4LEFA

Crystal structure of phosphotriesterase homology protein from escherichia coli complexed with phosphate in active site
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PHOSPHOTRIESTERASE HOMOLOGY PROTEIN FROM ESCHERICHIA COLI complexed with phosphate in active site
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Phosphotriesterase homology protein
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lefA00
1GKPA 3RYSA 3LGGA 4GC3A 2R1NA 2Z7GA 2A3LA 1KRBC 2PLMA 2WJEA 3MPGA 3OOQA 2OODA 3FDGA 4XD5A 3ID7A 1DPMA 3MDWA 4KQNA 4UBPC 4DLFA 2GSEA 4I6VA 3OODA 1GKQA 2F6KA 3T81A 4C5ZA 5FSDC 4HK5A 2BGNE 4HK6A 4YIWA 2E25A 1UMLA 4KF1A 3WMLA 4IFKB 1JGMA 1YNYA 4DYKA 1P6CA 2FTYA 4CQDA 4XD6A 3LSBA 4C6EA 2Q09A 4ZSTA 1K6WA 4NP7A 4V1XA 4IG2B 4WHBA 1YBQA 3IRSA 4PCPA 3O0FA 3GRIA 1YIXA 1RA5A 1QXLA 4IH3A 3GUWA 1EJVC 1UIOA 4BKNA 1YRRA 1R9XA 5HMDA 4LALA 3BE7A 1NDVA 3MVTA 2Z2BA 1FWAC 4J35A 2QVNA 1POKA 4J2MA 3MJMA 3KM8A 1R9YA 2Z25A 3MDUA 1RJRA 2D2GA 3TN3A 1KRMA 3S2MA 4C6CA 4KEVA 3S4TA 5A6TC 1FKWA 2FVKA 4LCRA 1E9YB 2EG6A 2DVTA 3SFWA 3OU8A 1P6BA 3MVIA 3QGKC 1V7AA 4ZSUA 1A5MC 4XD4A 4DZIA 1A5NC 2Z4GA 3GG7A 2VC5A 4R7WA 1RJPA 2EG7A 2VR2A 3DCPA 4GY7A 5FSEC 3EGJA 4PE8A 1V79A 4IGNA 1I0DA 2AQOA 1EZ2A 4HJWA 1A5OC 4ERIA 2UZ9A 3A4JA 2QS8A 3GU2A 4NG3A 4H9MA 1WXYA 4I6KA 3URBA 4DNMA 4KETA 2VHLA 3CJPA 4D8LA 1J79A 4H9ZA 4H9XA 1FWGC 1A5LC 3UR2A 3GU9A 4F0SA 1BF6A 2W9MA 4H9UA 2GWGA 1RK5A 2R1KA 2YB4A 5G4HC 4DI8A 1EJWC 4ERGA 3WYZA 4EPDC 1J6OA 4LAKA 1QW7A 4P5UA 4F0RA 1V77A 3GIPA 4IFOA 4G7EB 4QS6A 4QTGA 3O7UA 4KEZA 1HZYA 2AQVA 3MKVA 3D6NA 2RAGA 4CQCA 4EPBC 4C6OA 2HQAA 2P50A 2YB1A 4C6FA 1PTAA 1POJA 1A4LA 3URQA 1A4MA 3NURA 3RHGA 2BB0A 3GTIA 4KESA 3IGHX 3TN6A 3FEQA 2CZVA 3TN5A 3PBMA 1PSCA 2R1PA 4CQBA 3N2CA 4H9VA 1O12A 4PCNA 1FWHC 1EJUC 4AC7C 4V1YA 3MSRA 4QSFA 4GY0A 4WVXA 3UBPC 3F2DA 3UPMA 1RAKA 1W1IE 3LGDA 3AU6A 3T8LA 2VC7A 3V7PA 3GTXA 2D2JA 4NI8A 5LXXA 3K5XA 1PB0A 1EJXC 4INFA 4KEUA 3FDKA 1VFLA 1PO9A 1FWCC 1FWDC 4JOMA 2HBVA 3QY8A 3QY6A 1ONWA 4RDYA 1V51A 1A5KC 3LNPA 4IF2A 4IG2A 4BY3A 1ITQA 3E74A 3IPWA 3A3WA 3RN6A 1ONXA 3NQBA 4IFKA 5E5CA 4CNUA 4GX9A 3LSCA 2HPMA 4GOAA 4C6QA 2Y1HA 2Z2AA 2QT3A 4L6DA 4C6DA 2KAUC 3R0DA 2Z24A 3ORWA 3F2CA 3S2LA 1V4YA 4RE0A 4C6NA 4CEXC 4KIRA 1RJQA 1EF2A 1UBPC 4WGXA 3IARA 1YBQB 3WZ0E 3AUOA 4B3ZA 3UF9A 2PAJA 1O5RA 5AKQA 2PGFA 4C6BA 2OGJA 2DVUA 1UIPA 4GY1A 4B91A 4HA0A 2XIOA 3E0FA 4QS5A 2O4MA 3JZEA 3LY0A 4DLMA 4GXWA 2OB3A 2GWNA 4XAYA 2YZ5A 4RDVA 4DIAA 4E3TA 4G7EA 2PUZA 1M7JA 4GX8A 1EYWA 2Z28A 3QY7A 3PNZA 2GZXA 3B40A 4XD3A 3CS2A 3C86A 1FWFC 3E2VA 2UBPC 4QROA 2HNHA 1YMYA 2WJDA 2P53A 4ICMA 4TQTA 2GOKA 4C6PA 1E9ZB 2ZC1A 4B90A 3EWCA 4G2DA 5HMFA 1NFGA 3E3HA 5CH9A 1EJRC 1FKXA 3ICJA 3RCMA 4XAGA 2DVXA 4LEFA 4EPKA 2Z00A 1S3TC 3LA4A 4CEUC 3HM7A 1KRCC 1EJSC 1RA0A 3ISIX 4ERAA 2WM1A 4EPEC 1ITUA 2PGRA 3CAKA 3TN4A 1K70A 3GTHA 1WXZA 2YXOA 2HPIA 2R1MA 2D2HA 4GZ7A 4M51A 4BJHA 3E0LA 2I9UA 2ADAA 3GIQA 3F2BA 4C5YA 1XRTA 4LCSA 4LCQA 4B92A 3IV8A 3HTWA 4H00A 1J6PA 1XRFA 2HBXA 3AU2A 4GK8A 4C6LA 4DZHA 1P1MA 1J5SA 4LAMA 1GKRA 4LFYA 1FWBC 1RK6A 1FWIC 4L9XA 3ITCA 4LANA 4C6KA 4R88A 4C60A 3LS9A 3OJGA 1I0BA 4RDZA 4UB9A 1R9ZA 3UR5A 3OQEA 2OOFA 2EG8A 3PAOA 4IGMA 3F4CA 3EWDA 4CNTA 1NDYA 3F4DA 3DC8A 2Z26A 4PBEA 4C6IA 4AQLA 2FVMA 4QRNA 2IMRA 1M68A 3B0XA 3LU2A 4XAZA 1XWYA 4IFRA 4C65A 2G3FA 3GU1A 4Z42C 1K1DA 3E38A 3URNA 1KCXA 2ANUA 2AMXA 3NEHA 1ADDA 4OFCA 2VM8A 4PBFA 4RDWA 1EJTC 2ICSA 3T1GA 4F0LA 2VUNA 4R85A 2OQLA 4LAOA 3SO7A 3PNUA 3G77A 4DO7A 4DI9A 1XGEA 4J5NA 5HMEA 4C6JA 1ZZMA 4MUPA 1FWEC 2R1LA 2Z27A 1M65A 4H9YA 4EP8C 4HK7A 4RZBA 2FTWA 3S2NA 2Z29A 2O4QA 2Q01A 3DUGA 4XAFA 3K2GA 3S2JA 3A3XA 3IACA 4KERA 2E1WA 3GTFA 1IE7C 3HPAA 1NDZA 3B0YA 4CNSA 4IQJA 2FFIA 3OVGA 4GBDA 1KRAC 3URAA 4LH8A 4C6MA 1NDWA 4H01A 3MTWA 4GYFA 3TNBA 3QGAC 1FWJC 2WJFA 3K4WA 4H9TA 2I5GA 2QPXA 3IJ6A 3PANA
chains in the Genus database with same CATH superfamily
1E6QM 5E6ZA 4HPJA 3OVQA 2FLIA 2DY3A 2AL2B 3BOXA 4FIRA 1XGDA 1XLBA 2BODX 1LQAA 1YXYA 2ZUSA 3EOLA 4IICA 3FEMA 4C5ZA 2PDMA 3GXPA 3UJSA 2XGBA 4DJDA 3SURA 4JY9A 3VIOA 4AUBA 4IT1A 4NRSA 5E0KA 2VGGA 1CGWA 4HMEA 2PP1A 4B16A 2Q09A 4JDBA 2IUZA 3F1QA 3MI3A 4OU1A 1FWTA 1MNSA 1UPPA 1ITCA 3RPDA 3BO9A 3SM0A 1UP0A 5HMDA 3BE7A 3O8AA 4A4AA 5LIYX 1DIKA 2QAFA 1UQYA 4WDXA 4RR4A 2GVGA 3QJAA 2WC4A 4LVDA 4DM2A 3DFPA 3S1GA 4CN4A 1FHUA 1LL7A 4LBSA 3W07A 1UHVA 6XIMA 1A5NC 1XBZA 5AYXA 3H2NA 3UVAA 2J77A 2C16A 3VX1A 1I2PA 2R14A 1LG2A 1M5WA 3B8VA 3GVGA 4IGNA 2FFCA 2J24A 3QR3A 4ZO9A 2DQWA 3GAYA 3T44A 4HTBA 4B5VA 1W1B1 2WHKA 4FXSA 3NQVA 2PZNA 3SQLA 2ZZ6A 1EP1A 3N6QA 4OECA 4HVXA 1A5LC 4Z2HA 4MPQA 2PDHA 2A6NA 2GWGA 1HKMA 3CTLA 4IGHA 1QVBA 5FI8A 4UFKA 4Y9PA 3KBVA 4WZHA 3WUFA 2D0GA 3V18A 4F0RA 3GIPA 3EXTA 4OQVA 4L1GA 4UR7A 2HVNA 1XINA 4KEZA 1XJBA 5BXSA 3D6NA 1QAPA 2RGLA 3WELA 3ARRA 4C6OA 2HQAA 2Z0IA 1B30A 3JVAA 4K7YA 3URQA 4V15A 1OD0A 3N4EA 3IGHX 3L67A 4PN2A 4CQBA 1ML1A 2C79A 3CYJA 4ZEPA 1EJUC 4F9JA 1PZ3A 3M6DA 4TXEA 2FPTA 3KRUA 4LC8A 5C7HA 5F7UA 1GPWA 3SUSA 4PB3A 3AIBA 3GDBA 2VENA 4HKPA 