4LEFA

Crystal structure of phosphotriesterase homology protein from escherichia coli complexed with phosphate in active site
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PHOSPHOTRIESTERASE HOMOLOGY PROTEIN FROM ESCHERICHIA COLI complexed with phosphate in active site
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Phosphotriesterase homology protein
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lefA00
4PE8A 2XIOA 2ANUA 2EG6A 4GXWA 3CJPA 1ONXA 4RE0A 2Z7GA 4ERIA 4CNTA 3ID7A 4BY3A 1XWYA 2CZVA 4E3TA 4WHBA 2HPMA 4KIRA 1YBQA 3NURA 4AC7C 4EPEC 3LY0A 4QS5A 4B92A 3GUWA 3K2GA 2Z27A 4GC3A 4H00A 3S2MA 2YXOA 1P1MA 1NDVA 3GIPA 1QXLA 3UR2A 4DLFA 1HZYA 3E74A 4ERGA 4QROA 3TNBA 3V7PA 1E9YB 1DPMA 4EP8C 1J6OA 4DYKA 3OQEA 3T81A 4C6OA 1O12A 1RJQA 1UIPA 3BE7A 4CEUC 3MPGA 2GWGA 4F0RA 1I0DA 1FWAC 4C6JA 4GY7A 4PBFA 4KEZA 3GTXA 4KEUA 4DI9A 3URNA 3T8LA 4RZBA 4IGMA 3B0YA 2VUNA 1VFLA 2DVXA 5HMEA 4NP7A 2BGNE 4KEVA 3IARA 4Z42C 4C5ZA 4LH8A 2ICSA 2DVTA 1ONWA 5G4HC 4D8LA 4DZHA 1FWEC 1YIXA 2Z00A 4UB9A 1V51A 2VC7A 5E5CA 1FWFC 5HMFA 1FWJC 4WVXA 4EPDC 4KESA 3S2LA 3E2VA 4IG2B 3RHGA 2I5GA 2IMRA 1KRBC 2QPXA 3LSCA 2PLMA 1V79A 4J5NA 3DUGA 3S2NA 1J5SA 3MDWA 4R88A 4XAGA 4LCRA 1POKA 2Z25A 4P5UA 3QGAC 2PGFA 3MJMA 4C6IA 1XRTA 4QSFA 3FEQA 3SFWA 3F2BA 1EJWC 1M68A 4IG2A 2WM1A 1PO9A 3LS9A 4HJWA 3MKVA 1EZ2A 4LAOA 2Z24A 2EG8A 2Z2AA 3AU2A 3OOQA 4IF2A 3WZ0E 4C6FA 1FWHC 4INFA 3MSRA 4KF1A 4G7EA 2QT3A 4ERAA 4XAYA 3QY8A 1ITUA 2Q09A 4QTGA 4XD6A 2HBVA 4B90A 2FVKA 3A3WA 3O0FA 1EF2A 4F0LA 4IFKB 3F4CA 4H9MA 1GKPA 3ORWA 4H9ZA 4IFKA 5FSDC 1RA0A 1IE7C 3LGDA 4C65A 1XGEA 2FFIA 2VM8A 1YRRA 1GKRA 4IGNA 4CEXC 1KRAC 4ZSUA 3F4DA 1NDZA 1UBPC 2FVMA 4IFRA 2Z2BA 1EJRC 3A4JA 4R85A 1POJA 1NDYA 1ADDA 4GBDA 3MTWA 4I6VA 1FWDC 2GSEA 4RDYA 4C6EA 4HA0A 3DCPA 1J6PA 5AKQA 4C6BA 2R1MA 4RDZA 3QGKC 2QS8A 5A6TC 2AMXA 3IV8A 1R9ZA 2GWNA 3D6NA 4L9XA 2VR2A 4C60A 2OOFA 2OGJA 4GX9A 3URQA 3HPAA 2HNHA 2P50A 1K6WA 4DO7A 1EYWA 2ADAA 4KQNA 3K5XA 3DC8A 4H9TA 2YB1A 2F6KA 2FTYA 4DNMA 3MVIA 1RA5A 1K1DA 3LNPA 2HQAA 2AQVA 4PBEA 1P6CA 3LA4A 1JGMA 2WJFA 3EGJA 3KM8A 4BKNA 1FWGC 1A5KC 2R1PA 2D2GA 3F2DA 4CQDA 2R1KA 3HM7A 3E0LA 2R1LA 3OVGA 1EJUC 4B91A 4J35A 1FWCC 1PTAA 3NQBA 3QY6A 3RYSA 4C6KA 2OB3A 1O5RA 4XD3A 3URBA 4CNSA 4G7EB 4CQCA 3GU9A 4BJHA 1GKQA 4H9VA 4F0SA 1KCXA 3GRIA 1RAKA 3AU6A 1I0BA 4LFYA 4R7WA 3MDUA 4DLMA 4QS6A 5LXXA 1QW7A 2A3LA 1UMLA 4C6CA 2KAUC 3TN4A 4LANA 3TN6A 1V77A 1KRMA 3UR5A 2WJEA 4C5YA 4H01A 5HMDA 3A3XA 2YZ5A 4LAKA 1KRCC 3GIQA 3TN3A 1A5OC 1YNYA 5FSEC 4XAZA 3EWCA 1S3TC 1WXZA 2Y1HA 1ITQA 1V7AA 4RDWA 2O4MA 1RJPA 3E38A 3O7UA 3GU2A 1A5NC 3HTWA 3IACA 4M51A 1EJVC 1W1IE 1V4YA 4LCSA 1A5LC 3R0DA 4IH3A 3WYZA 2P53A 2RAGA 3B40A 2GZXA 1WXYA 1FWBC 4GY1A 2OQLA 1BF6A 1UIOA 3ISIX 4KETA 1A5MC 4NG3A 4LAMA 2VC5A 4XD4A 4LCQA 3UF9A 1E9ZB 4HK6A 4UBPC 2UBPC 4DZIA 3S2JA 1PB0A 3LSBA 1R9YA 4C6LA 1M65A 4PCPA 2PAJA 3E0FA 3TN5A 2WJDA 3IJ6A 3UPMA 2EG7A 1RK5A 4EPBC 4C6PA 4HK7A 2Z4GA 3PAOA 3RCMA 4GZ7A 4I6KA 1EJTC 1FKWA 2OODA 3G77A 4IQJA 4OFCA 4HK5A 4CNUA 4XAFA 4H9YA 2YB4A 3PANA 2FTWA 2ZC1A 2D2HA 4C6MA 4RDVA 4WGXA 2AQOA 2PGRA 4C6NA 3ITCA 3UBPC 1A4LA 1R9XA 3GU1A 1K70A 3FDKA 3N2CA 1FKXA 2HBXA 3RN6A 3MVTA 5CH9A 3F2CA 4DIAA 3FDGA 4ZSTA 4GY0A 3OJGA 1NDWA 2Z28A 4H9UA 4YIWA 1J79A 3K4WA 1NFGA 1RJRA 1YMYA 2HPIA 3QY7A 1XRFA 4KERA 4AQLA 4B3ZA 4XD5A 2G3FA 4C6DA 4TQTA 2Q01A 3GG7A 3EWDA 4GYFA 1EJSC 3C86A 2E1WA 3WMLA 3E3HA 2GOKA 2R1NA 2O4QA 4PCNA 3IGHX 2BB0A 4IFOA 2PUZA 4C6QA 2Z29A 3B0XA 3LGGA 3GTIA 4J2MA 3NEHA 1FWIC 2Z26A 1ZZMA 3ICJA 4V1XA 3PNUA 3LU2A 1PSCA 4MUPA 4QRNA 3S4TA 1RK6A 3OU8A 4GOAA 3T1GA 1M7JA 2UZ9A 1A4MA 2DVUA 2W9MA 3OODA 4ICMA 3AUOA 3URAA 2D2JA 2E25A 4V1YA 3PNZA 4G2DA 4DI8A 4JOMA 3CAKA 4CQBA 4EPKA 3PBMA 3IPWA 4L6DA 4NI8A 3GTHA 1EJXC 3JZEA 4LEFA 1YBQB 3SO7A 3CS2A 3IRSA 3GTFA 2I9UA 2VHLA 2QVNA 4H9XA 4LALA 4GK8A 4GX8A 1P6BA
chains in the Genus database with same CATH superfamily
5A3HA 5JH1A 4TVDA 3LM3A 4CNTA 3QEZA 1YADA 4Y2WA 4JXCA 2ATMA 4MY9A 4RW5A 1LRNA 3VOCA 2WC7A 1VB9A 4UQCA 1IXPA 2BWGA 2W3ZA 1IXQA 3AXIA 3OA5A 5BRPA 4GGHA 5T9CE 2ZFAA 3S2MA 2D3LA 1GVYA 3W7NA 1J2WA 1MEHA 2GK1A 2NVDA 1CZ1A 4AX6A 2NX3A 3C6CA 2JEQA 3OQEA 3SQMA 3T81A 1XYMA 2HXTA 1UIPA 4OBRA 2FZ8A 3RITA 5HWMA 3R13A 1H61A 4A3RA 4UQBA 1QI0A 1TCDA 7XIMA 3IGUA 2NSXA 7ENLA 2BVYA 4P7RA 5FJJA 1FWEC 4GIYA 4ATDA 1UP0A 3R6IA 4OOUA 4DJEC 1B5TA 1A5UA 1UD3A 3WG6A 1ZAHA 2DUZA 1FWJC 3MWCA 4HCHA 1OCJA 3S2LA 3KBNA 3RHGA 4JQ3A 1Z41A 4R5EA 3M6YA 3W7PA 5I0DA 1HVXA 3A9IA 3I3DA 1POKA 4G1KA 4RZ5A 4ACZB 1QDSA 3EXRA 5LNUA 3NPXA 4UCGA 1WOBA 1UKPA 1K6AA 1YW1A 1R3YA 5EYWA 3BXWA 1V0NA 3UJRA 1QO2A 4I5RA 4ASTA 4INFA 4WXYA 1QNVA 2QT3A 3AMLA 2X0YA 3IS4A 5H1WA 5K9CA 3BOFA 1XDLA 4KWVA 1CB7B 2WMJA 5CSUA 1SFTA 3ARTA 1JCLA 4C65A 3FKRA 1RY0A 2VM8A 3B8DA 3RLVA 5LGZA 4Q8QA 1YEYA 4GYKA 4ZOCA 3RGTA 3MT1A 1TPFA 3LB0A 4XSMA 3P3BA 4JTDA 2WSPA 4R85A 2C15A 2G37A 3NUKA 4NZ5A 2ZDSA 2ISDA 3DH7A 3B03A 2JIEA 4ZTYA 2XUCA 4RPQA 4LUJA 4U3CA 4C6EA 1S5VA 2ISVA 3OZMA 1B3VA 3USBA 2NLIA 4LYQA 4UZUA 2UWFA 2Y5EA 1R9ZA 3GE7A 