4LEFA

Crystal structure of phosphotriesterase homology protein from escherichia coli complexed with phosphate in active site
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphotriesterase homology protein
publication title Crystal structure of PHOSPHOTRIESTERASE HOMOLOGY PROTEIN FROM ESCHERICHIA COLI complexed with phosphate in active site
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lefA00
1YNYA 1ONXA 1XRFA 2QS8A 3ITCA 2I9UA 3SFWA 4EPEC 1M68A 3JZEA 4RDVA 4RDZA 1K6WA 4C6MA 3O0FA 1FKWA 2HBXA 4CQDA 4C5YA 4XD5A 3R0DA 1POKA 2UZ9A 4GY0A 4KESA 4PBFA 4JOMA 1GKRA 4C6CA 4L6DA 1R9XA 1V51A 4C5ZA 3GIPA 4Z42C 3S2JA 4LCQA 4DYKA 2VC7A 5G4HC 2P53A 5CH9A 4C6KA 1E9ZB 1K70A 1VFLA 3QGAC 4BY3A 3LGGA 1NDYA 4HK7A 3F2BA 4HJWA 5FSDC 3ISIX 1KRAC 3CAKA 3HPAA 4XAGA 4C6JA 1NDVA 2VHLA 4P5UA 4GZ7A 4GX8A 3GU2A 3LGDA 3S2LA 4C6QA 1V79A 4CEUC 2G3FA 1EJSC 3C86A 4DIAA 3GU9A 3DCPA 3E0FA 3UF9A 1YBQA 1E9YB 2IMRA 3UR5A 1K1DA 3IGHX 2Z27A 2FFIA 4RZBA 1P6CA 4ERIA 4EPBC 1NDZA 1WXZA 3E38A 1GKPA 2QVNA 3FEQA 4GY1A 4H9UA 1J6OA 4LH8A 3OVGA 2ZC1A 2FTYA 3GTHA 1ADDA 3UPMA 1M7JA 4GX9A 4XAYA 2D2HA 5AKQA 4LFYA 4ICMA 4XD3A 2D2JA 3TN4A 4B3ZA 1RA5A 3QGKC 4H9TA 2Z2AA 2ADAA 2GZXA 4GC3A 2E25A 1UMLA 2OQLA 4C60A 1J5SA 3MPGA 1IE7C 3RHGA 3E0LA 2VUNA 2ICSA 3NURA 4PCPA 3MSRA 1P1MA 1FWEC 4R85A 1RK5A 4OFCA 4GXWA 3AU2A 3WMLA 4CQCA 3N2CA 3CS2A 4GY7A 1M65A 1YMYA 4EPKA 1RAKA 1R9YA 4WGXA 2R1MA 2EG7A 2Y1HA 4XD4A 1O12A 4C65A 4I6VA 2AMXA 4J35A 2EG8A 4CNTA 1V77A 2HQAA 1A5MC 2WJDA 4AQLA 4QRNA 3T1GA 1RK6A 2Q09A 4QS5A 3GG7A 1YRRA 4V1XA 3QY7A 3F4CA 3EGJA 4H9ZA 5LXXA 2OGJA 2GSEA 2YB4A 2FVKA 1UBPC 2R1PA 2WJFA 4B91A 3T81A 3K5XA 3ID7A 2QPXA 3PANA 4D8LA 1PB0A 2PGRA 4G7EB 1RJRA 2E1WA 4C6LA 2R1KA 4C6BA 3FDGA 1JGMA 3OQEA 4GK8A 5E5CA 3S2NA 1YIXA 3KM8A 3OODA 1UIOA 3GIQA 4C6DA 4KEVA 3IACA 4ERAA 4IGMA 2A3LA 4L9XA 1POJA 3SO7A 2GWNA 4LALA 5HMDA 2PUZA 1KCXA 3S4TA 3LSBA 1FWCC 2D2GA 4RE0A 4HK6A 1XRTA 4HK5A 4IH3A 1J6PA 2QT3A 2Z29A 1EYWA 4KEZA 3URBA 2W9MA 2O4QA 2OB3A 4NG3A 5FSEC 3ORWA 3OU8A 2P50A 4KIRA 4E3TA 3IRSA 3UR2A 4QROA 4DI8A 4IFKB 1DPMA 3NQBA 2YB1A 3K4WA 4GYFA 4GOAA 2GOKA 4UB9A 1FWAC 2HPIA 3LY0A 4LAMA 3IARA 4IF2A 4J5NA 4CNSA 3GTXA 4YIWA 2PLMA 1KRBC 4QSFA 4DI9A 4LAKA 2RAGA 4PBEA 2UBPC 1XGEA 4KQNA 4V1YA 4C6IA 2Z00A 3DUGA 3MVIA 2Z26A 4TQTA 1A5KC 2WJEA 1EF2A 3F2DA 4MUPA 4H00A 3A3XA 4F0RA 3HM7A 2HPMA 3MJMA 4WHBA 3PNUA 3GUWA 3ICJA 1PO9A 4B92A 3PNZA 2VR2A 3S2MA 4KEUA 1RJPA 4G7EA 3MKVA 4AC7C 4IFOA 1J79A 2HBVA 2BB0A 4DZHA 3MDWA 1FWIC 4RDYA 4LANA 4CEXC 3WYZA 4BKNA 4KETA 4C6EA 1FWGC 4C6FA 1S3TC 4CNUA 4XAZA 4DLFA 3MVTA 4DNMA 1ONWA 3URNA 3HTWA 3DC8A 4H9MA 3LNPA 3E3HA 2VM8A 4NP7A 2FVMA 4LCSA 4IG2B 3MTWA 4R88A 2PAJA 1EJUC 1BF6A 2Z25A 3EWCA 2DVTA 2Z7GA 4B90A 4F0SA 4H9YA 4IFKA 3LA4A 4DZIA 3IJ6A 1A5NC 1HZYA 2EG6A 3OJGA 1V4YA 3WZ0E 2YXOA 4ERGA 3MDUA 1EJTC 3URQA 1I0DA 3TN6A 4H9XA 3B0YA 4H9VA 3O7UA 1EZ2A 3RN6A 2DVUA 2Z2BA 1NDWA 2OOFA 2Z28A 3NEHA 4R7WA 2AQVA 4CQBA 1QW7A 3LS9A 3F4DA 1A4MA 1A5OC 1RA0A 1KRCC 3GTIA 1ZZMA 2Z4GA 3URAA 3T8LA 2I5GA 1O5RA 1PTAA 1P6BA 3GRIA 3V7PA 1QXLA 4HA0A 3B0XA 3IPWA 1KRMA 3E2VA 4KF1A 1R9ZA 4M51A 3PAOA 3K2GA 4IFRA 4C6PA 4WVXA 2XIOA 2AQOA 4F0LA 4LAOA 3AUOA 4IGNA 4NI8A 4BJHA 3PBMA 3G77A 4LCRA 3RCMA 4IQJA 4QS6A 4UBPC 2O4MA 1EJXC 4IG2A 2DVXA 1FWHC 3GU1A 3UBPC 1ITUA 1V7AA 4XAFA 4C6NA 1PSCA 1FKXA 1WXYA 2Q01A 2HNHA 2KAUC 4KERA 3EWDA 3FDKA 2WM1A 4PCNA 3TN5A 2VC5A 2OODA 1ITQA 1EJWC 1W1IE 3D6NA 5HMFA 3CJPA 4PE8A 3E74A 2GWGA 1FWFC 1I0BA 3AU6A 2Z24A 3QY6A 4EP8C 3A4JA 4I6KA 5A6TC 4GBDA 1EJVC 4DLMA 2FTWA 4RDWA 2PGFA 4J2MA 5HMEA 3IV8A 1XWYA 4ZSTA 4ZSUA 3F2CA 3BE7A 1FWJC 2YZ5A 3GTFA 1RJQA 1UIPA 2ANUA 4G2DA 4EPDC 4QTGA 4H01A 2R1NA 4XD6A 2R1LA 1YBQB 3LSCA 4C6OA 2BGNE 4LEFA 3OOQA 1FWDC 3B40A 1A4LA 1FWBC 4INFA 1NFGA 3TN3A 4DO7A 3TNBA 3QY8A 1A5LC 1GKQA 3RYSA 1EJRC 3A3WA 2F6KA 3LU2A 2CZVA
chains in the Genus database with same CATH superfamily
4D9PA 4NU7A 1A3XA 3MUIA 2DY3A 3SGGA 1FFQA 2EGZA 1AODA 3L0KA 3GQYA 4GQQA 1P0NA 2FB3A 3WF1A 1FY6A 4WJXA 4ZXLA 2FIQA 3JVAA 3KWXA 2JF6A 3LG3A 3SCVA 2FDMA 1KXHA 1PEZA 4J9JA 1UWTA 3VOFA 1XYMA 3PZUA 1MEHA 1R9XA 3MKKA 5LZLA 3QQWA 5C55A 3WJYA 4IMEA 3VUSA 2PLJA 5K9XA 1X6NA 3S6OA 1XBXA 1IZKA 4PTWA 3AHZA 1XG3A 1TTPA 1P1XA 3FAWA 2QCDB 4DBWA 3CAKA 3UCQA 4E6MA 4DVOA 4WXZA 4MZ8A 4E8DA 3S2LA 5T9BG 2OVLA 5B7ZA 3CL6A 1EPVA 2OFJA 2I5QA 3NOEA 4I5XA 1SR9A 2ZE3A 3STGA 4TX8A 2VP8A 1J6OA 4JTAA 4OTKA 4CD7A 1Y5WA 2BBFA 3W71A 3T78A 5DRIA 1V6UA 5I0DA 2VX4A 1OFPA 2RJHA 2VEGA 3HF3A 1A3WA 3BAXA 3TW7A 2ADAA 3AMGA 2CBJA 3U4AA 3GR4A 3NURA 3VCRA 4C7FA 3REQB 4OFCA 1I1WA 4MF4A 3BZJA 2C1GA 3G1SA 4QG6A 4K38A 4GY7A 1M65A 2WVVB 2YA2A 3SCTA 3NL2A 2DSZA 5I6SA 1B3ZA 3PPFA 4IQLA 2C16A 1H41A 3GY1A 3MYOA 5E9AA 3T1GA 2QCDA 4O14A 4QBXA 4H9ZA 3EMQA 3QZEA 4N4QA 5HANA 3KX6A 3W87A 2NVCA 2YL9A 1S2VA 1UJQA 3QZAA 1PB0A 1UOKA 1WA3A 4G7EB 2OR2A 4C6BA 4WKAA 1WAUA 3W7QA 2WPGA 2PDQA 4LS2A 5J8LA 4PRWA 1KKOA 3BH4A 2ZIDA 2YOCA 1L0PA 1P0DA 5ECVA 1EJ7L 1NTHA 3CHDA 3N2XA 2Y7EA 3A4AA 1LWIA 1S2WA 3W2NA 3WD3A 2GJXB 3HPFA 4K39A 1OFDA 3DYPA 