3AU6A 2DFAA 4LB4A 3G8RA 1GOKA 4HJFA 4DBEA 3AS1A 1AH4A 5A1AA 1FWDC 4A8RA 4IZGA 1A0DA 3G3DA 4BFAA 2PWDA 3V0TA 2O9OA 4IG2A 1IZKA 4XWUA 3N2MA 4PH6A 1E0WA 3CPUA 1WAUA 3ARSA 4PL1A 1MYRA 1S2CA 3TSDA 1Y5VA 3O16A 3DHPA 3BICA 3WQ4A 4AIOA 1T96A 4Q8NA 3OBKA 2QT3A 4UR8A 1S5MA 3UWQA 3F2CA 2DZXA 1NU5A 1XRSA 3PZQA 4UTWC 1D7KA 5PTDA 1UBPC 3IARA 3WZ0E 5HR6A 3QSRA 2PAJA 1BXCA 3L5LA 4KGLA 4DZAA 1I75A 4Y9OA 2EO7A 2TPSA 4JX5A 4O8RA 4UFHA 5HJXA 1FOBA 4S38A 4QDWA 1EJ7L 3BW2A 3CK5A 3U9IA 4WDTA 4P2VA 1KFEA 2VDIA 2HSAA 3MA8A 3B8UA 4JS3A 2Z1SA 3RJYA 3W1NA 4JTJA 2G0WA 1OFEA 2XSAA 4PUJA 2FMNA 2D0HA 2Y4SA 3AIEA 3R2GA 3E0VA 7A3HA 1ME7A 1GVIA 3QEZA 3S46A 1MZHA 4ICCX 1R3YA 5CZKA 1DXIA 2EJAA 4EPKA 3W38A 3N11A 4NNCA 2VFDA 1YLVA 4JHMA 1XBXA 2DORA 1VBJA 1K70A 2QMKA 1UZ4A 5DCBA 1WDSA 5GNXA 3T07A 3E0LA 3GIQA 3WN6A 1ISVA 1V02E 2A85A 3IIZA 4RZ5A 1TPVA 5E1QA 2QQ6A 3LUTA 2DH2A 4H00A 3LPFA 1O60A 3VIHA 3H2OA 2YA2A 4UTTC 4FXFA 1EQCA 1UWAA 3I6RA 3BJFA 4ACZB 1LRTA 4Q8VA 1UKTA 4L9XA 4IP5A 3AIVA 3ARTA 2FZ8A 5ABFB 4R88A 3QPEA 4PR4A 4MMWA 2ZUTA 3KTCA 4QCEA 4J3WA 2OOFA 1IT8A 2ISSA 2NQLA 3AJ7A 5A6BD 1VFMA 1KXTA 1TSIA 2WHJA 4XG1A 4XAZA 4Z1BA 2YCJA 5CZ0A 2J7EA 3OIHA 1XF0A 1JD9A 3HGJA 1GNXA 1A5SA 1KFWA 1FWWA 2PZ0A 1EJTC 1H41A 3LYEA 1F07A 1OYCA 4FF7A 1XG4A 3RM8A 1EDGA 1C7TA 3AMLA 1KKOA 1UKOA 2Z29A 4TV6A 3LCIA 1H0IA 3DUGA 3GM8A 2ZWYA 2XISA 4J40A 1FP9A 3GB6A 3G8EA 4YLWA 4N2YA 2ZRUA 1XIEA 2CLOA 3GTFA 2PI6A 1KXHA 2VWSA 1I2RA 3K8KA 3RCNA 1HJUA 4GWEA 1QCWA 3RR1A 2VGIA 5HPCA 3E6EA 3LTPA 1CLVA 3DU0A 4J3ZA 3EDJA 4PUDA 4S39A 3KAOA 6CGTA 4AD3A 4S2CA 2QZRA 3CQIA 2RDXA 1TPH1 4JICA 3B8SA 1OVDA 4UBPC 3UWEA 3EX3A 3TQVA 6TAAA 1KA9F 3DKJA 4R7OA 4YIWA 1Q3NA 4IMEA 2ZQ0A 1PAMA 3W88A 2HS6A 4DYKA 1BPLB 4XZBA 3L12A 2D73A 3O2LA 1GONA 3LLFA 1R3TA 4US5A 4YCPA 4IIGA 3CUXA 4IH3A 1WOBA 4M1BA 1YRRA 1R9XA 4X2RA 2JEPA 2W3ZA 5IHRA 4AMAA 1J0JA 4GACA 5LNWA 3N25A 3G1FA 1H62A 3PUEA 2H6RA 3WFZA 5HMSA 4AU0A 3D3AA 1N2VA 4LUTA 2PTDA 1U33A 1OX6A 1A5MC 4NJKA 1Z89A 1RQEA 3ANYA 4PTMA 5EYWA 3C2RA 4ZO8A 5T91A 4GCAA 4AIBA 1UKSA 2DUXA 1QDSA 4MUZA 5DMMA 1W32A 3IEBA 4C1LA 4OHQA 4UTLA 1JQVA 3WDIA 2Y5EA 1LBFA 3GU9A 2QLYA 3A22A 4WLCA 2GGJA 4Z1AA 3KP0A 1HJXA 4LAKA 2FGLA 2BGQA 1PL9A 2A3BA 1B57A 1VCVA 4G7EB 1V7YA 3QQ1A 2XIJA 5F4WA 4S3AA 1UD3A 2V5CA 3CAWA 2GQAA 4R9XA 2CPUA 3UZZA 2HXTA 1QATA 2BLEA 3UCCA 4JTKA 3XISA 1HKVA 1LWJA 1R3SA 2BB0A 4PUEA 1UUQA 3FEQA 3TN5A 5GVJA 3FAWA 1G9HA 3MKKA 4N4PA 1E1CA 4NJHA 2PTZA 2BHUA 3MUAA 3WSUA 1YE4A 2VC7A 4DBSA 1E9IA 1S5NA 4DJDD 1EOMA 1PCWA 3UA3A 3A47A 3DYMA 1FWCC 4RXFA 1ELSA 3C3NA 7TAAA 4GUJA 3CHDA 4AD5A 2X42A 3LNPA 2XZ7A 5I02A 4D2JA 2GUYA 5I24A 2BVWA 4HCDA 5FACA 4IFKA 2NSXA 4TV5A 1R46A 4LBRA 3R12A 1TWIA 4C6DA 1J96A 4CEXC 5HWJA 1PKLA 1EF2A 4YVXA 3WQPA 4M29A 3MO4A 1UIPA 1XD1A 3KHJA 1SJBA 4HHLA 3VOCA 2ZC8A 3HQNA 2EPNA 2CXGA 3C0LA 4QJ5B 2YW4A 3TYEA 3WEMA 4BWLC 3EXSA 3ATYA 4E4UA 3E2VA 1XLHA 3UG8A 3NQ8A 3IIXA 4J3TA 1V3JA 3U0HA 3UXAA 2D0FA 2PDBA 4IL0A 5I0DA 4D6GA 4L64A 5E70A 3EB2A 1REQA 4WJXA 2ZC1A 1C93A 2CFFA 3BTNA 2QJJA 1VIWA 2RGMA 3FOKA 4DQWA 1LT7A 3NPXA 4IIHA 2QGHA 3VKKA 3A13A 4FSAA 3SRKA 3QW4B 1HX0A 1XIFA 3IAQA 3DFOA 1YTEA 3C61A 1NIUA 2VX7A 3OG2A 3G5EA 4D6DA 1GQNA 2J4GA 2RKXA 2ZZ1A 1PZ1A 2OU4A 1TA3A 2ZUNA 2W92A 2OX1A 1EO5A 5AY7A 2D2HA 4QE4A 1EHNA 1KXQA 1A5UA 2ADAA 4NJJA 5FEZA 4LPCA 3SCTA 4YTSA 2C3ZA 4HSHA 3W6YA 1V5XA 3W1MA 1JCYA 3CLWA 1J6PA 1W1ZA 4YHGA 1TKKA 3SRFA 3LERA 3UW6A 2X8RA 1TA3B 1C3FA 1FCUA 3KS6A 3A24A 4Q3MA 4B9YA 5CC3A 1SW0A 3SIZA 1GTEA 2YCLA 1I0BA 3SCQA 4A3YA 3MMWA 4ILSA 1RCXB 3OA3A 2V3DA 4L61A 3CV1A 2QJMA 2ZYFA 2E8ZA 4E38A 3ZT5A 4EF9A 2PFHA 3AROA 4IFRA 4Y90A 3LMZA 2AL1A 4M6QA 4XX6A 4QM1A 1KCXA 1SSGA 1KM1A 4S3DA 3DYPA 1UKQA 3A5VA 3CM4A 4R85A 4AZ5A 3OBAA 1T8XA 5FAJA 3HPXA 4H6QA 4J5NA 5AHLA 4PFHA 1P0KA 1OF6A 4QX4A 2FTWA 1CPUA 5CPLA 5BW6A 2WQDA 3RO8A 2E09A 1EXPA 1QU4A 3TTEA 4Q4KA 5SWUA 1IE7C 2W91A 1EHAA 2PODA 1P0EA 2WANA 3NPWA 3EOUA 4I9TA 3AWNA 2WSQA 1Q7MA 3OVGA 2QCCA 3QHOA 2GK1A 5ABFA 3GXDA 3LENA 3GXNA 2VTFA 1FFQA 4QITA 4H01A 3CNYA 5C9UA 3QGAC 5A8GA 3KBWA 3WBYA 1R86A 3W7CA 3THAA 5D9PA 3TZNA 1SW7A 2PLMA 5C70A 2BOGX 4KQNA 3H22A 1DXFA 3EEGA 3BOLA 5FSDC 7REQA 3U48A 1WB0A 4IX0A 5K3VA 8CGTA 4W85A 4TX6A 2BXVA 3KRSA 4XUYA 3KOYA 2A3CA 2OLAA 5U7SA 3WQOA 1W3NA 4NZCA 5CSRA 2OO6A 4MY9A 2ZZ4A 1RA5A 1UC4A 5AHIA 1NFPA 1JYWA 3LHWA 1HJSA 1NDVA 3NVDA 2JIWA 3VZXA 3KLKA 2PDFA 3MC5A 3G0UA 1L6WA 4W7UA 3S2MA 4J3UA 4D8ZA 2JKPA 1BSLA 3IK2A 3FA4A 3SFWA 4WSHA 3KW3A 1HUVA 4ZFMA 1R3WA 3QZAA 5TD4A 1X38A 1SZRA 1B3WA 1VKFA 2CBUA 1BD0A 4B2DD 3CPGA 2ISWA 4HYVA 2AAMA 2R6OA 4IMGA 3UWYA 1PZ2A 4MNKA 4L4LA 1A5OC 3ELFA 5BOEA 3I7QA 5FIPA 3AICA 3BCJA 3MI2A 5G4WA 1A3XA 1W91A 3SGUA 3T55A 1YTKA 1SMAA 4F0KA 3CZEA 1W17A 2QIIA 5G2HA 2J7FA 2OLHA 1WDPA 1RCOB 4UTIA 3WQCA 1F74A 5M1TA 1XLCA 3H2FA 4UIOA 3OO2A 1VR6A 3GUGA 3WIJA 1L0PA 2DJLA 5F1UA 2WV8A 4NAEB 2P0IA 2CEQA 2BY1A 1EZWA 3E2QA 4C1NB 3P5YA 4OT7A 1EC7A 1GOQA 4QTGA 5A6BA 3EAUA 5CPQA 3NQ2A 1E1FA 1MQPA 3TAOA 2ZWZA 3NPUA 3QLLA 1A4MA 8RUCA 3HU7A 2WZHA 4Q22A 3GTIA 4KESA 3GO2A 3T09A 3MZ2A 3N2CA 