4LEFA

Crystal structure of phosphotriesterase homology protein from escherichia coli complexed with phosphate in active site
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphotriesterase homology protein
publication title Crystal structure of PHOSPHOTRIESTERASE HOMOLOGY PROTEIN FROM ESCHERICHIA COLI complexed with phosphate in active site
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lefA00
4RZBA 3CS2A 2R1MA 1RJQA 2OQLA 4F0LA 1YMYA 4C6PA 4LH8A 2Z00A 1K1DA 2YB1A 4C6FA 3EWDA 2UBPC 4H9VA 4G7EA 3HTWA 4ZSTA 4KESA 3FEQA 2BGNE 1S3TC 3D6NA 4RDWA 3S2MA 3SO7A 2ZC1A 4CEXC 2QT3A 3URAA 3PANA 4PCNA 2R1LA 2PUZA 1UIOA 4GXWA 5FSEC 2AQVA 3GU9A 1PTAA 3EGJA 4GK8A 4I6KA 4IFKA 2FVKA 1UMLA 3MPGA 3E0FA 4HK6A 1DPMA 4RDYA 4XAGA 4PCPA 3S2LA 1EF2A 4ERAA 4B92A 3K5XA 3ORWA 1RAKA 4DNMA 1VFLA 2Z27A 3URNA 3GRIA 4NP7A 4CQBA 4XD4A 4V1YA 2P50A 3GTFA 1M65A 1RA0A 2DVXA 2HBXA 3NURA 4CNSA 1GKRA 2YB4A 4PBEA 3GU1A 4OFCA 1PSCA 3URQA 4KF1A 4QS6A 1ADDA 1EZ2A 3GG7A 1YBQA 4R88A 3T8LA 2E1WA 4ICMA 2FFIA 3UR2A 2BB0A 3TN6A 3PNZA 3T1GA 3RN6A 3A3XA 4C5YA 4PE8A 4LFYA 4LCRA 1XGEA 1I0BA 1NFGA 3CJPA 4KEVA 3E74A 4NG3A 3EWCA 2ADAA 2CZVA 4C6DA 3MJMA 4H9XA 4DLFA 2Z29A 3E2VA 3MKVA 3OVGA 4H9MA 2A3LA 2Z26A 3IV8A 1M68A 3OJGA 4AC7C 2P53A 4H9TA 4LALA 2Z24A 2GWNA 3R0DA 4GC3A 4HK5A 2UZ9A 3IGHX 2I5GA 1ZZMA 2HPMA 4CNUA 1I0DA 2ICSA 2R1PA 1EJVC 1KRAC 1W1IE 3TNBA 4C6EA 3RHGA 3NEHA 2WJEA 2O4MA 3WZ0E 3B0XA 3G77A 3ICJA 3DC8A 2Z4GA 2PGRA 2YZ5A 3B0YA 1K6WA 3FDKA 2GSEA 1FWBC 3O7UA 2VHLA 1K70A 3N2CA 1FWIC 2XIOA 3ISIX 4DLMA 3LNPA 3LSCA 2PAJA 4NI8A 4IFRA 4H00A 3K4WA 4C65A 1JGMA 3ITCA 1V4YA 4KEUA 4DI8A 5FSDC 4RDVA 2OB3A 3MVTA 1GKPA 3LY0A 3A3WA 4C60A 4GX8A 1YNYA 4HJWA 4QRNA 3V7PA 4RE0A 1A4MA 3GU2A 4C6BA 4EPKA 3GIPA 2Z28A 5CH9A 4DO7A 4XAZA 1A5KC 3URBA 1RA5A 4P5UA 4DI9A 3UPMA 2GOKA 4C6CA 3AUOA 1POKA 3TN4A 4Z42C 3OQEA 2AMXA 4XD6A 4B3ZA 3FDGA 4BY3A 4LAKA 1ONXA 3LU2A 3GTIA 4XAYA 4B91A 4R7WA 4QROA 2DVUA 3A4JA 3PAOA 1NDWA 4PBFA 3E3HA 2VUNA 4F0RA 4ZSUA 4GOAA 3OOQA 2D2GA 4IH3A 3MSRA 3QY7A 1J6OA 4DZHA 4KEZA 1EJRC 4LANA 1FWEC 1ONWA 1QW7A 4XD3A 2HNHA 4IG2B 3F2BA 3NQBA 2R1NA 3HPAA 4RDZA 4J35A 1ITUA 4WGXA 1A5MC 3MTWA 4R85A 4GZ7A 5A6TC 2Z25A 1FWJC 3GTHA 2VM8A 4C6JA 4C6QA 2HBVA 3UBPC 1R9ZA 2HQAA 1KRMA 4J5NA 1EJXC 3S2NA 4DYKA 1A5NC 1R9XA 2EG8A 2DVTA 2FVMA 4IF2A 4JOMA 4C6OA 4MUPA 4LAMA 2VC7A 4AQLA 1EJWC 5LXXA 4WVXA 1FWHC 5HMEA 3F2CA 4KQNA 4C6IA 2KAUC 3IPWA 3IJ6A 1QXLA 1RK6A 4D8LA 2ANUA 4GY7A 1IE7C 1YRRA 2QVNA 4QS5A 1WXZA 4IQJA 2W9MA 3UF9A 3IARA 3F4CA 4WHBA 4H01A 1FWGC 3RYSA 5HMFA 2Z2BA 3TN5A 3MVIA 1XRTA 2WJFA 3C86A 3E38A 1FWAC 2WM1A 3UR5A 3QY6A 4KETA 1FWDC 3GIQA 4C6MA 4H9UA 2F6KA 3T81A 4C6LA 2G3FA 3DUGA 4IGNA 2VR2A 1RJRA 4J2MA 2YXOA 1V7AA 3TN3A 2D2JA 2FTYA 1R9YA 3AU2A 1FKXA 4ERIA 3AU6A 2Z7GA 3MDUA 3B40A 2EG6A 4HK7A 5AKQA 4G2DA 1E9ZB 1P6BA 1KRBC 1XRFA 3LGDA 4XD5A 3IRSA 2OGJA 4IFOA 1J6PA 4DIAA 1EJTC 2Z2AA 1PO9A 2Y1HA 3LSBA 4LAOA 4QSFA 3OODA 3OU8A 4BJHA 3F4DA 2GZXA 3O0FA 4EPDC 4C6NA 4ERGA 3S4TA 2OOFA 2E25A 4B90A 2IMRA 4IG2A 2HPIA 3F2DA 1XWYA 2AQOA 4G7EB 3S2JA 1M7JA 4YIWA 3PBMA 2EG7A 4CNTA 4GBDA 2Q09A 1KCXA 2QS8A 1E9YB 4F0SA 2PGFA 4GY0A 4HA0A 4C5ZA 3MDWA 4IFKB 1V51A 3KM8A 1RJPA 3LGGA 4UB9A 4I6VA 2RAGA 3CAKA 2FTWA 1WXYA 1PB0A 4H9YA 1A5LC 2I9UA 1FWCC 4EP8C 4BKNA 2O4QA 1KRCC 4GYFA 1EJUC 3GTXA 4CEUC 1EYWA 3DCPA 3IACA 4LEFA 1P6CA 5HMDA 1V77A 4XAFA 4L9XA 1A4LA 4DZIA 5E5CA 1V79A 4L6DA 1ITQA 3RCMA 2OODA 4QTGA 3E0LA 1RK5A 3BE7A 4EPEC 3HM7A 4CQCA 5G4HC 1O5RA 2R1KA 3LS9A 4IGMA 3WYZA 1NDVA 4GX9A 1J5SA 3SFWA 1J79A 1YBQB 1GKQA 3WMLA 4C6KA 3QGAC 2GWGA 4UBPC 4EPBC 3LA4A 3PNUA 1FKWA 3GUWA 4KIRA 3QGKC 2D2HA 2PLMA 1FWFC 3K2GA 4H9ZA 1UBPC 1P1MA 2QPXA 4V1XA 4CQDA 1O12A 1NDYA 1NDZA 1BF6A 4LCSA 2VC5A 2WJDA 1A5OC 3QY8A 3JZEA 1EJSC 4LCQA 4INFA 4M51A 2Q01A 4TQTA 1UIPA 1POJA 4E3TA 1YIXA 4KERA 4GY1A 3ID7A 1HZYA
chains in the Genus database with same CATH superfamily
3W2UA 5FEXA 1KW1A 1NF0A 3W86A 4WDWA 4M82A 3P3BA 1NAL1 3T4CA 1ISZA 2AOSA 3Q67A 1S2AA 4CEXC 4QE1A 3VD4A 5DY2A 1OYBA 4RNFA 3H12A 3R0KA 4LUTB 4LVFA 3WH6A 1NOFA 1E73M 3GW0A 3GW3A 4ZZ9A 4NIRA 1QATA 3E0FA 4PMOA 3MYPA 4W4QA 1JCJA 4OIFA 1E6XM 4ACYA 1AUSL 1VFLA 3UXIA 4MKVA 1DEDA 5FEPA 3FSUA 1AH0A 3E02A 1OF6A 1HFBA 5H1WA 1FWNA 1R87A 3S0CA 2VJXA 1W6TA 3B0UX 4BEUA 2ZICA 1WP6A 1LLZA 4O0ZA 4NRSA 2A7NA 5BXPA 1SMDA 3W1XA 5I77A 2C8NA 5CZJA 1DJXA 1CCWB 2X30A 3IK2A 1VKFA 2O9TA 3AYSA 5C2CA 3ARWA 3GG7A 5E1QA 4NZ4A 3SUTA 2VCAA 4NKCA 4RXFA 1BXBA 4FALA 3IJ7A 1IXQA 4O1AA 3VIPA 2VKZG 4Q4OA 3RN6A 3W81A 5BU9A 4IIHA 4LCRA 4NG3A 2POTA 3B04A 4GQ0A 1MEHA 1OFDA 2W62A 4CD7A 3H2EA 4HT3A 3MJMA 3DEQA 4RLIA 2DT1A 3SB0A 3MKVA 4HZMA 2VELA 1L0PA 3REQA 2BMBA 4GWEA 4FB7A 4H9TA 3L4ZA 4C1NB 3QYQA 5TQLA 3W82A 5DCDA 1QPOA 4Y9OA 1NU5A 2G41A 3W71A 5MF5A 1U83A 2E67A 4O4VA 3TOPA 1THFD 3WEZA 1C3FA 2ZWYA 2C79A 2YKKA 4WUIA 1A3WA 2ODOA 3NSMA 1K02A 1ZAIA 4Q7BA 3L5MA 3OG3A 4GYJA 4KWWA 2QJMA 1YADA 4S3AA 3SUUA 3BXWA 3NJ3A 3B8IA 4ZENA 2JGYA 1XW8A 1UROA 1M41A 3A3WA 3H54A 1B5TA 1TWSA 2QAFA 2VFDA 4WKHA 2A3EA 4JNZA 4ALDA 3SFKA 1K7FA 