1CDGA

Nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose-dependent crystal form
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide sequence and X-ray structure of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 in a maltose-dependent crystal form.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase(glucanotransferase)
molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cdgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cdgA01
3QI9D 4NNXB 1U3HD 4AIZB 1A6ZB 3KPNB 5CLWA 4WSJA 3HI5L 2CHOA 4NWUL 4GZIA 3GRWA 5BO1H 3FQXB 1M6OB 4MB1A 2OTWB 2HWZL 4XNYL 3RDTB 4Q7NA 1UWSA 4BSWA 3VXSA 5TQ2H 4NHCL 5EU6A 3VDBA 5JMOC 4QHKI 3EFFB 5J6GA 3MGTB 3S4SG 2MCPL 1NKRA 4BSVB 1UKOA 5INCB 1XCTA 1OM0A 3KXFE 4NXSA 3OKOB 1H3UA 2WMGA 3QCUL 3VIPA 3OXRB 1OW0A 4OLWL 4L8SA 1M05B 2VO5A 4WI7A 2VXQH 4M1CD 5E7BA 4G8GA 4IRJA 5AWNL 2BVOA 1D5BA 4MCZA 1NSNL 4UTFA 4P2OA 1I7TB 3O11A 3FFCB 4W4OC 4Z2IA 1GPOL 2BMKA 4ISVA 4CNIB 1H0GA 2MPAH 3LQAL 5JO5B 4A2LA 2YD1A 1T04B 3MLSH 4OZ4B 4ZUVB 3HB3C 1P9MC 2R9HC 5KS9A 4LQ1A 3IJ9A 5KG9B 3IXTB 2EO9A 3T77A 4LF3A 4QTHA 4MSWA 3WUWB 5I18L 3VFSA 2GDVA 3L3JA 5EU5B 1HILA 15C8L 3H9HB 3QUML 5EBWB 2IH1A 1AHWC 1JWMB 5DMIL 1MREH 3OKKA 1EBAA 2YUWA 1G7JB 1OGSA 1JFXA 1ITCA 4F3FA 5BXFB 4U2ZA 3GSUB 4L5FL 1I9JH 1LDSA 5ACZA 2EACA 4NBXB 4P2RB 1QSEB 1NP0A 4O51A 3T3ME 2XY1A 4URTB 5D8WA 3PZ9A 1T6WA 1FLRH 1EXUB 1D3CA 1GGTA 2DRUA 2YMXL 3K4DA 3LQZB 4XBEH 5C09E 3V5KB 1GCFA 3HG4A 4H41A 1IAIM 1TJGH 5CZXD 5FO9B 4K9EL 2OLHA 2F8VA 3SKOB 4E8CA 4O2CA 2ARJQ 2P49B 4HKBA 4XH2B 3GKWL 2DQXA 4MNQB 1U8KB 2VLLB 4ZTPH 1UR1A 3MRHB 1I85C 5JR1H 3OX8A 4HOXA 3VIKA 4CN4A 1JRHI 2DLGA 4D8PB 5FYKU 4OI7A 1JGDA 2FWOB 3APGA 1HHKB 1Y6NR 4NBZB 2UWEF 4OSUH 3KPLA 1R0AH 5LAXB 4HIHA 3QHZL 3KYNB 1MIML 2XQBH 5EUOB 3WXWH 2BNJA 1BD2B 3ZE1E 3BVWA 3PTKA 4QHKJ 4ZFGL 1PKQA 4KKAC 5HGDA 1S7QB 5F9AC 1XF2A 1RI8A 2PBGA 4D6GA 5TH2A 3SQBA 4BS0A 5E8PB 3VXSE 5LA0A 2FIKA 3TO4B 1S9VB 3TIEA 1LG2A 4QF1A 3DRTA 1U8IA 3TTOA 5A94A 4JFEB 2IANB 5FYKD 3MJ9L 3PWJB 2E7HA 4QCIA 3QQ4B 1QNQA 3PGCB 4KHXH 3SGKC 2QQNH 3BKML 4Z5RB 1R5VB 4Y19B 2CBUA 2G75A 2R2EA 4DAGH 2Q3ZA 2YEZB 4OT1H 3L5WA 4PJBE 3K8LA 1OWWA 4Q9QL 3EW3B 1WC7B 2QQLL 3GB7B 1KUMA 4MDIB 5KANG 5L6YL 1CIDA 4DZ8A 4PGZA 3QGVA 5KJRH 2H32H 1KTCA 5GGSY 5E00B 3RVUD 2A9NH 4JE4B 2J25A 4UNTA 4WW2B 4XCCL 1PG7X 3N1GC 3GBEA 1ZBCA 1R3JB 1HDMB 1U8MA 5DK0A 3LX9A 3CH1A 4E2OA 4TNWK 3OGCB 3GSQB 2HFEA 3BD5A 1RZ8A 4PUDA 1QFWH 4L4TA 3UYPA 3QZWA 4JFED 4FNTA 5DXWA 3PV6B 4FQLL 2ESCA 5D2NC 1ZV5A 3QFJD 5I6XB 3EDJA 4OCLC 4TOYH 5IROA 1JPST 4JFYA 3VM7A 1UZ1A 1NL0H 5HHMB 1CD1B 5ALCL 