA 2OTDA 1IXNA 4A8NA 6XIAA 3WD4A 1Q63A 4KCTA 3L2LA 4RV8A 1RK6A 3EGJA 4HVXA 2W27A 3HQPA 1LLZA 1FCQA 1WZLA 2Y0FA 3MV11 1DORA 1OWQA 1HJSA 1NH6A 3NZ1A 3LRMA 4GHRA 5EMYA 1YX1A 2YKKA 2J62A 4GQBA 5F2GA 3OA3A 3SR7A 2IPGA 1UA7A 4HHPA 3AS2A 3CLWA 2A7NA 1QHOA 3FVMA 3EDDA 2CITA 4KS0A 4P7LA 1O5RA 2WV8A 3LSBA 5FIPA 1HX0A 1EZWA 1SMDA 2YYUA 3DBPA 1D9EA 4KFPA 2PDJA 4GGHA 3GVRA 3K8LA 2HNEA 3THUA 3T0TA 5XINA 4GBUA 1JEZA 1FH7A 1UQZA 1P6BA 2D2JA 4V33A 1LOSA 4FB7A 5I6SA 2QCLA 5CQ1A 5HAOA 4MYAA 3LPGA 5HPOA 1JNEA 1W8GA 4IGHA 2V2CA 4HYWA 1QOPA 3GKFA 3KCLA 3QTGA 1JZ8A 3PSWA 1HF6A 1AUSL 2ZX5A 3VGBA 1KM5A 3W28A 2HXUA 1VIWA 2H9AB 4GO9A 1YE4A 4AZGA 5AYZA 3FV9A 4W5ZA 2ON3A 1ZFJA 4H7CA 2E8ZA 4GMEA 1DOSA 3P93A 3WF2A 3AOFA 4AHOA 5F2LA 1BD0A 1XBZA 1RP8A 1QI5A 4W8AA 3B4UA 2VQTA 4WY0A 3BC9A 3VE9A 3AXHA 4IMAA 3C2RA 2UWFA 3VIGA 1G6CA 4AIUA 1K4GA 1IEIA 3QJAA 3PG8A 3VX0A 1I2RA 2TRSA 1JVNA 2V3FA 1R0MA 1JI1A 3MSRA 1QT1A 1FFRA 4Z2HA 5I7GA 4C6JA 1UZ4A 1NFGA 1UWRA 4WDUA 3W37A 5ABTA 1FWIC 2WJDA 5G2IA 5HPCA 1LP6A 2DSVA 3AO0A 3EDKA 1XYMA 4PR4A 1H60A 1P43A 3OGVA 1KV5A 4UQDA 5A6TC 2QPXA 3C2OA 1W3NA 4M8UA 3LD5A 4JTTA 4PCPA 3WNLA 1B4EA 2C3ZA 5G4WA 4J3UA 5FL1A 2QHAA 5C9RA 3TUUA 2I57A 2OELA 3RUBL 3N13A 4BK9A 2ZA3A 4EOUA 1FTXA 5AHLA 1B3XA 1EGZA 2GWGA 3WK0A 3MMWA 4GY1A 3UWYA 1DJYA 3LOTA 1YPIA 1XIJA 3BARA 3KL3A 1TTIA 4RDVA 3MDUA 1PCWA 4I8DA 5HUOA 5KMYA 3DGRA 4BA0A 3BJTA 1FWSA 1E1CB 1QPNA 3WDIA 1ISYA 3SBFA 4HJWA 4A05A 4HPXA 1DXFA 2FZ8A 4X61A 2O0TA 2GOKA 3KM8A 5K2ZA 4GI8A 4S3FA 5FKYA 5DRCA 1DQWA 2V5BA 2WVTA 4AHPA 4QG8A 2W79A 4KRUA 4WXZA 1FWTA 1IZCA 3G0XA 2QEZA 3SN1A 1R7OA 1XC6A 4IFOA 3N34A 3QY6A 2X2GA 4RR4A 2J4GA 4GYKA 3PZUA 5BU9A 4PCSA 4PSRA 4XD4A 1SFSA 1D3GA 1EJWC 2GL5A 1RQEA 2WC4A 1E4NA 4L4OA 2DT0A 1TMQA 4M5PA 5IHSA 3QXBA 4C1LA 2CWNA 1FCUA 3W88A 3LM7A 4HJFA 3WBAA 2FZMA 3GVWA 4L65A 3RR4A 3PS7A 1DTNA 3FYYA 3GKAA 3BLOA 4MLJA 3GWQA 1SM9A 2F2HA 4EXQA 4GCXA 3H2OA 1UG6A 5CJ5A 2DGAA 4JIRA 4YVPA 1YW1A 5CBIA 4K1WA 4E4FA 3T08A 4Q4SA 4UTKA 2WANA 4GI4A 3A3WA 2GK1A 3A5FA 2R91A 4Z0SA 1E3XA 5C54A 4W86A 3WMLA 5MKGA 4RXGA 1TR9A 4CD5A 4IMCA 3AZTA 2W63A 3TWAA 3ISIX 5I5RA 4D8ZA 3MUXA 5CC6A 3MWCA 3O8AA 4DBEA 4JTUA 5FJJA 1BGGA 3AMGA 3TYCA 2Y24A 1HP5A 2C18A 2DP3A 4GC4A 4ORIA 5JVLA 1KXVA 3S2JA 1LWHA 1GVRA 3KCJA 1DJXA 3C6CA 1W9DM 3S1GA 1B9ZA 1PZ3A 5CG0A 2YDSA 3Q65A 4E2OA 4H9ZA 3DC8A 1T8XA 3IIVA 4QISA 2Y2WA 1KWKA 2PP0A 5T9CE 5AN7A 3N19B 3OTRA 4JICA 4B5WA 4DI8A 2QR6A 3UPWA 3IGUA 3SUSA 3GHSA 2WVVA 1QNRA 3DEQA 3DENA 4BY3A 4DZ5A 2OGJA 4J35A 5C70A 4Q4PA 2O9PA 4S39A 1LORA 3O6CA 3ZZ1A 5M2FX 1J79A 2PWHA 2YDQA 5CZKA 1XYBA 3ZS4A 3WQ4A 1CT5A 3ITTA 2CNCA 5BRQA 1LBLA 2X40A 2HK0A 2J13A 1KRBC 5CPNA 