4B3KA

Family 1 6-phospho-beta-d glycosidase from streptococcus pyogenes
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
461
structure length
461
Chain Sequence
LAFPKEFWWGGATSGPQSEGRFAKQHRNLFDYWYEEEPDLFYDYVGPDTASDAYHQIESDLTLLASLGHNSYRTSIQWTRLIDDFEQATINPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQAYGGWESKHVVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELSDGRIGTILNLTPAYPASQSEADMAAAHFAELWNNDLFMEAAVHGKFPEELVAVLKKDGVLWQSTPEELALIAENRVDYLGLNFYHPKRVKAPDAIPVISPSWSPEWYYDPYLMPGRRMNVDKGWEIYPEAVYDIAIKMRDHYDNIPWFLSENGVGISGEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRPKASAYWFKKVATHNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Activity of the Streptococcus Pyogenes Family Gh1 6-Phospho Beta-Glycosidase Spy1599
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE
total genus 185
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b3kA00
1JG9A 3OBAA 1E4MM 2YOCA 4XZBA 1TVNA 3CHCA 2C7FA 1NP0A 3SUUA 1UR2A 1QI5A 5CLWA 1FH9A 5M5DA 1OD0A 1E4NA 2W63A 4UFJA 3GTNA 4CCEA 3PZTA 3TTQA 4D6FA 2PWGA 4OZOA 3K1DA 3WBEA 3CHFA 1BPLB 3U5UA 2BXYA 4WKHA 3A4WA 4W8AA 1UQZA 1PX8A 4GI9A 5A6KA 1NQ6A 3CUJA 4PEEA 3N11A 1J0HA 1G1YA 3AMLA 3IK2A 1SMDA 2J77A 1GVYA 3BCDA 3NDZA 1B0IA 1E4LA 3F4VA 3W6MA 2A3AA 1XH0A 1E3XA 3A6OA 2G3JA 2VCAA 4EK7A 1QBAA 5CSUA 2EPKX 1W9VA 3WN6A 1J18A 3VGFA 4HMCA 1JAEA 5E09A 2J4GA 1QNPA 2VJXA 5ABFB 2ZUMA 2ZXQA 2WMFA 4CU6A 3CZGA 2GJXA 1V3KA 2ZOXA 1Z32X 4JHZA 1W3JA 2WKGA 2JEPA 3FHQA 2W61A 1E9LA 1XV8A 4ACZA 4M24A 3BAJA 3O9NA 4DWSA 4JCLA 3PZMA 1IT0A 2A3HA 1WNOA 1ODZA 4V27A 3GH5A 3T09A 3VD3A 4HMEA 4NRRA 3N18A 3CUGA 1FH7A 5FL1A 2EO7A 4J3SA 1OIMA 4HU8A 1KR1A 3ZM8A 1C7TA 1QHZA 4H04A 1V03A 1HL9A 2WHMA 1VJSA 2V3EA 4W85A 1DWJM 4WF7A 2ZX6A 2ZXDA 3WD3A 4AZCA 4BQ2A 3HN3A 1VFOA 5JBFA 3MO4A 3TTSA 3CHEA 3UG4A 4JFVA 5A2AA 4QP0A 1OGGA 4Y7EA 3VDHA 4JFWA 3WEOA 1EO5A 1PBGA 2W5FA 1UKPA 1UD8A 4HOWA 1E6RA 2VR5A 5BXTA 2Q8XA 1CNVA 1VAHA 2BY0A 3KL0A 2EXOA 1UR9A 2YA1A 1JYXA 4PMXA 5AY7A 5AC5A 4FK9A 3VIOA 2AMGA 3WQ4A 4TOQA 2BXZA 2WMIB 1HKJA 2YBUA 1M03A 2ZXBA 2XVNA 4AWEA 5LYRA 3MUY1 4P7NA 1JNDA 5GNZA 3WNOA 3RILA 8A3HA 3WQ6A 1XCWA 3WH7A 4PMRA 4CD4A 2OSYA 4WSKA 3N12A 2XSAA 2VUYA 3WD1A 1GQLA 1QNSA 4LGXA 1GOIA 5E0CA 2E9LA 2OYMA 4OBSA 4F9DA 2PWFA 3PZIA 5HXMA 1KBKA 2E8YA 1RP8A 2JF6A 4OKDA 4WKFA 2VQTA 4P7QA 5EB8A 3AIBA 3VIGA 3UETA 1VRXA 3D3AA 1H1NA 3WD2A 1CXHA 3ZJ7A 1HJUA 4W8LA 3DC0A 1GHSA 3TOPA 2JEQA 5KEZA 4Z2HA 7CGTA 2ESCA 3BSGA 2BV9A 1FFQA 5DT5A 3W25A 3OIHA 4D6GA 3KZSA 4NSBA 1HJXA 5I77A 3UESA 3AIRA 3VTRA 5E6YA 5TD4A 2YA0A 1E3ZA 3MUIA 2ZE0A 3VX0A 1R87A 1U2YA 1XSJA 4TX8A 3GYCA 4GZJA 3W53A 5E70A 3VILA 4QLJA 1TE1A 3W37A 4PMDA 3AIQA 4J3VA 5CSYA 5JBEA 2O92A 2QMJA 1GOMA 2J62A 4WLCA 4UNIA 4MJ4A 5CXPA 3DECA 5BROA 1VFFA 3BAWA 5C71A 3WEMA 5IHRA 1E6QM 5A1AA 3WF2A 1DWHM 1EOKA 3T2QA 2WKLA 2WWCA 1C3FA 2HISA 3IJ8A 4PCTA 1J12A 1KCLA 1WDPA 3WL1A 3CZ8A 5CPTA 5C8BB 1MYRA 1QI0A 3RJXA 1OIFA 1AQHA 1JF6A 3CHDA 4PN2A 1CXLA 4IM4A 1YQ2A 5FD0A 4F9JA 4BS0A 3AI0A 4IISA 5E0FA 1HNYA 3SURA 3DYPA 4FLQA 4Z2LA 6CGTA 1X6NA 3W38A 2X09A 4CGTA 8CGTA 1KFWA 4YN5A 4H2CA 3AZRA 5A6AA 4P7RA 1TMQA 4DUXA 2YLLA 1PZ3A 5I3DA 1W9UA 2DSUA 2VZVA 4C7FA 5CG0A 1FH8A 4AZIA 2Z1KA 4ZE5A 1BG4A 3NCOA 3I3EA 3AICA 5I79A 2A3EA 3AOFA 1KGXA 1C91A 3EDKA 4IPLA 3J7HA 4PMQA 4UOQA 1Q6EA 1MQQA 3AS1A 3VKKA 1AQMA 1OBAA 1BVNP 3ECQA 3VUPA 1GQKA 4DWSB 3WNLA 4ATLA 5CPQA 3EDJA 1LL6A 3G6LA 4HA3A 2WAGA 1UKOA 1TVPA 4A3HA 2ZX8A 4P8UA 3SUWA 4AEEA 4MDOA 5A2CA 3L4XA 4JZ5A 1E4IA 2VI0A 1KWGA 2DH3A 3M7SA 3VU2A 4AD0A 2F8QA 5IHSA 3K8MA 2GDUA 1CWYA 3OGRA 1KCKA 4HTYA 3UEQA 1UWTA 5D8ZA 2D2OA 4R27A 2BNJA 3K8KA 4K68A 1BLIA 1UKTA 3ZT6A 1Q6FA 1O6IA 1HJVA 1JZ8A 3MUAA 1LL4A 4AW7A 1K6AA 3SCRA 2UWFA 3EBVA 3AXIA 2OYLA 1C8QA 2G4FA 3THCA 3CTTA 5CLTA 3VIKA 1CLXA 4GPNA 3KEHA 1C7SA 3II1A 1EIBA 1PIFA 1GQIA 2XVLA 2EBNA 4UFMA 2WMIA 4CN1A 3ZJ8A 2WHJA 1HX0A 2CCRA 5DFAA 2Y8VA 3AZSA 1JF5A 3MMUA 1J11A 3DHPA 4J27A 5E6ZA 2VRQA 3W0KA 4Z2IA 3POHA 3ALFA 4RE2A 2XSBA 2J78A 3GXMA 1WKYA 1UKSA 1NWTA 3K4DA 1B3ZA 5D9NA 3RM4A 5IDIA 1W9XA 1QW8A 4EKJA 4MB4A 1HKIA 1BAGA 2PI6A 1UH2A 1H49A 1GJUA 3IANA 2WHKA 3U57A 3AYRA 2WZEA 4CD7A 4D6EA 1JI2A 1NARA 2CBVA 4TXEA 4M81A 1W1YA 2WMJA 3SCWA 2UY3A 1CGYA 2CESA 1UD5A 2EEXA 2VR4A 1V0LA 3VD5A 1DWFM 5ABGA 3GH7A 1NM9A 1WAWA 2X8RA 1CYGA 1ZB5A 2O9PA 4HMDA 3CUFA 1ZS2A 1EH9A 1V0MA 5GNYA 1VENA 1OB0A 1B1YA 2DSWA 3N13A 1G0CA 2MANA 2CPUA 4GQRA 1EHNA 1G94A 4RE4A 1UR4A 3GM8A 5A6BA 2PWEA 1OWQA 5A6LA 3E1F1 1CDGA 5DO8A 3OGVA 4XV0A 2J8FA 4UTFA 4Z2KA 2XHYA 4YPJA 3B9DA 1E6XM 3CMJA 5A3HA 4ZXOA 3APGA 4TVUA 5EMYA 3O6AA 1E0XA 2Y8KA 3ZR5A 3F5LA 2GSJA 1UR0A 3WF1A 4PYSA 2QV4A 1NWSA 3WDPP 2D0GA 1PJ9A 2WYSA 4JKMA 3NDYA 1HJWA 5D4YA 5LA0A 1MW3A 2EPOA 1E15A 1H09A 2J25A 3TONA 3AS0A 2BS9A 1D3CA 1V3MA 4AD5A 2D1ZA 1GOKA 1KXVA 3QR3A 2W67A 4M29A 4AZHA 3BMVA 4FLOA 4W87A 2ZX5A 4M80A 3ZT7A 1VEMA 4AD3A 1JFXA 3DYOA 5I24A 1CBGA 3N9KA 2XTKA 4B3KA 3HU7A 1WE5A 4HA4A 5DMYA 2XM2A 2O9RA 4QCEA 3AXXA 4QDMA 1MW2A 2CKSA 2V5DA 3T2OA 1GJWA 3K46A 3AHYA 1UD2A 3MKKA 4CU8A 2DSKA 1WPCA 4GIAA 3VO0A 4URIA 4JHOA 1UHVA 4TVCA 1VEOA 4UOZA 4ACZB 