4B3KA

Family 1 6-phospho-beta-d glycosidase from streptococcus pyogenes
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
461
structure length
461
Chain Sequence
LAFPKEFWWGGATSGPQSEGRFAKQHRNLFDYWYEEEPDLFYDYVGPDTASDAYHQIESDLTLLASLGHNSYRTSIQWTRLIDDFEQATINPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQAYGGWESKHVVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELSDGRIGTILNLTPAYPASQSEADMAAAHFAELWNNDLFMEAAVHGKFPEELVAVLKKDGVLWQSTPEELALIAENRVDYLGLNFYHPKRVKAPDAIPVISPSWSPEWYYDPYLMPGRRMNVDKGWEIYPEAVYDIAIKMRDHYDNIPWFLSENGVGISGEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRPKASAYWFKKVATHNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Activity of the Streptococcus Pyogenes Family Gh1 6-Phospho Beta-Glycosidase Spy1599
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE
total genus 185
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b3kA00
5DMYA 3WH5A 2ZUWA 2XM2A 4P7OA 3RJYA 4OZOA 2YIHA 4UFKA 1UD5A 2VZTA 2WAGA 3GNRA 2CYGA 1B3YA 4R5EA 1N82A 2J7BA 4HOWA 1ESWA 1MW0A 1W1YA 4PMQA 4AXNA 2WHJA 1JDDA 1J0ZA 4ZEPA 1LL7A 5CPTA 3VUPA 4ZFMA 5CLWA 4V27A 3SUWA 2WBGA 3W27A 1HIZA 2Y5EA 2XYLA 3ARYA 1E55A 4AWEA 4W84A 3CO4A 1AQ0A 3WMSA 1E3XA 3ZQ9A 2ZX8A 1GQJA 5A8MA 5A6SA 5I6SA 1H5VA 2Y24A 4QCFA 1LLOA 4UCFA 2WC7A 1CGVA 2VCCA 1GOIA 2JF6A 5TD4A 1W2VA 3EDFA 4B15A 4XX6A 2WNWA 1E43A 3IJ7A 1BF2A 1UKSA 1OT2A 3AFBA 2BFGA 2X1IA 2XFFA 2AMGA 3SURA 3VNZA 4UOZA 2ZXDA 5FCZA 3CUHA 3DYOA 4D6HA 1AQHA 3W0KA 1EO5A 3WD3A 2ZX6A 4W88A 2J47A 1V0MA 4W87A 1J9YA 3AMKA 3G6LA 3VINA 1VJSA 5DFAA 2WVSA 5JBEA 5GNZA 4AIUA 5I77A 2PB1A 4HMEA 1H0IA 1DTUA 1E72M 1UUQA 1PZ2A 2WLYA 2DT0A 4GI8A 5CXPA 1EHAA 4RE3A 4D1JA 4PSPA 7A3HA 3VIOA 1BYDA 4U31A 1CNVA 1EGZA 1WO2A 4GIAA 5I2UA 1E73M 1HX0A 4LGXA 3F5LA 2X0YA 3T2QA 3SCQA 3TA9A 4W7VA 4PTWA 1CYGA 3RJXA 3U5UA 4CU8A 3K8KA 5LA0A 1JZ8A 2WXDM 1US2A 2WCAA 4U33A 2DGAA 1B2YA 5GNYA 3W25A 3L4TA 5F7UA 3N15A 3AS3A 4J3VA 5DEZA 4MAVA 4PMYA 1V6VA 3L4UA 4P7RA 4N0RA 3UEQA 4TUFA 1XSIA 1GHRA 3SCUA 1OGGA 3W6MA 1FFQA 1Z32X 1BSIA 1JZ4A 2V3EA 1NM9A 3WDJA 1E5JA 3WENA 2XPKA 1CGWA 2ZXAA 1BTCA 4ACZB 1VIWA 4V28A 2XGBA 4CCEA 3ZSSA 1LF1A 1W9PA 3RDKA 1WZMA 1UR2A 2J8FA 2BY0A 1SFSA 5DT7A 2VUYA 4D6IA 5A8PA 4HU8A 4WKHA 2VI0A 1BFNA 2W91A 4GO8A 4Z2IA 1JGIA 1E1EA 4B9YA 3UESA 2FDMA 3WD1A 4MNKA 3ARQA 4UR9A 1JYVA 4JIEA 4AMCA 1RP8A 1HVQA 1KB3A 4NSBA 4E2OA 1WZAA 5DF0A 4AZIA 2VNCA 4GI9A 3WUEA 2NW0A 2J79A 1UZ1A 1WDPA 4CCDA 4MNLA 4JFTA 1EQPA 3WELA 3NCOA 1JAEA 1XH0A 2QHAA 4JAWA 3MANA 1ODUA 1TVPA 4Z2JA 1UWIA 3OBAA 1JFXA 5BWFA 1CIUA 1V3IA 4PTVA 4GINA 1US3A 1GJUA 4DWSA 5A6LA 3CIVA 2WMFA 4Z2LA 2ZE0A 3QR3A 2V5CA 4QP0A 2DSWA 2J77A 2V3GA 3AYSA 3OG2A 5CPQA 5ABGA 4W93A 2JF7A 2WMHA 3LPPA 4PMDA 2Q8XA 3CZJA 3T09A 4ATLA 3TTQA 4CVWA 1V6XA 1DWFM 4ZE5A 3T2OA 3VD9A 2VURA 3WMCA 1DWIM 3LPGA 2DEPA 1K9FA 3MV11 4UFMA 4DM2A 2XVNA 5BXPA 1NP2A 2NT1A 2J25A 3N1AA 1HJWA 2WBKA 1ISYA 5A6MA 1B3VA 1JL8A 2O9OA 4FLOA 4F66A 3GH4A 1I1XA 1OIFA 1FHDA 3U57A 3RIKA 2EPKX 5E0FA 2Y4SA 9CGTA 2A3BA 5C70A 2WWCA 3GTNA 5E6YA 2OSWA 5E6ZA 1VFMA 4ACZA 3ARRA 1LG2A 1CENA 2HVMA 1BYBA 1E4LA 1E0WA 1S46A 2PI6A 3VGFA 4UZSA 2YA1A 3D5HA 4D6JA 4JL1A 3VIFA 2BVTA 1PAMA 4MADA 1MQQA 4KWUA 3ECQA 4LYQA 1GOWA 2CERA 3ZT7A 2UY4A 2QMKA 4ML4A 3N11A 3BLKA 3J7HA 2VRQA 1J18A 3GM8A 5I78A 3BAWA 4P8XA 1UKQA 3WDQA 4JHZA 3WNOA 3WDPP 3PBGA 3W29A 2DIJA 5BXSA 4WSKA 1WPCA 1WDSA 4MB1A 1KCLA 3WNNA 3UR8A 4QLJA 3CUFA 3KL5A 1MVYA 3TTSA 4UFIA 4PUEA 3THDA 4CD4A 2CBIA 1F4AA 1E4IA 1Q6EA 3ARVA 1WKYA 1R86A 3UG4A 1C90A 4D71A 2YBTA 2B31A 3ARSA 4M82A 1QI3A 3N17A 4AW7A 2YJQA 1CGXA 4PMNA 1BVZA 4B3KA 4DUXA 5C8BB 2YDSA 2W4XA 1C7TA 1QVBA 2DSKA 2QPSA 5ABEA 4EKJA 1UR9A 1C8QA 4MB4A 3W26A 2VX7A 3OLDA 5GNXA 4YHGA 2D3NA 1QHOA 1VEMA 4UQ9A 1CECA 4ZXLA 3TTYA 4UQCA 3EDDA 3FAWA 2X05A 1CWYA 2BS9A 2WMKA 3L4ZA 1QI2A 2JFEX 2BY3A 1ITCA 1H2JA 3MO4A 4H04A 3IANA 1KQYA 1QBBA 4HOXA 5A6BD 4J28A 2ZUNA 5I3DA 1UWSA 4Z2KA 4JFVA 4MNJA 4AD2A 3GYCA 1HJUA 3CUJA 3BAYA 3VOCA 3IAPA 2OSXA 1SMDA 3T2PA 3HMCA 4XZBA 1W9DM 4AZHA 3MMDA 1GOKA 1KBKA 4DWSB 2FGLA 2DT3A 2VZSA 3VGBA 2XWDA 4CVUA 1QHZA 5HDRA 1L0PA 2D24A 1BPLB 3VGHA 5HBFA 3UG5A 1B3XA 3GDBA 3M7SA 2G3IA 4MAZA 4HZ7A 1GPFA 3BAKA 1NQ6A 3TP4A 3VD3A 1J10A 4M1RA 4U5IA 3GXFA 1HJSA 5A2CA 1O7AA 1R85A 3SUSA 3HU7A 2O9TA 4NZCA 1KR0A 3TONA 2WYSA 4W7UA 5AC4A 3T08A 4JFWA 4J3TA 2DH3A 1WNOA 3MUY1 1HVXA 1V02E 2BV9A 3AISA 4DM1A 4AYSA 1H49A 1TA3B 3KE0A 3SCTA 2OLHA 1KXTA 2GJPA 4K68A 2WVTA 2W61A 1UWTA 1FH8A 2JALA 1EO7A 2J4GA 3ZT5A 3ZT6A 4FMVA 2ZUVA 3OA5A 4D6EA 3KEHA 4FLQA 3VDCA 1KGXA 3AZRA 1PZ3A 2CNCA 3UG3A 4MB5A 1OINA 1GVYA 1OD8A 1BGGA 3WNKA 1V3MA 2E9LA 3L4YA 4D6CA 4F79A 1EDQA 3EMQA 4TX6A 5E09A 2VQUA 3VDAA 3MS8A 2YA2A 1MXDA 5BRQA 1VF8A 2J7EA 3OGRA 1JDAA 3FW6A 3VIPA 3WY1A 1J11A 1JNEA 5FOOA 3WDIA 4OIFA 3AIQA 1UD4A 5FD0A 1ZL1A 2D22A 2QV4A 1Q6DA 1UKTA 3AMCA 1QBAA 1UQZA 1JD9A 3VIGA 1KXVA 1I75A 2J8GA 1GZJA 1HF6A 4FF5A 1V3KA 1QNRA 1YQ2A 3AHZA 2PWDA 4V2XA 1J01A 4HMCA 3GBEA 2CBVA 3UETA 3WIJA 4H2CA 2OYMA 1J0JA 2WHMA 3K4AA 3AI0A 5EFFA 2W63A 1UZ4A 1PEZA 5JIPA 3MUAA 3ZJKA 5CZKA 5FKYA 4BZYA 1EDGA 3D3AA 2GK1A 3CMGA 2PBGA 1OBAA 