4JN8A 1FHDA 2V5CA 3MZ2A 5XIAA 1Q6QA 3UJ2A 1XIMA 3W7HA 2ZXBA 1Q8AA 3T4WA 2W66A 1F8IA 4YHEA 2XYLA 4EAYA 2QZRA 3CZKA 3K46A 1JAEA 1TE1A 4PBFA 3WDQA 4UTMA 5HQMA 3G1FA 1Q6CA 3QYSA 4IX0A 3VNMA 4BI6A 3RIKA 3R79A 3VNDA 2A3AA 1M3UA 3LXCA 2AGTA 3CWNA 4FXJA 4PTMA 4R27A 2VR2A 3P74A 4K68A 3WO8A 4MJMA 3BJSA 1B3ZA 1OCJA 4QROA 1KC7A 3ZFHA 3LNMA 1S5VA 1JFHA 1NWRA 2VCCA 3PBWA 2I5QA 3GXTA 3F4WA 4NKCA 4GOAA 2GSEA 4F0SA 3N9KA 3M0IA 2J9YA 4I5RA 1VAHA 2INZA 3PTMA 3FEQA 3TJIA 2A3CA 2PB1A 4D6EA 3PWIA 1EBGA 2YOCA 1R3WA 2NQ5A 2A7RA 3C5QA 1ZU8A 3SUTA 3INPA 2BS9A 3QZAA 1FX6A 2QCFA 4O57A 3DC0A 4LALA 1KLZA 4W88A 2CPUA 1FOBA 4C91A 2KX9A 2G3MA 3UR8A 2OB3A 4O15A 1DXIA 4LV4A 2CBUA 4DO5A 5FF3A 1F6PA 2QUVA 1L8NA 4F3HA 1RH9A 4MGGA 3LG3A 3IWPA 2DVXA 3WEOA 1XC4A 4D6JA 1NF7A 5EBUA 4ROQA 1QR7A 3DOPA 3IJ8A 4JZ5A 1ISXA 3QSTA 5I79A 4QJ3B 1AJZA 3T8QA 7TIMA 3SGZA 1CGWA 3MYPA 4ERAA 3QOMA 1QBBA 4F0LA 1DQXA 4WSHA 4CEXC 3JRKA 4JFWA 3PZGA 4XZLX 3VD4A 3CZEA 3ZYZA 1V6YA 3BMVA 4K37A 1A0CA 2OOFA 3M0KA 3DG3A 3RX2A 4S3CA 1IXQA 3WJSA 3LRLA 1JUEA 2E6DA 1BG9A 3C86A 4H41A 3OQ8A 4IP4A 4WOZA 2R82A 1M5WA 2R9RA 1RXOB 4LJ3A 5DEZA 1KCLA 4ZENA 3QZEA 2ZBTA 5AHFA 1P1XA 1KM0A 2Y88A 1K03A 1KRCC 5BXRA 4BS0A 5LYRA 1GOMA 1LL4A 2OGYA 3HQOA 1OT1A 2DPEA 2EBNA 2E6FA 4H6KA 4CNTA 3EDJA 4NHVA 3S5NA 3PUGA 4PMVA 1UIPA 2D0GA 2OSYA 2GQ3A 5DCEA 4IJCA 2OOGA 1EWEA 4JEQA 2PWUA 2WMIB 3O0FA 4B5UA 1EP1A 2EPNA 1OGSA 4WLCA 1RPKA 4QP0A 3JVAA 3AC0A 1QNSA 1X6UA 1CWYA 3LLFA 2HPMA 2R1NA 2QJIA 2HROA 2V8ZA 3N9SA 4XG1A 1C9WA 2OLAA 4TO8A 3VUPA 4KGJA 1I0DA 1W31A 3LTSA 2FQIA 3CQKA 3PY2A 5CSYA 1Q45A 3VFLA 3IJQA 3T55A 1O95A 3LZ5A 3S83A 1FQ0A 4NX0A 1W5PA 4ZSUA 2C15A 1WB0A 2XUCA 5MF5A 5K7JA 1OSEA 1N2VA 3D3AA 3M0JA 5A6BD 3BICA 2Z28A 1WDPA 2BGNE 4QDPA 1XGDA 4GJJA 4HYRA 2VDGA 3H2MA 2BZNA 2PDMA 3VKCA 1E0WA 3F4VA 3MTWA 1LT8A 1JZ5A 4L80A 2WAGA 3VCCA 2OKTA 3QF0A 3W7IA 2OQLA 1U5HA 1NQKA 3B8SA 3FFSA 2REQA 4PEEA 3CB3A 2ZZ1A 1NELA 4IIBA 4NZ3A 1DHPA 2WSPA 1XYFA 1W1YA 4MB5A 2EPMX 4YCPA 4YMZA 3CZLA 2W92A 2FFIA 1JZ2A 1QNOA 3H53A 4IGSA 1KB3A 4CN4A 1EJXC 4YCOA 1N7KA 5LIWX 3EXSA 4WXYA 7A3HA 4AVNA 1I9CB 3AIEA 1SW0A 4AZCA 1BAGA 1KQZA 3CTLA 5F1VA 1Z42A 4F8XA 4JHOA 2CZ5A 4WCJA 2W91A 3LI0A 1ZAIA 4FIRA 1S1RA 3VC6A 1ADOA 2V81A 1YNPA 3TYDA 4CD6A 1WKYA 4QGCA 4KWVA 3A4JA 3ARUA 3ZVIA 3GO2A 4DJFD 3AIBA 2WLZA 3VABA 4CKQA 4N4QA 1QXLA 1UWSA 1B3YA 7XIMA 3UA3A 1C91A 1J12A 4JTCA 1H1ZA 4DWSA 1VFUA 3BH4A 3WDHA 3VNKA 4MF4A 3GNXA 3QOKA 1HJUA 5CPMA 4B9ZA 3TZFA 3HOJA 2V5KA 2WMHA 3VCNA 5CSRA 1KCKA 1OJXA 5C7HA 1F2JA 1F4AA 2NV2A 4XISA 1AD4A 3D0CA 4QITA 3G1DA 1VRXA 3NQDA 1ZCOA 1J11A 2PUZA 4JNMA 2VX6A 2NUWA 1KO0A 3AYTA 2OT1A 3K8KA 4GA8A 1XSJA 4X2RA 2OX4A 4XO7A 