1ZL1A 1FA2A 2VNCA 3WDRA 1AMYA 2FHCA 2J74A 4N42A 4J3TA 5A6BD 3FNDA 3PTMA 4AD2A 3L4UA 3WUFA 4NRSA 1CXFA 4A4AA 1JGIA 3ZSSA 2VX6A 2YL8A 4D71A 2FGLA 4PTVA 1IV8A 4HOZA 2WXDM 3GBEA 1UZ4A 1FOBA 2ZWYA 2WLZA 3AHTA 3KL3A 4GZEA 3L4ZA 3W81A 4TTUA 3AIVA 3QHMA 3SEPA 3QOMA 2WC4A 1W1TA 2AAAA 4LXFA 4E4PA 1CTNA 3WENA 1QNRA 1UH4A 1JNEA 1ZBCA 3F5KA 4CN6A 4U5KA 1OGBA 3EDFA 1EOMA 2BY1A 4PUEA 1B3WA 2WMHA 4KWUA 2CYGA 1HVQA 5CJ5A 3VGEA 4CCDA 1H4PA 1UWSA 4PMNA 2ZUVA 1EXPA 3N17A 2VO5A 1TA3A 3GXIA 4PMZA 4CD5A 1OD8A 3AJ7A 2OSXA 3KE0A 2OWCA 3WQWA 1FP9A 2OWXA 4DM2A 1W3LA 1BGAA 3PZ9A 2WLYA 1H5VA 1WZMA 2WMKA 4J28A 3ARZA 2YDQA 5D9MA 4UQEA 3QHNA 1E6SM 2DEPA 3DYMA 4XZWA 2VX5A 1ESWA 4H7VA 3RPMA 2VVNA 1CPUA 1CECA 1WDRA 3WMSA 2WK2A 4ZEPA 4QAWA 1B2YA 4M1RA 3WELA 3FN9A 4UQBA 2X0HA 1VEPA 2HVMA 1CXKA 1SR0A 3A4AA 2A3CA 2EPNA 3AISA 4IPNB 4N0RA 4TTGA 2D0HA 4UZUA 3CLWA 4D1IA 3WQ8A 3IJ9A 1V3JA 1IZKA 3VIFA 3ARWA 4X0NA 4XX6A 1E1EA 4HPGA 4UFKA 4NI3A 1AQ0A 3M46A 1CGXA 4B16A 2C0HA 4OJYA 3S2CA 3PZQA 4TUFA 3WD4A 1K9FA 2VMFA 3ARUA 1XHGA 4D6HA 1IZJA 3GBDA 3FAXA 3SCQA 1UKQA 3A47A 2WM0A 1ISVA 1E71M 3WSUA 2G3IA 6A3HA 4MB5A 2FHBA 2XYLA 3CZLA 3SCSA 3VIMA 3BCFA 2WWDA 2IXVA 2VZUA 2PWDA 3OB8A 2DSVA 1KXQA 1V02A 1CZ1A 1W1PA 3VGDA 5I2UA 4L4PA 2PBOA 1UWRA 2CBUA 4GXPA 3WUEA 4Q7NA 1J0YA 1GONA 1GQJA 1GNXA 1MFVA 3VMNA 5HPOA 1EGZA 4OBRA 1W2PA 5IXEA 3VMOA 4WIWA 3SUSA 1CGUA 2WCAA 1ECEA 2E40A 1EDTA 1KQZA 1XCXA 2XWDA 4M82A 1PAMA 1VFMA 4X0VA 3WDIA 3UERA 1ISYA 2X2YA 5F7UA 3UR7A 1GHRA 3OA5A 4BQ4A 2BHZA 1BVZA 1JFHA 4GI6A 1V3LA 1PX3A 3AMKA 3AMDA 5JIWA 2PF0A 2A3BA 4P7LA 1MFUA 3F5JA 3LPFA 1B3XA 5JBDA 3GNPA 2JF7A 1QPKA 2QF8A 1C8YA 4AIOA 1RD6A 3RM9A 2UY2A 2DIEA 2CERA 1E43A 1ZBWA 3GH4A 1LWJA 1BSIA 1EQPA 5HDRA 2VX4A 5ECUA 3ARXA 4OUEA 1W3KA 2W62A 1KR0A 4HZ7A 1CGVA 1WZLA 1X6LA 2CBJA 1QW9A 3EMQA 3PHAA 1HF6A 1KGWA 2E9MA 1JD7A 2X1IA 1GPFA 2VZOA 1MVYA 4AD1A 2G41A 2VOTA 5A8MA 2WZHA 3BSHA 1GOWA 1HIZA 1VB9A 2D3NA 3OLIA 1HJSA 3SCNA 3CMGA 4CUCA 4WKAA 1B30A 1XGZA 3WIJA 4F66A 3WQ5A 1UUQA 3LPGA 4W7VA 5BRQA 3THDA 3PZNA 2JE8A 1WZAA 3VGGA 1QHOA 2E0PA 4UQAA 3BAIA 1KWKA 3ARTA 2JIEA 1E0VA 1BF2A 5BXRA 1P6WA 5M17A 3CO4A 3OZOA 1W91A 5GNXA 4KH2A 1HL8A 2QHAA 3W6LA 3CUIA 5D8WA 2WHLA 1LJYA 4H41A 2DSZA 1G5AA 3SCUA 2F2HA 4Q22A 1MWOA 4PMYA 4HPHA 4AZBA 3CIVA 2RGLA 4DUVA 4QLLA 3O2LA 4JKLA 1A3HA 3BGAA 5IFTA 1QHPA 3SUVA 1MW1A 4C7GA 1TR1A 3U7VA 3OLGA 1OINA 3VVGA 1DWIM 3FY1A 4MDPA 4UFHA 3EDEA 3VGHA 1B3VA 1K9EA 3PTKA 2GK1A 5A8NA 2VVSA 1E55A 1B3YA 1R86A 5EFFA 3W29A 4AZCB 3L4TA 2WVUA 4P8WA 1V6WA 1V6YA 2XFFA 1CLVA 2B31A 1UG6A 5ABEA 3IJ7A 4KGLA 3BAKA 1ZJAA 3FXYA 3S6TA 3W26A 4U33A 4YHEA 2CKRA 1KBBA 5CQ1A 1V0NA 4HZ6A 4JFTA 4U2ZA 5A2BA 2D3LA 4BA0A 3L4WA 1FFRA 4KRUA 1ZBVA 1UH3A 2XIIA 4AISA 3GNOA 3VM5A 1UYQA 2Y5EA 4PTXA 1XYZA 3LMYA 3WL0A 3WF0A 1GOQA 4JFSA 2XG9A 1ZBKA 1S46A 4JL1A 6TAAA 4D6CA 4W5ZA 2E8ZA 2WVVB 1EDGA 1ZJBA 3RJYA 1V08A 1LL7A 4B9ZA 1V02E 2GJPA 2VURA 1R7AA 2W91A 5I6SA 3MMWA 1K9DA 1PIGA 5HOSA 2V5CA 4RL3A 4UQCA 5BXSA 1J0JA 4MNJA 3WF4A 4GKLA 1BFNA 2YJQA 4W84A 1L8NA 5BWFA 1JZ6A 2Y2WA 3ARSA 3NUKA 1V0KA 3K8LA 2YL9A 5EBAA 3W28A 1TG7A 3HJEA 5EFDA 1CIUA 4CVWA 3VINA 1OT2A 1ZU8A 5A95A 2WBKA 4ATDA 3CBWA 1GW1A 2Y24A 4FLRA 4GI8A 5M03A 5D9OA 3VIJA 3DHUA 1J0ZA 2CNCA 4MADA 3ZO9A 1V3IA 4M56A 2QMKA 1PEZA 2NT1A 3UCQA 2XM1A 7A3HA 4CU7A 4LYPA 2G3NA 1BHGA 5CZKA 3AXHA 1W9PA 2CETA 3ZMRA 2YLAA 3GXDA 1JYNA 5CGTA 5A69A 2CXGA 5I0DA 2XWEA 1E6ZA 1JZ2A 3VIHA 3CZJA 2YIHA 1SFSA 1GZJA 1J9YA 4GINA 1H3GA 2VZSA 3WD0A 1M01A 4P8VA 3ZT5A 1W9BM 3AQUA 4UR9A 3VOCA 2YBTA 3EMZA 4PSPA 2TAAA 1UD6A 2WNWA 2VL4A 1XC6A 2DH2A 2BHYA 4E8DA 3PBGA 2WB5A 4W89A 4V2XA 5HNNA 1R85A 2E9BA 1UD4A 2VQUA 4AD4A 3ZJKA 5I23A 2O9OA 1C93A 5GQBA 3VD7A 2FH6A 1R8LA 5AC4A 1D7FA 1EDQA 4U2YA 3N15A 4LX4A 1GUVA 2J7CA 1G9HA 2Z1SA 4GQQA 1NOFA 2XIBA 3MMDA 4ZE4A 4CD8A 2J8GA 2XVKA 4MTVA 3BLKA 1VFUA 1QBBA 5FKYA 2D23A 2JIWA 4AZ7A 2ZUUA 3VD9A 3VDBA 2EQDA 1CENA 2XVPA 4MB3A 4PTWA 2WCSA 2W92A 3NSXA 1MW0A 1R7OA 2DGAA 5ABFA 2YDRA 4MB1A 1G01A 3UG5A 1CGWA 4RE3A 4NZCA 2YA2A 3OLDA 3BLPX 1XD1A 4BCEA 1UA7A 3SUTA 1BG9A 4GO8A 1SYTA 3VPLA 4UFLA 1CXIA 2EJ1A 4QCFA 2VC9A 1UZ1A 1KGUA 3VX1A 2O9TA 2VRKA 4IUGA 1H0IA 1QNOA 3M07A 4LYQA 4UFIA 4ACYA 3RDKA 1MXDA 5AYBA 1FHLA 3WKZA 3MANA 9CGTA 3WMBA 5ABHA 2J79A 3WDHA 3ALGA 4MAZA 1BYBA 1BTCA 4J3WA 3LPOA 3BXWA 5I5RA 1QNQA 1HVXA 2JALA 1E73M 2D0FA 2OSWA 5LA1A 1I1WA 3NYDA 1BGGA 3WH6A 2CEQA 2NT0A 1WP6A 1XYFA 1D2KA 1UR1A 3TP4A 2GVYA 3GXFA 4D72A 1HP5A 2PB1A 4J7RA 1US2A 1WDSA 3QHOA 1JAKA 1MQRA 4FF5A 5A6JA 4D6IA 1J0KA 4PMVA 5DT7A 1HN1A 1JDCA 2ZUWA 4AXNA 1JZ5A 4AIEA 4AZ5A 2YDSA 1LG1A 2XGIA 5C70A 2WBGA 5CGMA 3T0BA 1EA9C 1JDDA 3ARQA 3L4VA 1TUXA 4NF7A 1K9TA 1ITXA 1JXKA 4DWSD 2G3MA 2CIPA 1JZ4A 2ZUTA 2BVDA 1Q4NX 2BFGA 3CZEA 2WANA 3OZPA 3ZQ9A 2WC3A 2XPKA 4E2OA 4GZIA 3T08A 1H11A 2E4TA 2J7HA 1EHAA 4H8UA 1B90A 2QPSA 3SCVA 4AEFA 4HOXA 4U3AA 3MV11 1H0GA 3D5HA 4J3UA 4AC1X 1NWUA 4LYRA 3CPUA 1ITCA 2DQXA 3GNRA 1ISXA 4FMVA 1W3HA 4WSJA 1QVBA 2JFEX 5LA2A 3IAPA 1JIBA 3QOKA 3EDDA 2RGMA 4C7DA 1XH1A 2ZUSA 3ZSTA 1W9DM 1JYVA 4JIEA 1FHDA 3RO8A 1MXGA 3N1AA 3FAWA 4HZ8A 4BZYA 3B8SA 1VBRA 3VM7A 