4X6DB 4DN3L 5CD5C 5HPMB 4XPAH 1BYDA 4YR6B 4IOFD 4ETYA 1TA3B 2OJEA 4YIQB 5A2LH 1OAQH 1NC2B 3VG9B 1RQ5A 1N6UA 2EDHA 3FB7B 4K94H 2FX7H 5K9JL 4PGEB 4BQ8A 1VPOL 2VXTH 1FNEB 2PYFA 3EIFA 4ZYKA 5JOPD 2X9YA 3DV6B 4X6BB 3CSBA 1GOMA 4GXUN 3P9LB 4IRJC 1I3UA 3CGTA 3A4AA 2HVMA 1S9YA 1D5MA 3TFKC 4PR5A 5HHOA 2OP4H 4BSJA 1RVFL 5J3HD 4O02H 3SY0B 4XB7A 5HYSB 1EOMA 4CCDA 3WDIA 4P4RB 4Y2DA 1AGBB 1F3DJ 4M00A 3OZOA 2DM3A 2P45B 2DQJH 3FFCD 4HBCH 2Z93B 1BX2A 4NFCA 2G3MA 4O2EA 1ZT1A 1OCQA 2WMHA 4WV1C 1EO7A 4AY1A 1Z0NA 5F7NC 3TBYB 2ZNWA 4J6RL 1VERA 4MXQC 5MEPA 1MCOH 3IU4L 5CMAB 4QWWD 1BFSA 3ARGC 1ISWA 1JFHA 4RGNC 1W1VA 4R9HA 5D7LA 4ELMB 5KVFL 4ELKB 2VLKE 1T03L 1AIFB 4ALAL 3NA9L 5BVPL 2QQKL 1CS6A 3G5VB 5I30H 4B9ZA 4U3XA 5DVNA 5HYJE 3MV01 4PJBB 5JW4N 5D2LE 1N5YH 4PJDA 3OAUL 4XT1C 1MHCA 4OCRH 5AZ2H 3U30B 1R7OA 4YDVB 3D3VD 4G9FD 1SYVB 2VRJA 5JIKA 4EIZC 3V95A 4FP8L 2VMFA 1MJJA 3D69B 1V7MH 1ZEAL 3MJ7B 4OGXH 1T1WA 4TNWF 5C0BE 3RWDA 3X14A 5J9PA 1ISZA 4Y4HC 1QOXA 1UUQA 1FGNH 3AS3A 4P7LA 3IKKA 4L1HA 3S4SB 1TJIH 1IC5H 4ODUB 1UWTA 2DT2A 4AD3A 4DVRL 3HE6B 4XCCH 2O92A 4Y5VA 1J1OL 1XGUB 5D6CB 3SDDD 5B38A 1UASA 1PSKH 4JQXA 4LSDA 5HYQB 1FFQA 2Y9RT 1EAJA 4N0UB 5KJRL 4P2QE 5C9JB 4ZXOA 4K3JH 3UXFA 3BKYL 2MTPA 5DD6A 2QQLH 1JYXA 3RIKA 3QCVL 4PRPB 5GGVH 3I50L 3GXMA 2VISA 3TPUA 3DGGB 4FQHA 1FFPB 2EJ1A 2DIAA 4XPGH 3BT2H 1KXTA 4U3AA 4ISVB 4WFGD 1ZGLP 2OI9C 5HHXL 1JBJA 1FNHA 1NC4A 1BOGA 4YN5A 2G2RB 1GGUA 5DHYA 2V5MA 3IJ8A 1U8NA 3MR9A 4HUWA 2A6DB 5HY9B 5L8KB 3T77B 1PX4A 4I0PB 1AQDA 3UMTA 4KQ3H 3MANA 3OGRA 4DN4L 1DJSA 1UENA 3IDJB 5K9KA 4FTVE 2CH8A 4XAKE 3MXVH 5AY7A 4N9GB 4LPWA 3IDYC 1U58A 1JK8B 1CIUA 3MMDA 3CAFA 5LGJA 4GJTB 3WEMA 4ZPVB 2FJHA 1RJYB 1YNLL 3DURA 5HGBA 1QPXA 4JY6A 4OCNC 3QXAB 5DFTA 4CVWA 2ED9A 5C3TA 1AKJB 5BRZD 2VIRA 2E7LA 1Y0LA 1PKOA 3CJJA 2CITA 4HZ6A 1I1CA 3UTTA 5E94A 4RISL 2FZ3B 1NEUA 3KJ6L 5KW9L 4P4KA 2XFFA 2K7PA 4RWYH 5J11C 4O2CB 4ODVH 4PRHE 4IIQA 3LXBA 2WZEA 5CILL 2X4NB 4WWKB 3SDAD 1QFHA 1EMTH 4PRPE 5C2BH 1ES0A 1CZ1A 3U7YH 3WE6B 4Y4FB 4PEEA 3O6FC 5ID1B 3L6FB 1I8LC 1RURL 5IK3B 4D8PA 1C5CH 5GRWA 5BRZE 1XV8A 1Q6FA 1BJ8A 2OZ4A 5D8JH 3M1BA 5SWZD 2C1PA 2QR0A 1AH1A 1YNTB 4ATLA 4JRWA 4MB3A 4XC1L 5SX5K 3WHE0 2DQIL 3DYMA 1Z2KA 4NQEA 3A24A 3MOBH 5DRXA 1EEYB 4Z7UE 1X5LA 5EU6D 1UZ8B 3FQUB 5LBSH 3R0NA 4FNUA 1BFNA 3GMQA 1QFPA 4MAUL 1NGPH 1SYSB 5A2BA 1KXQA 2ADIB 3OAZH 4UBDC 4HK0B 5T3ZD 5I1KH 1MCNA 2FX7L 3PWJA 5F1NA 4Z77A 2ZCLH 1KGCD 4OLEA 2XACC 4XV0A 1NAKH 1UJTA 4K8RC 5IB3A 3RI5F 2IPUG 4HFWB 1HHGB 2ZXBA 1JWUA 2GVYA 3NIGF 3V7AE 1CXIA 1WV7T 4LIQH 2VAAB 2WWMC 3KWWB 4TOYL 1A22B 3G04A 3NACL 5FYLL 3RWHB 