4L6HA 3CUHA 1Z48A 2D1ZA 3KVLA 4F0KA 1H1NA 2G41A 2NW0A 3WEMA 4JY8A 1SVDA 4LRTA 1V7AA 4GVGA 1B31A 4QCEA 3SY8A 1BTCA 4AY1A 2E9LA 4Q8MA 1U30A 1UR9A 4NUWA 1JD7A 3LCHA 2E5BA 1XLAA 2QMJA 4CCDA 4LUTB 5LA1A 4EVZA 5K9DA 3VC5A 3LRKA 3CHCA 3QYQA 4LGXA 5C9ZA 4MJ4A 5FACA 4O4WA 2VQUA 4LCQA 3S0CA 1HT6A 4KERA 2VT0A 1I1XA 3MBFA 2WKLA 3W1LA 1UBSA 3ZR6A 4OKDA 4AZ7A 1XYLA 4IMDA 3RHGA 3SURA 4LVBA 3ENLA 5A2CA 1GT8A 3SCNA 2Y8UA 5LGZA 4FZIA 2VENA 5GJNA 4PUEA 5FEZA 4ML4A 3MS8A 2DJLA 2QQ6A 4OV4A 1VBRA 3U2CA 3MT1A 3KS5A 1FWJC 4Q8TA 3F2CA 3NL2A 3NSNA 3PUDA 3GW0A 1H0IA 4KMQA 3GG1A 2B81A 1GHSA 1J93A 1Q3NA 3QGKC 5SWUA 1DWAM 1H7PA 2C16A 3TTOA 4CLMA 4CU6A 2PLCA 4XBJA 2EF9A 1V93A 3LPPA 3UF9A 1F4HA 1ITUA 3MI3A 3VPLA 4CQAA 3FXYA 4LC8A 1LG2A 1Q2RA 5U4NA 2HMCA 3GTXA 4O11A 3B04A 5FF4A 5I78A 1AQHA 2PLJA 2WSYA 4JTKA 3EWXA 3W23A 1OABA 1P6CA 3WK1A 1SJBA 1PEZA 5AVNA 2AGKA 3NPUA 3H2EA 4LS1A 2BXVA 2ASHA 2VJXA 1QI4A 1FWRA 1K8XA 4US5D 3N11A 4QE4A 1VZWA 1Z89A 2GVEA 5A2AA 4IIEA 1P1MA 3W1TA 4H6QA 2RAGA 1U22A 1UR8A 3SB0A 4DLMA 1W2VA 5EL1A 1C90A 1R2SA 4AD4A 3R8GA 4NU7A 5GJPA 4W8LA 3RM9A 2V30A 3TDFA 4DHGA 1IEWA 4HN4A 3CH0A 3FAXA 4LAZA 4Z2IA 4H9XA 3PZ9A 3U6WA 3FSUA 3W01A 2AMXA 3TH6A 2Q8XA 3LNPA 3NO3A 1KM3A 1FHUA 3PB2A 4JQ2A 3P82A 1EJUC 4H04A 3K8MA 4C60A 5LSMA 7REQB 1GKRA 3ANUA 1A5BA 2R8WA 3WLOA 4TIMA 4AD1A 1WCGA 5H8UA 3BAIA 4H19A 1N82A 2H8XA 4GI6A 2D2OA 4MIMA 2OJPA 5C7VA 3E96A 1XXXA 1W32A 4UIOA 1EEXA 2E40A 4FLQA 1JPMA 2YL8A 1IF2A 4J7RA 4W5UA 6TIMA 3LLXA 3E12A 2UY5A 1OFAA 1XUZA 4GE8A 4D1IA 2BY3A 4O4VA 2VFFA 2V5LA 1CEOA 5KSWA 3QMSA 2FPVA 4AX7A 4NIRA 2OZ8A 3WBEA 1TTQA 4EPDC 1CNVA 1NM9A 3GY1A 1DTUA 3K1GA 3W1AA 3W2JA 1W3TA 2CETA 3I65A 2YXGA 4H4IA 3BGGA 3LM3A 1XIEA 4DNHA 4M6PA 4UQBA 3PTKA 2BX7A 2VELA 1B57A 4I8YA 2E6YA 5BXTA 1KBIA 3CQJA 3CAQA 4XX6A 2B7OA 2VKZG 4DJDC 5F1UA 5HMSA 3CK5A 3WUFA 2QLYA 1XG4A 2P10A 3G1VA 4N6EA 4LB3A 1TRDA 3COTA 3TA6A 2BVTA 2DT1A 2I5IA 4CNPA 1TO3A 2XM1A 5CGTA 2EHHA 1O60A 4S2BA 2G96A 2EPOA 4AIOA 3LENA 1XW8A 3T0CA 1XI3A 3G1YA 1DIOA 4J5NA 1MVYA 3QHNA 7TAAA 3KWXA 4FK9A 3VD5A 1W3IA 2EG8A 1ZSXA 2E3ZA 3BSGA 4P2VA 3FS2A 4ZOAA 2O9OA 3IGXA 4JYFA 4BR1A 4XSLA 4Y90A 3H7VA 3ZJ7A 4UMBA 2ZZ2A 4PBEA 4LRSA 5FJIA 3W1NA 1IV8A 3FX4A 3PWGA 4L61A 1B3OA 5HJXA 4W7VA 3AS3A 3SEPA 2PBOA 3PB0A 4IG2B 1W54A 2QPUA 5JBFA 4HU0A 1M53A 4RK8A 1ME9A 2F84A 2ZE0A 3SI9A 3O15A 3F4CA 1H5YA 3W6MA 3AHTA 3D5HA 2XGBA 2HWGA 3TN6A 2DEPA 3QR1A 1E1CA 1SSGA 2WHJA 1FWFC 3CT2A 3LHZA 3WF4A 4ONVA 3BLLA 3KBSA 3BURA 2XU2A 4H9YA 4PULA 2W0UA 1X8FA 1HO4A 1GG1A 5JMUA 3FCPA 2XZ7A 1YBQA 3V1HA 1R3TA 3E3HA 2IKJA 5E0CA 3UPMA 3KBVA 1G69A 4ICNA 1T6MA 2X42A 1ITCA 4AD0A 1TWWA 3BOFA 1BKHA 2QUUA 1ONWA 1Q6LA 1D8WA 