3PZVA 4OOUA 2VCCA 4U5IA 3WDQA 5HPCA 4XB3A 3OLEA 4PBGA 5FOOA 3PZOA 2D20A 1LG2A 2BVTA 4AY1A 4AIUA 4Z2GA 4F8XA 1JD9A 1B9ZA 2GK1B 4LPCA 2YL5A 3WEZA 2YKKA 1UD3A 1KB3A 3L2MA 4MNKA 1VF8A 4WK9A 5BRPA 4CD6A 3ARVA 3CH9A 2WVTA 4F79A 4BF7A 1DP0A 1PX4A 1F4HA 1E5JA 2WZIA 4D1JA 2UY5A 3SIMA 1EQCA 4ATWA 5A8PA 1OT1A 2GJXB 4TVDA 1DWGM 2ZXAA 4L4OA 4UOJA 4EAMA 5HBFA 1EO7A 3OGSA 4FLSA 3VNZA 1FP8A 3WNPA 3U7BA 3WFLA 2ZIDA 1E5NA 1DEDA 4PCSA 4PMOA 2FH8A 2BHUA 3BMWA 1M53A 2YL6A 1DWAM 2QLYA 1J01A 1XH2A 4GO9A 1BYDA 3WNMA 1GCYA 3L2LA 1SMAA 4MNLA 2ZX9A 3I3DA 1UWIA 1I75A 3WUBA 3WQVA 3RM8A 1QOXA 1C92A 4KGJA 3ZOAA 3AS2A 5A8QA 2J7BA 4Z2JA 1ISWA 1CXEA 4ML4A 1HKKA 1LQ0A 3MV01 1CGTA 2J75A 3MUZ1 1V3HA 1BYCA 1HXJA 3AHVA 4ZENA 1UWQA 1NH6A 4PRWA 2DPEA 1VBUA 3AIWA 1H41A 5BCAA 4D6DA 2W66A 5M3WA 3LPPA 2CITA 2WSKA 3SCTA 3PZUA 4AMCA 4WJXA 2WPGA 4BQ5A 4W86A 3EMCA 4CN4A 2D22A 2DT0A 4W8BA 3WNNA 2GJRA 1JXJA 3RIKA 2QPUA 3WNKA 3SCPA 3RMEA 3AIUA 5FIPA 1MQPA 3BH4A 3WUGA 3MSDA 4B3LA 2IXUA 1XSIA 3B9EA 2CBIA 5AYIA 3VD4A 1VIWA 3EYPA 3VNYA 1UWUA 2WSPA 5E9AA 4MNMA 2WCGA 5JIPA 1L0PA 4CVUA 3L4YA 1NWRA 1QI2A 2BY3A 2VT0A 4H8VA 3W4RA 4QLKA 2XGBA 1XD0A 2VCBA 1JZ3A 3WH5A 1AVAA 1WCGA 2VTFA 2DT2A 4AYSA 1KQYA 1US3A 4ZFMA 1OSEA 3AS3A 1E6PA 1LF1A 4H8HA 1TFVA 2DT3A 4KMQA 3MS8A 4AZGA 2C8NA 5GPRA 2BVYA 4W88A 2ZUNA 2FGZA 5BXPA 3PZGA 1VJZA 1Q6GA 1GORA 3FHAA 3TTOA 3CUHA 3RCNA 4U31A 4V28A 2PBGA 1JI1A 1XSKA 1W2VA 4XUYA 1PZ2A 4J3XA 4M8UA 3GDBA 1I1XA 1WZKA 5FL0A 4JFUA 3CZKA 4W93A 2FHFA 3AZTA 2GDVA 5D9PA 3MU7A 4KRTA 3B9AA 1DHKA 1V6VA 2VX7A 4P7OA 4DWSC 1H2JA 3VIIA 1HP4A 1E1FA 1BQCA 1E70M 2X0YA 3WDJA 3AROA 3AHXA 3T2PA 3TTYA 1WO2A 2PWHA 2XFRA 4AZ6A 2NW0A 1LWHA 3VGBA 3GZAA 3VMPA 1Y7VA 1E72M 1CEOA 2ZICA 4JKKA 1GVIA 2OYKA 1Q6DA 3K4AA 3W24A 3WY1A 1W32A 3A3HA 7TAAA 2OLHA 1J0IA 1GOOA 5BYWA 5DF0A 3UG3A 5KZ6A 4R5EA 5A94A 4EANA 1WDQA 4HU0A 1PPIA 3NJ3A 1U33A 3WF3A 1HJQA 2J7DA 2XJ7A 3VIPA 3A4XA 3PN8A 4MJ2A 3BC9A 4HP5A 1NOWA 3AHZA 3TA9A 3W82A 5FCZA 2UY4A 1F4AA 1E56A 1UQYA 4D6JA 3PTQA 5JUVA 4HA1A 3VDAA 3IAQA 2WW5A 3MSGA 4W7WA 2V3DA 1RPKA 3BAYA 3M6DA 1A47A 2GUYA 3NIYA 5I78A 4B9YA 3HMCA 2EPMX 1E40A 4S3KA 3ARRA 4JL2A 4UQDA 2G8ZA 4S3JA 1JL8A 1HKMA 3FW6A 2CHOA 2J47A 4JAWA 1BYAA 1ISZA 2WMGA 3ZIZA 2AOSA 2V3FA 3T0AA 2BY2A 3U5YA 5IFPA 1JDAA 2DIJA 2J7FA 2WVVA 2ZWZA 3AMCA 1E6NA 2GFTA 3KWXA 3I3BA 1M7XA 1QI3A 1YHTA 4UCFA 1C8XA 4P8XA 2W4XA 4DM1A 4BQ3A 2EPLX 2X05A 3VDCA 1DTUA 1ODUA 2D24A 3KL5A 3T0DA 3JUGA 3CGTA 1UA3A 4CCCA 2OWWA 2J7EA 1OM0A 1V6UA 1X1NA 1JZ7A 4MAVA 4A3YA 2ZX7A 4QFUA 5A8OA 1KXTA 1Q6CA 1WB0A 1TA3B 3QGVA 3NSNA 1NOUA 1LLOA 2VZTA 2NSXA 2PC8A 2V38A 3W27A 3POCA 4OOZA 3AMGA 1N82A 1M04A 3AYSA 2FDMA 1UOKA 3WMCA 1QI4A 1TCMA 2J7GA 3WH9A 3ARPA 1U30A 1RH9A 4U3CA 4ZXLA 4W7UA 5CPSA 4TX6A 5A6SA 3WBAA 3WFZA 1UR8A 2V3GA 3WH8A 3NSMA 4CKQA 4PUDA 1O7AA 2IUZA 2XVGA 2XFYA 4X9YA 4DUWA 4UQ9A 2CHNA 4OIFA 4PTMA 2XUCA 1V6XA 2WC7A 4YHGA 4LQ1A 5DEZA 2WVSA 4JCMA 2Y4SA 1J10A 4EE9A 3AIEA 3AFBA 2F61A 4E8CA 1W1VA 3N04A 1KXHA 2DT1A 4PMUA 4B15A 2VRJA 1NP2A 3ZJ6A 1XRVA 3G6MA 3OG2A 1OCQA 3ZR6A 1JYWA 1TZ7A 4PSRA 5A6MA 1B31A 3UR8A 3ARYA 3SCOA 4MPKA 4UZSA 1C90A 2E3ZA 1OGSA 1E0WA 1RP9A 4W5UA 2DDXA 3BAXA 1HT6A
chains in the Genus database with same CATH superfamily
2CC0A 3BGGA 4PCNA 4MKNA 4IZGA 1FWEC 5C54A 5CLWA 1OD0A 4UFJA 4KFPA 4FEZA 4B2DD 2EHHA 1RAKA 4E6MA 2ZRZA 3KZPA 4RJEA 4UXDA 4XKMA 2J9ZA 1FRBA 3WBEA 3QY6A 3T40A 1BPLB 3U5UA 2BXYA 4F2TA 3DEQA 4XZLX 3SDOA 3W1XA 5EL1A 4PEEA 3A64A 3N11A 3QGKC 3W1LA 1JJKA 1G1YA 1LDCA 3AMLA 3HQNA 4NZ3A 1ZGDA 3EB2A 4DBEA 2X1TA 2ZBTA 2PRHA 2VCAA 1QBAA 3PVFA 2FMOA 1W9VA 3VGFA 4HMCA 1LROA 4B2DA 3NL3A 2J4GA 4HYRA 3D3FA 3Q67A 1TQJA 4IWWA 4CU6A 2QGYA 5T91A 2A3LA 4GE8A 2ZOXA 3HA1A 2W61A 4US5D 2PWVA 4ACZA 4M24A 2PGWA 5HR7A 3PBVA 5FACA 4X2PA 1BSLA 1WNOA 2ZADA 3GH5A 3VD3A 4HJWA 4NRRA 1XYLA 1FH7A 4O57A 3G3MA 3CIXA 4Q8UA 1K7EA 1HL9A 3H12A 3U2EA 2R1LA 3H2CA 4B5NA 3TVAA 4RDZA 4ZO7A 4WF7A 2ZXDA 4AZCA 3OBKA 3HN3A 5TAOA 3CHEA 2VFIA 1TO3A 4QP0A 5DMMA 5BMWA 3W85A 2JKEA 2YFNA 4UMAA 1UD8A 1XIEA 4I5UA 3HG5A 2Q8XA 9RUBA 1W6TA 2R91A 3WQGA 8XIMA 4X63A 3HQOA 3U6WA 4S23A 3TSBA 4MLRA 4YIWA 1RQHA 2ZXBA 2J9YA 3HF3A 4B5SA 5GNZA 3WNOA 3RILA 1VP5A 4XBKA 3OTRA 4CD4A 3RYSA 4WSKA 2XSAA 3QPEA 3WD1A 1GQLA 3LSCA 5E0CA 4HK6A 4MY9A 3NL2A 3APYA 1LBFA 4FO4A 2BWGA 3EWDA 4GH3A 4NILA 4OKDA 4HNUA 1XKYA 3AIBA 3UETA 3GNXA 5M1TA 4ADTA 4O8RA 1HJUA 1A5OC 2GVEA 4LJ3A 3BICA 4DYKA 1DIEA 4L4MA 4AVOA 4B5TA 5AVNA 3EGJA 1DTNA 3NZPA 4Q8TA 1KA9F 2ESCA 1TX0A 2QJIA 3M44A 4D6GA 3E6EA 2OEJA 4HKPA 1HJXA 3W7JA 4CNNA 3GC5A 3MUIA 4JDBA 2IKGA 4O4WA 3S8HA 2P76A 1OK6A 1XLHA 2YXXA 1TE1A 2REQB 3XIMA 5G4WA 3NEHA 4PMDA 5CSYA 1QWKA 5JBEA 2O92A 4AWUA 2J62A 2RH9A 4MJ4A 1WKEA 1VFFA 3BAWA 1AL7A 1E6QM 3NOEA 1DWHM 3L67A 1C3FA 4PCTA 1J12A 1FVPA 2IQTA 5DXYA 3WL1A 1DV7A 1XG3A 3TC3A 1MYRA 2REQA 1QI0A 3HPZA 3GU1A 1JF6A 3VNLA 1YRRA 5FD0A 1UMLA 4ZO6A 4BS0A 3I4KA 5J8LA 4QDWA 1I6NA 3W87A 4FLQA 4Z2LA 1E9YB 4IIBA 8CGTA 3AZRA 3CWHA 4P7RA 1TMQA 1QU4A 2WZMA 1FWHC 4E3VA 1LUCB 2Y85A 3DFYA 4QE1A 4LEFA 3EDKA 4IPLA 3NQ2A 5DX7A 4UOQA 3W2NA 3THQA 3VKKA 3DOPA 4HYVA 5MHBA 1Q6RA 4DWSB 