2Z28A 1W9VA 2IPJA 1O6IA 2OEMA 1BWVA 1IHIA 2IPWA 3VGEA 3KS6A 3AUOA 1GVIA 3QOMA 4QJ1A 2RGLA 4IT1A 4LAKA 3LG3A 2CZDA 3EOLA 4PL2A 5FJTA 4ADTA 4AEEA 4JTEA 2ZKMX 3SSJA 1PCWA 2W91A 2ZZ3A 2A3BA 2WSQA 3NYDA 5LNUA 3GYCA 1J6OA 3LM7A 3VVGA 5MHBA 3WQ4A 1EJRC 1QPNA 3O05A 1ONWA 3NQ8A 1L2UA 3ONBA 4Q8OA 4DUXA 5EMYA 5CBIA 3MTWA 3SSZA 4R85A 4DUWA 3RX4A 1J0HA 3R7MA 4X61A 3ANYA 3TMQA 3WQPA 1SSDA 2X0HA 1TIMA 2JEPA 2O9RA 3BGJA 3BTNA 2CHRA 4MUPA 3ANUA 1CNVA 1ZU8A 1RP8A 2DSZA 4PMYA 3IGXA 1JPDX 1XLAA 4C6IA 4AZ7A 3AIVA 3LX9A 1XFBA 1XCWA 4L7ZA 2P10A 3UZXA 1V3HA 3C2EA 3UEQA 1L2QA 1BGGA 1G67A 4CD5A 2W79A 1BVWA 2XH0A 1PVNA 3RLUA 3UR5A 1WDSA 1NWSA 1DJHA 5ABEA 3DGRA 1MWOA 1V6XA 3S42A 2GSJA 4CD8A 1K9TA 5CZKA 2D1ZA 3GH4A 1EXPA 3KVLA 1I2NA 3TA9A 2ISFA 1V6TA 3TC6A 2ZRUA 3VIJA 3SRHA 1R9YA 2OZ3A 1JR1A 2OYMA 2WKLA 1PAMA 5EFFA 1EC7A 4RNHA 4CNPA 1XIJA 4X60A 2A5HA 2CZEA 2ZOXA 3T0AA 5JU6A 1KRBC 4AVFA 1UUQA 1MDRA 5F2LA 2RDXA 4CNOA 4FSAA 4JFUA 3LMZA 4MB1A 3VGGA 2QPSA 4UCGA 3KVJA 1ZP3A 3SADA 2WPBA 4M81A 3LSBA 4K1WA 4IOTA 4CU8A 1GOMA 1Y65A 1Z9AA 3MI2A 1R46A 1VP5A 2QZRA 4ERGA 2IPGA 5AHIA 2DDXA 2NZLA 5CQ1A 2GUUA 2GOUA 1BTMA 2XIIA 1UB3A 3O06A 1XWYA 2AQOA 5FF7A 1M7JA 2QUUA 4YIWA 3TTSA 3TYBA 4L1XA 1KGWA 3SM0A 4GZEA 2INFA 3MSGA 5BXRA 3K4AA 1GZJA 1Z7AA 2DJLA 1ZY9A 4GY0A 1OHLA 4JIIX 4C5ZA 4KRZA 1XRVA 2ZVIA 2CIPA 2V5LA 5LZLA 3WD0A 1FQ0A 1NWRA 3NQFA 3I4EA 1E3XA 7A3HA 3P0WA 4WOQA 1YE6A 3SEPA 3U0HA 3CMGA 4CEUC 5C7VA 1VQTA 4P7NA 1U5HA 2XJ7A 2OKOA 3DCPA 3UP8A 3M7WA 4BI5A 2XGIA 1Q4NX 5E5CA 1HL9A 4JN6A 1O5QA 3WJWA 3ZR5A 2NX9A 4ECLA 3N2TA 5PTDA 2ISVA 2Z1SA 3CO4A 3PUGA 3NYZA 1LTDA 3VDCA 4PC8A 3HO8A 5I24A 5BU6A 3TIMA 3ZSSA 2VVSA 3GK0A 4EPBC 3D46A 3A6OA 4DF1A 3UXKA 2VEFA 4FHAA 2ATSA 1TV3A 3HQ1A 4H8UA 2GVLA 1VC4A 3B8UA 4CQ8A 1NDZA 4K7YA 1W1PA 3QY8A 2Q01A 2WOQA 3DENA 3G5EA 3ARRA 3GXNA 2OLHA 5KMYA 4R9OA 4B3KA 2OQLA 1W56A 1TA3A 3GDMA 1F4HA 4OT7A 3UGVA 3VNYA 1K8CA 3PUOA 1TWIA 1MZRA 1E9IA 1V0MA 2UBPC 5D9MA 1E1CB 4H9VA 3GVQA 4BA0A 2YZRA 2ZTKA 4QLJA 3N29A 3ITOA 2AQVA 4HGXA 1GEHA 1M04A 5LGZA 2QCDA 3WLRA 3MMUA 3CT2A 1CGXA 2ZUWA 4B92A 4CU6A 5CPQA 1VPQA 5EKYA 4Y9PA 1U1HA 1DORA 1UJPA 3FW6A 3P2VA 1AJ2A 2F6XA 3QTGA 1HQTA 3GG8A 3CV1A 3N9KA 1QTWA 1TMHA 5AB3A 5HOSA 1JUKA 3GZAA 1BQCA 5AN7A 3L2IA 3RF9A 4E2OA 3MUIA 4N9DA 2WHJA 4XG1A 2WVVA 1AL7A 3DYMA 1RY8A 1T8XA 4IQDA 3HV9A 3RDKA 4W87A 3UJRA 1Q85A 3ZJ8A 1A53A 1K8YA 1G7VA 5G1YA 2QULA 3NA8A 1AQMA 3M0MA 4AXKA 3F03K 3DGBA 3USBA 4PE8A 4A3UA 3E96A 3E74A 3EWCA 3WFAA 4N42A 4HYRA 4B9YA 4NILA 4H9MA 2FDSA 4LBSA 4L9YA 1S2WA 3R4IA 1E6SM 3OTRA 2OWXA 4AC7C 5A6AA 2VQTA 2GWNA 1G1YA 1ZZMA 3PBWA 3ES7A 1J5TA 2C71A 2BS9A 2ISSA 1B3ZA 1H7RA 1DXFA 1G6CA 3DC8A 3K8MA 3B0YA 2IKHA 4HJFA 4GKTA 2G96A 5FESA 1KXTA 1QU4A 3IVUA 2GK1B 1Y7VA 3QJAA 4H00A 4W93A 3PS7A 1GT8A 3NQDA 3WLOA 1F3TA 4BFAA 5F4XA 1O94A 4F48A 3MVTA 2F38A 1MW3A 4PBGA 4D71A 2ZRWA 1JGIA 3HPZA 4C6BA 1F4AA 3I3EA 4EPKA 2YW4A 5K2ZA 2DZAA 5BWFA 2GJLA 3WQEA 4DO7A 1JCNA 4P5UA 2VUYA 3TN4A 4UTLA 4I9TA 2WCAA 4D1JA 3W6MA 1UWRA 3TYCA 4D6HA 2BP1A 4GQQA 4ZFMA 3LXCA 2WHMA 3IUHA 2PA6A 4KKXA 4ZSUA 2YL5A 3NNTA 1TYGA 3LN3A 4DZHA 2VYOA 2Z0IA 3KVKA 4KRUA 1K77A 4M56A 1PV8A 1EZWA 1TZZA 4MWAE 3SRFA 3MSYA 4KCWA 3FJ4A 4PB5A 1F73A 4PTNA 4DBSA 1NQ6A 3BK0A 3BL3A 1XDJA 1E6RA 4H2CA 1A5NC 1JDAA 4NNAA 4P7RA 2FVMA 2YCIX 4AZ5A 3TROA 3U48A 3GC2A 4FMVA 2IS7A 2KAUC 3EB3A 3IPWA 3HMJG 3TYZA 1YRRA 3QLLA 5D05A 1OEPA 1QFEA 4J3SA 5HJXA 2NSOA 4YHGA 5A6JA 3GR7A 3KBVA 2QJHA 5M17A 1GYMA 3FHQA 1XUZA 5AHEA 5DX7A 3HIJA 1J9YA 2IW0A 1F6YA 3TU9A 4OOZA 4GI4A 4MJ2A 3LQGA 1UASA 2I5IA 1PDZA 2FTYA 1MUWA 3W7JA 2PU0A 2FHBA 4ZB5A 4ZE5A 4W7UA 5LA0A 3WBEA 3MDUA 3WJZA 1B9ZA 1XRFA 4CQAA 3GLCA 1H7OA 1ADSA 2EPOA 3UNDA 2OEJA 1BYAA 3LTPA 4PEEA 1GUVA 1T6MA 3ME3A 1EJTC 3TTYA 1MQPA 3WQOA 3T4WA 2Y8UA 3CQHA 3CO8A 1UD4A 4DZ5A 2Y61A 3GD6A 3UFYA 3LLXA 5FF0A 3WLKX 2OOFA 1FFRA 3USZA 3GAKA 4Q4QA 2HPIA 4JN8A 1MSSA 2DIJA 3UR7A 2C14A 2RKXA 3MZ2A 4F8XA 5BXSA 1VFUA 1C91A 4ACZB 2ZX6A 2PGFA 1W5NA 4ADUA 4JAWA 4HHHA 1Z42A 4FXRA 3M46A 5G4EA 2PMQA 1X6NA 4J3ZA 4H6KA 2PF0A 4GJJA 3B9NA 4UQEA 4S3DA 4WY0B 1TSIA 1TRDA 1EYWA 3HG5A 1A4LA 3RCMA 1LL6A 4XBSA 4TX9A 2NXIA 1DE5A 2OLSA 3WUFA 3UZYA 3G18A 4L4OA 1A5SA 3VD7A 5A5WA 4E3VA 4Q8QA 3G3DA 3QPEA 3V35A 1GKQA 3R0UA 1O68A 1IZCA 2J47A 3HZ3A 2EGZA 1UG6A 5C2XA 5CGMA 3EDDA 1DJNA 2D2HA 1FWFC 1YDYA 4YNGA 4LW7A 1UBPC 1KWGA 1PZ0A 1GVOA 5IHRA 1A5OC 1W54A 4K6AA 1R3YA 1ZAHA 3N3TA 3EXSA 2ESCA 2WNNA 3S2NA 3RCNA 4KFPA 3W1UA 5C55A 2YDRA 1PPIA 4AIBA 1UR1A 4CNNA 4LH8A 2I17A 2NQHA 1JZ4A 1H7NA 4GD0A 4D6JA 3D6NA 1PX8A 2TODA 3INPA 3MP5A 3N4FA 2QT3A 3G1AA 3TYUA 3B97A 2WLZA 3G1FA 3TAOA 1ZQ5A 4DEFA 3K1DA 3M0IA 3EGJA 3ERPA 3K8LA 2CETA 4HHPA 4LV9A 4IGHA 4V28A 3NR0A 1TVPA 2W4XA 3BICA 4KRTA 2VGGA 3OPSA 3MZNA 4NZ5A 1KM3A 1OK6A 2Y5SA 3SY8A 3ITXA 3SGZA 3MQTA 2P50A 2QXWA 3G2GA 4J28A 1TIWA 1KFJA 2AGKA 3RU8X 1KTCA 1RA0A 3F5KA 3WELA 3NURA 2HISA 5D37A 4A3RA 1R3RA 1WO2A 3LMYA 1KCZA 4I7VA 7REQB 3NPUA 4Y90A 5GJNA 4LNCA 4JIRA 3T8LA 2Y24A 1CX9A 4QQ3A 4C7DA 3UR2A 2OYLA 3CT7A 2CKSA 4IL2A 8CGTA 3R12A 1HO4A 1WB0A 