4LEFA

Crystal structure of phosphotriesterase homology protein from escherichia coli complexed with phosphate in active site
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphotriesterase homology protein
publication title Crystal structure of PHOSPHOTRIESTERASE HOMOLOGY PROTEIN FROM ESCHERICHIA COLI complexed with phosphate in active site
rcsb
source organism Escherichia coli
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lefA00
4KERA 4H9TA 3C86A 4H9VA 2GOKA 2PAJA 1QXLA 2G3FA 2FTWA 3O0FA 1FWEC 1NFGA 4QTGA 3WMLA 4BY3A 3PNUA 4HK5A 4C6OA 1NDYA 1M68A 3V7PA 3IJ6A 4XAFA 4IQJA 2VC5A 1GKRA 3FDKA 4XAGA 1JGMA 4KETA 3T8LA 4IFOA 3IRSA 1UIOA 4KEVA 4AQLA 3K4WA 3HPAA 1IE7C 4ZSTA 1V79A 4R88A 1EJSC 2OOFA 1FWFC 1KRAC 4J2MA 1P6CA 4IF2A 4QROA 2Y1HA 4J5NA 1J5SA 2R1NA 3GTXA 4WGXA 4DZHA 2VHLA 3AUOA 4RE0A 4G2DA 2Q01A 4RDZA 4Z42C 1FWGC 1O5RA 4B90A 2Z00A 3MDWA 1POJA 1XRFA 2QPXA 1FKWA 4OFCA 2DVXA 3F2CA 3D6NA 4HK6A 2ADAA 4C6CA 1R9YA 2AQVA 1GKPA 2Z2AA 2D2HA 2D2GA 1A5NC 3GU1A 4GZ7A 5FSDC 4EPKA 3RCMA 1NDVA 1ZZMA 4R7WA 4CEUC 1ITQA 3E38A 1WXZA 3TN3A 1FWDC 3GTIA 5LXXA 1NDWA 4H9XA 2YB1A 4IGMA 2OGJA 3IPWA 2EG8A 3GUWA 1M7JA 1PSCA 4JOMA 3S2JA 4IGNA 3UR5A 1UIPA 2BGNE 3PBMA 4EPEC 4ZSUA 1S3TC 3LSCA 3RHGA 4CNSA 4NI8A 2I5GA 3E2VA 4UBPC 4QS5A 3S2LA 1EYWA 4I6KA 1ONWA 4H9MA 4EPBC 4CNTA 4R85A 4XD3A 4C6DA 4G7EB 2D2JA 2OB3A 4C6JA 1K1DA 1GKQA 1YRRA 2PLMA 4H9ZA 2P50A 5E5CA 4XAZA 1PTAA 2BB0A 4HJWA 5AKQA 1EZ2A 4LAOA 3B40A 3TNBA 1KCXA 2R1MA 3AU6A 1RK5A 3QGKC 2FTYA 3OOQA 1YNYA 4MUPA 1M65A 1EJTC 3EWCA 5HMDA 4XD4A 2Z25A 1PB0A 3UR2A 3PANA 3URNA 1ONXA 4L6DA 4G7EA 1V4YA 2P53A 3ID7A 4C6PA 3OODA 1KRCC 2HQAA 1DPMA 4C6QA 4HK7A 1UBPC 3DCPA 3OVGA 3LA4A 3MDUA 4C6IA 4H9UA 5CH9A 2FVKA 3QGAC 4C5YA 3F4DA 4TQTA 4RDWA 1RAKA 4H9YA 4UB9A 4DI8A 4DYKA 2Z24A 1O12A 4GX8A 4B3ZA 2WM1A 2HNHA 2ANUA 2PGRA 3TN6A 2Z26A 4ERIA 2R1KA 4C6KA 3LNPA 4XAYA 4KESA 3URAA 3WYZA 2I9UA 3E74A 4IH3A 1V77A 3MVIA 2Z2BA 3ICJA 3BE7A 3LY0A 1YIXA 4AC7C 4CQDA 1I0BA 3URQA 1P1MA 2PGFA 1A4MA 3FDGA 4V1XA 1J6PA 3GG7A 4H00A 4LCSA 1FWAC 3CJPA 4E3TA 2Z27A 1RA0A 2FVMA 3OQEA 1E9ZB 1K6WA 3SO7A 3R0DA 4F0RA 3N2CA 4ERAA 3IARA 2E1WA 3F4CA 3EWDA 2GSEA 4KF1A 3EGJA 3AU2A 1EJXC 1POKA 4DO7A 3ORWA 4GK8A 2FFIA 2WJEA 1XGEA 2DVUA 2VR2A 2ZC1A 4GY0A 2AQOA 1VFLA 4XD5A 2Z7GA 3F2DA 3TN5A 1YBQB 4GBDA 1J79A 5HMEA 4DZIA 3QY7A 3FEQA 2YZ5A 3LSBA 4LAMA 4QSFA 3B0YA 3UPMA 3OU8A 4C6LA 2Z29A 3IACA 3GU9A 5G4HC 4CQCA 1A5LC 4B92A 2VUNA 2HPMA 3S2MA 2UBPC 2WJFA 3T1GA 3NURA 3T81A 2VM8A 2A3LA 4GOAA 1FWCC 4CNUA 1A5MC 3PNZA 4PCNA 2R1LA 4EPDC 3LGGA 1EF2A 1YBQA 2XIOA 2QS8A 2QVNA 4CEXC 4YIWA 3GTHA 4V1YA 2GWGA 3GIPA 1A5KC 2Z28A 3MTWA 2PUZA 4LFYA 4DI9A 4KEZA 1YMYA 3UBPC 3K2GA 1FKXA 3MVTA 3DUGA 1KRMA 4D8LA 4M51A 1I0DA 3MKVA 3ITCA 3O7UA 3QY8A 2GWNA 3GIQA 3ISIX 4LANA 4KQNA 1RJQA 4QS6A 1RA5A 4BJHA 1FWHC 4LCQA 2IMRA 4GY7A 3WZ0E 4C6BA 4LH8A 4C5ZA 1K70A 3JZEA 5A6TC 3NQBA 3F2BA 1FWIC 1RK6A 4LCRA 3TN4A 2QT3A 4C6NA 3PAOA 1RJPA 1KRBC 4J35A 4KIRA 3A3WA 3HM7A 1BF6A 1EJUC 2GZXA 3LGDA 2O4MA 2YB4A 3MSRA 3OJGA 3RYSA 1EJVC 1W1IE 4GX9A 4XD6A 2DVTA 1J6OA 1WXYA 5FSEC 4H01A 2RAGA 4GXWA 1EJWC 1FWJC 4PE8A 3E0LA 1NDZA 1R9ZA 4KEUA 4DLFA 2ICSA 4LAKA 4C65A 1V7AA 4IFKB 4DIAA 3S4TA 2W9MA 4HA0A 4INFA 4C60A 4PBFA 1QW7A 1A5OC 2KAUC 2VC7A 3MPGA 1ADDA 2OODA 3HTWA 3KM8A 4IFRA 1E9YB 3B0XA 2OQLA 1EJRC 4WVXA 2F6KA 3GU2A 3A4JA 4NG3A 2YXOA 4GC3A 3DC8A 5HMFA 3QY6A 3CAKA 4I6VA 1UMLA 4GYFA 4ERGA 1HZYA 3GTFA 4IFKA 4C6MA 2EG7A 2HBVA 4PCPA 4RZBA 3K5XA 4P5UA 4RDVA 1PO9A 3E3HA 2AMXA 4RDYA 3UF9A 4BKNA 3SFWA 3G77A 2HBXA 1XRTA 1RJRA 3MJMA 4F0LA 2UZ9A 2WJDA 2HPIA 2EG6A 4IG2B 4PBEA 3S2NA 3NEHA 2Q09A 4B91A 1R9XA 1A4LA 3CS2A 3IV8A 4F0SA 3A3XA 4CQBA 4LALA 1XWYA 1FWBC 4L9XA 3LU2A 4C6EA 3GRIA 3RN6A 4ICMA 3E0FA 4LEFA 4DNMA 4WHBA 4QRNA 1P6BA 1ITUA 2E25A 4C6FA 4GY1A 4EP8C 2Z4GA 1V51A 4NP7A 3URBA 3IGHX 3LS9A 4DLMA 4IG2A 2R1PA 2CZVA 2O4QA
chains in the Genus database with same CATH superfamily
2WVVA 3UR8A 1EC7A 3OIHA 1GOMA 5G1YA 2NV9A 4GH3A 3U2CA 4ORMA 4PEKA 3LCFA 3PHAA 2YDSA 5TQLA 3WL0A 1QTWA 1VCVA 2FIQA 1F74A 1JDDA 1M68A 1RCXB 3V7PA 4HHMA 3N2BA 3W07A 4B2DD 4KCWA 4KWOA 1FDYA 4JYEA 4MJZA 5DEZA 2VVSA 4ICNA 2WKGA 2WVSA 4HNVA 4IZGA 3KW3A 1Q6EA 3T4WA 3I65A 1J0YA 2RDUA 1R3VA 4Q8PA 3W7PA 4QROA 3BO9A 1ENUA 1V6TA 3GTXA 2VHLA 3VNIA 3HPZA 2QJGA 3QZ6A 2BXZA 3S1GA 1BXNA 3UWVA 4RDZA 2YCEA 3OVQA 4XKYB 2QPSA 3SIMA 1GPWA 2DVXA 3B9AA 2IKIA 1G9HA 2AGTA 2BVDA 2NVDA 1YTEA 1CPUA 3ANYA 3PG9A 1U1HA 3GVWA 2UY3A 2JKPA 4HYVA 4KEMA 2BHYA 1MI3A 3BXWA 3GZ3A 3VKBA 2V63A 4DJFA 3RCMA 3QJAA 1TR1A 3PZIA 4HOWA 3RM8A 4D72A 3P84A 2XSBA 4AZCA 3QGVA 2HXUA 3UVAA 1NDWA 1VIWA 3EBVA 2DUAA 4CD4A 1QBAA 5B7YA 3RITA 3AHXA 4JOMA 1IXPA 1FH7A 2E6DA 2OLHA 2QGHA 3W72A 3HPXA 4UTTC 3WBEA 4FMVA 2VGBA 1W3HA 3KLKA 1ZBKA 3H2NA 1J0HA 4UBPC 3PBGA 5K9DA 4GC4A 3SRFA 1J11A 2OGYA 2ALDA 3LERA 4Z1AA 1WX0A 3UG8A 3SCPA 4HBKA 2D2JA 1SFJA 1RQBA 4KWWA 4HB7A 1K1DA 1D3CA 3WQVA 4IQEA 1R3YA 1TMLA 3NPWA 3VDAA 3TNBA 1J0JA 3H2FA 3SUUA 3SUWA 4JIQA 2J7EA 3UD6A 4FS9A 3WNMA 1OCQA 3C3UA 4MB1A 5EMYA 3HU7A 3IK4A 