3WNLA 4ATLA 5CPQA 1W5NA 5J5DA 4MYAA 4HA3A 1O1ZA 5FEXA 1UKOA 3CEPA 3M0KA 2XFWA 3I6RA 4D9PA 2NWRA 3PUGA 4V15A 2DH3A 1PHQA 3SI9A 3OGRA 4HTYA 3UCDA 3BUVA 4JPGA 2D2OA 5D8ZA 1MRAA 4AC7C 3UJRA 1UKTA 3QY8A 1Q6FA 1LQ2A 2NVDA 4CQ8A 2PAJA 3TQPA 3R58A 4HNTA 1DKWA 3CPGA 5E0KA 2QYGA 3SCRA 1K7XA 4OTKA 1C8QA 3VIKA 3CTTA 5JVLA 4R33A 4GPNA 3KEHA 3C2EA 3SRKA 1EIBA 1DBTA 2CLEA 2G96A 4V33A 2QNEA 1R3YA 2EBNA 4UFMA 2WMIA 4RDYA 3ZJ8A 1HX0A 4M6QA 4C6KA 1UCWA 3AZSA 5F1UA 4G7EA 1J11A 1M9HA 4IQEA 2VRQA 3POHA 5BU6A 2J78A 4G1KA 1X96A 2HE8A 3N14A 4GJ1A 2PF8A 1BVWA 5IDIA 4M51A 4MB4A 3S0CA 3SJNA 1BAGA 4ZBCA 1GJUA 2WHKA 4Y96A 1VBGA 3F4CA 2DW6A 2PU0A 4GBUA 3AXKA 4KIRA 4D6EA 1SW3A 1SSDA 3LCXA 3U2OA 5AYYA 5B7YA 4H6KA 2WMJA 4LALA 1CGYA 2Q6ZA 4LEQA 3VD5A 2WZTA 1EX5A 1XRSA 3DBNA 1I9CB 1VENA 1OB0A 4PZVA 3WJSA 2G5WA 2MANA 2CPUA 4GVFA 3WLJA 4RE4A 1DXFA 3KTSA 2VEGA 4WVXA 1DIOA 5A6LA 3E1F1 4WOZA 1QO2A 1CDGA 3OGVA 3QC0A 3S4TA 4XV0A 2JK2A 4OFCA 4O1CA 3AWOA 5GVJA 4YPJA 2QV5A 1E6XM 1YBQA 4C6BA 1R47A 3P81A 1O5RA 3GDLA 1GVFA 3ABOA 1X98A 4KBXA 3C86A 2Y8KA 3ZR5A 1HZYA 3F5LA 1NAL1 4H19A 5CAKA 3TN4A 4DIAA 2B4GA 1M7OA 1R0MA 2FZ9A 2IS7A 2D0GA 1PJ9A 5D4YA 2EPOA 3G5EA 1E15A 1H09A 2J25A 1QJWA 3EEGA 1GOKA 3UJSA 3QQ1A 1MMFA 3S6OA 1F3XA 3V1PA 4RNJA 3A5FA 1W1IE 5FSEC 1IEIA 3ZVHB 3L9CA 3RLHA 4S3CA 3ZT7A 2O0TA 5I24A 1CBGA 1ITQA 1GZ1A 1K8XA 4FNPA 1ICQA 3R11A 1ZALA 1JUKA 3T2OA 1TPUA 1VYSX 2X30A 3RF9A 4QJ4B 1TPC1 3NXFA 1TTIA 3UXAA 4GYFA 2DSKA 3HM7A 4IMFA 1WPCA 1PS9A 4KW2A 2VHLA 4PR4A 1Q6QA 2H8ZA 1FA2A 2VNCA 3WDRA 1LQAA 3GNDA 4E5TA 4AD2A 4XVDA 3L4UA 1YNQA 4S3BA 3WUFA 2F7FA 1SZGA 4NRSA 4TMCA 1BXCA 3DENA 2W27A 3ZSSA 2VX6A 4Y9MA 2QPXA 1ZAJA 3GXNA 2ZWYA 3PWGA 1Z9AA 2YCLB 3W81A 3DGRA 2ZYFA 4DHGA 2E6FA 3G1AA 3UT0A 1QNRA 3P3BA 1QPNA 1FUYA 2INFA 3W70A 2FJUB 4C6LA 3EDFA 3KBSA 3CYVA 3G1YA 1H4PA 4PMNA 2ZUVA 3N17A 1BTMA 5DY3A 2VO5A 3M43A 4RK8A 4CD5A 3AJ7A 4JTHA 2OWCA 3SZ8A 1FP9A 2CLLA 1F8MA 1XPGA 1H5VA 3VZXA 1SFTA 3GVWA 4JBRA 4AHQA 1SJCA 1OFOA 2WJEA 5LIWX 5G2HA 2V0TA 3RPMA 4K8GA 4E8GA 3CLMA 1L2UA 3DHFA 4ZEPA 4QAWA 4FS9A 5D37A 4B3ZA 3FN9A 2X0HA 4QROA 2A3CA 4DJED 2EPNA 5CC3A 3ES7A 4TMBA 4JIIX 3JZUA 3G3DA 2JGYA 4PUNA 2B7PA 1YDYA 3O6YX 3HV8A 4JR5A 1AQ0A 1OF6A 4B16A 3A22A 3G1DA 1EP1A 4ADUA 3PZQA 4GGBA 4TUFA 3WD4A 4H00A 3ARUA 4D6HA 4XAYA 3SCQA 3LYEA 2QCDB 2YX0A 1IE7C 2ZE3A 3IV3A 3WSUA 1OABA 2FHBA 1XISA 2PDBA 3CZLA 3BCFA 3SGUA 1FDJA 2E5DA 2DZXA 4IMDA 1CZ1A 1W1PA 4L4PA 1KFEA 1UWRA 5DRCA 3WUEA 1J0YA 2GLKA 9XIAA 1MFVA 1EGZA 2GQAA 3VMOA 4WIWA 4A21A 2GVGA 4GUIA 3P80A 1KFCA 2W79A 1KQZA 3MHGA 3KX6A 1ZAIA 3RLGA 1PAMA 4IJCA 3HBLA 3BARA 3UR7A 3C2OA 4F0LA 4GQGA 1JFHA 3MUCA 4GI6A 1R3VA 1V3LA 1PX3A 4H9ZA 3AMDA 2VFHA 1G4EA 3GTFA 2PD5A 3KRBA 4DAIA 2PF0A 2A3BA 1LCOA 2QAFA 1MFUA 3LPFA 3FK4A 1QUMA 1F5ZA 5BW6A 3KBVA 3RM9A 2DIEA 3B8UA 1ZBWA 1OFBA 3FX4A 4A2SA 4HT3A 1PB0A 4RCXA 3VFCA 4A29A 2W62A 2Z2BA 3TYZA 2NX1A 4HZ7A 4OHQA 1QW9A 3ZFHA 1KGWA 3IJLA 4G9PA 1XX1A 4BI6A 2G41A 4REQB 4GCAA 4Z1DA 4YXGA 1F3EA 2H3DA 4KCVA 3R2GA 4XZNX 3W84A 5LNSA 3SCNA 3CMGA 4WKAA 1VPQA 3TN5A 4H4IA 5CAHA 1XGZA 1EB3A 3LPGA 4GC4A 4S1FA 3I7RA 4Z17A 3THDA 1XG4A 2JE8A 2PLMA 4TR9A 1WZAA 3QPYA 3EB3A 1QHOA 1MEIA 2E0PA 4UQAA 1KWKA 2JIEA 4YWSA 3RX4A 4KH2A 4UBPC 5HUOA 3W6LA 4Q8OA 1Z89A 2I5QA 1LJYA 1K03A 2A1YA 2QUMA 3TEVA 3EWWA 3MCNA 3B40A 4Q22A 4AZBA 3KP0A 3O2LA 2BSLA 5IFTA 4HK5A 3WQFA 3P60A 4Q6XA 1M7PA 1WAUA 2NQLA 4GISA 1OINA 1TMLA 1DWIM 2PP1A 3EDEA 2ZRXA 4FNRA 3W1UA 2OX1A 1RD5A 3E2SA 1VPYA 3TNOA 4AZCB 4BHYA 3IIVA 3B0VC 2Z7GA 2PDFA 2X7VA 3IJ7A 1FWDC 4PC8A 7TIMA 3FXYA 3S6TA 3WQEA 4U33A 4YHEA 2HTMA 4ZSUA 3BJTA 4LW7A 4C90A 1V0NA 4L1WA 3UWEA 4JFTA 2QT3A 2C1IA 4XZHA 4WJEA 1ZBVA 1NIUA 2ZVIA 4DQWA 4AISA 1UYQA 1M41A 4FNTA 4PTXA 2FZBA 3IGSA 1NVMA 2PC4A 1OX4A 1KM3A 4G5DA 2XG9A 1S46A 1DIKA 6TAAA 3HMJG 4W5ZA 3KBNA 1TPEA 2AGKA 1EDGA 1V08A 3R13A 1LL7A 1JVNA 4A2RA 4M7SA 4B9ZA 1JCLA 2W91A 1FWCC 2NX3A 4IQDA 3GZ3A 2WJZA 2W6RA 1J0JA 1EX1A 1C29A 3EXRA 4GKLA 3WJYA 4DB7A 2PODA 3GKFA 3R0UA 5CJNA 5EBAA 3W28A 1TG7A 2O7SA 3HJEA 4TV6A 3NFUA 1AH4A 4NQ1A 3EX2A 4IXHA 5G1TA 5K9CA 2I16A 2VGFA 3UW6A 2RJHA 3FA3A 1R38A 1J0ZA 1EC9A 2CNCA 4MADA 3PF3A 5SWUA 1XYCA 6PTDA 3PPCA 3FYPA 3PJXA 3TR9A 3TYUA 1YDOA 2NT1A 1TJ2A 1RUSA 3UCQA 1AODA 2HCVA 1ML1A 2G3NA 1BHGA 5KINA 3AXHA 1JDEA 1WXYA 3TCEA 3ZMRA 3RCMA 3B8DA 5A69A 1A5SA 1VBJA 2QAPA 5I0DA 4NYYA 3MW7A 3V0TA 4K2SA 2B7OA 4RV3A 2OZ3A 4AHOA 3OBEA 3Q45A 1SFSA 3DG6A 4PEKA 4L6OA 3ZT5A 3LX9A 1YYAA 1D7KA 3B4UA 3ITTA 1UD6A 3CU2A 3CL8A 2V6AA 5B80A 3NEVA 2BHYA 4GRSA 2PS2A 4QE4A 4ZQPA 3I6EA 2V5BA 2VP8A 4FALA 3KHDA 3NGFA 2O9OA 1C93A 1KCZA 5XIMA 4BJHA 5GQBA 3MTWA 3VD7A 3QV7A 5AC4A 3PWIA 2IKHA 2J8GA 1VFUA 3MCMA 5FKYA 4AZ7A 5FSDC 3M0MA 3O16A 4LUJA 3VD9A 2C15A 1XGEA 4O13A 3GR8A 4IXXA 1IQ8A 2BB0A 3ORWA 4DO7A 4LCQA 1XIDA 4MB1A 4NZCA 2DVXA 2YA2A 1XD1A 2I7GA 4AEOA 2WSRA 1UA7A 1BG9A 4GI4A 2EJ1A 3P61A 3R10A 1OC7A 4QAIA 3VX1A 4IUGA 3PAOA 3SN0A 4LBUA 3MZ2A 3M07A 5IOBA 2H6RA 3WMBA 4QS5A 1J2BA 4I8YA 5K7JA 4RDWA 1QNQA 2HNHA 1HVXA 2OSWA 3ABXA 1F7BA 1I2PA 3LI0A 2CEQA 2Z4GA 1XYFA 1OC6A 3PPFA 3H70A 4WY0A 1P0EA 1VCFA 1VBHA 1US2A 1WDSA 3MMTA 