3R8HA 5AC5A 3KTSA 4D2JA 2KZHA 3ZXWA 4W8AA 4DAIA 1P0DA 3WL0A 3EDFA 1JQXA 3AHXA 4HNUA 3AXXA 4MJZA 5D04C 2Y63A 4O1EA 4XKYA 4NZFA 2Z24A 3DAQA 3PG8A 3BLDA 3W53A 1Z41A 3CQJA 3NEHA 4O52A 2X1TA 1FH8A 3B0XA 3WBXA 3W74A 1OGGA 4O28A 2XFYA 5CLTA 1Q6LA 4AFYA 4RW5A 3BQ6A 3O7UA 4NZ1A 1K70A 1EO7A 3ZVIA 3D47A 4AUBA 3CU2A 3G1HA 1VFHA 3LGEA 2DQWA 4Y96A 5F2IA 3N18A 4KEUA 5HXMA 5EBAA 2NX1A 3BUVA 2WNZA 1NJJA 4CVUA 4NZJA 4DX3A 3VXGA 3WQCA 2Y88A 2HVOA 2G3MA 5LIYX 1L9WA 5MKGB 2BX7A 2PU1A 4MB5A 4AZBA 2HROA 4AEOA 3FKRA 2OQHA 1SFLA 3E2RA 1QI2A 4XD6A 5KETA 3VPLA 1XX1A 4IL0A 2A4AA 2DVUA 4I5UA 3KL0A 2C0HA 2OU4A 4HA1A 5CCZA 2ISDA 1W5PA 1YPXA 1DJYA 4GINA 3ZYZA 4QHRA 4WSJA 3S6DA 1VHCA 4GUFA 5CG7A 3BWWA 1XS2A 3G1SA 1EUNA 4QITA 4DRSA 1MUCA 1UWAA 2PDJA 2PWDA 3VDAA 3GWQA 5BRPA 4RV3A 3LRMA 4AC1X 1HXJA 2FGBA 1U33A 3NZQA 3CYJA 2VENA 5LIUX 3I65A 2VM8A 4C6QA 1LORA 1Q7ZA 3MHUA 1OG6A 3U7BA 3ZLFA 1XKYA 3DI1A 2DVTA 4B4HA 2YCEA 1EJWC 3IJ6A 5EGRA 2Y62A 3AXMA 1KTBA 2ANUA 3TSMA 3W1NA 2QVNA 2Z6JA 5DN1A 4I9AA 1WX0A 4XIAA 4RKAA 4H01A 5DFAA 1LYXA 4MFEA 2ACQA 4CCCA 2EEXA 3BG5A 3E38A 3VKKA 2E77A 1O5KA 1SMAA 1UBSA 1KKRA 2X7VA 3GIQA 5K9XA 4NNBA 1NARA 1ZALA 1EH9A 3LXAA 4J2MA 1FHUA 3O6AA 3B05A 5K3VA 4A2RA 4IP5A 3V36A 3WDRA 5C70A 1YNQA 3AU2A 3MBDA 2OX1A 3FFSA 3VOJA 1BKHA 1DWJM 1MXGA 2FZBA 1NELA 1TJRA 2ZUMA 4GRSA 4UTTC 3RLGA 1A80A 4DBWA 1X98A 2QPUA 2XN1A 1V0KA 1H60A 1ZGDA 1WAWA 4FLOA 1XXXA 4Z1BA 4L65A 3VTRA 1PO9A 2QDEA 4L80A 3OODA 3KDNA 1FDJA 2WMHA 2AMGA 1BYCA 4GYKA 3WIJA 4LWWA 3RITA 1HGYA 3WLTA 1CGTA 1PYMA 3GNNA 1UCWA 5H91A 4AG0A 4AEFA 1EA9C 1EC8A 5A8PA 1K8ZA 4URIA 3KX6A 4AIOA 8A3HA 1W9DM 3M0LA 2WC3A 4HA0A 4HHMA 4AY8A 1PKLA 4IFKB 1B2YA 1C8YA 2O4QA 4R5EA 1CYGA 1V79A 4XUGA 2PLJA 5I3GA 1ZCOA 2ZYFA 3ARQA 1CXLA 2PDFA 1B3XA 5EMJA 2GDQA 4AD1A 1ITCA 1F61A 4U3CA 3M0ZA 5A6BD 3SDOA 3BOLA 2O92A 3AWNA 5J04A 3JU2A 3VMOA 5F1VA 3WQWA 4IIBA 3IIZA 4K2SA 3TAKA 3W83A 2XFWA 1CGYA 3VMPA 1P1MA 2QPXA 3DYPA 4UMCA 1LJYA 5AHFA 5DBUA 1UOKA 1XM3A 3WMSA 3JZEA 1KGXA 3CB8A 3EZ4A 2J74A 3OW1A 3BW4A 2GJRA 1RUSA 2A3HA 4Q8MA 4Q8VA 1W1ZA 3VUSA 1V0LA 3K8KA 3ZSTA 1XSKA 2HRWA 2J6VA 2OFJA 1W3IA 3EWBX 4G7EA 3XIMA 3MHGA 6A3HA 2ATMA 3MUAA 1XLKA 1WKFA 1VPYA 1RQBA 1N55A 1OYAA 3CHVA 1OX5A 2CXGA 3G1RA 4O1BA 2VX4A 5D8ZA 3WJYA 3K5XA 1RAKA 2J9ZA 2VURA 1KV5A 1ALDA 4OHQA 4B5XA 2Y5EA 5E6YA 4O17A 4N9EA 1H5YA 1J4EA 1XLLA 4XQ6A 3VIHA 1PJ9A 3THDA 2F2HA 3SRKA 1SYTA 2PTWA 2OKTA 2QVHA 1GOOA 4W5UA 5HQEA 4DAFA 2D73A 1QBBA 1HJSA 4NJGA 2PRMA 1B54A 1E72M 4H19A 5D30A 2RDWA 1R2TA 3DX5A 3GDBA 1XG3A 3CAQA 1V7YA 1C7TA 3M6DA 3GC5A 4LB4A 2X42A 1ISYA 1XGEA 2YX0A 2REQA 2QR6A 3W76A 4JQAA 1HNYA 5M1TA 4FNRA 2PD5A 4EXQA 2ZA1A 4US5A 4UCFA 3M5ZA 3H2OA 3BLPX 4YLWA 4DWSA 3QR0A 2EXOA 3VKCA 3WQGA 3GNXA 2HZGA 2QHAA 2VFIA 4L4LA 1PTDA 2B7PA 3OBKA 2DH3A 5I3IA 2ZXAA 3V3WA 3GHSA 1W1A1 1NFPA 3QMRA 2FZ9A 4Z1AA 3WF2A 1PE1A 3CV2A 3WF1A 4NI8A 4IFRA 1W17A 1Q45A 3CQ0A 2B7OA 1C90A 2DGAA 3BAXA 4A2SA 2JKAA 1RH9A 6ENLA 1HF6A 3WDJA 1MFVA 4I8DA 4KFNA 1GKPA 3SJNA 3OG2A 4LPCA 4QRNA 4WLCA 1PYFA 4I9JA 4B4FA 1JRBA 2YSWA 4KW2A 1A4MA 4BI7A 2VFFA 2E5DA 1JUEA 1ZBWA 1Q6GA 4O8RA 3BLFA 3GIPA 4YMZA 4L56A 5BOEA 2ZZ4A 1BSIA 1TVNA 4JTJA 1POKA 4J9JA 3UWUA 5F2GA 5AC4A 4HZ7A 1OC7A 4ATDA 3R6IA 5E70A 4F0HA 2HWGA 2V30A 4XAYA 4O50A 1W2VA 3VM5A 1YPIA 4S1FA 3BGGA 4JL2A 2D2GA 4JN7A 1D2KA 3B8DA 4ZO9A 3SR7A 2Z2UA 1VPXA 4O1CA 3M5XA 3KHJA 4B5SA 2DZTA 4EAMA 5G1MA 5HPCA 1JF5A 4QBXA 4BF5A 3FSTA 4PODA 1RVKA 3ABSA 4PMUA 4U4MA 2EF9A 2UY4A 3H2CA 3EX3A 3TYDA 1J0IA 2VEIA 4MWAB 2QV4A 4AQLA 1HJUA 2VL4A 4WVXA 1EPVA 1R7OA 1JYNA 2WV8A 1FBAA 3QV6A 1JD9A 3CV7A 3ZS4A 4W89A 1VAHA 3UZ5A 3W1PA 1LWHA 1TB3A 1KQZA 1KR1A 4J3TA 1DWAM 5C71A 5ABFB 4AHPA 2OMAA 4WHBA 4YJ5A 4QAIA 3C86A 1V93A 1C8QA 1R38A 3N13A 2OZTA 3LNMA 3TFXA 2KX9A 4ROQA 3G0XA 1OFAA 4LXFA 1DQWA 5LIKX 3CMJA 5D09A 4FXFA 4QAWA 3QR3A 3SI9A 4IX0A 2P3EA 3CIWA 1G69A 4NJIA 3H4GA 3T2OA 3IRDA 1AQFA 5LXEA 1GHRA 3GFXA 1KXVA 4YVPA 2VD9A 2Z2AA 1XKJA 4NSBA 4LAOA 4HBKA 1L6WA 1UWIA 3HB9A 3RM4A 3WG6A 4ZQNA 3MUCA 4EPDC 1UA7A 3S4TA 1KWKA 3H24A 1EOKA 1XIMA 1R3WA 2A2IA 5C0QA 1RP9A 3L4YA 3P81A 3LBCA 3CC1A 4Q7IA 3DKJA 4GBDA 1P1XA 1RCOB 2Q09A 2YA0A 4MB4A 1CECA 4DELA 2G4JA 4S38A 2DSKA 5EA9A 5D02A 3A4XA 1IF2A 3MUZ1 4LEQA 3NZ1A 1E43A 1A5UA 5CGTA 4PYSA 3IUIA 5EMUA 1G4TA 1EJUC 1D3HA 1ZHAA 3IS4A 6TIMA 1B4KA 1BF2A 1UH3A 5DMYA 1YX1A 1EYEA 3H7RA 2WQDA 3W4RA 1GTEA 1WZKA 4A8RA 5A6MA 2EKCA 5A8OA 2OZ8A 3LS9A 4JFSA 1M01A 5GVJA 1EP1A 3GXPA 1TKKA 5CZTA 1FWTA 2NUWA 1SW0A 3Q65A 3WH5A 2CEQA 4QLKA 1PHWA 2ZUVA 4M6VA 1VGAA 1X38A 3MWCA 4Y9AA 1MEWA 1FHVA 3IJIA 1BRLA 5E0FA 4GISA 1AZ1A 3LXBA 1KM0A 3REQB 5IDZA 5TIMA 2LLEA 4GY1A 2YXXA 3AFBA 3STPA 4U2ZA 2ZCGA 4F9DA 4GNJA 1WOBA 4R27A 3WK1A 5A6KA 4HN8A 1TX2A 1KBKA 4Q32A 3P14A 1UR2A 2FTPA 2YW3A 3M7SA 4HNLA 4C6PA 2CHNA 5I6SA 1GONA 2GGHA 3PJUA 3DFPA 3VX0A 1JCYA 5AECA 1PDYA 3UU0A 2YOCA 3SW6A 4MNLA 1IXNA 1H5VA 5DT5A 3DC0A 3DKLA 4N4QA 1SR0A 3GNOA 4JTDA 4IPJA 3GU9A 2GLKA 3NGFA 2OSYA 1TZ7A 2CNCA 5CC6A 5D2WA 4GIAA 3LV6A 1DPMA 4E2VA 4XAGA 5HATA 1YTDA 2CBUA 4ERAA 3HU7A 4DNMA 4L64A 3F7JA 