2WVVA 2Q02A 1OK4A 1B9ZA 1KLZA 2NX9A 4IMCA 1K77A 1XSKA 4A3QA 1K4HA 3N4EA 4LYRA 4JXCA 1V6WA 4QSFA 2CBVA 4DI9A 2F9RA 2UBPC 1TV3A 4XZ9A 3G1RA 1KTCA 2VRQA 1V93A 3MJMA 3N4AA 2E6YA 3T40A 1K9FA 1AK5A 3BW4A 3G5EA 1ENUA 4MJ2A 4C91A 3GH7A 2CU0A 4G7EA 3PZ9A 4RX0A 1NQKA 3MKVA 5AC7A 4AC7C 2ZA1A 2HBVA 2VFGA 4JTSA 1E71M 1OC7A 3M0LA 3UEQA 1QNQA 4AZ5A 2VC9A 3IIZA 2CCRA 4HJFA 3UNTA 2R94A 4O13A 1J10A 4HHLA 2VEIA 1FH9A 3H8AA 1R3WA 3V18A 4DXXA 3WJSA 2BODX 2EQDA 4A8NA 2CITA 2GJXA 4B90A 5FL0A 2VRKA 1AJZA 4JFSA 4UFIA 4J4KA 4JGDA 2BG5A 2YXOA 3WFLA 4JZ5A 2WVTA 4Z0SA 4JTGA 4U4MA 1GZGA 4B5XA 2OQHA 1YXDA 2ISWA 3K8MA 1ZZMA 4IXHA 4UTMA 2REQB 3WH6A 2WHJA 5CSYA 3WLHA 5TQLA 2L5HA 4PTDA 5E1QA 3BVJA 3V5CA 5A6LA 1W9UA 2EXOA 1UD8A 4RPPA 1H11A 3ZT7A 2PODA 1EP1A 4RCXA 1LBFA 3RF9A 1ISWA 1OG0A 1T40A 3R10A 1H5YA 3RK8A 5CGMA 1PDYA 4X9SA 2PGWA 2HEJA 2GL5A 2DT2A 2RGLA 1CECA 1LLWA 4OBTA 4V28A 4C6NA 4K7VA 2BTMA 2IPWA 3PZTA 2PLKA 3TCSA 4BHYA 4ORMA 2KAUC 1QW9A 4Z1CA 2OG9A 1UC4A 4DM1A 3FLUA 1F8MA 3CJPA 3QH2A 1EOMA 4WY0A 4DEFA 3SEPA 5M17A 2AAMA 1HXJA 3B8VA 4UQDA 4P2VA 1G4PA 2FTWA 3TVAA 1XKYA 1GOKA 2OKOA 2REQA 1WKEA 2CLIA 2V2CA 1T7LA 3L4UA 1HNYA 3NQ7A 1RXOB 4M24A 3TQVA 4DN1A 2B7NA 4OOZA 3PC0A 3IJIA 4C6OA 2BGNE 4LEFA 3OVRA 3OIHA 1L8NA 4INFA 3QY8A 4YL2A 2ZUNA 3G22A 3E2SA 4AIEA 3HG3A 1TPDA 2YCLB 1YNYA 1ICQA 1W8SA 1SZEA 2CKRA 1AZ1A 2YCIX 3HG5A 2CLMA 1QPQA 1EHNA 3QPYA 4KH2A 4LUYA 2AL2B 1NWRA 3M4HA 2O9PA 4CQDA 4M29A 1K4GA 4R53A 4BK9A 3BLPX 4C6CA 3CIXA 4X60A 3DG3A 3W28A 4QJ5B 3KW3A 1LROA 4XZNX 1Q63A 3UG4A 3AYSA 3NPUA 4S3GA 3MI2A 4PUJA 4PMJA 1EGVA 3UETA 3EWWA 1B3VA 4NJKA 3EX3A 3TJXA 4F79A 3WLPA 1VS1A 5B80A 4DWSC 3UZXA 2CHOA 2DZUA 1N7KA 5LA1A 3LRMA 3Q58A 5A5WA 2POZA 4PR4A 9RUBA 3OLIA 2VFFA 4MADA 2V82A 4QR6A 1VBHA 1NDZA 4AZ6A 4Z2LA 4R9OA 1LOQA 5D9NA 2FZNA 5MHBA 3W7MA 2YCLA 4NJJA 4ROPA 1BEUA 3H2CA 1VBRA 1RA5A 1RD6A 1OK6A 4AWTA 2WCAA 2QCFA 3CWHA 4F66A 1BVWA 1Q6QA 2DZAA 4C60A 4I7UA 4QE5A 4QDPA 2AL2A 6ALDA 1UROA 1SO5A 1ZJHA 1UC5A 1V3KA 5G4EA 3HMJG 4H6QA 3DGBA 1VFUA 5I3GA 2EG7A 2YL5A 1QBAA 2GSJA 3FA4A 3CH0A 4WIWA 1XLAA 2EAWA 4K1WA 3SSZA 3AYTA 1LLOA 3BCDA 3A22A 1PYFA 1Q4WA 3UJEA 1R3TA 4QLLA 5BXSA 1ZAJA 2OGJA 3LCFA 3QGVA 2ASHA 4PH6A 2AOSA 3R2GA 1PXGA 4HU3A 3LHUA 3C52A 3TONA 4CD4A 1CXHA 3NFUA 1W6TA 1BTMA 3WH5A 1EL3A 3HFTA 4GI8A 1JGMA 4A05A 2J7HA 4M6PA 1IYXA 1SFJA 2GGEA 1YIXA 3G8EA 1UIOA 1UW9A 4C6DA 2BX7A 3TKFA 1AJ0A 1UH4A 5EMLA 2WCSA 3ZWSA 4LALA 4MY8A 3CH9A 2WQPA 4H83A 5BOOA 1J0HA 2YXXA 4IJBA 1O5KA 2ZICA 2J47A 1XRTA 4IH3A 5BWAA 4XZMX 2F84A 4H7VA 3NQAA 1HGWA 1TPEA 5EY5A 1LQ0A 3CEPA 4Q8VA 4NNBA 4DJDA 3WG6A 2EJAA 3C56A 1K02A 3DOPA 3SJ3A 4ZQCA 4L4LA 4J3UA 4YPJA 4TX9A 1VHCA 2F2KA 1A5AA 3BLDA 1MUCA 5GVJA 2E67A 4W87A 3PZNA 3WQFA 1QO5A 1NM9A 1XS2A 4S39A 3N04A 4EXBA 1GVOA 3AIVA 5LGXA 1BQCA 2A21A 3NZPA 3EB3A 1FDZA 1JI2A 3B0UX 1W1A1 5FF3A 2HPMA 4WHBA 3O6AA 3ICJA 4J3SA 4MWAC 4Y7EA 4KS0A 5DEZA 2Z1WA 3TZNA 1Q8AA 1F3TA 5HOSA 1E0XA 4LY8A 1E4LA 3EPNA 1VFMA 1C91A 1IEWA 3RDKA 1V0NA 2MNRA 3W29A 4CKQA 1DIDA 5CSSA 4DLFA 4R33A 4WR3A 4RNJA 3HB9A 4JEJA 2A3CA 2BY1A 3E3HA 4LCSA 3EDJA 3QC0A 2Y7DA 2FPYA 5LA0A 4JIHA 3MKCA 4B3KA 3DESA 1FFRA 3EWCA 4YHGA 1R3QA 4OZOA 4HSHA 5HR6A 4AW7A 3TYUA 1A5NC 5HJYA 1V4YA 3WZ0E 2QF8A 1DJWA 2OWWA 3DU0A 2HV5A 2OOFA 4AVOA 3T2PA 2GVYA 1QVBA 4P8XA 2RJGA 3D3FA 4Y8FA 2PWDA 3WQWA 1OFAA 5KETA 1T5AA 3NTYA 4AEFA 1GYNA 2PZNA 3KEHA 4UFKA 1YDYA 2J7GA 4G56A 2VFIA 3SCOA 2ZRVA 3WJZA 3PAJA 2ZUVA 5F7UA 3RNDA 4NI8A 4TVCA 3FKRA 5DF0A 2XTKA 1VFOA 3QPEA 1EF3A 1PAMA 1C29A 2Z1BA 4BF7A 1ESWA 4GIRA 5LIUX 1KCLA 3AXKA 4S3JA 2A4AA 1LT7A 2Z1VA 1G7UA 3TOYA 3EB2A 1TIWA 3K4DA 2Y4SA 2IPGA 4KGJA 3W73A 4MWAE 4HNCA 1ZHAA 4ZMGA 1TZZA 2OZ8A 2ZRZA 1JCNA 4IP5A 4N02A 3G3MA 4AX6A 3PSWA 3VNIA 3TTSA 3OYZA 3D5HA 2GDVA 2W63A 1PWMA 1VHNA 4CU7A 2YZRA 1J12A 4QTGA 1G4SA 3M16A 1QR7A 1AMYA 3GNNA 5CGQA 1ZENA 3R1ZA 3CQIA 1NU5A 2OYMA 1OD8A 1EWEA 1WDPA 3Q67A 2QW5A 4HMDA 1QNRA 3GBEA 2UY4A 4AYSA 5CLWA 3C2RA 2H6RA 3GAYA 4OV9A 1JF6A 2C15A 3AMDA 5C2XA 3MP4A 3UWUA 4EPEC 4B5NA 4MVAA 1DJIA 3S5NA 4FXJA 3WQ5A 3DFQA 3POHA 4MZ1A 4PMRA 3AROA 2WMHA 2CIPA 3R0DA 3VKKA 4BFAA 1V3IA 4QCFA 3UYIA 2BZNA 1E0VA 1T8QA 3CIWA 4BEQA 2C1IA 3PUOA 3W1PA 3N9KA 1JFHA 5A6KA 3W7HA 4B5WA 5D4YA 5C70A 1IIGA 3PBUA 9XIMA 3S83A 4G6CA 2YCKX 4JEQA 2ZUSA 3V35A 2JEQA 3UU0A 1XR2A 3L2IA 1OFBA 4KMQA 1DL3A 1AL8A 4MHBA 4K2SA 4HMNA 3EDKA 1SJDA 3LB0A 3CM4A 1K9DA 4ROQA 1M9HA 4RZBA 3IV3A 3TFXA 4GA8A 1YE6A 1Z32X 3MQTA 4H9UA 2XZ7A 3I68A 3P93A 4KCTA 4J7RA 2CXEA 1TMHA 4I8DA 4B5TA 3PTQA 1Z89A 2PE4A 1JCMP 1EGMA 3GH5A 2DIJA 1PX3A 2VX7A 4F8XA 3NZRA 3V1HA 2BOFX 4WOQA 3NL5A 1M53A 3NM1A 2G41A 1QI2A 4OU1A 3H12A 1NELA 2WBGA 1JRCA 4RL3A 1E0TA 1UWAA 1GHSA 2GQ8A 3KHDA 3LX9A 5EU9A 2PTZA 1SFSA 3HN3A 3NUKA 2Y62A 4FSAA 4PMDA 2F38A 3KVKA 2FZ8A 2EG8A 4GYKA 4WDUA 3E0WA 1BYAA 3TLLA 3T2QA 1RCXB 4QS5A 1TPB1 3A9BA 1EC8A 3OYXA 5LXXA 1X7FA 2NV1A 3BLEA 2WJFA 2XINA 1KBIA 2J7FA 5T26A 3ATYA 3L5AA 2E1WA 3C8FA 3UGRA 2WC4A 5CCZA 3C61A 5G5IA 4CCEA 3OODA 1KR1A 2QUMA 3ARYA 3L12A 4WSKA 5A8OA 4UC5A 3NXLA 4KEVA 3W27A 2YR1A 4YMZA 