1XIFA 1RBOB 4YWIA 1MQRA 3S46A 5A6JA 4JTJA 3T78A 4PTNA 3B8IA 4IQLA 4KS0A 3RXZA 1JZ5A 3VFLA 2OGJA 2PTYA 5C70A 3TK7A 1QOQA 1J6PA 2ZKMX 1QR7A 3AXMA 1TRDA 3N2TA 1XLCA 1K9TA 1ITXA 4ZTYA 3W7HA 3MKCA 3S5YA 3GC4A 2BVDA 3CZEA 1B4KA 3GTXA 3OZPA 1B5TA 3T08A 4JY9A 1EHAA 4H8UA 5AZ0A 1NWUA 1ITCA 3GG8A 3GNRA 3RGTA 2JFEX 1UZHA 5HULA 5LA2A 3QOKA 3EDDA 2GGHA 4C7DA 3T07A 4RV8A 1TVLA 3GVGA 5EMMA 4PTDA 3PZVA 2VCCA 2Z6IA 4U5IA 1A5CA 4XB3A 3TYCA 1XICA 5U4NA 3OYXA 3VNIA 4LV9A 1M6JA 3V4BA 3UR5A 4MNKA 3F1QA 2POZA 3CH9A 1THFD 5A6TC 1HGWA 2V30A 1ME7A 1YBQB 4DVOA 4D1JA 2UY5A 3RHGA 3BLOA 1AJ2A 4QRNA 3TLQA 4C1NB 4BKNA 2GUBA 4B5VA 3I10A 4L4OA 1YEYA 2I9EA 4IIEA 1FP8A 3LBMA 1ZJHA 3HPFA 3O6CA 4AF0A 2RFGA 3U7BA 5LNRA 3F7JA 3PNZA 1VCVA 1DEDA 2FH8A 3S1XA 4LT9A 2QLYA 1DOSA 4IG2B 4GO9A 2Z28A 1BYDA 1GCYA 1PKLA 2FZMA 2CLMA 3ZR4A 4KRZA 3RK8A 4OU1A 3FOKA 1KFLA 2J13A 3PWAA 5AC7A 1K4HA 3TYDA 1CXEA 3SQMA 2OTDA 3M0YA 3W02A 2J75A 3OYZA 5CZTA 1UWQA 4Z1YA 1VBUA 4Q8QA 4D6DA 5M3WA 3V36A 1AH0A 2WSKA 1UIPA 1OFRA 3LHUA 1MZRA 3NPUA 1XDLA 2NQ9A 3NVTA 4JN6A 3GRIA 3VE7A 2QJHA 3TYAA 4ZQRA 1H7WA 3WNNA 3UZZA 2GL5A 3WBWA 2FVMA 2Y7FA 3RMEA 3WUGA 3I4EA 3ANUA 5HMSA 3IGXA 4S3EA 5I06A 1XSIA 1XRTA 4IJBA 1X6UA 4Y8EA 1JQVA 1UWUA 2WSPA 3H4WA 4HTBA 2WCGA 5HR6A 1TUFA 3RR4A 2WO5A 1RLCL 3NQFA 1AL8A 3FFSA 3P62A 1U22A 3MA8A 2ZZ7A 1W8GA 1HL2A 3IVTA 2DZVA 2PTXA 3WH5A 1AVAA 4ZO8A 1Z44A 3XINA 1FCBA 3UYCA 2DT2A 1SJAA 1FKXA 1X8FA 3OPSA 3AS3A 1IGWA 1LF1A 1TB3A 3IK4A 3KHJA 4H8HA 4QEHA 3ICJA 1EWDA 4ICNA 3UP8A 3T05A 3VCNA 3LK6A 3O0KA 3LG3A 2V2HA 3PPGA 1ZSXA 5EMKA 3TTOA 4R7JA 4PL1A 2VFEA 4U31A 1FXQA 1FX6A 1W2VA 5C9WA 1KTBA 2ABAA 3DGBA 3TMLA 4JFUA 3AZTA 3SGGA 1T7LA 4F0SA 3CV1A 1T8XA 1CX9A 1RBAA 2OB3A 2C79A 2E5CA 4P7OA 4DWSC 3OP2A 5FJUA 1TZ9A 2V9DA 3PJTA 1E1FA 3L2IA 2WQPA 4LNCA 4LVFA 4NX5A 1EYWA 4EF9A 1LWHA 3TSDA 1Y7VA 1W5MA 3BQ5A 2ZICA 2OYKA 1L6GA 4CQ9A 2E09A 3WY1A 3LI1A 4EPKA 4LH8A 3SFWA 3ZLHA 5KZ6A 4R5EA 4EANA 2JQXA 1O95A 4IGSA 3VDGA 1HJQA 3UZWA 3VYLA 2E77A 3A4XA 5AFDA 3DCPA 3FYOA 3E02A 5I3IA 3BC9A 3E38A 1NOWA 3HIJA 3Q94A 5FCZA 1EJ7L 1F4AA 2R1MA 4DJEA 1UQYA 4D6JA 1XQKA 5JU6A 1OVDA 2R14A 4QG6A 2C16A 2GUUA 1SU5A 3M6DA 1ZPTA 4BWLC 4B9YA 2EPMX 1E40A 4BI5A 3LTYA 4I5RA 3FW6A 5BOEA 2J47A 4UWMA 1OFPA 5LGXA 1BYAA 3AUJA 3ZIZA 3BG9A 1FWBC 4E0CA 5FJPA 3UU0A 2Q02A 3SSJA 3U5YA 2A5HA 2ZWZA 3AMCA 1MSSA 1E6NA 2GFTA 1QI3A 4NT0A 3CTLA 4HNCA 3EA2A 4ECLA 4UCFA 5AZ1A 3KWSA 3VZZA 1O5KA 3UWVA 2TMDA 1QPRA 3DFSA 3S42A 1ODUA 3G0UA 2D24A 3KL5A 4FXSA 3T0DA 4K37A 3SO7A 3JUGA 4CCCA 1L2QA 1OM0A 1V6UA 3E3HA 1IWBA 4O50A 4AWTA 4H2HA 1FHVA 1KXTA 1UUOA 1N55A 1NOUA 4YCOA 1G67A 2H8XA 2PC8A 1TRIA 4Q4RA 1W1A1 5AC6A 3AYSA 2JGQA 1ZUAX 2GSHA 3A13A 3INPA 5HJLA 1XPYA 4W7UA 4DX3A 1TWDA 3WH8A 4Y6GA 1O7AA 4WGHA 3ATYA 1YADA 2CHNA 4G7EB 1V6XA 4PA8A 3V18A 4JCMA 1J10A 3CV7A 3AFBA 3DN5A 2F61A 1Z3NA 2J24A 1W1VA 1MNZA 2QEZA 3Q65A 4AH7A 1KXHA 2HVOA 4B15A 1P5BA 2IPJA 2VRJA 4LF2A 2GOUA 2WV8A 3ZR6A 1TZ7A 3UR8A 2O56A 1DJQA 1US0A 3TV8A 1C90A 3TR2A 2E3ZA 1SFJA 3BAXA 3TJXA 1VHNA 3OBAA 1JCTA 1TELA 4Q8WA 3HQPA 4XZBA 3I6TA 2C7FA 5I09A 1Q4WA 4ASTA 2H3BA 3IACA 3SUUA 4NX0A 1UR2A 3NO5A 2ASHA 1UOZA 3G1SA 1E4NA 1RJPA 4DJFC 5G1MA 1GZGA 4FX6M 3PZTA 2HBVA 1IIGA 5H1WA 2PWGA 4OZOA 1XDMA 1IEWA 3T8LA 2XH2A 4N02A 1UQZA 2HXTA 4GI9A 1T0OA 3I65A 1NQ6A 4HSNA 2TYSA 3H2MA 1FWIC 5A5WA 3NQ8A 3FSUA 4HSOA 3IK2A 2J77A 1GVYA 3MHFA 3BCDA 4Q4KA 4NZFA 4DYJA 4GY7A 5KMYA 2NQZA 2G3JA 1L8PA 4M5PA 4ICCX 1JPHA 3WLRA 4MJZA 4DLMA 1J18A 4ZZ9A 1JAEA 4W4QA 3KOXA 2VJXA 5ABFB 3NL5A 3GD6A 2ZXQA 3R8HA 2WMFA 4JX5A 3ABRA 2DUAA 1W3JA 2JEPA 5LSMA 1E9LA 2RDXA 2LLEA 5AHLA 1TCDA 2PDYA 3V5CA 3AUOA 4IGNA 4JCLA 2CXEA 1IT0A 2A3HA 3WLTA 4IIDA 4V27A 1QNVA 4AY7A 4R7OA 1LTDA 3OIXA 3BLLA 1TTPA 4PB3A 1OIMA 3TROA 5C0QA 3ZM8A 4QJ5B 1SO5A 4GOAA 1VJSA 2NWSA 3LV6A 1DWJM 1YTEA 3WD3A 5JBFA 1VFOA 1D8CA 2ABBA 3RPTA 4JFWA 3SR7A 2GYIA 2NVCA 1WUFA 2W5FA 1I0BA 2PCEA 2PTDA 5BXTA 5K9XA 1YTDA 1CNVA 2OZTA 1VAHA 3KL0A 2EXOA 1JYXA 4PMXA 4FK9A 2CZVA 4I6KA 4LAOA 2BXZA 3TOYA 1HKJA 3GDKA 2FIQA 4HHHA 3BURA 4AWEA 3MUY1 5GJPA 3CNYA 2A79A 4PUMA 8A3HA 1A5BA 3H22A 1Q7QA 4ALDA 1OQFA 1M68A 3KOFA 2VUYA 3WLIA 2OYMA 3PZIA 4GY1A 2E8YA 4UR8A 1KM2A 1F3WA 2JF6A 4C6JA 3LD5A 2BBFA 3VIGA 3LZ5A 2OG9A 4FXRA 1KFKA 1H1NA 3ZJ7A 4W9TA 3E0LA 3W83A 5T26A 3DC0A 3N6HA 2JEQA 1FY6A 4JNYA 4NJHA 1U1HA 5DRIA 3BDKA 1PTDA 3QH2A 3QVQA 3NPVA 2BV9A 1FFQA 2ADAA 5LIXX 1EPVA 2DZBA 3UESA 4BY3A 3AIRA 4KWVA 3LLFA 2YA0A 4R3UA 1E3ZA 5JH1A 1O66A 5FF0A 4S39A 1U5HA 5I7GA 2OZ8A 1PYFA 2BGNE 3W53A 4Q3MA 4LFYA 3F03K 4QLJA 3W37A 3B8TA 3EOSA 1C9DA 1I0DA 3ZYZA 5HMEA 2OEMA 5CXPA 3DECA 4G8TA 2Y5SA 3LHZA 5IHRA 1SGJA 4CCZA 3WF2A 2AQWA 3T2QA 2WKLA 2WWCA 2HISA 2RHGA 4NHVA 1L6SA 3CZ8A 3SQLA 5C8BB 1FWSA 3RJXA 3CHDA 1FWGC 2CZ5A 2SFPA 1CXLA 1RV8A 2F9RA 4HB7A 3B9NA 4DZHA 4QHRA 4EXBA 3TWBA 1FKWA 2Z29A 4C6NA 3B8WA 4IISA 1SO4A 3CAVA 1HNYA 1WDDA 6CGTA 1X6NA 3W38A 4CGTA 4Q4OA 4H2CA 3SW6A 8XIAA 4NZ1A 5HQMA 3C8FA 1PZ3A 5I3DA 2DSUA 3W2JA 2WSYA 4XG1A 3LERA 2AAMA 4YTSA 3QM3A 4ZE5A 1LT8A 5I79A 2A3EA 1KGXA 4XTIA 3NQCA 1H51A 1Q6EA 3VUPA 4FF7A 3SRDA 3EDJA 5I3GA 6TIMA 1P6BA 2WAGA 3W7KA 