1C91A 3A6OA 2A3CA 3N9KA 2O9RA 2ZX5A 4WIWA 2XGIA 2Z1SA 2XVPA 4ATWA 4C7GA 3W37A 3T0BA 3RM8A 1B1YA 2Y2WA 1XCXA 4AY1A 3DC0A 1EOMA 1VAHA 2XIBA 1XYZA 3U7VA 1JXKA 2CESA 3G6MA 4WKFA 4CGTA 2WCSA 2VCAA 1RD6A 1E4MM 5CSUA 1KBBA 1E6QM 4IPLA 5ABHA 3VILA 5ABFA 1X1NA 1OD0A 2E4TA 3BAIA 1CLXA 3AHYA 2VX6A 2WZHA 1DEDA 2TAAA 1E6ZA 3II1A 3VD7A 1VRXA 1LL6A 2GVYA 8A3HA 1QOXA 2CXGA 4CCCA 1IV8A 3APGA 3VMNA 1EIBA 4AD1A 1W1TA 3NSXA 3N13A 4PCSA 2PF0A 3QHNA 1K9DA 1SYTA 3GH7A 4W85A 3W38A 1K9EA 5IDIA 2GDUA 4H7VA 3GXDA 2D1ZA 2PWGA 2D0FA 1GORA 2D0GA 1HJXA 3VNYA 5D9OA 3F5JA 3W6LA 1NWRA 4UFJA 3VU2A 1WAWA 3MMUA 2ZUUA 1QI0A 4AZ6A 2W92A 5D8WA 1ODZA 2X0HA 6CGTA 8CGTA 4CN6A 1ZU8A 3W4RA 3ZM8A 3PTQA 4D72A 4CD6A 1Q6CA 4QLKA 1HKIA 1E6SM 1ZJBA 1GONA 1PPIA 3CTTA 4W86A 3MSGA 3WH8A 1JXJA 3W24A 1G94A 2E3ZA 4B16A 3WQVA 2WK2A 2A3EA 3CMJA 1UH2A 1TR1A 4L4OA 3FY1A 1EQCA 3I3DA 4D1IA 1ZB5A 3NUKA 3K4DA 2G41A 1VFOA 1J12A 2UY2A 2OYLA 1ISWA 1C93A 3KL0A 1CXEA 1OT1A 3L2LA 1V0KA 1UH3A 1R87A 1NARA 3RPMA 3RM9A 1KWKA 3WEZA 2VO5A 3BLPX 3FN9A 3B9EA 1JZ6A 3NSMA 2BHZA 1WB0A 1XRVA 3ZJ6A 3AYRA 5BRPA 2GJRA 5A8OA 2FHBA 1UA7A 3ZJ7A 4NF7A 3HN3A 3MV01 1QPKA 3VPLA 2XJ7A 1CEOA 1B31A 2CIPA 1U2YA 2G8ZA 4Z2HA 1UWQA 2DSVA 1KXHA 3ARZA 4XUYA 3AXIA 3ZR6A 4ZENA 4JFSA 1KFWA 3MMWA 3AIBA 2WANA 4JKLA 1JZ2A 3CZLA 2J78A 1UD8A 3VIIA 1FH7A 2EQDA 1UR0A 1XGZA 3E1F1 3U7BA 1E6XM 3QHMA 1JYNA 3GNPA 2FH8A 2C7FA 2YL8A 3WL1A 4D6GA 3A3HA 3A4WA 3AMGA 1IZJA 3WNMA 5ABFB 1XH2A 1HNYA 1V3HA 3SUUA 1ZBVA 5JIWA 4AZCA 1NOFA 2F61A 4TVDA 3S2CA 2J75A 1SMAA 1BHGA 1HKMA 2ZWZA 3WDRA 1OGSA 4H41A 4DUVA 5LYRA 4PEEA 3PTMA 2WC4A 1BAGA 1CXLA 2J7DA 1CGYA 1M01A 1NH6A 4MDOA 1NWUA 4AC1X 4D6FA 1LWJA 1W9VA 4QLLA 4BCEA 4URIA 5M17A 5JUVA 1J0HA 5CLTA 3GXMA 2E8ZA 2CPUA 3SCRA 1CZ1A 1BG4A 1PX8A 2RGLA 1EDTA 3CZKA 4M8UA 3VX0A 3CUIA 1X6LA 4LYPA 3RCNA 3PZMA 3PZIA 1HT6A 1W1VA 3EBVA 5A8QA 2D20A 2YL9A 3ARPA 4ACYA 1ISVA 2GDVA 1B30A 1XCWA 3IAQA 3WH6A 4J3WA 4S3JA 4U3AA 4M81A 3DYMA 1MW2A 1UR1A 1G1YA 1FP9A 3A4XA 1FH9A 3VIKA 1GJWA 2G3MA 3MKKA 1BQCA 1QHPA 2NSXA 2EPLX 6TAAA 2YOCA 1E4NA 1EA9C 4CN1A 2X8RA 1KWGA 1I1WA 1MWOA 2VVSA 2WW5A 1KGUA 2RGMA 2WHLA 2WKLA 2PC8A 3BCDA 3WF2A 4U2YA 4PRWA 1JF5A 1TE1A 5I5RA 1GCYA 5EFDA 5C71A 1O6IA 1WZKA 2QLYA 4HMDA 3WH7A 3F5KA 3L2MA 1C3FA 1VB9A 2CKRA 4WKAA 4BQ5A 1UR4A 3CZGA 5DO8A 2O92A 5E9AA 1IZKA 4MB3A 4TVUA 2VX5A 2E9BA 1C7SA 2UWFA 5CSYA 1G0CA 3WNPA 1JZ7A 4X9YA 4BQ3A 3BSHA 1J0KA 4JCLA 2XWEA 1E5NA 1E40A 2GFTA 2JEPA 4PMOA 1OB0A 1GVIA 1H41A 1CXIA 5FL1A 3DYPA 1KGWA 3WF3A 3CUGA 1M04A 1W1PA 2NT0A 1G01A 5BXRA 3AXHA 4J3SA 1B0IA 2VL4A 2WMGA 3RO8A 2BNJA 2QF8A 4S3KA 2VRJA 5FL0A 2F2HA 1VEOA 2DSZA 2VMFA 1MXGA 2VQTA 2WC3A 2VZOA 3VX1A 1UWRA 3LPOA 2HISA 1OWQA 3AIEA 3LPFA 1UD6A 2WM0A 4UTFA 2AAAA 1U30A 4OKDA 3POHA 1XD1A 3K46A 2BHUA 2WZEA 4XB3A 5BXTA 5CJ5A 4Q22A 4FLSA 2W5FA 4IPNB 4F9JA 4E4PA 1Q4NX 1V3LA 1ZJAA 4KRUA 1KXQA 1Q6GA 4LQ1A 4J3XA 2X09A 1LQ0A 3CZ8A 4UQBA 3L4XA 5IXEA 1XSJA 3I3EA 1JAKA 1A3HA 3ZOAA 3AMDA 4GQQA 1X6NA 2WVUA 3S6TA 3AROA 4AZCB 4JL2A 4PTMA 3PZQA 1CGTA 1XHGA 2FH6A 2ZUSA 1C92A 4OBSA 1HKJA 2DIEA 1A47A 1PIGA 2XTKA 2ZXQA 5AYIA 3UR7A 4QCEA 3PZGA 1EH9A 3A4AA 1D7FA 1AQMA 2W67A 1GUVA 2E0PA 2YDRA 1AMYA 1GOOA 2Y8KA 1MFVA 4TVCA 1JIBA 5E0CA 4EANA 1QNSA 2EEXA 3WQ4A 3IJ8A 1TVNA 3WUBA 3NSNA 2V38A 1UQYA 4P8UA 1LG1A 1W9UA 3PHAA 2YL6A 3EMZA 3NDZA 2YDQA 3CLWA 4LXFA 1BGAA 1R7AA 1MYRA 3F4VA 2WZIA 2IXVA 3AJ7A 4IM4A 4MDPA 1HJQA 1K9TA 1NOWA 4PMUA 2YKKA 3PZTA 4AZ5A 4C7DA 4C7FA 2XVLA 3RMEA 2ZUTA 4X0VA 7TAAA 5IFPA 1YHTA 3VM7A 4RE2A 2ZIDA 3L4WA 4HA4A 1E6NA 2DT1A 4AIOA 2WHKA 5GQBA 1W32A 3GZAA 4PBGA 5E70A 3WFZA 3VKKA 3QGVA 4JHOA 5M3WA 5EB8A 5A6AA 2GJXA 2X2YA 3CPUA 4W8LA 4P8VA 3ZMRA 4WSJA 2GK1B 2WMIA 5A6JA 3VMOA 2WMIB 2WSKA 3BCFA 1OCQA 1G5AA 2YLLA 3WH9A 5D9NA 1DWJM 1QW9A 1GQLA 2DT2A 1JZ3A 2GJXB 2WWDA 1W3LA 4A4AA 3CHEA 1Q6FA 4P7QA 2F8QA 2VVNA 1NWTA 3VGGA 3POCA 1JNDA 1QNPA 2BY1A 1OIMA 1LL4A 3B9DA 1D2KA 3W28A 1JYXA 4LPCA 1HL9A 1WZLA 1XYFA 5KZ6A 5A3HA 5DT5A 2VX4A 5IHRA 1E1FA 7CGTA 3GH5A 4WK9A 4PMZA 1H0GA 5CPSA 2XUCA 1E9LA 1B3WA 4U5KA 4BQ2A 1KQZA 2EPMX 2J7FA 4A3HA 4AD4A 2QPUA 2PWHA 3VIJA 3AICA 4LX4A 4KGJA 3W82A 3ALGA 3K8LA 4H8UA 4CU7A 3WQ8A 1VENA 1JZ5A 2IXUA 3SCOA 1PBGA 1H09A 1ZBWA 1TCMA 2YBUA 1NP0A 5A95A 1JI2A 3O9NA 1TG7A 3GNOA 1PX3A 5KEZA 4EK7A 2AOSA 2JEQA 4OUEA 1TZ7A 3OGSA 2VT0A 2OWWA 4BF7A 3B8SA 1W3HA 2CBJA 3CZEA 3B9AA 4X0NA 3AIWA 3FHQA 1PX4A 1E6PA 5AC5A 3PZNA 2W66A 3SCVA 2ZWYA 1OM0A 1MW1A 4J3UA 4MPKA 3CHCA 4YPJA 1NOUA 4CD5A 1W2PA 3M6DA 3WD2A 1E56A 1H4PA 1UKOA 2VZUA 5A69A 1E0VA 1ISZA 5BCAA 2C0HA 5A1AA 3VMPA 2FGZA 3BXWA 1GHSA 4M56A 4WF7A 1VEPA 4AEFA 1CLVA 3OLEA 2W62A 1GNXA 3WSUA 5I0DA 1ZBCA 2D2OA 3VO0A 1P6WA 1CXFA 1HN1A 4OOZA 1BLIA 3O6AA 2E9MA 3HJEA 1B9ZA 2DSUA 1EHNA 4P8WA 4AZBA 3QHOA 1WDQA 2O9PA 2D3LA 3ARXA 2VOTA 3KL3A 1GQKA 3NJ3A 3BC9A 5AY7A 3WBAA 3LMYA 1W3JA 2OWCA 4WLCA 4UOQA 4E8DA 3OB8A 3IK2A 2YL5A 2V3DA 3CHFA 5EMYA 1XSKA 2EO7A 2EXOA 4MJ4A 1UWUA 1MFUA 4HA1A 1RPKA 4KRTA 3N18A 3BAJA 3EDKA 2MANA 2WMJA 1UOKA 4Z2GA 3TTOA 3WMBA 3EYPA 1CPUA 2V5DA 3ZO9A 4OOUA 2BVYA 3ARUA 3ALFA 4UQAA 2WVVB 1M53A 3PZVA 3U5YA 3WUGA 4HPHA 3OLGA 1GOMA 