1H7WA 3KLKA 4Q4RA 5FF7A 3VOJA 4XKYB 1Q45A 1R86A 1VPXA 3EXSA 1XUZA 3Q45A 1JI1A 2INEA 1P5BA 1H61A 3GR7A 1GVSA 1UP2A 3VD7A 4X63A 4KEZA 2W9MA 3VFLA 4B2DA 5DY3A 4IIFA 1BGAA 4GNJA 3ZZ1A 3HV8A 3ZSSA 2ZWZA 1YNQA 4GCXA 4DI8A 1DPMA 4L1XA 1XRSA 3U6WA 3ZM8A 2IUZA 4RK8A 5K4XA 3KUMA 5C9RA 1R2SA 5HBFA 1W3JA 4YIWA 4RZ4A 2J9XA 4R27A 3VIGA 4MKVA 2CW6A 2J78A 3PK7A 1EGZA 1TTQA 4IIHA 5C2CA 2WMKA 4C6IA 3PZGA 1LWHA 1BGGA 3MVIA 2I5IA 3GTNA 1WZLA 2WJEA 2Y8VA 1ZBWA 5AECA 1XSJA 2VZTA 1XIJA 5CC6A 3DI0A 4IGHA 1VBJA 3OLGA 4IFOA 1J79A 2E28A 4OJYA 4Q8PA 3VGEA 4CEXC 3UZZA 1EUAA 5C2GA 4XKYA 5REQB 1ZY9A 3H23A 2HE5A 2FZMA 3RM8A 3U2CA 2YL6A 5A6MA 1SQ7A 2Z25A 5IDIA 1QHOA 4MAZA 2C19A 3ELFA 2Z7GA 3QMTA 1XYAA 1H51A 4Y9OA 3GW3A 2OLSA 1E1EA 3WF2A 2BNJA 4BI5A 3SQSA 1F4HA 1WZMA 4JTQA 3RJXA 3RX3A 2PD9A 3ARZA 5F2IA 4HMCA 3VXGA 4Z1YA 2ZZ4A 2AQVA 1UH3A 5MKGB 1DORA 1AQHA 1CXFA 3W2LA 5KITA 2EF9A 3GTIA 5H6HA 3PBWA 2Z4GA 2DDXA 1EPXA 3QLDA 1YHTA 1ZCCA 4JX6A 3SAZA 5HNUA 1OFQA 2ZTKA 1QXLA 4LUTB 5AN7A 4CVWA 1WCGA 3B8IA 1R9ZA 3KBSA 1M7XA 5AHLA 3VDHA 5EA9A 5AYBA 5FF0A 4MLJA 3AQUA 2XIOA 3NOYA 4QLJA 2Q8ZA 1KTNA 3TYBA 4BJHA 3MZ2A 2V63A 5A95A 1G5AA 4H6EA 4NNCA 4QG8A 3OVPA 1S1PA 1V0KA 5IBXA 3W83A 3C0SA 1R7AA 1C93A 2OMAA 2FHCA 4UR8A 3II1A 5G1TA 4GIEA 3HPZA 1I75A 2DZWA 2RUSA 2BHUA 2E8ZA 1DQUA 4O0ZA 4Y96A 5TF0A 1SW0A 1DXEA 3B8SA 3PPGA 3T55A 1N8IA 4ML4A 2ZDRA 1Q6CA 4DJFA 4NL1A 3KFTA 1TFVA 2VC5A 4UIOA 1W3LA 3RFAA 5IDZA 1EDGA 1FWFC 4QNWA 2HVOA 3ERPA 1FOBA 1QRQA 2F61A 3G0XA 4DLMA 1FWTA 3V5OA 4RDWA 3A5VA 2OSYA 3FS2A 1QO2A 2DJXA 2QNEA 1RJQA 2A3BA 4W7WA 4LUTA 4GO8A 4RV3A 2OELA 1O7AA 3OOQA 3N6HA 3B40A 1E3ZA 4AG0A 3QYSA 1ADSA 4AUBA 3TNBA 4ZL1A 2DQXA 2XWEA 2Y61A 4YU1A 2DJLA 1R87A 3WD2A 3I6TA 4KRUA 1XCFA 4M19A 2VYOA 3ITCA 1HX0A 4HNLA 3PTMA 4M0XA 2WKJA 4MY9A 4D6JA 2P3EA 5AC4A 1M5WA 2HBXA 1SW7A 3PVFA 2E9LA 1B0IA 3TYDA 1EA9C 3P8IA 3O15A 3QQ0A 1K8XA 1QU4A 1TX0A 3VX1A 4BF5A 4Y9MA 3RAOA 3VILA 3B4YA 5I00A 4DYKA 1RVGA 3QLLA 4B4HA 2DT1A 1U1HA 2VD9A 2WKGA 3QJAA 2BP1A 2P8CA 4XISA 3H70A 3E2RA 2QJHA 1DYSA 4JTEA 1ZNNA 2GJRA 1JVNA 1O6IA 1V79A 4M56A 3DCPA 4DUOA 3P74A 1PZ0A 1HKKA 5EMMA 4A29A 4ML9A 4GZJA 4AHQA 4GVHA 1S2TA 4GY1A 1GNXA 2QHAA 1A5SA 5A2CA 1CZ1A 1MWOA 1UASA 2E5DA 1N2VA 2DEPA 2VQTA 3FGCB 2INFA 5FKYA 5I24A 1EB3A 4RNHA 3NPWA 1E6QM 4FXRA 3WLOA 3WL0A 3DFNA 2HROA 1NH6A 4DXKA 2IPJA 4ZTYA 8CGTA 1XRVA 2ISSA 4A3UA 1UD5A 3UQNA 1B90A 2E6DA 3G24A 3WMSA 1W9DM 1HKIA 2FGBA 1RQEA 4NX5A 1KM3A 4GVGA 3GFYA 2RHGA 1SPQA 3UWVA 4CQCA 5A8GA 3BLIA 1VEPA 2YBUA 1X8FA 3ZJ8A 3H2FA 5D02A 1RLCL 3A3HA 2D22A 4D6EA 2Q6ZA 3VIPA 5FD0A 1WDDA 1S5WA 1VJIA 2Q09A 2NXHA 4ZOAA 2WPBA 4H2CA 2RFGA 1PKLA 1YRRA 1XHGA 1VQTA 3WH8A 4TR9A 2YKKA 1C8QA 3VABA 3CZGA 3PANA 4HTBA 4JTDA 3B9OA 3BJFA 1KFWA 3W7LA 3TNOA 4RXFA 2QV5A 3LTSA 2MUCA 3OQEA 3S9IA 3QVQA 4E2OA 1HF6A 3GG0A 4RNFA 3SQMA 1W0MA 4AHOA 4DJEA 2IQTA 4DJFD 4C1NB 1MUWA 3S4TA 1JXKA 1J93A 4A3HA 4L61A 5G2WA 4PCTA 3H22A 3LK6A 3RM9A 1DJQA 1Q6EA 4DUVA 3WBAA 2YL8A 1CLKA 4NAFA 1TR9A 1XIDA 3VVGA 5EYWA 3KTXA 5SWUA 3IRSA 1ZJAA 1S5MA 3QR3A 4HP5A 5MF5A 4W84A 1W2PA 4GOAA 3FYYA 2PF8A 4FOKA 2GGHA 4QXIA 1GTEA 1TJRA 2RAGA 1UR1A 3G6LA 4HNUA 1O4UA 2GGGA 4V1YA 3CMJA 3TAOA 4FP1A 2IPFA 4LY4A 4H00A 1WO2A 4DBUA 3OTRA 2VTFA 4NZ4A 3GXMA 3OG3A 3DHFA 1HL2A 1I4NA 4KEUA 1WXJA 3OPSA 5CZKA 3KOFA 1ZL1A 3MDWA 3L2MA 4PL1A 3ECQA 2PDPA 2Y7FA 4Y9NA 1W1B1 3P0XA 1UKSA 3S6TA 3W0KA 1CGVA 5EMYA 3T0CA 3E0IA 1UWSA 3DHPA 1ONWA 1US3A 1MQPA 1EP3A 4IJCA 2FVMA 2HK1A 2DSVA 2W66A 1QK2A 2FJUB 3GDRA 2A85A 1S3HA 2X0YA 3PY2A 3F4NA 2WNZA 1B3OA 2GK1B 3LCWA 4JIRA 1HVXA 2Y63A 4B5VA 4AZBA 4XX6A 3MT1A 3UA3A 1V08A 2NQHA 4UNIA 4XZLX 2ZRUA 3B0YA 5CQ1A 4F0HA 2I17A 2DVUA 3THCA 1S1RA 2WXDM 3NEHA 4DF1A 2ZUWA 5HQMA 1QI0A 5BYWA 1LL4A 2UY3A 4P7NA 4XZHA 4H6RA 2NQJA 3CZEA 1TZ7A 3SUVA 5CSRA 6PTDA 4Q7IA 1HP4A 3HA1A 4WSJA 4PMUA 3W9ZA 1EBGA 1M03A 4WVXA 4DM2A 7CGTA 3LV6A 4A2RA 3E9AA 1MMFA 1TYGA 4MGGA 3SN4A 3G77A 2FVLA 4LCRA 3FYPA 4LS0A 2QUNA 3ZS4A 3N2BA 5I02A 1PKNA 4JTIA 4RV8A 3CZKA 3L4TA 3HO8A 3V1PA 4UR7A 2NV9A 3HV9A 7TAAA 1JCLA 2JE8A 4CNNA 3FKKA 2VWTA 1W9XA 3FDKA 3F4VA 2ZXQA 2Z6JA 3PULA 1E4MM 1EJWC 1Q65A 2HCVA 1FX6A 3BOXA 1IIHA 1I0BA 4WOZA 3QPZA 1W56A 4XZBA 1X6LA 4GNVA 2ZXAA 4AAJA 2QDHA 1TVLA 3KS6A 3FN9A 4JPGA 1GCYA 1TSIA 2A3AA 2YBVA 2PGFA 4KWOA 4X3ZA 3HG2A 4PCFA 4L4OA 4A4AA 5F4WA 4DJED 3EMCA 1XYZA 3TW9A 4PMYA 2V67A 2ATMA 3GNDA 4OECA 2HJPA 3U2EA 5FEPA 5IFPA 5CG7A 1V02E 3QTPA 1OX5A 1UWUA 3W7PA 2PB1A 5CAKA 4BQ4A 2FKPA 1L6FA 1OVDA 1OF6A 1M68A 4PSRA 5LNRA 1VZWA 2V0TA 2VI0A 4AC1X 2YSWA 7A3HA 3M0ZA 3RCNA 2FGZA 1LORA 1U83A 2PDXA 1Z3NA 4K8GA 3U7VA 2ZYFA 1P0BA 1UR8A 4Z42C 4HT3A 4WDTA 2VC7A 4A2SA 4LV4A 3ZVHA 1I9CB 2BSLA 4FF5A 3IJ9A 4HYRA 3C0JA 3FXYA 4B16A 3TK7A 2QCEA 3TE9A 3LZ3A 3LHZA 1KA9F 1CT5A 2ZVIA 4LOCA 2WZMA 1FA2A 4XAGA 2XFFA 3LTYA 4CEUC 3N34A 1EYEA 3UF9A 2CKSA 3LCHA 3O16A 4UR9A 3UR5A 2RKXA 4HPHA 3P80A 2XIIA 4QAIA 3H7RA 3W7NA 4O11A 3M0JA 1OC5A 4MYXA 1FHVA 1GKPA 6TAAA 1OG6A 3ZR6A 2QULA 1ME8A 1WOBA 4GX9A 2GFTA 4LFYA 4HU8A 4O54A 3MMDA 3R11A 1DHKA 1GOXA 3BAKA 3H7UA 1XIHA 4S3EA 4L9YA 