4LLYA 5EWIL 1WNOA 1E27B 1QFWL 2Y6SC 1SMAA 3DXAB 4NO2A 4YHNB 4MWFB 5I1CL 4YHKL 3AIUA 1IT9L 4UI2A 1TQCB 2AK4A 3U6RA 4UV4H 4OFDA 3KPPB 5JUVA 4LLQB 4F8XA 1WQVT 4QGTA 4WI2A 1FG9C 4Y4KA 1QRKA 1JPGA 4F7EA 2UY4A 3AZSA 4P23B 4EDXA 4WIWA 1V8HA 3NFNB 5DJ8B 2FX8L 5F8RC 3MYJA 3UCRA 1B2YA 4F9JA 5KVEH 3CVIL 3C6SB 1ZLVH 3VGEA 1UD5A 5BQ7B 4UTAL 3FT3A 1UG9A 4GKOA 1A5FL 1E4XL 4LVEA 1HQRA 1US2A 4IRSB 4YIQA 4O00A 3OJMB 2IJ0C 4JL1A 2IFFH 4XWGH 4B3KA 4ZG1A 2F61A 3LRHA 1NOFA 1MY5A 4K3DH 4ZYKB 3WBEA 3FQNA 4U1LA 3B9VA 4M1GL 3F5KA 3VG0H 3Q1SH 3VSTA 1EEZA 2D0HA 3PWNB 3UO1H 1OVZA 1DHKA 3P9LA 2O9PA 2V7NA 3KLDA 3PZIA 1J10A 5F9WB 1PG7H 1JNHB 3U7BA 4BA0A 4B53A 1E4LA 5IM7A 1DUZA 5E03A 1GC1H 2WLYA 4Y4HB 3C8KA 1BREA 4I77H 3T1WA 3X3FH 5A43C 5I73C 1KCVH 2NY0C 4TPRH 5DZOA 5IBTH 4U7MA 1W9XA 4MZ3A 5H2BA 4KHTL 1KG0B 3LKQA 4R4FL 3ARBD 5F7DB 1RIHH 4M1DL 4JKLA 3VFGL 3WN5C 3DUSB 1RZIA 4HGWA 2XWDA 4YDLB 2W4XA 4DWSB 4LGSB 5DDHA 5FM5O 1B2WL 3PG2A 3U4EA 2OYLA 5HJ3B 3HMWH 3MLRH 4KZDL 3ULSA 1AD9B 1NMCB 5C8JA 4WNQB 1GIGH 5BXTA 3ARFD 3DYPA 3VRJB 3RA7L 1WAAF 2D03L 3OJ2C 4GXVH 1GJUA 4PRAB 3SKJL 4Z9KB 2OI9B 4JRXD 1PVHA 3S35X 3D87B 3HR5B 3VX1A 3KPSD 3GSRB 2CDFA 4OTXH 3S96A 1K9FA 3QNXA 5GRUH 1I1AD 2A1WL 3TESA 4HWEH 2XZCH 1OAZH 3KNBB 1HL9A 5IHSA 2FBJH 3BUTA 1RPQA 1LQSR 3PDOA 3T3PE 4NQCE 4AISA 1UJ3A 1X9QA 2GJJA 1J8HE 3SUSA 5GISH 3MLYH 1ZMYA 1PG7W 5IVXF 3BH8A 1A6AB 1NDMA 4RMVA 1ADQH 1NFDB 1CFVL 2NY1B 3T0EC 4JDTH 1UXSB 4GS7B 1I8KA 2DWEB 1Z9LA 2VX5A 3DRQA 2DQDH 4DKDC 2HKFH 1U8OB 5GISL 4F7CB 5F44A 5E2TL 5J11B 4ZAKD 4RQQA 3V9FA 2BNRA 4LHJB 1B0GA 2HVKB 2MKLC 4PJEB 3FO0L 4WWKC 1OAZL 1RSFA 1WTGT 1IM3A 3DSFH 3SKNB 5A3ID 1WVZA 5GHWL 3MRMA 4UFLA 3QEQA 4FQ2L 4JFXB 4E41B 1FG2A 3F12A 2JJVA 3WIIL 1B3ZA 4MNKA 1ETZA 1JGEB 3U9PH 5J6HB 5FOBB 1EJOL 5ANME 2P1YA 4X5WA 2DYPA 3EYFA 1CTOA 3ULVE 3MRCA 4AM0A 4FNPA 5D7KD 4NUJB 1TQBB 4XPHH 3WEOA 4FFVC 1TPXB 5FB8A 3WSQL 5CEZH 3VGGA 3CFEA 5J06A 3MRRA 4CD7A 2A6DA 4R26H 4GSDH 1YEEH 1S9XB 3ZSTA 4GPNA 1N2RB 5GSVA 3P9WB 1ZVSA 5DC4B 1Q38A 4QHNA 1QPKA 3BVNA 4NPYA 4WHYG 4HPGA 4UFIA 1J8HB 4L4PA 4PMZA 4W87A 1YYLH 4R8WL 3EOTH 2CRIA 3F7VA 1FYHB 4WUKH 3TV3L 4R6UA 1F8TH 4ODWA 2M1KA 4IOIA 4NKOB 4X5LA 5GSRA 2VIRB 1MF2H 2CIIB 3K0WA 1CGSL 2YK1H 3O2DA 3O6MH 2G4FA 4YZFF 2Y2WA 2VDPL 5DMKB 4UT9L 3VNZA 2G5RA 1DBML 1EO8H 2DIBA 2OR9H 5F3BA 1Z5LA 3Q1SL 3RAJL 3WQ8A 4GW1B 2PF0A 4XGZB 3FQWA 1DLFL 4PJEE 5DUBB 1HEZB 2CKBL 4NM8H 3TF7C 1MCQA 5D7IA 3HNTH 4LASH 1OAYL 5CSUA 4X99A 1QLRB 5FUZL 4PJCB 3QUZA 4CGTA 4K68A 3L6FA 5KSAD 2CLVB 4AZGA 1KLUB 3P9MB 1LO5A 1YJDH 5HI3D 5I1DB 1MCBA 1T3FB 3CZFB 3IDGB 1KIPA 3A0OA 2GT9A 