1VCGA 4B9ZA 2P3EA 2HTMA 1UWSA 1KM2A 2X16A 4M80A 4WVXA 1HGYA 3F2DA 3TYZA 1W1IE 1G0CA 3E5BA 2DSUA 3POCA 4E8CA 1WKFA 1CXIA 5HUOA 2GGIA 3UG5A 7XIMA 4HMCA 2BX7A 4NZJA 1AJ0A 4O16A 2WCSA 4Q6JA 3G0XA 1ONWA 2PC4A 3W3OA 4YTTA 4JBRA 3FN9A 3T2PA 3A23A 3H4WA 1F6YA 3DHFA 1WAWA 4HU8A 4AB4A 4NVTA 5E5CA 3TQ0A 2PS2A 4MF4A 1MW2A 4DJFD 2OZ3A 3UEQA 2E4TA 4JNYA 1ME8A 1RVGA 2HCVA 3PJWA 3DENA 1S2UA 3MZNA 4AX6A 4C6NA 5J5DA 2HEJA 4KIRA 1V03A 1SFJA 4TOQA 1KFCA 3CQKA 2J9ZA 1NVMA 4EKJA 4J28A 1WZMA 3I7RA 4FLQA 1UQZA 3SCRA 2GWNA 4KWOA 4ZOCA 4MY1A 4G7EA 1GVQA 2OELA 8XIMA 3KBNA 4WOQA 1OCQA 3CB3A 3W83A 2QAPA 4PUNA 4XD3A 4DNHA 1XBYA 3NG3A 4F9DA 5BOFA 5CJNA 2YL5A 4B90A 1UA3A 4ZFCA 1TV7A 5CH9A 2QULA 2J88A 3P14A 1K8ZA 4H1ZA 1KTNA 3K8LA 3W2MA 3ITVA 3HG4A 3AI0A 4B4FA 1X97A 4XBSA 4BHYA 2V2DA 2WBGA 4WCJA 5HK4A 2EEXA 1Z6KA 3TZFA 2XWDA 3SJNA 3VGBA 3CQJA 2D22A 1R2RA 2NV1A 1VFUA 1Q13A 5F2LA 3ABQA 4GZIA 2HPIA 3VKDA 3ZJ6A 3MCNA 2P8CA 4DWSC 3GVWA 3F2BA 4C5YA 7REQB 2OJPA 3ES8A 3SN0A 5MKGA 4N0RA 4QQ3A 3C6CA 5CXPA 1U5VA 1UOKA 2V5DA 2ZBTA 3WH5A 3O6DA 3KZSA 1G7VA 3QMTA 1RK6A 3FHQA 1V0MA 4ZQOA 1VJZA 4Y9MA 3B8TA 3LNMA 2CKRA 3W72A 1FRBA 2GDQA 2WYSA 1V6XA 3DC8A 3V4BA 4LBUA 2JK2A 4JNMA 1ZJHA 1IGSA 1CB7B 2PCEA 4G8TA 2C14A 2AMXA 3M5YA 4IWWA 4E6MA 1UD2A 1UR0A 1K7XA 4F0LA 3GW3A 1NM9A 1W2VA 1LQ2A 2WCAA 3WLLA 5CAHA 2FGBA 4RZBA 5FF7A 3IANA 1V08A 5CZSA 4UTWA 5I79A 5K2ZA 5JUVA 1C29A 4EK7A 4GO8A 2NLIA 4O52A 4MLRA 2Y24A 4QLKA 2YX0A 3TUUA 3TTQA 4IIEA 4PEEA 1D9EA 5FOOA 1SW3A 2D3LA 3O9NA 3L4ZA 1NDWA 1TWSA 1VFOA 1PTGA 4FR6A 4LVBA 3S1WA 5H6HA 3LHTA 1LDCA 3TCSA 3KTXA 1MVYA 3RK8A 1Q6LA 1VBRA 3WUBA 3RXZA 5J5RA 4E2BA 1I9CB 4U3AA 3WJXA 3HQOA 1BYCA 2E67A 4KPLA 3WL0A 1PX4A 3GDTA 3WQWA 1ZAHA 4QJ3B 3GDRA 3T4WA 1G4PA 4D1IA 3QR1A 4YTUA 4GMEA 2Y5JA 1SGJA 3MUY1 3U4AA 2NLYA 3CH0A 4GISA 3U2OA 3QLDA 4CNPA 3GUWA 4PMQA 4LALA 5IXEA 4AHPA 1DOSA 4O19A 1UH4A 3DG3A 1DWHM 2W66A 2PRMA 1KRMA 1W3LA 2V38A 1H7PA 2FZBA 3KVKA 1PCKA 2CBVA 2QV4A 1KFLA 1FXQA 3WLHA 4J1OA 3NYDA 1YDNA 4MG4A 1XLIA 4U10A 2INZA 3DHDA 1AZ2A 1XIHA 2VELA 3LTYA 1EC8A 9CGTA 2UV8G 3ZYZA 1UP2A 3M0IA 5EL1A 1W9BM 4HU3A 3MY9A 4J4KA 1GVRA 3NZRA 3DCPA 5FSEC 1K4HA 4QSHA 4J9JA 2G3NA 4AY8A 4XKMA 1QPOA 4DXVA 4XUGA 3SAZA 1XW8A 3W7EA 4MHBA 3GR7A 3VGDA 4RV8A 1N55A 4LUSB 4FB7A 2YL8A 3GC5A 1GQJA 1VIZA 4K7VA 4XIAA 5K9XA 4H9ZA 3QOMA 4KFOA 3WEOA 4DUOA 5TIMA 1KFKA 4REQB 5A6KA 2AKMA 3HJZA 4GD0A 3BDKA 5G4HC 4XBJA 4LF2A 3GIYA 5ENLA 1FHVA 4EXBA 1M7XA 1QASA 4UTJA 4GCXA 3EMQA 3A4WA 2E40A 3NJ3A 1RUSA 4HB7A 3PN8A 4J2PA 3EDDA 1GYNA 1MXGA 4DJEA 1BYAA 3LBCA 3R43A 4DELA 2DV0A 3JS3A 2EBNA 1JPDX 4QAWA 4ZQMA 4MB1A 4MB5A 2FJKA 1EGZA 1OGBA 2OX4A 3VDAA 4PUUA 1LOSA 1XDMA 5GJPA 2PGEA 1CXHA 1PIGA 4O10A 2DH3A 2D2JA 4AG0A 4NI8A 2POTA 2JEQA 1VFLA 2ONEA 4C7DA 4JOMA 3MYPA 1W31A 1V51A 2ACQA 3HMCA 2NT1A 2XM1A 4QEHA 3OGRA 1BRLB 2C1HA 4IJRA 3I4EA 2XGIA 2ABBA 4UTTA 3PUGA 4JCLA 1FHLA 1KWKA 2Z24A 2XIIA 1EUNA 4ALDA 5FCZA 1SO6A 3NGFA 4Y8FA 2Y63A 1X6UA 2HROA 1JI2A 3DEQA 3CUJA 3V1PA 2PUZA 4MADA 4ENLA 3ZO9A 3IV3A 4L4OA 2VXNA 1W56A 1X7IA 2UY4A 4PMZA 1ZFJA 1A53A 2XFYA 3KL5A 4HD5A 4LUYA 4REQA 1LL6A 4HNVA 4W8LA 4LS1A 1VHCA 3H54A 1KWGA 3T2QA 2FKPA 3TFCA 1DL3A 2QJGA 1OX5A 4XB3A 4KRUA 4JEJA 4PTWA 2VC9A 4MZ8A 5HNNA 3FKRA 1JZ7A 1MZRA 1XYBA 3UR7A 5GJMA 1C90A 3ITXA 4CEUC 3I3BA 7TIMA 1XM3A 2X0SA 3VMNA 2WM0A 4JX6A 4MSSA 3GTHA 3RLUA 3G1VA 5C54A 5LKYA 5I3GA 1FP8A 4QR6A 5EFFA 2NXIA 2ZADA 1E6PA 1ZJAA 1DWGM 2W6RA 1EWEA 3PZ9A 1KTCA 3MWAA 3FA5A 2NX9A 5C7VA 3K1DA 4NJGA 1ISWA 4N4QA 2BZNA 3OIXA 2OLSA 4FK9A 1FWNA 1JCTA 1XKYA 3LS9A 3OJGA 1SFSA 3OQEA 2V2HA 3H24A 2PSNA 2WNZA 1NDYA 3CMJA 4CVUA 3QHNA 3RPMA 3W7QA 3SB0A 4MNJA 1SSDA 2GVEA 1X98A 2E5DA 2WSPA 4MYXA 2J6VA 1UB3A 1EKOA 3KL0A 3ABOA 1GJPA 3HV9A 4N02A 1XYAA 1J93A 1EH9A 5F1VA 4CCZA 2J7GA 2VUNA 4WOZA 5C9WA 3W7GA 1AW5A 4BI6A 1THFD 1XGEA 4LRSA 4RJEA 4GYJA 4PRRA 4RPPA 3N2TA 6XIAA 4D6CA 1H1YA 3BLFA 4TVUA 1FA2A 1XFCA 4XIMA 4H8HA 1OZMA 5M5DA 4TTUA 3NGJA 2ZVRA 2E1WA 1J0HA 4GYKA 3ECQA 5CEWA 1J10A 1GEHA 1GOIA 2NZLA 3PAJA 1GCYA 1VQTA 4GBDA 4LYKA 1RHCA 3I10A 1XUUA 5T26A 3MTWA 1CCWB 3GBEA 1VGAA 3D0CA 1H0GA 3K4WA 4PZVA 4HPXA 4Q4PA 3NNTA 3FX4A 1B90A 3LGGA 4JL1A 3W1LA 4AFYA 4JKLA 5TF0A 3MPGA 1VAHA 3BQ5A 2CERA 1L8PA 1QW9A 2VDHA 1AFSA 1GKQA 3QMSA 3T81A 3WDPP 2BGNE 5KZ6A 4QEEA 3STGA 4ONVA 1BVZA 3L0NA 1NJJA 1BAGA 4NI3A 1R5YA 1T40A 3B0UX 4HCHA 2GQ8A 4V1XA 3HGSA 1GYMA 4GO9A 2E1DA 3PB2A 3E12A 4AIUA 2WC3A 1PTDA 3G1RA 5BXTA 1EJVC 3WNNA 4J3VA 1BLIA 1PKNA 1XLLA 3NPVA 3ZZ1A 4FI4A 4JZ5A 3RLVA 3WG6A 3N9KA 4QHRA 1BWKA 5C2XA 1FBAA 4K6AA 4S3EA 2WBKA 2XDFA 3GXMA 1IV8A 1UBSA 3BH4A 4LOCA 3SGGA 4ZSUA 4GXMA 3WEZA 4P7OA 4FMVA 3RM9A 5LGXA 1RQHA 3N3MA 4NF7A 2YA0A 1TQJA 1S39A 2VR2A 1BVNP 2IKJA 1IEXA 4PMUA 4BF9A 2NQ5A 3L0KA 3SCOA 1W3TA 4IIDA 3NQGA 2AQOA 3BMVA 4KW2A 4HJWA 2PURA 1MXDA 1RZMA 2QCDB 3PBYA 3XIMA 1JEZA 3URBA 4BEUA 3AUJA 1KQZA 3PG9A 5I3HA 3DGBA 3EOSA 1KD0A 3QV9A 3CZLA 2B81A 2HK1A 1OX4B 2PLJA 2E5CA 2BHZA 2V3GA 2JIEA 2W9MA 3ABSA 3Q4DA 1VC4A 3UNDA 2QKFA 2J7DA 5C9XA 2VWTA 2C0HA 3WLTA 2OOGA 2W5FA 2NVDA 3NXLA 3AYVA 1IWAA 