3DFNA 2ZYFA 2C6QA 2J8FA 4UUIA 1VFHA 2CZDA 5REQA 1VH7A 2W61A 5LZLA 3T4CA 5HQLA 3DFYA 2NVCA 1DVJA 3GQYA 4HP5A 3K2GA 3DIPA 3CYVA 5A94A 1KFWA 2DIKA 2R6OA 4DEFA 3EWZA 1VLIA 1PHWA 2OEJA 4NAFB 2PGWA 1K3UA 3H2AA 1K7XA 2ZZ7A 2BBFA 2PDQA 5D30A 1PL9A 4GUHA 1K8CA 1WKDA 4H8VA 3SFKA 2D0HA 1HKMA 3UETA 3B40A 2J7GA 1C92A 1HKVA 3BGJA 4JKKA 3V5FA 3FKKA 1EPVA 4BQ4A 1E6XM 4G1KA 3QV6A 3OVQA 2RH9A 4MNJA 2OYMA 2ZUNA 5IRPA 4LVFA 4K39A 5I24A 3MQTA 1BXBA 3LTYA 1P0BA 2NWRA 5FEPA 1IZJA 1F74A 3UW6A 2A6NA 4QLLA 1GTEA 4NY2A 4OECA 1X39A 3S5ZA 4HK7A 4ES4A 4AHQA 4JKLA 1H0GA 4ZO6A 1WQ5A 4XSMA 4MFEA 4GG9A 2F7FA 2WZIA 5KZ6A 3WBWA 4J2MA 4MAZA 2OX1A 1EP3A 3W27A 1TTPA 4AG0A 5I3IA 2BV9A 2YB1A 3F4DA 4G1NA 1JCNA 3GVVA 3SUWA 4WGXA 3I7SA 4GUJA 1UWIA 4DAFA 3KVKA 3NGJA 1JPIA 4ORMA 3M0XA 1UASA 4XUYA 3UVAA 3AHXA 1OYAA 2NVDA 5CPLA 4I9AA 1QPQA 4YHGA 5BRBA 2CFFA 2BB0A 2I9UA 4WK9A 2GVJA 1UKSA 4DX3A 5F4XA 3GXMA 3IAPA 4PB5A 3A4XA 3SIMA 4QG9A 4IJRA 3CPUA 5CPOA 5FSEC 4NYUA 2HBVA 2Z6IA 1EC9A 5IFPA 4H7VA 1YTDA 3MMTA 3VGEA 2Q71A 4CNUA 3WQPA 1BQGA 3SSJA 3ZO9A 4LEFA 2YB4A 3C8FA 3UEQA 3P0WA 1R38A 3RO6A 3O16A 2ZRXA 5KITA 1XR2A 2FZBA 4PCTA 1GVEA 3PTQA 2DZTA 4C6KA 1PZ1A 1SFJA 4O16A 1ECQA 5EA9A 1SFTA 3VTRA 4DLFA 2WZMA 1TRIA 4MKVA 5B7ZA 2Z1WA 3LQLA 3QPEA 1EGVA 3T6CA 3UR2A 1BWVA 3QV9A 5DXYA 2XFFA 4Q7BA 4QXIA 4PYSA 1KXQA 3PK7A 5CC7A 2QAPA 5CC3A 2X1TA 1FP9A 3NQMA 2E5DA 3WNMA 2NQJA 1BKSA 5D2VA 5D03A 1OK4A 4GPNA 1PDYA 1DJIA 3W7DA 3C8NA 1U1UA 1GOKA 3A13A 4D8AA 4HSOA 4B4HA 4D6HA 1VEMA 2V67A 3EKZA 4PGLA 4ZVJA 1QTWA 3W7LA 3W0KA 3MBDA 1W9UA 3KS6A 2Z1KA 1WPCA 1SSDA 2XVNA 1V0KA 3HTWA 4NF7A 1CDGA 1CXLA 1TV8A 3MSYA 1TJ1A 1G5AA 1OINA 4IIFA 3TE9A 3W6YA 3Q94A 1QU4A 4JTQA 3WSUA 1XLBA 2YLLA 1JZ4A 4GINA 1X97A 1SO6A 3UWUA 1SZEA 2YBVA 3AS0A 1WE5A 5E70A 3LK6A 1UD2A 4MKSA 2A7PA 2QUMA 3NAVA 3W2LA 5D33A 1E55A 1DPMA 3G22A 3EPOA 3G2GA 4GYPC 3D3FA 4A8RA 3TIMA 1AL7A 4IHCA 2C7FA 4CCCA 1AQMA 4J3SA 1FWEC 3L5LA 1ITXA 2PDHA 2H3DA 4HK5A 1XBVA 1JNDA 3RRAA 3B9OA 2QXWA 3IAQA 3AU6A 1PWLA 4AC7C 4TX6A 2BOEX 1X1OA 3B9EA 3REQA 2EGZA 2VRJA 4UTTA 4JTHA 2UY2A 1P7TA 3SDOA 1HG3A 3SQSA 2JIWA 5C9UA 4H2HA 3RU6A 1UZ1A 3IJLA 1UROA 3E0FA 5AYXA 1D7FA 1GORA 2FKPA 2NT0A 4Z17A 4N42A 1GQKA 2J74A 4XTIA 1RV8A 5HA7A 1PTAA 3Q45A 3HQ1A 1ECEA 2FGZA 5BYWA 1LUCB 2DZBA 4EPKA 2R1PA 5TBOA 4DIAA 5G1MA 3TNOA 4O13A 3VGFA 3W6LA 3M5ZA 4Y6GA 4DWDA 1OF8A 1B3VA 3TAOA 3DFOA 2XVPA 5J04A 3CHDA 2WHMA 3H8AA 5DLCA 4K1GA 1FHLA 1ICPA 1HTIA 1XYZA 3M0VA 3GRIA 3NEHA 4ZA0A 5H1WA 3GIPA 5CJMA 1KKRA 5HNRA 1YXCA 3W7QA 3WLPA 5BCAA 3C61A 3SECA 3UERA 3S3GA 1V3LA 3WY1A 2NUXA 1XKYA 4UTLA 1R2TA 1NFBA 2X7WA 1EIXA 4UBPC 4JY9A 1TIMA 3NUKA 1R6WA 4KWOA 1TV4A 3VMNA 3CMJA 