4HIXH 4YWGH 4Q9RH 4LPCA 1LEIA 1K5NB 3S2CA 5JOEA 1M1SA 1TXKA 1UEYA 3ZE0E 2D7TL 4LQFL 3WSQH 5JW5A 5GS2D 3RZCA 1GVIA 3U7WH 1FN4B 4S1DC 5HYJB 3GMMA 4TVUA 1LO3H 5T1MB 5GS1A 4JHBA 5A6BA 1EDGA 4OIBA 5FGBC 1A7OL 4EKXA 1WE5A 4OCWH 5HBBA 2YZ8A 4J1UA 5D71L 32C2B 1IGYB 4Y8DC 2IF7A 3SDCA 4PTUB 1YEIH 2DQGH 3SCTA 2VAAA 3KWWA 4FXGB 4XNUL 4LCWA 1FVCB 3CLEL 5FV1L 4OD2B 1UM5L 4UFJA 2R1XA 2VQUA 4PJHE 5CG0A 5I8OL 4LLYB 1PLGL 1M7IB 4M1CC 5C08D 1O7SA 1M04A 4GZJA 4FK9A 5CGYD 1ECEA 3E6HA 4JO1H 1NMBH 2GSJA 3ZKMC 1CFBA 2VTFA 5IR1B 4X9IA 1B0IA 3TLRA 4PJGF 1YEKL 1G6RH 1YEHL 1INEH 1T5XB 4GT7A 1YY9D 4MJ5A 1PW3A 5H37H 4G80B 1BQLH 2FO1A 4RMRA 1T22B 3CZGA 1R3HB 1HNYA 1W9UA 1FSKB 4ZPTA 4ZFMA 4G7YL 2OWWA 2XZCL 1HKKA 4NOBA 2F5AL 1J86A 1T5WA 2X70B 4JM2B 5CEYB 1UR9A 2CSPA 4C56B 4WVRA 1LEKA 3WIFB 4PRIB 4UQEA 4IRSA 1OAKH 5CPSA 2OXGA 1FNSL 3LMYA 1UR4A 2FEEL 3CFKA 1UQYA 2ENSA 4PJIA 5I1EH 3ROLA 1XGZA 4OZGE 1JZ4A 4PJHA 3C87A 3QUXD 4TNVF 2ZUUA 1OTUD 2EDTA 4KQ4H 1E0VA 3T8XB 3GNML 4YHPA 4MAYC 2E9BA 3QEGH 4RDQF 5DEGA 3C8KB 1FZOB 1QSVA 4N5ED 3TNMA 1ZT7A 5DJ0B 1KG0A 5I76B 1W9VA 3QJHA 3MUJA 4G43A 3AHZA 3II1A 3ROOA 4H20L 1FFOA 1WWCA 5GRVK 4ZNCD 2YC1B 1D9KB 5D7JA 5H94A 5CZVH 4AG4L 2BV9A 1OP5H 3SGKA 3LMJL 2WWKT 2XWEA 3D48R 2PWGA 4OZFB 4Z0XB 4XHQA 4GG6A 2J4GA 2ESVB 4ZXBD 3KYAA 4W7WA 2AP2A 1UOKA 4TUOB 4ZNEE 1YYMH 3O3BA 1SFSA 4NFBA 2W5FA 5AC4A 1OARH 4N0RA 3BXNB 3DX3A 3MFFA 1YQ2A 5ENWB 1WPCA 1A02N 5EZJB 1AO7B 2NY6C 5DZLA 4KKNA 3BSHA 1AR2A 1EHLL 2P46B 1EHAA 2HJLA 1QSFB 4RGNB 3RAJH 2FGWL 1M7DA 3BCDA 3EOAB 1QQDA 5GGSA 1QW8A 4APQC 5DUPH 1XGQB 1KENL 5I8KL 2BFVL 1AQKH 3CPLB 1U2YA 5CCKL 3FFCA 3RWJA 3L1OH 3QFDB 2EDBA 2WIIB 3EFFA 4PD4K 2ZSWB 1GHFH 2D31B 2B1AH 3DHMA 3DETD 3WF3A 2UUDH 1BJ1H 3VFSB 3LEVL 1IAII 1BD2E 3A6OA 3V4VH 4FP8H 1RD6A 1RMFH 3D52A 5M95B 3KJ4B 1KWGA 4HG4K 1E3ZA 2IQ9H 4OKVB 1WCBA 1S8DA 4XWOC 2BRRL 1JI2A 3K81A 4PJ8B 4YDIH 2EDRA 4HZAA 1IZKA 1QSEA 4PRHA 4P8UA 3KPQA 1FG2B 1TITA 4X7EC 4ZXLA 1FDLH 4PP2B 4PRNA 1BZ9B 2NR6D 3UTTE 4JKPL 1QI4A 4Y5YA 3G5YA 4F7PA 5ABEA 3T3MF 1JMXA 4KKLC 2WZPD 3BUPA 4FNRA 4DKFL 3B9AA 3IU4H 5C70A 2IGFH 1S9XA 1K2DA 1NBVH 3EGSB 4TTDD 3HR6A 4LHQB 3BIAX 1RJZA 3IDIB 1KXHA 3PL6B 4EANA 3AAZA 4LPVA 5AZEH 3SURA 3OWEA 2UUDK 5T3ZE 1JGDB 2WVTA 3V6FA 1OAXH 5CP3A 5TE6L 3WXVL 1Z9SA 3MS8A 2E27H 4FFWC 4NQDB 4H26A 3NZHL 3V5KA 3EYUL 3IDNA 2ZUSA 3IXAB 2G60H 1WP6A 3VD9A 3I6LD 3WHXA 3ORJA 4NZRL 2PTVA 2CIIA 1B6DA 4DZBA 4BQ9A 1AGDA 1S7QA 2RGMA 4MD5A 5DD1L 4HMDA 3CMJA 4RMSA 1JPFA 1S3KL 2A9ML 3W11C 1HXKA 5CJBA 1Z5LB 3IKCA 3QUYA 3BEWA 4MJIB 3DRTB 4Y5VC 1BFVL 3KJ6H 3LB6D 4JGJA 1FP8A 4M82A 4NQCA 2MANA 