1W1PA 2GZXA 1LRTA 1J0JA 4V15A 3WD0A 3E0LA 5CGTA 3IUDA 3NQEA 4IP7A 4E2VA 3S3GA 2VUNA 3R58A 3I65A 5I77A 4ADUA 1WUEA 2A7RA 3GSMA 3L65A 1WDRA 2KX9A 3LHTA 1PX4A 3CS2A 1DXFA 3OHIA 1K9TA 1YMYA 1DJNA 3IGXA 3QOKA 3OIXA 1Y0EA 1V7YA 2AMXA 3ONBA 4GACA 3AWNA 4AYGA 1A47A 4NYUA 1FH8A 1R46A 4DF2A 1KM1A 1DJGA 1LYXA 3H54A 3DXIA 4XUGA 2ZUMA 3T81A 5D37A 5AVNA 5ABGA 3TH6A 2BXYA 5DN1A 5JU6A 1W3IA 3LPPA 2VO5A 3NR0A 2FH8A 1O95A 3AS0A 4YTUA 1GJUA 2Y8KA 5D9MA 3HBLA 1CX9A 3RLVA 2XJ7A 4NZFA 1KFEA 3O3RA 2ZX6A 5AHEA 3ZMRA 4ENLA 2Q71A 4JNMA 3W85A 1POJA 1YXYA 5HMDA 3L4XA 3NO3A 2BVTA 4MOZA 2RH9A 3M5YA 5DCDA 3E2QA 1HJSA 5FJTA 1QUMA 5AOUA 1I45A 1JF5A 3CT2A 3PZVA 4HGXA 4W86A 4LF2A 1HJXA 4UFJA 1J18A 2I14A 2NZLA 1Y5VA 2VDHA 3B8WA 1B54A 1DJYA 4LAMA 3KS5A 4IF2A 1JNEA 4CNSA 2DT0A 1G6CA 4AU0A 3H4XA 3Q2DA 4RNIA 4YTTA 3UXDA 5LHEA 1JZ6A 3HMCA 4HOXA 2XFRA 3IUHA 1A5KC 3C8NA 3HM7A 4JIPA 3AYRA 5BCAA 4D1IA 4M8UA 1EDTA 3M0KA 3P5YA 2BGQA 1GK8A 5CAHA 2OU4A 4UZSA 3BSHA 4KW2A 4BCEA 3DFOA 5TAOA 3RM4A 1U5VA 2CWXA 1TX2A 1DIKA 3FHAA 3KCLA 3A9IA 1EC9A 4Y9PA 1E5JA 1S3TC 4UTUA 4G7FA 1KQYA 1SM9A 4GYPC 1Z8AA 2Z6IA 2B7OA 3UD6A 5HPCA 3LNPA 2YJQA 1SO3A 2VM8A 5HINA 1PKYA 4BR1A 5F4SA 1CCWB 2HVNA 5D05A 1GVYA 2VEKA 3K46A 1C7SA 5C7VA 1Z41A 3B0PA 3QV6A 1DVJA 2ZZ6A 5DLCA 3D0CA 4G5DA 2XH2A 1ZTVA 1XPYA 4PC8A 1D3GA 1MNZA 5HQLA 1E4NA 1W3TA 3KCOA 4US5D 3IWPA 1W9BM 4LBUA 2P0OA 3TN6A 3LBOA 1IT8A 3B04A 2Z2BA 1WUFA 2XSXA 1J01A 1P0KA 3GBDA 1DJXA 4O1DA 3GDBA 3LXBA 3CC1A 4JNYA 3P14A 3UP8A 3AXIA 3VMOA 3GRIA 4C1LA 1GVIA 4PUNA 3OB8A 3VMPA 1QMLA 5M1TA 5BWFA 4IFRA 4CLMA 2Y88A 1V3LA 3TDFA 4GBUA 1MEWA 4N42A 4DNHA 3WNMA 3E02A 3N6QA 1E73M 1OGSA 4ZB5A 4QS6A 2PDWA 4IJRA 1VFTA 1BTCA 3NSMA 3SY8A 1GEHA 1C7TA 4AZIA 3VNZA 3DBPA 3BMXA 1W32A 4H3DA 4TV5A 3NAVA 3Q94A 1VPYA 2WM1A 2HZGA 4P7QA 1TVNA 2C0HA 3I3DA 3U57A 3TN5A 2GUYA 3KDOA 2QJGA 5HK4A 1FQ0A 1YDVA 3R0KA 2UY2A 2JKPA 3ARTA 1XPGA 2G37A 4YYFA 1OQFA 3KDNA 1OGGA 2XG9A 1VYRA 4NXSA 1LDCA 4ZFCA 2H8XA 3DFPA 4LVGA 2OOGA 3U8GA 3N4FA 5DT7A 1ZAHA 2PC8A 3W76A 1DQWA 4GJIA 3FV9A 3BE7A 3OG2A 1QOXA 2PDLA 1UIPA 4JDYA 3O1NA 4C90A 3M0VA 3XISA 2O9OA 3NDOA 2CWNA 4A8RA 4JICA 3BW3A 2VMFA 5JBDA 2F6UA 1OM0A 2FB2A 2V9DA 2XSAA 4Y90A 4HPXA 2HDJA 1CGTA 2V5JA 4M80A 3W1XA 5I79A 3SSJA 3GHUA 1QDSA 1AW1A 4Z1BA 3NQ6A 4FLOA 4JS3A 4MNJA 2ACRA 1AD1A 1ZALA 4I5RA 4N4PA 3DH7A 3CWNA 1K03A 3DFHA 2BHYA 4C6MA 3CUIA 4LB4A 5LYRA 1KTBA 1LL6A 2VOTA 2ZUUA 3WMCA 4PBFA 2WM0A 3VMNA 1MXGA 4U2ZA 2ZZ7A 1B30A 2O55A 5AHMA 3S2JA 4H19A 5CH9A 3P5ZA 5G1YA 1EBHA 4JKMA 1MVYA 2QQ6A 3BJTA 3BWWA 4HK7A 1HW6A 4HJWA 4CD6A 4PB5A 2B4GA 3VDAA 4OOUA 1W31A 4XWUA 1XBYA 4LAUA 2VZVA 3GU9A 3ZJ6A 4HHPA 3FVMA 3F4WA 3UT0A 2DW7A 3KP0A 3NGFA 3CEUA 2X16A 4BWLA 2OT1A 3SCSA 3E38A 5LSMA 1Q6LA 4O4VA 5FAGA 1R30A 1HG3A 3SRDA 1VYPX 4EF9A 1B57A 4ICMA 1XV8A 2GJNA 2E77A 1GVEA 1OABA 3W72A 3BLOA 4NAEB 2ZOXA 4A22A 1GJPA 3W7KA 4LX4A 3M7SA 3TJIA 4DYJA 3WX7A 1EEPA 4UTTC 1H50A 3ABXA 3CV1A 2YDSA 2IS7A 3IK4A 3LBMA 1AA1B 4I9AA 1CW2A 3MW7A 1G69A 5AYIA 4W88A 1F3XA 3WNLA 2OWXA 2PWEA 2C14A 3K8KA 4WGXA 3VKJA 2HK0A 4HPGA 4GGBA 1XF0A 3AZRA 3G8RA 4ZE4A 4W4QA 1V77A 3APTA 3WH7A 4AQLA 1VLIA 4QRNA 1H09A 2J62A 3CT7A 3LHVA 1RK6A 3NCOA 2VR5A 5I06A 3TAKA 3CZJA 2FPTA 3AS2A 1K8YA 4TO8A 1WE5A 1X7IA 4P7RA 1X96A 1US2A 2WANA 3ITXA 1UWRA 2C8NA 3K5XA 3UZJA 1UR3M 2J66A 2ISFA 5A8PA 2XPKA 3W3OA 1XYCA 3OGSA 4JL1A 1I8JA 4MNMA 1GQKA 2WVUA 3WLLA 3S2NA 3UPWA 3TTYA 3U7BA 1DKWA 4O53A 3KZSA 5A94A 3KTSA 1UMYA 2I16A 4IMFA 1VCGA 1D3CA 2G0WA 4IPJA 1C3FA 2LLEA 4NAEA 5E6YA 2OZ0A 1JAKA 3T09A 2G3MA 3N25A 2VUYA 2EJ1A 5FSEC 3WO8A 2DSUA 3CGTA 4W7VA 4EWND 3MWCA 3ORWA 2VX6A 3JU2A 1S46A 3VNJA 3A12A 1HUVA 3VA8A 2ATSA 1TMQA 1CB2A 2WW5A 4CD5A 3M0XA 2V3GA 3PWIA 5ABHA 4YVVA 3VTRA 4GNKB 3GHRA 2XGBA 1XJBA 2OXNA 3UERA 2J79A 3S8HA 2XSBA 4KQNA 3ABZA 1BXNA 3OBKA 2JGQA 1VB9A 3MHUA 3WJWA 3RJYA 3SUTA 3YPIA 4JIIX 4BWLC 1FRBA 5H8MA 3TFCA 1TPH1 1KFJA 3UR7A 4N0RA 2CHRA 3LTPA 4RDYA 5CKSA 4PMVA 2NLIA 1W3KA 5EPDA 1CXEA 3LN3A 5AY7A 3VCNA 1TPUA 3CHCA 5JBEA 3ZQ9A 3VIJA 1SO6A 3T05A 1RQHA 3MSYA 4YTRA 1BF6A 4RZ6A 3G1VA 3TC7A 3ZLGA 3GW0A 3EWXA 4GUFA 3B9NA 1E6PA 1GUVA 5DX7A 4TVUA 3LEPA 4DO4A 3WLKX 3IJ6A 2VOMA 3A13A 1HL9A 1KW1A 4H9VA 3O7UA 4GQ0A 3B9AA 5C9WA 1S5VA 8XIMA 3BK0A 4FX7A 1MNSA 3R13A 2NSOA 1QW7A 4Z0JA 1JCXA 5CXPA 3S42A 3S5ZA 3AICA 5CLTA 2X1IA 1H5VA 4ZQNA 4PTVA 1TQXA 2BMBA 1WNOA 4WK9A 3DERA 3KAOA 1JQVA 2WLZA 5KZMA 1JYXA 2IQ0A 1DWHM 2QJMA 4AD3A 2E68A 1XYLA 2WO5A 4QSHA 4C6PA 3FA5A 4OKDA 1ALDA 2AQOA 2G5WA 3BDKA 3RPMA 4R34A 5LNVA 1OYBA 2AMGA 1F74A 5JQ9A 4CU6A 4YHEA 3S2CA 4H6KA 4FALA 1E1CB 1VRXA 3ZVIA 4WZHA 3A23A 4H8VA 2B31A 5DCBA 4AWEA 4A8IA 3AI0A 3DZ1A 3MY9A 2VFEA 3EPOA 2IKJA 3JZUA 4Y8EA 4D6FA 4ILSA 2Q01A 3RMEA 5A2BA 1Q66A 5DCEA 4KERA 1O5XA 3WLQA 4PCNA 4P8WA 1BWVA 3SCWA 1GT8A 4W93A 2W6RA 4QX4A 1XQLA 1UHVA 3E74A 1A5CA 1F8IA 1QI5A 2Z24A 3H55A 3MJYA 1TUXA 3DG7A 2FZ9A 1W1YA 3GVWA 4AF0A 2XISA 1EX1A 1VD6A 4Q4OA 1HJVA 1XLHA 3FSTA 3MUZ1 1XWYA 3W7IA 2FQIA 1FWJC 1W5QA 1T0OA 2ANUA 2ZRYA 3EWUA 1VEMA 4HYVA 4LQ1A 9XIAA 3WL1A 2R1LA 1QFEA 4OHQA 3IJDA 