1T96A 5JIPA 5F4XA 5A6JA 5DBTA 1W9VA 2GVEA 5D2VA 3H21A 1CECA 3W2JA 4H8HA 3UGRA 2ZUWA 3OVPA 5BOFA 3OVGA 4WQ6A 4EWJA 4ZQRA 3HV8A 4NJIA 3F4DA 3CMJA 3IRDA 1UZ1A 4MSSA 2IPGA 1TVPA 4GHRA 5AB3A 4UTIA 1N82A 1L8PA 1GOWA 2QDDA 4M5PA 1QAPA 4J3TA 4FSAA 2YSWA 4ZTXA 4Y8FA 4AEEA 3BLKA 1Q6QA 4JTKA 3CL8A 4XAYA 1RSCA 1XJBA 1ZRQA 3G8RA 5HJYA 4HMNA 3M0XA 1QMLA 4TVDA 5CZ0A 3DN5A 3QV7A 5DY2A 4IHCA 4AC7C 5IDZA 1A4MA 5FEXA 1VPQA 1ITXA 1FWAC 5CPNA 4NUWA 4OBSA 3ZIZA 4YHGA 1PZ3A 4Q4OA 4CCZA 1B57A 3G1YA 4Q8VA 5C9UA 2YL6A 4N6FA 2O9RA 4RUBA 1ME7A 2E1WA 2Y7DA 3F4CA 3AS1A 1O68A 1HT6A 1Z7AA 1H7WA 1V6VA 1WUFA 4NX0A 2PRMA 3A47A 3R8HA 3W84A 3VGBA 5ECVA 1RV8A 4IL2A 4WZHA 4HSHA 2YJQA 4XD5A 3K46A 4QG8A 1I2PA 3IVUA 1TPB1 3P67A 4AEFA 3K4DA 4DJEC 3WCZA 4MYAA 3UPMA 3KOZA 3E02A 3TTYA 3WLJA 1WBHA 2BWGA 2R6OA 1UR4A 3GU9A 3SSJA 1NWRA 3P2VA 2OEJA 1GWJA 3LHYA 2AMGA 1H7OA 2PGEA 3OTRA 2Y61A 2Z7KA 3PK7A 2MANA 3SFKA 1XF0A 3DG6A 4DBWA 5C5YA 3TU9A 3NGJA 4MKVA 1XH1A 6ALDA 2DSZA 1F7BA 4ZODA 1XQKA 3VNZA 3OA3A 1J5TA 5HWNA 3L4UA 3QSTA 2PUZA 3KCLA 2AL2B 5DMLA 4MKNA 3S2CA 3DHUA 4U2YA 4YTTA 1RJQA 3KBMA 3A9IA 2ATSA 1W3NA 3MP5A 3AIQA 3NQBA 1FWIC 5JVLA 1BHGA 3B05A 2QPUA 5LKYA 1OGSA 3F5LA 1UUOA 2OZ8A 3WF1A 1EC8A 2D24A 4JX5A 4AVNA 4AXNA 1J2WA 1EBHA 3GNOA 3BC9A 3MHUA 1W9XA 3N3TA 1H63A 3AIRA 1V7AA 1THFD 1XDMA 2QLYA 3BTNA 3MJYA 5CPTA 3W74A 3VIHA 3B9EA 4ZB5A 3HPFA 1A5OC 2KAUC 5SWUA 3QPZA 3UGVA 3B9DA 2WZEA 3WFZA 3UXDA 4K6AA 3NZRA 3M43A 1US3A 2VEFA 3SQMA 5BXPA 2IW0A 2CC0A 3G1HA 5HMFA 1VD6A 3W38A 2YDAA 5A8MA 2GJNA 3VE9A 1UMLA 3WLQA 3P3BA 4EIVA 1ZALA 4ADTA 3BCJA 4C7GA 1DOSA 3KCOA 3EWBX 1YE4A 1JZ3A 3SR7A 1TV3A 5LYRA 4UOZA 4HT3A 1KFLA 3QH2A 1U33A 3MMDA 4XAPA 1QHZA 3AIUA 4HZ6A 1VBGA 3W70A 3GBEA 4Z1BA 1RBOB 2XIIA 3ITVA 4K8GA 4Z08A 2ZUSA 3NEHA 1W1ZA 1EX1A 3AFBA 4P8UA 1BYBA 3SCQA 3BL3A 5A6SA 4I8DA 3SQSA 1X1ZA 1H60A 1PWMA 1WDRA 4JIPA 3BSMA 1KLYA 2ZE3A 1QDSA 4WHBA 3USBA 3KUMA 3DESA 2WC4A 3KRUA 1OY0A 2LLEA 3DZ1A 1SZFA 4J3VA 1O94A 4TTGA 1BAGA 3AHTA 3W01A 5BOEA 2V38A 5K4XA 1T7LA 4O1EA 3NYDA 3FDKA 1GKRA 4XAGA 2A85A 2E9BA 5ABTA 4F4RA 2QF8A 3IRSA 2OZTA 3RR1A 1HX0A 1PX8A 1W37A 4PUJA 1TTJA 3VUSA 1VYRA 3N6JA 4G7FA 2OKOA 1PDZA 1TA3A 5A2AA 3CUFA 2WBKA 3TKFA 3THDA 2HJPA 1KFWA 3GG1A 2XH2A 2P8BA 3USZA 1OIMA 1CX9A 3BLDA 3GDKA 4O15A 1RPXA 1IEXA 4OFCA 3LHVA 3VXGA 1JFXA 1X6UA 3S1WA 2ON3A 2PA6A 3VGDA 5IOBA 2J75A 5HA7A 1ODZA 3Q37A 3M0YA 1W31A 3FV9A 3KVKA 1IEVA 1AZ2A 1LYXA 1WA3A 5A8PA 3AROA 5E09A 2J6VA 1I2QA 4AX7A 1EX5A 5A6KA 1FTXA 2AOSA 3GKFA 4LXFA 4Y7EA 1VKFA 1BG4A 3B8TA 4KFOA 4DPPA 8TIMA 4M6QA 4Q4MA 1TJPA 2VFGA 1W8GA 4G7EB 1AQHA 1DJGA 3LG3A 4YMZA 2G3NA 5CJNA 1SSGA 1MSSA 4LAOA 1LP6A 1QW9A 4B5SA 2MNRA 2V5KA 1LL7A 3W7NA 3EKGA 5LZLA 2A7RA 3VOGA 2G95A 3R0UA 4IMGA 3A4AA 4X60A 1CXIA 3GTNA 3URNA 5A8GA 2DUXA 4W85A 3OZOA 4DF0A 1U22A 1JUEA 1V3LA 5FAGA 3KZPA 1Q4WA 4MZ1A 2YLLA 4DM1A 4UTWA 4C6IA 4H9UA 5IRPA 4PH6A 1VB9A 3C5QA 3UCCA 3M0ZA 4YJ5A 4AEOA 4RE2A 4BHYA 4DI8A 2QMJA 1EKOA 1TMQA 3PJUA 4Q8MA 1V3JA 5CSUA 1O1HA 1YXDA 2CKSA 1BXBA 5DMNA 3BLIA 4Y96A 1O1ZA 1OC7A 4JQ4A 4I3GA 1QPQA 4OJYA 4DX3A 3QR3A 3QM3A 5CZKA 3V5FA 4ZBCA 3N2TA 2VQTA 1MRAA 3KHJA 2A7PA 4FOUA 4D6GA 3TQPA 3AMGA 1KD0A 1QO5A 3DG7A 4AWTA 2OO6A 4M7TA 1GVOA 3N2CA 3NWRA 5LXEA 4LAZA 5FJOA 4RZ6A 3N9RA 4CNNA 2W6RA 4XVEA 3EWWA 4JTJA 4LB4A 1H7XA 2P76A 4EOUA 2V5BA 2CWXA 3QV9A 3GHTA 3PPCA 4DBUA 4R33A 1UD4A 1YE6A 1A50A 2DSUA 3GDBA 1R38A 4NYYA 4HMEA 4AIUA 5AY7A 1I45A 3L67A 2HEJA 2ISWA 1RUSA 2QUTA 4A8RA 5A8QA 2ABAA 5HUPA 3ARPA 4LYQA 4EWND 1VCFA 2C18A 4UTHA 3MCOA 2VFHA 1SO6A 1Z69A 5AC7A 1AUSL 3PTMA 3MW7A 3P82A 3W1AA 3B9OA 2JF7A 2IUZA 3EAUA 3PNZA 1E9LA 2FZMA 2VC9A 3A5FA 1J18A 5ABFB 3TH6A 3SZ8A 4F0MA 1ZHAA 3ZOAA 2VKZG 4F2TA 1SFLA 1K8YA 2WMKA 4MF4A 3T09A 2BBFA 5CBIA 4ZB2A 4BJHA 3G1RA 4JCLA 4B5XA 2PCEA 1HXJA 5C71A 3EX3A 2VDIA 3BJSA 3AUJA 3HM7A 2BVTA 4CLMA 1EJUC 3MSRA 1RLDA 2EJAA 2XDFA 1W1IE 4XD6A 1P0BA 4Y6GA 1GHSA 1JNDA 1M7XA 4WD0A 3V1PA 1B2YA 3SIZA 2VX4A 5BYWA 4PMJA 1R5YA 4FNUA 1DJXA 5HANA 1DE6A 3MBDA 1E6XM 1QPKA 4AD1A 3OLIA 3IGUA 2XIQA 3PUOA 4E38A 4R34A 3KS6A 1DIOA 3FEMA 1NP0A 4K36A 3EXSA 3WG6A 3OLEA 3CMGA 1T8XA 3GU2A 6REQA 2HXTA 1XC6A 3II1A 3FIGA 1SM9A 3GC5A 1AQ0A 4M1BA 3IGXA 2EG7A 2HBVA 3RLGA 1AQMA 3T0BA 2WSRA 1A5CA 4H6EA 2A6NA 4HNUA 1GVSA 1PIIA 1J4EA 4OWGA 1VZWA 3OYXA 2PDHA 3P0WA 3EX4A 1Y7VA 4JGDA 2IPFA 1TSIA 2WJDA 9RUBA 3NTYA 1UKQA 3I3DA 1W3JA 1DHKA 2OELA 2GJPA 1H0GA 1O5XA 1V02A 4FAMA 2XFWA 1LG2A 1P43A 4MWAA 3O6AA 3MYOA 3M9YA 4D6EA 4DQWA 3L5AA 1PTDA 3N29A 3CPGA 1LLOA 2CLMA 2IQTA 2DZSA 3TJXA 1JI1A 2ZX9A 5D8WA 5D38A 3WD3A 4FNRA 1V7YA 3D47A 2ZRYA 3JS3A 1HP5A 4RPQA 4FXFA 4AF0A 4C6OA 4PTDA 5I3FA 1D7KA 1JGMA 1EIXA 4P8WA 3K1DA 5HDRA 3DEQA 2FH8A 2PFHA 1V79A 4DRSA 3MZNA 4MY1A 3WQGA 4IUGA 1ZU8A 1QI4A 1K03A 3MUY1 3MSDA 1AMKA 3TW6A 1C29A 3ZJ8A 5EMJA 1PHWA 3AUOA 3ABQA 2R82A 3WUEA 1DJIA 4JIRA 4ICCX 3T9PA 1EYEA 1YTDA 2DJXA 4K1WA 2XFYA 4NNCA 3W22A 2E40A 4U3CA 2YLAA 2FJKA 2HZGA 1ESWA 3FXGA 1EUAA 2E3ZA 3SCTA 2XWEA 3RLVA 2ONEA 1F6PA 2E9LA 4UUIA 2Y0FA 2XZ9A 3DOPA 1XYLA 5A6MA 1NDVA 3VPLA 2QKFA 3RUBL 2YBTA 