3W37A 2YYUA 5LNSA 1C9WA 3WH8A 3DZ1A 1AMKA 4CD4A 2PGWA 3TXVA 3OZYA 3NXLA 3CQIA 4ATWA 3KOFA 1XH0A 2V82A 4DBEA 2WLYA 2ACRA 3N6JA 1XJBA 3W7LA 2J24A 4G6CA 4CNSA 3L4TA 4NT0A 4K8EA 5FJPA 1XD0A 1XUUA 3OVRA 4P7LA 2FDMA 3PR2A 3VNKA 3ABQA 1VRXA 1WAUA 4X3ZA 4DXVA 2BVTA 4JTIA 1P0BA 4PTWA 2PZ0A 2NV9A 1A3XA 2CBJA 2A7RA 3GVVA 2IQDA 4BQ4A 2WSKA 1V03A 5HUPA 1KM1A 2O7SA 4UFIA 3OIHA 3SUSA 4JDBA 2CZFA 3OLIA 1F6PA 4LAZA 4DLFA 4UUIA 3R25A 1YHTA 3E2VA 5IDIA 4D6EA 3UW6A 3OJGA 1UWUA 3S5SA 4TO8A 2BXYA 2XYLA 2GJXA 1JCXA 2HPMA 2ICSA 4KIEA 2GK1A 1KRAC 1W1IE 5D2VA 3GH5A 4B5VA 4DJDA 5CZSA 3EDJA 1V08A 2X05A 4HSOA 2PDIA 4Z08A 1K6WA 1XG4A 2DEPA 3FDKA 1I2RA 4IPPA 1NF7A 4IIDA 4BR1A 3UCQA 5KTLA 2QCGA 4DLMA 3LENA 4KT2A 1DHKA 1Q13A 4UWMA 2E68A 3O07A 3LYEA 1ZAJA 3H21A 2YA1A 5JBDA 2FGLA 5DEZA 4Y8EA 2Z6IA 4RE0A 3SQLA 1ADOA 2V6AA 1RR2A 3ATYA 1JD7A 2XPKA 2W63A 1TJ0A 2VWSA 4UMBA 4DI9A 1VLWA 2GOKA 2J13A 1QMLA 1VZWA 2PRHA 3HPSA 4A3YA 1IEXA 5HWNA 2AMXA 3FDGA 4DJFC 5AHMA 3TJLA 8TIMA 2YCKX 3CHCA 4WDXA 1GGOA 3MKCA 3ITYA 1Q6FA 3O63A 4ZQCA 1X1OA 4QJ4B 2ZX7A 1FY6A 2R1NA 3AHTA 2UY3A 2VGFA 1Z69A 1CLVA 2NX3A 3BLKA 3R94A 4ORIA 5T91A 1S3HA 4Q4KA 2PTYA 1EUAA 1IEWA 3VFCA 1M53A 2HK0A 5A6TC 3P8JA 1P4CA 4LY4A 1H0GA 4DYEA 3NQEA 4MY8A 4GYPC 3BLLA 4OGZA 2XGZA 3VA8A 4AXNA 2V2HA 5FAJA 5FL1A 2VC7A 3Q37A 2QDDA 1QNVA 5T8GA 3A23A 1OX6A 1H50A 3RR1A 4WDUA 5LYRA 2P0OA 2WHKA 4FEZA 2HVNA 5CAHA 4AY7A 2WKGA 2BVYA 3F4CA 4LVDA 1ZBCA 3H53A 3S6TA 3R58A 1JZ8A 1N2VA 2WM1A 5KZMA 1XYAA 4AAJA 4KFOA 1NM9A 3EYPA 1EGZA 5CEWA 2VGIA 1EBHA 3T81A 2VR2A 3QMSA 2ZZ6A 1ECEA 1WYIA 3C2RA 3DFOA 4LUYA 2VNCA 3ZT6A 4MJMA 3H70A 2QDHA 3AO0A 1DHPA 2OZ0A 3TC7A 2EG6A 1S46A 2NQ5A 5C54A 1XLBA 1J6PA 5EL1A 1JAKA 1MUMA 2PDHA 2VFEA 4R3UA 1MDLA 2QIIA 3EKZA 3W25A 1CTNA 1TA3B 5BRBA 3EWUA 2TAAA 4JIQA 3A12A 1LT8A 2O0TA 1HKKA 1R30A 5A95A 2PURA 1UPMB 1XFCA 2MNRA 1M03A 1EXBA 3F4WA 4NYYA 2WMKA 1TPH1 1W3LA 3SGUA 5AFDA 5HPOA 1EL3A 2QUMA 2RAGA 4LYRA 3CAKA 2FTWA 4JXCA 4PTVA 2A21A 3RO6A 1AQ0A 3UZWA 2ZC8A 3COTA 4JEQA 3WD1A 1EP3A 1VBUA 2IKIA 2QGHA 4PSRA 1MI3A 3E2QA 3QQWA 3HMCA 3AC0A 3RJXA 4H41A 4OE7A 4QTGA 1DL3A 5FOOA 2ZZ2A 1V6VA 3FNDA 1V8EA 4S3CA 2XVNA 4JTGA 3HM7A 3PBYA 4JQ2A 1RBLA 2FHCA 4MY1A 1Q6RA 3THAA 3GIYA 2DZBA 3E0VA 4IGMA 2WVVB 1O1ZA 1NDVA 2XU2A 3VKBA 1CI1A 4U10A 4PZVA 3TX9A 1E4MM 1I4NA 1ZFJA 1VEPA 3AYRA 1Q6OA 3W7IA 3LRKA 2RJGA 3L23A 1E1FA 2ACUA 2WANA 1LRQA 4WJ8A 2DT2A 3WEOA 4E3TA 4IX2A 3ZFHA 9CGTA 1FH7A 3FA3A 1KV8A 3AIQA 2OO0A 3DDMA 4ZR8A 2CWNA 4ZMGA 4NL1A 2ONEA 4UNIA 4B3LA 3PZ9A 2NVAA 3I3DA 1R6WA 4RDWA 1RXOB 3L0KA 1CIUA 2PS2A 3B9EA 3URAA 3WJXA 2R1LA 4BZYA 1UD3A 3CK5A 3AUJA 2PDPA 1FDZA 1TR9A 1R86A 5E0KA 3W7DA 1FXPA 1A0DA 4UTMA 3LPGA 1PHQA 4LVBA 2Y85A 5CSRA 4UMAA 4F4RA 1S39A 1XSIA 1RALA 4N02A 4ZQMA 1TG7A 2NQ9A 4JHMA 8XIMA 1XPYA 3W27A 4W88A 4U31A 3P8IA 5RUBA 2ZRYA 4XIMA 2DFAA 4E0CA 2EPHA 2NW0A 2G95A 5E0CA 2Y8VA 3RFAA 2XDFA 4K8GA 1JPMA 2BY0A 1A5BA 4KF1A 1Q6DA 4S2BA 1S1RA 2E1WA 2WW5A 2HCVA 4CUCA 3THUA 5EY5A 3SURA 3T42A 3S2CA 5A2AA 3MANA 4W8BA 4XZIA 4WJXA 4DVOA 4C5YA 4FX8A 4MVAA 3CEPA 7CGTA 4ZO7A 2QJNA 3DECA 1X97A 2OX4A 4H8HA 3AMCA 1UC5A 3MO4A 4ZB2A 4FOKA 1GWJA 2FH6A 4DM1A 1W37A 3AICA 4HOZA 1YDOA 1ZPTA 3LD5A 4TV6A 3L4UA 4O4WA 3WZ0E 3R13A 2BY1A 1A5AA 1J2WA 1VF8A 3W7EA 1X39A 1OINA 4L4PA 5I06A 1FWIC 3SJ3A 4RUBA 3NQAA 3TC3A 3I68A 1WPCA 3R43A 4HCLA 3VU2A 1SO3A 1JGMA 4GYPA 1A3HA 1TWWA 1I8JA 2WSRA 2X40A 3RM8A 1XLHA 5M2FX 3GC4A 2ZUSA 4GIRA 4PCFA 3TR2A 2YDAA 3GU2A 1FUYA 2V5BA 3DHDA 2AAMA 1WV2A 3BANA 3S9IA 3H7VA 5HR6A 2A3CA 4C6CA 2BV9A 4GKLA 3CHEA 1ONXA 2ZX9A 1NQKA 2FB2A 3W00A 3WLQA 4YXGA 3PAJA 2BOFX 1ZS2A 2B81A 3A64A 1LDCA 3GHTA 4AD3A 1IYXA 3I3BA 4F0MA 4KEZA 1TPDA 5TBOA 1KFLA 4PEKA 3OEXA 1ONRA 3QBUA 2BY2A 3HPAA 4FLRA 5I0DA 2CLLA 2V3EA 1LG1A 4QJ5B 4WGXA 3O6CA 4HMCA 3VZYA 5CPNA 4MPQA 3R8GA 1CZ1A 1VBJA 4OUIA 1I1XA 3UESA 1F7BA 4DQWA 4LY8A 4KGJA 1DP0A 4IF2A 1O95A 2BSLA 3W88A 2PWHA 3CWNA 2QF8A 4AD4A 3S83A 3CL8A 1PTGA 3I7QA 3C0SA 2QAPA 3KOYA 3CPGA 5AHNA 1XRSA 1Z3NA 2BG5A 2X2GA 2OOGA 1RD6A 3TN5A 3KOWA 3NL5A 3WJSA 3MV01 4J3UA 1G0CA 1EHAA 4DO4A 1H41A 1CXIA 3SCPA 4UFHA 2XUCA 1XLDA 4IGNA 1SSGA 2Q6ZA 5IBXC 2YXOA 5C5YA 3O8AA 1DXIA 1L6FA 4QEHA 1Q8JA 3CGTA 5EFDA 2W66A 3BSGA 3GKAA 1GYLA 2EBNA 4Y2WA 2Y2WA 1QI5A 4M1BA 4M6QA 1Y5XA 5FJOA 3WQVA 3OVQA 2E28A 2Y1HA 3KL5A 1X1NA 1P0NA 4N4PA 4JZ5A 4CCZA 1BSLA 1WQ5A 4Y9NA 4XX6A 2GGEA 4YVXA 3APGA 4IG2A 1ZENA 4LYKA 5HINA 2FMOA 2NVDA 1SJBA 1REQB 2YFOA 3NL2A 1SJDA 2EPMX 2VFHA 4LF2A 5A69A 3U2CA 2P76A 3L2MA 3I4KA 2FZ8A 3U5YA 1W5MA 2ZX8A 3P0XA 1HGWA 3DFNA 4AYGA 1JZ2A 3TXZA 3UR8A 4XUYA 3T7VA 1G01A 5HWJA 1PX4A 2PTXA 1J93A 5TD4A 1EB3A 3VNLA 3V5OA 3GTXA 4REQA 3O9NA 2X2YA 1AVAA 3WEMA 1K9EA 1VJZA 2PC4A 4O10A 2CLMA 1MO0A 3IJ8A 3T44A 1GVEA 4AF0A 3U5UA 2GL5A 4S3EA 1F76A 1X8FA 3ARPA 2X7WA 3CLWA 1UWQA 4L5ZA 5A2CA 1VS1A 3W7HA 1IGSA 1G4EA 3WMBA 3B0VC 4UOQA 3LPFA 4JBRA 4UZSA 1KFCA 1HJQA 3QKZA 1QCWA 4X0VA 4Q8PA 3GXIA 4H9ZA 2BXVA 3GYEA 4NY2A 5LIWX 5C9UA 3VYLA 2RJHA 2X0YA 1TTIA 2IXVA 3C8FA 2CHOA 1U2YA 1VJIA 3RGTA 2J7DA 3BZJA 3TOYA 3F4NA 5D2TA 1V02A 