5ABTA 1TR1A 3RITA 2C91A 1A49A 1A5LC 4LPCA 3KL5A 3CAWA 1F05A 2W5FA 4WSHA 3WH9A 1M41A 3UFYA 1BXBA 1ONXA 3N15A 4MB3A 2PF0A 1UBSA 1GW1A 2X40A 5HNRA 1XLMA 3L2LA 1JG9A 1LF1A 4GI9A 3VM7A 4UTLA 1RP8A 3STFA 1W5MA 3EDEA 3WBWA 2Y7GA 4KCUA 1C9WA 3SI9A 3O63A 1CENA 2R14A 3R0UA 3IIXA 2AKZA 4Q7BA 2PU1A 3WMBA 5KTLA 4GUGA 3EZ4A 1E15A 4O4WA 1K70A 3WQ6A 4ZOBA 3QTGA 1J5TA 4RW5A 1KRAC 2W91A 2VHLA 3C5QA 3GU2A 3LGDA 4HCLA 3VFCA 2DIKA 4R5EA 1XDJA 4E8GA 4L4PA 4Z1AA 3N9SA 1JZ3A 3AZTA 3EYPA 4GVIA 2GPTA 4H41A 4WXYA 4UOJA 2TRSA 5CZJA 5EMUA 4EIVA 4I9JA 4L5ZA 1U22A 4JTLA 3ANVA 1L6YA 3ARVA 5C9UA 3VOIA 3UWEA 1KV5A 2ZXBA 4FNTA 1OCQA 2OWCA 4DPQA 2CETA 1KO0A 4B3LA 4PCPA 5HMSA 1FWEC 1LBMA 1RK5A 1XDLA 5DFAA 3M0IA 1K3UA 2XZ9A 5EMKA 3R6IA 4Y9AA 3WMLA 1E0WA 1Q4NX 4QHRA 2QPSA 1MRQA 3GDTA 2XWDA 4J35A 3TMQA 4B5UA 3RX4A 3WQVA 3NQDA 2WK2A 2V38A 2WMFA 2PWVA 3GG7A 5CBIA 3VDCA 1C8YA 4KWVA 4RE2A 3SRHA 2FGLA 4H8HA 3PSVA 4MB1A 3N3TA 1YTDA 4LVFA 3T0AA 1H62A 4CCCA 3EEGA 2EPLX 3FDGA 3GXTA 4NIRA 3S1WA 3GIQA 1ECEA 2PTWA 2QCCA 3KE0A 2QCHA 4AY1A 4J27A 3NL3A 1KCXA 3LSBA 4E4PA 3QFWA 1XIMA 3QEZA 2D2GA 1E9LA 4HK6A 1JUBA 4XTDA 4XG1A 3WQPA 5FJJA 3HIJA 1JAEA 1EKOA 3BXWA 5L9FA 3W02A 2P50A 2QUTA 4JQ1A 4E3TA 4NILA 2CXGA 2PEVA 4DUWA 1W3NA 3HURA 3AUJA 3NQBA 1UR9A 1A0DA 3NQMA 1FWAC 3LY0A 3A47A 4V33A 1XH2A 3O6DA 3L7RA 3NQCA 4AFYA 4O52A 3TC6A 1XICA 5DT5A 2GVEA 1U30A 3AMCA 4GUIA 4IOTA 3IJ8A 3EOSA 1CXIA 2XDFA 2E1DA 1SFTA 4WUIA 3BG3A 2Q3OA 1TPFA 3OGRA 1H0GA 3HPSA 1VGAA 4H4IA 3WDIA 4AIUA 3LLDA 3WF0A 2JK2A 3BQ6A 3SZ8A 1B4KA 1H1NA 3WKZA 4PN2A 4ZODA 4GPNA 3BMVA 4I8YA 1J11A 1JZ5A 2ONEA 4HHHA 3WUBA 2GVJA 5EMJA 2PDUA 4RE3A 4O15A 5G2HA 3S1UA 4LF1A 1OIFA 1ZAIA 3OVQA 1KXQA 2NV2A 2DUAA 1U2YA 1W5NA 3OA5A 2DVTA 3F5KA 1UPPA 3COTA 5CPTA 3GDLA 7XIMA 5BW6A 1SZGA 3LA4A 4EX4A 2Y2WA 4L1GA 2WZHA 1EZ2A 4O0KA 3IVTA 3OZMA 1K8ZA 4GABA 4H8UA 3GHTA 2X05A 4UTWA 3MWAA 3LXCA 1RLDA 4KEMA 2I5GA 1RVKA 3ARPA 1XP3A 2H90A 3HQPA 4RR4A 4DF0A 3CMGA 2WQDA 3B03A 3ITYA 4PGLA 4H1ZA 1GW9A 2C79A 2YDRA 2X7VA 4NJHA 3CUGA 2E7FA 3HJZA 4FHAA 5D2YA 2WNQA 2QCLA 3G0UA 4JTFA 4JNZA 3RCMA 3CHFA 4D8ZA 4LSBA 4UBPC 3EMZA 3T0TA 1XDMA 3W6LA 4JN6A 3NSNA 2DVXA 4AEOA 4W8AA 3CO4A 1L9WA 1UUMA 2P10A 1I6NA 1OSEA 2VC6A 4UQCA 4L6OA 4GZIA 3FJLA 1Z48A 4QDMA 2HNHA 4AISA 1IEXA 2WJZA 3L0NA 3G1HA 2VEPA 3D6NA 4YWIA 2CZ5A 2ZZ5A 1RPKA 2P3ZA 3W2MA 2KZHA 3EDDA 4F9DA 1J0KA 1XXXA 5A6TC 1J4EA 4U2YA 1UKQA 3GYCA 3LHWA 4JFTA 1X39A 2IKGA 3L4WA 3CASA 3EWBX 3F2CA 6XIAA 4Q6XA 2FLIA 3KLLA 1DOSA 1PYMA 3ABOA 2FZBA 2XVGA 3W2JA 1YBQB 3VD4A 4FNSA 1PPIA 3QF0A 1JDFA 3ZSTA 3HGRA 4L64A 3VIOA 5BMXA 4R9XA 3GC5A 4DO7A 5LHFA 1DJHA 4LJ3A 3MV11 1H0IA 1EO7A 3TC3A 1ODZA 1W1TA 4AX7A 5G1MA 4Q4SA 1G94A 3I10A 1O5QA 3SCPA 5J5RA 2CERA 4UUIA 4HIBA 1XLLA 3E12A 4W89A 3QMRA 1QT1A 4J3TA 3RLUA 1BQGA 3P3BA 3LCXA 1POKA 1ECQA 2UZ9A 5I2UA 3CZLA 1H7NA 4X0VA 1DIOA 3A21A 4LTSA 2OJPA 3UA4A 4X22A 1G0CA 3I3EA 4UTWC 5G4HC 2P53A 1IT0A 4HNOA 3SY1A 1E9ZB 3VKCA 2A0NA 4PUUA 3BTNA 2P0IA 4DZ5A 3F2BA 2RDXA 6CGTA 3ARRA 1IF2A 1NDVA 4I3GA 3P8JA 1R47A 3IS4A 3MMTA 3RG6A 3CLWA 1YBQA 1QATA 3ZR5A 2IMRA 1NVMA 3A4WA 4IZGA 3W6YA 2FFIA 3Q37A 1HN1A 3ABQA 4LWWA 1P6CA 2A2IA 4MSSA 3AHXA 2YCJA 4XV0A 2FTYA 3MCMA 3GTHA 1M04A 2TODA 1THFD 4N9EA 5HPOA 4W7UA 4XD3A 5FCZA 1O66A 3DX5A 3E5BA 3WEOA 1GOWA 1UOZA 3CTLA 4K6AA 1IR2A 1DTUA 4LT9A 4FF7A 1NAL1 4WKFA 2V30A 1W9PA 2DUZA 3G1AA 3N2CA 4CD8A 1CGXA 4V2XA 1ISZA 1GG0A 1RALA 2R1MA 3W37A 1ZLPA 1CGUA 3MCOA 1A5MC 2WJDA 1TA3A 2WKLA 3QR0A 3FIGA 6REQA 3C3NA 4B9ZA 2FDSA 1A0EA 1AZ2A 3T0BA 1W1ZA 2OSXA 3I6RA 3CYVA 1FUYA 4YN5A 5HXMA 5JXQA 3UXKA 3SUWA 4D8LA 3GX9A 2DPEA 2ACUA 2TPSA 5LNSA 1CBGA 4GK8A 1C8VA 1YNPA 3LCGA 3K8LA 5EKYA 4WY0B 4NZJA 5FEZA 3LLFA 2AQWA 3RR1A 2Y24A 3PUDA 4EAMA 1TV8A 3DFSA 2F7FA 1L2QA 3WDQA 4CN1A 3IJQA 2OLAA 1XLBA 4P8UA 2YGYA 1HP5A 3B06A 3M5VA 3KBVA 1UKOA 5DMMA 1DBTA 2WMJA 3PZOA 3MU7A 4DWSA 2WHMA 3PB2A 2CBUA 2R82A 2BY3A 3MZNA 2VXNA 3TSDA 1KBJA 3PHAA 3K4WA 3CUFA 3LQLA 4GC4A 5I3IA 1XYBA 2DSKA 4L7ZA 3SR7A 5KSWA 3V0TA 2PRHA 4YNGA 3NO1A 3UCDA 2Z2UA 4XAPA 1RCQA 1RP9A 4PZVA 1F61A 1KGUA 3B8UA 2Z00A 4TQTA 1Z42A 3F2DA 1W54A 5AB3A 2CLEA 3VDBA 5AC6A 1KBKA 1K7FA 4KFOA 2BOEX 5I3HA 3R8GA 1DWGM 1R3VA 4PUMA 3MHFA 1EP2A 4QLKA 1FWIC 4U3AA 2BVDA 3BL3A 3E96A 1XLJA 1YEYA 2J75A 3I7SA 1FWGC 1UKTA 4DO5A 1XLGA 4C6FA 3PBGA 2WSKA 3L21A 2FMOA 4XAZA 3QBUA 4IX0A 1WDSA 3DN5A 1JUKA 3DC8A 2C13A 2V5LA 2GQ9A 4NP7A 3M6DA 4BQ2A 3T07A 4CCZA 4ASTA 1GONA 4LB3A 1P4CA 2WMGA 5F1UA 2VVSA 5HAOA 5A69A 3LENA 3SCUA 3F5JA 4S2CA 1J0YA 4GJ1A 4NJGA 3GH4A 3DG6A 3T6CA 2EBNA 4KRTA 1WKYA 3W22A 3W53A 1R6WA 2VZSA 1SUXA 4LUIA 1HJWA 4HKPA 2V2HA 3C0QA 4R7WA 1CXKA 1RA0A 1JRBA 1ME9A 2VGGA 4JHMA 3W7JA 4GD0A 3HOJA 3KRZA 1UYQA 5HDRA 1PKMA 1LM1A 1WZAA 3VIMA 3WIJA 1XI3A 3EX2A 1QNOA 3H2AA 4D6IA 3PS7A 3WQDA 2GDQA 3M7WA 3WQOA 3C6CA 4PUDA 4UMBA 3TYAA 2PI6A 4P7LA 2XVKA 1O94A 1OJXA 1GPFA 2TMDA 1BHGA 7ENLA 3GU1A 3GUGA 3ZXWA 3V16A 1QNSA 1XLDA 3G1FA 3KZPA 4GIYA 5F2LA 3LQGA 2J6XA 2PDMA 1NWUA 3AHYA 1OBAA 4BI6A 3GVVA 4MWAA 3UJ2A 3E49A 2X1TA 3WQGA 3WBXA 3CYJA 4KCWA 2Y5JA 2J7EA 4JYFA 