1WXZA 3TN3A 1FWDC 1HTIA 1K02A 1I1WA 4MB5A 1CCWB 4NJHA 4YPJA 1CGXA 2YB1A 1M7JA 4YTUA 2P5NA 1RLCL 1IGSA 3LCLA 1E40A 3BANA 3IIVA 3IJDA 4AWEA 3N13A 2ACUA 1FHDA 3NA8A 3CAVA 5C54A 3MU7A 1KXVA 3GSMA 4CNOA 4TVUA 4ZXLA 2EPNA 4KGJA 3HJEA 3W2LA 1XW8A 4DF2A 5D8ZA 3HB9A 2GJXA 4H9ZA 1ZP4A 1M3UA 1EQPA 1CGTA 4N7QA 4Y2WA 1YPFA 2DIKA 2R8WA 2CBUA 3C4UA 1HGYA 1XBZA 5D33A 4ZFCA 2VT0A 5GVJA 1F6YA 4IQDA 3QTGA 1QNQA 3LX9A 1KWKA 4I9MA 1V4YA 2P53A 2RUSA 4WGHA 1UH2A 4DJDA 1OFAA 3WDJA 3NXLA 3RPTA 3K13A 3P8IA 4HZ7A 1FP9A 5BWAA 1CWYA 3TWAA 4B5NA 4FOJA 2X42A 2QCCA 1NOUA 2DUZA 4U10A 4GRSA 4B3ZA 3UESA 1UROA 4JN7A 3C52A 4RZ5A 4J1OA 1AH0A 4XZHA 3QKEA 1MEWA 2CHOA 1RD6A 3VCRA 1HFBA 3HGOA 3QEZA 1BKHA 4NXSA 2QIWA 2YPIA 4ZVJA 2EPOA 2CYGA 4QG9A 3WJSA 2CBIA 3UXKA 4XV0A 4GJIA 5CSYA 3OQ8A 2F61A 4NSBA 3WH5A 1L6SA 2AKZA 4L6OA 1M7PA 1HN1A 1X1OA 3FYYA 2KZHA 3PWIA 3ZO9A 3ZLHA 1K4GA 3WNOA 4EAMA 1EJXC 4B4FA 1POKA 1WYIA 3GYEA 1ECEA 3DFHA 2FFIA 3GKAA 3GW0A 1P7TB 2WWDA 4XZNX 4LVBA 2ZZ3A 3F2DA 4NX5A 3KOYA 3ABRA 3FKKA 3LSBA 3VMPA 1OX6A 2PDUA 4DJFD 2HV5A 1A5LC 1SZGA 2A3BA 4UIOA 2I17A 3S2MA 4QEHA 1DWJM 1IT8A 2VM8A 1A80A 2ZOXA 1SZRA 3PFRA 5F2LA 3ZT7A 5CSRA 1W54A 4EXAA 4BR1A 4V28A 3GIPA 5DX7A 3REQA 4GUFA 3CIVA 3W1RA 2XIJA 4W8AA 2ISFA 3AS0A 3BMWA 2R91A 2PI6A 1BYCA 3WMBA 1EUNA 1P4CA 2PSNA 2JK2A 1ZQ5A 2OSXA 2CLPA 1XSJA 5D9NA 5I3DA 3PAOA 3P14A 2B81A 4Z2KA 2V3DA 5FEZA 5HR7A 2GZXA 3MT1A 4UQEA 5HWJA 1GG1A 4KWVA 1MZHA 5C7VA 2Z1XA 5I7GA 3VA8A 1FWJC 3ITYA 3KRZA 3A6OA 2WHLA 3IJ7A 2REQB 3MUXA 1OYBA 2BVYA 2BODX 3AXKA 1E1CA 1VH7A 1UC5A 1JXJA 1E0VA 4FLOA 4AHQA 2WKJA 1LF1A 1XXXA 6TAAA 1RY8A 4PMXA 1IV8A 3T0DA 3EA2A 1MUCA 4HMCA 2WQDA 4KRTA 1Q6CA 3L7RA 1P0KA 4IT1A 1RCOB 4RV3A 4CVWA 1ISZA 4Y8EA 2NUWA 4N4QA 2E8YA 2TAAA 4RZ4A 2YR1A 2WCGA 1T99A 3EZ4A 2ZXAA 2YYTA 3H7UA 4L1GA 3S9IA 4FIQA 4LY4A 4RDYA 1Q66A 5K9CA 2C15A 3APTA 2XN1A 4LU0A 1B5TA 3U6WA 1RJRA 3PJTA 1BD0A 2FB2A 6CGTA 3R12A 4MIMA 5AYYA 4AWUA 5MKGB 1ZNNA 5KSWA 4W8BA 3BQ5A 4XSLA 2GGEA 4FNQA 3BOFA 4R9XA 1AMYA 4K68A 4ICMA 4IPNB 4AZBA 1MUMA 2UY5A 1MEHA 1TG7A 5D9OA 1V51A 1CB7B 3DYOA 2HCVA 5HOSA 4WXZA 3U4FA 2ZZ6A 3TTOA 2CIPA 3NVDA 4NI3A 1I8JA 4KIEA 3EOLA 3TQKA 1OCBA 3C0LA 3OZPA 1F4AA 1WUEA 3DFQA 4PTMA 3KVLA 1GNXA 1ONRA 3AISA 2CESA 3QFWA 1UA3A 1W1PA 3RG6A 4JL1A 4YTSA 3SGUA 3EOEA 1US0A 3FCPA 1KW1A 3L23A 1W5NA 4RE0A 3QPEA 2VUYA 3W27A 4Z2JA 3WO8A 3VD3A 1KM4A 2Z00A 2VFIA 4L9ZA 3EX2A 4X2RA 1GZJA 4HKPA 3LCHA 4KWSA 1WDSA 2V2HA 4HK6A 4YTQA 3CWOX 1UD8A 3EDFA 3HOJA 4MHBA 1P0DA 2D2HA 5G1MA 2DW7A 1SVDA 3NSXA 1XIEA 2OCZA 5JH2A 3W1XA 2YZRA 4K2SA 2DY3A 3GR7A 4WLCA 2JALA 5HK4A 5LHFA 1NQKA 4E2BA 1E3XA 3F7JA 5HATA 4IIBA 5AC8A 4HA3A 3S1UA 4HCDA 1PSCA 5CG7A 1VS1A 2PB1A 4MG4A 1E71M 1LM1A 4KCUA 4PR4A 3UG5A 2X0SA 2VDGA 5I3IA 4I6KA 3P7YA 4H9MA 2BP1A 2V9DA 3R5EA 4WSJA 3EB3A 4AD4A 4JTEA 3BSHA 2OEKA 3GDTA 5C7HA 3WL1A 4EE9A 1JCXA 3PUDA 4JPGA 1GW9A 4FA3A 3UJ2A 2PMQA 4DZAA 3A3HA 3KL5A 3RIKA 2G4JA 4JFVA 4S3GA 5JU6A 3W7IA 3QBUA 4Q33A 1HKVA 1F07A 1KXQA 4JQAA 2TRSA 3BICA 2I9EA 3E12A 2DZPA 3GG8A 3EOSA 3HQPA 2GDVA 4K3ZA 4DNHA 3AIWA 1U30A 3GO2A 3TR9A 3TW7A 3BH4A 4L1XA 1XPYA 2DT2A 3ZVIA 3COTA 3GH5A 1UR0A 3SJNA 4JNZA 1Y5VA 3IGSA 5I3HA 1E6ZA 1ZFJA 4WDTA 1MXGA 3ZVHA 4GX8A 2A1YA 1S2CA 4NZCA 3SY1A 4Q4QA 3GVVA 2F7FA 2ANUA 1UKTA 1IEIA 3NDZA 3LNPA 4W93A 3M1ZA 3I6EA 5G4EA 4GKLA 1U1JA 4QJ3B 5D9PA 1S38A 4JTUA 5FF7A 7TAAA 1V77A 2VENA 3NZPA 2GGIA 5A2BA 2IKGA 3URQA 4AYSA 3ZQ9A 1FCBA 1W1TA 3U48A 3NDOA 3D3FA 3WJZA 1SW3A 2OTDA 4Q8UA 1MDLA 2G3MA 1G01A 1WAWA 4UNLA 1WE5A 3N2MA 3SO7A 3PZQA 4WKFA 4E5TA 1F76A 4LVGA 3SAZA 1PWLA 7A3HA 2OX1A 4HU0A 3RO8A 5EMUA 2BY2A 3FXYA 4GY0A 4J2PA 4QLLA 4E2VA 2BS9A 4H7ZA 3R94A 3L9CA 1HP4A 2O9TA 2A6LA 1Q85A 3SN1A 2GK1B 2OSYA 1VEMA 1CB2A 1TJRA 5KETA 4LAMA 4WR3A 3SGGA 1UCWA 1GYMA 3BW2A 4M24A 1EDGA 3LBOA 4O53A 4QJ4B 2Q71A 2QYGA 1YPXA 3AQUA 4F3HA 4Q7BA 1JCYA 3QYQA 2V3GA 2VEMA 4AISA 3FJNA 3T81A 2PEVA 3UCQA 3O15A 2ODOA 4F9JA 4OECA 1FWCC 4DXVA 3NQAA 1NOWA 3BLLA 1CYGA 2DW6A 4JQ1A 1F8IA 3VFLA 3PUGA 2QQ6A 4Y9NA 2ISVA 4XBKA 1BFNA 3TLLA 4EVZA 4UC5A 3K2GA 4W84A 3TV8A 1TUXA 3NQGA 4Z0SA 5GJNA 3IJIA 2PWUA 3FAXA 5DXXA 5A6TC 1GOQA 1ZENA 1RJPA 4E6MA 5JQ9A 1KTCA 3WBXA 3THUA 2VP8A 1TELA 1VPYA 1D3HA 1U5HA 4HVXA 3WQWA 1Q5MA 5FSEC 1IXOA 2QIIA 1C90A 4GXWA 3LBMA 3TC7A 5H8PA 1JR1A 3G0UA 2V0TA 4UTMA 5FJIA 1V0NA 4WRHA 4FEZA 4PUWA 5AECA 4C65A 1KGWA 3S5NA 2I14A 3B3DA 4YYFA 4QLKA 5CC3A 4TIMA 4D1IA 4IP5A 4OU1A 3UPBA 3W2MA 2TYSA 3NPXA 3B0XA 1IXNA 4Q8TA 2YCLB 5CBBA 3VIJA 1PPIA 1TPC1 3KRBA 4QEEA 5EU9A 4BFAA 5L9FA 3H2AA 3VCNA 1LOLA 1TRIA 2JEQA 2FH6A 2X1TA 3QR0A 1JAKA 3TX9A 3FAWA 4QG6A 2XM1A 3BOXA 2POZA 1HJQA 2DDXA 2ZZ4A 1I75A 3UF9A 3SFWA 1FBAA 3ZR6A 1A3WA 3KOWA 4EAYA 1NFPA 3IK2A 3R0KA 1DVJA 2YOCA 4O8RA 3NR0A 5AHFA 5M1TA 2PZ0A 4YYCA 4WDWA 3LRMA 4KGLA 2PZNA 1JUKA 5CXPA 2Q09A 1R9XA 4Q22A 1NU5A 1H49A 1TX0A 4C1NB 1C3FA 3NAVA 4PL2A 1WKYA 4MJ2A 1NF0A 1GJPA 5EY5A 2WZMA 3AWOA 3S9ZA 1VCGA 4A21A 1G1YA 2PBOA 4OUEA 2GLKA 4CU6A 3L4YA 4F2BA 3DERA 3R8RA 4C6FA 3BLFA 3ZSTA 5BRPA 3M41A 3KAOA 4YVPA 3BGJA 2VEGA 3GBDA 4FPSA 1LDCA 1XGDA 