2CFFA 1W31A 3SY5A 4B5UA 4H6QA 3WH9A 1HVQA 4IMFA 5JBFA 4A21A 4IUGA 4M6PA 2E8YA 2XIQA 4P7OA 3AXHA 3CZGA 1OJXA 1VD6A 2JIWA 3KRSA 3UNTA 3F5LA 1UKQA 1FCUA 3H6OA 1N8WA 1KNWA 5D33A 3TNOA 4KESA 3VAVA 2ALDA 3MCNA 4WIWA 1GVYA 2BOEX 4R33A 1KQYA 2VOTA 4PN2A 4AH7A 4J7RA 3EKLA 4NJHA 2CLPA 4MNKA 4EVZA 4PUJA 3VCNA 1UMLA 3VKAA 3A4AA 3MSDA 5I09A 2UY2A 3LZ3A 2H8XA 1BTCA 2A85A 4JIPA 5A1AA 2X1RA 3AIWA 4AX7A 3H2NA 3QYSA 2I56A 3FLUA 3H22A 3PUEA 3VD3A 4PL1A 4GVGA 4JTRA 1FHLA 4GMEA 1UYQA 5F1UA 2RDTA 3AIEA 1ZJHA 1SR9A 2PPGA 5A6SA 4PBEA 4WRHA 3W7PA 1DIEA 1XIIA 3LCXA 4MLJA 2WWDA 1SZFA 4BQ5A 3NUKA 2J8FA 4TVDA 3HN3A 4HP5A 4FLSA 3GDRA 4LFYA 1I0BA 5FJJA 1A0EA 1F2JA 1MXDA 1DBTA 3TZNA 5TF0A 5ABHA 1QHOA 3TP4A 2P3ZA 1B9BA 2QJIA 2WMIB 2Y70A 3VGHA 2HK1A 3O15A 3W6LA 1A50A 3NQ2A 3CTTA 4RJEA 1EJVC 4YCOA 4KPLA 6REQA 1JPKA 1KLYA 4U5KA 2XZ9A 3ICJA 4UTKA 4KH2A 2YZ5A 2OEKA 2JQXA 2ZQ0A 3NG3A 4M3PA 5EBUA 2XIOA 4NUWA 3N4EA 3M47A 5REQA 3M1ZA 1CT5A 1E5JA 3CBWA 3OZMA 1X7FA 2ZDSA 4M8UA 3SCUA 2WYSA 3AYVA 1KLZA 3UJ2A 1X8CA 2CLOA 4GUGA 4D72A 3WF0A 1GJPA 1OC6A 4O15A 3M16A 1JJKA 5HAOA 3W72A 3T2PA 3W85A 4F2UA 3HG4A 2CLFA 4O1DA 4JQ3A 1O5XA 2FZNA 1AJ0A 2VFGA 4S3KA 2RUSA 3WBWA 3HV8A 2NV2A 4W86A 1UUOA 2XM2A 3PZMA 1B3OA 3QRHA 1XIFA 1NDWA 2VCCA 3BV4A 2XWEA 2YLAA 4F0RA 2GQAA 3UVAA 1TV7A 2I7GA 1TPC1 4NI3A 3AZTA 2XSBA 2HXUA 2BVDA 4BEQA 2OSWA 2ZVRA 3D0CA 3O1NA 3I6EA 4LUJA 4DHGA 2CW6A 5DF0A 3P7YA 2X1SA 3N4AA 5GJPA 1YE4A 3DFQA 3R5EA 1JVNA 3VC5A 3VX1A 3F4VA 3KDOA 4PMJA 3ZM8A 2CLIA 3GS6A 3WMCA 1UR3M 3WUBA 2OGYA 3TW7A 3LTSA 2YCLA 3AJ7A 4EOUA 4E8CA 3GBDA 2QMKA 3T0TA 3W7RA 3POHA 1XH2A 1W5OA 5EMKA 3VOIA 5DMLA 2XGBA 3MVIA 3QSTA 3DH7A 1WKEA 2EO7A 1XRTA 2Y6ZA 1K03A 5G2WA 1NOUA 3AIUA 3DESA 3VIIA 2GUYA 4EAYA 3QY6A 1HL2A 4C6MA 1MNSA 3I6TA 3AHZA 1RJRA 3OZPA 4NXSA 1V7AA 1OIFA 1FKXA 3RO8A 1QI0A 3W1LA 1ESWA 1E3ZA 2JF7A 4UR8A 4UNKA 2CLHA 3KBWA 2HS8A 2BBFA 2VX7A 3QC3A 2VR4A 2WMFA 3NWRA 1KBIA 2BNJA 4JDYA 3PB0A 3CAVA 5HJYA 1XBZA 3W3OA 3T09A 3G0SA 1EEPA 1TTQA 3RLVA 4IIEA 2G3IA 5DXYA 1XISA 3KBJA 3CEUA 1UP2A 4G7EB 1TV4A 2W61A 4Z1YA 4CNTA 1B90A 1TQJA 2G3JA 2YIHA 3UWVA 2J79A 3WFLA 2CESA 4JCLA 2Y7GA 1XLFA 1QO5A 2F8QA 5SWUA 4FF7A 1XIEA 4H9YA 3V4BA 1O60A 3TQPA 3ZMRA 1N8IA 4OWGA 4UFKA 3TSBA 3UQNA 2ZDRA 3CL6A 3A3HA 4PMXA 1GOWA 1UWSA 1R3VA 3P80A 5JBEA 3VE9A 1M7OA 4IPNB 3BE7A 3WLJA 2L5HA 4EPEC 4A3QA 3W23A 1O5RA 1XQLA 1ZTVA 4BK9A 1FHDA 3OIXA 3OGVA 3SFWA 6XIAA 3QGAC 4HNVA 1GVFA 4DY1A 1I2QA 3KRZA 3WDQA 4B5NA 5I23A 1C9DA 2J9XA 3K2GA 3M9YA 2GGJA 2D0FA 2REQB 1UH4A 4XTIA 4XAPA 3OA5A 6PTDA 1GVQA 2W6RA 1EJSC 3ABXA 2H90A 2DUZA 2TMDA 2V0TA 4H1ZA 1OQFA 3QZEA 3A9IA 4DWSB 2QJGA 4UTWC 1T40A 3UPBA 3TTQA 3WQ6A 1H62A 5U4NA 4F0LA 1K9DA 1JXKA 3AYTA 3WDIA 1F8MA 4MAVA 1OCJA 3P82A 5I5RA 4C6FA 2IXUA 3EWDA 3M6YA 5BROA 4IUOA 4X9SA 1SPQA 3VOHA 5FF4A 1QW8A 5CXPA 4IJRA 1DXEA 2A1YA 4HOWA 3T0BA 3UJFA 1EQCA 5CC5A 4Y7EA 1TMLA 2CBVA 3H26A 1E1EA 5HA7A 1GW9A 4I6KA 2FVKA 1IGWA 4MHBA 3WSUA 4AMAA 1B30A 3GFZA 1SFTA 3BMXA 1VRDA 2OR2A 2Z27A 1HKMA 4BF9A 3LTYA 1LUCA 1MMFA 1EP2A 3G1VA 2VRQA 2XWDA 4GZIA 3QFWA 4GXPA 3UWWA 5I79A 4NAFA 2J8TA 3BJSA 3JZUA 2PP0A 3GU1A 4OFCA 1R85A 4IM4A 3LHYA 3N9SA 4ZO6A 5A2BA 1L6SA 4AZCA 4HD5A 3ARTA 3PNZA 2A3AA 3C4UA 3CV6A 5BZAA 7ODCA 4ZODA 4XBKA 1KM2A 4O0QA 2ADAA 4NU7A 3P5ZA 1GYNA 4C6DA 1QDSA 3RRAA 3EMZA 4FXSA 4MADA 2GPTA 1NP2A 2EJAA 5DCBA 1OIMA 5CLWA 1GG0A 2FLIA 3SCVA 9RUBA 5LIXX 1X96A 2AL2A 1US0A 4HYVA 2V38A 3OQ8A 1TREA 4LF1A 1G5AA 3G1DA 3OLEA 5AC6A 3PTMA 3G77A 2WM0A 3OB8A 1AW5A 1WOAA 2C1GA 1UHVA 4LX4A 3K13A 2O9PA 2VX6A 3WO8A 5AOUA 1PX3A 3ELFA 1RCQA 2IKGA 3PC0A 4N9BA 4I8YA 1QK2A 3BARA 1YXCA 4K37A 5TAOA 2XM1A 5K9DA 3WNKA 3BGAA 1JYVA 3NM1A 1FP8A 2PDXA 4GX8A 3V7PA 1NH6A 1LOQA 4N7QA 3EEZA 2OT0A 4UOJA 1EFZA 5JMUA 4D9PA 3AS1A 1NFBA 2FZDA 3PBVA 3MY9A 4D8ZA 1RA5A 3UPMA 3N04A 1SJCA 4ZBCA 4WD0A 1RQEA 4WR3A 2ZZ7A 3HOJA 5M3WA 3S47A 1GQLA 3G6MA 4HU8A 2YCJA 3BMWA 3QPYA 2EPNA 3TQ0A 4HMEA 2Y7EA 4J4KA 4EWND 4IIFA 1JZ6A 3KRBA 3BCJA 2G97A 3MSRA 1CXHA 4GNVA 3N2MA 1QNSA 4UQBA 1H61A 1XL9A 5F4WA 2VMFA 3Q4DA 1BVZA 2JBMA 2WBGA 4ZCWA 3U6WA 3FJLA 4RDZA 3EX6A 2EPKX 1VEMA 4R9XA 1UOZA 2D0GA 3IJDA 1A5MC 2GGIA 2QEZA 3GTHA 5ENLA 2J6XA 5DELA 3U4FA 3QLDA 4HTYA 1EJXC 4UQAA 3BLIA 1JEZA 1R9XA 1TRIA 4HHLA 3EBVA 5FL0A 4DNHA 4M29A 4JD4A 3W28A 1KCLA 2F84A 3EMCA 3LI1A 4DUVA 1FWHC 4FOUA 3QW4B 3TW6A 4D8LA 4CCEA 3ALFA 4QS5A 1WXZA 1D9EA 4J1OA 1PKMA 3TV8A 1SO6A 5J8LA 1DV7A 2HE5A 1UWTA 5L9FA 3UD6A 4M80A 1UD6A 3WDHA 2C13A 4ZFCA 3R8RA 2J7EA 2YGYA 2DZXA 4E8DA 3H4XA 3H4WA 2WCSA 1FWDC 2OELA 1V02E 4AHOA 2G3FA 4H7ZA 4W8LA 1HT6A 1NP0A 4IIGA 1UKOA 4U33A 3PJWA 3E5PA 3P84A 4G5DA 4LV4A 3ZWTA 1BRLB 1TUXA 3QXBA 4A05A 1OG0A 3O6YX 3AALA 3VNJA 3WLNA 4YCPA 1LBMA 2DT3A 2XN0A 3WUGA 3CZJA 2HNEA 2BTMA 4W84A 1R47A 3A9BA 1R7AA 1EWDA 2JFEX 5C9XA 3CIXA 3W87A 1R8LA 2QCFA 4DPPA 1ISXA 3C52A 5BOFA 1FDYA 4GJ1A 1U22A 1S2VA 1BAGA 2OWCA 2BXZA 4UTWA 3VOCA 3E9AA 5HMSA 4F66A 2ZWZA 1V51A 4OU1A 3IWPA 4BCEA 3SIMA 2D3LA 4XTDA 4ZO8A 1PB0A 1EBGA 4JTTA 3S1XA 3PZQA 1DJGA 4IHCA 3N6QA 1P6CA 4GA8A 2ZBTA 3OLDA 3A47A 1ITQA 2OJPA 