4JX5A 4WQ6A 1QWKA 3T42A 1MDRA 3TW6A 1EJVC 2JF7A 1ZBKA 1UPMB 3PB0A 3UG5A 2VDIA 4XVEA 1E72M 1F76A 1KV8A 4ZSTA 2W67A 4PTXA 3GTFA 3EOEA 1OD0A 1MW1A 2R1NA 4D6GA 2CHNA 3OBEA 4E3VA 1F6KA 4JY9A 4M3PA 2PDBA 3POCA 1FWBC 1SYTA 2D3NA 4EE9A 1TWDA 3USZA 2DW6A 2A3EA 3EWZA 1UUOA 1E6NA 1WOAA 2DFAA 4WJ8A 2RGMA 4TMCA 3VD3A 3LU2A 5BRBA 2O9TA 2A7NA 2ZUTA 3DHUA 1TVPA 1LOLA 4MTVA 2VJXA 3NG3A 4F2UA 3PWGA 2R24A 3ZJKA 2EPOA 4RDVA 1ICPA 1FP8A 3FCPA 3F03K 2J8FA 5JMUA 4FS9A 4GJJA 2YFNA 4GY0A 4KESA 5HR7A 3GXDA 3SN0A 4AHPA 3EXTA 4L6DA 2OKTA 4C1KA 1D3HA 2BGSA 2EPKX 1UZHA 5E70A 4P8VA 2VCAA 3ITLA 1KKRA 4URIA 3CZ8A 3PZMA 1JIBA 4Q8TA 5FSDC 3UXAA 2OTDA 4GMEA 5DO8A 2VR4A 4K8HA 2X0SA 3BCJA 4O8RA 1IT7A 3W7GA 4GX8A 4CCDA 7REQA 2J8GA 1OX4A 4IPIA 3UGVA 1XSIA 1JCYA 3B97A 3CPRA 3UXLA 1EWDA 1PJ9A 1S2AA 1LUCB 2H8ZA 2QVNA 3BARA 3FEQA 4IIGA 1TPWA 3SGZA 1UR4A 4QEEA 4TVDA 2PDHA 5AKQA 4MYAA 1F4AA 2IQDA 4K36A 1UQYA 4N6FA 3QQ1A 1BWKA 1IE7C 3W1RA 1WP6A 2OEKA 1ITCA 1Q6DA 3EWYA 4PUKA 3LM7A 2VVNA 3FJ6A 4J28A 4GG9A 1TPVA 1KWGA 3TYCA 1O1HA 3K1DA 4DHGA 3NVDA 5LA2A 3EOLA 3W84A 4C65A 5HULA 2JIWA 4POCA 4UZUA 3VOCA 1ONRA 4NF7A 3BAYA 1FCVA 3T2OA 4QITA 1F6PA 2J13A 2WMIA 3W81A 2Q3RA 1XFCA 4M1RA 3WJXA 6A3HA 3QY7A 4N9BA 1RSCA 3KVMA 3SN1A 5FA5A 4HTYA 1UQZA 2D0GA 3W4RA 5FESA 4WLCA 4HZ6A 1JFXA 4O16A 1T6MA 3CL8A 4C6LA 3PBVA 2R1KA 1AG1O 1LUCA 3R79A 3KVJA 4DBSA 4ZCWA 2I57A 3TWBA 5A1AA 2EPMX 1UKPA 4MNLA 1F3EA 1ZJBA 2ZX5A 7TIMA 2DP3A 4EAYA 5GJNA 3GNOA 3RRAA 4HK5A 4XVDA 1JD9A 1TRIA 4IP4A 2IKIA 1EZWA 1KM2A 4NG3A 3PJXA 4NZCA 2ZADA 2BASA 3O8AA 3AFBA 3UR2A 3C0LA 2YB1A 3HGSA 3UJRA 5J5DA 2NX1A 1ZPTA 3ARUA 4ZO8A 4QJ3B 3TP4A 1DWIM 4J5NA 5D2VA 4AMCA 3O2LA 2ZTJA 4LVBA 3K1GA 2HMCA 1HKVA 1D9EA 3IGUA 1N82A 1ZU8A 3VPLA 1XW8A 3ANYA 2V5CA 3A3XA 1JUEA 2PA6A 4PUEA 3VAVA 1RBAA 2VR2A 3W74A 1RJPA 4PTMA 2DGAA 2XN2A 3QOMA 5AHFA 2QVHA 2B7QA 2MANA 5T8GA 4ZEPA 3VX0A 4F40A 1GPWA 3W1LA 1YDNA 3WY1A 1JDAA 4N2YA 3ALFA 1VFHA 2DZBA 3CQ0A 3DI1A 3B9EA 4H9MA 4IHCA 3MB9A 3DKJA 1EUNA 3FK4A 3P0WA 2GVLA 4R88A 4Q8WA 3NPXA 3UR8A 3GB6A 3N6JA 3WBEA 4A35A 3ZO9A 4ECLA 4GINA 3W7OA 1ZB5A 4F0SA 3GXFA 3NSXA 4UMCA 4FEZA 1RHCA 1HZYA 4QJ4B 4WRHA 4DJDD 3HJEA 3EXRA 3AISA 5CG0A 4UFMA 1AUSL 5K9CA 1V0MA 4HCDA 1X6UA 2I56A 3TJ4A 1OB0A 2WC3A 5G4WA 4Q22A 1A5OC 2ZRXA 4DYEA 3BOFA 1UH2A 1D8WA 4O12A 4EWJA 1XGDA 3H4WA 3IRDA 3W25A 3MC5A 3QHOA 4ZBCA 4OUEA 4IWWA 1AQ0A 1HVQA 3QW3A 1WDQA 3MUCA 4PMOA 1K8CA 1OFRA 2ALDA 2CYGA 1Q7ZA 3SM0A 3IUIA 3PTKA 4PBGA 3AUOA 2WSYA 4IGNA 4GZEA 3QYQA 4AY8A 4J1OA 1EQCA 4ES4A 2O9RA 4JQ3A 5M03A 1PHQA 3SRKA 1NIUA 1ZJIA 1PUDA 4IIDA 2C18A 2W79A 4M81A 3NDYA 4QFUA 1DE6A 1G4EA 3H2MA 1KM6A 3U4FA 1GEQA 1DE5A 1S5NA 5HUOA 5CSUA 5HWMA 4WY0F 4FAMA 3UJFA 1AH3A 1VAHA 3F5LA 4CN4A 4JTJA 2OX1A 3S1VA 3MANA 1R0MA 1LG1A 4I7VA 1ZP4A 3QZ6A 2NWSA 3L0GA 1IWPA 1DQXA 5TD4A 1EFZA 5HATA 4GBDA 4HZ8A 4S3CA 4UQBA 3N19B 4M6QA 4DRSA 2ZKMX 4YS1A 2QKFA 1V0LA 4KPLA 3UPBA 3WLJA 1L6SA 4U5IA 4DPPA 2OLHA 1AH4A 1FWDC 4LXFA 4ALDA 3VYLA 1GQNA 4QAWA 3AS3A 4XTIA 3BPWA 2D73A 3RYSA 2J7CA 4ZENA 1X8CA 1RCOB 1XLKA 3PJUA 2VWSA 3I4KA 3W7EA 3OA3A 4ZR8A 1AQMA 2TSYA 3ITOA 2VT0A 3WNPA 1A5UA 4L6HA 5FAJA 4U33A 1VH7A 3ES7A 1PZ1A 3O0FA 4TTGA 1LG2A 2PP3A 3ITGA 4E2BA 3QSTA 3DGRA 1XLCA 4NUWA 2ZZ2A 3GDMA 3NVTA 1VPQA 3MYPA 3FOKA 4C6KA 1YTKA 1TE1A 3GYEA 3W00A 5ENLA 2EKGA 4EK7A 4LC8A 5LXEA 1I2OA 3ISIX 1MW3A 3SADA 4D6HA 3B4UA 1VC4A 1C92A 4JCMA 2G8ZA 3HQNA 1J96A 1TV7A 4JX4A 5C7HA 3UG8A 4TXEA 3T7VA 2WCGA 1IXOA 3A4XA 4HCHA 6XIMA 1TTIA 3NZQA 4NI3A 3KP1A 1BWLA 1E4IA 5EFFA 2OZ3A 1IV8A 4AMAA 3TQ0A 4REQB 1GG1A 4AWSA 4XAYA 4F2TA 2DT3A 4PL2A 4QCEA 4O8AA 4PFHA 4Q4MA 5HA7A 4B3ZA 1OX6A 4FIRA 4ZQOA 3UXIA 1JZ8A 2PMQA 1KFCA 3AS1A 1E55A 3MPGA 4LU0A 1XYFA 3TA9A 3HGJA 5A6SA 4GE8A 2ICSA 3ABRA 1ZCOA 4IPNB 1AL7A 3FNDA 3S6DA 3WENA 1RZMA 4GFSA 5FACA 4F9JA 1B1YA 2VZUA 4A3RA 2ZFAA 2I1OA 4DWDA 3MP5A 1CDGA 5C71A 1XISA 3B3DA 4L4MA 5FOOA 4ZVJA 4I6VA 3RPDA 4S3FA 3KOXA 1SR0A 4O10A 3AIBA 2HQAA 4YTSA 1OFEA 3HPXA 3W7DA 3U2OA 3N2TA 2ZCGA 2GSEA 3UZWA 2B81A 2R1PA 4B91A 2GOUA 1YW1A 4XSMA 2X42A 4P61A 3SY5A 2CLLA 3N3MA 3JUGA 2V69A 5D9OA 1KCKA 4MB5A 1KGXA 2ZZ1A 4DAIA 1FDJA 1BSLA 3FJNA 3GO2A 2X1RA 4REQA 3WDJA 3N14A 3SO7A 1R2TA 2F8QA 3N13A 2WWDA 4XUYA 2C3ZA 1Z9AA 3BCFA 1B3WA 3H53A 4Q8MA 1J6PA 2WNNA 1NP0A 2E3ZA 4JTHA 3CQKA 2X1SA 4ZTXA 4O1BA 3FA3A 4TTUA 3V0SA 1TUFA 1JZ7A 3BOLA 4EKJA 1OCBA 3MO4A 1L2UA 3RU8X 4NASA 3VE9A 3NQ8A 1FCUA 5CPMA 2DH3A 3ZLHA 3GTXA 2C6QA 5KMYA 3BLFA 1QK0A 3K13A 2PCQA 1D7FA 5I03A 1UR0A 4MZYA 3DUGA 4BQ3A 3CHEA 3DEQA 1G9HA 2ZBTA 2A79A 4ZO9A 3TR2A 3FXGA 1Q2RA 2IW0A 1EQPA 5BNKA 4IX2A 1Q5MA 2CZFA 4HN4A 3PFMA 3S2MA 5I3KA 1J0ZA 2PPGA 2AKMA 2QR6A 1WV2A 5DXYA 3ZLFA 3LCLA 1H4PA 2BVWA 1TJ1A 2NUXA 3OLDA 3MVTA 1UP0A 4GQRA 2R91A 2YPIA 3W75A 1JYNA 9CGTA 3TQPA 4ZO7A 1LP6A 3OHMB 1JXJA 4X0NA 1ODUA 1XLEA 2HTMA 2ZRWA 3GZAA 4B2DD 4H9YA 4PODA 3EDFA 3TXZA 1IXNA 2VKZG 4JTTA 3UY8A 3NWRA 1B3XA 1MZRA 3AIQA 4GLEA 3MDUA 4JTUA 2J4GA 2VNCA 3EKGA 3AALA 4Z2IA 1LRQA 2BOGX 1PTAA 3MUY1 3FHQA 4IUGA 3V7PA 5E09A 4NSBA 3M5ZA 4O0QA 1PS9A 3KVLA 1GYMA 3NIYA 1BAGA 