4CQAA 7TIMA 7PTDA 2QCMA 4GD0A 1JZ6A 4GGHA 4XUGA 4E4FA 3QHOA 2QJNA 3KBJA 2OKTA 4L65A 3STPA 4JEQA 4O0KA 3S9YA 1DXEA 3RMEA 2GQ8A 4ZCWA 3P93A 2BGQA 5E9XA 2R1NA 4WGXA 1M5WA 4H19A 5BROA 1D2KA 3MV11 1V5XA 5E0FA 2UV8G 1POJA 1R3QA 1JCMP 5BXSA 1CT5A 1GVIA 2DZVA 1W6TA 1Q6DA 2VX6A 5E6YA 3WLMA 3A12A 3QOMA 3I7RA 3MHGA 3GNRA 5K7JA 2WMIB 2AAMA 4EPKA 2X1IA 2Q8ZA 5FF3A 2CERA 4MLRA 1XQLA 3GTIA 2D0HA 4FX7A 1SQ7A 1UWAA 4DBEA 5LXXA 1J96A 2X1SA 4NZ4A 1T8QA 5PTDA 4PMQA 2VI0A 4E4PA 5GQBA 3TP4A 3NCOA 3N4AA 3B9NA 3PBMA 4AZHA 1VRDA 4CNSA 5FACA 3STEA 4ZFMA 2GOUA 4UFKA 4PUKA 2ACQA 4R53A 1E51A 1MW1A 3S5OA 1Q7ZA 5TBOA 3QHNA 3WN6A 5DRIA 3H6OA 5E5CA 2GVGA 3NNTA 4IMAA 1HF6A 3ITXA 3CB3A 4S3EA 2WMJA 1B54A 2G37A 2D23A 3HG5A 3GNPA 5I07A 3EPOA 3MYPA 1KBBA 2XIMA 4GVIA 1EGMA 2VOTA 2D1ZA 1OEPA 4B2DA 3QR1A 1AK5A 3TYZA 3D0CA 1V3HA 2NSXA 3XISA 1KRCC 2E8ZA 3CUZA 4MWAD 2VJXA 3GLCA 4HU4A 1KR0A 1ZP3A 5CQ1A 2BG5A 4PMOA 4H3DA 1W32A 3NJ3A 4GUIA 2ALRA 4JX6A 3A64A 3T0AA 4FB7A 3RDKA 4OOZA 1KLZA 3V0UA 4OOUA 2QJHA 4UFIA 3H2EA 3T42A 1OT2A 3LN3A 4LUSA 3M7SA 2VFDA 2PWHA 3WSUA 2YA0A 1RBLA 4GUJA 3G3MA 4LX4A 2AQWA 3MVIA 5I3KA 4B9YA 1S46A 1GTHA 5D2WA 3BGGA 3O0KA 3M0HA 2H8XA 1H4PA 1RP8A 4PRTA 1MQPA 3S46A 5IBXA 4DEFA 3AMCA 4V2XA 2YBUA 1M53A 1MVYA 1K6WA 3DYMA 3OVRA 4ZB0A 2FYMA 1GYNA 1JYXA 2V3FA 2PPGA 5D02A 1N8IA 2DZUA 2J7CA 2PDIA 3ARUA 1YADA 4QQUA 3QV6A 4DO7A 1Q6LA 2XFRA 2WJEA 1SJAA 4YVVA 3PPFA 3P74A 3N17A 4L4MA 2CXEA 3W88A 4RXFA 3BUVA 3DFSA 1QOXA 2E67A 1LOQA 3QY7A 2ACSA 3JU2A 5GJMA 4A3UA 2Z29A 2WNQA 3OGRA 2DIEA 3G1FA 3T1GA 1UYQA 4ONVA 1GQJA 2BTMA 4E0CA 4LBRA 3LM7A 4RNIA 3XINA 4IIGA 2V5CA 1GG0A 4CEXC 1K8CA 3QMTA 1O4UA 3MTWA 2R94A 3JW7A 3BWWA 1TJ2A 3GD6A 1YMYA 5CJMA 4D8LA 4M51A 2HE5A 2H9AA 3QQ1A 1O5QA 4L5ZA 3CPUA 1W91A 2GWNA 1J0KA 3LDVA 4JYDA 3T40A 4A3RA 1WCGA 2WYSA 4PL1A 4H83A 5EKYA 4LCRA 4NILA 2QT3A 1KTNA 4CD8A 3ZZ1A 2EPKX 2J7GA 1ODUA 1Q7MA 2VYOA 3S5YA 1LROA 2NXIA 1K4HA 5BU6A 4UNKA 4WDXA 2V5LA 1JFHA 3QQ0A 4KEUA 2OG9A 1S5WA 3ME3A 2X8RA 2E4TA 3MO4A 1QWGA 2CU0A 2V68A 3T6CA 3OBAA 4S38A 5FCZA 3UJEA 4ML9A 2XVPA 4XSMA 5JUVA 3TXVA 2YL8A 4DXKA 2E5BA 4IM4A 4UTLA 4DY1A 4YLWA 2QNEA 3QY6A 5H6HA 1UR1A 3M0MA 3K30A 1HZYA 4YTRA 3ARTA 1TTQA 1E6NA 1CEOA 4X63A 1H62A 3MBFA 2YDRA 5I00A 1LUCA 1XYBA 1WZKA 1TV5A 1LL6A 1WDQA 1EWDA 3E3HA 2OWWA 3BAWA 1TWSA 2EPLX 1HVQA 2HE8A 3G22A 4Z2HA 1SJDA 4RXGA 5BMWA 3C8NA 3NQEA 3TCEA 1AQFA 1ISXA 1FRBA 5CZTA 5A5WA 4PBEA 3CS2A 5DXYA 2QCGA 4UOQA 2CBJA 2XTKA 3KP1A 2E77A 1TIMA 2BY1A 4L9XA 3VO0A 1RR2A 2BVWA 2QXWA 3CZEA 4NKCA 1IWBA 3E0FA 3SGZA 2YW3A 3W7KA 1ZPTA 4QRNA 3FSUA 1R3TA 4L80A 3FVDA 1K8ZA 2FDSA 1SFTA 1WKDA 2O4QA 1JNEA 2DPEA 3VOHA 2GOKA 2RGMA 1SYTA 5K3VA 1XRSA 3U2ZA 4XIAA 2NX3A 3NGFA 3WUBA 1C8VA 4JR5A 1NDYA 4IPLA 4JKMA 4AH7A 2J88A 1XIHA 4O1BA 1XCFA 4KETA 5DBUA 4AY1A 2HROA 4ZO9A 3NQFA 3R4IA 3FA5A 5FL1A 2DT1A 3ONBA 4D8ZA 1FWFC 1IR1A 2R9RA 3UP8A 3G0SA 3LXBA 2GJRA 3CEPA 2FB3A 4XBSA 2PWVA 1MMFA 3F5JA 2IPJA 4IIFA 4KRZA 4TOQA 3DAQA 4HP5A 4JTLA 4NU7A 5D2TA 2ZUVA 1V6UA 1UP0A 3HIJA 4S3JA 2X2YA 1KXHA 5FF0A 3D6NA 2NVCA 3U5UA 4Z2GA 1QNVA 3P80A 3SJ3A 4QE4A 4AVOA 4RW5A 1E6RA 2P0OA 3BLPX 5IDIA 2Z1SA 4D6CA 4CNPA 3C3NA 4ATWA 3VCCA 2X2GA 2ZA1A 3HMCA 1R3WA 2IS7A 1HQTA 3NO5A 1CXKA 3KE0A 3KWXA 2F8QA 2PDGA 2BGNE 4PC8A 2Z1BA 5CC7A 3GVRA 5AC4A 5DCDA 4NI8A 1JPIA 5DMMA 2RFGA 4JEJA 3S2LA 3VIGA 3P6LA 2QEZA 4JKLA 1DKWA 1HJVA 3LXAA 5KITA 4C6JA 3ZWSA 1TWIA 2PLMA 1XUZA 1UOZA 1AJ0A 4XAZA 1PTAA 1VEOA 2BB0A 2YKKA 3T78A 1OB0A 2ZZ2A 4AXKA 1AW1A 3TZNA 3QGKC 3EKLA 3NYZA 3ARYA 2XISA 5HQLA 2JF6A 3R58A 1IHIA 5I5RA 4I9AA 5D30A 3BV7A 2J47A 3ABXA 3LV6A 4Z1CA 2G3IA 4N0RA 4MJMA 4HNLA 2A2IA 2OT1A 3IIPA 3R8GA 2Y63A 5I0DA 1HJSA 1MW0A 2Q3RA 3ATYA 3G3DA 1GEQA 4FF7A 1RAKA 3VD9A 3UG3A 1PX3A 3VD7A 4XO7A 1OJXA 3GAKA 5AYIA 1XGZA 2YCJA 7ODCA 2R1KA 4WJXA 4MZYA 2VXNA 1KBLA 1VJZA 1SMDA 2VCBA 3YPIA 1CBGA 5AHEA 1UJQA 1A49A 2GQAA 1R85A 4REQB 1RBAA 3AC0A 1X7IA 2ZQ0A 1OFBA 4U5KA 3NQCA 4JIEA 3VNDA 4DUVA 5C0QA 2HK0A 1YXCA 2E09A 3I4EA 1G94A 4XTIA 2R14A 1M03A 3B8WA 1H11A 3CL7A 2Z1WA 1XIIA 3CO8A 3RGTA 3PZ9A 4GNVA 5REQB 3TONA 4DYJA 1VFLA 3ELFA 3G24A 2NW0A 4NZFA 4UNIA 2JIEA 4GBDA 3O8AA 1E70M 2XH7A 3FEQA 1W3TA 2GVYA 3B0YA 3EXTA 3CZGA 1AJZA 5A6AA 2WJFA 1OC5A 4GYPC 2VFEA 2J7FA 1XLKA 1I2NA 1YBQA 3RFAA 4JFUA 3WLNA 3GFZA 2V81A 3OHMB 4KEZA 1G4EA 1DIKA 2JFEX 4QE1A 4HPHA 3GIQA 4F48A 3M07A 2PD9A 3N4EA 4TUFA 2TSYA 4IP7A 1KRBC 2X05A 3TYUA 1JDEA 1F8MA 2GGJA 1OG6A 4JS3A 2NVAA 5A1AA 2OLAA 2HISA 5JIWA 3PZOA 3RYSA 5LNSA 1F5ZA 2VQUA 2DVTA 4LF1A 4NVTA 3MA8A 4FXJA 3N2OA 4C91A 5C9RA 1B31A 4GO8A 2VX5A 3K1GA 4JHMA 3E6EA 1UWUA 3EYPA 4NT0A 3BURA 4CD5A 1LL4A 5CLWA 4IXXA 4MKSA 2PDXA 1GQKA 1L6WA 3N18A 1NF7A 1FP8A 1NM9A 1KFJA 3VKDA 1GZ1A 5AHIA 4LVAA 1J0IA 5LA2A 4UTUA 2OSWA 2I56A 4Z1DA 1IEWA 2OQYA 4NAEA 1GVQA 1X98A 2QJMA 1XHGA 2WSKA 1SMAA 3AHZA 4PFHA 3PG8A 3WNNA 3NZQA 5EGRA 1W3IA 4ACYA 1C8XA 2E7FA 4HN4A 4PCTA 5XINA 3T8QA 3RX3A 4RX0A 4HNOA 2OZ0A 1UW9A 2XZ7A 3A9BA 4QIUA 3MZ2A 1OCJA 3G77A 2VNCA 3NFUA 1EF3A 1I4NA 4UZUA 3WMCA 3NOYA 4UFMA 3TZFA 1QHPA 3H53A 3S2NA 5C70A 1IXQA 4OBRA 