1W3IA 2GLKA 4K6AA 4PSRA 1C8YA 3BLKA 3H24A 4QG8A 2REQB 3W23A 1DYSA 1JCYA 2INZA 4AFYA 2FTYA 3BAWA 2OEJA 1K1DA 2HQAA 4FPSA 3KL3A 3EDFA 3W29A 3JU2A 3KDOA 3E5PA 2BXVA 3SCSA 2ZZ3A 3HO8A 2XYLA 2QEZA 2YFNA 3E6EA 2AAMA 3QY6A 4MHBA 4NRRA 4FNTA 4DWDA 1AG1O 3KFTA 1HF6A 3OHMB 4LY8A 3PULA 4DJFC 3FV9A 1Z42A 5LZLA 3ITXA 3O05A 4DF0A 2WLZA 4G5DA 4GBUA 4U5KA 3ZJ6A 1GVQA 3S1VA 2ZUTA 5DBUA 5EA9A 3BDKA 3W7RA 4PMNA 4X2PA 1Y5VA 1FWWA 1DORA 1MUWA 3AS2A 1IXOA 1IGSA 4DAFA 3EWWA 3GIQA 4PZVA 1JFXA 2J7GA 5FSEC 4MKVA 4JX6A 3MYOA 3C2VA 1FHUA 1UA3A 4GH3A 3GDBA 4DO5A 4EAYA 1YYAA 1LCOA 1SZNA 4HP5A 3W1PA 1A5NC 5D4YA 3AHTA 4M51A 3P5ZA 3CTTA 3M5YA 3R0DA 1DL3A 2NX9A 2OSXA 4JN7A 3NZQA 1UIOA 4E4UA 4NG3A 1W1YA 4EWND 4MKSA 3A4AA 3S3GA 1OQFA 1OSEA 1LBLA 2FDSA 4ILSA 5C6MA 4PUNA 1XBYA 2AOSA 3TAKA 4NNAA 3U48A 3W00A 2OTDA 1XQKA 1RK5A 2G95A 2EKCA 1GNXA 1F76A 3NQEA 2G96A 3QMTA 4BA0A 5C8BB 3CZJA 3GBEA 2VNCA 3GTNA 3B8WA 2R14A 3OGRA 3AIEA 1ISXA 4C6MA 4PCTA 2E5CA 1HO4A 1RQEA 5A5WA 2WVUA 2WZEA 3DC0A 5TBOA 2A7PA 1NVMA 1H7OA 1B3XA 4JDYA 4H19A 2GGIA 2FJKA 4O10A 4EKJA 5AYXA 4GI9A 1V8EA 1YMYA 3QY7A 2G8ZA 4HMDA 2DZVA 1JDEA 2FHBA 1Q6LA 3G0UA 4V28A 1EB3A 1XCWA 4FLSA 5FF7A 5AHFA 4XUYA 4IUOA 3WSUA 4C7DA 3ZSSA 4V1XA 4IIEA 4X9YA 2WHJA 4ICMA 3TTSA 1GQJA 3DBNA 2DZXA 2BV9A 3ARYA 3MMTA 4S23A 3BMXA 3JZEA 1W1ZA 4GNVA 2WYSA 1OX6A 3U7BA 1E9LA 3R2GA 1CX9A 4M24A 2WNQA 3A9BA 4MPKA 4MYAA 4L64A 1LWHA 3DG3A 4LOCA 4CQ9A 1XLGA 4HA3A 1VLWA 1M41A 1S5WA 2SFPA 2X0SA 2PDXA 2XINA 4DZ5A 4FAMA 1AODA 3CH9A 2PWGA 5D03A 3IANA 3AC0A 1QXLA 3TJXA 3SADA 2RH9A 4QROA 4BEUA 1C8XA 1JF5A 3V0SA 4BQ5A 1IR1A 4MDPA 3AMDA 1MZRA 1W1A1 4US5A 4N4QA 3HFTA 5G4EA 3P60A 4F40A 1XW8A 3URNA 4IP7A 4M5PA 4FOUA 1TV2A 2ZQ0A 3GVRA 1KQZA 9RUBA 2DVXA 2HXUA 4NP7A 1KM5A 2VTFA 5KINA 2DT3A 1EBHA 2WNWA 3U4AA 1RCOB 4KW2A 3OBAA 2ZADA 2P5NA 4UC5A 4UTJA 4D1IA 1KTCA 4I90A 1EX5A 3BG3A 2PLMA 3GKFA 2VRQA 5HK4A 2PA6A 4R88A 2Z25A 4JQ4A 4DF1A 1LRTA 2Z2UA 4YVXA 5CG0A 3QMSA 4AD1A 3L68A 4H83A 2PWHA 4L4LA 5AOUA 5AC4A 1TZ9A 1DIOA 2QYGA 3LTPA 3K1GA 2YW3A 3V5FA 3WZ0E 4Q4OA 3WN6A 3EOSA 2G5WA 2WVTA 2HSAA 4UTHA 1XLMA 3W7CA 4BF5A 3STCA 2Y5SA 3W76A 3WUEA 4XZNX 1ZLPA 4QBXA 4A3HA 1OX5A 5C9ZA 4QAWA 1IE7C 2HISA 1NQKA 3N13A 4CNOA 3QYSA 4OHQA 4XZWA 2V82A 3II1A 3ZVHA 5D30A 3PWGA 4PRRA 3A4JA 1XF0A 4E0CA 2CBJA 3FOKA 3IIVA 3NQMA 2EKGA 4UTTA 3GDKA 1YPIA 4P7NA 3ZMRA 2QIIA 1PVNA 4GUIA 4WD0A 3VE9A 1I60A 3HPFA 8XIMA 1F8MA 1U5JA 1BXNA 3WF1A 4EE9A 2QMKA 2PBGA 1XYFA 1SFSA 2YSWA 1XL9A 3UWYA 5LIUX 2VEIA 3KCJA 4NHVA 2XSXA 2GL5A 4LY4A 3ZJ7A 1SW7A 5J5DA 4IPNB 4NYUA 3NQ2A 3EDEA 1CGWA 2WANA 4JX5A 1LWJA 1CGTA 3B9EA 2R1PA 3CAQA 2D2GA 3GR8A 3JR2A 2HZGA 3WD2A 3OVGA 1AUSL 3GYEA 3I6RA 4OZOA 3LCXA 5M5DA 3WUFA 2PD9A 1RALA 1ODZA 1TIWA 3TYZA 2CLFA 1KXTA 1OWQA 1TA3A 4J3VA 2G50A 1LL7A 3WDIA 1TELA 1B90A 4AX7A 5KEZA 1A47A 1XKYA 5M2FX 1QW7A 2QPSA 3W74A 2W27A 3CNYA 3W2JA 1ALDA 4C6CA 3RLUA 4IMDA 3T4CA 2WMKA 4YCOA 2E4TA 1PZ0A 2J25A 3CUXA 2WQPA 5CGMA 2BBFA 1TVNA 1ZAIA 3QR1A 3VM5A 3WLMA 3DFOA 9CGTA 3A4XA 3MUIA 2XISA 2HK1A 3H6OA 1OF6A 1W2VA 4H1ZA 3M0VA 2XIMA 4YPJA 1X98A 4LCSA 4GQRA 3KBJA 4QNEA 3TW9A 3T2QA 1LP6A 3K4AA 3PB0A 4Q7NA 5EPDA 3ARUA 1VFHA 4XKMA 2QZRA 2ZZ6A 1E9ZB 1JD7A 4DZIA 1EWDA 3SY8A 4FMVA 4GGBA 2OZ3A 4JFSA 1PZ1A 2OELA 3LQLA 4IL0A 3SSJA 2Z1SA 3SRFA 4JD4A 1YKWA 3I4KA 5ABHA 2D2HA 3BLIA 1P0KA 1G7VA 4GG9A 3CO8A 3NGFA 3SY1A 4J4KA 1TPWA 2ZVRA 3N2CA 4DO6A 2P0OA 3GVGA 1T0OA 2ZX6A 2J4GA 3WO8A 2W79A 3S47A 3PHAA 3OJGA 4GHRA 3LHUA 4KGJA 1NDWA 5EMKA 3ZVHB 3G22A 3GQYA 1NFGA 2FZ9A 3DBPA 3KLKA 1S1RA 3R7MA 1P0NA 5HA7A 1VFTA 3T0DA 2IKGA 4GH1A 3ARXA 3PUEA 4FB7A 4OWGA 1B57A 1ZP3A 1PX8A 2CU0A 3LXBA 3PBVA 3BARA 2PU1A 3SRDA 3HGOA 3B0XA 3RPMA 2EJAA 1KTNA 4H6QA 1V6YA 2MANA 1AQHA 2YDSA 3UT0A 1F74A 3PBYA 3BOXA 3TU9A 4AU0A 5MF5A 2C3ZA 3BW4A 1LTDA 1G4PA 3PNZA 3VVGA 4QJ5B 4QQUA 4POCA 3QGVA 1J4EA 4BFAA 4ROQA 2NWRA 1FCVA 4GK8A 2W63A 1W6TA 1TQXA 5AC7A 2Z7KA 4UFMA 1CEOA 2GQAA 1Q85A 4J3ZA 4WHBA 1FFRA 3AIQA 1WDRA 2CIPA 3AXHA 3SCUA 2RDTA 1P4CA 1M03A 3OQ8A 1GPFA 3GC4A 2OQHA 3VTRA 1B3ZA 5I79A 3VAVA 1H1ZA 1XIGA 2D20A 3D3FA 2I56A 4E5TA 3TNBA 3V7PA 2VR5A 2E5BA 3BGJA 3SY5A 5CPTA 3WKZA 4G9PA 1R6WA 1DP0A 3CL6A 4OV4A 2P1FA 4HU8A 1W5MA 1P1XA 4YNGA 1NH6A 4DJFA 1H5VA 1A3WA 1T7LA 1NSJA 3L4ZA 4RZBA 5CBBA 1V6UA 4RV8A 3NO3A 3KEHA 2Z1WA 1PPIA 2XFFA 4JNMA 4JTJA 2ZKMX 4DZHA 1VD6A 4LS1A 1EP2A 4JTSA 2J24A 3W6LA 3EEGA 1SZFA 3LPGA 4X3ZA 2IMRA 3TW7A 5A6LA 1R3SA 3QKZA 4TTGA 4U4MA 3R1ZA 3BJSA 3KTSA 1BTMA 5C2XA 1CLVA 4AUBA 2XM1A 3GO2A 1GOKA 3KTXA 4K36A 2BOFX 3OG3A 4NT0A 2D1ZA 3V1PA 2NX1A 3NQ6A 3QSRA 4AISA 3NL3A 5DY2A 3IIZA 5A6MA 3VKBA 4WJXA 1GZ1A 3AQUA 3QTGA 5DX7A 1MQPA 2Z24A 4FXFA 3L7RA 1GW9A 3TC6A 3REQA 1Z32X 1YX1A 4DYEA 4OUEA 3N9KA 5F4XA 4QLKA 4YTSA 4W8AA 3LN3A 1OFDA 3STEA 4H7CA 3HFYA 3VZZA 1EDQA 1CLKA 3RRXA 3UY7A 4QG9A 4IIHA 1PKNA 4NJGA 4U31A 1FWTA 3MMUA 1P6WA 3VMOA 4QIUA 2PC4A 4F0HA 3QV8A 4IGNA 5A6BA 3VGGA 4PTMA 1DBTA 1RD5A 1UD4A 1VIZA 5BROA 1Q6EA 2CHNA 3GK0A 1XUZA 3W3OA 3MP3A 4LUTA 1V3IA 5AY7A 3CUGA 1E4MM 3O16A 3COTA 3H53A 4S2BA 1J2BA 3AIVA 1UR8A 3I3EA 3QPEA 