2DT2A 2W61A 1P1XA 1VHNA 3WF0A 4WXZA 4GYPA 5CC7A 1ZUAX 2R94A 4EPBC 2ISFA 2P50A 1RY8A 3GG0A 2NUWA 1POJA 2G95A 3RHGA 1TB3A 1DEDA 2QCDA 2BP1A 1XFBA 3CXOA 1PDZA 2F6XA 4H9VA 3QYSA 1YTDA 1Z8AA 4Q4MA 3WNKA 4JEQA 5IDZA 3B05A 1Q7QA 4GY0A 5LIKX 5D37A 1HKKA 2E9LA 3O1NA 1DHKA 1ECQA 2OZ8A 3H21A 3PWGA 4HU4A 3GBDA 3S2CA 3WF2A 3PS7A 4GINA 3F5KA 1C8YA 2XUCA 4HHMA 2CIPA 2DSKA 4FOJA 1TV8A 1DJQA 3C2EA 1HJWA 2QW5A 3SCPA 1DTUA 3QMRA 1A49A 2CESA 3N9RA 1XC6A 3CB8A 4YNGA 3MYOA 3TC3A 2HPMA 5I3KA 4KCWA 1F3TA 2NX3A 1W8SA 4JD4A 1PYMA 1CW2A 1NWTA 3QV7A 4I5UA 4DO5A 5E9XA 4U31A 2J75A 4WGXA 2V3EA 4CNNA 2PDGA 2BG5A 2XIOA 1H1ZA 3GKFA 1WZKA 5DXXA 3H6OA 4JTIA 2WKGA 3RJXA 5IRPA 4RNIA 1L6YA 3QY7A 1H63A 2Z28A 2PLKA 5G5IA 3IK4A 4UFIA 2RJHA 3AXHA 3ONCA 2UBPC 3UJRA 4DYEA 1GVSA 2QCHA 4P7NA 2GJNA 2WZMA 1SYTA 4TQTA 5A8QA 2ZX6A 2ZUVA 4OZOA 2Z7KA 3V1HA 5HMFA 1JNDA 3ABRA 3PFMA 4HHPA 3VC6A 4KBXA 3NZPA 3TYDA 2RJGA 2GQ9A 3WK2A 4XAGA 4IQDA 3RX4A 2DT0A 4GIRA 1DIEA 3RDKA 4AWEA 3LA4A 2I14A 1KRCC 1O4UA 1RBAA 1RA0A 4GVFA 3EWZA 2PGRA 3M0KA 4E4FA 2VJXA 4PRTA 1QNPA 1R2SA 4U5KA 3W7JA 3W73A 3W2UA 1R3QA 3GR8A 2VZVA 4H6EA 4M7TA 3QQWA 2CETA 3UWVA 4C1KA 3SY8A 1TUFA 2ZUMA 1E6XM 2DT3A 3WLIA 1MEWA 3AS3A 3GYCA 4LNYA 4C6KA 1OF8A 4JN7A 3SIMA 5BOOA 3DFHA 1GORA 1WE5A 2OTDA 2X1UA 1VYRA 1G7UA 1LROA 2FH6A 2V3FA 4LB3A 5I7GA 4J27A 3VE7A 3RUBL 1F3EA 3CHVA 1XH2A 1PS9A 1MDRA 4QAIA 3HBLA 4DYJA 4OWGA 1DQXA 4D9PA 4KKXA 1JQXA 4B2DA 4PBFA 2Y0FA 2ICSA 3S5SA 4MAZA 4F0MA 1E6RA 1A3WA 1H51A 5JH1A 4Q8QA 3RF9A 1PKYA 3GC4A 2PDNA 4UCFA 4DAFA 3WBXA 1V8EA 1SJDA 2J9XA 4O1CA 1OC5A 3W85A 3HA1A 3GD6A 1U5HA 3HQ1A 1EYEA 4UWMA 3W76A 4EAYA 3NDYA 1KM6A 4GFIA 3RAOA 4IJBA 3ZJ7A 3K13A 3EDEA 2XFWA 4JIEA 3T9PA 4IJCA 1PJ9A 1GZGA 2YKKA 1DIDA 2XH7A 5C8BB 1V0NA 4ZTYA 1S38A 1SZFA 2O55A 5K9CA 3CUZA 3TNBA 2QPXA 1G1YA 1YPFA 3E2SA 3B04A 3KE0A 2VRJA 4LXFA 2G50A 4ZO6A 3BURA 4QFUA 2WJEA 3SN1A 4NX5A 5C0QA 3ID7A 4E2VA 3R11A 3TJXA 4Q4SA 1DJHA 3LCHA 2PWFA 1E70M 4OBSA 3MCMA 1R0MA 1G01A 2VQUA 4C7FA 4YMZA 3VIIA 3HF3A 3BANA 5I00A 2QCLA 2J8TA 5C2GA 4XD6A 3W1PA 1OSEA 3ARYA 1YBQA 3D5HA 3GH5A 3L21A 5HULA 4D6HA 1CB2A 1H5VA 4IP4A 3CYVA 3PP7A 4FP1A 5CG7A 3TSBA 1TZ7A 3KWSA 1CWYA 1TTIA 1IF2A 1DBTA 4L4PA 2QVNA 3SEPA 1WCGA 5D8WA 3B8DA 4N9CA 2NVCA 1K8CA 4O18A 2B31A 3ZIZA 1VEPA 2PWVA 1JG9A 4X63A 4PB4A 5K4ZA 2EG6A 4QGCA 1A47A 2ATMA 4M7SA 5A6AA 2PBOA 5FAGA 3QTGA 3NZ1A 2VC5A 2CLKA 2EPMX 4LS0A 5A8MA 3OEXA 2WSRA 3KBSA 1I0DA 1E4LA 3UCDA 2VFFA 5A2AA 3HB9A 3O15A 2UZ9A 3LM3A 1W5QA 1Y5XA 2ACRA 3BCFA 4CKQA 2PDQA 1ZJIA 4GQ0A 4PTNA 5BRBA 4K1WA 4A35A 4LV4A 1EGVA 1EJWC 4QISA 3WX7A 3WFAA 4EPDC 2OXNA 2VUYA 3W28A 2IKIA 1O6IA 4NSBA 2R91A 2Y7DA 4GUGA 3WDRA 2VX5A 1LZOA 1VEOA 4BR1A 3STFA 3HO8A 2V8ZA 4EACA 3OGSA 3SCSA 1FH7A 2BWGA 1W8GA 3EA2A 1EO7A 3TFXA 3UVIA 1WXJA 3F5JA 3MI6A 6A3HA 3CV7A 1VH7A 1FWHC 2CWXA 3SCNA 2DZVA 1EQPA 3EWBX 2NQ9A 4G9PA 3UBPC 1B4EA 1OQFA 1TIWA 1EA9C 3OVPA 4URIA 4PEKA 3CMFA 3AJXA 2QCNA 3HOJA 3GQYA 4LV9A 3GFXA 5I07A 3TOPA 1VZWA 2RUSA 5DEZA 4BY3A 1K03A 5DY2A 3NQBA 1OT2A 1Y0EA 4O8AA 3WD0A 3LSCA 1OJXA 2DSVA 3WBAA 1ZBWA 4UOQA 1F7BA 4RW5A 1XYLA 2WMJA 1J0IA 2HWGA 4MKVA 5CPOA 3CT7A 1V4YA 3W7PA 2OR2A 3EYPA 1JRBA 4LUSA 3L7RA 2BSLA 2GOUA 3C2YA 3MP5A 3DIPA 4X9SA 1UZ1A 1TWDA 3U57A 4DIAA 3BK0A 4Z2LA 3MP4A 3S9ZA 3O05A 3L66A 1WOAA 4GX8A 3R8GA 1O5XA 4UFLA 2GZXA 3B40A 3LQGA 4HT3A 2J66A 2NUYA 1NWUA 4IM4A 3N12A 1YMYA 1S5TA 2IQ0A 3WJYA 4BI7A 4Q8UA 3PZGA 3UZJA 2YW3A 3EWCA 5H8PA 4HMDA 3BV4A 5I03A 1O95A 2F61A 3ZSTA 3MSDA 1JL8A 4UQEA 3L9CA 1Z48A 4ZXOA 3C56A 4KWSA 1H5YA 1QT1A 5A95A 3VX0A 2DVXA 2CBIA 1H7OA 3EPMA 1OK4A 1W1VA 2VX4A 4NXSA 2YCLB 3UY8A 4ADUA 1BWLA 2PU0A 4A3RA 1B1YA 4A3QA 3CZKA 2WM1A 3PBVA 2OYLA 3TN4A 3LHUA 2VCAA 1QMLA 1WXZA 3E49A 2YXOA 1KKRA 2WW5A 4YCOA 3VFCA 1XSKA 1RLCL 4MJ4A 3VOFA 4BJHA 2G3MA 3CZGA 2NQZA 4IHCA 3TXZA 2WNWA 2XH4A 3S8HA 4ROQA 3MP3A 1XX1A 2HBXA 4GLEA 2WO5A 4Y96A 1B3XA 1KM3A 3PULA 1Q65A 2OEJA 4EOUA 3KLLA 1H2JA 3DECA 4CCDA 2QV5A 5K4XA 4EVZA 2Z1BA 3VVGA 4UB9A 5HWNA 4KRZA 4IGMA 1JR1A 2E7FA 3WQ5A 5FD0A 4PMJA 2Z26A 1GJWA 3P81A 1NARA 4C6IA 2J13A 1E0TA 1FDZA 2IMRA 3B0XA 3LU2A 3MQTA 1IEIA 2YXXA 4Q8TA 4CU8A 5EBAA 2C13A 3PBGA 2YSWA 4Z42C 2EAWA 1XICA 2B7PA 4Z2KA 3TW9A 5IDIA 5FF0A 4TR9A 1M04A 1I60A 1LM1A 3TDFA 3CU2A 3WDJA 4JQAA 3WK3A 2NXGA 4LNCA 1W54A 1W3HA 5C6MA 1ODUA 2BV9A 1Z69A 1CLKA 4I9MA 1V6YA 3S2NA 1YADA 4F2UA 2PDXA 3GW0A 3H7UA 3ZMRA 3BAIA 1E5JA 2GLKA 3PSVA 1S2VA 3M41A 2A21A 3H2CA 4CNSA 4KWWA 2WSKA 2FFIA 3E9AA 5DMLA 3ARVA 6PTDA 5LSMA 2V6AA 4OJYA 5EGRA 4XZWA 1JDFA 3ZSSA 3STEA 5BWAA 3SSJA 4GYFA 2PBGA 3UPWA 3MSGA 4XO7A 1NY1A 1QWKA 5FKYA 2XH0A 1YNQA 1ZRQA 4O0QA 5LA2A 2PDCA 4GC3A 4K39A 1OK6A 3WD1A 1L6SA 1MQQA 4LJ3A 3VI2A 1DPMA 3P3BA 4G6CA 3OZMA 1MMFA 2F6KA 3LCXA 3KDNA 2PWUA 3LHZA 3LLXA 4QG9A 4Z1CA 2WLYA 4KMQA 3BG3A 2BOFX 4CCCA 1CT5A 1KFBA 1I6NA 1PWLA 4CNOA 3O0FA 2Z6JA 4AEOA 4QLLA 3MBDA 2GL5A 1E6ZA 3T2OA 4HZ6A 5AOUA 1H4PA 4NIRA 2AMGA 4MZYA 1YXDA 4DBDA 4E4PA 4YYFA 1PVNA 2ESCA 4WD0A 3E02A 1QNQA 4DF1A 1V3HA 4O1EA 3ZM8A 1K6AA 1QOPA 1A3HA 2FZMA 4LCRA 1HTIA 3L0GA 1ICSA 1IZJA 3QGKC 