2PEVA 2BGQA 3FEMA 3UY7A 3GH7A 2X1IA 4FLQA 1IWPA 2E40A 3C2VA 1UR8A 2PDMA 4W7WA 4CQCA 2ZRVA 3GR4A 3PZOA 2H9AA 1JDCA 1W91A 1WCGA 3GSMA 3S1GA 1U30A 3CPUA 3T8QA 1FRBA 3I6RA 3PHAA 5JVLA 3LCLA 3LA4A 3ZVHA 1IZKA 1E0TA 1C8XA 3SIZA 1TV2A 1SZGA 4HCDA 4FIQA 3RX2A 4FAMA 4ZL1A 2CERA 3ENLA 2E9BA 1ITXA 2PDLA 3EPNA 5I2UA 2BASA 4MY9A 1NDYA 1UZHA 3DFHA 8RUCA 3TCEA 4JTHA 4ILSA 1SO4A 4INFA 2GSHA 4EKJA 4LUIA 1QO2A 1AQHA 4FPSA 2BHZA 4ES4A 1WKYA 1Z32X 3CB3A 1JZ5A 4E4FA 4BQ3A 1RJQA 2DZPA 4O13A 3K1GA 2GJXB 2ON3A 1Y8BA 1QBAA 3SN1A 3WFZA 2YBUA 1AD4A 5BWAA 2XVKA 3GX9A 5E93A 1R2RA 4HTBA 2QW5A 1CB7B 2YB1A 2XISA 3L0NA 3R11A 5KEZA 4LUSB 1G94A 1W9UA 1S3TC 1J0KA 3ARZA 3L67A 1LT7A 2VR5A 1RY0A 2BDQA 1LQ2A 1UIOA 5FSEC 4MNMA 4V15A 4HK6A 1AD1A 3MP4A 4RX0A 2VDGA 3ORWA 1XC6A 3CYVA 1KM5A 4FS9A 3NTYA 4V1YA 4F3HA 2I9EA 1D8CA 3GTFA 4GI9A 1A0CA 4YS1A 4AWSA 3H55A 1KKOA 2W3ZA 3GY1A 1UKPA 1VENA 4BF7A 3RILA 1C93A 3NPVA 2W67A 4EIVA 2JIEA 1L8NA 2X1UA 1UKSA 2DUXA 1BXCA 3PP7A 3TQVA 3WY1A 4ZXLA 4GBUA 3TN6A 3MP3A 1PS9A 3ZR6A 2WVTA 4L1GA 3W38A 4RPPA 4QG8A 3RUBL 2R8WA 2E6FA 1V3LA 4V2XA 1KA9F 3IV3A 1E6ZA 4GVIA 1CW2A 4Y8FA 4KGLA 3N17A 1BGAA 3ZJ6A 1M7PA 4IJCA 1E55A 2FJKA 4GC3A 1EDQA 1K3UA 3CLMA 2UZ9A 2QDGA 4QEEA 4MZ8A 4CNUA 3AMLA 4MUZA 5BMWA 3H23A 1Q7MA 5EB8A 1W32A 2E5CA 1GORA 4WKAA 4HU3A 2DJXA 1YQ2A 3VIMA 3AS0A 2WO5A 3BV7A 2BGSA 2H8ZA 1X6UA 3T78A 2J9YA 2PODA 4MWAC 4PRTA 4TR9A 1HUVA 3LNPA 1Q6QA 4LB3A 5LA1A 3ITCA 1X6LA 3RJYA 4RDVA 4QDMA 3CUFA 4TU1A 5C8BB 2OLAA 3M64A 1E51A 1N7KA 2V8ZA 4Z17A 1F3XA 1VYSX 3TQKA 4D6GA 4Q8WA 3SRDA 3TH6A 2W27A 1LOLA 2IQTA 1OFOA 3DIPA 3RAOA 2VD8A 2VZSA 2AGTA 3NEVA 4YHEA 3ARXA 3E5BA 3OHIA 4BY3A 2P5NA 1X1ZA 1TUFA 3BLOA 6TAAA 2PRLA 4W5ZA 3CIVA 3IJQA 1I45A 1OZMA 4TX8A 3O16A 3OOQA 1XC4A 1KC7A 1G4PA 3P74A 2QMJA 1QOQA 3T05A 2ZIDA 2VZOA 1DYSA 3UWQA 3T0DA 4IPLA 2GFTA 3W1QA 1E4IA 2J7HA 2PDWA 2NLIA 1GQIA 3C0LA 4HU0A 3UJEA 3CAWA 1L6GA 1DTNA 1Z89A 1HX0A 2Z25A 3UGRA 1WKDA 2PDGA 2HBVA 4XV0A 4FA3A 2CWXA 4K1GA 2XFFA 1KRMA 4DYKA 1PUDA 6CGTA 4KWOA 4JTUA 1G4SA 5E9AA 1VR6A 1V3JA 1K6AA 3EDKA 3UG5A 3WQFA 3BAWA 2QNEA 3ZJKA 4DXXA 3P60A 1XPGA 5GNZA 2A0NA 3A5VA 2J8GA 1BWKA 3EOUA 3WF4A 2Q3RA 3U9IA 3BC9A 3CH9A 2YPIA 3LV5A 1W1B1 5AZ0A 4Q4SA 4UZUA 1VBGA 4XWUA 3VCRA 2OSXA 1IV8A 2I1OA 3VILA 4AHQA 1OFRA 3OBEA 4H3DA 1JFXA 2WZIA 4E38A 4JTCA 4K7VA 1CEOA 3B40A 4M6UA 2Z1BA 3OZOA 4DYJA 2ZE0A 2JE8A 1OD8A 3BW2A 2QCNA 2ZUTA 4FNSA 2C19A 5CC7A 3MW7A 5AC7A 1LLOA 4EE9A 1R0MA 3U8GA 1REQA 1J0JA 1OF8A 1JNDA 1YKWA 3OGRA 3AS2A 1W9BM 1W1YA 4B90A 1XGZA 4IPIA 5K7JA 1ENUA 3U3HA 4MF4A 3CH0A 2ZX5A 1S5VA 1DWHM 2PLKA 3HJZA 1XSJA 1KCXA 1VYRA 4PB3A 3RM9A 3NZPA 3CWHA 4JIEA 3AMDA 4J27A 4JNMA 3WLIA 3W9ZA 1RD5A 3W01A 4ZB0A 2W5FA 2EJ1A 1SVDA 3WQDA 1A5LC 4WF7A 2I9UA 5I07A 3GVGA 4G9PA 5CAKA 5FEWA 1W3NA 4GGBA 5FJUA 4C91A 1T96A 2PDNA 1Q4WA 2ZXBA 3VABA 4LRTA 4ML9A 1SM9A 2J66A 5G4HC 3AZSA 1G9HA 3PJTA 4TIMA 3MYOA 1KD0A 4HSNA 3WD3A 1MZHA 4N6FA 1NVMA 1W1TA 3A24A 4Q4MA 4J40A 4E4PA 2EQDA 4QFUA 5AZ1A 4I90A 1H7XA 4JFWA 3G24A 4H04A 4LRSA 2PLMA 2B7NA 4ORMA 5EPDA 3ZWSA 5KINA 5T9CE 1B3YA 4MYXA 2EKGA 1QOPA 2QIWA 1RCXB 3VZZA 3VDHA 4MYAA 4H6RA 4B5WA 5D38A 2GVYA 1E40A 3L21A 2DQXA 1GQKA 2VRKA 2D20A 2EHHA 3DI0A 4RZBA 3VGBA 1DIKA 2V63A 4GABA 5AY7A 1CXKA 1FWWA 4XVEA 4DBUA 1EGVA 4PUNA 1GTHA 4MSSA 4BI6A 3QMTA 5EMLA 2VI0A 1DWIM 3L7RA 3KAOA 2ZUUA 1BFNA 3UWZA 5H6HA 2ZXQA 4FK9A 1F5ZA 4ROPA 5DBTA 3VNMA 4GACA 3MPGA 2CKRA 2R82A 1I6NA 5XIMA 2PDKA 3VGFA 1U1JA 4OBRA 1QHZA 3CUZA 4TTGA 1Q65A 4GNKB 1RZMA 3P6LA 1YW1A 3OYZA 1OBAA 3RMJA 5XIAA 2XZ7A 2NWRA 1FXQA 1TPWA 1DJQA 3M0YA 4AYSA 3UWEA 5D4YA 4UFMA 1T99A 3RPMA 1TO3A 3MJYA 1TPUA 1VIZA 2J77A 4DN1A 1VFSA 4W9TA 3ABZA 1JCLA 1AA1B 2E09A 1H7PA 2QJJA 4AIUA 1ISWA 1YBQA 5DMMA 1YDVA 3KCLA 1SO5A 2FFIA 4LBUA 5JH2A 3MMWA 3WLPA 1LWJA 1AH3A 4XSMA 1J0ZA 2DZWA 2Z1XA 3ITTA 3VE7A 3VDGA 3T1GA 3E12A 2WMIA 3PN8A 3WLLA 4HPGA 4MIMA 1AL8A 2PDCA 5D8WA 2Z29A 1W3HA 5FEZA 1Q66A 4X22A 5I3JA 4IMAA 2P53A 3FK4A 5F7UA 5H2ZA 1F05A 3U2OA 1HVXA 4WCJA 3W6YA 4HOXA 4NNCA 2TRSA 5T26A 1L8PA 3EXTA 1Y5WA 2VTFA 5DY3A 4FX7A 4DWDA 1B3VA 1BWLA 2VHLA 3VI2A 1W0MA 3MS8A 1XBXA 1C92A 5HANA 2VXNA 2J7BA 1B4EA 4POCA 3SCWA 2ZZ5A 1W3KA 3ARVA 1B31A 4GH1A 3E0WA 2WPGA 3CM4A 3IANA 4IMCA 4IGSA 1JAEA 1ZCCA 2V5CA 3OHMB 5F2MA 1NY1A 4XAZA 2PP1A 4PUKA 4ML4A 1E4LA 4PMRA 3WBYA 2FH8A 4TUFA 3LU2A 3GTIA 3A4JA 2OO6A 4PBFA 1TZ9A 4RK8A 3KOXA 3IGSA 3OBAA 3QH2A 5ABGA 3WD2A 1ECQA 5BMXA 2WK2A 4G1NA 1H09A 3B3DA 2YL8A 4IG2B 3NQBA 1S5MA 2OWWA 4D8AA 2YLLA 4RE2A 1ZP4A 1OD0A 2VZVA 4ZTXA 4GZ7A 3NQCA 2NVCA 3SUVA 4PUUA 2F2KA 3TLQA 1XQKA 4FZIA 1XDLA 2HQAA 4JCMA 4J5NA 1D3GA 1XLCA 4RNJA 1UKTA 4QP0A 3F2CA 3W7CA 3W84A 2J88A 4REQB 1BYDA 1JXJA 2NSXA 5D9OA 4HPNA 1GEQA 3GAYA 3UF9A 4AF0B 3GXMA 2O9OA 4YTSA 3CNYA 3W29A 3G1YA 3FGCA 2Z1WA 4MLRA 2XH2A 1JI1A 3LCHA 4ZOEA 4X63A 1OFEA 1M6JA 5ABTA 4GHRA 1YYAA 2PCEA 1JCMP 2VRJA 1H7WA 3HURA 1NWUA 2E9LA 2ZRXA 1MYRA 3PZTA 4ASTA 4UTJA 5BCAA 5G1TA 1H11A 2AKMA 4UFLA 4I9MA 3U4AA 3IRSA 1J11A 4IFOA 5EU9A 3C2YA 2RDUA 4LVGA 1YTKA 2GJPA 4E5TA 7XIMA 2R6OA 3V0SA 4QDPA 3U57A 