2EAWA 4XZHA 1BRLB 1LTDA 1TG7A 3PF3A 1FCVA 5M5DA 2EG6A 4RPPA 3P60A 1JUBA 1IXPA 2AQVA 4I5UA 4XZ9A 2Y63A 3QSRA 2RJGA 4Y96A 1VGAA 4ZCWA 2EKGA 4PB4A 1M04A 1XF0A 3OLIA 4HPJA 4JQ1A 1VJIA 4R7WA 2JKPA 3NQVA 4I90A 4L9ZA 4PL2A 3W7CA 1RVKA 3ITGA 1JAKA 3PFMA 3M0MA 2VMFA 3WDRA 3BAJA 2ALRA 4EX4A 4A6GA 3S6OA 1VCGA 2J8TA 4GVFA 4KCUA 3V5CA 3ZSSA 1EF3A 1GWJA 4HSHA 3N73A 1R9YA 1VENA 4DJDD 1QRQA 1HVQA 2AKMA 1E15A 3QGAC 1XCWA 1E51A 2YFOA 3CPRA 3SO7A 3SCQA 3KTCA 3QEZA 1S2TA 1OZQA 3DFSA 3A4WA 3BMXA 2JF6A 3MCOA 3POHA 1B4KA 1VF8A 3W1RA 3EA2A 3ARPA 4WY0F 3RR1A 4N2YA 4HHHA 1AZ2A 2PMQA 4AH7A 4CN1A 4H9MA 3DYPA 1C9DA 1I75A 1ZZMA 3S47A 4O1FA 2P0IA 4R33A 5DXXA 4XB3A 2J9XA 2ZQ0A 2J7FA 3AI0A 1JCLA 5BOFA 2PD5A 2ZUSA 4B5VA 1R3SA 4R53A 5AZ1A 2JKAA 3QHOA 3I6EA 3MHGA 4GYPA 1Q6DA 2XH0A 2V38A 3WN6A 1ZQ5A 4NJIA 1OZMA 2Z00A 3IUHA 4H00A 1VR6A 3AICA 4GUFA 4AD3A 4US5A 3IUDA 4ZGYA 4KQNA 3GK0A 3W22A 2OPJA 4DJEA 2WNNA 2AAAA 3E5BA 2A3BA 6TAAA 1DJNA 3MVIA 3PVFA 3B8DA 2DORA 2VGIA 4JFTA 4AWUA 1NQ6A 2ZRYA 2O7SA 3WLRA 2PTDA 1R85A 2CEQA 3GXFA 4I5XA 3VZYA 1DWGM 2TMDA 4F0HA 3DHDA 1M65A 4DYJA 2HXTA 1T40A 3AIQA 3V35A 4GFIA 4QR6A 1UPMB 4B15A 1RJRA 5BNKA 4XKYB 1W9BM 1V51A 1PV8A 4NZ5A 4KIEA 4N4PA 2J8GA 3E1F1 3B0YA 1FCBA 3SCOA 3OVGA 3E74A 1OGGA 1LCOA 4MM1A 3A21A 3OZMA 5DBTA 4C5YA 1ZBVA 1JF6A 3HN3A 5BZAA 1EFZA 4LFYA 4IFRA 3G24A 4DI9A 4LAKA 4BJHA 4ZTYA 4C6EA 1JUKA 4NNCA 1O4UA 1CGTA 4W9TA 1EC8A 1L9WA 2QW5A 1MUCA 4ATDA 4G5DA 2FVKA 2XIBA 3M6DA 3FIGA 3EMCA 4TXEA 2O55A 4V2XA 3R7MA 1KXTA 3NDOA 1H1YA 1OVDA 4W8BA 3QV8A 3VD9A 2I17A 2EEXA 3V0UA 2FPTA 4Q6XA 2PTWA 1F73A 3ZJKA 3AXXA 2E0PA 3LLDA 1YADA 3OGRA 1CTNA 1OF6A 1NAL1 1UMYA 1E9ZB 1PKLA 2PFHA 4NAFA 2VZUA 2C14A 4XO6A 3ZJ6A 5HNTA 1POKA 2IS7A 1VRDA 1PHQA 3R6IA 3WJWA 4KPLA 3E02A 4WGHA 2GGEA 2BGQA 2B7PA 2Z2UA 1DE5A 5A8QA 1PWMA 4Q4RA 1UH2A 3TCEA 5CCZA 1K6AA 4G7EB 5AYIA 1SMAA 3DG7A 3PTDA 1LT7A 3PBMA 3URAA 3VDHA 4ZQNA 3FA3A 2A85A 3UXAA 3OIHA 3PJXA 2OZ0A 1HNYA 3VUSA 4IPPA 3CBWA 1P0NA 4N9BA 4PMRA 4QS6A 3TC3A 1ODUA 2A79A 2WWCA 3MANA 3VOGA 4C6DA 5CXPA 1TPWA 3H23A 1SR9A 3R25A 3W74A 3HG2A 1BVWA 1LBFA 3FHAA 1G4SA 3R0KA 4HZMA 4QSFA 3GZAA 6XIMA 3CASA 1Q2SA 2XPKA 1OFBA 4GUGA 1IR1A 5FD0A 3P8IA 1NOUA 3OBKA 3PWAA 4L56A 1Y5XA 3CQHA 4H8UA 4JL2A 4AW7A 3BJFA 3GUGA 3M7SA 4P7RA 3VOCA 1I6NA 3JUGA 2ONEA 3AMCA 5BOOA 2ZZ4A 3AIVA 4UCFA 3R11A 1XD0A 1XLHA 3HPZA 2GGHA 8TIMA 1H51A 2GLKA 3UY8A 2XINA 4IMFA 1G01A 2XTKA 5I09A 3H2FA 1E6NA 3IVSA 3LA4A 3AWNA 4J4KA 3RYSA 1EJSC 2V3GA 2PDYA 4C6OA 4JGDA 1HJXA 1FWWA 2VC5A 4KKXA 4WRHA 2WM1A 2MUCA 2VFEA 3HV8A 3TQVA 1VPQA 3N9RA 2P88A 4DB7A 5C9WA 3T40A 4DJFA 3U5UA 3EOLA 3SAZA 5AHIA 2C1HA 2A5HA 1JYXA 4YTUA 2DUAA 3DKJA 5HNUA 3F1QA 