4L9LC 1ZU8A 3CXHJ 4D0DB 4HC1L 1E43A 4P5TA 4QNPE 2RR3A 3F6LA 1X5XA 1LD9A 4H88L 4PJCA 3SKJH 2ICEB 2D03H 3C08L 4N1EA 5KTEH 1XGYH 3BVUA 2VZVA 1CXFA 2EC8A 2ZG3A 2JB5H 4XPBH 1MH5A 2ERJC 4URIA 3QH3A 1S9VA 3TIEB 1QD0A 4PRHD 3D1MC 1J7VR 5E2JA 3CZEA 1QVBA 1JD9A 2OL3A 4OV5B 3W82A 1US3A 3MNZA 4EN3C 1HSAB 4YXLL 3ZTNL 3CH1B 1A9BA 3GHEL 4QFUA 4ZUSB 1L0YA 5HYJA 5M7QA 3N9KA 2H2PD 1ZT4A 1RZ8B 2ICWI 3DV4A 1LDPH 5E1AB 2DI9A 3OF6A 4HHAB 2QHRL 1MCPL 1BG9A 1SJHA 4IUGA 4K3JL 2FATH 2EDKA 4YBHA 4EVNB 3Q3GB 3D2UD 4JEGB 5MP6L 2ITCA 5F89A 2PXYD 5C0NC 2P24A 3C5ZA 3SEPA 4HU8A 2OBGA 3ZTNH 5L2JA 4JFFE 2JK5A 4Z2HA 1BIHA 4N5EC 1EFXD 5A16A 4HEPG 3SDAB 1MCJA 4MXWL 3V4PL 1DTUA 3TZVB 1QLFB 3WBAA 1MW0A 2QHRH 4M7LT 3MUY1 3F7QA 3OPZL 3GJFH 3QZWB 5L8JB 2EYTB 5I3DA 2YD3A 3RL1B 1NCDL 2PO6D 1MFAL 2IBGA 3AGVA 3IAGC 4RWHA 2CLZA 1GQIA 1J1PH 2HLFD 2ZUQB 4H88H 1NAML 5IMMA 4P4RA 2LTQB 3QEGL 2DIEA 2CD0A 3VFRB 1KB5B 1OAUL 1FZMB 5D7SH 1E6ZA 3FB7A 3RVXD 4KQ4L 1XIWD 1C16B 2AK4E 2UY6A 2CETA 2X4RB 2JB5L 2B7DT 3VSVA 3MCKB 5BV7L 1IEBA 4JFQA 2GK2A 3GKWH 3SE8L 5IMKB 1J0YA 2XVGA 4DGIL 3VWJC 1FNSH 5I79A 1TZGL 2EDLA 3STBA 1FE8L 4HX1B 5HBFA 1MVUA 4YK4B 5M94B 1NM9A 4D6EA 4N1HB 4NN6C 4JANB 1FZOA 3OG4B 4Z2JA 6TAAA 1OGTB 4O02L 3GSNL 2JEPA 4QHLB 1QRND 5F21B 4PTWA 5I76A 3QJHB 5LBSL 3DUUA 1SYVA 3QAZC 4RE2A 3GSNH 3D69A 1DQJB 4ZQKB 3PWPE 3SCMD 4X4ME 5J9PB 2XZZA 4PJXE 4R7NB 4OF5A 1T1YA 3AREB 2IWGA 3MODH 4JG0L 3G5VA 3O3BB 5BJTA 5ILTH 3QG7H 3ZR5A 2DSVA 5HYQA 2DTSA 1X5YA 5C9JA 1U92A 4M3JA 5L88H 2XZQH 1NANH 1GSMA 4TULL 4PRPA 5IEKB 2WKGA 3TJHD 3D39A 3VXUB 1RZJL 3EOAA 3W9EA 1DWHM 1V3IA 3C8DA 1JIBA 2CLRA 1MJJB 3DGGA 2P5EB 3IFPB 3MOQA 1OB0A 2NMSA 4MD0A 3VJ6A 2V3DA 4MNQD 3H54A 2D22A 4JN1L 4UTBL 1PKQE 3VFWA 4AH2A 4NHCH 3LH2L 5DHYB 4NQUA 3RPIA 3ZQ9A 5DUPL 3SJVA 3U0WL 4OGYL 1U58B 4LBEA 5FOOA 5LGJB 2NY5H 2CKNA 5F1OB 3SDXA 3SKMB 1IL1A 1NJ9B 3TPUB 5A2JH 2E8YA 4PJ7B 2ICCA 3IDMA 3H42H 1A2YA 1UD3A 2SEBA 1W72L 2G5BA 2AJUH 1BOGB 4WFFE 1F4YH 3G5YB 2EZ0C 3TBSA 5BVJB 5FKAA 3MA9L 2WINA 5IV2A 3T4YB 2M26A 5JLZB 4PMVA 3POCA 4UOZA 4WENB 1ED3B 3P0GB 4Z7OF 3EMZA 4M7ZB 3C5SA 4U05A 2BVQB 3TCLA 3WE6A 3FMGL 5HDQL 5J12C 4Y1AB 4MPKA 5DRNB 1QNOA 3WY2A 2VDML 1NFIB 3M1BB 2GTZA 5E4EC 3BZDA 3CK0H 1G9NL 2XWTB 4EZMA 2IBZX 5BV7C 1F13A 1HN1A 3AY4C 1ZHKA 2XZAH 3VH8B 3EAKA 5ICYB 1AXTL 4ZTPL 2J7HA 4IIQB 4XI5C 5F7YC 3UEZA 1YMME 4RSVA 1N5AA 2ADIA 3HNSH 3TFKD 2YPKB 5DJCB 5IHUH 2VXVL 3H7BB 4D0DA 1NFDF 3HZVB 2HH0L 2WHKA 3QNZA 1B3XA 1TZHA 5F93C 1IMHC 3OG2A 5GHWH 2H2SD 1JF1B 3BZ4A 1C93A 3WDPP 4O9HH 1ZHLA 4AMKH 3AYRA 1HTYA 3DYOA 2HYMA 1DWJM 5B22A 1MWAB 5KSBE 4MYWB 3RWHA 2ZJSL 