1H11A 2XFYA 4NI3A 3NIYA 3PZ9A 2XM1A 1EXPA 4PTXA 5D8ZA 1V6YA 3VDHA 4A3YA 4E8CA 1J0IA 4PN2A 5CGTA 4HA3A 4UZUA 4GQRA 3ARTA 4F9DA 3ARWA 5CGMA 1XH1A 1V0NA 4W8AA 3FHAA 2EPOA 3NDYA 4HP5A 4P7NA 1IT0A 5I79A 1UHVA 1W3KA 1LJYA 1KCKA 1E6RA 1JFHA 1R8LA 4UQDA 1OGBA 2CKSA 3W53A 1CTNA 4TTGA 4Y7EA 4GI6A 2DQXA 1G9HA 3WQ6A 3IJ9A 4TTUA 1V0LA 3N12A 1E70M 4XV0A 2VTFA 1WP6A 1C8XA 1Y7VA 2XHYA 2BXYA 3SCWA 1WCGA 5A2AA 1HP5A 5M5DA 2VC9A 2XG9A 4KGLA 4AZGA 1TMQA 1TFVA 2ZXBA 3OZPA 2E40A 1JG9A 1VFFA 2XVKA 3THCA 3SUVA 4PMXA 2G3JA 1FP8A 1B3ZA 5A6KA 1HJVA 2WSPA 3BMWA 4YN5A 1ZS2A 4TOQA 4M80A 3EDEA 4TXEA 1VFUA 1UR8A 5HPOA 3QOMA 1UD3A 5BYWA 2YLAA 2XVGA 5D9MA 5A8NA 1JYWA 1V02A 4HU0A 2G3NA 2QMJA 3WL0A 2ZX9A 4XZWA 3AQUA 2GSJA 3M07A 1GOQA 3I3BA 3JUGA 4AD5A 4N42A 3MSDA 4JZ5A 1RP9A 4TX8A 1CXHA 1CGUA 1E0XA 2CEQA 2CCRA 2EBNA 3VIMA 4MJ2A 2YA0A 3KWXA 1WE5A 4PMRA 2V3FA 3AHXA 1TUXA 4NRSA 1DWHM 4AZ7A 1CXKA 5A2BA 3WFLA 2WVVA 4GPNA 5D4YA 4AD0A 3BGAA 3MU7A 1BVNP 4AD3A 3T0DA 4UNIA 3T0AA 1UYQA 4W7WA 2GUYA 2E8YA 1HKKA 4JKKA 4P7LA 1MQRA 4PMVA 5ECUA 3SIMA 3WEMA 4AIEA 4LYRA 3N04A 4D6DA 1WDRA 2ZICA 3BAXA 3VM5A 3EDJA 3CGTA 1FHLA 3WEOA 1FA2A 3AS2A 4GZJA 2WB5A 2WCGA 1XD0A 4GXPA 2OSYA 2VRKA 5HPCA 4AISA 2PWFA 4U3CA 3DHPA 2C8NA 3AZSA 4DUWA 5BROA 1MQPA 2IUZA 1PJ9A 3WF1A 1W91A 3AS0A 3K8MA 1L8NA 5IFTA 2J7HA 1V6WA 2DH2A 1ZBKA 3VVGA 3SEPA 3PTKA 4Q7NA 2BHYA 3RM4A 4PUDA 4CD8A 1MW3A 1BYAA 2FHFA 5IHSA 1D3CA 1K6AA 3AMLA 5CQ1A 3OZOA 2J74A 2G4FA 4NRRA 2D23A 2EJ1A 4M24A 1HL8A 3M46A 3OLIA 5LA2A 3MUZ1 2D0HA 2JIWA 1CBGA 1DWGM 3FNDA 3WBEA 3WF0A 5JBFA 3WQWA 3AHVA 5GPRA 2UY3A 2EPNA 2XIIA 1QNQA 1UKPA 4W8BA 4GO9A 2ESCA 4UQEA 3AIUA 3BMVA 5FIPA 5HOSA 2DPEA 3WD0A 1R7OA 1JF6A 1BG9A 3AS1A 1C8YA 1UA3A 1GW1A 3OIHA 1H3GA 3AHTA 4EAMA 3WD4A 2VJXA 4QDMA 4W5ZA 1E71M 4RL3A 3WNLA 4WJXA 4B3LA 4PYSA 5EBAA 3VTRA 3L4VA 4IISA 4HOZA 2VR4A 1VBRA 4R27A 3SUTA 3FAXA 1XV8A 4ATDA 1M03A 4FK9A 4JFUA 3CH9A 1HP4A 4UFHA 2WPGA 3UERA 4HZ6A 1DWAM 4CU6A 1V03A 3CBWA 4ZE4A 1QNOA 3SCNA 1FFRA 1OSEA 3VIHA 2VZVA 3ZR5A 5M03A 4BS0A 5I24A 3AZTA 4AEEA 1XC6A 3EMCA 5JBDA 1JI1A 4GZIA 4HPGA 3O2LA 3K1DA 2CBUA 2JIEA 3OGVA 1V08A 1J0YA 3ZSTA 4QFUA 3AOFA 3VD5A 1UG6A 1VBUA 1VJZA 4U2ZA 1JD7A 2JE8A 4UOJA 2PBOA 1BYCA 1CDGA 2ZOXA 4OJYA 3WN6A 1AVAA 2A3HA 3SCSA 1E3ZA 1DHKA 4FLRA 2ZX7A 4CKQA 3KZSA 1QW8A 4J27A 3WF4A 1ECEA 1GQIA 2A3AA 2BVDA 1FOBA 3PN8A 4W89A 1UH4A 3W81A 4GZEA 3WDHA 2J7CA 3ZIZA 4DWSD 3AIRA 3AXXA 3GBDA 4F8XA 1RH9A 2CETA 6A3HA 4CUCA 1H1NA 1QI5A 3VDBA 4BQ4A 4PCTA 3WQ5A 1W9XA 3DHUA 4GKLA 2VR5A 4UFLA 4B9ZA 3NYDA 2XFRA 2OYKA 4H8VA 1LWHA 3BSGA 1PIFA 1M7XA 2CITA 4EE9A 3BH4A 2CHOA 1F4HA 3GXIA 1HXJA 2BY2A 3A47A 4CN4A 1U33A 1TA3A 1EOKA 3DECA 2WKGA 2XSAA 3QOKA 2CHNA 3SCPA 1B90A 1ISXA 4M29A 4J7RA 4RE4A 5HXMA 4YHEA 5A94A 1NWSA 4MNMA 1UD2A 4KMQA 3AIVA 1DP0A 2OWXA 4ZXOA 1V6UA 4HTYA 5AYBA 3WKZA 5A6BA 3FXYA 3UCQA 4W5UA 3WUFA 5LA1A 2PWEA 2DDXA 3TOPA 2J7GA 4OBRA 4IUGA 3VGDA 5D9PA 4PSRA 2Z1KA 1SR0A 1QI4A 3PZOA 1JDCA 1W9BM 5I23A 4DWSC 5HNNA 5CG0A 2Y8VA 1V3JA 3CHDA 3PZUA 1ITXA 2WLZA 2FHCA 4KH2A 2UY5A 4HZ8A 2XSBA 4CD7A 4BA0A 4MTVA 4JCMA 4L4PA 1KR1A 2J62A 2VCBA 3MUIA 3VD4A 3ZJ8A 4QAWA 3RILA 2BXZA 3VGEA 2ZUMA 4H8HA 4JKMA 1E15A
chains in the Genus database with same CATH superfamily
5TBOA 2OTDA 3E2SA 3C3NA 4LC6A 1PV8A 3LXBA 4OZOA 1WUFA 2YIHA 1UD5A 2VZTA 3UXAA 4DZIA 2CYGA 5DQPA 1N82A 1DE5A 1ESWA 1MW0A 1W1YA 3T8LA 2ZRWA 4DB7A 2BP1A 1JDDA 4FNPA 1K7EA 3G2GA 3RK8A 3TSBA 3L68A 4ZEPA 3QY7A 1IR2A 4AWSA 2X7WA 5CPTA 1NSJA 4ZFMA 2W9MA 4V27A 3SUWA 1ADSA 3W27A 1HIZA 1QTWA 1F6PA 3QVQA 1DIOA 1E55A 4W84A 3WLJA 1K03A 2H90A 6TIMA 3ZQ9A 2UV8G 3Q65A 2ZX8A 4OE7A 4XVDA 2OCZA 4ZQMA 1LDCA 2Y24A 1YPXA 1QU4A 4UCFA 3CL7A 1CGVA 1GOIA 1JUKA 5TD4A 2VYOA 4NNBA 2HV5A 2QVHA 3A9BA 4B15A 1K8XA 3IJ7A 4I9MA 1BF2A 1OT2A 4RKAA 1ONXA 2Z24A 2ZXDA 4I6VA 3DYOA 4LNCA 3W0KA 1ZUAX 1EO5A 3WD3A 2WSQA 2ZX6A 1S1PA 4AYGA 2DUXA 3AMKA 1QUMA 4HN8A 1KV8A 5GNZA 4CQDA 1ZALA 1DTUA 1PZ2A 4RE3A 2OLAA 1G7UA 4U31A 4Q8QA 1A4LA 4NZ5A 1HX0A 4LGXA 4IMEA 3SCQA 4PTWA 3U5UA 4CU8A 1JZ8A 2F84A 1OQFA 1US2A 4U33A 4GX8A 3G1VA 4GCXA 3L4TA 2R1PA 3OODA 4J3VA 1XIHA 4NZ3A 2IKIA 4PMYA 2E1DA 3IS4A 2B7OA 2E77A 1PL9A 1PKLA 4U4MA 1IF2A 2PU0A 3H2AA 4TUFA 3KOZA 1FFQA 3C6CA 4Z0SA 1BSIA 1IHIA 1VC4A 2AMXA 3W7KA 3ZLHA 4ICCX 3WDJA 1OVDA 3CC1A 1E5JA 2XPKA 4GNVA 3MUCA 3EB4A 3GXTA 2XGBA 1W9PA 4ZOAA 1SFSA 3KX6A 2D73A 4HU8A 2VI0A 4PA8A 1NF7A 1JGIA 5HR6A 3ARQA 1EJUC 4FF7A 4QR6A 3KRSA 4C1NB 1T40A 1WQ5A 3T9PA 2RFGA 3GK0A 3G18A 2KX9A 3NM3A 1UZ1A 4P61A 4O15A 4ROQA 4JFTA 5EA9A 3WELA 1LM1A 1ZP3A 4JTLA 2QHAA 4JAWA 4Z2JA 5LHFA 5BWFA 3VCNA 1GJUA 3HTWA 1TPDA 3PAOA 1PO9A 1F5ZA 3BPWA 2V5CA 4RDWA 2J77A 3OG2A 1R9YA 5CC5A 4O17A 1YE4A 2PDNA 4S23A 4W93A 3LPPA 3CIWA 4PMDA 4UXDA 4CVWA 4PODA 4GQBA 4GQGA 1DWFM 3T2OA 3VD9A 4EP8C 3WMCA 4PFMA 1K9FA 2OFJA 3WLHA 2XVNA 1NP2A 2NT1A 3V16A 1ISYA 1DTNA 1I1XA 2Y63A 1OIFA 1Y0EA 4HCHA 1MZHA 1WXZA 3FXGA 1XXXA 4UCGA 3QZEA 4Y9PA 5E0FA 3IRDA 1HG3A 1TPC1 3IRSA 4YYCA 2WWCA 3CB3A 3R79A 5D33A 1VFMA 4ACZA 3EX6A 1E4LA 1E0WA 1DJQA 1OCJA 1BRLA 3C56A 3VGFA 4O1BA 2YA1A 3D5HA 4D6JA 3S6DA 2BVTA 3CPRA 3G3DA 4M51A 1MQQA 3ECQA 