4PBGA 1OC5A 1R9XA 5U7SA 1VP5A 2EO7A 1PIFA 2ZUVA 3CEUA 3CIXA 1RA0A 1VYRA 4UQCA 1RALA 1WDSA 3ZWSA 2ACQA 4E2DA 3W38A 3AHZA 2J7BA 3H2CA 1UOKA 3TVAA 1A5CA 4S23A 1GW9A 1AZ1A 1DWFM 1VYPX 2WBKA 4NNBA 5BOEA 3UT0A 4O0KA 4Z1BA 2ZRVA 3CZGA 3NQEA 3WF0A 3KP1A 1A53A 5E9AA 3T81A 3MKCA 3RAOA 3CAKA 1ZHAA 2R1KA 2GJRA 3QZ6A 2WPGA 1TE6A 5AYYA 4Z08A 3PHAA 4IM4A 3FDGA 5A2BA 3BLFA 4TTUA 2VC7A 1L6GA 1GVOA 4RE3A 4B9YA 3W7EA 4Y7EA 1X96A 1XDLA 3ARQA 4OE7A 4AF0A 3AJ7A 1OC7A 1M01A 1J0JA 4UC5A 1Q6GA 2V3DA 2WCAA 5EFFA 4GQGA 1NY1A 1LUCA 1JDFA 1CX9A 1J0YA 3GXPA 5EMMA 2GJNA 4LNCA 5M3WA 5D04C 3NM1A 3FJNA 5HR7A 4K3ZA 3VXGA 3CYJA 5H91A 4ZE5A 4C6QA 1P7TB 4DJDA 5M03A 3U2OA 2P76A 3FJ6A 1E0VA 3N25A 1H2JA 1HVXA 3O9NA 2PGFA 4K8HA 4IFKA 3GTHA 3QC0A 1YRRA 2HBXA 1YTKA 1E9LA 2HE8A 1OB0A 5FEWA 1QDSA 1BGAA 1J01A 1JYNA 3WUBA 2Y70A 2A21A 3WFAA 3OODA 1Z44A 5CPSA 9RUBA 4JCMA 3CWOX 2OCZA 5PTDA 4UNIA 4DVOA 1US2A 5K9XA 3W71A 2HS8A 1HXJA 4BQ2A 4GZIA 2WPBA 3NL3A 3R94A 4HCDA 3CUZA 4AIEA 2A3HA 1XLDA 4Q6JA 5D2XA 4ZEPA 3SY5A 3A22A 4MZ8A 1RVGA 1OGBA 2BG5A 2AAMA 2HCVA 2J7DA 3W7MA 5HJYA 1S46A 2QDGA 1J0HA 2PA6A 2F6XA 4UB9A 1I2QA 4DBSA 4AEOA 2IQTA 2X09A 1E70M 4I3GA 4HGXA 2BXYA 2P5NA 3GFYA 2XN2A 1F7BA 3KW3A 3PNUA 4YTTA 7PTDA 3DX5A 1X7FA 1ELSA 3KBJA 1H50A 1NP0A 1LRTA 5CBBA 3PN8A 3PAOA 4HZ7A 3UNDA 1CI1A 2CXGA 3IIZA 2WZTA 3LCWA 4RCXA 5LGXA 3LCIA 4PFMA 5KINA 1E0UA 1RZMA 2X0HA 1XIIA 3QQWA 1H09A 3MPGA 3WNOA 5CZ0A 1WXYA 4LB4A 1W3KA 5D9NA 1S2AA 3S2CA 4GY0A 3W7RA 2HJPA 3NCOA 3PZQA 1G1YA 2CYGA 3VFCA 3LBMA 4GNVA 1V7YA 3VAVA 1CZ1A 3B0UX 5EU9A 3BWWA 3W81A 4CD7A 3KOFA 2E28A 5F2IA 1U5VA 5E0KA 1W56A 1X7IA 1D8CA 2VEKA 4UTIA 3B0VC 3HV9A 2GQAA 3ABXA 4HNVA 2CZEA 3WNPA 3EWUA 5LNWA 2WKJA 3KRBA 3M6YA 3V4BA 5JH2A 1JCYA 2D2GA 3M9YA 3H4WA 3THAA 3N29A 1YQ2A 1VHNA 3GX9A 2ZXDA 3D46A 2QCDB 1ZLPA 4Z2GA 4OQVA 1V3HA 4LT9A 2EJAA 5A8GA 3TSBA 5EMJA 3TCSA 5A6AA 5EMLA 3ABQA 2P1FA 4WZHA 4HHMA 3HM7A 3AXKA 3VI2A 1DXEA 1NWSA 1IEQA 5ECUA 1ONXA 4DRSA 1VBGA 4ZOCA 3OLEA 4ATLA 8CGTA 1TWDA 2V3EA 5CG7A 3HBLA 1MXGA 3HGOA 1Z41A 5CZSA 5CGMA 1UZDA 3WMSA 4Q8NA 1SYTA 1KM6A 1WXZA 3VCRA 3WQDA 3KAOA 2PODA 1FDYA 3AIRA 4TTGA 2C19A 3GBEA 3MHUA 3CMFA 3W2MA 3MU7A 4AEFA 2GYIA 5HUPA 4E38A 4IXXA 4YTRA 2CZFA 3BDKA 5A6JA 2XN1A 3NQ7A 1BRLA 2OODA 1P0KA 3B0PA 2CXEA 2IPJA 1NF0A 2VWTA 3P80A 1IT8A 4N7QA 3CWHA 3FA5A 4PMDA 1L6WA 4O1CA 4H3DA 1O6IA 1UKOA 1S39A 1W6TA 5LA0A 4E5TA 3ATYA 4DF1A 3LV6A 5I3FA 4H83A 3EX2A 5G2WA 2GSHA 4HOXA 5IHRA 2FDSA 1ICQA 4A29A 1W91A 3W9ZA 4S3BA 1Y7VA 1LLWA 3OIXA 2DUXA 8A3HA 4A8IA 1JD9A 2QAFA 1C93A 3H24A 3R1ZA 3P62A 5DT7A 3LGDA 1CCWB 2C8NA 3OA5A 3P8JA 4ZO7A 3QLLA 4RW3A 4A2SA 2PC8A 4M29A 2WNWA 3A4AA 1ESWA 3P2VA 4CCEA 1X6LA 