4NASA 4O28A 3H12A 3EEZA 4LALA 3AALA 3M7WA 3KBVA 2PC8A 4A3YA 4XISA 3NPVA 2YCKX 3S3GA 1L0PA 4J4KA 3E2SA 3SCUA 4BI6A 3CTTA 2INZA 1R8LA 2I57A 3ZT5A 2Y62A 1ITUA 3CYJA 3I7QA 4GY1A 2J24A 3IUDA 3MMUA 3URBA 1V3IA 2CLEA 2PTXA 2R1PA 4NXKA 1TCMA 3B06A 4DB7A 3C2YA 3EOOA 2QZRA 1EZWA 4GI6A 4L56A 1E4LA 4ZL1A 1NFGA 2DZAA 4IX2A 1R2RA 4LYRA 3C2EA 4MLJA 3AHYA 1XCXA 1XLAA 1CDGA 1A0DA 3HPAA 2FZBA 3W7QA 1TZ9A 1WXJA 3HGSA 1MEIA 2ZVRA 3PPGA 4LB3A 4J2MA 4CN1A 2GL5A 3HG2A 4EANA 6A3HA 5KTLA 4O1CA 2BLEA 1LRNA 2FZ8A 3N4FA 2H8ZA 1QFEA 5DN1A 1VAHA 4NJJA 4TV5A 2Y7FA 3FN9A 4B4HA 3F2CA 2QUMA 2ADAA 4YN5A 1R9YA 2AQVA 1XUUA 4JFSA 4LQ1A 5CZJA 4R7WA 2BXYA 1E5JA 2QVHA 3VD4A 1KTBA 4H6KA 1SUXA 2YCLA 1DWFM 1NJJA 4UFHA 3T07A 3B97A 3BAXA 4JCMA 3IPWA 1KB3A 3B0VC 4EPEC 4A35A 1OD0A 3W3OA 3H24A 4ZQNA 3WD1A 5F7UA 3W75A 3AIBA 3STCA 4I7VA 2R1MA 5K2ZA 1ZBVA 3FS2A 3WJWA 4P7NA 4MUPA 3WMSA 3NQ2A 1Q6GA 4NAFB 1WB0A 1OM0A 4Z0JA 4L6DA 5DT7A 3NL6A 2E0PA 4IGSA 1LWJA 1TZZA 3GXIA 3DCPA 4O11A 2PWDA 2CHNA 3TYAA 4IISA 2FVKA 1EDQA 1XICA 1ZY9A 4UTTA 3V18A 1UR8A 5IXEA 2VRKA 4QISA 1TPFA 4D6FA 3UT0A 3WQPA 2PDBA 4PODA 2QGYA 3HG4A 1TTIA 1GZGA 3M4HA 2PDPA 3N14A 2SFPA 4KFNA 2YX0A 3BE7A 2WHKA 1YDYA 1O95A 1L2UA 2J8GA 4I5UA 3WD2A 4QJ5B 2GVLA 4ZQOA 4MVAA 3ABSA 1TQJA 2DSVA 2C1GA 2GSJA 1E9ZB 4PA8A 4Z1YA 4GYKA 2EKGA 4I5XA 1L9WA 1ICSA 4DWSB 2A3EA 3OHIA 3TMLA 1W9BM 2ZADA 1HIZA 1EDTA 3CU2A 3F4NA 1MW3A 3EWUA 5CSSA 4A29A 2ZUNA 1AG1O 1J79A 1OYAA 4A4AA 3VGGA 1PEZA 3TEVA 2YBVA 2NQLA 3WQOA 1NELA 4K7VA 3N12A 3M64A 5F2GA 1D8CA 5ECUA 1OK6A 1SJCA 5D32A 3MS8A 1UZHA 3EA3A 7REQA 1KQYA 2VRQA 3GE7A 1MQRA 5DFAA 1XI3A 1JL8A 1F3EA 2VVNA 1IGWA 1FVPA 4JTIA 3IAPA 3UJRA 5I3GA 3GDRA 4G1KA 4HZMA 5AC6A 2EKCA 3GX9A 3T0CA 4OIFA 1R2TA 2PF0A 1BVNP 1VF8A 4LH8A 3KDNA 1XDLA 1F73A 4PYSA 4A6GA 5I24A 2OX4A 4QDWA 1YDNA 2I5IA 1BF6A 1RH9A 3NSMA 2X16A 3CO4A 3LGDA 3DC0A 1QI0A 2C1IA 1VLIA 4DJEA 1C91A 3LCGA 1W2PA 4JTQA 1JVNA 1AL7A 1X8CA 1XP3A 3DG3A 2BX7A 1JCJA 2CXGA 3AIEA 2XINA 2XM2A 3EXRA 4HZ8A 4JQ2A 2V69A 3L2LA 4W7VA 3H7RA 3CAQA 4PMNA 3V36A 4E8CA 1E43A 1KKOA 4E8DA 1WKEA 2ZXBA 3VU2A 3W26A 1VBJA 3CAKA 1X96A 1W2VA 1KM6A 3GTFA 4IFKA 4UQAA 3V75A 4AD3A 3POHA 2YW4A 1B4EA 2Y70A 3HGRA 5LSMA 5K9XA 1EPVA 3LPOA 4AB4A 1CZ1A 1O66A 1GONA 3BGAA 1ZJIA 3MUIA 4BKNA 1KV5A 2X30A 1MQQA 1H50A 4QDPA 3RR4A 3PSVA 1BVZA 1ADOA 3JZUA 5CGQA 3AZRA 4D1JA 2WVVB 3CHVA 2QCDA 1ZBWA 1B9BA 4LEQA 5LIUX 3CPRA 3OLDA 3KBWA 3WQFA 2VTFA 4CGTA 1DWIM 4W86A 4ZO8A 4JBRA 2V2DA 4LRSA 5HNRA 2Z4GA 5A8OA 3CUIA 4IG2A 4D6DA 4GPNA 2GPTA 3PM6A 3PWGA 3CHDA 4XQ6A 3BMXA 3OO2A 1V03A 5XIAA 3PBVA 1QXLA 3CZLA 1KFBA 2FTWA 4JD4A 1UR2A 4GI9A 1M04A 3WMLA 1H7NA 3DFYA 2J4GA 3UWZA 1E6SM 4IFOA 4D6JA 3ES8A 1UIOA 2A5HA 3CXOA 3AZSA 3K4WA 3TVAA 3F03K 3ZM8A 5AOUA 2WSQA 3KDOA 3O07A 2WQPA 5AYZA 2RJGA 3H23A 4FOKA 4MGGA 4LV4A 2ZX7A 2ZRVA 5CEWA 3CZ8A 3TJ4A 3LHWA 4WK9A 3H70A 3IJQA 3RF9A 3T55A 2WANA 4AZCB 3OPSA 4MOZA 3W2UA 4TTUA 1JDAA 1Z8AA 4NL1A 1O60A 3CTLA 1KC7A 4K7YA 3M0LA 2PRLA 4LV9A 4O1DA 1UWQA 4FNSA 4GI4A 4R5EA 5FSDC 2ESCA 1B3VA 4G1NA 1QCWA 4O10A 2DZWA 1LQ2A 2XFFA 1HW6A 4RKAA 1WOBA 2DU2A 1EA9C 2WOQA 2XN2A 3GXPA 3M6YA 4O8AA 2GSHA 4IPIA 3CC1A 3KRSA 2OGJA 2ISSA 3S2JA 1CLVA 1A5AA 3H26A 4IGNA 4UR7A 3LSCA 3S42A 5C8BB 4PMDA 2BZNA 3GXDA 4QP0A 1XC4A 2PC4A 5LIKX 2J7HA 1OWQA 2NXGA 3CH9A 3QLLA 4WSHA 4TV6A 1YYAA 1LBLA 3IIZA 2PP0A 4L4LA 1K9DA 4JTAA 4KCVA 3HQOA 2G5WA 3N2XA 1YQ2A 3AXMA 2NUYA 5AKQA 1BGAA 3SUTA 3WH9A 1X7FA 1VFMA 1SFSA 1UKPA 4CQ9A 4ECLA 2FHBA 4QNEA 1X6LA 5RUBA 1M41A 2PGWA 1O5KA 4WIWA 3DKJA 3F4WA 4BF7A 2QV4A 3DECA 1HKIA 4HOXA 4N9CA 5I79A 1DPMA 3DU0A 3TJIA 1CGYA 2VGFA 2WSYA 1QU4A 4LAUA 4H8VA 3T44A 1EHNA 1P1XA 2C1HA 3AMDA 3EOUA 4NY2A 2O7QA 1Z9AA 1O12A 5T9CE 1WV2A 2HNHA 2PTWA 1FHUA 1R3RA 3LPGA 3S6TA 3CK5A 4ERIA 3UZJA 4C7DA 1Y65A 4GISA 1JXKA 5KEZA 1RPKA 3AYSA 3GH4A 1VP5A 4UR8A 1DQWA 1EH9A 1BVWA 4HTBA 4U33A 2C8NA 2C0AA 3NEVA 2NQ5A 4DUXA 2VEPA 4ILSA 2INFA 1LBMA 3KL3A 4R9OA 4W8LA 4H00A 5MF5A 3H2OA 4E3TA 4U3AA 4RNFA 2W62A 4B3KA 1JRBA 3B4UA 4QXIA 4P7QA 1K9FA 2DT3A 4QCEA 4X0NA 3W1LA 2GGGA 3M0KA 4B5TA 5LA1A 1W1B1 1CGWA 3INPA 5CPOA 4US6A 4PTNA 4JDYA 1YKWA 4NF7A 4F0HA 1R3SA 4W88A 3L68A 5HAOA 2RKXA 2YZ5A 2NLIA 2J78A 6XIMA 4C6LA 1U2YA 4MB3A 3IACA 4ACZA 3N25A 3NG3A 1GVFA 3QC0A 2EBNA 2VUNA 3ZJ6A 2WW5A 2Q8LA 5LHEA 3L2IA 2YL9A 3RAOA 4ADUA 2XIOA 1PYFA 3UFYA 1MXSA 4LT9A 4PFMA 4HCHA 2WK2A 1HKKA 5LA0A 4HPNA 3UBPC 1FKXA 3C6CA 1S1PA 1FQ0A 3I6RA 1XLEA 3QY8A 4HYRA 4PRWA 2HMCA 4KQNA 4XUYA 4AX6A 1ITCA 1ZCCA 4JTRA 4O1AA 1IF2A 1RK6A 1IWPA 3VTRA 4CUCA 1G4SA 3LRKA 1HVXA 1NWTA 3H4WA 3A3WA 3G5EA 2Q3OA 1UWIA 3SCSA 1PCWA 2YB4A 2ZKMX 3I4KA 1DIDA 3W7RA 5BRBA 2XPKA 3TOYA 2WCSA 1JPHA 5F1UA 1EJWC 1DJYA 4LY8A 5HNUA 2QCEA 2CFFA 4W5ZA 3UZZA 3GVGA 2ZA3A 1JZ7A 1R30A 4P7OA 3GVQA 2X0HA 1QW7A 3PBUA 1GUVA 3CMFA 5AHMA 4PB5A 3TYDA 3PTKA 2OQLA 3RNDA 2G41A 3W82A 2WM0A 1NEYA 2VURA 3WK2A 3W7HA 2VGGA 2DZXA 4D2JA 3ARSA 2YXOA 1FDZA 2J77A 1J93A 3HF3A 3LMZA 9CGTA 3ANVA 4NJGA 2G4FA 4P61A 1KR1A 1H51A 1EOMA 1E9IA 3OZYA 4FR1A 4REQA 1TX2A 3DHDA 1S39A 2XGZA 3ABZA 3UWUA 1K9TA 5EBAA 4LUYA 