1TVPA 4A3HA 2GGGA 4P8UA 4AEEA 4MDOA 4Q7BA 4B5WA 1QT1A 4JZ5A 5L6UA 2E7FA 1E4IA 3WLNA 1KWGA 3PSWA 2F8QA 1I60A 3K8MA 4LUSB 1KCKA 1O1HA 3M0LA 3JZEA 1UWTA 1RY8A 4R27A 4GKTA 4AFYA 3GR7A 3K8KA 4KKXA 1EJUC 3VA8A 5D2VA 2XDFA 3BL3A 4K68A 2GGEA 4Z0JA 3C2RA 4EWND 4RPQA 4AW7A 1K6AA 4HQVA 5K4XA 1QOPA 1T6MA 3AXIA 1XF0A 4C6MA 1GKPA 4A3QA 1JCXA 1P6CA 2PP0A 5D04C 3V16A 1SVDA 2XVLA 2OQYA 3G8RA 1EKOA 3DH7A 3NWRA 2RJGA 3VNKA 4FIRA 3PC0A 2WHJA 5HQEA 1UMYA 2ZRYA 4RPPA 3DHPA 2YCLA 3L21A 3QV9A 4HU4A 3ALFA 2ISWA 3PPHA 1NWTA 1EUAA 1QATA 2D69A 3S1UA 3AU2A 1SZRA 3TMQA 4EKJA 2OZ0A 2HSAA 1R9ZA 1HKIA 1BWLA 1IWPA 2ISDA 1PSCA 4FOKA 3ITOA 2EKCA 2QDHA 3GIPA 3K1GA 1NARA 1GK8A 4I9JA 4MFEA 3SCWA 1SUXA 3BOLA 4IMEA 2EEXA 1V0LA 4CQBA 4YTRA 4NG3A 1DWFM 5ABGA 1SJBA 1XBZA 3UA4A 2PWUA 1PDYA 2PE4A 2HRWA 1ZB5A 1W17A 5EMJA 3M0ZA 2DSWA 3N13A 4LB4A 2EG7A 4O15A 1UR4A 3GM8A 5A6BA 1AH3A 2TRSA 1WKFA 3AU6A 5DO8A 1MEHA 4NNCA 4O1AA 4KT2A 4TVUA 4M0XA 3EA1A 3TU9A 1E0XA 4OV4A 3B97A 3QBUA 3D0CA 2OLAA 4B91A 3ABSA 3OU8A 4PYSA 2PDHA 3S9ZA 3TFCA 1NWSA 3WDPP 4JKMA 2WYSA 5CPOA 1P7TB 1MW3A 3NQVA 3QLLA 4WY0B 3DFHA 3AS0A 2BS9A 1YNPA 3GFZA 5DMNA 3OODA 2I5GA 3KM8A 2W67A 3QR3A 4AZHA 3LV5A 4W87A 5U7SA 3F2CA 2NXGA 3MWCA 5HJXA 4LVAA 3TQ0A 4XD6A 1JFXA 4AMAA 4HA0A 1Q45A 3WK3A 5CZSA 3VOIA 2XM2A 2O9RA 3N3TA 3H24A 3N2MA 2V5LA 3TAKA 3S5SA 1GJWA 1ZHAA 3AHYA 3MKKA 4MHBA 2E5BA 4KQNA 1P0DA 4FAMA 5DCBA 3S2NA 3URAA 4LWWA 3EWUA 3LRKA 4URIA 1EJXC 3QY7A 4K6AA 4TVCA 1H63A 3MVTA 4ACZB 2QF7A 1AK5A 2GQ8A 2X2GA 4J3TA 5A6BD 3PTMA 1QK0A 2ON3A 1CXFA 1F07A 5D2YA 2FTYA 1IHIA 2GGIA 2FGLA 3IGHX 2OGYA 5FJRA 1UZ4A 3NDOA 3AIVA 3QHMA 4NZ5A 1SPQA 4OBTA 1W1TA 1Z8AA 4I90A 4MFDA 3KBWA 1T8QA 1EF3A 3FDKA 2ISSA 2AL2B 1XLIA 3BCJA 1DQWA 3UWUA 2BY1A 6ENLA 1HVQA 4CNPA 3VGEA 3C0JA 3ZS4A 5H8MA 3M0HA 2OSXA 1ADSA 1IIHA 4E4FA 1LT7A 3KE0A 2OWXA 4A8IA 4RW3A 3L68A 1W3LA 2FJKA 2WMKA 2EJAA 2J27A 4J28A 3ARZA 1P0NA 3FYYA 5REQB 2NLIA 4K38A 4UQEA 4JNMA 4LV4A 3DYMA 1ESWA 4H7VA 1Q2SA 3QZEA 6REQA 3LMZA 4IIHA 1W3TA 4Q32A 1P48A 3QLDA 3FEQA 2WK2A 5BWAA 3D6NA 5FJJA 1B2YA 2PGEA 4M1RA 3WELA 3UWZA 1H7OA 1A5UA 1CXKA 1SR0A 1G6CA 2KX9A 2NXHA 4ENLA 1A5KC 4GGHA 3O15A 2IW0A 4HPNA 3PUEA 1TJRA 4AAJA 2VENA 2UZ9A 3ARWA 1V5XA 4XX6A 2POTA 4UFKA 1F73A 3GXPA 2QDGA 1CGXA 1XYBA 4XAPA 4NAFA 3S2CA 3MP5A 3JS3A 3C4UA 1IZJA 4WCJA 2I57A 1RJQA 1E71M 4XZ9A 1P43A 4KEZA 4FPSA 3N2CA 2XYLA 4PL2A 2OU4A 4BK9A 1ALDA 4FR6A 2IXVA 2VZUA 3CWOX 1S2AA 3QYSA 3TH6A 1NFBA 2R1KA 2PBOA 4JXCA 4GXPA 3KVLA 4Q7NA 1AQFA 1GONA 1Z41A 1K8ZA 4LVGA 4Y9PA 1DJWA 3KDNA 2QCEA 1J6OA 1CGUA 1YPXA 2PDMA 1EDTA 1XCXA 4GJIA 4M82A 1VFMA 3UERA 2OX4A 1W5QA 2X2YA 5F7UA 2NQJA 3H54A 1I2RA 2BHZA 1BVZA 1VFHA 1ZFJA 1OX5A 3TN6A 1ENUA 4YVPA 4MZ1A 2XISA 4P7LA 3F5JA 5JBDA 1B3XA 3GNPA 2JF7A 1QPKA 1MRQA 2CERA 3PSVA 1T5AA 4HCLA 3W2LA 5D2WA 4HMNA 1TIWA 1BSIA 1EQPA 3DKLA 1ITUA 2CWXA 5ECUA 3URNA 1ICSA 3R43A 1YXDA 1KR0A 4J5NA 1X6LA 3NPWA 3C2VA 5FI8A 2CBJA 1HF6A 2E9MA 1Y5XA 4BEQA 2X1SA 2PEVA 4AD1A 1EBGA 5ABTA 2WZHA 5G5IA 1XP3A 3FS2A 5FJOA 1DXIA 3COTA 3BSHA 1GOWA 1XS2A 4XD4A 4YLWA 1HIZA 4GACA 3GDMA 4CUCA 1E51A 4PCPA 4G2DA 3WIJA 4MWAB 4IP5A 4F66A 3WQ5A 4W7VA 5BRQA 2DZTA 3NQAA 3CPRA 3T6CA 2AKMA 3V35A 1KM0A 1H5YA 3VGGA 5D32A 2PDNA 4LY4A 3IRDA 3BAIA 2ICSA 1BF2A 3H21A 1X97A 1WX0A 3I7SA 5GNXA 3S83A 1HL8A 3FA5A 4JYFA 4IICA 5EA9A 5F4WA 3CUIA 4YYCA 2P53A 4H41A 5D05A 3UJ2A 4MYXA 1G5AA 3IJQA 2F6XA 3SCUA 1RPXA 1XYAA 4TU1A 2GOKA 3DI1A 4DAFA 4QLLA 4DBDA 2JBMA 3NQGA 3TN3A 1QHPA 3RG6A 1MW1A 4C7GA 1M65A 3TFXA 3EKLA 4JX4A 3P5YA 6REQB 3EPNA 2FPYA 4QGCA 4JTRA 2QDDA 4MDPA 3DAQA 2GPTA 1K9EA 3BPWA 2YXGA 1TX2A 3LDVA 3HG2A 5EFFA 3N6QA 3FEMA 3L4TA 5K4ZA 2BP1A 1DE5A 2GSEA 3NM3A 1RVGA 5LIYX 1BRLA 2RAGA 3P6LA 4KGLA 1VFSA 1S3HA 1ZJAA 1GKRA 2BLEA 3LBCA 4Q4PA 3P74A 2CLFA 3PNUA 5CQ1A 1EYEA 3XISA 3HGOA 4O17A 5A2BA 1JPKA 1W37A 4BA0A 3L4WA 1FFRA 3BV4A 1UH3A 3WLKX 3GNOA 2Y5EA 1XYZA 1EIXA 1GVQA 3WF0A 2Y7EA 1QDSA 3UCCA 4JTGA 3EX6A 3P8IA 4JL1A 4GXMA 4B4HA 1X8CA 4D6CA 4UNKA 3S2MA 3M0IA 3AC0A 4AYGA 4L61A 5AVHA 3RJYA 3GUGA 3MO7A 3R0DA 2NVAA 3MB9A 5HWJA 3LOTA 2GJPA 2VURA 7XIMA 4GNJA 3IPWA 4QSFA 1K9DA 5I07A 1PIGA 1F3TA 5C9RA 3FA4A 2YDAA 5DCEA 3W6YA 2V82A 3E5PA 4JIQA 2NZLA 3OA3A 5BXSA 3WF4A 4WOQA 3O1NA 4O19A 4W84A 4AHPA 1L8NA 1FWNA 4N9EA 2Y2WA 3ARSA 3K8LA 1KTNA 3BLEA 4CVWA 3MWAA 4DO4A 2ACUA 1OT2A 5A95A 2JKAA 3GG0A 2WBKA 3QSRA 1X39A 3CBWA 4DJDA 2Y24A 3TW7A 2VOMA 4GI8A 4YCPA 4KCTA 4H6EA 2XH7A 3ZO9A 2GQ3A 2C13A 4OGZA 1PEZA 2ZZ2A 5EBUA 1FWJC 4LCRA 4YU1A 7A3HA 4Y9OA 5AHEA 4DBSA 4UTIA 3BMXA 4EVZA 5CZKA 1ZJIA 3R4IA 4LANA 7PTDA 1ZTVA 4IHCA 5HINA 1JYNA 1JCJA 4JNZA 2CXGA 4O1BA 3D47A 3VIHA 3CZJA 2YIHA 3PG9A 3GHRA 3W7EA 1J9YA 1W3IA 1EJSC 2R1NA 4K7VA 5IRPA 4G7FA 1PZ0A 3JW7A 1W9BM 3VOCA 4CNOA 2DY3A 3EMZA 5TBOA 2TAAA 3UJEA 2PMQA 1XLEA 1N7KA 3MZNA 4E8DA 4W89A 4V2XA 3RR1A 1R85A 3S5ZA 1TIMA 1UD4A 4C6FA 4AD4A 1TV8A 3WMLA 5J5RA 4O8AA 2Z1SA 1REQA 4QIUA 4GQQA 3M5ZA 4CD8A 3N9SA 1QBBA 3FXGA 2JIWA 4QQ3A 2VC6A 4K8EA 3IVUA 1SZEA 1IXNA 1CCWB 5AKQA 3E96A 2EQDA 4Q8MA 5AECA 4DWDA 2PZ0A 2Y70A 4ZOBA 5FEZA 2WCSA 3NSXA 4LNYA 2VEIA 5KZEA 4R34A 4NP7A 2O55A 3SADA 3CL6A 3LLXA 