2G5WA 3T0DA 3VKBA 1GJUA 3VUSA 3L4YA 4M56A 2ATSA 4GIYA 4HZ8A 5D04C 4CVWA 5FF2A 3GHUA 3V36A 1TMQA 3CO4A 4ECLA 1GTHA 3H70A 3AQUA 5HANA 3MMUA 4O50A 2X0HA 3MUXA 2ZZ3A 3TP4A 3IUIA 5G2WA 1QHPA 2H9AA 4QBXA 1JDDA 1JZ3A 3L23A 1H1NA 4S3GA 2DU2A 1NOUA 1ZHAA 2AGKA 5LNRA 5GPRA 5GQBA 3UG4A 2TYSA 1BF6A 3ZWSA 1T5AA 1TVLA 3PZVA 1JUKA 1J6OA 3FGCB 3LCWA 4WQ6A 2IKHA 3S5YA 5AZ0A 1FDJA 4KCVA 5H1WA 4IFOA 4UQCA 3M7SA 1QJWA 3OA5A 3R10A 3STCA 2E0PA 4ORMA 4FLOA 3FS2A 3OLDA 1ZTVA 3O3RA 2BASA 1MXSA 3GXTA 2JGQA 1CGVA 3KOFA 2PD9A 4DWSA 1YX1A 2PDJA 3MKCA 3P80A 5DBTA 3TN6A 3W25A 4AEFA 3W70A 4U2ZA 4J3XA 2J62A 4GXPA 1QTWA 2DP3A 2J25A 1XKJA 2DPEA 3W7OA 5CJMA 3QPYA 4ATDA 4K37A 4GVIA 1H7WA 4OOUA 3W00A 1XYMA 4YU1A 9XIAA 2PRHA 3BLOA 5D32A 2DIJA 3LGDA 4OBTA 1G4SA 3M16A 1Q8AA 1TUXA 3NO1A 3W2KA 1LTDA 4INFA 4Z1YA 3WH9A 3VA8A 4GUHA 5J8LA 3NQFA 1UWQA 3M1ZA 3VD4A 1QI3A 1A5KC 1SZEA 2WQPA 1GHSA 2E6DA 1V3LA 4RUBA 3LI0A 4X2PA 2BVYA 2X1IA 3IPWA 5B7YA 4GUIA 1JFHA 1X1ZA 4MOZA 3CZ8A 2ZE3A 1W1PA 4WGHA 3PBUA 3VE9A 3P74A 3PZIA 2J47A 3LTSA 1KTBA 3EDKA 2NW0A 3UPBA 1WP6A 3JU2A 4H2CA 3VNLA 2E3ZA 2OGJA 3OYZA 3WY1A 1OC6A 4HA0A 3IGSA 8TIMA 2QVHA 3JZEA 3MMDA 2A79A 1OBAA 2F9RA 1TELA 4BQ5A 2DIKA 1OX4A 4KCUA 4RPQA 2MANA 2O7SA 2YBTA 3TJLA 5DLCA 2WJDA 4YXGA 5ABGA 5LIWX 1GT8A 4I8DA 5BXRA 1HIZA 3F7JA 5F4XA 4PUKA 1XCXA 1ZSXA 1QPKA 1ZU8A 4A8IA 4ZXLA 3TMLA 5C5YA 2CW6A 3GVVA 2OWCA 4IUOA 5C2CA 5JXQA 4O0KA 4I7VA 3ARUA 4U3CA 3OLGA 3SCWA 1TPFA 3VOHA 4W7VA 1IXNA 1MI3A 5CC6A 3BSMA 2X7VA 2Y7FA 5HWMA 2OT0A 1D3HA 3EX6A 2PGWA 1DYSA 2ZICA 2YFNA 4M6PA 2XYLA 1OG6A 1OM0A 4I7WA 5IFPA 4X3ZA 3HTWA 2GJXA 3R0UA 4A3UA 2Q02A 1K9FA 1L6FA 4GJJA 1M1BA 1HNYA 4HPNA 1J5SA 1VFTA 3KHDA 4DAIA 2QF8A 2FJUB 3VMOA 1XUZA 1WA3A 1EDTA 1XYFA 4JTHA 3EPOA 1XIBA 1B2YA 1TE1A 4B5TA 5FEXA 5CBJA 2W0UA 2BNJA 3F4DA 3TW6A 3DBNA 1O5KA 3BQ6A 4AQLA 1AG1O 4ORIA 1JZ5A 4QRNA 2QXWA 2ALDA 7ENLA 3RIKA 4HN8A 1SZNA 3VM5A 3LOTA 2AL2A 4MIMA 1XYCA 3EB4A 1CLXA 5DCEA 1Q6QA 3CL8A 4LY4A 4FX8A 1A80A 5FESA 3O07A 2P1FA 1KGUA 1GW1A 5CBIA 4FHAA 3H2EA 4LVFA 1XISA 3RPTA 4K3ZA 5EPDA 5BU9A 5E0FA 4AXKA 3R7MA 3KFTA 1UR1A 3AALA 3B8IA 1LUCB 1TTPA 2VGFA 1Q4NX 3IACA 3WLOA 4JGDA 4WUIA 5AC8A 1HW6A 4ZQCA 1WKYA 1TREA 4W88A 3S6DA 2AOSA 4ZE5A 1X39A 3UA4A 4LUJA 3BAWA 4M82A 3QR0A 3BXWA 3IRDA 2B4GA 1Q2SA 1Q66A 4GUFA 1UJQA 3H12A 2E28A 4D6EA 5FJRA 3EX4A 3VKAA 3P0WA 4JQ2A 4MB3A 1RLDA 4TUFA 4PTDA 3IJ6A 2W4XA 1S5VA 2Z6IA 2D23A 1K9TA 4Q8PA 1DP0A 3MHGA 3FYYA 3FDGA 2FDSA 5HNRA 4EXAA 3MT1A 2VVNA 4Z0JA 4JQ1A 4JYFA 1TZZA 3N9SA 2E9BA 5I23A 3DAQA 1UMLA 2WVVA 2RDWA 1UG6A 1X6NA 1E72M 4A2RA 5BMXA 3GNRA 3VDHA 3T05A 4WHBA 3P8IA 3WMSA 4AVFA 4J3SA 3B0VC 3KEHA 5BRPA 1OB0A 3PWAA 3RRXA 1HN1A 2QNEA 3V35A 5I78A 2AGTA 4B5XA 3M9YA 3NQ7A 4NY2A 4IPLA 4MKSA 3DX5A 1M01A 4W5UA 3AHTA 3TN3A 4NZ1A 2CLHA 5XIAA 3S4TA 4YVVA 1QPQA 2XSXA 1E9YB 3TQKA 3QN3A 4UOZA 1RXOB 3AYTA 4R27A 2ALRA 2GGGA 1JCNA 2XHYA 1E4NA 1F3WA 1OCJA 3I65A 4GY7A 5D2VA 3OPSA 1F6KA 3QFEA 3RG6A 3LQLA 3TTYA 4XSLA 4H7VA 3V5CA 4FPSA 2INFA 1US3A 1WZLA 3TTOA 2XVPA 3UYCA 4I6KA 3B9OA 4RLIA 3IVSA 2VHLA 5EA9A 2OKTA 2ODOA 2OO0A 1W37A 5FJPA 4GVHA 4CD4A 3UETA 3M0JA 5AECA 5BRQA 4FNQA 1OIFA 1DJNA 1XPGA 4DI8A 2J7CA 3WYZA 3SQSA 3CASA 2YYTA 3REQA 1Y65A 4XZIA 4ZGYA 1UD4A 2WWDA 1Q4WA 5EMMA 4D6JA 5E09A 1RCQA 1RV8A 2IS7A 1OFQA 5DF0A 3TVAA 1OFPA 1R8LA 1T0OA 1W3KA 1CGXA 3OZYA 1PTAA 2EKCA 1LOLA 3W7HA 1S1RA 4OIFA 1JZ2A 3ANUA 4LT9A 3ITGA 4Z2IA 1JAEA 5JQ9A 4UFMA 4EE9A 4WJEA 1R85A 3CAQA 2V69A 1O12A 4NL1A 2W63A 1JJKA 3MSRA 1ZAJA 4DVOA 5A6JA 3L4UA 2J7BA 4JIRA 3L4XA 3GG1A 3GTXA 3TV8A 2BMBA 1UW9A 1AD4A 2CLIA 4E2DA 3W27A 1GOWA 3QY6A 4RDYA 3H26A 1MEHA 1EX5A 1HO1A 2BXYA 2Y61A 2V68A 4Q6XA 5HPOA 1IGWA 4IMAA 1ONXA 1N8IA 2REQB 3KOXA 3OLIA 2WMFA 4FLSA 4AD2A 5KMYA 4TTGA 2PTYA 3BCDA 1T7LA 4DWSD 1XPYA 1D7FA 1VENA 1RJQA 3KXQA 1GOXA 1N8FA 1XGZA 1WNOA 2VOTA 1ISYA 4QDPA 3NOEA 1IWPA 1T99A 1PHWA 1XLMA 1ADSA 4DLMA 3A3HA 2V5KA 3GLCA 3PTQA 4ZE4A 1LF1A 2G37A 1F6PA 1J18A 3UERA 4BF5A 4GPNA 4AHQA 3O6YX 1JCXA 3WF1A 2ZRZA 2WMHA 4W89A 1EUAA 4GQRA 3EKZA 4RXGA 3EOOA 3KBJA 3TR9A 5LYRA 1PHQA 2IQTA 2WVTA 5XIMA 1C8QA 1U1UA 4LSBA 2VGBA 3NUKA 4H2HA 2XM2A 1FKXA 1NF7A 3STPA 2JKAA 3KCOA 2E77A 3E0IA 1QO5A 4ATWA 2PWEA 1RP8A 4DBUA 4K2SA 1S3TC 3HM7A 3B4YA 5HQEA 1ZP3A 3W87A 4JY8A 1SZGA 2P3ZA 2Y2WA 3RLHA 2DW6A 5CZJA 4D8AA 4EF8A 4AMCA 2BXZA 1XXXA 4NT0A 5CQ1A 2GUBA 5A8NA 3LZ5A 4MWAB 1NP2A 4NUWA 3IGUA 3P5ZA 2QJHA 4UFJA 2CCRA 3KWXA 1W1YA 3ARWA 3USZA 3B8WA 1HGWA 1V3MA 5AZ1A 3KOWA 2O9TA 4WSJA 3P62A 3WFLA 2YR1A 1Y5WA 1UOZA 5DBUA 2F8QA 1A5BA 4LUIA 1XLJA 4WX2A 4YN5A 1UWUA 2HRWA 4I9JA 1F76A 1UYQA 1HKIA 1E0UA 2YL6A 3PAOA 4JQ4A 3EWDA 1BYBA 2NWSA 3T4CA 3TMQA 3UXIA 4LVGA 1E51A 4D1JA 1N8WA 2W67A 3PK7A 4PCTA 4MWAE 1AQHA 1EPXA 4IUGA 2J78A 3URNA 4HOXA 2XIBA 2R8WA 3T42A 2FZDA 2ZCGA 2CHOA 2PDYA 1D3CA 1UR8A 2D69A 4OE7A 2R1LA 2W79A 3AMKA 4OVXA 1NSJA 3AXXA 1W9DM 3C4UA 4AD1A 2A7NA 1AQFA 4H3DA 2VO5A 1PIFA 1EFZA 2XFFA 3ONBA 4GQGA 5HQLA 4HPHA 3LLDA 5HA7A 3N13A 2P0OA 3S5NA 2PDUA 2O92A 1GOOA 3T0CA 3W82A 3G1YA 1TJ1A 1TTJA 3V0UA 3G1XA 3S5OA 4I5XA 1N7KA 3CPRA 