4DPQA 4HMDA 3JRKA 2NV1A 2I16A 1MFUA 4JY9A 4WJEA 1J18A 3BMVA 3PBMA 4E8GA 4FI4A 3W07A 4LVAA 3S9YA 1XIHA 4XO6A 3WLMA 1ZRQA 3NQ7A 1HJVA 4HIBA 1WE5A 1M5WA 2X0SA 1H1ZA 3B03A 5A8MA 2ZUNA 4W7VA 3AMKA 1RLCL 4S3GA 5G5IA 2Q8LA 3QV7A 4Q33A 1KRCC 4FOJA 4GYFA 4PH6A 3AJXA 1S2CA 4XK2A 4DF0A 4XAFA 4DZIA 2C16A 3OYXA 3KP1A 4DO6A 3NPXA 3A21A 4QDWA 3N73A 5ECVA 4W85A 2I57A 4XZHA 3N11A 5LA2A 4Q6JA 4C6KA 1UZ1A 4UBPC 4BS0A 5M03A 4I5RA 3PNUA 2PDYA 3GUWA 4KIRA 1XP3A 3C61A 3LBMA 5LSMA 4J3WA 4LT9A 1JDDA 3FKKA 3JVAA 4WKFA 1JF6A 4LCSA 1LCOA 1QHPA 1FX6A 2CLKA 2J7FA 3VK5A 2V68A 4CVWA 3SCNA 2OG9A 1XICA 3K4DA 2R1MA 1VBHA 3NOEA 2PE4A 3QTPA 5CJNA 1XDMA 3P62A 2WXDM 6REQB 3QVQA 4JTKA 1K1DA 1Q6CA 4OV4A 3W75A 3G22A 3VNIA 3HTWA 4P8VA 2BGNE 1LF1A 3KEHA 1OFBA 3BPWA 4PCNA 5REQB 5E6ZA 4PMDA 2WJZA 1TCDA 3CQKA 4MZYA 5BRQA 1KBJA 4MDOA 3LHVA 1EF2A 3F5JA 4NX5A 2PF8A 2B31A 4JPGA 4AZGA 2E1DA 1OY0A 1KCKA 4NP7A 3ZT7A 1MW0A 3NQGA 1H0IA 1IEVA 2H3DA 3PTDA 1ZLPA 3VMNA 1JRCA 3UA4A 4XVDA 2HXTA 4R34A 5FKYA 1W3TA 4HNOA 5HBFA 2DPEA 3ZJ7A 3LCGA 4Q7NA 4F40A 5IM51 4H83A 3EOOA 2VOMA 1CENA 4FXJA 1EZ2A 4GQBA 4UR9A 4UTTA 2C3ZA 5B7YA 3FA5A 3BCDA 3CJPA 4A29A 1H51A 3SN0A 1V3IA 2A3LA 1ONEA 1DE6A 1J01A 2FQIA 5AC8A 1CWYA 2H3BA 3RG6A 3TNBA 3L12A 3PSVA 2GVEA 3BVJA 4CCDA 4PUDA 1MRAA 2GSEA 3N34A 4KCTA 2YCLB 3TJIA 3FXYA 4HPJA 3ISIX 2NLYA 4BQ2A 2HE8A 3LSCA 2PAJA 3AWOA 2V3FA 3K4WA 3ZOAA 4C65A 2XSAA 4N9CA 4HPHA 4PMQA 3AMGA 3QHMA 4C60A 3W2JA 3TWBA 2YR1A 3TEVA 5D2YA 1KBLA 2J7CA 3ITLA 3BZGA 5HNRA 1TPB1 3OLGA 3R89A 4FNQA 2XTKA 4RE3A 4U5IA 4RCXA 1P0KA 4A4AA 3PAOA 2FHFA 5BXTA 4K39A 1OGSA 2VUNA 2ZRZA 3C5QA 3CUXA 4IMEA 5AYBA 3LOTA 5HJLA 4DJFD 1FWEC 2XINA 4AD2A 4D6FA 1XYLA 1Q63A 5CSYA 3F2BA 1VFTA 1NSJA 4KCUA 4PFHA 4WX2A 1EDTA 3WK3A 4MM1A 3BG9A 1ITUA 4Q8UA 2PWEA 3WNNA 3S5YA 3PPHA 1XCFA 2PD9A 4YTTA 3U2EA 1AFSA 5FACA 3B4UA 2RH9A 3UBPC 4RZ5A 1QPKA 3UG3A 3F1QA 4C6OA 1BD0A 1I60A 2ZA3A 4H7CA 3MWAA 1HP5A 4LC8A 1FCVA 1ICPA 3MBFA 1QXLA 1BKSA 3SCSA 4TMCA 1IE7C 3KE0A 3M0KA 2FIQA 3TLLA 1UMYA 3GXDA 3TSDA 1UP3A 2PWVA 3NO1A 4OJYA 1PWLA 4Q8NA 3M5VA 4ZA0A 3NDZA 1P7TB 3W02A 1AODA 1JG9A 5GJMA 3T55A 3UPWA 3TZFA 5LNWA 4C6LA 3PFRA 4PTDA 1XLJA 2V5DA 3SCOA 1FOBA 2YYTA 3H2MA 3NFUA 3MMTA 3UG4A 3GM8A 1H1NA 3MI6A 4WY0F 2XIMA 4HK7A 4JX6A 1ZUAX 4L61A 2F7FA 4O12A 2QGYA 8XIAA 1QRQA 1UZDA 4DIAA 4JY8A 4P8UA 3HGJA 4GFSA 1S5TA 4FO4A 4X9YA 1TVLA 3F4DA 1SW7A 3NDYA 5CBJA 1XR2A 4PGLA 2Q8ZA 3I7RA 2C18A 4C6NA 1C7SA 2RHGA 2IMRA 3KLLA 4F9JA 4XZLX 3FAWA 3YPIA 3UCDA 3ALGA 4OOUA 2QS8A 3PWIA 4A22A 3BCFA 4GXMA 3GHUA 4FNUA 3LHTA 5H8UA 3QZ6A 4QR6A 1OCNA 3L66A 4H8NA 4GCXA 1IXOA 2PTDA 3UYIA 3GXFA 4R7JA 3T2QA 4NRRA 3PWGA 1HO1A 5CSUA 1LUCB 3RCYA 3C8NA 4HSHA 1LM1A 3KTCA 3KZPA 3L65A 3WH7A 4NAFB 2PBOA 5HUOA 3ZLGA 4XO7A 4WSHA 3T9PA 1L6YA 3WYZA 5CZ0A 1J79A 5LGXA 1E0XA 1Z48A 1V3MA 3NQMA 4AZCB 1IEQA 1R3TA 1DQUA 4Y9MA 1WA3A 4RW3A 3VIOA 3O3RA 2WMJA 2PZNA 1QVBA 2OVLA 1WZMA 4HVXA 3KW3A 1DJIA 1YTEA 2VC5A 2A6LA 3STCA 1FWSA 1U5VA 1XLMA 2JEQA 1JNEA 5FJIA 3TYEA 3B4YA 4JICA 4TQTA 1BG9A 5C6MA 4LUSA 2AL2B 2VQUA 1ZL1A 5IHSA 3O0KA 1IT0A 4JYFA 4WXYA 1YMYA 5CPLA 1VH7A 1PXGA 3LCFA 3N1AA 3JW7A 5I7GA 2JGQA 5A6BA 1X7IA 2W92A 4JHOA 4ENLA 3S1WA 3LUTA 2V3GA 1RLDA 3SCRA 3P93A 4B15A 3OGSA 4GXWA 3QQ1A 4NAEA 1KB3A 7ENLA 4GK8A 5CPSA 5LNRA 2E6DA 4JFVA 4LSBA 1DJZA 2X16A 1B3WA 1T0OA 1M3UA 2ZFAA 4US5D 1TWDA 4PCTA 2INZA 1DIDA 4DWSD 1GOQA 2WZTA 3VCCA 1KM4A 4XD4A 2WZEA 4Q4RA 1BEUA 1WBJA 4GJIA 1M65A 3KLKA 3FXGA 2WCGA 1RPKA 3DG6A 3UETA 3UWYA 5G2HA 3GTNA 3URQA 4B9ZA 4QS6A 4JX4A 4R88A 1ZB5A 1HTIA 2A7PA 2BWGA 4ICMA 3ZIZA 3L4WA 1BPLB 2ASHA 2QV5A 3ZQ9A 1TV8A 1YDNA 4XISA 2V69A 3A3XA 1V6WA 3UZJA 1H2JA 4KEVA 1OFQA 4HKPA 3GO2A 2D22A 1Q8AA 2VEMA 2E7FA 2NT0A 4H9XA 2V5KA 1M1BA 2P8CA 1J0YA 3BAKA 2Z26A 4I7WA 4UC5A 3O2LA 3GXTA 2PDBA 4XZWA 4GIYA 2QUTA 3IGHX 4N2YA 4B2DD 4F79A 1JZ7A 1I0DA 3IAPA 4YYFA 2GQ8A 1OWQA 3WK0A 1J8VA 1MW1A 4E4UA 1UW9A 3GNPA 1J96A 1IWAA 4LBRA 1TJPA 4EWJA 1XGDA 3ABRA 4JHZA 1LBFA 4GQRA 5FSDC 3BJTA 2ZADA 4NQ1A 3LY0A 3NVDA 1YNYA 2DZUA 3QR1A 4MAZA 4S3JA 1VCFA 4GUJA 3W1MA 3W2NA 1CBGA 3TVAA 1W9XA 3MUXA 2BFGA 2B4GA 5CH9A 3V1PA 1A5KC 4OBTA 4PMNA 1PKYA 1C29A 4JYDA 1VCGA 5D32A 3I7SA 3NL3A 1QOXA 4LS1A 3M0HA 3N19B 3O6DA 2H6RA 3TCSA 1VIWA 1E0UA 3E3HA 4GFIA 4TTUA 4GOAA 3B8SA 2JKPA 3DU0A 3NAVA 1VCVA 2PGEA 4LC6A 2HNHA 2D69A 2R91A 3APTA 5I00A 2A79A 2IPFA 4PB4A 1JL8A 2YL9A 4Q22A 1FP9A 1QI4A 3C0JA 4PTXA 3NGJA 1KBBA 4O19A 3W7MA 1QASA 2XN2A 1Y5VA 3II1A 4K36A 4CLMA 4DB7A 4GUHA 4O18A 2E5BA 3T6CA 1MQRA 4ZTYA 3RXZA 3LB0A 3FJ6A 3HF3A 5F4SA 5HNNA 3GKFA 2WBKA 5DCEA 4LS0A 4OKDA 4ICNA 1NTHA 3ES8A 2O56A 3JR2A 4IQEA 4S3FA 3HQOA 5B80A 1KFKA 4IZGA 4EANA 3GHRA 4NX0A 2H9AB 3ZLHA 3QHNA 2VVNA 4RZ4A 3DOPA 4JQ1A 1JFHA 4MNJA 3FV9A 4Z2LA 3M41A 2F6KA 3DG3A 4OV9A 2E6AA 3ZVHB 2VP8A 3I10A 3EA2A 2HSAA 2PWUA 2OCZA 4UQDA 4JYEA 1P43A 1O1HA 4FF5A 1P6BA 2XSXA 1HIZA 3EX4A 1F6KA 3M0VA 1QWKA 4ZE4A 1SZNA 4M1RA 1MVYA 3EDEA 4BJHA 2XHYA 4H4IA 2GZXA 3VKJA 4AD0A 2Y5JA 1JIBA 1A5CA 1V5XA 4KS0A 1R3SA 4DWSC 4AVOA 2CC0A 3H2AA 3VIFA 3F2DA 3TJ4A 3QKEA 3L9CA 2EG7A 