2ZA1A 4OVXA 1GOWA 2UY4A 4S39A 3N11A 2VEPA 3MP3A 2QYGA 3GM8A 3BAWA 1Q63A 3IIPA 5EMLA 3TYCA 4EACA 1UKQA 2XIMA 3WDQA 2DIJA 3A22A 2A5HA 3WNNA 2AKMA 3R25A 1ITUA 2GQAA 4GBDA 3KL5A 3WJYA 1SO4A 2NX9A 4PUEA 4C6LA 1W5MA 1WKYA 3UG4A 3R58A 1L8PA 1X38A 3WBXA 4IL2A 3ARSA 4M82A 4AW7A 3TIMA 4JQAA 1SW7A 2ZTKA 3P6LA 3GO2A 4B3KA 3M16A 5C8BB 4LVFA 2ZE3A 2QPSA 1E51A 5ABEA 3PNUA 1UR9A 1C8QA 4MB4A 2E67A 5GNXA 3ITXA 1SGJA 4FNSA 2B7PA 3C2VA 3TTYA 1I45A 4A8RA 3W7CA 1NTHA 4WQ6A 4DYKA 1QI2A 1VPQA 3LD5A 1ITCA 1H62A 3PNZA 2ZZ5A 2BB0A 4QQ3A 1KQYA 4HOXA 1X7FA 5I3DA 3PS7A 2PC4A 4ZOBA 1XUUA 1MUCA 2HXTA 3KW3A 5A8GA 3BAYA 1M9HA 4JR5A 4B2DA 5KZMA 3TU9A 1PIIA 3TYZA 2A6NA 2WV8A 4XZBA 3PF3A 1HO1A 1WKEA 3MMDA 5D05A 2DU2A 1RCXB 2H9AA 1QRQA 1MO0A 3VFCA 1TKKA 2H3DA 4CVUA 5HDRA 3SFWA 3DG3A 1L0PA 1YTKA 4CEXC 1BPLB 3FVMA 5HBFA 3KRUA 2V5JA 1W1ZA 2QULA 1DQXA 4RDZA 4JTQA 3MJYA 1H7NA 3BAKA 1NQ6A 3MSRA 5GVJA 1J10A 4IGHA 2FGBA 2PP1A 3BARA 4U5IA 5A2CA 1HJSA 3GU1A 4QISA 4H4IA 5C7VA 4NZCA 3TONA 5AC4A 3LI1A 2DH3A 4XKYB 2D69A 4YLWA 4HHHA 1I60A 1N8WA 2BV9A 4HD5A 4L56A 5K2ZA 1H49A 3IARA 2VEGA 4QRNA 1H7OA 2A1YA 1YDOA 5C9RA 2Z6IA 4K68A 2J9XA 2ACRA 2ATMA 2JALA 1RALA 4O1DA 2J4GA 4WDUA 4FO4A 4FMVA 4FLQA 3P5YA 3KXQA 1Q8JA 2PUZA 3IWPA 1OFBA 2PDHA 3IIVA 3AZRA 3AUOA 4IFRA 3UWYA 2CNCA 1Q6LA 3PG8A 3ELFA 3WQDA 3NURA 5H8MA 4IUOA 1IGSA 4TX6A 3VDAA 3MS8A 4JN7A 3DGBA 4HHLA 2YA2A 1Z44A 3LUTA 2P5NA 2OO0A 4NAEA 1VF8A 1AD4A 1FHVA 3VIPA 2Y1HA 1JNEA 4Q7BA 4FX7A 3AIQA 1J93A 3C0LA 1Q6DA 1UKTA 4YL2A 1QBAA 2BG5A 1KXVA 4NI8A 1RHCA 1V3KA 4FX6M 1QNRA 1YQ2A 2PWDA 3HPZA 1OG6A 4H2CA 3W3OA 1BEUA 4G6CA 4C1LA 3ES7A 1OFEA 4JXCA 2ZDSA 1GVRA 3AI0A 1B9BA 4N6EA 2D2HA 2DUAA 4IL0A 1ZNNA 1EDGA 4A29A 3W7DA 1Z6KA 2Z28A 4JTCA 2A3CA 1JRCA 2O9RA 4TX9A 2XGIA 2XVPA 2QCDB 4J35A 1DQUA 1J79A 1XKJA 3GZ3A 4I5XA 3LLFA 3DC0A 4GRSA 3LV6A 2GVLA 2QUVA 1XYZA 3G3MA 5TAOA 1FTXA 1JXKA 3U0HA 2HTMA 2PDQA 1EKOA 2VCAA 2VFEA 2YCJA 4PTDA 2XH0A 5ABHA 1OX6A 3TN3A 1OD0A 2OT1A 1UC4A 3AHYA 4DO7A 4E6MA 4HU3A 4Y8FA 3BZJA 3II1A 4Y9AA 3RF9A 3B0PA 4L80A 4GE8A 1OYCA 2GVYA 1IEVA 3P60A 8A3HA 2V6AA 3UY7A 4EPEC 1IV8A 3APGA 1SO5A 3NSXA 2PF0A 3QHNA 4FP1A 1SYTA 4BR1A 1ME8A 3GH7A 3LGEA 4FXFA 4W85A 2QUTA 5IDIA 2GDUA 3GXDA 3M6YA 2HNHA 1HJXA 4JNYA 1AD1A 3W6LA 1NWRA 3CWNA 4UFJA 2QIIA 1WAWA 1DJYA 3MMUA 2ZUUA 3I68A 5D8WA 4XZLX 3AWNA 1DL3A 4CN6A 1GYMA 1Q4WA 5AVNA 1ZU8A 1X7IA 1K1DA 2PTWA 1Q6CA 4FB7A 5XIMA 3PBYA 4J40A 1PKYA 3DAQA 3MSGA 4W86A 4JTKA 3W24A 1G94A 2CZVA 3THUA 1TR1A 4L4OA 5AHNA 3LNPA 4NX0A 4DNHA 4DUOA 3NTYA 4TU1A 1OT1A 3R0UA 5A5WA 4QXIA 2A2IA 2FPTA 1UH3A 1R87A 4V1YA 3RPMA 4F2TA 3RM9A 3WQCA 3A24A 4AVOA 3FN9A 4WJ8A 1W1IE 3ZJ6A 3AYRA 1TCDA 4XBJA 3W1PA 1RY8A 5CSSA 3ZJ7A 4O4VA 3PJXA 1XYCA 3APTA 4A21A 1OF6A 1UBPC 3MI3A 3N25A 1EP2A 4AVNA 2NWRA 2DSVA 1KXHA 3AXIA 5CPOA 3KBMA 4JFSA 8TIMA 2ZZ2A 3BW2A 3MQTA 4JIRA 4JKLA 3SN4A 4A3QA 3GDLA 1EPVA 1GTHA 4MZ1A 1MUMA 3A3HA 3AMGA 3V0TA 1HNYA 1A5LC 3S2NA 3MHFA 4KEMA 1ZBVA 5JIWA 1EGVA 4JQ3A 3UXDA 5DMNA 4EIVA 2F61A 3N4EA 4TVDA 1KKOA 3S2CA 2Y5SA 4O14A 4KT2A 3V0SA 3VE9A 2J75A 1SMAA 1BHGA 1PZ1A 4P5UA 3KVKA 2YYTA 4H41A 4DLFA 1I6NA 1FWIC 4HSHA 1OG0A 1BAGA 2IPWA 4D6FA 5DLCA 2QW5A 1TO3A 1M68A 1J0HA 3MI2A 4F0RA 4O0ZA 1RA0A 4GH1A 2CW6A 1CZ1A 1S1RA 3CZKA 7ENLA 3RCNA 4BHYA 3XINA 1HT6A 4YU1A 5FEWA 5A8QA 2YL9A 2Z2UA 3ARPA 4ACYA 4PC8A 1B30A 1L6WA 3KP1A 1KTBA 3S2LA 3QTGA 1REQB 1Z9AA 4HPNA 3KZPA 2ZVRA 3R0KA 1OADA 3FYPA 3DYMA 4ZMGA 3QY6A 1FH9A 3GYEA 4E8GA 2BLEA 1Q7MA 3MWAA 3TN6A 3W2KA 1E4NA 4CN1A 1ZCOA 2DZBA 3DFQA 1R0MA 1XW8A 3DG7A 4NT0A 4PRWA 1TE1A 2BGQA 4OFCA 5EFDA 1GG0A 4W9TA 3CUXA 2OU4A 2ISWA 3T44A 3GHTA 1VB9A 2CKRA 4HNNA 2OQYA 2Y88A 3CZGA 4GOAA 1ONEA 1R9ZA 3QN3A 2E1WA 4TVUA 4DBSA 3FYYA 5DXXA 5AC6A 1QFEA 2UWFA 5CSYA 3WNPA 1QJWA 4Z42C 4X9YA 2TSYA 1EJSC 2XWEA 2BSLA 3PBUA 1E40A 2GFTA 2JEPA 4US5D 1H41A 1CXIA 1VYSX 3K4WA 5DELA 5AZ1A 4XZNX 3IGUA 1ZZMA 4XBKA 4S3BA 1I2QA 3E38A 3B8IA 3NL5A 2QF8A 2VRJA 3RU8X 5LHEA 2VMFA 4O1AA 1MXGA 3R5EA 2QCHA 2WM0A 1WKFA 4R7JA 1RBOB 4OKDA 1L9WA 3H7UA 4HSNA 4C6QA 2FDSA 1EC9A 5EYWA 4CEUC 4DYEA 2KZHA 2QVNA 4LAZA 1XIMA 1PHWA 1ZJAA 1Q6GA 4NP7A 3MBDA 4ADTA 5AHIA 4M0XA 1XISA 1CT5A 4UQBA 3RXZA 4RZBA 1OX4B 4D2JA 1JCYA 1WOBA 1XSJA 1UR3M 3ZOAA 4ZCWA 5LGZA 3M0YA 4AZCB 4JL2A 2FZMA 4PTMA 3I7SA 3N6HA 3V7PA 4HNTA 3FEQA 1A47A 2NV9A 3CTLA 3M5VA 5TQLA 5AYIA 1LUCA 3WFAA 4ML9A 3O6DA 4IHCA 2O7QA 4LVBA 2E0PA 1AMYA 2PDYA 2DIKA 1JIBA 5E0CA 3S8HA 3QR1A 3W2JA 4C6PA 3O0KA 1LG1A 2GZXA 1FCVA 2PPGA 1XIGA 4C6IA 2YL6A 1EYEA 3EMZA 5HAOA 4JX5A 2PA6A 1P0KA 2Y62A 1H50A 3KDOA 3AJ7A 1TJPA 4MDPA 2TRSA 1P7TA 5CG7A 2QPXA 1NOWA 4PMUA 3GR4A 1FBAA 4NJIA 1W6TA 3OW1A 4AWTA 4NZ4A 2G97A 1YPIA 3EOEA 1UZDA 4X0VA 2Z00A 3FFSA 3NG3A 2JKPA 1PHQA 2RKXA 2ZIDA 4AMAA 3BQ6A 4HA4A 4PUNA 5DBTA 3WFZA 1E9ZB 3VKKA 3FA5A 3QGVA 3GFYA 3TFXA 3CPUA 1FDZA 3UJSA 4P8VA 4L1WA 4OHQA 5A6JA 3CHVA 1ME9A 2G0WA 5KZDA 5D9NA 1DWJM 3B9NA 3QMTA 4G1NA 1JZ3A 1UIOA 4NL1A 4A4AA 4P7QA 3NWRA 4M6QA 3TYBA 3VGGA 2QCGA 3POCA 1JNDA 3H2FA 3FJ4A 2DJLA 2Y5JA 3TX9A 2AL1A 5K7JA 4ROPA 2RDXA 1SFLA 1XYFA 3IIZA 1LZOA 2INZA 1KM5A 1BSLA 4JBRA 4N9CA 2QJGA 4WK9A 5KTLA 5HUOA 4TV5A 