4KGLA 4W88A 4V33A 5E6ZA 3S6DA 4GJ1A 4NXSA 1IT7A 1THFD 4Z1AA 2BOEX 1IZCA 1DJWA 3GSMA 5GJNA 1E1CA 4PRTA 3MV11 3QQ0A 2CXEA 3O6DA 1CWYA 1RA5A 3BAJA 3UESA 3WLTA 2E77A 2ZYFA 3BLEA 3PJUA 2QF8A 4RE3A 3WH5A 2QDDA 4I7WA 3K30A 3WNNA 3HM7A 1FH8A 4LX4A 5JQ9A 3HBLA 3SUUA 3W28A 4CNSA 4XB3A 1OD8A 3HG3A 3GU9A 1WKDA 3SGGA 2X2YA 3OTRA 3FKKA 1IYXA 3GDTA 1XGDA 3UYIA 1NFBA 1K7FA 1TRDA 4TOQA 3MDUA 3NOYA 4RNFA 2PP0A 3GR7A 3SFKA 4QEEA 2WC4A 2KAUC 4P61A 3B4UA 3MUZ1 3GH7A 1JYNA 1KNWA 3UR5A 1ISZA 1O66A 1P48A 3DERA 4YYCA 2RDXA 4MMWA 1W9PA 4K7YA 5D04C 1RR2A 3OBKA 2ZX5A 1WXZA 3RCYA 2O4MA 2XSAA 3WNLA 4GUJA 4U33A 5EMJA 1WPCA 3F1QA 3PZTA 4I9MA 4JTLA 3WYZA 2P53A 1VJIA 3QFWA 4GKTA 4JEJA 4B5VA 3L23A 1WXYA 3W2KA 4O1FA 5LSMA 3STFA 4KWOA 1XYAA 2POTA 5I02A 5G5IA 5FCZA 1U1HA 2JKAA 4ZCWA 3RUBL 3KRBA 4R34A 4GFIA 4S3KA 5GJMA 5FAJA 2PDKA 1GQLA 3BANA 3M0HA 1V0MA 1G5AA 3WFAA 1S5MA 1ZU8A 1Q5MA 2G3IA 2X41A 4MUZA 3EZ4A 3SQSA 1UP3A 2EAWA 3GKAA 2VFHA 3RCMA 3UWWA 3DG6A 5M17A 2VZSA 3F7JA 1BKHA 1J5TA 3SEPA 3DFSA 3NZGA 2WHMA 1FY6A 5CZ0A 2CLPA 1GCYA 2AQOA 3IAPA 1S2AA 3N29A 3LD5A 3OLIA 1FWSA 3GU1A 3CWOX 5TF0A 3SUTA 3VCRA 3K13A 2IQDA 2YLLA 3HMJG 1RPKA 5AYZA 3H70A 3SRKA 1H0IA 4ZEPA 3WBEA 3KRUA 4OV9A 4DHGA 3ITVA 4AHQA 1BQGA 1KCZA 1EJSC 1XRSA 3CPUA 4S38A 5XIAA 2PDGA 3POCA 4MNLA 4HZ8A 3BGAA 2ZX8A 4XKYA 4C6QA 2Z29A 7A3HA 2CKRA 4J2MA 1FWIC 1XLJA 1YTDA 1U5VA 3LU2A 4LRSA 1TV3A 4NF7A 4L1GA 4GI6A 2AMGA 1EOKA 3WQFA 3ABRA 3WQ4A 4O15A 3GXFA 2OT1A 1PJ9A 2X1IA 2E1DA 5A8OA 4J3WA 4LC6A 4DBSA 2DQWA 2NLYA 1E5JA 5GNXA 2QCGA 3GTFA 2ZXQA 2QVNA 4LALA 4B3KA 4FS9A 4DXXA 2Q02A 3VOGA 4Z1BA 5HNRA 2HVOA 1TMHA 4KCWA 3E2SA 1ONXA 3CLWA 1DJIA 1OGSA 3OIXA 4XWUA 4B2DA 2GUBA 3NPWA 1Z6KA 5FESA 4KCUA 3TWAA 1BHGA 2V2HA 2YBVA 2E68A 2UY3A 4NZCA 4P8WA 2PDUA 1ECQA 1HXJA 4XVEA 2WBKA 4AG0A 4Q8UA 5IFPA 3WJYA 1LBFA 4EF9A 5AYYA 1OX4A 4CN6A 4MWAC 4WKAA 3UZYA 3T8QA 4DUOA 1JG9A 3MSDA 1OYCA 3GIPA 2QUMA 1PS9A 3M7WA 4E4PA 1HZYA 2Y24A 4A8LA 2BLEA 4ERGA 3FJNA 1XIMA 1REQA 3SR7A 2WXDM 3HF3A 2GSHA 3EB2A 1F5ZA 4GVIA 4UR7A 1HN1A 4A3YA 3P7YA 4C6JA 4JIPA 2A0NA 2FKPA 3W7IA 3KWXA 4DI9A 3T8LA 3C2EA 4M1RA 1QI4A 4IGMA 3N04A 1NWRA 2W4XA 2BGNE 1RSCA 4LUSB 1JL8A 5FF3A 3WK1A 3E1F1 4K1GA 3NFUA 2TODA 3TQVA 4GIRA 3UZXA 1RBLA 1PEZA 2B7QA 3TSDA 3R94A 4LU0A 2B7OA 3DHPA 5HR7A 2X2GA 4DWSC 3VIPA 3TE9A 1XSIA 4O18A 1QOPA 3L4UA 1HTIA 4K8HA 1WP6A 1BYCA 1R7OA 2VEGA 3TNOA 4I8YA 1EF3A 1JNDA 1UH2A 5ABFB 4W86A 1ISWA 3B04A 2E6DA 3CQ0A 1H4PA 3OO2A 5G1YA 3W2UA 2C1IA 3LHVA 3UWUA 4X9SA 4DX3A 2W66A 5AVHA 4UMAA 2HBVA 2G4FA 2V3GA 3QQWA 4B90A 3LG3A 4ZFCA 2VGBA 4EF8A 4UOJA 5E09A 4MAZA 5HJXA 1RA0A 5EBUA 1TSIA 4O19A 4C7GA 2V63A 1D3GA 1K9EA 1JDFA 2QCDA 4HJFA 1NDZA 1V02A 3O63A 1U22A 4P8XA 4Q8NA 2FVMA 7CGTA 4N02A 3TXZA 4KWWA 2OSWA 4QFUA 2ACQA 4ZQRA 1B2YA 3WQ6A 4XAPA 3NVDA 5ECUA 5I3JA 3EX6A 1TRIA 2V5KA 4O16A 1TMQA 2QJIA 5AKQA 2XGZA 4RDZA 1UD6A 4ZA0A 4AZCA 1R8LA 3IJ7A 3R11A 4Y6GA 2ZRXA 1OC6A 7ODCA 3EAUA 2GGGA 2YKKA 1JCJA 2ADAA 4HA1A 4TX9A 4FA3A 1GTHA 5D02A 3UNDA 2F6KA 2VD9A 4FLQA 1GEHA 3QC3A 1VGAA 1SJCA 3BQ6A 5GNZA 2A21A 3WLSA 2C19A 3NWRA 4HHHA 3LHYA 5KITA 1MW3A 5LHFA 2OX1A 3PZMA 3KVJA 2Y61A 1L6FA 1U5HA 3BSHA 2VXNA 4W8LA 5M3WA 3F03K 3CBWA 3POHA 4ACYA 3KBSA 5CLWA 2E8YA 4GQBA 2QVHA 1F73A 3UQNA 3N11A 4HCDA 3GLCA 4C1LA 2NV9A 3E0VA 4TVUA 4OT7A 1QBAA 3DEQA 4MNMA 4GACA 4IISA 1ECEA 1N8WA 3UPWA 4JYDA 3VNMA 3LLFA 1S2TA 1W1VA 4QQ3A 5CJ5A 4Z08A 3WDQA 1PAMA 1XD0A 3LXAA 2E0PA 1OT2A 3E38A 3TK7A 4U28A 2ESCA 4KWSA 3GU2A 4JTKA 4LSBA 4N9EA 5HQLA 3JS3A 4JTIA 3AXXA 3CMGA 1W1PA 4OGZA 4PCSA 5C7HA 4F9JA 3NPVA 4HYWA 2B4GA 2CBIA 4LAMA 4PMXA 3T2OA 2XM2A 3Q67A 1NTHA 4WKHA 4FLRA 3KVKA 1BYBA 1H7NA 3ALGA 4EIVA 1XSJA 3BG9A 2BTMA 3GS6A 1V0LA 1A80A 2QCFA 2PAJA 2WJDA 4N9CA 1KV5A 3L4TA 8XIAA 2Z4GA 3PAOA 4GZ7A 3G77A 5I3KA 3NO5A 5JMUA 3JRKA 4Z17A 2GJPA 3GWQA 1QRQA 1CLXA 4IIFA 1EO7A 1PXGA 3UXKA 1ZFJA 1M7PA 3LPPA 4QISA 4IGSA 1H49A 4RL3A 2DDXA 2DW6A 3Q58A 3WEOA 1K70A 3BV7A 3EX2A 1PTGA 3UG5A 1D3CA 1E5NA 4GCAA 1EFZA 1TCMA 5CPLA 3WF2A 2Y0FA 3CK5A 3AIWA 1O5QA 3VC5A 4CCDA 1AL8A 1W9DM 1I2PA 3EWDA 4ZR8A 1JGIA 4AIBA 3ZVIA 4L56A 1VZWA 3C0QA 1F3EA 3KOFA 3NNTA 2HWGA 1SO6A 3PG9A 2OKOA 3UETA 5I6SA 3VIOA 3ITLA 3OODA 1D9EA 1QASA 3H7VA 1G4TA 4LBUA 3SJ3A 1KA9F 3A47A 2J8TA 3U3HA 3VIHA 2QCEA 1BXCA 4LEFA 4ROPA 1XIIA 3P62A 5C7VA 3AYRA 3UWQA 1WCGA 1E1EA 3DKLA 1TPH1 1V0KA 3CT2A 3N6QA 4US6A 1F2JA 4GXWA 3WIJA 1U83A 4Q8VA 1V6WA 4UR9A 4XZMX 5BNKA 5CSSA 2WB5A 1HJQA 4EXBA 4F0KA 1U1UA 4R33A 2XG9A 3RX2A 3TSMA 2V2DA 1PV8A 2HDJA 4GC3A 1UBSA 2XFRA 4B4HA 2PWFA 3FLUA 3VFCA 2BDQA 2HMCA 3MHUA 1UPMB 3A12A 3NOEA 1F4AA 1B9BA 1I0DA 1FWAC 4PBFA 3TJIA 3LX9A 1P7TB 2RKXA 2PRMA 4KEUA 3CYVA 2ZCGA 3KAOA 2VO5A 1NOFA 1IT8A 2WPBA 1S39A 3NQDA 3CL8A 1E51A 2DVTA 4BI6A 2WZMA 3IJIA 4ZVJA 5AYIA 1VHNA 5CPMA 4X2RA 3AROA 1XLKA 2GDUA 4QNWA 3AYVA 3W24A 4E2OA 3EDJA 2YGYA 4FK9A 2BY0A 2YCJA 3RG6A 2CLOA 1S1PA 3S2NA 1EEXA 2OYLA 4UNIA 1KFBA 1ZBWA 2GJNA 1JDAA 3HG4A 3P61A 1JFHA 3F2BA 1EJWC 3RCNA 4B9ZA 1XXXA 3CMJA 2XVGA 4LAOA 2DJLA 1FH9A 2ZXAA 3UJEA 4LVBA 3W02A 3PZVA 4YYFA 2QUTA 4TU1A 1K03A 