2AJYH 1T21B 4AIEA 1ZWIB 1UVQB 4XNMB 5T5FL 3O9NA 2AJ3A 3RWFB 1VIWA 4X0NA 2V2WA 1OAXL 1V6VA 1MIEL 4YC2B 5K9OB 3AS0A 3QYCA 4M02A 1MQRA 2KBGA 3OKMB 4YPGA 3ARFC 3RPMA 3PDGA 4P2YA 3RDTC 4L3EA 1OCWL 2WWCA 4QXTB 1CLOH 3HC0B 2IPKA 4KJYA 1SZNA 4B16A 2P5EE 2VXTL 3SDCC 1E6QM 4S1SH 4G8IA 3KPRA 1AMYA 1G7QB 1ZS2A 2ZX6A 3Q6FA 1U8LB 2J78A 1QBAA 3V4UL 5I1AB 3GMOA 1JDAA 3EKCA 1BLIA 5E9AA 3SE4C 1MAKA 2DQGL 1I1XA 3WUEA 5JPMB 1XGTA 5BMFH 2QKIB 3FCTB 3TZVA 3I2CH 3VXRA 4F7EB 3PWLA 2R2HB 5DRWB 1QI5A 4LLMB 5GRJH 4EDWH 5C92A 4F15C 5HHNA 4G8FB 1DUZB 4KHTH 4NRZB 1A14L 3GXNA 3X11B 3ULUH 4N8PA 1J18A 3FT3B 4U7KA 1NGYA 2DQTH 3QP3A 2D7TH 4LQFH 4PMNA 2AJZA 1JAKA 5IW3A 1UCBL 3HB3D 5T1DL 1IEAA 5DVOA 1FO0H 3BW9A 1MWAL 1C16A 1MFNA 2IANE 1QG3A 4B5EA 4QRPB 3U4EB 5DWUH 1Z6JT 5DEZA 2L7UA 1INDH 4JY5H 2YPVL 4AEHL 1E6RA 3RHWK 4UT9H 4QLKA 3GUTB 1DBAH 3HC4H 1K6QL 1OM3L 2XGIA 1MF2L 2VZSA 4GRWE 5TQ0H 5FECA 4P7RA 5FGRA 2YKKA 2YSSA 4U31A 3PGFH 3P11H 3QOMA 1MVUB 1XT5A 2H3NB 1BZQK 3KLLA 2VLJA 4NN7B 2I26N 5HGAB 4CVXA 2A3HA 2DD8H 4ZSOB 2X6MA 4AZCA 4JKKA 4YZFE 1AFVL 1J1XH 3TO2B 1LO4H 3FY1A 4EK7A 2F54D 5I6SA 1ZA3A 2CK0L 4ONHB 4R3SB 2HT4D 1MHEA 2I9TB 4RGMC 2VERN 4GI6A 2YLAA 4RA0C 3TA3D 1BF8A 1V6YA 1A6AA 3WKZA 1NFDA 4G8EB 4L4VA 2D1ZA 3JTSA 3I3DA 3TA3A 1RZKC 4JRXB 4ORZC 5MI0C 3T3PF 3DRQB 5CINL 1G0CA 4ZOAA 8CGTA 2FB4L 1RZJH 4JFVA 4PBWD 2DQCH 4RAUA 1IE5A 4Y19E 4OQTA 5BJTB 4HJ0C 2I60L 4HV8B 1HXMA 5DS8A 2DSWA 4R0LC 1CICA 1A4JB 1CE6A 1NDGA 2XN9A 1CR9L 3D5OF 1QI3A 4YUEH 4Z7WF 4G8GB 4IRJB 3F5LA 3WDQA 1HHJB 3MRMB 2IXUA 3K7UA 1KJ2H 2ZX7A 4JFXA 3ARBB 1NAKL 2FECI 3PDDA 4LPTA 1FHLA 4OZ4A 1T83A 3WS6C 3EYFB 4NWTH 5TE4L 4S1SL 3VJ6B 2OR7A 3LPPA 1B3JA 4UDTA 1DFBH 1HI6B 1BZ7A 2JJTC 2YA0A 2NY7L 3IRZA 1U8OA 5HDBF 3HAEB 1SVZA 3H9HA 4QRRD 3O6FD 1JWMA 1E4WH 2UVFA 2WBJB 1N2RA 1C90A 1FCCA 1ZVSB 4KVNL 1TZIB 4DVBB 2XTKA 4Q22A 1U8HB 3RX5A 1LLOA 5C6TH 3HAEH 4ENEC 3MV8D 3OAYK 1DN2A 2PYED 1NMAL 3DBXB 5CIPA 3DVIA 5ITBL 4I48B 3WEXA 5IHBA 1UXWA 4MHHG 1O0VA 3O3DB 5T5FH 1IKNA 4D6CA 1AI1L 1G1CA 2DYPB 2FSEA 5FF6B 4M6OL 1AP2B 3LQAH 3O6AA 5EOQH 4HPHA 1QI0A 5EC2A 2HLAA 5D5MA 3CLEH 2FHCA 5E1HB 1KYOK 1T83C 3RUGA 2JIEA 3NCOA 1QWUA 2XOTA 2FBJL 1S5IL 5BVJA 5FKAB 4U1IA 3WL1A 1FH9A 1VFAB 5GRUL 1VFBA 2W0LA 1EERB 1CGWA 5CINH 1AGFA 3RMEA 2F58L 3VWJA 7TAAA 4JIEA 3BRGC 1HT6A 1U93B 4B7IA 3DVNB 3KXFA 5E8EA 3QBTB 1H5BB 3S34H 1PEWA 4I2XE 4O58H 1WCGA 5E0QA 2GT9B 2EICA 1Q6DA 4JQIH 2ITDB 1I85A 1F6FB 2J8UB 5TH2B 1E6SM 1RIHL 4M1DH 1FA2A 2KZ1B 3SN6N 2CDEA 1YN7B 1GL4B 1LG1A 4U33A 1NLBL 1G9NH 4GW1A 4GKSA 2H26A 3QDHA 1FPTL 2D9CA 5HDLA 4PJAE 2QV4A 3MJ8A 3W0WD 4XPGL 