4UTTC 4PMZA 1H0GA 1E9LA 4X61A 4QG6A 1P7TB 4BQ2A 1KQZA 1OZQA 2J7FA 3TJLA 1JZ5A 3IK4A 3TW6A 1PBGA 1DPMA 1ZBWA 4Q6JA 1NP0A 2CC0A 3PANA 1PX3A 4JNZA 5HUPA 1TZ7A 1M5WA 1O1ZA 1QPOA 2VT0A 2OWWA 4BF7A 3H2CA 1W3HA 2CBJA 4LBUA 5HJYA 2GWNA 4X0NA 5C9ZA 1PX4A 1RY0A 1J6PA 5CBBA 5AC5A 3PZNA 1JPIA 3TH6A 2W66A 2ZWYA 4POCA 4LALA 4J3UA 4YPJA 3ANVA 1W2PA 3M6DA 2Q01A 4H9MA 2VZUA 3V36A 4GG9A 5JVLA 3L67A 4M56A 1VEPA 8RUCA 4U10A 3V5CA 3WLKX 2W62A 3F4WA 3MW7A 4ZODA 3NA8A 1ZY9A 3F2CA 1TUFA 1P6WA 4Q8NA 4LSBA 2DZTA 1B9ZA 4PCPA 2GDQA 3QHOA 3G1SA 4GUFA 3OOQA 2D3LA 3TJ4A 3MI6A 3C0SA 3YPIA 3UD6A 2IS7A 2OWCA 3C0QA 4F0LA 5ECVA 1A0DA 2P1FA 2Y61A 4KEZA 2EXOA 4RCXA 1T8XA 3UU0A 3MPGA 1RPKA 3B40A 1MI3A 3TE9A 2MANA 4AAJA 2WMJA 4WCJA 3EA3A 3HQ1A 1G7VA 1LRNA 3EYPA 2RH9A 3CL6A 1TV2A 3ARUA 4UQAA 3RLVA 4G7EA 4HPHA 2XH2A 1H11A 3NIYA 4LS2A 3MZNA 2XM1A 3KBWA 3C5QA 4MM1A 1QCWA 1EPXA 4HHPA 4C60A 3U2OA 3GFXA 5CGTA 4F9DA 2EAWA 1JCMP 1B5TA 2GGHA 3EKZA 2EPOA 2A7RA 2OZ3A 3NDYA 1XGDA 4HP5A 3A13A 3UJ2A 4GUIA 3TK7A 1K4HA 2XN0A 5XINA 2AL2B 2V82A 1E6RA 1ZTVA 1R8LA 4UQDA 1O5QA 3LN3A 3W53A 3DDMA 3D3FA 4B91A 2DQXA 1NJJA 1S5MA 1E70M 1SO6A 2ZTJA 1PZ0A 3I6EA 2WNZA 3T78A 1ZJHA 4I7WA 1HP5A 5M5DA 2PTXA 3UGVA 4EF8A 1REQA 4HIBA 4F0SA 3A64A 3V5OA 2HZGA 2VDGA 3OZPA 3OVRA 3QYSA 3TQVA 2FMNA 1JG9A 1VFFA 4DXXA 3SUVA 2G3JA 1YXDA 4MY1A 1MSSA 3PPHA 5A6KA 4Q8VA 2P53A 3BMWA 1NAL1 4KCVA 1KCXA 3QOMA 1V93A 3IJDA 2XVGA 3TYUA 1JYWA 4IP5A 1V02A 3LM7A 2VWSA 5DMMA 2QMJA 3EOSA 3WJWA 2WNQA 2BX7A 4KBXA 5J5RA 5L9FA 1IXQA 3JW7A 1U1HA 4WSHA 2E6FA 4UTTA 3I3BA 1HZYA 4WJEA 2O4QA 1XIDA 4MJ2A 2RAGA 2YA0A 1IEQA 1OK4A 3KWXA 3WZ0E 1FWJC 1FRBA 2PF8A 3LBOA 3GIYA 4IPIA 4PCFA 3ITOA 3MU7A 4G56A 1PDYA 3LY0A 4NY2A 4UNIA 1RVKA 1X97A 2ONEA 3H4GA 1JPHA 4P7LA 1D3HA 3PPFA 2C91A 4PZVA 3WEMA 5F1VA 2ZICA 1DYSA 3OVGA 1Z41A 1TJ2A 1KCZA 2GVJA 5E5CA 1R3RA 2VEIA 5E9XA 2IMRA 2VGBA 2WB5A 3SI9A 2WCGA 4GJ1A 5FF7A 1XM3A 3LCLA 1KBIA 3DHPA 2GGGA 1R9XA 1Q6OA 3N2OA 3KVLA 1RCOB 3U48A 2R14A 2IUZA 4IGSA 3TOYA 4DIAA 4ZOEA 3K8MA 3EEZA 3DFYA 4G7FA 2OZ8A 2DH2A 3H2OA 2OGYA 4K7YA 3BV4A 3PULA 4PUDA 1DJGA 3F4NA 3O0FA 3RN6A 2PFHA 4J2MA 1A5NC 2D23A 3AJXA 3EKLA 3SN0A 1HL8A 4QE4A 3M46A 3NXFA 4GUJA 1ZAIA 3W1MA 3UA4A 3QR0A 3LEPA 1QATA 3UP8A 2D0HA 3HZ3A 4OGZA 3WF0A 4C6CA 4GXWA 2VKZG 2YDAA 2YX0A 2EPNA 4WDXA 4W8BA 1UBSA 2G96A 5FIPA 3W75A 1JF6A 1BG9A 4E4UA 2QUUA 3OBKA 1H3GA 5IM51 4ICMA 2VJXA 1E71M 1TTQA 4O28A 3WNLA 4YTUA 4B3LA 5EBAA 4AHPA 2P8BA 5C9WA 1XV8A 5M1TA 1EF2A 1M03A 4JFUA 1SO3A 2B81A 4KWWA 3PSWA 1LBMA 3TC6A 2DZUA 4EWJA 3GQYA 3WQOA 1V03A 4LJ3A 1RCQA 4D8AA 4ZE4A 1EZWA 3GD6A 3BE7A 3ITTA 2VZVA 1XDLA 2OLSA 4IIDA 1VRDA 1XC6A 3SRDA 5A6TC 4LH8A 2IQTA 3K1DA 3B4UA 2JIEA 3PC0A 2YGYA 4QFUA 5LNSA 4JYEA 3VD5A 1VJZA 4ONVA 4U2ZA 1JD7A 4LCRA 4CQ9A 3P5ZA 3GDTA 4UOJA 3AYTA 2KAUC 4DYJA 2PLCA 2PDBA 1RA5A 3GIPA 4Q4QA 3WN6A 1DHKA 2ZX7A 4J27A 4OECA 1ECEA 1GQIA 1SQ7A 4W89A 1UH4A 4I90A 3W81A 4S3FA 3WDHA 3PJTA 1EXBA 3JZEA 4KEUA 3BURA 2YXOA 1FXPA 1TWZA 3W70A 3KRBA 2RHGA 3QFEA 3H21A 1EA0A 3RLGA 2ADAA 3ZLFA 4KEVA 1M7XA 3CK5A 1TPUA 4EE9A 3I7QA 1PKMA 5T9CE 3EX3A 2V2HA 1TE6A 3NZRA 1F8MA 2ACUA 1U33A 1EOKA 1ONRA 2WKGA 1Q85A 2Z6JA 4FPSA 3U3HA 2FMOA 4HQVA 4RE4A 4JGDA 1CX9A 4S3DA 4JTHA 1C9DA 3B8WA 2VEMA 3DEQA 4ZXOA 1V6UA 1XDMA 3QLLA 1K3UA 4UTIA 1SVDA 1NFPA 5LA1A 4LUTB 4B92A 4RPQA 2Q6ZA 3PVFA 3DC8A 4FNQA 1H7XA 2Z1VA 1QI4A 4M7TA 1JDCA 1W9BM 3GU9A 3GHRA 4AH7A 1Q8AA 2Y8VA 4AG0A 3CHDA 1TZ9A 4GCAA 2PE4A 4KH2A 2Z25A 2NVDA 2V2DA 4XAYA 4MTVA 1EJVC 4NJGA 3GE7A 4US5A 4L4PA 4MSSA 3RYSA 2VCBA 2OPJA 3VD4A 4H8NA 1IEWA 2B4GA 3RILA 1F2JA 3VGEA 1IWAA 2PD9A 5DX7A 2ZUMA 3NQVA 4H8HA 4O50A 1E15A 4MMWA 3WH5A 4P7OA 2OZ0A 1JUBA 1FWDC 1XPYA 4LEQA 3RJYA 3ME3A 1RQEA 2WAGA 3GNRA 4LUTA 3OG3A 1R6WA 2OX4A 4AHQA 1XBVA 4AXNA 2V2CA 2PGFA 2HK1A 2GOKA 4NZ1A 4DF0A 1J0ZA 1OHLA 4LANA 4Z1AA 1BWVA 3VUPA 4C5ZA 2WKJA 5K3VA 1S2VA 5FF0A 4HTBA 2RUSA 1PUDA 2WBGA 3ARYA 2B7QA 3CO4A 1AQ0A 5DY2A 1TR9A 3TW9A 3OEXA 5DXYA 2WOQA 3INPA 1WDWA 5A6SA 2XFWA 1NFBA 5LIXX 1QPQA 1YW1A 4BK9A 4ICNA 4IOTA 4RE0A 2VCCA 3M0KA 3OQ8A 3EDFA 4ZTYA 2F38A 2WNWA 1D3GA 1QOPA 4MLJA 1XRTA 3WJZA 4HMNA 4J1OA 2X1IA 4JICA 2AMGA 3UF9A 2I5QA 4BI5A 2QAFA 4D6HA 1AQHA 4QDWA 4YS1A 2YFNA 5E1QA 4N9BA 3GB6A 4KERA 2X1TA 5I09A 1VPXA 2PB1A 4HMEA 3W2LA 3AO0A 1E72M 3MY9A 5CXPA 2A7PA 4D1JA 5C6MA 3C2YA 2DZWA 3R0DA 1GZGA 1WO2A 2JGYA 4C6KA 5I2UA 3UR5A 3WLLA 3CXOA 3PPGA 4V15A 1CYGA 3RJXA 3R2GA 3V1HA 3BLFA 3B03A 3G77A 1A5BA 3N15A 4GXMA 1SUXA 1M7PA 2FQIA 4ZQRA 5DEZA 3WQPA 3T40A 4KESA 2X1SA 3L4UA 1KM1A 2G37A 2C1IA 4HU4A 3SCUA 2NVCA 2V3EA 4WY0B 4HK6A 2NWSA 1NM9A 2P8CA 2DUZA 3P62A 3R13A 1OFDA 3PWIA 1PDZA 1UP3A 4ACZB 2HPMA 4GC4A 4V28A 4GY0A 3HGJA 2EHHA 2YXXA 2C6QA 1SW3A 3RDKA 4K7VA 3S9IA 5DT7A 3RCMA 2CZ5A 4UMAA 1I2NA 1GVSA 3D46A 3THQA 5FSEC 2XINA 3R8HA 2V5LA 2FDMA 1Z69A 2QEZA 2PDKA 1JYVA 1KRCC 2Z27A 2RDWA 3IV8A 4AMCA 1RP8A 3NL6A 2I9EA 4CNSA 2VNCA 4GI9A 2GGEA 5HA7A 4JTIA 2R1MA 5SWUA 2J79A 1F07A 5KSWA 2ZYFA 4CCDA 3NPXA 5TIMA 3UZXA 4NAEB 1H61A 1X39A 4MWAA 4RXGA 1AFSA 1XINA 4A3UA 5T9BG 2NXIA 1FWBC 1QNVA 1A5CA 3DFPA 4FOKA 4HPXA 1UWIA 3C2FA 1V8EA 2JQXA 4EPBC 2WMFA 