3VMPA 1UASA 1ISXA 1AL7A 4X22A 3IWPA 2VZSA 2V2CA 1GOMA 3NZGA 3WBEA 4RX0A 1E4IA 4ZVJA 1GKPA 3UGRA 1SO5A 4MLJA 4JTLA 4LVAA 1W9XA 1TCDA 4XD5A 1BXBA 3MDWA 2Y8KA 4B4HA 1R7OA 2W62A 4I6VA 3U7VA 1R7AA 5MF5A 2FQIA 1WPCA 4KF1A 4F8XA 1L6GA 1E1EA 4AWSA 4CQDA 1XH0A 2WK2A 1GVEA 1K6WA 1LBMA 3PTMA 1I2QA 1I4NA 3IRSA 1ZCCA 5AC5A 5E93A 3C8FA 2ZZ5A 4H4IA 6REQB 2DUAA 1UD6A 3SUVA 1ME9A 3IS4A 4PCFA 2VL4A 3QKEA 3QFWA 4HHHA 1NAL1 4ICNA 3WCZA 3L65A 5GNYA 4AD0A 4OV4A 1GQIA 2BY2A 3C0SA 4DXKA 3W1QA 1DVJA 4GQQA 4XD4A 1VPYA 4DZIA 1TYGA 5A8PA 2PTWA 2RDUA 3BZGA 1YKWA 2TODA 4NQ1A 1W5OA 4LY8A 4ZOAA 1G94A 5C71A 2C91A 4RW3A 3VOIA 4IMCA 2OZ0A 1JZ8A 4OKDA 5D2TA 1GZJA 1E9LA 3QV8A 3NXFA 3KRZA 3LHVA 1GQKA 1AVAA 3GXIA 5LXEA 4S3FA 4I90A 3XINA 1LLWA 5JBDA 4EWJA 1EBGA 4H9UA 1B3ZA 2OWWA 2VKZG 1C91A 1A50A 3H4GA 2MUCA 1AW1A 3D3FA 2BY3A 3VYLA 1DJXA 2VD9A 2QDEA 3N4AA 4DWDA 4XISA 1DWIM 1V6WA 1HZYA 1C92A 2VR4A 1O1HA 4I7UA 1YEYA 3PUDA 4JTGA 5AHEA 1KB3A 2A7RA 2POZA 3PM6A 5DXYA 1OINA 2X41A 2CZVA 2P5NA 3QSTA 2VC6A 2BHYA 2DZWA 3F5LA 4IIBA 2VEGA 1AMKA 5E0CA 5AN7A 3EBVA 1HVQA 1C8XA 2Y85A 2ZTJA 4GQBA 2PP3A 5HUPA 5AYZA 3AHXA 2H90A 1IEWA 3HFYA 3ZLHA 4LX4A 3S1XA 1E6NA 5AFDA 4NZFA 4X60A 1H11A 3IUHA 4KEUA 4JNZA 4GVGA 1Q6CA 1RPKA 4PBGA 4AX7A 2OEKA 3DOPA 4NZ3A 2NX1A 1BQCA 4H7ZA 1PX8A 4O53A 3A3WA 1VBUA 1UWRA 4W4QA 1GGOA 4W86A 1BSIA 3A5FA 3FGCA 1FCBA 5LNVA 4HA4A 5A2BA 4O57A 1QBBA 3OZPA 3DN5A 3VD5A 4C6BA 4B91A 4QS5A 1UUOA 3FVDA 1TJRA 4QXIA 5LNUA 3C52A 4XAYA 2O7QA 3WNLA 5D33A 4ML4A 1EYWA 3UFYA 1WV2A 3PB0A 3M7WA 5M17A 3OHIA 3S9YA 2HE8A 2PDPA 2HNHA 1AJZA 2VEIA 1VD6A 4DO6A 4ICMA 4PC8A 1KM0A 3S6TA 1UMYA 2BFGA 4HQVA 2NQHA 4MYAA 2VFIA 3QZ6A 4GJIA 3PG8A 4FNTA 1QK2A 3L2MA 4K38A 4NYYA 1H7RA 1EJSC 1TRIA 2PMQA 3G18A 3EX2A 2XN1A 5G4EA 5XINA 1ZS2A 3CAKA 1M6JA 1VRDA 3HPSA 3KVMA 1B0IA 1MWOA 1XSIA 2QMJA 1I2OA 3V3WA 3QQ0A 1WUFA 3BAYA 4N6EA 1NP0A 2WLZA 4LCSA 2V82A 3GH4A 3WH8A 1DJIA 4Y7EA 1SFLA 2X05A 3UZXA 3PF3A 4R9OA 3A64A 4AH7A 2OWXA 1MW1A 3IAPA 1J9YA 5KZEA 1YDOA 3LPOA 1YE6A 3EEZA 1TFVA 3WD4A 3AISA 1V3KA 3ITCA 3N6HA 4LANA 3WQVA 1LUCA 4MY8A 4IPIA 4RDZA 3SI9A 5AVNA 4U28A 4MTVA 1F3XA 3VNIA 3WJWA 4WJ8A 3VKCA 3U8GA 3CIXA 2ZXAA 5D8ZA 2IQDA 1SPQA 4O1FA 1ZBVA 3SUWA 3VC5A 1EC9A 3M6YA 1I8JA 5E6YA 2J27A 3CHFA 4YWIA 1U2YA 4JFTA 3FFSA 4PB5A 1IXOA 3BZJA 5CZTA 4OTKA 5DMYA 3TJ4A 3BAXA 3G1DA 3MWCA 1GK8A 3T8QA 4E8DA 3EDFA 3JRKA 3PNUA 1QRQA 3AMCA 3J7HA 4DJFC 4ADSA 3W1XA 3NO3A 3UG3A 4Y9NA 2BY0A 4JN6A 1H7NA 2TSYA 1MUCA 3LK6A 2QYGA 3G1SA 3GNNA 1ZPTA 3ERPA 1KQYA 2YFOA 3H53A 3WENA 1QNRA 4QQUA 4JFSA 1A5CA 4BCEA 3H8AA 4Z2GA 4MNMA 1CENA 2WZEA 1JUEA 4CQ8A 3URAA 1T6MA 3IJLA 4S1FA 5LGZA 3CEUA 3BARA 2W27A 1CEOA 3N19B 4P7LA 5TBOA 4OGZA 4O54A 1UC5A 3E1F1 1F8MA 1W3JA 4F48A 4QIUA 3PANA 3AIRA 5JMUA 1R3VA 1EGMA 1XIMA 4NZ4A 1S1PA 3QH2A 2OSWA 2ZIDA 2GSEA 1FWRA 4R53A 1LRQA 4HK5A 1EL3A 2ZA2A 2E25A 4HNNA 3PTDA 5A94A 4W87A 2WMKA 3GNDA 3DKLA 4MB4A 4PMRA 1GUVA 4KWVA 1A5AA 3LCLA 2WB5A 1TV2A 1F9CA 1QXLA 2UWFA 3WDHA 4MJ2A 2B7OA 3LXBA 4GHRA 1E5NA 3GNPA 3G24A 3N17A 4HYRA 3EZ4A 4DUWA 2QGYA 1L2UA 2PD5A 1R9YA 2VZTA 1E55A 3PPGA 1FKWA 2NWRA 4O0ZA 3ZLGA 5CBBA 1YDYA 5LHEA 4DF0A 2X7WA 4A21A 1KR0A 1CI1A 3HZ3A 3S1UA 4DUVA 5I3JA 3NQAA 4KIEA 4M5PA 4O4VA 2EQDA 5G1TA 1R30A 2DDXA 1IIHA 4BI5A 3SSZA 1BHGA 4HNOA 3ARZA 1HP4A 3UCQA 3H4XA 2HK0A 2DZSA 4OV9A 3FXGA 2JKEA 4HOZA 4ATLA 1FUYA 3S0CA 1WXYA 1H3GA 1EEXA 4DNMA 4XZNX 1DWJM 2VT0A 4UQ9A 3WNPA 3CJPA 4D8LA 3R13A 3C2VA 3HPFA 3I7SA 1FWGC 3UR2A 2Y70A 4L9YA 2PDIA 1OHLA 3LRMA 4D72A 2O9PA 2YB4A 1FX6A 1AH3A 4AY7A 2PDWA 1QW7A 1WKEA 1AD1A 2YZRA 1YNPA 2GSJA 5KSWA 3MV01 3KP1A 5EMYA 4ZODA 3O6AA 4MWAC 3H55A 3B0PA 4JYEA 5RUBA 1AMYA 1W9PA 2FDMA 4CUCA 1X1NA 2NV9A 3SGZA 4PMOA 2PDKA 4DUXA 4YTQA 1KCKA 1HF6A 4AC7C 4V1YA 1US0A 4W8BA 4JIPA 4L6OA 2GJPA 3TTSA 4FLRA 4MM1A 4Z2JA 9RUBA 3SW6A 3KX6A 4RE4A 3ITTA 3WQ6A 3BAJA 3W22A 2X09A 3VZZA 1QI0A 3L5AA 3K5XA 1FWSA 1GYLA 1Q5MA 2BVDA 2OSXA 1OD8A 3DFTA 3CHCA 3QY8A 3L4TA 1TVNA 5EMKA 1J2BA 4FEZA 1EPVA 3WNMA 1E56A 3BJTA 2YGYA 3LHYA 4XTIA 3M64A 3SDOA 1XC4A 1AK5A 3APTA 2UY5A 2PF0A 5HNUA 4CU6A 3NM3A 2ZX5A 5D38A 3PZTA 4IPPA 3TAKA 2JQXA 1ZAIA 5BU6A 1EBHA 2Y7GA 3PBWA 3W7NA 3M46A 4MGGA 2E6YA 4H41A 4XZ9A 1IHIA 2PEVA 4IQLA 3WQEA 1XDJA 1X1OA 4RDVA 1F2JA 4NZ5A 3THDA 2DT1A 4UNLA 1CGYA 1E6SM 3TOYA 3NDOA 4JTEA 4HNUA 1QI2A 3WD2A 3QRHA 1W9UA 4KGJA 4JIQA 3T0BA 3OBEA 4DPPA 3UWWA 2VRKA 3L2IA 1I1WA 2QUTA 4FX6M 1NFGA 3W75A 3W7DA 5LIUX 1ZL1A 4ZA0A 1VCFA 3NFUA 1GEQA 4Q7BA 4GNVA 3TE9A 1CXKA 3WUGA 1J0ZA 3SY5A 1AUSL 1OFOA 1K3UA 4U2YA 4LWWA 3B97A 3A21A 4AD4A 2A3EA 3DH7A 1ICPA 4JTCA 1XLGA 2WC7A 3W84A 3LB0A 1U1JA 1LT8A 3B9NA 3SCUA 3DG7A 3FAXA 1PYFA 1I45A 4XZMX 4ZQPA 2ZOXA 4GGHA 4GH1A 4W9TA 4B92A 3IV8A 2EHHA 1ALDA 3BLEA 4G5DA 1OT1A 3BSGA 3W6MA 3OYXA 5LNSA 3ITLA 1MQRA 1P1MA 1JNEA 2TAAA 4D6IA 2FHBA 1JAKA 1S46A 2VEMA 4Y9AA 2G8ZA 4C60A 2FZNA 3W4RA 3LEPA 1KGWA 1FCQA 1Q6OA 2YA1A 4AZ7A 1AJ2A 2FTPA 3APYA 3VXGA 3KBMA 5M03A 5A2CA 4AF0B 1F73A 3DI0A 2Q3RA 3ZVIA 1PKMA 1J0YA 1KBKA 4TIMA 2QIWA 1KO0A 3BPWA 2ZE0A 3VO0A 4IPJA 4M6VA 1G4EA 2JF7A 1DQUA 