2VCBA 3SCQA 3VC6A 4F0SA 4YWSA 5K4ZA 3VO0A 3LEPA 4EXAA 5CPMA 4PFMA 4Y6GA 3SN4A 3KM8A 1W2PA 1DWFM 2EPLX 1BHGA 5E9XA 3N2OA 4P2VA 1EKOA 2FPYA 2WKJA 1EDGA 1HKJA 1FCBA 1GG1A 3M44A 2QUNA 4L9XA 4L6DA 1TR1A 2OODA 3UYCA 3PPGA 1EX1A 1OCQA 1FCQA 3NQ6A 3BSHA 2WSYA 2R1KA 2G3NA 3S1VA 1OK4A 4S23A 3IIPA 4PUWA 3EXRA 4PUMA 4QG9A 4QNWA 3UXLA 4YVVA 2VDIA 1M9HA 2J25A 3TA6A 3U7VA 3EPMA 1QNOA 4DJFA 4JTLA 4CQ9A 4GI6A 2C1HA 3NVTA 4JKLA 3BDKA 2PI6A 2YL6A 1MEIA 4LCQA 3PZUA 3W7NA 1PBGA 2FPTA 1SQ7A 2HV5A 3IUDA 2FPVA 2CLEA 4P61A 1UQZA 5D9PA 4RE4A 3DERA 4O11A 1KXQA 1GJWA 4A35A 3G3MA 3SZ8A 1EF3A 4NZ3A 4A8IA 1AG1O 3FEQA 3SO7A 3HQNA 2ZC1A 2BHYA 2OXNA 1EHNA 3NZGA 3EOEA 1CDGA 3PM6A 2C1IA 3WNMA 1TJ1A 2PBGA 1WDQA 3WQ5A 4QE4A 2C7FA 3PZNA 4MFDA 1GQJA 4PCPA 4YTRA 2CXEA 3WLSA 3W24A 1AZ2A 2FVLA 1VFFA 3HFYA 2OYKA 5HWMA 1JYWA 1Q5MA 2WHLA 1P0EA 1YPFA 4EK7A 4YTUA 1JQVA 4LU0A 2Y0FA 4GLEA 2SFPA 4A8NA 5CGQA 4DJDD 1QW9A 1QNRA 1LL4A 4M24A 1WXJA 2E9MA 2WB5A 4PUEA 3GNDA 4E2DA 3APYA 3MB9A 4XKMA 5I3FA 2J7GA 2PTZA 2ABBA 5I02A 3QM3A 2QQ6A 4DZAA 5H8PA 3PVFA 4Q3MA 4RL3A 2DY3A 2Z7KA 3GG1A 3PK7A 3V18A 3WD4A 3QW3A 1NFGA 4J2PA 2J27A 3SQMA 4JR5A 4C1LA 3OVGA 4GCAA 3UG8A 2WNWA 5KITA 3KL3A 4OECA 4GZJA 1C8VA 3VUPA 1P48A 4AW7A 5C2GA 2Y7FA 3SUWA 4K38A 3NM3A 3GG0A 1PKNA 1P5BA 1ZBVA 3UXDA 3SGGA 5CPTA 4C6EA 1D3CA 4UFJA 2WJEA 5DO8A 3QC0A 5GQBA 3V1HA 1IQ8A 2VGBA 3K30A 1OT2A 1KFBA 1GJUA 3GVRA 2YA2A 4KWUA 4RPQA 2DV0A 3L4VA 4LUTA 2MUCA 3W7QA 5BNKA 1N8FA 2G8ZA 4US6A 9XIAA 4ZVJA 3STGA 3ZZ1A 1QNPA 4XBJA 3LK6A 4HJWA 3JS3A 1Q7QA 2YDQA 2PCQA 2Q71A 2CITA 3QEZA 3PPFA 3STEA 3L4XA 3LCWA 1TV5A 1VJSA 5AYIA 1PIFA 2GDUA 5A8QA 3VM7A 2WZHA 4ZGYA 4LS2A 1HN1A 2CZ5A 2XG9A 3LQLA 4QROA 1I1WA 3E6EA 3DG7A 1M7XA 1E6NA 4DJED 5FF2A 1NEYA 4EF8A 3W22A 1XI3A 1MRQA 1WBHA 2XH7A 1XV8A 4OVXA 4LANA 4CN4A 5DRIA 1QW7A 5AVHA 5BW6A 4NHVA 3W7GA 3GFYA 3VD9A 4IXHA 2HVMA 3QPZA 4PSPA 4X2PA 3V5CA 4GVHA 1LZOA 3PJXA 2JK2A 1R9ZA 1IWBA 3CZKA 4C1NA 4O8AA 2PC8A 3SBFA 3PG9A 3S1UA 3LHZA 4FNPA 4X2RA 3KTXA 5LXXA 1EGMA 5A8NA 3DBPA 5HMEA 2OPJA 5HR7A 2V81A 3WNPA 3G0UA 3BOFA 3WCZA 4MGGA 3R10A 4MKNA 4UR7A 4KCVA 3V16A 3RYSA 1PL9A 3NSNA 5HULA 3LM3A 3EOSA 3D3AA 1ODUA 4K3ZA 3TONA 3TTEA 2GQ3A 1FH9A 5IOBA 3FOKA 2V5JA 1BG4A 1SJAA 3UJSA 2V2DA 2O55A 2ZTJA 3HG2A 2J78A 3QGVA 2FJUB 5FCZA 4ERIA 3AU6A 2Z7GA 4JGDA 2ZA2A 1WUEA 3C3NA 2Q02A 1E9ZB 3BAJA 1MQQA 4JIHA 4XD5A 1GZ1A 3WL1A 6XIMA 1TMQA 1Z6KA 1AK5A 4IMGA 9XIMA 2V67A 3TDFA 2R9RA 4PRRA 4QSFA 1CPUA 3OU8A 1K8XA 2FKPA 3QF0A 4B2DA 3O0FA 4HA3A 3DHFA 4JTAA 3KVMA 1I9CB 1XYZA 2V2CA 3GVWA 1KTNA 1VBRA 1FVPA 3HFTA 3M07A 4KBXA 4Z0SA 4PMVA 3TUUA 3FVMA 4DJDC 3TMLA 1KGUA 2ALRA 3A5FA 3HPXA 3E2SA 4FR6A 1AW2A 4G7FA 3RK8A 3FN9A 4U3AA 3S5ZA 2E4TA 4UB9A 3FJNA 4O16A 1IZJA 3KP0A 3WK2A 1OX4B 5LNVA 1FWRA 3FA4A 1E6PA 4GGHA 4EP8C 4S39A 3RIKA 1AJZA 4RV8A 2DUAA 4N6EA 4G8TA 2VT0A 3B8TA 4S3BA 2I5QA 4E6MA 2BOGX 3L0GA 4PR4A 3N14A 1IIHA 4J3XA 3BAYA 3WX7A 1HG3A 4YWIA 4CKQA 1J5SA 1YBQB 3CXOA 3W2MA 3P67A 3PTQA 1HKIA 5KZDA 3KFTA 3R2GA 1LP6A 4AU0A 4NZCA 1TFVA 1ELSA 1F07A 3ONCA 1W8SA 3H2FA 1IT8A 4HZ8A 3MKKA 5TNVA 3E1F1 4V1XA 3Q58A 3NCOA 3EKGA 3VOGA 1S2TA 2WJDA 3H7UA 4ZOBA 1TELA 2TSYA 5D2XA 1TE1A 1ZNNA 1YIXA 4KERA 4DBDA 5LKYA 3WNLA 1HZYA 1ICQA 3OA3A 4B16A 2ISWA 3BJFA 5GPRA 5CG0A 2ZXDA 3PPCA 2F6UA 3C2OA 4EX4A 5JIPA 4JNYA 2XVPA 4CD6A 3J7HA 4ZOCA 1I75A 4HYWA 1E4NA 3NPWA 3WF3A 5FA5A 3KXQA 2GYIA 3M43A 3S2MA 4L4MA 1TJ2A 2WVSA 1GZGA 2NWSA 1XD1A 1BYBA 4WQ6A 3HPFA 2PUZA 4GH3A 1CGVA 3DFTA 3MA8A 1JYXA 3G1XA 4DJEC 3CL7A 3CUJA 3V0UA 3DYOA 3M5YA 5D03A 3TR9A 4TOQA 4U28A 4IP4A 5DQPA 2RFGA 3PFMA 3LHUA 2ZE3A 1PIIA 1F8IA 2QUVA 1OSEA 5CC3A 4ZQRA 4NJJA 1DOSA 2NXGA 5FF3A 2HBXA 4QISA 1GKRA 3LZ5A 1XIDA 5IBXA 1BXNA 2DW7A 2RGMA 4V33A 4Z2KA 4JKMA 4YU1A 2VZUA 2G5WA 3EWWA 5I78A 1P6WA 3VINA 3IEBA 1LBLA 1OABA 4LGXA 1GOIA 2PP3A 2D2OA 1S5NA 3S3GA 3MHFA 1KM6A 3VFLA 2DU2A 1SZEA 1K4HA 3C56A 1UR0A 3IV8A 4GUIA 3FYOA 4JX5A 4LALA 3R0DA 1JCTA 4HK5A 4KEMA 1HKWA 3N2BA 2QCMA 1U5JA 2WSPA 4A3HA 3BG3A 2QKFA 4DUOA 1WDWA 1E1CA 4JEJA 1ML1A 1XIGA 4IISA 1OT1A 1HP4A 3PY2A 2Q3OA 4QJ3B 3N2CA 3PSWA 5KZEA 2UWFA 1GHSA 1LQ0A 2GJNA 3SY1A 3PUDA 4FX6M 3WLHA 3EWXA 3FGCB 2V9DA 2GUBA 3GQYA 1V4YA 3AIBA 4HZ6A 1E0WA 3VNDA 1Q3NA 1HJWA 1RSCA 4NF7A 1JZ3A 1GVRA 2HS6A 3RNDA 2PWFA 3WNOA 3QZAA 1VFOA 4F2TA 2OT1A 1UD8A 3MU7A 1ODZA 1IR2A 3URBA 1E9LA 3FX4A 3EX2A 3KOZA 4B3ZA 5JXQA 3CASA 1U1UA 4B91A 4R7WA 4TVUA 1PWMA 3STFA 5C9RA 1CGUA 3QV9A 2Y8KA 1K7EA 1TCMA 3KBSA 3EPOA 1UC4A 3VIKA 4IH3A 2FMNA 1DWGM 1PZ1A 4AISA 1Q6EA 1TE6A 5B7ZA 1TPFA 3RPDA 3N2XA 4CGTA 1PEZA 3GZ3A 4XD3A 2C0AA 1GOXA 4Q6XA 4AX6A 3BQ5A 1ME7A 4J35A 1B1YA 5CJ5A 3DN5A 4GIEA 2XH4A 3NXFA 3RX3A 5A94A 4C6JA 2BVWA 2QCHA 4XZMX 3FYPA 3EA3A 3WDPP 3TJXA 5FAGA 4JQ4A 3FYYA 2EG8A 4JOMA 5HQLA 1EOMA 3MMDA 3CUGA 4R7OA 1EC9A 1FTXA 1RV8A 3PZIA 1WNOA 4I7UA 1D7FA 1P7TA 1RBOB 3WUEA 1ZJBA 5AHLA 4IQJA 2IKJA 3UXAA 1D7KA 2VEKA 4ZOAA 1FWGC 5HMFA 2NUYA 3P5YA 3TTOA 3WENA 1LRTA 7TIMA 1JDEA 3L2LA 3AAMA 1DKWA 3VGDA 1TQXA 4KETA 1ZSXA 3LBOA 4H9UA 4LJ3A 4YL2A 3DUGA 3MUY1 1I2OA 4HA4A 1OZQA 3TN3A 2CPUA 1JPHA