1VYRA 2EG8A 2ZE0A 5CKSA 1EBGA 3H23A 3SSZA 2V3GA 2OGJA 1Q6QA 5ABGA 3EKGA 4PFHA 2OEMA 1AZ1A 2Z4GA 2RDUA 3T09A 4ATLA 3TTQA 3LG3A 1V6XA 4ZE5A 2OEJA 3GRIA 2VURA 1DWIM 1SPQA 2XU2A 1KBLA 3LPGA 2DEPA 3S2MA 3ABXA 1TPWA 2BASA 2Q8LA 3GTHA 1HJWA 5CSRA 4FLOA 2O9OA 1QWGA 4F66A 3O16A 4YWSA 3O06A 1FHDA 3OHMB 1Q5MA 5HMDA 5B7YA 1UCWA 2EPKX 2ZRZA 4LB4A 1RQBA 2HDJA 5FAJA 1W5QA 2OSWA 1P1MA 2HVMA 5CAHA 2PI6A 2BWGA 2L5HA 3M5ZA 4JL1A 4MY9A 1N8IA 3QGKC 4LYQA 3W02A 2CERA 4MYXA 4ORMA 4XG1A 2VFGA 2ZZ3A 3BLKA 1MEIA 4DPPA 2HBXA 5I78A 4P8XA 3W2MA 1HW6A 4JHZA 4ZQNA 3DKJA 3PBGA 5BXSA 3M0HA 5LIWX 1RAKA 2W0UA 4GJJA 3NQAA 1EZ2A 3UR8A 3CUFA 4Q3MA 3TTSA 2CBIA 5EGRA 1F4AA 5HANA 2CLMA 4OQVA 5FF4A 1Q6EA 4C6DA 1C90A 4D71A 2G3FA 2XN1A 3GSMA 1OFQA 3NQCA 1NDWA 1RPXA 5H1WA 1QVBA 2DSKA 3RNDA 4EKJA 2EKGA 1QHOA 1QMLA 1AW1A 1OYAA 4K8EA 3GX9A 3EDDA 3FAWA 1GPWA 1PXGA 1CWYA 3QPYA 3VYLA 3NZGA 5ENLA 1YEYA 3H7RA 3IANA 2PDUA 4IIBA 2FLIA 4J28A 4ZSTA 4NAFA 3N2TA 4Z2KA 3MDWA 4JFVA 5CZ0A 1UMLA 2INEA 3GYCA 3CUJA 3PR2A 3VOCA 1G6CA 1MRAA 3IAPA 3N4AA 4JTSA 3EWBX 3HG4A 1VCVA 1W17A 2OSXA 4KKXA 3HMCA 1W9DM 3TA6A 2PDIA 1ZGDA 2NSOA 1IEIA 5E93A 3R89A 4DY1A 2VFFA 1PE1A 2DT3A 3DIPA 4H6KA 1ZSXA 4UTKA 4OV4A 1QHZA 4Q8WA 4MJZA 4S2CA 4KETA 2FPVA 3M7SA 3S5ZA 4OWGA 3DBPA 2G3IA 3R10A 2OVLA 2VDHA 1GPFA 4C6OA 4LRTA 3W72A 2QJMA 1ZJIA 1D7KA 3P82A 1H51A 3V5FA 3S42A 1TJRA 5FACA 5FJJA 3L2IA 2ALRA 1R85A 1PTDA 4MWAC 4QDPA 1KR0A 1RJPA 3BK0A 5E0KA 3CS2A 3ITGA 4W7UA 3U4AA 3T08A 4J3TA 4H9TA 3TR9A 1EP1A 1HVXA 1V02E 4GIEA 4XD3A 3L66A 2V8ZA 3KE0A 3SCTA 1P48A 2OLHA 1ICSA 1KXTA 2GJPA 1FWEC 2DW7A 4N7QA 3ZT5A 3ZT6A 1BD0A 3CASA 3L0NA 4DX3A 3S4TA 5C55A 1KFCA 4MB5A 4X22A 1GVYA 1OD8A 5LIKX 1X1ZA 1V3MA 2FTWA 4B90A 6XIMA 1WOAA 2VENA 2G95A 3OA3A 3T0TA 2GPTA 5E09A 5IRPA 2A4AA 2VC7A 4LV4A 4UTHA 3SRHA 3MC5A 4DJEA 3G1YA 2Y0FA 1JDAA 4NJHA 2CLEA 1RLCL 1Q6RA 1VFTA 3L23A 1UD4A 5FD0A 2X30A 3VZZA 4PUWA 2GUUA 1UQZA 3S5NA 3GUWA 4PMJA 4XAZA 4FF5A 1ADDA 3LI0A 5CZJA 3HPFA 3WLQA 4V2XA 1TELA 4ZA0A 1XYLA 3UETA 3WIJA 1KO0A 5CEWA 3VCCA 2WHMA 2WQPA 3K4AA 4PB3A 1PYMA 3NQFA 3TNOA 3ITYA 4F0HA 2WO5A 1XYBA 1PEZA 4ZO6A 5JIPA 1H7PA 2TODA 4XWUA 7REQA 3MUAA 5CZKA 3PK7A 4NYYA 3CMGA 4GYPC 2ZZ7A 3UCDA 3W88A 3SO7A 3A6OA 2POZA 3FKKA 2CLHA 1NDZA 1Z3NA 4C7GA 3W37A 4IT1A 3T55A 1B1YA 4JQ4A 1XCXA 2DJXA 1EOMA 2FYMA 5EBUA 4WHBA 2FKPA 4XIMA 3U7VA 3VZXA 4G1KA 1TTJA 2ISDA 1EX5A 3BVJA 3ITCA 4IPLA 1SZRA 2I1OA 2E4TA 2ABAA 3W71A 2VX6A 4MG4A 3OVQA 1VRXA 3DENA 5BMWA 1RBAA 4M7SA 4XD4A 5CBIA 1AH3A 4CCCA 3VMNA 5LIUX 1OX4A 1YNPA 1K9DA 1VH7A 3V18A 3AAMA 2PTDA 1JJKA 2D1ZA 2D0FA 2PWGA 1GORA 5D9OA 2HJPA 3F5JA 3S47A 1BRLB 5CGQA 1K6WA 3VDGA 2VGFA 3W4RA 4LYKA 3ZM8A 4D72A 4QLKA 1X96A 3H22A 4C65A 1DVJA 2GL5A 3H7VA 3WQVA 3CMJA 3IJ6A 3OYZA 3FY1A 3I3DA 3QPEA 4D1IA 1FWTA 1ZB5A 1VFOA 1C93A 3KL0A 4QJ5B 2TPSA 3ERPA 1Y5XA 1GT8A 3GKAA 2VO5A 3LYEA 4BEUA 2QIWA 3VZYA 1JZ6A 4X60A 1WB0A 3GVWA 1EUAA 2QJIA 3UGRA 3NR0A 3M0ZA 4C1NA 2GJRA 2V63A 5A8OA 2FHBA 3C86A 5FJRA 3BLDA 1B54A 3MV01 3MHUA 3VPLA 4F2UA 2YCLB 2XJ7A 3A5FA 1B31A 2CIPA 4Z2HA 2ZKMX 4XUYA 4NXKA 1QXLA 4ZENA 3HG3A 3AIBA 1U5JA 3LCXA 4EVZA 1JZ2A 2EQDA 1UR0A 2YB1A 3MCNA 1E6XM 3QHMA 1POKA 1VKFA 3GNPA 1DIKA 3G1RA 2C71A 3KCJA 4D9PA 1F6YA 3BV7A 5ABFB 3SUUA 3CAQA 4DJEC 3FGCB 4BKNA 4HNOA 2ACQA 3UYIA 3B97A 1TJ1A 1HKMA 2ZWZA 1FHUA 3UA3A 4B3ZA 1TV4A 4DUVA 2XISA 3GLCA 3CV1A 4PEEA 4HYRA 1TX2A 4XO6A 4MDOA 9RUBA 4S3GA 1LWJA 1W9VA 4BCEA 4URIA 2DQWA 3CLMA 4GYKA 3QW3A 4XBSA 1VCGA 3SCRA 2CPUA 7XIMA 1SSGA 1BWKA 4IMCA 4YTRA 3VX0A 4LT9A 5I3FA 9XIAA 3O1NA 3UZYA 1WXYA 4XD6A 5HWNA 4O16A 2A79A 4IQLA 4JDBA 3SRFA 1RBLA 4M81A 4U3AA 4K8HA 1MW2A 3TQ0A 1UR1A 3A4XA 1VQTA 1FUYA 4E38A 3W7RA 1GJWA 5AKQA 2G3MA 1KRBC 3MKKA 5T26A 2CLOA 3UR2A 1QHPA 2NSXA 6TAAA 3BJSA 1KWGA 1OC6A 1KGUA 3IJLA 2RGMA 2WHLA 2WKLA 1L6FA 2PC8A 3TLLA 1XGEA 3IGXA 4AQLA 1LORA 1UUMA 1JF5A 1T41A 4GC3A 4HSOA 4MWAD 1WZKA 3HIJA 4HMDA 3WH7A 3F5KA 2PLMA 2R82A 2OG9A 4WKAA 4IJCA 4BQ5A 4IH3A 5DO8A 3BLOA 2PMQA 3CV6A 4XZHA 3W74A 4JY8A 2VX5A 1DJZA 1G0CA 1ZHAA 3BSHA 3LV5A 1J0KA 1AODA 3NFUA 2MNRA 3NVDA 2IPJA 1OB0A 2PRHA 3UWEA 1J5SA 3DYPA 4IP7A 3F2BA 2P3ZA 4KWSA 3H70A 1W1PA 4J3SA 3UCCA 5C2CA 4S3KA 5FL0A 3SIZA 2DSZA 1TREA 3HA1A 5HJXA 2VQTA 2HISA 3AIEA 3LPFA 4H00A 3E0VA 2PZNA 4UTFA 3ZS4A 1U30A 4IG2B 4H2HA 5MF5A 4QE1A 4HNCA 4X2PA 3HBLA 1FWSA 2PDFA 3GKFA 4UMBA 3W2UA 2R1KA 2VD8A 4IPNB 2OMAA 5F4SA 3LX9A 4E4PA 1BTMA 4KRUA 4J3XA 3L7RA 3ZVHA 4C6NA 1OF8A 2X09A 1LQ0A 3IGSA 3JR2A 3N2CA 3L4XA 1MDRA 2ZA3A 1VYPX 3GXPA 1JAKA 1A3HA 3I3EA 1TRDA 4QAIA 5B80A 4H9YA 2QT3A 5D09A 1C92A 1DJWA 1YE6A 5U4NA 3PUDA 5H8PA 2DIEA 3RLHA 4MHBA 2XTKA 2ZXQA 3TWBA 3PZGA 1D7FA 2W67A 1FKXA 2QZRA 4C90A 4E3TA 2YDRA 1GOOA 4IICA 3S1XA 3LLXA 4EANA 1QNSA 1Q7ZA 3C61A 5F2LA 4R3UA 3IJ8A 3SW6A 3SECA 4P8UA 4MYAA 3GAKA 3GR7A 3PY2A 3CLWA 2ISSA 1K4GA 3W23A 1N7KA 3F4VA 3W1QA 2WZIA 2IXVA 3TCSA 2C0AA 1HJQA 2HCVA 6PTDA 4S3CA 3LM3A 3PZTA 4AZ5A 3NZPA 4AF0A 3ZLGA 1ECQA 3EXSA 3RMEA 1DXIA 4HHMA 1JULA 3SY5A 1FCQA 7TAAA 1HQTA 1DKWA 1IE7C 2YW4A 4UMCA 3VM7A 1XLKA 3LU2A 1H63A 2JKAA 4O0KA 4AIOA 4I9TA 1XIFA 2WHKA 3PB0A 1W32A 3K2GA 5E70A 4FX8A 4R88A 