5BRBA 3TIMA 1GOQA 4M82A 3LCLA 3BGGA 4XAYA 4UOZA 3UY8A 1XCFA 4MOZA 4WDXA 4AW7A 1I1WA 2VFIA 1D7KA 2E40A 4JBRA 1XLEA 2DORA 4IPLA 2OT0A 4GJIA 4IFKB 3W72A 2WLYA 5A6AA 2CXGA 3T9PA 1XGEA 4CCEA 5E9XA 4Z1CA 4AAJA 1EZWA 3LRLA 2VDIA 1JPIA 1J01A 4UNKA 4PEEA 1JDCA 3P74A 3BURA 3NPUA 5I77A 5I06A 4QLJA 4PTVA 2WWCA 4JNZA 4MIMA 3MBDA 1C8QA 4QE5A 2GSEA 3LV5A 2ZWYA 4HA0A 2H3BA 1TTQA 2DJXA 2ZXBA 1UWTA 3W87A 2A3HA 2OOGA 3P67A 3IVUA 3IV8A 5A95A 3EPNA 1TPB1 2HNHA 1TFVA 3I7SA 3O15A 2V3DA 2VX5A 1EUNA 4M81A 3WLRA 2YX0A 2F38A 1RD6A 3LNPA 2AKMA 2YL8A 4A35A 2YCLA 2W92A 2F7FA 2WSYA 4XO6A 1XYCA 1ADOA 3FGCB 1H41A 4RNJA 3D3AA 3LEPA 1EJUC 5CC5A 1WE5A 4J35A 4BF7A 2QF7A 5GPRA 3WD0A 2O92A 4WOQA 2D3NA 1S2WA 4LB3A 1O4UA 3MBFA 3UERA 1JPMA 2XJ7A 3GG1A 4BJHA 3TLLA 3CH0A 3NGJA 1KCXA 2C6QA 3VIJA 4B5SA 4MPQA 1AQ0A 1LRQA 1P0BA 2P0IA 1O6IA 3GVVA 4QS6A 4B3LA 1W31A 4PYSA 1UMLA 1W5OA 2BGQA 2OO0A 3B8VA 3TN4A 4OVXA 4ECLA 4Y7EA 3VILA 1KGWA 5HMDA 4A2SA 3I4EA 4UQEA 4AZBA 1BPLB 4KCVA 3BJTA 3R58A 4GA8A 5SWUA 3ABOA 4EXAA 3N12A 3UR7A 4QJ4B 4E4FA 3CT7A 4WEVX 1ZY9A 4LS0A 4UFHA 4A2RA 4H8HA 1V03A 3P0WA 1W8GA 4FNUA 4S2CA 3AS1A 4NJKA 5EKYA 1V3LA 5H2ZA 1F3XA 3V4BA 5CSRA 3R8GA 4OU1A 1GQKA 4P7LA 3VOIA 1FDYA 1IZJA 1J93A 4E8GA 3DYOA 2QQ6A 3AAMA 4F2BA 5EY5A 2XU2A 2H9AA 3CV2A 4S3AA 1FCBA 1F9CA 1P5BA 2POZA 4JKKA 3BO9A 1US2A 3WFLA 5HNNA 1AZ1A 3CZEA 2NXIA 4XX6A 2J74A 5D9MA 1HJWA 2OODA 1P7TA 3QC0A 4HK5A 3FAXA 2YB4A 3PANA 2YR1A 3M64A 2D24A 4IQEA 3CB3A 3KOWA 3BLFA 1A5CA 1LQAA 1WV2A 5BW6A 1A4LA 3PP7A 2HBXA 3PJXA 1DTUA 4G8TA 4JTUA 2QJJA 4KWUA 5A69A 2Z28A 4YIWA 1DE6A 1IEIA 5IHSA 5DBTA 2XVLA 3TTEA 1PCKA 4C6DA 5A8MA 2MUCA 3JZUA 1E6ZA 3WK0A 1FOBA 3U9IA 2W6RA 1XPGA 4ZO8A 2O4QA 4I3GA 1GOMA 2PUZA 1E40A 3FN9A 3GNDA 3NEHA 4GO9A 1JPHA 2V6AA 2QGHA 4TMCA 5B7YA 1HVQA 6XIAA 1U30A 2CHRA 1KGXA 3RM9A 3WL1A 1M7JA 2VEFA 4FHAA 2W9MA 3LLDA 2NQ5A 3WMSA 4MFEA 1QUMA 1WX0A 4U2YA 3SZ8A 4DWSB 4G2DA 1TIMA 4QP0A 1PE1A 3IPWA 1AMYA 3VD4A 1EJXC 3B8UA 5J04A 2EJ1A 2FPVA 1A0CA 1R3QA 1CNVA 2VHLA 5G4WA 2GGEA 3R25A 2XIOA 3L0NA 1US3A 2Q6ZA 4K68A 5MKGA 4YCPA 3EA2A 3CGTA 2VCCA 3IWPA 1JZ5A 2DSKA 4JYFA 4ACZA 3TYEA 4AVFA 4EPEC 1QTWA 1A53A 1GVSA 2GJXB 1QMLA 3WNKA 4AVNA 1XUUA 4W7VA 3SBFA 1SJDA 1OIFA 4K8GA 4ZTXA 3VIFA 1R87A 1SZRA 3A5FA 3ALFA 3GG8A 3ABSA 1FHLA 3MPGA 2GWGA 3GHRA 4JGDA 1XV8A 3WMBA 2DV0A 2O56A 4FR1A 3MUXA 3QKEA 5AC6A 4PRWA 4KEVA 3IARA 2X7WA 4C5ZA 4O0KA 3RLHA 1I75A 2QCCA 2PWVA 2R6OA 3PPHA 1TWSA 2VC6A 1ZJBA 5B80A 3PTQA 4JTFA 4C1NA 4GLEA 4C90A 4Y8FA 4L80A 5D38A 2OQYA 3Q37A 3VYLA 3LHZA 4Z2JA 4UTLA 1KM4A 1IWPA 2BSLA 1CT5A 2C16A 2WSRA 1TUXA 4UTTC 5A2AA 4UZSA 5F1VA 1S38A 5CZSA 3DAQA 2PRLA 4G7EA 3C52A 4ERAA 1VRXA 4DVOA 5E0KA 2Q09A 3EX3A 4BI5A 2AAAA 2ONEA 3GAYA 3EWZA 3QHOA 5K2ZA 1DWHM 3N6JA 3O2LA 5FSDC 2WCAA 1GZJA 2IPWA 2IPJA 1WQ5A 2GVGA 3V0UA 2X30A 3USZA 4NAFA 1R86A 3QF0A 4M19A 3G0XA 3YPIA 2BP1A 1AA1B 1I2QA 3WJZA 1W5NA 2XSBA 3EWYA 2ZUMA 1YXDA 4GISA 2WMGA 3ARWA 1T99A 2NQZA 4FALA 3G3DA 3WD3A 4PL2A 4IIGA 3M44A 3W82A 4C6BA 2WV8A 2C18A 2IXVA 2R1MA 2VGIA 3C56A 3NSXA 1V3KA 3CPRA 4LTSA 3DU0A 1VF8A 1A5SA 3QV6A 4WXZA 4GD0A 1ISVA 5I07A 1JD9A 3M1ZA 1IHIA 3XINA 1LQ2A 2RHGA 2CKSA 1KR0A 5F2GA 2D0GA 1E15A 3F4WA 3C4UA 1R46A 2XDFA 2GPTA 3LPOA 3GY1A 1B1YA 2IPFA 2Z1VA 4PGLA 4P7QA 4B5UA 4EXQA 1EXPA 3BWWA 3WBYA 2ATSA 3S9ZA 4LUSA 3WQEA 3FHQA 1TPEA 4D6JA 3TC3A 5F4SA 2R1LA 1BXBA 3EKZA 1JEZA 3H7RA 2NVCA 1HP5A 2ZZ4A 3M4HA 4LVDA 2X1TA 4O8RA 1XC4A 3VNZA 3S5OA 4HZMA 1KW1A 3NA8A 1Y0EA 3KL5A 4F8XA 1KM2A 4A05A 3WX7A 4PMDA 1VC4A 3QV7A 1W1B1 2PCQA 1AMKA 3WQDA 4W85A 4HNTA 4C5YA 1YE6A 3STPA 3A3XA 3QQ1A 4BI7A 3H2CA 4QEHA 5D37A 5EL1A 1FA2A 2XHYA 4DYJA 1XC6A 1IQ8A 4B4FA 4AEFA 4XBKA 2GDQA 3EB3A 3ZT6A 3HA1A 3UXLA 1W1IE 1LOSA 2GSJA 2PDPA 2OWCA 3K46A 2PE4A 1TG7A 3TQ0A 4S1FA 4GVHA 1ICSA 5BYWA 3APGA 1CB2A 2CW6A 3NQGA 1BQCA 3S5YA 1DJNA 2OZ8A 4Q8WA 1YXYA 1RP9A 4LXFA 1JZ4A 5D9OA 4W8BA 3LOTA 3B8TA 1MI3A 2VOTA 3W1MA 2O9PA 3EOEA 4W9TA 5ABGA 2PDQA 1M01A 4HK7A 4JAWA 4MDOA 4EWJA 4HU3A 3VABA 1CXFA 1EPVA 4JCLA 4IQJA 3OYXA 3QMRA 1B9ZA 1J0HA 5FKYA 1AH3A 4W7WA 3HMCA 4FX7A 4I7VA 1MYRA 1WZMA 4L4MA 3VKJA 1O94A 4WGXA 2XZ7A 3WCZA 3A5VA 3D0CA 4PR4A 3B9NA 2CITA 1EDTA 4JFUA 3EDDA 2X09A 4IMFA 3MVTA 4FP1A 3J7HA 2NT0A 1W37A 1K8XA 3AWNA 3H54A 1VEPA 3RX3A 1HUVA 2YOCA 1RJRA 4AQLA 2EF9A 2XVPA 2J27A 1B4KA 1Q45A 1E6XM 4O4VA 3PAJA 4IT1A 2FJUB 3E3HA 2OJPA 3APTA 1JAEA 3WLNA 3BPWA 1XFBA 4R3UA 3LBOA 3OIHA 2VDGA 2J75A 2VYOA 1EH9A 4R7OA 4UMBA 3BV4A 1SYTA 4FNPA 1ESWA 5FJOA 1ZCOA 1G1YA 2UZ9A 1A4MA 4P8VA 3MA8A 1RCXB 3BZGA 2E25A 4MADA 2INEA 4LWWA 5FEZA 3T0CA 4LC8A 1JRCA 3CAKA 5F2LA 3EBVA 3SCVA 3AICA 3SSZA 2DSUA 1H0GA 3QTPA 4O4WA 3SO7A 3LBMA 3N2BA 1CECA 1GK8A 4NILA 5FIPA 2ANUA 2EG6A 4HMNA 1UZ1A 2Y8VA 3LZ3A 1R7AA 4HSOA 4DBEA 4PODA 2CZVA 4CD7A 1S5TA 2HPMA 5CZTA 3AZTA 3NURA 3WELA 2QV5A 1JCMP 2PWEA 2FGLA 1N8IA 2J9ZA 5I3HA 2P8BA 4H00A 2VVNA 4MKNA 2YXOA 4QCFA 5HPCA 4XV0A 4HHLA 1CGUA 1Q7MA 1QJWA 1DPMA 5AHMA 4MLJA 1YNQA 3TKFA 3CZGA 6A3HA 1TZZA 4Q22A 5HJYA 2RJGA 3PUOA 1H60A 5JIPA 3ARPA 3W1LA 1JCTA 1XYBA 1K8CA 4ORIA 3GTXA 3I68A 3PZGA 