4Q2ZB 4XP6L 4P5TC 3FRPG 5F70A 4P3CL 1LO5B 1MQPA 3PHSA 1I7UB 2NY5L 4C83A 2KZWA 1CQYA 3MC0A 3EMCA 3UERA 1RUML 3BIBX 1LEIB 3MLWH 1BQSA 1MWAH 1OINA 4WI5A 3O41A 4DZ8B 4R96A 2R0ZH 1UCBH 5T1DH 1RIUH 4M80A 4AIUA 4JO2H 4OD2A 1W91A 2X4TB 3QWRA 2R1XB 4OLYH 2ED7A 2O5XL 4X0KA 4M93C 3DX6B 2NR6C 3DX9A 3TT1L 4LHUD 4NBYB 5E08L 4OGZA 5LGKA 2AJ3B 3RWFA 1IGIH 3VFVA 4UQ2B 1T5XA 4PLJC 2J7GA 1QTYT 4RGOL 3OA5A 4YHZH 3BPCB 4WWKD 4WFHD 4YBQC 3OKMA 3FT2B 5KZCD 3V7AG 3LKSA 1F90L 4DO6A 1MHHB 3RJYA 2YRPA 5EORH 4J3SA 5F6HI 3M17A 4U0RB 3WBDA 5F9JB 3WIHH 4EN3B 1FFNB 3FHQA 4Y5YC 5F9OL 3ALFA 2VR5A 3MSDA 2XM2A 3CVHB 2QSCH 1E4MM 1WO2A 3FXYA 4NP4H 1EJOH 5GS0C 1AKJD 4PRIA 1BFVH 2DQHH 1JN6A 4B41A 3BGAA 1S3KH 2A9MH 3C5ZD 5IWLC 5L88L 4Z0BH 1SJXA 3EDDA 4U49A 4QRRB 1GVYA 4J3UA 5HHME 3STLB 3WUFA 1U6AL 5D72H 1LO0H 1A1NA 1CDHA 4G6JL 5B38G 2DQIH 4I0PD 3HI6H 1D5ZA 1RZKL 2WBWB 3RVVC 2E27L 1BM3H 4JDTL 1PYWA 4FQPA 2D20A 4JFUA 3A3HA 4K7FB 5DGQA 2BXZA 2H32B 1NGPL 4GMTL 1A1MA 4PBGA 3SUWA 5DJ0A 1BX2B 5DA0B 5AYUH 1BAFH 1RK1A 2XPGA 4TUFA 2NX5A 5IJVB 3CFKB 3MBEC 4U3HA 5KBNC 4BK5A 5KOVC 1UG6A 3UCQA 1FIGL 3GJEB 2FE0A 1JUFA 1XF5A 4OIFA 4YAQA 2VLRA 4R7DA 3ARBC 3AHYA 5D7SL 3BZFA 4HQQL 2P8LA 4NSKB 4OF0A 4PV9B 5KEZA 4KRTA 4N8VA 4K3GA 2YS4A 3ZHLA 3NOIA 2DDQL 3T1FA 2R15A 1I1RA 2YSSB 3GMRB 3MYZA 5C0CA 3VXSD 1RJLB 3QSKB 3MFFB 4WKHA 1PPIA 4FLSA 3FAWA 4NM4L 3PP3K 5CKAA 5JQ6H 3SE8H 4M56A 4PJDB 4ZSOA 3QPXH 4BK4A 2WCGA 2WV3A 4LSVH 3NVQA 3M46A 4Z76A 5MENA 1ZJBA 1R85A 2BVPB 1FFOB 4K71B 4QRQB 3V4VL 2C8NA 4NKIH 4K8RH 4PLOB 3DETC 3V4PH 1XCWA 1FBIH 4K2UL 1H11A 3BGFC 4W6XB 4N0FB 3S37L 3BRFA 3RWJB 2BSTA 1MAJA 1TNNA 3WLBB 2FBOJ 4MB5A 4ODUA 4Z7WB 3GYCA 1EIBA 2ZSWA 2BSSB 2D31A 5ADOL 3JTSB 5DJXA 3BHBA 3TA3B 2XYLA 2R0ZL 3DTXA 5FO8B 3DARA 5EZLB 1ERNA 3DMMD 3MLZH 5DK3A 4ZFOA 1F4AA 3LSOA 1MCPH 4HV8A 4E5XB 4LSQL 1WCBB 2DM2A 4RRPA 4M6ML 4C7GA 5JXEA 5JXAL 4PYHA 4OOUA 1KNOB 2ICWA 3BP7A 3OAZK 4MJIE 3WFDL 5GS0D 1H3TA 3TBWB 2UVEA 2VDKH 1NC4B 3OKDB 4XBGB 5FA3B 5HD8D 5C07A 5C09B 3W25A 2X9WA 3ZTJH 5EBLA 4KJQD 1AQDB 1FJ1A 2XTJD 2YPLE 5DJYB 3TN0A 2FX8H 5CZVL 5ESAA 2KUTA 4XPBL 3RX8A 2XGBA 2WWMD 1GOGA 4H0GA 3N1MC 1E5NA 5KSAA 2JIXB 3JWOH 5CJOH 3CH8A 2FJHB 2B4CC 3QHZH 4UTBH 3V6FB 3AISA 3QCTH 3DWTA 1Z9OA 3BKCL 4L3CA 1QA9B 2CDGA 3B8SA 2GHWB 3S37H 4CW1A 5BRQA 4PRNB 3WYRA 4NO5A 2C1OB 1A4KB 3E8UL 5EC2B 4P4KB 4XXCC 4GQPH 4S10A 4LYRA 4ELME 2Y8KA 1QSEE 1TTUA 3H53A 4FFZL 2CJUL 3Q2CA 2H8PB 4YHYB 1E72M 1XIWC 1Y18B 3QFJB 3UBXA 2HAZA 2BY0A 2BOBA 4MJIA 4OLVL 1JMZA 2VSCA 4M6OH 4LCYB 4OF8A 5I2IA 4ODHH 1AI1H 1INQB 4I0CC 1YY9C 2EXWD 3BP4B 4G6FD 1I9RH 4GINA 4DTGL 