4JHZA 1FWTA 2HS6A 1M9HA 2P1FA 1C93A 1B4KA 5G5IA 1KV8A 4DPQA 2PWGA 3UQNA 3BZGA 2WCAA 4G56A 2P88A 2FPYA 3LK6A 4JTHA 5E70A 1E55A 1K77A 3SCVA 4O52A 4Q4RA 1Z89A 3RRXA 5DANA 2WLYA 5AYXA 3WENA 1REQA 4Q7IA 1P6BA 3O9NA 3ZR4A 3VOCA 4W5UA 1CI1A 4DHGA 4HNTA 3BLEA 1TA3B 3GXMA 5EMKA 5CKSA 5CPLA 3TA6A 3W81A 1XV8A 6XIAA 8RUCA 3PB2A 4XAFA 2BHZA 1HL2A 5KINA 3UR7A 5C9XA 3Q65A 4JIHA 5CZSA 1JZ8A 1UC4A 1EJSC 4PCFA 1KRAC 1OT1A 1OCNA 2J7DA 4L4OA 3W7LA 5JXQA 1OIFA 1MNSA 4DZHA 1MUWA 4G2DA 3VOIA 3U7BA 1RHCA 4E8GA 4OV4A 1PJ9A 1UD2A 4HA4A 3VK5A 3TCSA 2UY2A 1DJQA 3RMJA 2ZZ1A 2ZWYA 1GVEA 1D7FA 2OXNA 4HPGA 4C1KA 4JY8A 1J10A 5FAJA 1GKPA 3R6IA 3IS4A 1GORA 1JDFA 3QZEA 3V4BA 3P81A 4O16A 1FH8A 1R87A 2X40A 3PF3A 4KCTA 4H6RA 2W27A 3ALFA 1H7PA 4CCEA 5JMUA 1N8WA 3SUSA 1XBYA 1MDRA 3SUVA 2BFGA 4PUMA 3UR5A 3O16A 4HPXA 3CUJA 3A21A 4DWDA 3D46A 4WXYA 2XSAA 1PV8A 2I5GA 1ZL1A 2W5FA 3UWEA 1OC6A 3AHVA 5FD0A 1TV8A 4E2DA 2FLIA 4PUEA 4QS5A 4OQVA 1ONWA 3QC3A 3BG5A 3GY1A 5DQPA 3RCNA 4C6DA 1Z3NA 2PLCA 4PUUA 4QDMA 3Q4DA 2HVNA 1KQZA 3NL5A 1G6CA 1JIBA 3FHQA 3AU6A 2QJJA 1VEPA 4F66A 4HA1A 3L0KA 1V93A 3EWCA 4P7LA 3M44A 3PY2A 5HMDA 4K38A 4IMEA 3C61A 3ZFHA 3BW4A 2FZ9A 5G2IA 2VEKA 3M47A 2X0YA 1EP2A 3AMKA 3FJ4A 3L4TA 4MPKA 4L1WA 1UBPC 4N02A 1W5PA 3IWPA 2W61A 3QZAA 3KVJA 4O0ZA 4N42A 3UYCA 2E9MA 2AAAA 3UJFA 4H9YA 3WBAA 3M5XA 2CEQA 2OQHA 4GZEA 3LZ3A 2J79A 2AKMA 3NPUA 2NUXA 2PGRA 2QUVA 3IVSA 4LUTA 3OGVA 1EC9A 3R11A 3FYOA 2H3DA 2C14A 3PFMA 3DIPA 4M29A 3N11A 3SADA 1JCLA 2B7OA 4BWLA 3ICJA 1OZMA 1ZGDA 1YIXA 1F3TA 3LD5A 1KGUA 1XYCA 3K8KA 3RO6A 4X9SA 4MAZA 1DHPA 1KM0A 1RA0A 1PKMA 1GW1A 4S39A 2G50A 5K4ZA 3KHDA 3R0DA 3BPWA 1PIFA 2XH4A 4PB3A 4O54A 2POTA 1OFDA 3AU2A 2IXUA 3ITGA 1A5SA 4N9BA 2X7VA 3WLKX 4LOCA 2ZCGA 4GK8A 2ZC8A 1E4IA 2OPJA 3LHUA 3DI1A 5BU9A 3LLXA 5FI8A 4D71A 4GYJA 1NH6A 3TN5A 4MNLA 1OFRA 2I5QA 5HJXA 1TKKA 5HMEA 4KBXA 1OGBA 3APYA 3VOJA 4QSFA 4GH1A 1Z44A 1SO4A 3ANUA 4KW2A 3UNDA 2A4AA 1E72M 3M46A 4LBUA 1KFCA 3VYLA 5BWFA 3E1F1 9XIMA 4CNUA 3PULA 3W9ZA 3GDMA 3H22A 1EF2A 4H7CA 5BNKA 4V1YA 3BLOA 4QBXA 4C1LA 3QF0A 2EJ1A 3VIIA 1TVNA 4GFIA 4ZE4A 2VO5A 3FGCA 1OG0A 5ABEA 3VMNA 5BZAA 3W37A 3MP3A 4D8AA 2OMAA 3WY1A 3ISIX 4PCSA 5H1WA 3WZ0E 1XINA 3JZEA 1UR9A 3K4AA 2NWSA 1D9EA 3B8UA 1BWVA 2ZDSA 4LNYA 2XIBA 1JZ2A 1DWGM 4W87A 4PN2A 1SPQA 2QCFA 2EXOA 5BMXA 4ROQA 2FHFA 5EBUA 3T2OA 3UZWA 3E0LA 1U1UA 1NFBA 5DELA 6REQB 3WDHA 4MNMA 3O6YX 1VRXA 1TYGA 1XLFA 1LRQA 3R25A 3MC5A 4GQBA 1M1BA 4MPQA 3PAJA 3RCYA 4BQ5A 4LGXA 1LLZA 1QR7A 3KOFA 4IFRA 1G7UA 4LVDA 3C56A 3ARWA 3LCWA 1XYMA 4GQQA 1ZUAX 4B5VA 1B3WA 3RRAA 1UJPA 2VZTA 1HO1A 4EF8A 2PP3A 1C9WA 2ZRXA 5IM51 4C6MA 4UCFA 3E0VA 5TAOA 1GPFA 3P62A 1XLGA 4P5UA 1SW7A 3W28A 2DH2A 4FK9A 3WJYA 4C7FA 4A8LA 3W7GA 2NQJA 4POCA 1ELSA 2NXHA 1P0EA 4JICA 3TYBA 4RNHA 2QULA 3ARRA 2WPBA 4WKAA 1K9EA 2Z6IA 3WKZA 4EXBA 2VWSA 4AIEA 4CKQA 2QDEA 2EF9A 1FDJA 3UWWA 1TFVA 3DBPA 3VDGA 4B91A 4I5RA 4XWUA 3BAKA 2A79A 3RX4A 1BRLB 4MZ8A 2PDYA 4PTWA 4H8NA 3DDMA 5AN7A 3QRHA 3KBNA 4J27A 3LU2A 1F61A 1VFUA 1DWHM 1VJSA 2ZZ5A 1CXEA 4IMCA 3RLHA 4DNMA 1K7FA 2HNEA 3VFCA 4FLQA 2Y4SA 1S3HA 3ERPA 4Q32A 1UUQA 2FTPA 1JYWA 5KMYA 5HPOA 3MWAA 1PX4A 3C86A 1X8FA 3O0FA 5EYWA 4QTGA 4LJ3A 3V16A 1KWGA 1Q6OA 4WY0A 1YNPA 3HFTA 4J7RA 2EEXA 4IP4A 1EP1A 3STFA 5DO8A 4KEVA 4AQLA 3K8LA 3U7VA 5T8GA 3TC3A 3W6MA 1PYMA 2BDQA 5D05A 3PN8A 2RDWA 3ITTA 3VOFA 5M17A 3QQWA 1OABA 1OD8A 1JYVA 2C19A 3U3HA 4MTVA 1XSKA 4D6HA 4GQRA 2FZNA 1KM3A 1MZRA 2FPTA 3WH7A 3WX7A 1JG9A 5D37A 3TFXA 1AL8A 3E96A 3CHEA 4DJED 3DXIA 1Q45A 3RPMA 1QK0A 2DQXA 1KFEA 2ACRA 3EX6A 4QLJA 4JQ3A 1X6NA 1ZZMA 1JPDX 1PS9A 2WSPA 5FJJA 1Y8BA 3QYSA 4XKYA 3HQNA 2GJXB 3SRKA 3PZMA 3MP4A 4H9XA 2Z6JA 4MB4A 3AS2A 4WKHA 2ZUUA 1CXFA 3I3EA 1OF8A 2WVTA 3CNYA 3GC2A 4RV8A 1BF2A 3CYVA 4AD2A 4XD3A 1LT8A 1S5NA 1BTMA 5T91A 1L8NA 3WNLA 2TMDA 3W25A 3P8JA 3L4XA 1US2A 3NZ1A 3C2RA 1XX1A 1RP9A 4V33A 4S3KA 1XISA 4S3FA 1KA9F 4I90A 2EPHA 4IPPA 3GFYA 1TWZA 1GTEA 4S3AA 4IX0A 3OODA 2XVNA 2D0FA 3TTQA 4WOQA 4D6IA 3N3MA 2ZRWA 1Q13A 3IV3A 3MDUA 4DVOA 1B0IA 5FIPA 3G1XA 4DYKA 3G0XA 3TWBA 4B3LA 1H0IA 2GFTA 2VRJA 4KH2A 3UZYA 6ENLA 1DTNA 3MY9A 4DWSC 3WLLA 1VYSX 2ZUMA 4ES4A 1XCWA 4EXQA 4OZOA 1JEZA 3PJWA 3AZTA 4NQ1A 1H09A 4UTFA 4CQDA 2NSOA 3WLOA 3M16A 3LTPA 1GJWA 3W29A 2ZRUA 1A5UA 3CJPA 4Q4KA 1JUBA 1C7TA 2CCRA 4GGBA 4MNKA 3EDJA 3VGHA 3OBKA 3I10A 1C92A 4AW7A 5I03A 3AI0A 3OG3A 3KBSA 3IIOA 1EP3A 2Y24A 2QJIA 1V02E 1OINA 1W9DM 1XLLA 1OSEA 4MWAE 2Y5JA 3N34A 5DT5A 4U2ZA 2PP1A 4GNJA 1LTDA 3A24A 4GINA 4O4VA 3REQB 3G6MA 2FZDA 2CZFA 4H8UA 3HQ1A 1UZDA 3WLRA 1Y5XA 1DJHA 4A2RA 3HBLA 4HIBA 4AC1X 1QJWA 3LI0A 4O0QA 3CWHA 2Y5SA 4PUDA 3CL6A 1JD7A 4PTXA 2O92A 4PULA 2R1LA 2VX7A 2PBGA 2QS8A 5DLCA 4YU1A 4JZ5A 2J9XA 4AIBA 3W83A 4DI9A 3L4WA 2WNNA 1QATA 3WNKA 3NQVA 1FWHC 4GY7A 2F84A 1G7VA 1TPWA 1XYAA 1MO0A 5L6UA 2VCCA 1E1CB 1SR0A 2XU2A 4KIRA 3VVGA 5I23A 2C79A 2J62A 2WO5A 3MUAA 1RQHA 3AWNA 1EQCA 1TV2A 1J6OA 3P5ZA 1C9DA 2AL2A 1DWAM 3CB8A 4L9YA 4HCLA 3T05A 5ENLA 2BXVA 3SCWA 1R9ZA 1UD3A 4RNJA 4BEUA 2V6AA 2PRHA 2W63A 4U5IA 2E5DA 4XO6A 3TMQA 4JTTA 4INFA 