2DZAA 4MWAD 4U2ZA 3C2OA 5HMEA 1TE6A 3T55A 2DT2A 3D5HA 4QR6A 3FCPA 2OLAA 3EKGA 2ALRA 5I5RA 1ONEA 3G6MA 3TUUA 1XRVA 1B30A 4XZIA 2ACUA 4KPLA 1JNEA 2ZZ2A 3NCOA 1LT8A 4G6CA 1FUYA 1Z9AA 1LORA 1XSKA 4C6IA 2Z0IA 4CCCA 3SECA 2QUVA 1KLYA 3HGJA 4IG2A 1FP9A 5DANA 1ITCA 1V7YA 2ZUNA 3N6HA 1EZ2A 3DG7A 3WBWA 1K9FA 4URIA 3SW6A 3I7QA 2EG8A 4IF2A 3LRMA 1FWHC 1C9DA 3S83A 4KF1A 1PDYA 4WDUA 2ZICA 4P7OA 5GVJA 4XBSA 4GZIA 4XD6A 1GWJA 5FJRA 4U10A 1EF2A 1EOMA 2GGJA 4H9MA 1GKPA 2J9XA 2J8FA 1HGWA 4N9BA 3WLKX 1Z69A 3HOJA 4OBSA 4FF5A 3NQVA 1OBAA 5LA2A 5DT7A 2BY1A 4FXRA 4CQ8A 3L9CA 4ZE5A 4TIMA 5A8PA 1IIGA 2B31A 3P5YA 2PF0A 4HIBA 3UJSA 4H6KA 2FGBA 3G8EA 4CNNA 1W0MA 5AHNA 1ZJHA 1OADA 1RCQA 3B9DA 1J11A 1LOQA 3E2RA 1ZTVA 3BMWA 5A6TC 3RMJA 2UV8G 1XBZA 1UOZA 4L9XA 1BD0A 3GXTA 3NR0A 4JS3A 3VX0A 2I17A 2ZZ1A 3NXFA 2PLCA 3RAOA 3W22A 4PB3A 1N2VA 1TJ0A 4HBKA 1WDSA 2FH8A 4QLLA 3W7LA 3VMPA 1RV8A 3VGEA 3W2NA 1H11A 2I5QA 5FJPA 4YS1A 4CQDA 1JJKA 1O5XA 1TJRA 1UR1A 4DNHA 4B91A 3VKAA 3PG8A 5DN1A 3P82A 1UUOA 2QXWA 3CZKA 3VINA 1HO1A 3ARSA 1NWSA 2VCAA 3TYAA 2NUXA 4RR4A 3WL0A 1KTBA 3BLOA 1SGJA 3RIKA 5HNUA 3GHUA 3N17A 2R94A 3QHMA 4DLMA 3EWBX 2YW4A 2A3LA 2QCHA 5DLCA 4FIRA 2VFEA 1XIJA 3IJLA 1UJPA 3FXYA 4JDBA 1C7TA 1KRMA 3DYMA 3N18A 4I9AA 4REQA 6ALDA 1S2VA 3QHNA 3VNJA 3GDMA 4XAZA 2PBOA 4LF1A 4WJ8A 1RJPA 5LKYA 3W0KA 1DHPA 2FDMA 3NZ1A 2J7HA 1HQTA 3HTWA 4GMEA 5HULA 1RUSA 1UR0A 1FDJA 4X0NA 2C0AA 1KBLA 1NOUA 5MKGB 1C7SA 1SO3A 1CGYA 2G4JA 2EPKX 1E6SM 1LJYA 2RGLA 1T41A 3DGRA 4CU8A 4O1EA 2J88A 4XISA 4RX0A 2C91A 5FEPA 2A6NA 1R9YA 1MFUA 4JL1A 3L5MA 3EA3A 2BHZA 3BLDA 2EG7A 3NDZA 2TAAA 2ZVIA 4RKAA 5FAGA 3GNRA 1V02E 2XZ9A 4G1NA 3AIBA 4I6KA 3S0CA 4DBDA 3ABZA 5D2TA 4G56A 4LRTA 4FO4A 3PTKA 4O14A 2B7PA 7REQB 3VD9A 2Y7EA 3WJWA 1XCXA 4XO7A 1EP1A 4WUIA 2F8QA 1A3HA 5AFDA 4QGCA 3OLEA 2CYGA 3VX1A 4HPGA 4W4QA 5C9XA 3WF0A 2Z1KA 1DWIM 3FDGA 4MNJA 2IW0A 3V16A 4DUXA 4AZ5A 2PGEA 2OEKA 3FIGA 4DRSA 4FF7A 1IV8A 4DAIA 3K4WA 1CYGA 3WEZA 1EGVA 4O1CA 4JEQA 3SURA 2NT1A 2WC3A 1HKWA 2ZTJA 1GVIA 1TR9A 3L2MA 3U2OA 3FX4A 2PZNA 3MHFA 3M5ZA 5A8QA 1I45A 3ICJA 1AL7A 2O55A 4OBTA 1O60A 3DXIA 3DI1A 2ACSA 1RK6A 4G7FA 1E0XA 4GOAA 1QOXA 3W4RA 1I9CB 2DH2A 4LBRA 1GEQA 1XFCA 1JUKA 3GBDA 1SQ7A 4JPGA 3SQLA 4PB4A 2WOQA 2E9BA 2JQXA 1X39A 2G3JA 5HWNA 3CL7A 4MGGA 3H8AA 3M0LA 4PE8A 3C0SA 4QE4A 3UA4A 2ZXDA 4DQWA 2OXNA 4I7UA 5D9NA 3ID7A 3ANVA 4PMQA 1ZSXA 4WY0A 2X16A 5LNRA 2C13A 2XFYA 3APYA 1BSLA 1QWGA 3B0PA 3K2GA 1F6YA 4H2CA 4IQDA 1WNOA 1MQQA 2DSWA 4DLFA 5CAHA 2FZNA 1GHSA 3B8SA 3H2AA 2TSYA 4JZ5A 3UZWA 4YN5A 1R2TA 1TKKA 1HG3A 5JBFA 1RJQA 3G1XA 4ZO7A 3T4WA 4ZOEA 1TA3B 3VMNA 4CEUC 3BVJA 1GOOA 1I2NA 5A8NA 2CPUA 2OGYA 4KEZA 2E6YA 3C8FA 1QNOA 4HNOA 3I7RA 1YPXA 3B0YA 3TYUA 2E09A 2H90A 4IIBA 1XD1A 2C1GA 5FJTA 3A4WA 2V5JA 1J8VA 1MXDA 3S5NA 6TAAA 3H22A 1ONWA 2CERA 4ZQNA 4QDWA 2IKJA 1YIXA 4CN1A 2E7FA 5E5CA 5T8GA 1XDJA 2A6LA 4AIUA 4PMVA 4XUGA 4KESA 4LYPA 4LAUA 2V81A 3NL5A 5TIMA 3LM7A 2CETA 3THDA 1IZKA 2ON3A 3G1SA 1EP3A 4YHGA 3FA5A 3BICA 4BEQA 2DUAA 5I7GA 3WH6A 2FZMA 4AWUA 2PDLA 3UWZA 2XIJA 4V15A 1V6VA 1TX2A 1XRTA 2F2HA 1MVYA 4Q8TA 1LLZA 5C5YA 1XH0A 3ZZ1A 1UHVA 4HNUA 3M47A 5FD0A 4HJWA 3HQPA 4DZAA 3T6CA 2HV5A 4O53A 3OOQA 5BU6A 2XN0A 3UG8A 4FNQA 3CHEA 2IXUA 1LBMA 2YFOA 4MLRA 1TWDA 2I1OA 3W38A 1JUBA 4W93A 1UQZA 1TVPA 1H2JA 4AVOA 5G2WA 2CLKA 4YLWA 3O0FA 1Z8AA 4MF4A 2PDFA 3QZ6A 1WB0A 3VGFA 4AY1A 2FFIA 3BZJA 4IMAA 4XIMA 1T8XA 4BWLA 1KBBA 4S3JA 3B9OA 3BLLA 4GYPC 3RR1A 3R43A 2E5DA 1E4LA 1MNZA 3SI9A 1N8FA 1ZAJA 1ADDA 4LVGA 1L6WA 3VOFA 1T6MA 2A3AA 1KB3A 4RDYA 3VUPA 5C54A 4QM1A 5IM51 5CPOA 1E1CB 1K4HA 2JK2A 5LIWX 3FSTA 1IT0A 3R0UA 5H8UA 5KSWA 2NVAA 4HVXA 4QHRA 1NM9A 3W53A 1Q6QA 4KQNA 5CAKA 3QXBA 1FWNA 2IS7A 5GJPA 1KBKA 4KRUA 1UZHA 2AL2A 3KLLA 3TMQA 3B8IA 2D0HA 3E12A 1K8YA 1QT1A 2PC8A 1JAKA 2DQXA 3AO0A 3CM4A 4NZ4A 4PUWA 2HEJA 5KMYA 3A22A 2QNEA 4JTCA 7TAAA 3QW4B 5G2HA 3URBA 3S42A 3AHYA 1FHVA 3PPFA 3UNTA 3UXAA 4IQLA 1JPDX 3RLGA 3GRIA 3W26A 4J28A 4N0RA 4E2BA 1WZLA 1SJAA 5HINA 4Z2IA 4NSBA 1NIUA 3S6OA 3DHDA 4HMEA 3RJXA 5I00A 1SR9A 2ZOXA 1OYAA 1KD0A 4E8CA 3VC6A 3KW3A 3IVTA 2WK2A 2YZ5A 4LAKA 3UA3A 4DELA 4CU7A 2PDIA 1SPQA 1YNYA 2YA1A 3CHVA 4US5D 4CQAA 2V8ZA 1XIFA 3W83A 2VI0A 2NW0A 2FFCA 3RM8A 5H91A 5MHBA 4WZHA 3W88A 2VX4A 3GXPA 4LEQA 2BY3A 3O7UA 5CPSA 3W6MA 4QXIA 4M6VA 2YZRA 3QR0A 3M7SA 3LCGA 3WD1A 1K7XA 3TAOA 2VX7A 1LQ0A 1KFWA 1A5MC 1L0PA 3GFXA 2GVJA 2GYIA 3M5XA 2WMHA 3NL2A 3A3HA 4IPJA 4Q33A 5KZMA 3FJ4A 2QHAA 2OG9A 1ELSA 5JXQA 3VDBA 4F2TA 2J7FA 5LIYX 3VIKA 4QJ3B 1FKWA 4JFTA 2NUWA 4AYGA 1TO3A 4MSSA 5CG7A 1TV7A 3T40A 3QPYA 4IGHA 1O1HA 4L65A 2PGRA 1JYVA 4CCZA 3WLHA 4HGXA 4ADUA 3W86A 2X40A 1RVGA 4MB1A 2FHFA 2V69A 3VM7A 4D6DA 1J0JA 4H9UA 5CXPA 1E6QM 3RXZA 4Q4KA 3ANYA 1GUVA 4HTBA 2QKFA 4E2DA 4CNPA 3DHFA 2GUYA 3NVTA 1OC5A 4Z2HA 1VBHA 2Y5JA 4IFOA 1NWTA 3NQ7A 1T40A 3THCA 3NG3A 3EKLA 2Z26A 4S3CA 4XSLA 1TE1A 1PSCA 4J3XA 5E93A 3OU8A 1JZ2A 2W0UA 3KWSA 2CLHA 4ZOAA 1XLDA 1R38A 3HG5A 1QR7A 4GIEA 3E0WA 1F07A 3AUOA 1BRLB 1OJXA 2HVNA 1SM9A 3GNNA 4DI8A 4DJDC 4LQ1A 1JXKA 4JFWA 4L6DA 4NI8A 