4GI4A 3WLMA 2X2YA 3RGTA 1WYIA 4W8LA 4MWAE 3LHVA 3N14A 4YTSA 3KTCA 1S3HA 1RK6A 1XLLA 2WMIA 3VMOA 3PG9A 1XRFA 3BCFA 1GKRA 1XYAA 2FJUB 3CO8A 1G5AA 2YLLA 4H6EA 3ZZ1A 3WH9A 4IGNA 2GVEA 1GQLA 3NGJA 2Q71A 2WWDA 1W3LA 3CHEA 3NQ8A 3WLOA 3H2EA 1FCBA 1NWTA 2AAMA 1XL9A 1QNPA 2H6RA 1D2KA 3W28A 5AC8A 4LPCA 1HL9A 5KZ6A 5A3HA 1RJRA 1E1FA 7CGTA 1BXCA 3GH5A 3L9CA 2XIOA 1P4CA 4LW7A 2XUCA 4G7EB 3QZ6A 1B3WA 4ORIA 4HYVA 2IKJA 4U5KA 3P67A 2ZRVA 4AD4A 2QQ6A 3VIJA 4DZ5A 3Q45A 4LX4A 4KGJA 5BOOA 5J5DA 1EBHA 4H8UA 3QQ1A 2IXUA 1H09A 1TCMA 3S1UA 3AU2A 3O9NA 3CMFA 4HA0A 3LCFA 2CLLA 2JKEA 1L2UA 2AOSA 2DFAA 3OGSA 4XISA 1YMYA 4L7ZA 4B2DD 5T8GA 1K8YA 3SN1A 2WM1A 5DY3A 3FHQA 3H4XA 2NQHA 3B0XA 3NPUA 1PTAA 3T07A 3SRKA 4CD5A 3DH7A 5GJNA 3WD2A 4HZMA 3BSMA 3R43A 4I3GA 4B5SA 2WJDA 2C16A 4DNMA 2QCCA 3JRKA 5A1AA 2GYIA 3RHGA 2Z7GA 2BODX 3CWOX 4AEFA 3UYCA 1EJRC 3GG0A 3TTEA 5I0DA 1ZBCA 3KCOA 1K8CA 2BZNA 3VO0A 4BEQA 4H1ZA 3CUZA 1S2CA 5D38A 1HN1A 3DI0A 3HJEA 1EHNA 4GFIA 3G1FA 3HPAA 2VOTA 1MEHA 3W7OA 1X98A 1LBLA 3WBAA 1VFSA 1W3JA 1QWKA 3G0UA 4E8DA 3KLKA 2V3DA 5EMYA 3H6OA 1XSKA 2EO7A 1O66A 1MFUA 3LDVA 1Q66A 3CV2A 1GVEA 4V1XA 1NQKA 1CPUA 2FB2A 1RLDA 4LCQA 2WVVB 1M53A 3W9ZA 4S38A 3OLGA 4F2BA 2CZFA 2YFOA 4NI3A 1OFRA 3W1AA 4W4QA 3LS9A 3E2RA 4FHAA 2HS8A 4E8CA 2XZ9A 1ZLPA 5KZEA 2GGJA 2IQ0A 1A53A 4G5DA 1XH1A 1V0NA 4OU1A 1S2AA 4W8AA 3ID7A 4DAFA 4ZSUA 2WJEA 1RQHA 1LJYA 2QCDA 1TYGA 3C2RA 4DI9A 3KUMA 1OGBA 2CKSA 4TTGA 5I07A 4DZHA 4FNUA 3WQ6A 1M7JA 4TTUA 2J88A 4XV0A 2XHYA 2BXYA 1TIWA 4DJFA 2Y8UA 3SCWA 2VC9A 3U9IA 2XG9A 4S3AA 3UZJA 2ZC1A 3SM0A 4GYPA 1TFVA 2ZXBA 4O4WA 4OBTA 1XG4A 4Q4SA 1OY0A 1KFEA 2DORA 4L5ZA 1GQNA 1ZS2A 4TOQA 4HB7A 5HMEA 3HFTA 2NVAA 1VFUA 1UR8A 5HPOA 5BYWA 3ZYZA 4HNUA 1Z7AA 4PRTA 3H2MA 3APYA 3L5AA 1R2RA 3WL0A 4HK5A 3SGGA 4XZWA 4K36A 3LRMA 1RVGA 5FJTA 4LTSA 3NXLA 4UTUA 3VA8A 2D2JA 4JZ5A 4MKNA 1CXHA 4IIFA 2VGGA 1UROA 1E0XA 3C52A 3UT0A 3LRLA 2CCRA 2PDJA 3EZ4A 3RLUA 5AHMA 3MUXA 2BGSA 1UWAA 4QS5A 4BF5A 4UR7A 1CXKA 3K30A 1H5YA 3TXZA 4Q6XA 4AD0A 3TEVA 3BGAA 1BVNP 4L6HA 3STGA 4NNAA 1UYQA 3SJ3A 3LHWA 1G67A 4GWEA 4Q4OA 4WDTA 3BJTA 2B7NA 1SJAA 2J8TA 1OK6A 3WCZA 4E2DA 3T4CA 4PMVA 5ECUA 3N04A 4D6DA 1WDRA 4KIRA 1V5XA 3CIXA 3CGTA 1FHLA 1EWEA 3PSVA 3TAKA 3UG8A 3WEOA 2VP8A 5D37A 4DBEA 4GZJA 3O07A 4HNVA 1G4SA 1SJBA 2Z26A 2J13A 4GXPA 4GK8A 4JTRA 2ASHA 5HQMA 4HYWA 1KFJA 1XBXA 3BZGA 3TMLA 3LGDA 3AZSA 2YCIX 4DUWA 4YMZA 5CAKA 4Y6GA 5AYXA 1TB3A 2EJAA 1PS9A 3G1AA 3VOIA 1L8NA 4ZO8A 3MDUA 5FSDC 1TWWA 1YNYA 2TYSA 4JIQA 3PTKA 3RM4A 1RD5A 4CD8A 1MW3A 1P1XA 5CJNA 1D3CA 3AMLA 1XCFA 2J74A 4NRRA 3BWWA 2EJ1A 1OFPA 4ERAA 2PODA 3OLIA 5D2VA 3KTXA 4A8LA 1YBQB 3TLQA 2UBPC 2FVMA 3TCEA 4L9ZA 2CFFA 1XLHA 1CBGA 1A3XA 5H8UA 3WBEA 1Q3NA 3XIMA 3WQWA 5GPRA 2AQVA 3EPNA 2UY3A 4ZGYA 5F1UA 1UKPA 4JTJA 1TTPA 4G2DA 3AIUA 4ZVJA 2DPEA 3AS1A 3AHTA 3W01A 2NQ9A 1DOSA 2DY3A 4YTQA 4RL3A 3WK2A 5DBUA 1GVOA 3O63A 3C4UA 3GY1A 4PYSA 2HMCA 4O12A 1L2QA 3L4VA 2OJPA 3FJ6A 1BVWA 1VBRA 4R27A 3T0CA 1HP4A 4DJFC 2DVUA 4CU6A 1YADA 5PTDA 5EY5A 1F3EA 1FY6A 1TV7A 1TZZA 3W00A 4DRSA 2PDGA 5F2MA 4DO6A 5D2WA 1I0BA 1FFRA 3ZR5A 4AY7A 2DZAA 4BS0A 5I24A 2GSEA 3AZTA 4JNMA 3EMCA 3PWAA 4O11A 1R3WA 3O2LA 3A12A 2CBUA 2PD5A 3OGVA 4NVTA 3HURA 2BOFX 4RV3A 4NYUA 3LXAA 5D02A 5XIAA 2XIJA 2O4MA 1EFZA 2JE8A 2F6UA 3VNKA 1JGMA 1ZP4A 4C6EA 4H01A 2QCEA 4Q8TA 3H54A 4Z0JA 4E3VA 2CXEA 3KZSA 2NV2A 1A50A 4H7CA 1QW8A 1FWRA 1FXQA 1YDYA 2AL2A 2A3AA 2BVDA 2P0IA 2DZVA 4H9VA 4BY3A 3ZIZA 3AXXA 4R9XA 1FVPA 1RH9A 2CETA 3GVVA 5C9UA 4DPQA 3CAVA 4B5VA 4BQ4A 2LLEA 2VR5A 4B9ZA 4A8NA 1C8VA 1XDJA 3NYDA 2Y89A 3VKDA 4H8VA 2CITA 3LBMA 3BH4A 1HXJA 3TZNA 3E0IA 2C3ZA 1DXFA 4XK2A 4QJ4B 3QOKA 1B57A 2CHNA 2NUWA 4ZQCA 1ISXA 1JVNA 2OT0A 5A94A 3NL3A 3GU2A 3AIVA 3B0UX 2ZRXA 5AYBA 4QSHA 4W5UA 3VXGA 2OZTA 2PWEA 2J7GA 3TNBA 2OKOA 4QEHA 3TN4A 5D9PA 1P0NA 3O6CA 1SR0A 5F4XA 5I23A 2NLYA 4EF9A 4QROA 5AHLA 4DWSC 4LS1A 5HNNA 5CG0A 2HBVA 3OZMA 4NZJA 1BQGA 3MVTA 2FZ9A 5FJOA 1P43A 4CNTA 4CD7A 4BA0A 1P0BA 4UB9A 1XI3A 2FVKA 1FDJA 4JCMA 3MA8A 4C91A 3MUIA 3I10A 4QAWA 3V35A 3P8IA 3SADA 1S2UA 3L0KA 3W07A 4JIHA 3SBFA 2ZUWA 4JTDA 3LCGA 4UFKA 1B3YA 4R5EA 4IFKA 4DZAA 2BGNE 3T6CA 2WHJA 1NF0A 3SY8A 4NJJA 3P84A 1GEQA 2ISFA 3WLPA 1AQFA 1W1A1 2YCKX 3PPCA 4GNJA 1K70A 5KMYA 3LHUA 2XYLA 3DKLA 1KM0A 3DUGA 4AWEA 3M44A 4F3HA 3BICA 1E3XA 3H55A 1P6CA 3IVTA 5A8MA 1K02A 5I6SA 1H5VA 1LLOA 3ORWA 2WC7A 3P80A 1FWAC 2F6KA 2JF6A 1C29A 3BGGA 3LNMA 1E43A 3LSCA 3SURA 4FALA 3VNZA 1I2PA 4W88A 2J47A 1L6YA 4W87A 1J9YA 3G6LA 4HCDA 4GQ0A 1UPMB 2GJLA 1VJSA 3GHSA 1YXCA 5JBEA 3GNXA 5I77A 4AIUA 2ZCGA 3W7HA 1H0IA 3QV9A 1UUQA 2WLYA 2DT0A 3PWGA 3IJQA 1EHAA 4PRRA 4AEOA 4JEJA 4WZHA 4JTAA 2PTZA 4FOJA 3QW4B 4PSPA 7A3HA 1BYDA 6REQB 4L64A 3JZUA 3F7JA 3QMRA 1EGZA 3SQLA 2NZLA 4KS0A 3F5LA 2X0YA 3T2QA 3HPSA 5D2TA 4W7VA 3ZWSA 3K8KA 5LA0A 2ZC8A 3PBVA 2WXDM 1EP3A 3M41A 2DGAA 3G1DA 5GNYA 3W25A 5F7UA 3SZ8A 3NAVA 4ES4A 1YPFA 4MAVA 2FZNA 1D8WA 3SR7A 3RRXA 4DXVA 1MRQA 3V75A 1XSIA 1GHRA 4DXKA 3TFCA 3QBUA 3OTRA 2EG6A 3LK6A 4RNFA 3HGRA 3EA2A 1CGWA 3GAYA 2X41A 3NNTA 4CCEA 3BW4A 3ZSSA 3QQWA 2J8FA 2BY0A 4D6IA 2VUYA 1EYWA 3W86A 5A8PA 4WKHA 