3NO1A 3AYVA 1EEPA 4S38A 5LHEA 3ARVA 4PTVA 3VNZA 3EEGA 4MG4A 1ISVA 1DIEA 2YBTA 1UUMA 3I6TA 3OYZA 4C7FA 3O7UA 5AECA 1KFJA 1XP3A 3CLMA 3Q67A 2H3BA 1F3WA 1FWBC 2OXNA 2XFWA 3BO9A 4XD5A 3ZQ9A 1XLJA 4PTDA 1G7VA 4Q33A 3OGSA 3P5ZA 3OVPA 3NSXA 1PJ9A 4NZCA 1BTMA 1MFUA 1SO4A 3TP4A 1BPLB 3G1RA 2V5DA 4ZOBA 4Y2WA 2KZHA 5G2HA 3R89A 3V3WA 4RE4A 3CAWA 4CQCA 1UH4A 1XH0A 1RUSA 4L4MA 3EA3A 3LQGA 3QPYA 4ZB0A 3GR8A 1UD8A 4O1AA 4HNUA 5HWJA 4PFHA 4AY8A 1JDEA 1QMLA 4LANA 1LJYA 3S2MA 3HG5A 2BMBA 3PUOA 1V4YA 1OADA 3TR2A 4DNMA 3MO7A 1CGYA 2BLEA 4H01A 3OZPA 4X0VA 4O1BA 2G97A 3L4XA 1R46A 1LG1A 4GO8A 5LHFA 5GVJA 3WJXA 2XG9A 2G3NA 4LWWA 1XD1A 4YU1A 4GZEA 1TREA 2R1MA 1RQBA 2YA1A 1P0DA 4HYVA 2ZX6A 1R3QA 4OU1A 4D2JA 2DV0A 2YZRA 1YDYA 2SFPA 2ZX7A 3N2MA 1HKJA 3T42A 4D6GA 3W1QA 1XBXA 4PMJA 3QR0A 1OIMA 2E9BA 3GSMA 1LBMA 3ANYA 2R24A 2DH3A 4FI4A 4L6OA 3CAVA 5FI8A 3QW4B 2WMGA 1UWUA 4NVTA 2Z1XA 2VVSA 2NT1A 4QHRA 3DECA 3DHPA 1PXGA 4FX7A 4M1RA 7CGTA 1KBJA 1K9DA 4XTDA 4P7OA 5H8PA 1M03A 4GGBA 5LXEA 1F05A 5GNZA 5HINA 5B80A 4X60A 3U2EA 2FHBA 3APGA 2PWVA 3TYAA 5D37A 2DSWA 2NWSA 3BL3A 4O54A 2IW0A 2J7CA 5DBUA 3THQA 3V36A 1EUNA 4WF7A 4KH2A 3SQMA 3EDEA 4IMGA 2Y7EA 3E2QA 1JDDA 1KBKA 3H6OA 1TJ2A 1MFVA 3W2KA 3U7VA 3WLHA 3AAMA 4MNMA 3SJ3A 3BMWA 3DYMA 4QS5A 4J9JA 4WSJA 1TB3A 3S1WA 1W37A 3TWBA 3UJSA 2NX1A 2CU0A 5K4ZA 3UGVA 2V5JA 3FDKA 2FHCA 2X8RA 4MNKA 3G77A 3ALGA 1WKEA 2CC0A 1QCWA 2RGMA 3DI1A 4MY1A 2ZCGA 2CLEA 5FAJA 5A6BA 2PP3A 4RLIA 4M6VA 4IH3A 1K9TA 2IKIA 2Z7KA 4IF2A 3KDOA 2ABBA 4REQB 1NDZA 1IEVA 4R88A 2NQ9A 1GYMA 4AYSA 3K5XA 1MUMA 4P8UA 4S3JA 1JYWA 4ZZ9A 2H6RA 3I10A 4XAGA 4PC8A 4WDTA 1M7JA 4HA1A 1PYFA 2VXNA 2BVWA 4KEUA 2OFJA 1KFKA 1VFLA 2GQ9A 4I6VA 4XWUA 1WAWA 1G67A 2X7VA 1DJGA 1CLKA 1BWLA 1MO0A 4WJEA 4ZFMA 4ZQRA 4DJEC 4JFSA 2XZ9A 3ITOA 2QCGA 4Z1AA 4HN8A 2ZTJA 3CT7A 4ZE4A 1EQCA 2EKCA 1JZ7A 1LLOA 5E1QA 7REQA 4B3ZA 3OOQA 3GD6A 2FH8A 1Q6RA 3ZR4A 3T0DA 1TPH1 2OO6A 3T9PA 1GVYA 3EKGA 3EAUA 3OBAA 3QGVA 1MEHA 4HPGA 1X1ZA 2A1YA 1UZHA 2VM8A 2F61A 1AW5A 4JQ3A 3WNKA 2WMKA 3HB9A 3ZM8A 1SR0A 1EJRC 1POJA 4IIGA 4KBXA 5JH1A 4Q8QA 2DW6A 3M0HA 3NXFA 3EB3A 5DO8A 5LIYX 3UG5A 5E93A 2G8ZA 4EP8C 1M1BA 1QWKA 1B5TA 2ISVA 3VKAA 3TONA 1TR1A 1JYVA 3HG4A 1HP4A 3WJZA 2HS6A 4F2TA 3L0KA 1PAMA 3N04A 5DELA 2WSRA 4GX9A 2Y7GA 4R85A 4UCGA 3WQCA 1NTHA 1O66A 4FOKA 4J3XA 2NQLA 1F8MA 4WD0A 2UY3A 3I3BA 1EC7A 4ZQPA 1QHZA 1YEYA 1US0A 3GHUA 3LGGA 2IKGA 2VNCA 3WENA 3K4WA 1A5SA 3Q2DA 2HPIA 4TVUA 4E2BA 1ISZA 3GHRA 1JFXA 4HPHA 3IIOA 1C29A 3RM8A 2D3LA 2Z25A 4M56A 3VX1A 1IT7A 1YPXA 2ZUMA 3AMKA 4C6MA 5LA2A 2PAJA 3TJLA 3ES8A 1VEPA 1ZAJA 5D9OA 3H4GA 2CHOA 3GG8A 3USZA 4B5XA 2X30A 3R58A 1EH9A 3NQFA 2L5HA 3KRZA 