5C9RA 1Z44A 2DGAA 2VP8A 3ARQA 3HGRA 3H7VA 2ZX7A 3G77A 5ECVA 5D2YA 1VRXA 1ZZMA 1CGUA 3PJXA 4H9YA 4WY0B 3W2JA 3P67A 1CECA 4Z08A 2FIQA 3K46A 1L8NA 2GVYA 2DZBA 3PR2A 1UUMA 1OIMA 2O4QA 1WO2A 3PTKA 5DY3A 1JXKA 2QPUA 3LCGA 4DY1A 3KZPA 3MJYA 4UZSA 4BF7A 1V6TA 1JIBA 3HPAA 4UNKA 5DT7A 3KUMA 2X1TA 1JRCA 5BCAA 4PULA 1LLZA 1E3XA 4A05A 2PP0A 4PMYA 2Y8UA 2CLFA 1BWVA 1ZQ5A 1DE5A 4RZ4A 1BVWA 5HJLA 2NXHA 3EA1A 1KBBA 3VK5A 3MCOA 1FWJC 2WJFA 5AC4A 3EOEA 3S9IA 1K7FA 4MKNA 2B7NA 4DRSA 3UZ5A 2GPTA 4F40A 2R1NA 3WD3A 3P2VA 3AHZA 2YDSA 2FZ9A 5CLWA 1OC7A 4CGTA 1W6TA 3VIGA 3VZYA 4BA0A 1M7PA 3CUHA 2GUUA 3LV6A 4IFKB 1JGMA 5BNKA 3FYPA 2C18A 1YNYA 2FTYA 5AC6A 1X96A 4HZMA 3LSBA 4RK8A 3WLJA 3P8JA 3RNDA 5B7ZA 1UWIA 1E73M 2J79A 3GE7A 5AC7A 2O0TA 1SQ7A 1C9WA 2WJZA 4MWAA 4WXYA 5REQA 3MVTA 1HP5A 2QHAA 1FWAC 2J8FA 4UTHA 4KT2A 3MJMA 3BGAA 2OZTA 3Q2DA 3AXMA 4PL2A 1OY0A 1RJRA 3TH6A 1QPNA 3VD3A 4HPGA 2HMCA 1CXFA 2ZRXA 3FW6A 1LG1A 1XLFA 1ZB5A 2WPGA 4GKTA 4RKAA 2EGZA 4M6UA 5HBFA 2Q71A 1MUMA 3GX9A 3HV8A 3PJUA 3NQMA 1VYSX 1V79A 1XCWA 4UTFA 1ISZA 4MFEA 2Z1KA 1KR1A 4MDPA 3BLPX 2QS8A 5F4SA 4TMCA 3GSMA 4H9MA 5L9FA 2F84A 4S3BA 4AWTA 5D9OA 4S3CA 1VS1A 1L2QA 1L9WA 3S47A 3L2LA 5DANA 1B4KA 4HCLA 7PTDA 3V5FA 3DFYA 3CV6A 1TJPA 8A3HA 3NR0A 1QBAA 3S42A 2PTXA 1J11A 3THUA 3ANVA 2P8BA 1NOFA 4YS1A 3AS2A 5D05A 2VDGA 5T9BG 3R1ZA 1XCFA 3DHUA 2ZRWA 2BS9A 5KZMA 2Z1VA 1O94A 4GIEA 1O66A 3B9DA 3NURA 4P7QA 4HNLA 3RMEA 5ABEA 2PC8A 1UP3A 3OHMB 1IQ8A 1C9DA 1ENUA 1PSCA 4DB7A 1GVOA 1Q6EA 2XH2A 3HGOA 1AW2A 4NAEA 4E2OA 4MFDA 3LGEA 3ZR6A 1EA0A 4JHZA 2OKOA 4QDMA 1EP2A 2GDVA 3CT2A 4O12A 1PDYA 4AVNA 4W5ZA 4GFSA 3LPGA 2H9AB 2HBVA 1ZJBA 1SR0A 3L5MA 3RGTA 4JR5A 3UXLA 4PODA 1G4TA 4MNLA 1RP9A 4OUEA 1QI5A 4PCSA 1DXEA 3W7MA 1Q63A 2Z2AA 4RV3A 3VIJA 3R0DA 3HFTA 3U3HA 3TWAA 3B4UA 1CGTA 1P0BA 4E3VA 1QK0A 1FH9A 4LEQA 1O5RA 2PGFA 2NV2A 3GG8A 2QDGA 3M5ZA 3U7BA 4FAMA 1WDRA 5D9MA 4LRTA 1IR2A 5EBUA 1UA7A 3WK1A 2QEZA 4WDWA 1TMLA 3ZXWA 3S83A 4UCGA 3UXDA 3QGVA 2A6LA 2A3HA 2RFGA 5M2FX 2Y6ZA 2QDDA 4X0VA 1LCOA 2DSWA 3WBWA 5FJTA 2WZTA 3LBOA 4GZEA 5EKYA 3N04A 3ICJA 3M0ZA 1Q7ZA 3EMCA 3A12A 5JBEA 3UR8A 1NQKA 1OGSA 4G7FA 2V67A 5C9ZA 4HYWA 4FNRA 3WLPA 1UR9A 3W29A 2WAGA 1UJPA 2YBVA 2OEMA 4EPEC 3VNYA 1E71M 1JPMA 2JALA 3ZJKA 3AYSA 4L7ZA 4M51A 4QG6A 1XHGA 4Q33A 2UY3A 1RY0A 1XRTA 1RH9A 4LCQA 4WKHA 3DBPA 2GQ3A 3EWXA 1KM4A 3AXKA 3RX2A 3TLLA 2OPJA 3WJZA 3HG3A 4BWLA 3DFQA 5AHNA 4C6LA 1IZCA 4DZHA 3FVMA 1BQGA 1QI4A 4LAMA 1MFUA 4FXRA 3ZVHB 2WKJA 5A3HA 4A6GA 3IVUA 1BFNA 4PUWA 1IR1A 1K4GA 1QR7A 2EF9A 2I9EA 5A6MA 3LX9A 2EG8A 4MZ1A 3CBWA 4B5NA 4CNTA 3JR2A 4H8NA 3W1UA 3H7RA 3NL2A 1QOXA 1M68A 3RU6A 3KRBA 4JFUA 4L5ZA 1ZP4A 4XAPA 1CX9A 3N15A 3TA6A 5BXPA 2ANUA 3AWOA 1ADDA 4CD7A 2V5LA 1BTCA 1LOQA 2I5IA 1OZQA 4K8HA 2GDUA 3TXVA 3UT0A 4W93A 4LAOA 4DO7A 4LTSA 1VB9A 4S23A 1WDQA 3VDBA 4LQ1A 3C5QA 2DQXA 1FXPA 3HN3A 4HK7A 3AS0A 1CXLA 3N73A 1W1TA 4ROPA 2QDHA 3K4AA 1MUWA 4KERA 2QJNA 4BQ3A 1W5NA 3I3EA 4XKYB 5IBXA 5IHSA 3BG5A 3D46A 1HKJA 1BF2A 2JFEX 4FX7A 5HQMA 1PBGA 5F2IA 4L80A 2X1SA 2CLMA 4GBUA 3RCYA 1PEZA 5IFTA 3Q67A 3KVJA 4H8UA 4EAMA 1KCLA 4JTSA 1TVPA 1A0EA 2XIMA 3QM3A 1GW9A 1XIGA 2YLAA 3M0MA 5DCDA 4A3HA 4O1AA 1B3YA 2I5GA 1CTNA 3N3TA 4ACZA 1B9BA 1KXVA 1ZCOA 2FPVA 4DM1A 4ZMGA 4UMBA 4GZJA 2Z7GA 1KNWA 3CHEA 4ZQRA 4K8EA 3WKZA 3OODA 1UR3M 5ECUA 3TW7A 2WOQA 3LG3A 6ENLA 5EY5A 3WMLA 1KCZA 3W01A 1PPIA 4UOJA 3W24A 1P6CA 3ARPA 4EWND 3T0AA 3RITA 5FF3A 2EXOA 1ZY9A 1REQB 4W8AA 2XJ7A 3W6LA 5H91A 2H3BA 3GR4A 4M1RA 3B9EA 2HE5A 1KGXA 2VCCA 2Z2BA 4DHGA 2GSHA 3QC3A 2Z25A 3FIGA 4JTRA 4AZCB 3NL3A 5TNVA 5A6SA 4KEVA 3FSUA 1MW0A 2CZFA 4NNBA 1CNVA 3MW7A 5ABTA 4ZR8A 3TNOA 3IUDA 3UY7A 1QW8A 1H09A 1DKWA 1M3UA 4E5TA 4KCTA 5K7JA 1E43A 2FHCA 1IT0A 1BKSA 3TQPA 2IXUA 1TV3A 4DBWA 1RVKA 3RM4A 3S6OA 1AH0A 2VYOA 4NAFB 4UXDA 4PMDA 4ERIA 3P61A 4I5RA 5AB3A 3MU7A 4DWSB 3GU2A 4NG3A 3NL6A 1WBHA 2CLLA 3BWWA 3W81A 4C91A 2C1IA 1J4EA 2VQTA 3HG2A 1W5PA 1PV8A 3VU2A 1LLOA 2X40A 3AYRA 5AYYA 4S3KA 3AIWA 3C3UA 3WQDA 4P5UA 5A6LA 4S2BA 1TWWA 3GDMA 4ZB5A 2G96A 2XU2A 1P6WA 3M0LA 3IIOA 4NJIA 5FJJA 3U2CA 4K68A 1VJSA 1TPWA 3CZJA 1XSJA 4B5UA 3RR4A 4K8GA 1WBJA 1DJGA 3CUIA 2J74A 4XV0A 2YBUA 4PCNA 3OZOA 4GA8A 1S3HA 2BOEX 2PF8A 3BW4A 2J8GA 5I5RA 3BL3A 2PWGA 3SR7A 1JPIA 4ZOBA 3OG3A 3WUEA 4V27A 4P8UA 2R9RA 1IEQA 5AYBA 4YL2A 1PB0A 3AFBA 1PO9A 2E6AA 5EFDA 4AAJA 3HPZA 1JUBA 3UXKA 2HISA 1KBIA 1JD7A 3E74A 1EEPA 2CYGA 3KL3A 3VGFA 4R5EA 2C15A 1OG0A 3F03K 3RLGA 1JCMP 5I3IA 3SBFA 2Y1HA 4JN8A 2XVGA 3TIMA 2KAUC 3W71A 5I3FA 2F2HA 3TK7A 1TQXA 1D8CA 4LF1A 5KZDA 1FHDA 1RD6A 3AUOA 5FA5A 2VNCA 1M53A 2INEA 4EANA 1KM5A 3ZS4A 4GY1A 1EIBA 3IJ7A 2FB3A 1SR9A 1XBVA 4NNAA 2E6FA 2YZ5A 3TX9A 4AW7A 1M41A 4FA3A 3EB3A 1Q45A 1AQMA 3C86A 1E15A 3O63A 3NIYA 5M3WA 1XD0A 2CLPA 2ZDSA 2ISVA 1RBLA 4OUIA 2GOKA 1E9ZB 3CLMA 1E4MM 2ZA1A 1VEMA 3EMZA 3E3HA 1P0NA 4Q8WA 2QCEA 4AEEA 4O11A 1K77A 1LORA 3ABXA 2SFPA 2E8YA 3D47A 5T8GA 2F6UA 3ISIX 4PMNA 3AZSA 5I6SA 2Y7EA 1P0DA 3UJ2A 2ON3A 4FOUA 4JQ3A 5KTLA 2WPBA 1XIJA 5EMJA 1LQ0A 3SQMA 5KEZA 1LJYA 4TVDA 4WEVX 3W37A 1NOWA 1BXNA 