3REQA 4LVDA 4KWWA 4HA3A 4UXDA 1DEDA 3JS3A 2XM1A 3PAOA 2DV0A 3BLKA 4PMXA 2WC7A 5M2FX 1AW2A 4ZOCA 3U2ZA 1HJQA 3LD5A 3LUTA 1H2JA 5HNTA 3BMWA 3PN8A 2VCBA 2QGYA 2FJKA 1HGYA 1M7PA 1A5BA 1OT1A 4XBKA 3KBJA 1H3GA 4HB7A 1JD7A 1R8LA 4RJEA 1KBLA 5G2IA 5M5DA 5LKYA 3MBFA 1SJCA 3H7VA 2OODA 1W1IE 3ABSA 4GUHA 4W5ZA 1BF2A 3SECA 3QY6A 4GH1A 2OX4A 3KOWA 4D72A 3S5SA 3EA3A 4QE1A 2ZX9A 3LRLA 2OO0A 5HMEA 4JCLA 4E2DA 4HMEA 4HSNA 4NAFB 2YZ5A 1UD3A 2FYMA 5ECUA 4EPDC 4ORIA 2WAGA 1H7OA 1FWRA 1TMLA 4Q8QA 4XD6A 3LRKA 3TSMA 2HS6A 5BROA 3WD1A 1JPDX 1MXDA 3AJXA 4AD0A 3LOTA 1V02A 1GQLA 3JRKA 1W5OA 3MBDA 1QW8A 1F3WA 5EL1A 4DQWA 2PFHA 4FPSA 3GFZA 3APYA 5GPRA 3GWQA 1RD5A 1OEPA 5XIAA 4OBRA 5BXPA 4JOMA 1GKRA 4N6EA 5CEWA 1KB3A 1XBZA 3TZFA 5FEXA 1YLVA 1JDCA 1VFLA 1AQFA 4KKXA 4LV9A 1JYWA 2WSQA 4GQGA 1X1ZA 2ISDA 1FWSA 2CLKA 4NZ3A 2VENA 4QQUA 2OEMA 2G3FA 2WHKA 3C86A 5GJMA 3E0FA 1F7BA 3IGHX 4K8EA 1PZ2A 3W2KA 2PD5A 3CIVA 1CI1A 1NFPA 3USBA 5AHNA 3E0VA 1Y65A 3IGSA 2QCMA 2ZE0A 3CQHA 4M5PA 1U5JA 2PC4A 2PTDA 2YA1A 1WDWA 4MIMA 4AD4A 2Y8UA 3UJSA 1Q85A 3THDA 2YA0A 4IXXA 2PBGA 1KFBA 2DZPA 2GYIA 3U0HA 4O18A 1RV8A 4LBRA 2CFFA 1OYCA 2J24A 3IIOA 4PEEA 2E09A 3WK3A 1I2PA 3AU2A 2VD8A 3V75A 3SFKA 2ABAA 3CV6A 4LYQA 2W27A 3UCCA 3AXXA 3C3UA 5FJRA 3OW1A 3C2FA 1KR0A 2ACQA 3K4AA 1DP0A 4UTJA 4Z2HA 2BXVA 3PZQA 3P2VA 1I2RA 4UTKA 1ME7A 4JN7A 4S3BA 2GSHA 4PB4A 2YB4A 5AC8A 1US0A 3WEMA 5L6UA 1MYRA 5HJXA 4A8LA 1YQ2A 1O1ZA 4HQVA 2JGYA 4LUSB 3LHYA 3UNDA 4HZ7A 4BA0A 3LI0A 4HA4A 4R7OA 4B4FA 1H63A 5I3FA 1YE4A 2CESA 3IACA 2A3LA 1V5XA 1GORA 4A21A 1TWSA 5I3JA 4AVNA 4HPNA 1EDQA 3U3HA 1IGSA 5BOEA 2QT3A 5DBTA 2Z29A 3URBA 1YYAA 2JFEX 4W85A 1Q7QA 1I2QA 4Q4PA 2O4QA 4ZZ9A 1Q13A 1L8PA 4IMDA 4ZB2A 2YIHA 1W9VA 3OU8A 3T08A 1T8XA 1VLWA 3SCNA 1MI3A 4AZHA 4HOZA 3GXNA 1E6ZA 3GC2A 1IZJA 3VGHA 4RKAA 1N8FA 3P60A 5EGRA 5CPSA 1LRNA 2UY5A 1PVNA 1LQ2A 1AD4A 1LQAA 2CLOA 2OYKA 4L80A 3O6YX 3FAXA 5U7SA 1F73A 1TJ2A 1FHUA 2IXVA 4KT2A 2Z26A 3ARWA 3N11A 1BG4A 4JFVA 1WPCA 1WQ5A 3W26A 5C0QA 2V68A 4OVXA 3N2MA 3R43A 4LUSA 4O19A 4YYCA 4U5KA 3QV9A 3FYOA 4ZFMA 3HGOA 4LANA 3BGJA 3NEVA 2IXUA 3HZ3A 4KETA 3ZVHB 3UZ5A 2Y70A 2PCEA 2JBMA 4FLQA 1HT6A 3MMUA 3GVQA 3KRBA 2NQ5A 5CPLA 3CTTA 3ME3A 3GKAA 1B3YA 4H7ZA 4IG2B 2VRJA 1VBGA 4NT0A 3WK0A 2O7QA 4B5SA 8RUCA 2HISA 2QYGA 3TLQA 2C71A 4AB4A 1RBOB 3STCA 1W3HA 3B0VC 4YVPA 4ERGA 1PX8A 3VIHA 1EJTC 1JZ2A 1BD0A 2WZIA 3AMKA 2E4TA 1NEYA 3ALGA 5CPNA 4GKTA 1LJYA 4CQBA 3D47A 3LS9A 1UP3A 3GIYA 1O68A 1LTDA 1X38A 4ZB0A 5JH2A 3V4BA 2FPVA 3P67A 1P6BA 3THUA 3I7RA 4F3HA 1KXTA 3IPWA 4KF1A 1MW2A 4N9DA 3AJ7A 1KCZA 1S38A 4M51A 1XD0A 4O1FA 1FBAA 3WDHA 4GXMA 5LIKX 5AC5A 4DX3A 5JVLA 3OQ8A 1QPNA 3RX2A 1ML1A 4M7SA 2QJIA 1IXQA 2DORA 3KCJA 2PGEA 3P84A 1XINA 1EJXC 3GNXA 4GWEA 5A8MA 4JQ4A 1LWJA 4IG2A 4U31A 4CQAA 1YPFA 4B9YA 2VCCA 1V7AA 5AVHA 4JHZA 2D2OA 4PB3A 3T4WA 3B9DA 3WUFA 1JZ4A 2ZX7A 4FI4A 1ZGDA 1HKMA 4LYKA 1EH9A 1IQ8A 3MHGA 3N29A 3WLIA 1ZP3A 4XO6A 5JUVA 4GCAA 4HPJA 2PRMA 4JFWA 2EPNA 4EP8C 3BC9A 1EA0A 1JULA 2VGBA 4PULA 3TIMA 4GYPA 4NRSA 2VX5A 3GNPA 1MFVA 3S47A 3T4CA 3TEVA 4FMVA 5H1WA 1XCXA 1QWGA 3MSGA 2NQLA 3STPA 1E1FA 2BS9A 2PDKA 3W86A 5ABFB 1U5HA 2JEPA 3VIIA 5DQPA 4UQ9A 4WX2A 2QJJA 1F07A 1D8CA 1Q2SA 2G4FA 1OINA 3EX4A 3PBYA 4DUXA 4KCVA 1BXCA 1E56A 3M64A 5H8UA 5DRCA 3R7MA 3A3WA 3OLEA 3UG3A 1XRFA 3GR8A 2I9UA 4S3KA 4OQVA 3M43A 3H24A 5A3HA 5BMWA 4C7GA 2CBIA 1K6WA 3IVSA 4QIUA 4LNYA 1FXQA 1XIGA 3R25A 5DMLA 3W88A 4QM1A 1D7KA 3CV2A 4C5ZA 2B0MA 3TA6A 3GIPA 3Q65A 2J6VA 1AVAA 3FFSA 3BANA 2PZ0A 1UJPA 4ZQMA 1IR1A 1KXVA 5TIMA 3ZFHA 2WVSA 1G67A 4MFEA 4Q33A 4C6JA 3CHVA 1Y7VA 4R3UA 4DJDC 4NRRA 2A6NA 1EJSC 4DIAA 1NFBA 1QBBA 2P5NA 1C8XA 5ABFA 4AIBA 3THAA 1SZRA 1K1DA 2QV4A 1QI4A 4K3ZA 4D6CA 3M0MA 1BYBA 2YW3A 3WQCA 4M82A 1JPMA 3TV8A 2QAFA 2QDGA 1VRDA 2PBOA 5CZSA 3RIKA 3WELA 2CZEA 3LPGA 3TN4A 3W82A 5ABEA 4UFLA 4E38A 1I1XA 1TELA 1R7OA 3TROA 1YKWA 2E25A 1J5SA 4Q8NA 3CB8A 5LIYX 3WF3A 3I3BA 3CV7A 2AL1A 3GVGA 2I7GA 4HNTA 2E9BA 4TUFA 2XVPA 3WNOA 3WEZA 4A3YA 3MSDA 1V6VA 1UCWA 4EPKA 1RAKA 1R9YA 3VI2A 1WBJA 4XD4A 3M5XA 2BWGA 4Z2KA 3L68A 3SBFA 4UCFA 4JFUA 2NQZA 4FXFA 1P6WA 3NGJA 4LRTA 5A6BA 3W7CA 4XZWA 2PDNA 3INPA 3QR1A 3OBAA 4MG4A 1PIIA 3XIMA 3QM3A 3S1GA 3UWYA 3QXBA 2PTYA 4HN8A 4MJMA 2OO6A 4NNAA 4O1AA 3R8HA 5D03A 1Q6GA 4XO7A 1Q6OA 1KM5A 3M0YA 3AOFA 2O0TA 1X1NA 4Q4KA 5FJOA 4FIQA 1PE1A 3LGEA 1GGOA 3AZSA 3VUPA 2PURA 4DBDA 3M0HA 1SVDA 5U4NA 3VNDA 1TJ0A 3WBYA 1TWZA 4YLWA 1VFSA 3OGVA 3NQ2A 3T8QA 5GNZA 4IICA 3I7QA 4QROA 2BVYA 2B7PA 4GYFA 4XKMA 4UB9A 4PYSA 5H2ZA 1X1OA 3B05A 4MLRA 1MDLA 3TYEA 3UYCA 3L67A 2OEJA 4O57A 3WN6A 2WYSA 3RPTA 4GO9A 2FTPA 1DXIA 4F0RA 3WD4A 3PNUA 3RLGA 3GUWA 4JIQA 6TIMA 4UTTA 2QIWA 4TIMA 1CWYA 1UUQA 1XH1A 2GUUA 4QJ1A 3LNMA 3DBNA 3E5PA 4KWUA 3WYZA 4ATDA 4C6EA 2J77A 1VF8A 1QI3A 2PDYA 3G1YA 5I5RA 2PDJA 3UWWA 2VFHA 3URNA 3H2EA 4K7YA 1F5ZA 3WK2A 1S2CA 3VGFA 3D3AA 3OO2A 4YCPA 3EX1A 3FEMA 4LVAA 2G50A 1PBGA 5CPOA 3W6MA 4HOWA 2X1UA 2E5CA 3H26A 8TIMA 2XH4A 4Q6JA 1U1UA 5KZ6A 4JD4A 3L66A 2HNEA 4Q7NA 1TRDA 2FHFA 3CL7A 3AO0A 3V3WA 4QP0A 3QMSA 3A6OA 