1WAUA 4HYRA 3MWAA 1TJ1A 4H9XA 2YCIX 4PB5A 2ZE3A 4JR5A 1PZ3A 1OHLA 4ZFMA 3CUIA 4BY3A 3CIWA 4OOZA 4LV4A 3MO7A 5C2GA 1E70M 2W62A 1Z44A 3JW7A 2R82A 3AI0A 3ABQA 1W9BM 3ZM8A 1EA9C 2O7QA 4MB5A 2WSQA 4KFOA 2GVYA 1S2CA 3M0JA 4B92A 4O57A 4V27A 1LM1A 2ZRWA 3VXGA 2VL4A 4OECA 4H04A 3IJQA 1BVNP 3S5SA 1S46A 3ATZA 5CLTA 4DYKA 2CNCA 4O8AA 3MKKA 1YDNA 3FNDA 3SM0A 3LENA 2QCDB 2YPIA 3SCRA 4DJEA 1BRLA 1LWIA 1QK2A 4ZZ9A 3UP8A 3KZPA 1B3YA 1R2SA 3RU6A 1VFLA 1VFUA 3L12A 4GZJA 4H3DA 4PUDA 5REQB 3LHTA 3EDKA 4D6EA 4TX6A 3BC9A 3FEMA 3H26A 4BHYA 4GI8A 2BGSA 3GVQA 3HJEA 3VZYA 2J6VA 1Q6FA 2XFWA 4EPDC 1QHOA 3E2VA 2BMBA 3PWAA 5LNVA 3TW6A 3W73A 2A4AA 4EANA 2RDWA 3TV8A 3ZYZA 5HJLA 4D6IA 2QR6A 3BOLA 2PGFA 5FOOA 4O1AA 5XIMA 5AHIA 4E38A 4ZGYA 1RZMA 1M68A 1ICPA 5J8LA 1CI1A 4QG6A 4M6QA 3LS9A 4IM4A 4W87A 2O9TA 5BZAA 4PUMA 4YWSA 3BSGA 2PF8A 1G4SA 2PPGA 4JX4A 4YTRA 1L6SA 2W91A 1TQJA 3ARQA 4QCEA 2JIWA 1QPOA 4RZ6A 1WBHA 4O1BA 1SR0A 4F0LA 2DT1A 4JFVA 3UXDA 1XG4A 2HTMA 1V3MA 3U57A 1ZPTA 3V0TA 3F4DA 3W7MA 1JDDA 2IKIA 3ZJKA 4IFRA 1EJRC 3BMVA 4GINA 2LLEA 4DY1A 4R9XA 1UMYA 3F5JA 4K38A 3TQKA 1F4HA 1UD5A 3E96A 3L2LA 5HPOA 4HCLA 3T05A 5F4WA 3IVSA 3FVDA 2AMXA 5AVNA 2ZIDA 2L5HA 3PTDA 3U8GA 1ZBKA 3E49A 1LOLA 1OFBA 1SMDA 2DW7A 1EYWA 1F8IA 3DC8A 2VKZG 1I2RA 3BG5A 4UCFA 4KKXA 3ZR6A 5FF2A 2PWUA 2P76A 2WJFA 3QR3A 2WVVB 2PP1A 1GZGA 1JQVA 1ME8A 1K02A 3CIXA 2BASA 3U4FA 3PZUA 5G1MA 1CENA 3BAIA 3M0YA 3WLPA 3IK2A 2PEVA 4BWLC 2F84A 1B0IA 3WD4A 1F3TA 4LBSA 5DXYA 2QV4A 2INFA 1EO5A 5FEWA 2JKEA 1E4IA 4ZOBA 1KFJA 3VI2A 2CWNA 2REQA 4MJMA 4OIFA 4IHCA 3N14A 2J47A 3LLXA 1PUDA 4LNYA 3T0AA 2ABBA 1V08A 2OYMA 4L4PA 3LZ5A 1EHNA 3G1HA 4AIOA 1FRBA 1CPUA 1EXBA 2J7DA 3N4AA 4HHPA 1G9HA 1W2PA 1XIHA 2OQLA 4MB4A 3O6YX 3LNMA 3XIMA 3W7HA 2ZZ5A 2VC5A 4E6MA 5EB8A 1QBBA 6REQB 1NEYA 3WH9A 4HK6A 4RUBA 4ICNA 3ZIZA 4C6LA 3O07A 4ZL1A 1UR4A 3KBWA 4X63A 1H62A 3PBGA 4YJ5A 1UH4A 3OGVA 4KCTA 4H8UA 4C6PA 3IUDA 1PYFA 1SFJA 4MFDA 4DM1A 2DSVA 1MXSA 3G24A 5BXTA 3PM6A 5LYRA 3AALA 1TB3A 2CZEA 1LL6A 3FHAA 2MNRA 3TR9A 2GVLA 2JGYA 2DIJA 1D8WA 3T78A 4JIQA 4ZENA 3AWOA 2YL9A 3OB8A 4DF2A 1V6TA 3FDKA 1DTNA 4Y90A 4ZO9A 5L6UA 3TTYA 5CH9A 2Z6JA 4LUTB 5DFAA 1XICA 3UPBA 4ZSTA 1CTNA 4MY1A 4HOZA 4BQ4A 2E67A 3S9YA 1PWLA 4FLOA 3WK2A 3QLDA 2NQ9A 1VPQA 4Y9MA 3V3WA 2QDEA 4Z1YA 3GG7A 2VURA 2WCSA 2AKZA 2UY4A 4FNRA 5CEWA 2R1NA 2BNJA 3CZ8A 2ZA2A 3K4DA 3W81A 2BB0A 1UD2A 3W7JA 1VKFA 4Q8PA 1Q7QA 3O8AA 3DDMA 4JHMA 4TMBA 1N7KA 1HKIA 5DQPA 3KS5A 3PNUA 4S3GA 1A3XA 1EQPA 4MUPA 4QRNA 4DJDA 1Y7VA 3T1GA 1HKJA 4L6OA 3ATYA 1VAHA 3KHDA 4JY8A 4TV6A 3LXCA 5DEZA 2IUZA 2V67A 1FXPA 2ACRA 4JOMA 5PTDA 1BWVA 3W84A 4CQBA 3W2MA 3ZSTA 4IP5A 2WMIA 4HTYA 4EOUA 3ZT5A 3MCNA 2QW5A 2EEXA 3GUGA 4NRSA 2J77A 4RE0A 3DECA 3AFBA 1K3UA 5LA1A 1QI2A 4KIRA 5D8ZA 3SN1A 4IXHA 3HQNA 2GJXA 2J79A 1KC7A 1IEVA 4QS5A 5IXEA 2XN1A 3EB4A 4DWSA 1LYXA 4O12A 3KVLA 4DXVA 2ISSA 1B3OA 1BWKA 1Q8JA 4GUHA 3GHSA 3BE7A 2A7NA 1WZAA 9XIMA 1FCUA 1TPC1 4HU0A 3CHDA 2Y63A 1C92A 1HJVA 1FFQA 4NAFB 4CVUA 2NQJA 3QOKA 4KT2A 1GQIA 3HPXA 1VYRA 4S3FA 3S8HA 4D8LA 2HNEA 1VJSA 1QHZA 3NAVA 5E1QA 3KXQA 4JQAA 1KR1A 3FS2A 3WDHA 1NELA 1P0DA 3TTQA 3WUBA 3PJTA 1J96A 4HN8A 2YCEA 4DPPA 4TXEA 1E6NA 2DY3A 2QPXA 2BVWA 3DUGA 2VRJA 3FAWA 4XAGA 1VPXA 4MWAA 3LMYA 5JUVA 3FEQA 3N15A 2G0WA 3CO4A 4ONVA 3I6TA 4NYYA 1KFKA 4LVFA 3MKVA 3H4XA 2DSZA 4HA4A 1MQRA 1WUFA 5DXXA 3I10A 3N2MA 3NO1A 2DZSA 1EDGA 3DGBA 5IBXC 1Z3NA 1QOQA 1SVDA 1PHWA 4Y8EA 5TAOA 3CUJA 4PMJA 4PUEA 1Q2RA 2PDYA 3AHXA 3ORWA 1XYLA 3P80A 3E02A 3WLJA 1VP5A 1XKJA 1KFEA 1GVRA 4GPNA 1PWMA 5E0CA 2VFGA 2TYSA 5M1TA 2A2IA 2XIQA 1F05A 4BZYA 5EMUA 3LQGA 4L1XA 1ZB5A 1A50A 2VWSA 1VFFA 3WQOA 1IF2A 4L9YA 4JTAA 2Y89A 1Q3NA 1N82A 2HROA 1L9WA 4R9OA 2Y88A 2QS8A 5JBEA 1QPKA 1TPUA 2VR2A 1K77A 2OOFA 2J7EA 4Y9PA 4JL2A 1BSIA 3AHVA 1UWRA 3GFYA 1VLIA 3ECQA 1QO5A 3TLQA 2DZBA 2FYMA 1UKTA 1GG0A 1NP0A 3W85A 4DNMA 3MVIA 4J3TA 3TH6A 5AHLA 3BAYA 4PC8A 4XVDA 3G0SA 3ITGA 2YXGA 4J1OA 3KM8A 1MNSA 3MI6A 2BFGA 1ME9A 1BTCA 2OMAA 1UYQA 1XGZA 1XYZA 3E0LA 3FGCA 3PS7A 1VBUA 2FZDA 2VGGA 1KCLA 2XH2A 4A3UA 1KBIA 3B05A 1ZCCA 1FWCC 3NQBA 3K8KA 4XZBA 1O5RA 2A79A 3VNIA 2BODX 3LCIA 4G7EB 1GKQA 5CBJA 3AU6A 1IEXA 1HNYA 2GK1B 2ZUWA 4ZQMA 5BXSA 2NQLA 3FW6A 2HVMA 1E6RA 3TYCA 2QGYA 1HL9A 2YDRA 1V93A 3L4WA 3UEQA 3VE7A 3UCQA 2FVLA 1QNSA 3TN6A 5I3IA 1V77A 4H01A 1JVNA 5H8MA 2F2KA 1A5OC 5DRCA 1YTEA 1X7IA 1J0ZA 2DU2A 5C2CA 1UWIA 4RDWA 1GQNA 4Q6XA 4MB3A 3VKCA 3BSMA 2XIBA 4XG1A 1Y5XA 3UG4A 4N9DA 5EMYA 4TR9A 4DJDD 3HGSA 1I6NA 1ONRA 3LK6A 2NUYA 4IH3A 1US0A 5LHEA 2GZXA 3DFYA 1VIWA 2BVDA 4N4PA 3R8HA 1FWBC 5JBDA 3HJZA 3L4VA 1F6KA 1C9WA 1OEPA 2ISFA 2PP3A 1KXHA 4PL1A 2HJPA 1XDMA 4LCQA 2J13A 2VOMA 4Z2GA 1T8QA 2NZLA 3LSBA 4AWTA 3GW3A 4HPHA 1V5XA 1W9XA 1DV7A 1WDDA 4HSNA 3H2MA 3L65A 2R9RA 3T42A 2KZHA 3CV1A 2VRKA 4ZODA 1RY8A 1D7FA 2G97A 2Q8XA 5IDZA 2ZUSA 3VD7A 1AW1A 3P84A 4PTWA 4OFCA 3RJYA 2WVSA 3L21A 2G41A 2ZX7A 4RCXA 3JUGA 2ZUVA 2NSOA 3C2RA 4RDVA 4MAVA 1MZHA 4IIDA 5I2UA 2RGMA 5HNTA 2JALA 1HKKA 4HD5A 2VCBA 5D32A 3HURA 2YL5A 1FKXA 2A3CA 3FJLA 3MJYA 3W6YA 2I9EA 