4CNSA 3BLPX 4WJ8A 1KC7A 1ZQ5A 1PL9A 3VAVA 2I1OA 1UZ1A 1H62A 2A21A 1KGUA 5G2IA 3LLDA 3LY0A 3UG8A 4GYPC 5C7HA 2PCQA 1DJNA 1W5PA 4QXIA 1FWWA 2DP3A 5CPLA 9CGTA 1L6YA 1ZRQA 3CT2A 3GAKA 1RBLA 1BYBA 1O94A 4J3WA 4RZBA 2DW7A 5I00A 3AO0A 3QFEA 4M1BA 2ZTJA 3NYDA 1BGGA 4YS1A 3WH6A 2D2JA 3T4WA 4I7WA 1WP6A 1CB2A 1D2KA 1DVJA 1T99A 3VE9A 4AG0A 4MUPA 2GVYA 3GXFA 3HO8A 2WQDA 1HP5A 1XIMA 3M7WA 1XBYA 1J0KA 3DFOA 1HN1A 1JDCA 4UIOA 2ZTKA 4AXNA 4AIEA 3WJWA 2BOEX 1BQGA 4AUBA 4DJFD 1IR1A 3KOZA 3T0BA 1EA9C 1JDDA 2HVNA 4NF7A 4ZQOA 1JXKA 2ZA2A 3IIPA 5BOFA 1RQBA 2DU2A 2CIPA 3TW6A 2ZZ6A 1ELSA 1WOAA 1EP3A 1KRCC 2QZRA 2XPKA 3GO2A 1TPWA 1H11A 1B90A 2QPSA 3SCVA 4U3AA 1H0GA 3CAKA 3WFAA 4L4LA 2QJJA 4C5ZA 3ATZA 1JRBA 3CPUA 2DQXA 2OELA 4QITA 3IAPA 3PG8A 2RGMA 4NXKA 3W75A 3B8VA 3PTDA 4A8LA 3W1RA 1W9DM 3GTIA 1FHDA 1OJXA 3P7YA 1SW7A 1MXGA 4XISA 1OZMA 3C56A 3GDTA 1W1ZA 1VBRA 4OOUA 5HPCA 2G97A 1UIOA 4KFOA 3UGVA 3VKAA 3OLEA 4PBGA 3PZOA 1LG2A 4AIUA 2OODA 3WK1A 1JD9A 1Q7ZA 2Q8ZA 3EX3A 3WEZA 3ANVA 4H9UA 1UD3A 2V2CA 2ZDRA 2CLOA 3LCGA 4CD6A 3ARVA 4NL1A 4BF7A 5H6HA 3HFYA 4GLEA 4IP4A 1UWAA 2PURA 2WZIA 4IIGA 4HCHA 1FWRA 1OT1A 3OHIA 4NVTA 4TVDA 2ZXAA 5HBFA 1EO7A 3OGSA 4FLSA 3LHWA 3W23A 2Q3OA 3E74A 1GTEA 3CQ0A 3VABA 3WFLA 1X7FA 3FJ6A 4I7UA 1R5YA 1J5TA 3HGRA 1UC4A 1MEWA 2FFCA 2VEMA 2YL6A 1TE6A 1J01A 3SB0A 3H55A 3TLLA 3BE7A 3WNMA 4Z0SA 2HDJA 4MNLA 3BO9A 1PO9A 3C2YA 3DKJA 3H4GA 1I75A 3W1MA 3DU0A 2OOGA 1R6WA 2NX9A 3O0FA 3WQVA 4DZIA 1C92A 1AJ0A 4UUIA 3PUOA 2PU1A 3AS2A 5A8QA 6XIAA 1V7AA 2J7BA 4I9MA 2VXNA 4GUGA 3VZYA 3D46A 3FV9A 1GVOA 1IEXA 2INZA 4JGDA 1VYPX 1OFQA 4KPLA 2VGGA 4WJXA 4DZAA 5D09A 3VC6A 3HPAA 2P88A 4BQ5A 2I9UA 2Z7KA 3TJIA 4W8BA 4G56A 2Z26A 1TJ1A 4R53A 3E2QA 1FHUA 1PKMA 4DLFA 1B3OA 5FJIA 4B5UA 3CJPA 4ADSA 4AWSA 2CBIA 1X38A 4NJJA 3EYPA 4N6EA 2Z2AA 4WX2A 3I7QA 5E9AA 3LGGA 1XIIA 2PLKA 4QE5A 4RXGA 4JOMA 1L0PA 4CVUA 1NWRA 4DJEC 4YTQA 1NSJA 4O0KA 3W7OA 4GJJA 2QIIA 4DRSA 3PFRA 4QLKA 4PGLA 4X61A 1WCGA 2FZNA 2WPBA 3QF0A 3UXIA 1GYNA 1LBLA 4RE0A 4ZFMA 1OSEA 4Q4MA 3QGAC 1TFVA 3GWQA 1GG1A 4LY8A 2PGRA 4LAZA 1A3WA 1MI3A 2FGZA 5BXPA 3WO8A 3BANA 2YYTA 3R79A 3R5EA 4UMBA 1GORA 1EFZA 3FHAA 3CUHA 3O63A 4C6IA 4EF8A 5DBTA 2PBGA 2C6QA 1PZ2A 4J3XA 4LS1A 5G2WA 2ZZ5A 3E0FA 3GU9A 4XK2A 1XLDA 2OJPA 1HUVA 1R2RA 4JIRA 1GW9A 1V6VA 3P8JA 2VX7A 5CBBA 4EXQA 1HP4A 2QCLA 5MKGA 3VOHA 3AROA 3H8AA 2R1PA 3UY7A 1BXBA 3G22A 5CG7A 3VGBA 1MO0A 3FJ4A 1CEOA 2P0IA 4JKKA 1GVIA 3KRZA 2IKIA 3QTPA 3LGEA 3H6OA 3K4AA 2HMCA 2BMBA 1W32A 4EXAA 1LM1A 2OLHA 2XN2A 1J0IA 5DBUA 4LTSA 3B3DA 5BYWA 5AHFA 5DF0A 3PAJA 5A94A 3P0XA 1WDQA 1PPIA 5CBIA 4DI9A 2NSOA 3W74A 3WF3A 1H1ZA 4ZQMA 1A0EA 3LNPA 2VDGA 3W7QA 4MJ2A 2DVTA 1R9YA 1VR6A 4IF2A 1Y65A 3BW2A 3AHZA 3GW3A 2UY4A 2QJGA 1QFEA 3PTQA 4HA1A 3GHUA 1DJZA 3M0VA 3WLPA 2WW5A 3G1FA 2ACSA 2VFDA 4O4VA 5I78A 1Y5WA 4QSHA 5G4EA 3C8NA 5IBXC 4S3JA 1JL8A 1HKMA 1YX1A 2QCNA 2CHOA 2ATSA 4PUUA 4EPDC 3C52A 3MP3A 2D2GA 4R9OA 2FVKA 3W86A 1JDAA 4C1NA 5IFPA 2WVVA 1PWMA 3CHVA 1YHTA 3U2CA 4GABA 4P8XA 3KRUA 4AX7A 3O7UA 4IFKA 1DTUA 1KLYA 3F4WA 2E6YA 1KNWA 4MSSA 1ME8A 3CGTA 5LNVA 1UA3A 2OWWA 2J7EA 1J4EA 2ZA3A 4AVFA 4EPBC 5DN1A 2ZRUA 4QNEA 1GWJA 2G95A 4CQAA 3QGVA 4Y9AA 2NSXA 3POCA 4DF0A 2D73A 2Q3RA 1UOKA 1EJRC 1XIBA 3ONCA 3LHTA 2A2IA 1HFBA 2J7GA 4JEJA 1U30A 1RH9A 1PTGA 3A4JA 4OQVA 1NFPA 3CAQA 3ITCA 1KFJA 3LRLA 5CPSA 1CLKA 1GEQA 4RXFA 4H8NA 3BGJA 2V3GA 4EPEC 4CKQA 3NA8A 1A5LC 4PTMA 3TC7A 2QJMA 4LQ1A 4GBDA 2Y4SA 4L65A 4EE9A 1P1XA 3AIEA 1W5OA 1VGAA 3VOFA 3T0TA 3VCCA 2HNEA 1FCQA 1VJIA 5B7ZA 2GQ9A 3HJZA 3RNDA 4L1GA 1G7UA 3VI2A 3W01A 2NQHA 1ZCOA 3H26A 3UZYA 1I2QA 1JYWA 4PSRA 4GX8A 5AYXA 3URBA 3QXBA 1KRBC 2QCCA 3SCOA 4MPKA 4UZSA 3PULA 4W5UA 4Z1CA 4O52A 4Y8FA 2C3ZA 2V63A 1JG9A 3DESA 4DBWA 3E2RA 4CEUC 3NZQA 4ZMGA 2V2DA 3CHCA 5DLCA 3L5LA 1NP0A 4GVHA 1RA0A 1QI5A 4YVVA 2W63A 4UMCA 3QKEA 3GTNA 3IJIA 1XLBA 3TTQA 3IVSA 4D6FA 1SM9A 4YMZA 3K1DA 1GVSA 4F0MA 1DJXA 4WKHA 1KKOA 1S39A 3A4WA 4W8AA 2A7RA 1PX8A 5A6KA 2OQLA 3WLOA 5AYZA 4JIHA 3CUJA 1UASA 1J0HA 2Y6ZA 1Z48A 4IPPA 3NDZA 1E4LA 1Q7MA 3F4VA 3BTNA 2A6LA 3EOOA 1E3XA 5CSUA 4NAEA 3BSMA 1F9CA 3EWZA 3WN6A 4S3GA 1BEUA 5E09A 1NFGA 3VOJA 3N29A 3KW3A 2C14A 2ZUMA 2BZNA 5C55A 1TPB1 2J8TA 3E9AA 3V5OA 3CZGA 2GJXA 1V3KA 1UB3A 2O4QA 4GD0A 4JHZA 4HJFA 2WKGA 3FHQA 4LBRA 1M5WA 1XV8A 3V1HA 2A85A 4O0ZA 3GU2A 2PSNA 3SQSA 3O9NA 3WQDA 4UNLA 3E2VA 3PZMA 4F0HA 5EMLA 3KXQA 5J04A 3T09A 3N18A 1PZ1A 3CUGA 4J35A 1KRAC 1R2SA 1H7NA 1G4TA 1C7TA 1QHZA 3PBMA 1V03A 3W7NA 2VD8A 2PDQA 3CQHA 4BQ2A 1Q63A 3MO4A 3B04A 3WLMA 3UG4A 4JFVA 3ABQA 3VDHA 1R9XA 2VKZG 1PVNA 3N9RA 3K5XA 1UJPA 1OFDA 3GK0A 4HOWA 2EGZA 2YZ5A 2HZGA 3RLUA 3KCOA 3MVIA 1UR9A 3W7PA 1A4LA 5AC5A 2AMGA 4IQJA 3N19B 5FESA 1M03A 4HNVA 4P7NA 3N4FA 2YSWA 1XCWA 3C5QA 1FTXA 2OSYA 3N12A 1X7IA 1FXPA 2FB2A 4F9DA 4NYUA 5HXMA 4DXVA 1KBKA 1EA0A 2G37A 4F4RA 2C18A 4NU7A 1WKDA 1YLVA 3DC8A 3C61A 4WKFA 4DO5A 4P7QA 4U28A 3D3AA 1JULA 3GXTA 4O53A 1YPFA 3IGUA 4W8LA 2PLCA 3NQDA 4HHLA 1GHSA 3TOPA 4KERA 3SY8A 1WYIA 4WDWA 4Z2HA 4ZTXA 4REQA 5KEZA 1Q85A 7CGTA 1GQNA 1YMYA 2PFHA 3MBFA 4NSBA 2DORA 1F61A 3N6JA 1XBVA 1GYMA 2WM1A 3TDFA 5I77A 3TIMA 