3ES7A 4S2CA 4TX9A 3MQTA 2Z2UA 3NUKA 3V3WA 4AZ7A 5IHSA 5H91A 3CLWA 1EJRC 1AD1A 1WNOA 4O50A 2PDCA 4J3XA 1N55A 1WP6A 3GHUA 1TJ0A 4ERGA 4OT7A 4U28A 5F2MA 4BCEA 2WPGA 1JDCA 4RZBA 1GQIA 4GI8A 4P8VA 4S2BA 5FJPA 2FGLA 1L6YA 4GJ1A 3GUGA 1XLHA 2VGIA 1OFPA 1UASA 3APGA 3W1MA 3NOEA 4AD5A 2IPWA 4KT2A 3UWQA 1QPRA 2BOGX 1JZ5A 5E0CA 4DF1A 2J7BA 4AUBA 4ZOEA 1MYRA 2VZVA 1J12A 4HNNA 3NIYA 2D3NA 5T26A 1TE6A 3L0GA 3T7VA 3I68A 4C6EA 2HRWA 2PLJA 2E25A 4EP8C 1EFZA 1UKSA 2WHJA 3LS9A 1B3YA 1AVAA 4DJFC 4KERA 4ZO7A 1MRQA 2QDGA 4AG0A 4ZEPA 1UP2A 1XKYA 3KVMA 2FJUB 4V27A 1EEXA 3HFYA 2G3JA 3LMYA 2O9OA 2OJPA 3PVFA 4BS0A 1SSDA 3NM1A 4GNKB 4Y9PA 2BY3A 1FWNA 4O18A 5AC5A 3SURA 1UD6A 7XIMA 1UWSA 4ZSTA 2QV5A 2ZFAA 3CEUA 3EX1A 4PTVA 1EB3A 1OX5A 1KFKA 3TTEA 2WZHA 1FCVA 5HULA 3VGFA 2BGSA 3QKZA 1F3XA 1UOKA 3ZJ7A 4Z42C 1JF5A 3H8AA 3MCNA 4B90A 4FZIA 4RE3A 1NWUA 3BDKA 1VPXA 2J8TA 4BQ3A 4A3QA 2QCLA 4QITA 4HHLA 4C6CA 4AFYA 3NQ8A 1JCTA 2WKLA 3W73A 4GZ7A 1ITQA 3GC4A 3GDLA 2P8CA 1KCKA 4XIMA 1V3KA 3OGSA 4TX8A 1PZ0A 2WMFA 5EFDA 3UG4A 3UETA 1PHQA 3FJLA 4QSHA 5CPMA 3GUWA 3WQCA 4IGHA 3KZSA 4JYFA 4JL2A 4E3VA 2WXDM 2NX9A 2QCHA 3EWYA 1Q2RA 3KOXA 3WDPP 3VDBA 3T08A 1FH9A 4AHPA 3Q67A 4EPBC 2O56A 4DXXA 1R7AA 4O14A 1TIWA 1H5YA 2PF8A 4FLRA 1E0WA 5CGMA 1G69A 1X39A 2FQIA 3MI6A 1PE1A 3TAKA 1TUFA 3AO0A 4XZLX 3WBWA 2FTYA 1AH4A 3WFLA 2X09A 5FF2A 3GB6A 3ZVHB 2W4XA 4UWMA 1PB0A 2ASHA 2ZE0A 4ML4A 4NRSA 4QNWA 4G7EA 5GNXA 2JGYA 2OFJA 3QOKA 2DH3A 4FXRA 4Q8QA 3G1DA 1S2VA 2PDNA 1A0CA 2XGBA 3LEPA 4ZXOA 1FWSA 2B31A 3TSBA 4O4WA 3BJTA 1GOKA 2ZBTA 3L66A 4HU3A 3ALGA 1TPUA 2X7WA 2F6UA 3UPWA 2FVLA 4FR6A 3TUUA 3WYZA 8XIMA 1PL9A 1J8VA 4LNCA 3WIJA 3LHZA 4RLIA 3E74A 3HPSA 2O9PA 1LBFA 1W8SA 4UOJA 2WC7A 4NIRA 1N7KA 4EF9A 5E9AA 5A94A 2Z27A 3R13A 3OQEA 3RPDA 3F5KA 5CGTA 5F2IA 3IARA 7CGTA 3EWDA 4X61A 1J2BA 3B0UX 4ASTA 4UFLA 4ZOAA 3BK0A 3I6TA 4I9JA 4KRUA 2PDJA 3CWNA 3M6DA 1FY6A 4A8IA 2XVLA 3BZJA 2OO0A 4IJBA 3QMSA 4IJCA 4IOTA 5LNRA 3CAWA 5A6BD 1O7AA 3H7VA 3U5YA 3OU8A 3SW6A 4BZYA 3QFEA 4IQLA 4FLSA 2OYMA 2XYLA 3Q45A 2QAPA 2CETA 1UPPA 1VBHA 3NURA 3VD5A 5G2HA 2A3LA 2I1OA 2GVJA 1K8XA 2F2HA 5HNNA 4US5D 4F8XA 1TCDA 4HGXA 1E0UA 5I3JA 5H8MA 4H2CA 4WJ8A 1B1YA 2CWNA 3S5ZA 3WLHA 3DUGA 1DJZA 2PWEA 5BW6A 2JKAA 3KEHA 3OLGA 3BCFA 1RA5A 2BNJA 5CJ5A 3WF0A 3FK4A 4C5ZA 1K70A 4IIDA 3R1ZA 4NZJA 4B9ZA 3P60A 5FF4A 3GR8A 2FGBA 4UMCA 3FFSA 3VZYA 1ONEA 5ABFA 1MXDA 2CBVA 3RLUA 4GZJA 1EJVC 3W1PA 2PS2A 3UNTA 3ZLGA 2Y89A 1WXYA 1H61A 1G0CA 2VR5A 2VDHA 4Y9MA 3LYEA 2ICSA 4ZENA 1GEHA 4PEEA 4RJEA 4TMBA 3CV2A 3G1SA 3RU6A 4DBDA 5I2UA 3FY1A 3QV8A 4C60A 2CZEA 2VC7A 3MPGA 5U7SA 3T0TA 2D20A 3LTYA 3WQ4A 4M1RA 1E15A 2YCIX 3WD0A 1I60A 3NSNA 2YA2A 4ZOCA 4KWUA 4JAWA 3FX4A 4J9JA 3SM0A 4O57A 3C2OA 4GE8A 1LG1A 2DQWA 1BKSA 1Z6KA 2X1UA 1MFVA 5JBEA 1N8FA 2XN0A 3FYPA 1CNVA 1W0MA 3WK3A 2W92A 1V0LA 4JDBA 2AMXA 4QGCA 4HOZA 4P7RA 4AZ5A 1Q8AA 2V8ZA 3EB2A 2B4GA 1KM2A 1UG6A 2GDUA 2HPIA 2WWCA 4XZMX 1QRQA 3IV8A 4ENLA 3NQ6A 1KCLA 5AHNA 3W6LA 4ATDA 1TRDA 3C0QA 3MHFA 4CCDA 1ZJHA 1B30A 1EL3A 2J13A 3CBWA 3LM3A 1CGUA 3GXTA 5KZMA 3HGJA 5M5DA 1IR2A 2J8FA 3CQJA 3G2GA 1WZMA 1E73M 4MM1A 1DP0A 1VFFA 4ALDA 2FPVA 3UWYA 3UYIA 2ISDA 3N6HA 1NP2A 4DYEA 3O1NA 4JTCA 2ZDRA 4QM1A 1F05A 1ISVA 3H4XA 4EACA 3BARA 1S5TA 2D0GA 1TPDA 3V35A 2I7GA 3M0IA 3AJXA 1FWEC 1VENA 2V5JA 3GK0A 4JKKA 1LORA 3JVAA 3EKZA 2DIJA 4Y9AA 5CPSA 3ZLFA 4PZVA 2CLIA 4AYGA 1VHCA 3IJ6A 4KS0A 2Y88A 3PJXA 2RGLA 4LUIA 4KPLA 3T8LA 4LYKA 4B5WA 3MI3A 1IE7C 3MV01 3AOFA 2OOFA 3B8VA 2GQ9A 2NT0A 3TYCA 2QUUA 3BSGA 1Y0EA 3MMWA 3OB8A 3CV7A 3V0TA 2IKHA 5JBDA 2Q01A 1EGZA 4J3WA 3PP7A 5HPCA 1AA1B 3WLSA 6PTDA 3S5SA 3VMOA 3GNNA 3QMRA 3SN4A 3LZ5A 4FP1A 5EPDA 3BAJA 2CITA 4NNBA 2D2GA 4AZIA 1UH4A 2O0TA 4HHHA 1QNRA 2F9RA 1HJXA 3QSRA 1XIFA 5DY3A 1X38A 1UHVA 3GFXA 4M81A 3UERA 1WBJA 4DAIA 3U8GA 1M01A 1IYXA 1FX6A 4UTWC 4M7SA 2NV2A 4LF2A 3QTPA 4IGMA 4NHVA 3SDOA 1K3UA 2E6FA 1SO5A 2W0UA 3CUHA 1KBIA 4ZSUA 3KLLA 3CV6A 3R2GA 4QCFA 3P61A 2J74A 3VNYA 1EYWA 2A3CA 2HS8A 4R85A 1GOIA 4KMQA 1PKLA 4YL2A 1R86A 3PUEA 1IEQA 1E4NA 2L5HA 4S23A 1BWKA 1E3ZA 3IANA 3VKJA 1KCXA 2GYIA 3OOQA 1S2AA 1QW8A 1HKJA 1QASA 2ABBA 5E6ZA 4DWSD 1TO3A 3SECA 1ALDA 1BTCA 3PANA 1BRLA 4N4PA 4LUSB 4J3SA 1F2JA 2IXVA 4FX6M 1CIUA 4C6PA 4XTDA 3O6CA 3VIFA 3EDKA 3VUPA 1MW2A 2DP3A 1FHLA 2V3EA 4GQGA 4AHOA 4C5YA 1VFTA 4QR6A 2EGZA 4RDWA 2B0MA 1CW2A 1EXBA 3SCOA 3EMCA 1Q4NX 1HKMA 3TN6A 3ARVA 3C0SA 4XZ9A 2V5DA 4QE5A 1VQTA 4EX4A 4QQ3A 4R27A 4PMVA 5GPRA 5I77A 4AMAA 2H90A 2Y6ZA 3ONCA 4R7OA 2IQDA 3POCA 1UWTA 5CAKA 1P1MA 3C8FA 1LCOA 4V1XA 3N04A 4IMFA 1QBBA 1J6PA 3EPMA 4LCSA 3VNLA 2ZX8A 3LPPA 1GQNA 2P3EA 3W7DA 4I7WA 2OWCA 5U4NA 1YHTA 1A3XA 2XHYA 3VIPA 4ERAA 1KKRA 3O2LA 2DT0A 2GSEA 3EGJA 3PZNA 1BQCA 3AICA 1V08A 4B16A 1PKYA 2Y5EA 2D73A 1V0KA 3ARQA 3V1HA 2Z7GA 4AY8A 3GG0A 3IJ8A 2XG9A 4YS1A 3AYTA 1E4MM 3TR2A 3LGEA 3WK0A 3H54A 4PRRA 4LWWA 1FHVA 2B7PA 4CQCA 3Q2DA 2H9AB 5ABHA 4BWLC 4B92A 4R3UA 1NVMA 3TXZA 2UBPC 5BCAA 3W85A 4DO6A 3E2RA 6TIMA 1XFBA 4JNMA 3CZJA 1L6GA 1P7TA 2Y8KA 3WJXA 1S5MA 3ITOA 4GMEA 5F4SA 4HTYA 3W23A 3DBNA 1A5KC 1TE1A 