3OP2A 2XHYA 5FJPA 3F4DA 1KRCC 3NNTA 2QAPA 3N12A 4DXVA 3Q4DA 3SDOA 4D6DA 1XBVA 4AWUA 2ALRA 4HD5A 3TWAA 1V3MA 4HA0A 4IL0A 1KRMA 1X97A 2PWHA 4C7DA 2OZTA 1CLVA 3ZT5A 1E40A 1NWSA 3RR4A 4CU8A 2V2DA 1XQKA 2R9RA 1QAPA 3C2VA 3DECA 1ZBVA 5AYYA 3DYOA 4MMWA 5I07A 2QPUA 2P1FA 2J9ZA 3EAUA 2BDQA 4S2BA 3UBPC 5JBFA 3R94A 1DWFM 2XUCA 3WQ4A 2WSRA 5A2AA 5A6BD 1VEOA 3IIVA 2XGIA 1MSSA 4HHMA 3BV4A 3N17A 1LOSA 4NZ1A 5FF4A 4WKHA 3SUSA 4IIBA 3NZGA 4QISA 2XH7A 3T9PA 4B15A 1XIIA 5D32A 1EC7A 3BICA 5GNYA 4JHOA 3BLLA 1LCOA 3ZR4A 3C2EA 1PDZA 4G2DA 1OZQA 1HQTA 2QEZA 2W62A 1KGWA 2OPJA 1E6RA 2D0FA 5RUBA 3PG8A 4MNKA 3BURA 2YDQA 3TTOA 4S1FA 2VL4A 5CC5A 1HO4A 3UWZA 4LS1A 3TU9A 3ANUA 2WZTA 4FA3A 1EJRC 1H7PA 2W0UA 3LDVA 3NQFA 5C9ZA 3TTEA 5D8WA 4FR6A 2JKAA 4UOQA 2E8YA 3UWQA 1ZUAX 1H1ZA 1E43A 3BJSA 3MMWA 1JDDA 4WCJA 5BXRA 4C5YA 3NJ3A 1TTJA 2XM2A 3IIPA 5BXTA 3AIEA 1GWJA 4JKLA 3RMJA 3R5EA 1JPHA 2PWUA 2QMJA 4FK9A 5D2TA 5B7YA 2YLLA 1PL9A 5TNVA 1ISXA 5REQA 1NDYA 4J3XA 4HNNA 1WKFA 4UWMA 1E70M 2PWGA 4JKKA 3SCRA 2XGZA 2NSXA 2QIIA 4AY7A 3MI6A 2QUUA 1E0UA 2POTA 1FCQA 3R89A 2WNWA 4AXNA 1CLXA 4FNUA 3NQVA 1GTHA 4S38A 5CBJA 3NA8A 1NY1A 3S5YA 1U33A 4GVFA 1WXZA 1XC6A 3CMFA 3OVGA 1BKSA 2XVNA 1W91A 2ZQ0A 3DKLA 1SMDA 4IMGA 2ESCA 1UZDA 2VEFA 3LCIA 3B8DA 5MKGA 2A7PA 2UWFA 3EKZA 3RXZA 1BKHA 3EKLA 1B2YA 2XFYA 1FVPA 4RZ5A 1WAWA 1GVQA 3THQA 3MSRA 1REQB 4R85A 1CTNA 1UZ1A 1ELSA 3M07A 4K68A 1X98A 6ENLA 2O92A 1VIZA 3MI3A 2Y1HA 4YWSA 1JQXA 3NXFA 4IPPA 1UWIA 4AXKA 1R3SA 5LIXX 1FHDA 3M1ZA 3S1XA 4GI4A 4V1XA 4BEUA 4GHRA 3BAJA 1CXLA 3M46A 3XINA 2FVKA 3W24A 2V3DA 1KC7A 3MS8A 1CIUA 2HSAA 3ID7A 3TXVA 2QZRA 2PGRA 1RJRA 5DBUA 4GFIA 1TREA 2Y89A 2RDWA 2NUWA 5E5CA 3GG8A 4JYEA 4EF8A 2ISVA 1OWQA 1CYGA 2ZX8A 3DFYA 2AAAA 3W1NA 3DC0A 4IGMA 1OY0A 5AZ0A 4AF0B 5HNNA 2GWNA 4JYDA 2QCGA 2XU2A 1FWCC 4FOJA 4MDOA 3U48A 4IT1A 1G4TA 5BU9A 4X2PA 5FI8A 1I2NA 3BGAA 1REQA 1K6AA 2NWRA 4KGLA 2GLKA 1VENA 3EA2A 1A53A 1PIFA 1OT2A 3DYMA 2ZVRA 3A5FA 4K1GA 3MA8A 4PMQA 4MJZA 2DZSA 2WWCA 3AWOA 3IARA 1NARA 3WNKA 4IISA 2PDCA 5IBXC 4R7JA 3FVDA 4GYJA 2WZEA 1J9YA 1OCJA 4OBSA 4J3ZA 1MO0A 4Z08A 1EF2A 4LEQA 1F6YA 5H8PA 4CVUA 3UVIA 2NT1A 4DJFC 4BS0A 2ON3A 2IKHA 1Q7MA 3ONCA 2Z1XA 3RLHA 1FXPA 2BB0A 4DZHA 3ZJ7A 3OZPA 3LMYA 3PP7A 2OSWA 7ODCA 4G1KA 3BV7A 2XYLA 4GISA 3S9YA 1XG4A 3SURA 1SZFA 1A3HA 3VZZA 1F2JA 3UW6A 1EHAA 4FOUA 3VKDA 3NDZA 1WKDA 2V5KA 1JR1A 1JPIA 3G2GA 3VNYA 4N7QA 4ZQPA 3NPVA 2TAAA 1QNPA 2O56A 4FNQA 1VBUA 4O1CA 3WQEA 3ENLA 2HE8A 4TU1A 4H7CA 1QOPA 2XN0A 2V5BA 1MXSA 4DZIA 2P88A 3OJGA 1VIWA 4XBSA 4X9YA 1TWWA 4XZIA 5D30A 5CC3A 1KWKA 1XC4A 2X30A 3VK5A 1NDWA 2OYLA 2YXGA 2Z28A 5E0KA 1OGBA 5LGZA 2J8TA 1A50A 3PPHA 2C7FA 3FGCA 2Z1SA 3URAA 3VU2A 1FH7A 1FP9A 3F7JA 4XQ6A 4Z1DA 3CUXA 5C9XA 1P48A 3B0XA 1N55A 3KXQA 1C90A 3S9ZA 2X41A 3DFTA 3ARXA 1ITXA 4MM1A 2XIMA 1TQJA 1NWTA 3SUUA 3JR2A 4ZQRA 1EXBA 1UD4A 5K3VA 3VO0A 2ZDSA 5EB8A 1KLYA 1LL7A 3JW7A 1DWJM 4Q4QA 2NUYA 5AHIA 4D8AA 3NZ1A 4DO6A 1FKXA 3L4VA 1CGYA 1UA7A 5XINA 3GE7A 4O1EA 2CLHA 1KM4A 1ITQA 5HQEA 2PWFA 4PE8A 3TJLA 5DY2A 4S3AA 2HS8A 3IAPA 3S46A 1TIMA 4GH3A 1BPLB 4UQAA 3W2UA 4E0CA 4E4FA 4AIOA 5A6JA 4C1NA 3GDKA 1NF7A 1NOUA 3FX4A 4ZSUA 3R12A 2CC0A 3MV01 1XH0A 2AGKA 1ZRQA 3WF4A 4H01A 3WK1A 1E51A 1JGIA 3LSCA 4GXPA 3TR9A 1ZBCA 4IQDA 4YCOA 4E8CA 1NFGA 3E6EA 3TN3A 4KFPA 4Z17A 2WHLA 1AH0A 1XFBA 4ZE5A 4PEKA 5CZ0A 1YTEA 3DDMA 5DELA 1JCTA 1TZ9A 2QLYA 3KL3A 3PR2A 3W1TA 4RDZA 4NYYA 4XD5A 2R6OA 4LW7A 4LYPA 1MQQA 4PRRA 2Y0FA 3NL6A 4IMAA 2ZZ3A 4LCQA 1KD0A 4DJEC 1A0CA 3QRHA 3W01A 3GK0A 1QCWA 4AD5A 3QGAC 3CBWA 3G6MA 1HJUA 2ZXDA 5I3DA 4WDWA 5CPQA 3L4YA 4M6VA 2ZWYA 5LNUA 1PV8A 1G1YA 3AIRA 5BU6A 3L23A 1AMKA 2WBKA 4GZ7A 3L9CA 4I9TA 1B5TA 4XIAA 4XK2A 2Z27A 4LUJA 1F9CA 2CLFA 4BQ5A 2GK1A 1M3UA 1PZ3A 3KL0A 5DMNA 4ICNA 5EFDA 1J8VA 1R38A 3P6LA 4DAFA 4QG9A 1DV7A 4K37A 2RDUA 3UPMA 4X2RA 3W1AA 2HVMA 3BAWA 3SB0A 3DENA 1MEIA 5AYZA 3K30A 4GC3A 2V3EA 4BF9A 1UMLA 3RHGA 3KBWA 2BFGA 2J7DA 4GXWA 4MB4A 3HQOA 2GQAA 4IIEA 1FWWA 1C9DA 4E5TA 3MP3A 4AD2A 1XIFA 1AFSA 1TV4A 1O12A 1W2VA 4OE7A 1OADA 8A3HA 1OZMA 4AVFA 3P82A 1UG6A 4UTHA 4CNTA 2YYTA 4NJIA 1GOOA 5F2GA 2FH6A 1DTNA 4Z2GA 3F4CA 1GJWA 4XBJA 3N2OA 3WFAA 4AZ7A 4YJ5A 4GRSA 3ARSA 3CK5A 2PTXA 1N8WA 3LBCA 2D23A 4J3WA 1Z6KA 2CZDA 4XSLA 3VZXA 5DANA 3F1QA 5CJ5A 3KM8A 2RDTA 1KFLA 5K2ZA 3QW4B 1EIBA 4ERAA 4RW3A 1RY0A 2Y5SA 3H6OA 1H7RA 5IHRA 3P61A 1M6JA 2BXZA 4H04A 2PS2A 4JIEA 5CBBA 4LAZA 2UV8G 1EYWA 2DH2A 2W61A 1L6GA 2G3IA 3PF3A 4M6UA 4US5A 4KBXA 4NQ1A 3O0KA 1SW3A 1V8EA 1W5PA 4RUBA 2VURA 1QTWA 1DWAM 2H3DA 2BY2A 3VGBA 1XCWA 1XD1A 1XL9A 5GJPA 3C2OA 3RRXA 3KHJA 2CEQA 1KRBC 2D24A 1B4EA 2DSWA 5BRQA 1JNDA 3A64A 1V3JA 3V36A 1XGEA 4UNLA 4IGSA 4MUPA 2A1YA 2PDIA 5F4XA 5JIPA 4CN6A 1PO9A 2WB5A 4W9TA 2D1ZA 4D71A 3RCYA 1NQ6A 2INZA 4UCGA 4E4UA 2NVAA 3LM3A 1NF0A 2J27A 4BKNA 3PPCA 5D2XA 3GKFA 4CNUA 3WLTA 5JIWA 4O28A 1LZOA 4TX6A 3GLCA 4I7WA 5E93A 3S5OA 4JTKA 3UVAA 2XFWA 5FJUA 5KZDA 3O05A 2PAJA 1TE6A 3RILA 2JIEA 4MPKA 3W07A 2V8ZA 2PU0A 3VDGA 2E6FA 3KOZA 4OT7A 3H21A 3PUGA 1ZFJA 2YFOA 1Z44A 4JTRA 2VDGA 5D09A 1PIGA