1G4SA 1FCVA 4JTTA 4IFKB 1XXXA 2ALRA 4Q4QA 2X1RA 1R87A 1U2YA 4A8RA 4TX8A 4GZJA 3FLUA 3Q4DA 5FAJA 5E70A 3R1ZA 1W1B1 2P5NA 2QULA 1P4CA 5C6MA 5F1VA 4J3VA 4L5ZA 2QMJA 1VRDA 2IPGA 1GOMA 4WLCA 4DI8A 1TKKA 4AVNA 3LBOA 2HPMA 3TAOA 4LF1A 3RRAA 5LKYA 2F84A 3WEMA 3L0NA 3R6IA 4Q8VA 2OR2A 3IJ8A 2YW3A 2E6DA 1POKA 2P8CA 3APTA 1WDPA 3UY8A 3DHDA 5CPTA 1LOLA 1TWIA 3TWAA 5FEPA 4RZ6A 1OIFA 2BXVA 3W9ZA 1KBIA 5BNKA 1YQ2A 4F9JA 1DYSA 3HFTA 3AI0A 1NDYA 3PJWA 1S5VA 4WGXA 3GKAA 2PTZA 5E0FA 4WR3A 1P0BA 2Z2UA 1NJJA 2FMNA 1KFWA 1JEZA 3O05A 3IEBA 1VYRA 4R7WA 3UJFA 3JR2A 4DUXA 1SW0A 1W9UA 5CPMA 2VZVA 4C7FA 5CG0A 2PRLA 3HZ3A 1FH8A 3P0WA 2XZ7A 5K2ZA 1IWAA 1BG4A 4RNHA 2E68A 4WDXA 3I3EA 4AQLA 1A53A 1C91A 4NNAA 4PMQA 4E2BA 3AS1A 3REQA 3W7MA 1OBAA 4LC8A 1F2JA 4DO6A 1LL6A 2BGSA 3G6LA 1Q6OA 4ZL1A 5D33A 4AXKA 2HE5A 3GAYA 3QYQA 2ZX8A 4Z1BA 3NO1A 4B90A 3K13A 1LOSA 4X2RA 2NV2A 3VU2A 4HD5A 4AD0A 3MJYA 4D8AA 1YTKA 3TE9A 1CWYA 3LENA 4LUTA 3WLHA 1GOXA 2BNJA 3CH0A 3MKVA 1BLIA 4HNOA 3ZT6A 4IPIA 3U4AA 3HV9A 1JZ8A 1GG0A 1N2VA 2H9AA 4MGGA 3MUAA 2HEJA 1VQTA 3IARA 1GKQA 3EBVA 4JTQA 4E38A 3THCA 1CLXA 4MMWA 1MUCA 1CB7B 2ANUA 2Y8UA 1AJZA 4DNMA 2CZDA 4PRRA 1PIFA 4HNNA 5CGQA 3MSRA 3PP7A 2GGJA 1TPFA 4CN1A 2QR6A 3B0PA 2CCRA 1YNYA 2F2KA 2Y8VA 1AW2A 4RDVA 1HKVA 3KFTA 5E6ZA 1F76A 4GXWA 1HO1A 4PFMA 2XSBA 1WKYA 5K9DA 4MY1A 4M7TA 4XIMA 3F2DA 1VS1A 3GVQA 2DVUA 3RM4A 1D9EA 1UR3M 1QW8A 4GIEA 4GVGA 2VWTA 1UBPC 3AAMA 1UH2A 1H49A 1TTQA 2RDWA 3IANA 3NQEA 4CD7A 3P67A 3YPIA 1K6WA 4NNBA 5EY5A 4TXEA 2VM8A 4IP7A 1PHWA 2UY3A 3IIOA 2CESA 2G50A 2VR4A 4Z1AA 2R82A 2OKOA 1GGOA 4GUHA 1WAWA 1P0KA 2X8RA 3W76A 4HMDA 2O9PA 1KBJA 1ZS2A 1EH9A 4NY2A 1B1YA 4GH1A 4MIMA 4FB7A 3O07A 2Z1WA 3OVPA 3WZ0E 1G94A 2Z1VA 2PWEA 1OWQA 2HWGA 1J79A 3PUDA 4H3DA 2J8FA 4UTFA 1EWEA 1W54A 4Z2KA 2XHYA 3IJ6A 1Z6KA 4KESA 5CC7A 5A3HA 4DEFA 4ZXOA 2CW6A 3WX7A 2FDSA 1S5NA 4ZFCA 5EMYA 3E5BA 4B5XA 2CFFA 4ZR8A 1JPMA 1TWZA 3TZFA 4XO7A 4M6UA 1UR0A 3W71A 3WF1A 4HIBA 3V3WA 2QV4A 4H01A 3NDYA 4B4FA 1HJWA 3OVGA 3TONA 1D3CA 1IT7A 2QS8A 3V0UA 4IMGA 5KTLA 1P1MA 3L0GA 4FLOA 4KCWA 1QXLA 1YW1A 4GCXA 4KETA 4M80A 4H83A 4AD3A 3DYOA 4MWAD 4XAZA 1IR2A 3HU7A 3G1XA 4DF2A 3DFNA 1VCGA 5DMYA 1CI1A 1CT5A 3AXXA 4QDMA 1MW2A 1R3TA 3B0YA 3B0UX 1LLWA 5KITA 1KFBA 3DERA 4QBXA 4HNLA 3RX2A 3V5FA 3H2AA 3C6CA 4JHOA 2DZPA 3SY5A 1ZL1A 1AMYA 5HNTA 4CEXC 3FNDA 4TIMA 3KBMA 2Z27A 3STFA 3W00A 4A4AA 4H6RA 4O1DA 2ACRA 4D71A 1EL3A 1RCOB 1XIJA 5LIUX 1CW2A 2J6XA 2VFGA 3GBEA 1FOBA 1TPDA 3HG3A 1XWYA 3L4ZA 2Z6JA 4TTUA 3H7RA 3ITYA 3QOMA 3H4XA 4GYKA 4XO6A 2AAAA 2PLJA 4LXFA 1Y0EA 1CTNA 2VYOA 3MPGA 4J4KA 1ZBCA 3F5KA 4TX9A 4U5KA 1S5TA 1KW1A 3A3XA 3PY2A 2PP3A 1KD0A 1OGBA 2XN1A 1EOMA 2WMHA 4KWUA 3ZXWA 3L65A 5CJ5A 2QCDA 2OMAA 1NF7A 2FPVA 1I2OA 1TA3A 4PMZA 1V8EA 3ZLFA 3LUTA 3P84A 3B03A 5F2LA 3IRSA 1BGAA 1WZMA 1GPWA 4EP8C 1XKJA 3RITA 1WXZA 3A9BA 2ATMA 3A23A 5D9MA 1A4MA 1E6SM 1O4UA 4XZWA 5HQLA 2VVNA 4IJRA 3LZ3A 3O3RA 1WDRA 1UP2A 5F2IA 4UQBA 4NZ4A 2DZSA 1R3RA 2UV8G 3A4AA 4C6EA 1I4NA 2RDUA 3HGSA 4N0RA 4O1FA 4XAGA 3CLWA 4D1IA 1WBHA 2QGHA 3NG3A 5TNVA 3O06A 1DHPA 2EAWA 3A9IA 3IJ9A 1V3JA 3CMFA 3KVMA 3VIFA 2YCIX 3GFYA 4C6PA 3M47A 4X0NA 1E1EA 1YKWA 4RUBA 3L5MA 4NI3A 3M46A 2GDQA 4OJYA 3KOYA 4V1XA 1K9FA 2VMFA 4RX0A 1WUEA 1K8CA 1EJTC 3FAXA 1S1RA 1ISVA 2FB3A 2OLSA 6A3HA 3NYZA 3SCSA 3VIMA 3TJLA 2WWDA 1HTIA 3OB8A 2Y63A 3BV7A 3GB6A 2DSVA 4GHRA 1KXQA 1OX6A 3VGDA 5I2UA 2P3EA 2CBUA 4GFSA 3IWPA 2AL2A 1J96A 1GQJA 1GNXA 4OBRA 5IXEA 3W3OA 4CLMA 3LTSA 4IX2A 3ID7A 4F2UA 1TWSA 4YJ5A 2WCAA 1UJQA 1ECEA 1S2VA 2E67A 1X1OA 4DXXA 4X0VA 1PKYA 3WDIA 1MXSA 3UPMA 1ISYA 3T1GA 3KS6A 4BQ4A 4D2JA 5HJYA 3HURA 1VKFA 4M3PA 3AMKA 4WZHA 1WQ5A 4IL0A 4CQCA 1ZZMA 3TSMA 4FX7A 1OHLA 3MCOA 4AIOA 1RD6A 2UY2A 2W3ZA 3MC5A 2V69A 4PE8A 3QMTA 4OV9A 2VX4A 3M5XA 4GIRA 4O12A 1B9BA 4D8ZA 3STEA 2YCEA 1A49A 4PCFA 1OZQA 3EMQA 3RRXA 3T4CA 5F2MA 2X1IA 1GPFA 1VFLA 2VZOA 3L66A 5FJTA 2VOTA 4A3UA 2G3FA 2V8ZA 5A8MA 2GVLA 1RJRA 4B92A 2OOFA 2V68A 3PB0A 1HJSA 3W07A 5H8PA 3U8GA 2RKXA 1KRMA 1TV5A 1B30A 3WQOA 5XINA 4A8NA 3S5NA 1YE4A 1Q5MA 3PZNA 1AW5A 3PBYA 5C2CA 4XSLA 3M4HA 2Z00A 4ZB0A 5M2FX 2CLKA 3NM1A 3ARTA 1E0VA 1U1UA 1BF6A 4ZA0A 5M17A 1U83A 3QJAA 2WNZA 2V5JA 3CS2A 2HV5A 4RLIA 3OZOA 3TX9A 2QHAA 1J93A 4HU3A 3M1ZA 2YPIA 5D8WA 2WHLA 2DSZA 4F40A 2PRMA 2QIWA 3H2OA 5REQA 4PFHA 1MWOA 3ZZ1A 4HPHA 2DQWA 3CIVA 2RGLA 4DUVA 5AOUA 3P14A 3BGAA 1LZOA 4A3RA 1I45A 3S9IA 4N7QA 1TR1A 3U7VA 5E9XA 3W73A 3VVGA 3GSMA 3FY1A 4WDTA 5CJMA 1Q65A 4JQ4A 2Y5JA 3OZMA 2GK1A 4K7YA 2PA6A 1E55A 1B3YA 1O5XA 3ITLA 1OCBA 3W29A 5D38A 3EWYA 4POCA 2WVUA 4P8WA 1B4EA 1V6WA 1V6YA 5ECVA 2B31A 4FXJA 5ABEA 3BAKA 3EZ4A 4PH6A 1KBBA 2YGYA 3WQCA 1V7YA 3MHUA 5KSWA 1XBXA 3TA6A 4KRUA 4MWAE 1ONWA 2XIIA 3OW1A 1GVEA 3VM5A 4UTHA 4L64A 2E1WA 1GOQA 4JFSA 4O11A 1POJA 1H1YA 2R94A 2E8ZA 1G4PA 1YXYA 1AZ2A 2A4AA 1DJGA 2ZDSA 4BF5A 4UTWA 1JGMA 5HOSA 2V5CA 2QJNA 4JDYA 4UQCA 4F0RA 4MNJA 1QTWA 3W7IA 5JH2A 1BFNA 2YJQA 1X1ZA 4XIAA 1V0KA 1IF2A 4Y9NA 4HCDA 1M1BA 3IV8A 4WDUA 1CIUA 1OEPA 4LUYA 3VINA 1ZU8A 4ZSTA 3C0LA 3OQ8A 4IFOA 4LU0A 1GW1A 4R85A 1QCWA 4DN1A 3ISIX 3DHUA 4M56A 2FPTA 3W7RA 1Q3NA 2HPIA