2EO7A 5EFFA 3PBYA 2DORA 5EL1A 3KTCA 2C0HA 4G5DA 4HPJA 1W5OA 3MKVA 3ECQA 4O1FA 4LCQA 3N15A 3W87A 3TN4A 3WK1A 3GR4A 4J35A 1XIGA 2AL1A 3O3RA 4MDPA 4FF5A 3B8DA 3CQIA 1IIGA 2YGYA 3U57A 2WMGA 4I8YA 4M19A 2OLSA 3WH6A 4WJEA 4H01A 4H6QA 3W76A 2DZBA 4DZ5A 1T5AA 5M03A 4FNPA 1GJUA 4LAKA 5DCBA 1UBSA 1C8YA 1Y5WA 1VHNA 1OHLA 2BY0A 2QUNA 4GYPA 2PODA 3S4TA 4HA0A 5E0KA 4MWAC 1P48A 1LUCB 2VD9A 1ADDA 2OODA 3F1QA 3HTWA 1V0MA 5LGZA 2PLKA 4ZQPA 2IKJA 2DSKA 3ATZA 3PS7A 3BCDA 4E4UA 1FWWA 1B90A 1WDPA 2H6RA 1VBUA 4NG3A 4JTGA 5FJRA 4GC3A 3QN3A 1UQYA 4UTKA 4YCOA 2REQA 5LNVA 3M5VA 3NXFA 4HJFA 5CLTA 1LLWA 4RDVA 2VZUA 4IL0A 4WF7A 1RY0A 2Y2WA 1RD5A 3PTDA 4GIEA 3SB0A 4M82A 1HL9A 3BV4A 1RZMA 1SR9A 4MAVA 1JGIA 2YL5A 2G0WA 3W1TA 1PDYA 1A4LA 1IZCA 4A2SA 1ZJAA 3UVIA 2PTZA 1UMYA 2HVOA 5AFDA 2Z0IA 3DYPA 4O13A 2JIWA 2XUCA 4IUOA 1M6JA 3LUTA 1XBXA 3RN6A 4K1GA 3LV5A 4JXCA 4EK7A 4DELA 2R24A 2OEMA 3CQKA 3W1QA 1TZ7A 4JTSA 2YYUA 4DUOA 5MKGA 1RQEA 2D2OA 4H9VA 3L4ZA 4WOZA 1OADA 4HNCA 1TJ1A 4ZA0A 3PZTA 3PNUA 1GHRA 1K7EA 3WLTA 1YW1A 2GJLA 1AODA 4XZIA 1ISWA 4ZMGA 2P0IA 3OG2A 4GJJA 4S1FA 4BF9A 1FCUA 5XIMA 3EMQA 4OV9A 3CHCA 4OGZA 3W2KA 3V5CA 1V3MA 3O06A 2ZWZA 3MMTA 3S0CA 4LPCA 4J28A 1G67A 2Y1HA 4J5NA 1JYNA 5C2GA 1F6KA 3NDYA 1S2TA 1TTPA 3W0KA 1O5RA 3EB4A 1UR3M 4N9EA 2XSXA 3QLDA 3GHSA 3GWQA 3VNMA 4CCCA 1EA0A 1QT1A 1EPXA 4K37A 5EA9A 3DX5A 3NVTA 5AVHA 2VZOA 1CTNA 1IIHA 3EA1A 3KS5A 3CT2A 1A5NC 1GVYA 5AVNA 1KO0A 1G5AA 1W3LA 1KBJA 3E38A 3PB0A 4DJDC 4NNAA 3CIXA 3W7EA 2E1DA 3GW3A 5A8NA 3A23A 4HMDA 3WF4A 4GIAA 2DJLA 3JUGA 4DBSA 1VLWA 1BG9A 3WQEA 5TD4A 2VR4A 4RE4A 1R46A 3J7HA 1TVLA 2HDJA 5LIWX 4PMZA 3BOLA 2G96A 4F2UA 3BG9A 4JFWA 4J3ZA 1YPIA 4YXGA 3I7SA 4S3BA 1JAEA 4HD5A 1WOAA 1EZ2A 2YIHA 1OGGA 3LI1A 1JCNA 1XIJA 1M65A 1EJTC 3GIYA 3W1UA 1IT7A 4JNYA 2Z25A 1FCQA 3GNXA 3AS3A 3D5HA 4WUIA 3OZMA 1Q7QA 2HK1A 1TPH1 4GACA 2B7NA 3IVTA 3W7CA 4Q4SA 3B8IA 3EWZA 4HK7A 2DFAA 4BK9A 1NTHA 3CV1A 3EPNA 4ZO6A 3LA4A 5IHRA 1Q63A 3TROA 4UB9A 2RJHA 1HKWA 3VKCA 4AWSA 2WM1A 3DI0A 4W4QA 4FX8A 4GWEA 3DHFA 5HXMA 1JPMA 4XZBA 3URAA 3ARZA 1OYCA 1E5NA 4UQCA 8A3HA 4MY8A 4ZQMA 3ARXA 2JEPA 4Z2IA 1DYSA 2PGFA 3HO8A 1OX4B 2JE8A 2HTMA 3GG7A 4ZR8A 3N6QA 4PMRA 5I6SA 3MI2A 5B7ZA 5LGXA 4BQ4A 4UR9A 4CN4A 2RDXA 3AJ7A 4F0RA 1NOFA 4FNTA 2OYLA 1ICPA 3CM4A 3UU0A 4YNGA 4RPPA 1XGEA 2UWFA 3GNDA 2DVUA 4YVXA 4TU1A 5FEPA 4C90A 1A3HA 3A4XA 1JI2A 1BEUA 1YBQB 3RJXA 5KZDA 2DGAA 2J25A 2PDLA 1XL9A 5EMMA 2RHGA 3PZUA 5C6MA 4O17A 2C3ZA 2ZIDA 4IJRA 1DE5A 4TR9A 1X97A 1PXGA 3JRKA 1ZJBA 3PPHA 1ZS2A 2C91A 4G6CA 4GOAA 2WNWA 3GHRA 2IQ0A 5AZ1A 2GK1A 3LNMA 3A5VA 2PDKA 3IAQA 4IPJA 1PBGA 2VEIA 3M5YA 4LSBA 3E49A 3TFCA 2H3BA 3VABA 4AZ6A 3N19B 4UMBA 4MJ4A 3CZKA 1I0DA 4UXDA 3F4VA 2WC3A 2CPUA 3CT7A 5TIMA 2OU4A 4M8UA 3FA4A 4UQDA 3F2BA 1K7XA 2G8ZA 4JTDA 3SI9A 1YX1A 3QW4B 1IT0A 1H2JA 5G1TA 2DSWA 3CH0A 4F0KA 3SCRA 2Y8UA 4NAEB 4RW3A 3LENA 5HINA 5KZEA 2ZTJA 2RAGA 1I9CB 1WQ5A 1EEPA 3BVJA 4PE8A 3FKRA 1NDZA 4FI4A 5GNYA 3OEXA 4NJKA 3CQ0A 4M6VA 2FMNA 3SBFA 1E6QM 1T6MA 4KFPA 2V67A 1AZ1A 4XZWA 4HN8A 4PB4A 3ZT6A 1VBRA 3PZVA 3KM8A 2WZIA 4GVFA 2D69A 1NSJA 3L12A 4Q6JA 4BF5A 4A8NA 2F38A 4UCGA 3PR2A 3GZAA 4WDUA 4B5UA 2J27A 4GCXA 4W9TA 4TXEA 3DFOA 3V0SA 4A05A 4R7JA 3M0JA 1EJ7L 2WAGA 5F4WA 4QHRA 1E56A 3W7MA 3K5XA 2P10A 3VM5A 2DZTA 1O6IA 5DRCA 1FFQA 1RVKA 3KL0A 3KWSA 5D09A 1ZAIA 2CZ5A 1OVDA 1LRTA 1XD0A 1W9UA 3TDFA 3Q58A 2NQZA 1BXCA 2E6YA 1H3GA 3P0XA 1K6AA 3WDIA 3HA1A 3GAYA 2GUUA 2E68A 1Z48A 4OBTA 3ZS4A 3PZGA 5HQEA 3L65A 1Q2SA 4K39A 2O7SA 3GRIA 4MADA 4LEFA 5CG0A 1UUMA 1JPKA 3NZGA 3TSDA 2YFOA 4NP7A 3ZXWA 3IGHX 1XIMA 1EWEA 1BYDA 4IWWA 3TQ0A 3VIOA 1ZTVA 1QNSA 4H9TA 3RJYA 1G4TA 3UXLA 4C1NA 5M2FX 3EMZA 2G3FA 5ABGA 3FA3A 3NO3A 4BY3A 3TK7A 4HK5A 4DN1A 1YDVA 2GQ3A 4IQJA 5G4WA 2QR6A 3IUHA 4XG1A 3AIVA 1ICQA 2CLHA 1HGWA 1VR6A 1PIGA 1W5MA 3LBCA 1BQGA 4IF2A 1J5SA 3A13A 1DL3A 4JIIX 1OK4A 3ITLA 1H1YA 3TSMA 5D4YA 3EDEA 4YWSA 3QHMA 4M6UA 1SW0A 1R6WA 2WVUA 5IFPA 4F40A 1VGAA 1WAUA 3XIMA 1YEYA 3GU1A 1TQXA 1P5BA 1AW2A 2HWGA 2XVKA 4OTKA 2PTYA 5A95A 4OKDA 4BI7A 2ZX6A 1OF6A 1Z32X 1DQXA 2FHCA 1ZB5A 4PSRA 1KXTA 4QAIA 3B03A 4FIRA 2FKPA 1XLIA 3UA3A 2WMIA 3TIMA 3KCJA 2YDQA 3TYEA 2YA1A 1G4PA 4XVDA 1XLMA 4M3PA 4P8XA 1GKQA 3S8HA 5FL0A 1PKNA 4PGLA 4HJWA 1TWDA 2AGKA 3B40A 5FKYA 5D03A 1LWHA 1RK5A 1E1EA 3MO7A 4LYPA 1YNYA 4EKJA 2OR2A 1EGVA 4GLEA 4I9TA 4XD4A 1EOKA 4U4MA 3KXQA 4UZSA 1SGJA 2PCQA 1W3KA 2HQAA 4ORIA 1J0ZA 1WPCA 1GVRA 3CGTA 1Z42A 2OVLA 3UJSA 4AU0A 3MSGA 5I78A 1W1A1 3QGAC 4TQTA 3PSWA 2FGZA 4GXPA 3HV9A 3SCNA 1F9CA 3SSZA 2ZXDA 3VI2A 3U4AA 3WF2A 1XG3A 1MWOA 2NWRA 3S1XA 3UXIA 3EWXA 1TWWA 2I9UA 1IQ8A 2V30A 3QVQA 3VKAA 2Y85A 1JF6A 3T4CA 1L2QA 4QFUA 3RILA 1AJ2A 3FDGA 3HZ3A 4BQ2A 4HSOA 4X3ZA 3S47A 4Y9OA 3VC5A 3RXZA 2CLOA 2FVMA 4O19A 3H2MA 1FXQA 3IUIA 4NZ3A 4N9DA 1RXOB 1PZ1A 1E1FA 1A47A 2XWDA 4Q7NA 2NV1A 1F3WA 2ZVIA 3FJ6A 4KF1A 4M56A 1GCYA 3W1NA 2EPMX 5CBJA 3ORWA 4GXMA 2D3LA 5A6LA 1TV4A 3B0PA 2VR2A 1UKOA 1V6YA 4ZZ9A 7REQB 4Q6XA 2X41A 3TLQA 3ZWTA 1Z41A 3VIMA 3WEOA 1RVGA 3HMJG 3M0VA 4MYXA 1HL8A 1H5VA 5A69A 3HG3A 2PDQA 5FOOA