4LAOA 2WNNA 1E1EA 3TROA 4B9YA 3AYVA 1TQXA 2QDHA 1VFLA 3W7GA 4UR9A 3HB9A 4JIEA 1HVQA 1KB3A 3FIGA 4NSBA 1WZAA 4WGXA 5I06A 5DF0A 4AZIA 3W7IA 2Y7DA 3M0IA 3WUEA 4FA3A 3UZWA 4GGHA 1Y8BA 4AF0B 1WDPA 2PTYA 3BCJA 4FNRA 3NCOA 3KDNA 2FVLA 1JAEA 1EEPA 1XWYA 1X1OA 2H8XA 4RZ5A 4QTGA 4UNKA 3OBAA 1JFXA 2Z2BA 1CIUA 1US3A 4GVGA 4UIOA 4DWSA 1EIXA 3CIVA 3VC6A 1ZAJA 4UR8A 5BW6A 4JD4A 5D04C 4QP0A 2DSWA 3AYSA 3G24A 5CPQA 3GC4A 2V30A 2JF7A 3G5EA 2WMHA 3EWCA 3W76A 4I5UA 1J8VA 3GG7A 4EAYA 1AJ0A 2P3EA 3A4JA 3MV11 4UFMA 3S1WA 2EGZA 2J25A 3N1AA 2WBKA 4GISA 1JL8A 3QGAC 1GEHA 3WBWA 3GH4A 2YSWA 2QJHA 3P74A 5LGXA 2QDEA 5I00A 4C5YA 1F3XA 9CGTA 2A3BA 4KQNA 1P6BA 3GFZA 3GTNA 5E6YA 1AH0A 3ARRA 3PFMA 3VNJA 3E5BA 4DLMA 4YCOA 3B4YA 1S5NA 4UZSA 1ZENA 3VIFA 1JR1A 4HGXA 1PAMA 4KWUA 3E02A 1ZCCA 4A8IA 3ZT7A 4DO5A 4UTJA 2QMKA 2VM8A 1F74A 2PP3A 5BU6A 3BQ5A 4LRSA 5FEPA 1O60A 3WNOA 4IIHA 5CPNA 3WDPP 3W29A 4WSKA 1S3TC 3RPTA 2R94A 4QLJA 4FSAA 5AB3A 1V7YA 3EEGA 4UFIA 3THDA 4MKSA 2IQDA 3ARVA 1R86A 2ABBA 2YBTA 2B31A 5FA5A 1QI3A 3ENLA 4LAKA 4MFDA 2INFA 1KRAC 2YJQA 4FXJA 1CGXA 4NAFB 3W1NA 4PMNA 5AYZA 3KCLA 1Y5WA 4ZOCA 3TN5A 1BVZA 4R34A 4DUXA 2VEKA 3VNIA 1C7TA 4MGGA 5FEXA 3THAA 1F73A 3M64A 3W26A 4YHGA 3EOOA 4RNIA 4UQCA 2BS9A 1OZMA 2WMKA 3Q58A 2AGKA 3WBYA 1H2JA 4H04A 1NU5A 1ALDA 3VKAA 2ZUNA 1UWSA 3WLSA 4A2RA 1RXOB 2QJNA 4AD2A 1HJUA 3HGOA 2PSNA 1GVQA 4GACA 1JQXA 3CQIA 3DFHA 3T2PA 3NOEA 2GVGA 4DVOA 1XLMA 2BOEX 1F76A 4K38A 1XPGA 4FZIA 1XQLA 4R33A 4DWSB 2FGLA 3VE7A 1KM6A 2VZSA 3GTXA 2XWDA 3BDKA 3CU2A 5AN7A 3EPOA 3BLEA 3MP4A 1OFOA 3VGHA 3UG5A 1B3XA 4XSLA 2PCEA 3VC5A 3VNLA 2HE5A 3E9AA 4G8TA 3P2VA 4KWOA 1YIXA 3Q37A 3TP4A 3VD3A 1M6JA 3TR2A 3SUSA 1SJCA 3GVQA 3H53A 3S1GA 3NYZA 1R3VA 3BOFA 3NGFA 3C2OA 4RLIA 2CWXA 4INFA 4JFWA 4Q4PA 1WNOA 3MUY1 3R6IA 4K8GA 3TXVA 3ABZA 2WSYA 2HVOA 1TV3A 4O0QA 3AISA 1QO5A 4DM1A 3KLLA 4AYSA 3ONCA 4IIEA 1TTIA 2W61A 1SFJA 1FH8A 4RR4A 4EXBA 4D6EA 4GYJA 2C19A 4DELA 4YJ5A 3BL3A 1TJ0A 2HE8A 1KGXA 3UBPC 4XZIA 1PZ3A 3UG3A 1OINA 2W3ZA 4K39A 1S5TA 4QHRA 2E9LA 3C8FA 3L4YA 4GFSA 1EDQA 1MMFA 3EMQA 3RG6A 2A7NA 3LSBA 4NNCA 2NXHA 3OGRA 2J7EA 3FW6A 4DWDA 3S5OA 3WY1A 1J11A 1AL7A 1AK5A 3OIXA 5FOOA 5F2IA 1ZL1A 4H9UA 2I5IA 1JD9A 4O10A 4LEFA 3KVJA 1J01A 4HMCA 4WR3A 3GBEA 3NQEA 2CBVA 4Y90A 4WD0A 2OYMA 1MZRA 4KW2A 1H7WA 2GSHA 4FR6A 1OJXA 5EFFA 1UZ4A 3MJMA 5BOEA 3VNDA 1BXBA 2R91A 3ZJKA 1XJBA 3D3AA 1NDVA 2PBGA 1W31A 1LRQA 2PDWA 3FLUA 2E68A 1OBAA 3N2MA 4BWLA 3N9KA 3EWYA 4WIWA 2ZX5A 4PGLA 2GQ8A 2Z1SA 4MPQA 3GDMA 4JS3A 1R47A 2ISVA 3S6OA 4H9ZA 3N9SA 4WKFA 1LROA 4CGTA 1AMKA 3WK0A 5CSUA 5HMSA 5ABFA 1TPEA 3BAIA 4JHMA 2EKCA 4ZQOA 2WZHA 1I8JA 4J5NA 1FWWA 3VD7A 4ENLA 3NO1A 3VI2A 1LL6A 3P7YA 1XFBA 3GS6A 3E0FA 1QOXA 5H91A 4NU7A 1VIZA 2CXGA 3CQJA 4UC5A 1EIBA 3SAZA 3WMLA 4PCSA 5LIYX 2FTPA 3ABSA 3E12A 1KM2A 3NVTA 1V4YA 4H7VA 2QNEA 2V5BA 4JTUA 4MUZA 3NQ6A 3VNYA 4YWIA 3URAA 4LUSA 3CEUA 1W1B1 1TPVA 1QI0A 2DW6A 1ODZA 2X1UA 6CGTA 3URQA 5KINA 2BBFA 8CGTA 3ABQA 1PSCA 4A2SA 4A05A 1IWBA 2AGTA 2A0NA 3PTQA 5HQEA 3N9RA 4PH6A 4CD6A 4YIWA 3N6JA 1TIMA 1LQ2A 1ZJBA 1WUEA 2J66A 3WH8A 4ADSA 1Y5VA 5I3JA 5EU9A 4B16A 3HQPA 4QS6A 2Y6ZA 3GHUA 1UH2A 1A3WA 1EQCA 1I4NA 3K4DA 2G41A 2J27A 1J12A 2UY2A 3C3UA 1GZ1A 4IPPA 2XZ7A 3B8DA 3VKCA 1KWKA 2ANUA 3BLPX 3UNDA 2NQ5A 3B9EA 3NSMA 1W54A 5CBJA 2BHZA 4WDWA 3URNA 3EXRA 5BRPA 2I14A 3HM7A 3EB2A 3VNMA 3S9YA 3G1HA 3UZZA 4ECLA 4JPGA 1PVNA 1EX1A 3E74A 1AH4A 3QQ0A 5G2HA 3N4FA 1U2YA 2G8ZA 1UWQA 3TDFA 3ARZA 3T8QA 3ZR6A 4IQDA 2ZFAA 3MMWA 3HQNA 4XTDA 3CZLA 1UD8A 3EAUA 2RDTA 4Q4MA 4XKMA 3U7BA 1TV5A 1JYNA 3GW0A 4K3ZA 3LENA 4WY0A 1LQAA 2C7FA 2YL8A 3WL1A 4D6GA 2PRLA 3BMXA 5FEZA 3A4WA 1IZJA 2Z1WA 1XH2A 2OOFA 1V3HA 3O3RA 3TV8A 5G2WA 3HOJA 3EXTA 2E6YA 1DJIA 3Q2DA 3B3DA 4DJED 4LVGA 4O13A 4M3PA 2AQOA 3RRAA 3PTMA 1O4UA 3FSUA 4I8DA 1IEXA 4R53A 5CLTA 1BG4A 2RGLA 3CUIA 1EWDA 1X6LA 4LYPA 3PZMA 1O1HA 4LAMA 2P0OA 1W1VA 3U6WA 4DF2A 3KOFA 2D20A 4Y9MA 3H2NA 1Q2RA 4D8ZA 1ISVA 2GDVA 3M0LA 2YR1A 1XCWA 1B3OA 1HUVA 3WH6A 4S3JA 4BWLC 2PDXA 1YYAA 2VGIA 4NJKA 2NQLA 4WY0F 1G1YA 3HJZA 3VIKA 1CW2A 3ZFHA 2EPLX 4E0CA 2PWUA 2X8RA 1MWOA 1O95A 2VVSA 5AFDA 4X3ZA 1UW9A 3B04A 4U2YA 4ALDA 3KTSA 1SZNA 3KM8A 4GZ7A 3IUIA 1O6IA 1Q45A 3U2ZA 3MB9A 5G1MA 3S5YA 4MF4A 1J6OA 1A4MA 1QR7A 1UR4A 3GNNA 4XZMX 4B4HA 2FB3A 2O92A 5E9AA 3UPMA 1LP6A 3EWUA 2VOMA 4OV9A 4YNGA 3TC7A 1C7SA 4MWAB 3PAJA 2PU1A 1JZ7A 4BQ3A 4Q4KA 2C79A 4JTEA 4F40A 4JCLA 4PMOA 2HPIA 3NQBA 3A21A 4S3EA 2PURA 4PUUA 1KGWA 4WOQA 4S1FA 3WF3A 1ZFJA 2NT0A 3H8AA 1G01A 4AFYA 2H8ZA 2G50A 1RV8A 2VL4A 1F3TA 2WMGA 3TYEA 3RO8A 3N19B 2F2HA 3MO7A 1R2SA 4MVAA 2WC3A 2VZOA 1UWRA 3MT1A 3HF3A 1OWQA 4HJWA 2P76A 1UD6A 4B5TA 1DJNA 1HO4A 4NG3A 3PUEA 2XH7A 3UVIA 2AAAA 3RX3A 2VELA 1CCWB 1XD1A 3K46A 3RFAA 1S39A 2BHUA 1O5XA 2PGEA 4XB3A 5CJ5A 1XFCA 4FLSA 2IKGA 2W5FA 5LNWA 3I7RA 3OJGA 1A5AA 4IMGA 1V3LA 1KXQA 1B4EA 4LQ1A 4J2PA 1KFLA 4AX7A 4TR9A 1Q2SA 4JIIX 3GTFA 5IXEA 2C1HA 3TZFA 2BOGX 4GQQA 4N4QA 1U5VA 5G4WA 1XS2A 1OCNA 4I9JA 3PZQA 1CGTA 1XHGA 2PZ0A 4H83A 5IBXC 2Q8ZA 1HKJA 3H12A 3GDKA 1DV7A 3E96A 4G9PA 4KIEA 1EH9A 3A4AA 4R85A 3CH0A 1AQMA 1GUVA 2WSRA 3QMSA 2HXUA