2VDHA 1IQ8A 4Y9OA 1IZKA 3KRSA 2ADAA 3BK0A 3I7QA 1G4PA 1HUVA 4ILSA 2J77A 1GW1A 2INFA 3DI0A 1ZJBA 1H7RA 4IPNB 2QCDA 4J27A 3HG3A 3RDKA 2G3FA 1BVZA 3ELFA 1SW3A 1EP2A 1J9YA 3H22A 3L9CA 1IWBA 3XIMA 4B5TA 1EHNA 1ZALA 2WB5A 1LQ0A 5C71A 4LVAA 5FCZA 5HJLA 4R5EA 4WDXA 1KLYA 3HJZA 1I4NA 1UP0A 2UV8G 3SRDA 3SUUA 2FMOA 1ENUA 2OWCA 3KXQA 1SJAA 3NQ2A 2VP8A 2WM0A 1J4EA 4JX5A 5KZMA 3EB4A 2GJPA 3OO2A 1RY8A 1KM1A 3L4UA 3HIJA 3NPVA 5HWNA 1DJWA 1WUEA 2HRWA 4JFUA 2PS2A 5I2UA 4QE1A 3FLUA 4PMUA 3LDVA 1TMLA 4GFSA 4CQ8A 1AH4A 3C0LA 4JTIA 3P81A 4H8NA 1GVIA 3N6QA 3FA4A 3M0ZA 4U2YA 1E5JA 2XFYA 2VCAA 4YPJA 5FF2A 4JIHA 3CUGA 1RA5A 1QW8A 1GEHA 3VZZA 3PZNA 2TSYA 1SZRA 4JYEA 4K8EA 2PDGA 1E6SM 4E4PA 1YKWA 3CGTA 1TV7A 3W7JA 1F6YA 5EBAA 1A3XA 5FA5A 3TLQA 5G4EA 1I0BA 4P7QA 2YZ5A 2Q3RA 3O0KA 2XSXA 4Q8VA 3GVGA 3GG0A 4DUVA 4M6UA 3CIVA 2G95A 1N55A 5JU6A 3SGUA 1K7EA 2XIQA 1Z3NA 3WD0A 1TPFA 4EPEC 3OP2A 3VD7A 2ZXQA 1V3IA 3AYRA 1GG0A 3G5EA 2DIEA 1SJCA 3T1GA 4JNYA 4DWSB 4H2CA 3GH4A 5RUBA 4JDBA 4EF8A 4Z2LA 2GGGA 1SPQA 1ZBWA 2ZICA 2X16A 1TYGA 1OY0A 3MSDA 1EA0A 3N4EA 1V0MA 4DAIA 2D20A 1YNQA 3AISA 3ME3A 4B3LA 2WMFA 2D0FA 1NEYA 4KGLA 3MZNA 4CEUC 3F2BA 2OVLA 4M82A 1V6VA 3SCVA 1WAUA 2Y4SA 2GJXB 2WJEA 2QNEA 1OD0A 3CO8A 3ABOA 2XGIA 1V8EA 5EGRA 2WJFA 2DIJA 1FDZA 1F07A 1HKKA 2Q8LA 4NT0A 4O1EA 4EKJA 1OHLA 1W3HA 1TPDA 5FESA 4QDWA 3FOKA 4KF1A 1K8ZA 1EDGA 3C3UA 1A80A 3BUVA 2JEQA 1W5QA 1VKFA 3B3DA 4QFUA 3QQ1A 1O1ZA 4C6IA 3VGDA 2HK1A 4KCVA 3URQA 6CGTA 5JBDA 3VDCA 2CESA 3MKKA 2AMGA 1OD8A 1UW9A 3WJYA 1TX0A 2X1RA 1JPDX 3CNYA 3UCDA 3M46A 2ISSA 3OPSA 1WNOA 2Q8ZA 3OZYA 2HTMA 1GQLA 1T0OA 2D3NA 3N2TA 3OHMB 3PP7A 1PX4A 5E0FA 4ZR8A 4DUXA 1UA3A 5FF7A 1JF5A 1FFQA 4ERIA 3UVIA 1HFBA 4EXAA 1E43A 2X1SA 4TMBA 3KBWA 2VC9A 2B7QA 4YTQA 4MTVA 3CH9A 3D47A 1FWHC 4LVDA 3SY1A 1EDQA 4V1XA 3F4NA 3G3MA 3F5JA 1YXDA 3OVRA 3MI6A 3MUIA 1KCXA 4PTWA 4LQ1A 4TV6A 2WZEA 3TMLA 4BI7A 1B9BA 1LDCA 1H63A 4A2RA 2E68A 5CSSA 1UWTA 1XCFA 3KZSA 3THDA 4D1JA 3NWRA 4JOMA 1E56A 2IKHA 1AW1A 2YCKX 4NYYA 3GYEA 4F0MA 1L6FA 1TCDA 2CWXA 3EOEA 1P4CA 3MCNA 2RFGA 1A4MA 9XIMA 1CW2A 4P5UA 4JHZA 3RJYA 5LIUX 4CUCA 1XRTA 1R9ZA 2E25A 1XIHA 2WKGA 3WX7A 5TD4A 2WCGA 1KGWA 4W89A 1LZOA 3TR9A 3V5OA 5IM51 4HZ6A 4YVXA 2J7EA 1RJPA 1SO5A 5XIMA 3K13A 3MW7A 3G0SA 3RN6A 2FH6A 1L0PA 3ARZA 4FOJA 4NZ1A 1RBLA 1V0LA 5AVHA 3OHIA 2PRMA 4P8VA 4DJFC 1TPC1 5HXMA 3A64A 5J8LA 3JU2A 1W1B1 3ZXWA 1E6RA 1NP2A 1O7AA 3ITXA 2W5FA 3SCTA 3L4VA 1OFRA 4IG2A 2E77A 2X1IA 1XL9A 2UBPC 3R2GA 3WH7A 1TIWA 2FYMA 4DYEA 4XIAA 3L67A 2OZ3A 2VFIA 4FEZA 1VFFA 2P0OA 3R13A 4XZNX 1SGJA 1U5JA 4PB3A 2LLEA 2YCJA 1OG0A 3KOXA 1HN1A 3IJDA 1NFPA 2Z24A 2ZZ6A 3L12A 2QF7A 3QY8A 1JG9A 4QIUA 1EYWA