1E43A 1OFAA 1KFCA 5A6JA 4B3ZA 3Q4DA 1UG6A 1UA7A 3T0BA 1Q2SA 1WOAA 2WNNA 4PMYA 4Q7BA 1DWFM 1QWKA 1OIMA 2DT0A 4PEKA 3IGHX 1GOIA 3R89A 3WF4A 5DRIA 3G18A 2V5DA 1EBGA 3MUCA 3WLQA 4JKMA 1TWWA 4ATLA 4DEFA 4UIOA 4WSKA 3B3DA 1XLLA 3FVMA 3VDHA 1W3TA 4Q4QA 3PBMA 4O11A 3NQ8A 4PTNA 4NJJA 4CU6A 2V38A 3WLLA 2X1RA 1P6BA 1NWUA 1TPVA 2DGAA 2VX6A 1XWYA 1VFOA 2V5BA 5D05A 1CW2A 4ZBCA 3KTCA 1C93A 4UFLA 4FIQA 1F6PA 3CXOA 1SMAA 4AC7C 1CXIA 1OFPA 4LT9A 2Z27A 2CZ5A 5KETA 2X1UA 3UR2A 1VCVA 2TRSA 1M3UA 3SN4A 1R0MA 2XH4A 2XWDA 1MFVA 3MW7A 2GDVA 4NJHA 3OVQA 5TNVA 3M0XA 1I1XA 4MZYA 4L4OA 3UCCA 2VMFA 2PRHA 1Q6DA 4GI4A 4UTKA 1BKSA 3HV8A 3LI0A 4NXKA 3O06A 4WK9A 2VUNA 2J6XA 3KE0A 3OG2A 1BLIA 4XBJA 3M07A 2FPTA 4ALDA 3UFYA 4LH8A 3FYPA 4M80A 1H7RA 1SSDA 4YTTA 1ME7A 4LPCA 4PMZA 2F9RA 4XTDA 4PSPA 4RZ4A 3A64A 3T07A 2I5GA 3UR8A 3C61A 4E2VA 4LUIA 4J5NA 4DXKA 2WWDA 1CXEA 3O3RA 4Q32A 1YE4A 3P81A 3MDWA 4MWAB 1MEWA 4P5UA 3MSYA 4R7JA 4KIEA 2DIEA 5BOEA 1YDYA 1EHAA 3CQHA 4GXMA 3IV3A 4UTWC 2AGKA 3HQ1A 2JF6A 4HMCA 1DQWA 3VDCA 2E9LA 3ZLFA 7REQA 3AU2A 5EGRA 5F1UA 4KS0A 4ZQOA 1M7OA 4Y9AA 3MSRA 3N73A 3R0KA 3W07A 1ITUA 2X1SA 4QTGA 2FZBA 5U7SA 3HPSA 4X22A 1M1BA 3HGRA 3EX1A 2EO7A 3P6LA 1QNPA 1R3TA 4Q6JA 2YYTA 2I5IA 5BWFA 1O7AA 1YRRA 4RV3A 4CEXC 1NF0A 1PTDA 1QNRA 4F3HA 1TWZA 3U2EA 1BGGA 4JTTA 2F61A 3M41A 4RW3A 4YXGA 3VGHA 4NNCA 3VNDA 3LERA 3AISA 2Q3OA 1ZS2A 4ATWA 2AL2B 3UVIA 4L5ZA 4GBDA 1OB0A 3PZOA 4LAZA 1ZP4A 1J0YA 2YBUA 4ZB0A 1EC8A 3N2TA 2JGQA 4OUIA 1EX1A 2Y7DA 4GX9A 3STGA 3HPAA 3M5VA 2ZZ7A 3L4YA 2QIWA 3HG2A 3RRAA 2E9MA 3E9AA 4YWIA 4CD6A 3OLGA 3GXMA 3S1WA 3CQJA 3CU2A 3LA4A 3E0IA 1FWGC 4QJ1A 5DCDA 3JVAA 4K7VA 1WAWA 1E3ZA 2R1KA 1W1TA 2WQDA 2GGHA 3ITTA 4PMOA 4N6EA 3A13A 4IZGA 3MV01 3C0JA 2RFGA 2FIQA 2CWXA 1EIBA 3SIZA 4B5TA 1XIDA 1RAKA 5HDRA 2E6AA 3BQ5A 4UTWA 4A8NA 4AMAA 5LXXA 1JR1A 2YCLB 4NX5A 1OFRA 4ICCX 1QI5A 1YPFA 1JF6A 1D2KA 3O1NA 1AJZA 4OTKA 2IQTA 1XX1A 2PTDA 2DP3A 3VD3A 2YLAA 3MI3A 4FX6M 3CASA 3AZSA 4MYXA 4MZ1A 1GYLA 5E70A 5BRQA 3GAKA 1GW1A 2QAFA 2B7NA 2JE8A 5TQLA 4HB7A 1XBVA 3DFNA 1ICQA 1M53A 4GZEA 4WRHA 1ZJIA 1A5LC 3G1VA 4Z0JA 3RNDA 2I57A 4WDTA 1VPYA 3VFLA 1NARA 1TJPA 5DF0A 4PA8A 4U5IA 3VOJA 5RUBA 2VVSA 4KETA 4BS0A 4M3PA 1KGUA 4K1WA 3M16A 4JIHA 5D9PA 4M1BA 1EYEA 1VCFA 2W67A 2PLKA 4AB4A 4WIWA 3UCDA 3QH2A 4J3SA 3UPMA 1Y65A 3DYPA 2WO5A 2BVTA 2VQTA 4Z0SA 3PPGA 3F4VA 5CC6A 1FVPA 1OABA 3AJ7A 2KX9A 2Y7GA 3N9SA 3OYZA 4W7UA 4J9JA 4Q8MA 4O1DA 1OT1A 5C71A 2FTWA 2WZHA 1ZUAX 4D6FA 4GQ0A 3W1NA 4AWEA 1SJBA 4AHPA 4O54A 4GYJA 1BGAA 1R9XA 6TIMA 4YTQA 4GKLA 3H2NA 4QITA 3SCNA 3H12A 3MZ2A 5GQBA 4ZXOA 4UNLA 3QZAA 2VZTA 4R53A 1KM6A 3C5QA 4O50A 5F2IA 3UZJA 3EWXA 3QVQA 4ML4A 2FB3A 1E71M 3KL0A 3KP0A 1J79A 1GPWA 3RPDA 1PX4A 1XRFA 5DMMA 3OGSA 3NDOA 1X6UA 4CD8A 1NOWA 2GOKA 4UTMA 2IQ0A 5C55A 1BFNA 4XZHA 1UD8A 3LGGA 3N2OA 1FHDA 2C7FA 3WUGA 1B54A 3EX4A 3F5LA 5D2YA 1F3WA 3Q2DA 3BW3A 1UROA 3ZR5A 3S4TA 3INPA 4X60A 3SCTA 1HGYA 1XLIA 5HOSA 3CWNA 5K7JA 3OBEA 3B9AA 3PF3A 4HNNA 3WDRA 4J7RA 4JICA 1LDCA 4KBXA 3IK4A 4M56A 2VD8A 4LW7A 4WQ6A 2HS6A 1KXQA 2PGWA 4L7ZA 5DCEA 3G1RA 1SO5A 1KXVA 1A5AA 2C0HA 4E3TA 2CHOA 2ZE0A 3PSVA 7PTDA 3N2XA 2EXOA 3S1UA 4AHOA 2WKJA 1HJSA 3AMCA 1RQBA 1DKWA 3GUWA 1ZJAA 5I3DA 2XVKA 1X7FA 4M8UA 5FJIA 1RVKA 2BY2A 1P1MA 2YXXA 1QNQA 4GUGA 3UGRA 4NL1A 2YYUA 3SJNA 4C6OA 1S2UA 1PL9A 2WAGA 4MM1A 4AD4A 3LUTA 1Q6RA 1XBXA 2ZRUA 3FFSA 4F0RA 4F79A 3MB9A 4D71A 1Z89A 1GVOA 5AC8A 1Z48A 2CLIA 3DZ1A 4A8IA 3WBAA 2VUYA 3ZS4A 2GQ3A 4B9YA 1F7BA 1H09A 5JH2A 3T44A 3QYQA 4B5WA 1AQMA 3M0KA 4ZMGA 2QUNA 3LTSA 1VH7A 3QPZA 2TMDA 1L2QA 1KRBC 4YVVA 4NVTA 4IJRA 2VEKA 4LCRA 1OGBA 3FSUA 3BL3A 1E55A 3TYBA 4BR1A 1Q4NX 1SO4A 5KTLA 1EPXA 4Q7IA 2HK0A 3NXLA 4QSHA 4RXGA 2FHCA 1R47A 1XI3A 3EWUA 5D09A 4AD5A 5BXRA 5AC5A 4FOKA 3V75A 1I8JA 4LNCA 3L0GA 4B5NA 4AEEA 4D72A 2X7VA 3V18A 2QAPA 4JIEA 1OZQA 1G01A 5AHEA 4A21A 1TVLA 5E6YA 5EMLA 2VEPA 1K9DA 1GKRA 3ZQ9A 3IIXA 4B2DD 3HV9A 2XGBA 4ZSUA 3CIVA 4D6GA 2OZ0A 4H6EA 4CN4A 2YDQA 4CLMA 3LYEA 4CD4A 1TMLA 1KO0A 1Q6CA 4O13A 4HNVA 1D3HA 2O0TA 3PUGA 5FI8A 1FWDC 2Q3RA 2QPUA 3RM4A 3B4YA 3DCPA 3GC2A 4GNKB 2WKGA 1ML1A 3WBXA 2WZTA 3WH8A 4ZQPA 4FSAA 5K9DA 1XPYA 3ZXWA 3SUWA 1VRDA 3SCOA 4AXNA 1I4NA 1OX4B 2P50A 3AHZA 4DO7A 5DO8A 2QULA 1JCNA 3N3MA 3GH4A 1DJXA 2AQVA 1TYGA 5FF0A 3U2CA 1Q7ZA 3BCDA 3WQ5A 1AZ2A 3CV6A 1YNPA 4R27A 5H6HA 4GXPA 3F2DA 4HOWA 4ZXLA 5LNSA 1EIXA 4C6KA 3V5OA 4XD3A 2ZA1A 1TREA 2OU4A 3ITOA 4TO8A 4CQCA 4E3VA 4H9VA 4OQVA 4F0SA 6CGTA 3H4GA 3WQVA 1M9HA 1DIEA 2XIIA 1LL4A 1M6JA 1XR2A 2R91A 3M46A 2Y85A 3W75A 2NXHA 1XIEA 1DEDA 1XS2A 4RE2A 2DPEA 3UJFA 3OHIA 5B7ZA 3ABXA 2OVLA 3V35A 4Q8OA 3EWCA 4KEMA 3WQWA 2ZUUA 1TR1A 1V7AA 4XZLX 2X8RA 2FQIA 1X8CA 1U33A 4WY0B 2ISWA 5KZDA 2PI6A 2OFJA 1PCWA 4GY1A 4WOZA 1QAPA 1BF6A 1BVWA 1IIHA 3NSNA 1LLWA 3AXKA 1TUFA 2V3EA 1EJ7L 1B31A 2PURA 2R8WA 2XVNA 5CC3A 5CGQA 1V3JA 2EPNA 2UBPC 1EGMA 4WKFA 1PB0A 2CLLA 2YIHA 4GIAA 1L6GA 1UASA 2Z1XA 3WJXA 4B15A 4RPPA 4L61A 4GJJA 3E0FA 1OINA 1WA3A 3IJ6A 3IGXA 4MNKA 3W1TA 1KKOA 4HYVA 3PFMA 1AVAA 3N19B 4NZ1A 4O28A 2DZPA 3MMWA 2WVVA 1L2UA 