1W9VA 4JDYA 3F4VA 3VUPA 1R87A 1X8FA 1NFBA 5CGQA 1WZAA 5A69A 3CAVA 1WX0A 3SUTA 1M7OA 3FJ6A 3G6MA 1GKRA 2A5HA 3P82A 4H83A 4US6A 2G97A 3CTTA 3SCVA 2WHLA 1Q6DA 3DG6A 2GJLA 3CIVA 1UKPA 1R9ZA 1EF3A 4GKLA 1OFAA 5LHFA 3PUOA 4GABA 2WVVB 3FKKA 5I3DA 1J2WA 4PBEA 2YCEA 3GC2A 2OSYA 4A22A 4F2BA 3GFYA 2HDJA 3M0VA 3VAVA 1YQ2A 4O28A 1K1DA 2WKLA 3QTPA 4R7JA 3BLIA 3NEHA 4HU0A 2VM8A 2DJXA 4RDWA 5CSYA 3VNJA 3CGTA 2I17A 1HXJA 2E9MA 3B9AA 4B3KA 4WR3A 4C6JA 4TVCA 4Z17A 4P8XA 1M65A 4EP8C 2I56A 3BUVA 1BGGA 3MHFA 3A6OA 3ALFA 2OQYA 4BQ4A 2B0MA 3W7LA 3UWZA 3WLKX 1DJWA 2ZRVA 5BWFA 3WH7A 4IQJA 1O5QA 3IJ8A 1AL8A 2WVUA 5CKSA 4EXQA 3BLDA 3VFLA 4F66A 4M24A 3USBA 3TR2A 3E5PA 2XG9A 1KFJA 3BW3A 5CPMA 5F2MA 3VDCA 4A8LA 3C8NA 2YPIA 3AIUA 1W1A1 2CHRA 2YDAA 1G67A 2A3LA 2WMGA 3JZUA 2OODA 4WY0A 4R34A 1XIIA 2PB1A 1FH8A 1K02A 3W7KA 3LRKA 3NL5A 4XQ6A 4Q8MA 4HSNA 3R0KA 1BRLA 3NVTA 2NVAA 1GVFA 5D2XA 1XLEA 3T40A 4ZSTA 4NP7A 2VR5A 4JYDA 3NSNA 4H6RA 3ZT7A 4YWSA 1Z9AA 2P10A 3T08A 4HMNA 4AZ6A 4AZHA 5CGTA 1PX3A 1E3ZA 3KCJA 1D8WA 4GNJA 3VILA 3VABA 1K9DA 5G2IA 2ISDA 1F8IA 4F0HA 4J2MA 3QW3A 3KM8A 4MWAD 3MDUA 3FJLA 3N2OA 1H7XA 4JFWA 5CSUA 1MRQA 3ZT6A 3RMJA 3AHYA 4DX3A 5CGMA 2WHMA 2HZGA 3BMWA 5MHBA 2ACSA 5JH2A 3GG7A 9XIMA 3TONA 5HR7A 4B3LA 4Y8EA 1GVYA 1TRDA 3KVLA 5DT5A 3WLQA 3EGJA 4HIBA 4CU7A 2XZ9A 2G3IA 3GYEA 1TV4A 1G6CA 5JIWA 3UJEA 3CQ0A 1TX0A 1QFEA 1CBGA 2V9DA 1EWDA 4H04A 3COTA 4ZTXA 4AC1X 2RH9A 3HG5A 2EPHA 4CCEA 4PTXA 1C8VA 1QO2A 1TX2A 3I3DA 1SUXA 2CU0A 1XV8A 1TWZA 1W3IA 1SM9A 4EIVA 3AXIA 3HJEA 5GNZA 3MHUA 2OFJA 2YDRA 3CL7A 1K8YA 3VIMA 5H8MA 1P5BA 3O7UA 1B31A 2DW7A 4UC5A 3G3MA 4OBRA 2HNEA 2PE4A 1ZLPA 4LC6A 2QUMA 3YPIA 4FOKA 4FZIA 4QE5A 1FDYA 3DZ1A 1NTHA 3EKLA 1QNVA 4LW7A 3GWQA 4JAWA 4LYQA 1XQKA 3W9ZA 3AOFA 3I4KA 1KBJA 2XVLA 1TPC1 2G3JA 3WQFA 1QHOA 1RAKA 1Q6FA 4JTUA 4AYGA 3EWUA 3V7PA 4ZOEA 1IWBA 2VZOA 1M03A 4KFNA 4D6FA 4C90A 3M0HA 6TIMA 2X0YA 3CWHA 1JCJA 1ECEA 1BTMA 2VMFA 5ABHA 1X8CA 1RR2A 2V5JA 3ENLA 3R94A 2F38A 1VLIA 3MS8A 1H49A 3MB9A 5CAKA 1VYPX 2CLEA 1DWFM 3VIKA 1WDWA 1MRAA 1FVPA 1WYIA 1GG1A 3ZFHA 1TE6A 2H8ZA 1EDQA 2WSYA 1MNZA 4HNTA 4RE0A 3SRDA 3VIPA 2OCZA 2ZRYA 3B06A 3EX1A 1ONRA 1QNOA 2REQA 1WQ5A 4S3JA 3BG9A 4JIHA 1O7AA 3JW7A 4LGXA 3LY0A 3Q65A 3N2BA 4GI4A 4UQBA 2E68A 1PZ0A 4JKKA 2OB3A 5DN1A 1JF6A 3NQDA 3GH7A 4O15A 4PMXA 4FIQA 2JGYA 4MJMA 3CS2A 3BGJA 3ZQ9A 1HVXA 4IMDA 1JXJA 3DGRA 2FMOA 5FF4A 2FB2A 4MDOA 3VNMA 3Q37A 3HMJG 4WK9A 2J9YA 2KZHA 5BMWA 1TV5A 4HTYA 1PE1A 3N1AA 3LRLA 1P7TA 2OYKA 3SUUA 4FALA 5KITA 3FLUA 3S1VA 4GI9A 2CBJA 1U5JA 4PA8A 3A4AA 3NZQA 4JIIX 3DXIA 3UP8A 1KW1A 1W5MA 1VFSA 4E8GA 1SO3A 2I57A 5DQPA 4U4MA 3LDVA 1K7EA 3WLSA 1U22A 3KOZA 2ACUA 3AAMA 4R33A 1IYXA 1VBHA 4AZGA 4GK8A 4NRRA 3FJNA 2FGZA 2VCBA 5T9CE 3QBUA 3ZR4A 1NQ6A 2ZZ2A 1CXEA 4CD5A 2DZTA 1M9HA 1JDCA 1OCBA 3WLNA 5HOSA 1XI3A 2VEFA 3CUFA 1D3GA 5CCZA 4QCFA 2CZ5A 1VJIA 2YCKX 4JX4A 2P76A 5H2ZA 4EX4A 1OWQA 3QXBA 3TJIA 2CITA 5IOBA 1TJ0A 4C65A 1R38A 5AHMA 3BVJA 1S2WA 3KCLA 1OCNA 4YHEA 3GNXA 1FCVA 2TRSA 1FTXA 1LWHA 4ML9A 3Q45A 2OQLA 4GGBA 3SO7A 2VRQA 3VDGA 2OVLA 4GE8A 3WMCA 4XBKA 3EWYA 1R47A 3W0KA 2VI0A 3W26A 2PCQA 3F4WA 4WSKA 6REQA 4KH2A 1EIXA 3WNOA 4TU1A 3K2GA 1V6VA 4P61A 5FL1A 3SN4A 5H8UA 2V5BA 2XSBA 1IEVA 3EPNA 3MUZ1 2ZKMX 1T41A 5JIPA 1RD5A 2XGZA 3W1RA 2ABAA 1G5AA 4PFMA 4RE3A 2VD8A 1JFXA 1IT7A 2GVJA 1XIDA 5FJUA 1OFRA 2A2IA 1JYVA 1IXPA 1JDAA 3P6LA 4H8VA 5FEWA 3W23A 3VIFA 3R25A 3RYSA 3BLKA 2PWHA 3H23A 2GJRA 2FH8A 5BROA 2HVMA 1JZ6A 2MNRA 3IJDA 3PJTA 3LXAA 1LP6A 3AZRA 2QR6A 1BKHA 4I8YA 4DJEC 3FYOA 3TEVA 3OVRA 3ZLFA 1VFHA 3GRIA 1YIXA 4AWUA 2Q3OA 4GI6A 1GPFA 1QNSA 2PU1A 4JHOA 4XVDA 4PSPA 1MEIA 3B3DA 1UH2A 3TU9A 3U6WA 1UD5A 3BGGA 1HT6A 4J35A 4GH3A 3MBFA 2D2GA 1CYGA 3EWWA 4FO4A 2P88A 3LCFA 4C6CA 3EXRA 1MSSA 4RNJA 5A6TC 4WKFA 3TWBA 3VCRA 1OADA 2XVNA 1Z3NA 1P6BA 3MVIA 1V7AA 4RE2A 5CPNA 3MO7A 2BVTA 1SVDA 1UCWA 1E1CB 3T0TA 3P60A 4RZ6A 2RDTA 3CQHA 3TSMA 3M43A 3WLRA 4FF5A 2C1GA 2YIHA 4DPQA 4LU0A 1V0KA 3GHRA 1TZ9A 3ZJ8A 4NXKA 4HN4A 3II1A 2IPWA 3V5OA 2VEPA 4Y2WA 1ZBCA 5DRCA 1K9EA 4KETA 4CD6A 1RALA 5CLTA 2ZA3A 3THQA 4ASTA 2GFTA 1YDVA 2X2YA 2CWNA 4UR9A 4H9XA 3M4HA 1U30A 4KFPA 3GNOA 2Q8LA 1RK5A 4C7GA 4GJ1A 4ERGA 4DF2A 4CN1A 1V77A 1XH1A 4O13A 2C0AA 5FJIA 4B5WA 3IGXA 1AZ1A 2RAGA 2EPLX 3NSXA 3R4IA 4IXHA 4CQCA 1NEYA 1VBGA 2CXEA 2QUUA 2X2GA 1DJYA 2OG9A 3M0YA 3N14A 3QPZA 3AMGA 4NU7A 3PBMA 4MPKA 2JE8A 5D9NA 1JPHA 2IPJA 3O06A 2O9RA 1DV7A 1UR4A 2A4AA 3MUIA 1I1XA 2EJ1A 4XSMA 5U4NA 5LXXA 5AYIA 2FVLA 3FDKA 1J12A 2YLLA 2L5HA 3QZEA 2D1ZA 4PGLA 4JCMA 3M0XA 2WVSA 4UTKA 4AHOA 3GDKA 1TJ2A 4WRHA 4WF7A 3RN6A 1LRNA 7CGTA 4WKAA 2CC0A 3UZYA 1GZ1A 3K8MA 4L4MA 3INPA 1H61A 2EPOA 5D09A 1UROA 3U5YA 2NSOA 2C6QA 4OOZA 5AKQA 2DVUA 3K1GA 2O4MA 1HO4A 1P4CA 4L65A 3G2GA 3VOJA 1TPUA 1DQWA 5AHFA 4E0CA 4E3TA 2C19A 3NWRA 1JF5A 3VCNA 4L6HA 4AZIA 2ZXBA 1RBOB 4DZ5A 3PNZA 1FWFC 1Z32X 4AIEA 4F4RA 1QWGA 3ZOAA 1NWSA 2P53A 1JPKA 4KWUA 2VURA 3R58A 4G2DA 3N34A 4HZ7A 1EJRC 4IOTA 3EA3A 3RCMA 3W7IA 3UESA 4WY0F 3WF3A 3PY2A 2WCGA 1IIGA 2Z00A 3S3GA 4P7RA 3V16A 2XN0A 1KBLA 4AISA