2WBGA 3THUA 2NV1A 4XQ6A 2J7CA 5K3VA 1OG0A 1QW8A 2GUUA 2D23A 2XTKA 5CJMA 2OKTA 2V9DA 3RPTA 5BMWA 3SN0A 3IIOA 3TXVA 3MSGA 4IPIA 1RPXA 3SAZA 2OLSA 1TPDA 3ZWSA 4CGTA 1UKSA 1W56A 2OYKA 5KZEA 4TVCA 2V5CA 4AD3A 4AD0A 1HJUA 1TJ2A 3V5CA 2JKPA 4PULA 3IJDA 3GTIA 4HNLA 4IJBA 2IPGA 3U0HA 1VFSA 3SCPA 1OD0A 1UJQA 4LUYA 1A49A 1X96A 3RF9A 4RE4A 4DBWA 3PZIA 4PTXA 1TWIA 2DVUA 2IKHA 4MWAE 4GE8A 4D6CA 1WDQA 1LUCB 1P43A 3WEMA 1C91A 1MW0A 3DENA 3KCOA 3GTHA 1FP8A 4IL2A 4EX4A 4XTIA 1ZBVA 1H7WA 3CS2A 1NP2A 3GM8A 4FR6A 2I9UA 4PUKA 1Q13A 3PSWA 2J7BA 4KH2A 3RO6A 3KCLA 3OP2A 1XH2A 5G2IA 2BXYA 4M6UA 2OLHA 2D2OA 2FLIA 4LJ3A 3A23A 1X8FA 4KMQA 3P93A 5LNWA 4H7ZA 1W9VA 1DQUA 3BJFA 2C8NA 1W5PA 3BLPX 5HUOA 2VFDA 2PDHA 2XPKA 3LY0A 3AZRA 5I78A 1E6PA 4AZ6A 4GNJA 1C8VA 4DUVA 5LXEA 1SU5A 1WXJA 3EMZA 4KRZA 4EP8C 5CZKA 1O12A 1PYMA 4A22A 2PTZA 2XH0A 1S5NA 5I3FA 3ERPA 1E0TA 3L4XA 2QCLA 1LG1A 4QAIA 5EFDA 5AN7A 3IEBA 4D9PA 2Q8LA 2VENA 4MZ8A 3TROA 4IOTA 4NASA 5I03A 1OCQA 1PKLA 2X0HA 3KHJA 5CPNA 4UFJA 2ZC8A 3NIYA 3KS6A 3ZT7A 3TX9A 3RU8X 2BS9A 1RXOB 2Z00A 3T0TA 4YU1A 1LZOA 3G5EA 4WVXA 1XP3A 5FACA 1HL8A 1K7EA 3BUVA 4B16A 1NF7A 3KOXA 3LSCA 3MCMA 4GRSA 4FX8A 1UUQA 3MKCA 1J5SA 2WZIA 4U3AA 4YHEA 1R30A 3QGAC 3MJMA 2PB1A 2O7SA 4DPQA 1UKQA 3R4IA 3UZZA 3FY1A 4K37A 3SFWA 2EPMX 3R10A 1PO9A 3FA3A 1IEQA 8CGTA 4C1KA 4GVGA 4DBUA 4IPPA 1G94A 3UWVA 3DX5A 4PFHA 2OWWA 1R3RA 2EQDA 1SW3A 3ZOAA 4I5UA 4FEZA 5CGTA 4NJIA 3QY8A 5DMNA 1FTXA 1B3WA 2YA0A 3QZEA 1EA0A 1J18A 4H8NA 4RXFA 2FVKA 3A3WA 3RO8A 2CBVA 1VR6A 3W7EA 4A6GA 3F4CA 5E9AA 3R79A 4H9ZA 4IFKA 2P88A 4ADSA 4UOQA 3ZJ8A 5LGXA 1L8NA 2VFFA 2AGTA 3KOYA 4F4RA 1UWAA 2OWXA 3I65A 2Z2BA 3BAXA 1GT8A 2ASHA 2X05A 2WW5A 3ANUA 1VEOA 3HN3A 1RLCL 3PZ9A 3EOLA 3U7VA 1PDZA 2CLEA 3LHWA 3GHTA 3CPGA 3GXNA 3TZNA 3TOYA 3CWHA 1UZ4A 3TOPA 3QGKC 5C9UA 1HW6A 5AYBA 1V3HA 5A8GA 3WDJA 3URQA 4C1NB 4AMCA 3SDOA 3PUDA 1FXQA 3N4FA 2QDHA 3EMCA 3R5EA 3VZXA 4H9TA 4A8RA 1UR2A 2F6XA 2XGIA 4DJFD 2ZRYA 4JIIX 5AZ1A 4DO4A 1A5KC 1OVDA 3PY2A 3V36A 1YHTA 3TONA 4W84A 4Q4PA 2QDGA 1DJQA 3M9YA 3CYJA 4GVFA 2P3EA 1PTAA 3M0ZA 1HKVA 3VDAA 3RYSA 1YDVA 3T7VA 3PBWA 3LI1A 1AFSA 4J2PA 1VQTA 1KM0A 1OCBA 3U2ZA 1Q6GA 4GQGA 1I0BA 1NU5A 4R7WA 4NI3A 1KFLA 1XG3A 3NYDA 4LANA 2R24A 5A94A 3TCSA 3XISA 1TTPA 1XLBA 3TN3A 2D69A 3WY1A 3QFEA 1HP4A 3G2GA 6ENLA 2FTPA 4IICA 4RJEA 2ZBTA 4PMRA 1ITQA 4HZ6A 3MMDA 1GVFA 1OFOA 3QM3A 2VQUA 3PZQA 2PTYA 1Q8AA 3L5AA 3B40A 3IAQA 3MQTA 4GCXA 3OEXA 5ABEA 4DWSD 3T2PA 1KWKA 2HCVA 4F2UA 4AZIA 1WKYA 3TFCA 1UC4A 2F6UA 3CAWA 2Y7FA 4A4AA 1PZ2A 1IR2A 5TD4A 1YDOA 2Z1BA 1H3GA 2WKLA 4FZIA 4JTQA 5CSYA 1ODUA 1MWOA 4I9JA 3TN5A 4EPBC 1GONA 3WJSA 5CJNA 2RDUA 3GB6A 2CFFA 4N42A 4AY7A 3KBVA 3G1FA 4ML9A 1EJTC 5FF4A 4D8ZA 5HWJA 4IXXA 5EFFA 1A5BA 1TX0A 5DELA 1R5YA 3REQB 1J10A 2HE5A 1MMFA 2VR4A 4Q3MA 3CEUA 3M0MA 2ZWZA 4TX8A 3F2CA 1W3LA 5BOOA 1AH0A 3BW2A 2W5FA 3CUZA 1GORA 3MU7A 3SGUA 2E8ZA 1DJYA 1DOSA 1OF8A 3OZOA 2G3FA 2PSNA 3PB2A 4D8AA 3KDNA 3TR2A 4AZCB 2W61A 5M03A 1UZDA 1CGVA 4FNSA 5T26A 1CBGA 1S3HA 1QHPA 4UTUA 5FJUA 1DHKA 1VENA 5CCZA 2P8CA 3MCOA 3SIMA 4AF0A 1F61A 1ZZMA 4XIAA 3W7GA 4UQAA 1W17A 3K8LA 1E0UA 1DXIA 1UQYA 3TSBA 1KBJA 4A3QA 3TA9A 3ZR4A 2ZRZA 3BH4A 1K8ZA 4PMUA 4L9ZA 4NIRA 4EPKA 3KBMA 4AIEA 5FL1A 4LF2A 4ZB5A 5I3GA 3U6WA 1OYBA 3ARVA 3S2CA 4WSHA 4GX8A 1JI2A 1YQ2A 3HZ3A 4HPNA 4BK9A 2DZUA 3ZLGA 3CHCA 3CJPA 1JZ8A 3FXGA 3VUSA 3DFTA 5D2XA 3ONBA 3VNYA 1CGXA 4PBGA 1PKYA 1MO0A 3AIRA 5K4XA 4JQ2A 3VGDA 3W71A 3P14A 1JZ7A 5CZJA 1NDVA 1QPNA 4JTRA 3E74A 1AQFA 3PJWA 3LCHA 5CPQA 5DMLA 4UR8A 4HZ7A 4UMCA 3N9RA 1LROA 4LV9A 4IMGA 8RUCA 1K9TA 3UXIA 3AYTA 3WF3A 2FPYA 4JY9A 2J78A 3P0XA 1E3XA 4Z2KA 1VJZA 5ABTA 3MUAA 4RNIA 2ZA3A 3NZRA 1BF2A 2Y4SA 2DH3A 3KP1A 4QE1A 3QW3A 1TV5A 4Z42C 4ZO6A 1D8CA 3G8RA 1QI3A 3OA3A 4TV5A 3W27A 1QPQA 1V6XA 2VC7A 3RK8A 2WCGA 3LMZA 3EPOA 1FWFC 4UTFA 1X97A 2AQWA 5HANA 2VGFA 1X6LA 1GYNA 3GD6A 1ZQ5A 3C2FA 4MTVA 4ZQCA 2VT0A 3ELFA 4D1JA 1FX6A 4WSJA 3O6AA 2BXZA 3VCNA 3P2VA 1QPRA 2V3FA 1GHRA 3BK0A 3GW0A 1CIUA 3AXMA 1RHCA 3SCWA 3H2OA 1MRQA 3MY9A 4NY2A 3W1RA 1OM0A 1VBGA 3W1QA 2WMIB 2Z2AA 4W5UA 1J12A 3N4EA 7TIMA 5BXPA 4ZB2A 5F2MA 6REQA 2PS2A 3QOMA 1H50A 3WENA 1AJ0A 3GNPA 3LGDA 4F0MA 2YCKX 3U5YA 3Q45A 2PDBA 3VIMA 1NFPA 3A24A 3H55A 3MC5A 3WQCA 4HOXA 1RQHA 2BOGX 3GG0A 1N55A 4TTUA 4UFKA 2DIKA 4NAEA 3HU7A 4M6PA 4EACA 1KV8A 3RX4A 1BYDA 3DFQA 3AUJA 4L1WA 3IIPA 3DHUA 2A5HA 5FEXA 5CC7A 5BU9A 2WJZA 3QN3A 3CUFA 1VCGA 2GWNA 3D6NA 3MI2A 1T5AA 1XLAA 4YTUA 2B0MA 3VNLA 1KM3A 3UWEA 1Y8BA 3VCCA 3MANA 4GYPA 3VIGA 4HNCA 4ES4A 1FDZA 1TZ7A 2C79A 2H8ZA 4PTDA 1XIBA 2OCZA 4X61A 3B97A 1P0EA 4CUCA 1XISA 1P6CA 5JIWA 3ENLA 1FBAA 3CLMA 2DEPA 1UWSA 1R3WA 2X42A 4MJ2A 2WSKA 2Y8KA 1VBRA 3OZPA 1RBOB 4AY8A 1GG1A 1GJWA 3W7QA 1YLVA 3FK4A 4HU4A 3OW1A 5K4ZA 1W3HA 1NY1A 2ZX9A 5A2BA 3AMGA 1UKOA 4IMEA 5EU9A 3GDRA 3T08A 2WHKA 3UU0A 1EKOA 1VS1A 4H2HA 3VGBA 3RDKA 4DB7A 1J9YA 3CV7A 3M43A 1XINA 1MDRA 3KOZA 4MY8A 1OK4A 4S3EA 4AZHA 5I24A 3TJ4A 2OSYA 1CXHA 3K1DA 3MO4A 1C90A 2G3MA 3NZPA 5FL0A 3LBCA 1JULA 5A2CA 2WJEA 2QJMA 2QUUA 2VEMA 4J27A 3DIPA 3S1XA