1U93A 2V3EA 1VGEH 4PJXF 3SGJC 2VE6B 4CD5A 4W7VA 4HAFA 3L3GA 4PGJA 5BRPA 2FRGP 3IDNB 3IXAA 1N59B 4NQEB 1EEYA 1MCOL 1H9VA 3RILA 1HNFA 5C07D 1FL3A 1UB5A 4A3HA 1FOBA 4I3GA 4RBPK 1SEQL 3HRPA 1XAUA 2L7JA 2NT0A 3QO1A 3LPOA 1T7XA 1OF2A 3VFPB 3V5DA 4OFYD 4NWTL 5TE4H 1I9RL 2EQDA 5F1NB 3MRNA 1NEZB 1L0XA 3B2UC 4RZCA 3CC1A 1CGYA 4OUOA 1J01A 3QXDA 1PLGH 1A9BB 3UAJD 2C3WA 2Y5TA 4X83A 2EXYC 3IJHA 4Q2ZA 4JG1H 5E5RB 1YMHA 3OSKA 3EUUA 4UT6H 1EZVY 3NCBB 2D0GA 4FQQB 3VIHA 4D6DA 5D1ZD 4ZDHB 5C0CE 5D71H 5C6PB 5IIEA 5DJAA 4HPOH 1FYTD 3CUPA 4DKFH 1SJHB 3HFML 1J05A 2DQCL 5C0DA 4B9YA 2WC4A 2OR8A 3C8HA 1UR2A 4Q0XH 1N0LA 3QI9C 1FDLL 2VLRE 4X5XB 3D0VB 2GQHA 5F9OH 3U2SA 3KPPA 1KCUH 2ARJA 4CVZB 2CBJA 4NT6A 2ZCKL 3GIVA 2E6JA 2NX5E 2YPLB 2XSAA 2RB8A 3T4AA 4RFOL 4Z2GA 1AQKL 5FIEA 2IQ9L 4GZEA 1QLFA 5ELIA 4LCCA 1KTKE 1E0WA 4PREA 2CK0H 5I0ZA 3F62A 1YPZB 1RMFL 3OPZH 2F7RA 2CXKA 1OPGL 2BVTA 3G9VA 2XTJC 3UAJC 4OT1L 2B1AL 2XYCA 1AQHA 1FORH 3RWEB 5E08H 2CBIA 1GAFL 3MRDA 5BQ7A 2ITCB 5F89B 3LDBB 43CAB 3IYLW 5A6BD 4Y5XC 3HNTL 1F6AB 4LASL 3CVHA 4YDJB 2EEAA 1WFNA 2D73A 4TUKL 1U3HA 1KENH 5I8KH 4TQEH 5A2CA 1BVZA 1XIWA 4PLNC 4OLZH 4H5SB 1WZKA 3QQ9C 3VXTA 3FN0L 1R24B 3MI6A 2CNCA 3CFCL 1IEBB 2Q6WB 1WWAX 2DM4A 3D3AA 3QUZC 3MRQA 3W26A 1ZBVA 4OOZA 3WFLA 4KWUA 2HKHL 5HVGB 2W0PA 4XP6H 4OCSH 2BNUA 4X6CE 3VW3L 1VJSA 4AZ8A 4WUKL 4NQTA 5H8DA 2CLZB 4QEGA 3QRFM 1S7SB 2AKRB 2VXSH 3I3EA 4OZHB 2X4PA 1PYWB 4IMLB 1UQZA 4EDWL 2EXOA 3GNOA 3ARGB 3BP5B 2EPKX 3QULB 4NI3A 1DZBA 1IV8A 3MRKA 4EBQH 4MDPA 2CCRA 4DWSA 2N7BA 4J4PC 2P47B 2XPGB 1S5IH 4HULB 4V1DA 3BPLB 4AQOA 4KV5F 3WH7A 5C8JB 3BGMA 3RU8H 3ZDXF 1PAMA 3GM8A 4ZQKA 3C9NB 1MIMH 5GGTL 3SCRA 5B4MC 4LVHC 1SY6L 2Z35A 1AY1L 2JTDA 4NNPL 4XC3L 3TIDA 1EOKA 2BP3A 3BP6B 5SV3A 3WENA 2WAHA 2OLDA 2AXHA 3U57A 4GQ9H 3RDTD 5ACLA 2A3AA 3BX7C 4QHLA 3P0YH 3PDOB 3ZT5A 3D85B 5E5MB 5CJ5A 4TSAL 1Q9WA 3S36H 3BISA 2DLIA 4BUHA 4OM1H 2CYGA 2HKFL 2G60L 2XN2A 4WFFD 3SE4A 2A74B 2Y24A 3SCPA 1D6EB 1D2KA 1S7VA 3WLBA 2DWEA 4ZMAT 5TDNA 4H0HB 35C8H 3GMLA 1JV5A 2F19H 4O4YL 4PD4J 5KSBF 3VXNB 1MCKA 1NUGA 4G6JH 4ZUUA 2OP4L 3S8WA 5ADPL 5CJQL 5DO8A 3SJVB 1U92B 4H25A 4K23H 3SO5A 4C58B 4PJEA 3LSOB 4HWEL 4E5XA 2WHJA 4QXGL 1G1YA 1XCQB 4HG4J 4TVPE 3D39B 3F12B 4QTIL 1WWBX 3RWCB 4JN2B 4LK4A 2GW5A 5FOBA 4UUJB 1SVCP 2QSCL 3BDXA 4PJ7A 5IHUL 1P1ZB 4KU1A 1A2YB 4MD0B 5GGTH 2OSLB 4I3RL 2AQ2A 1HIML 4AH2B 3RU8L 2DWDB 3VXMB 4XNUH 1NSNH 4NQVA 5ID0B 1HQ4A 1F4WH 2B1HL 3THML 1CBGA 1CR9H 5IW6A 4F8QA 3ALPA 4NZFA 4RE4A 2GFTA 1KTLA 3OIHA 1QW9A 4IPNB 1E4KA 4MLIA 3L2MA 1EHNA 1HKJA 2AEQH 3OJVC 3BVNB 4NPYB 1LO3L 3AQUA 3C5SB 1XR8B 1G0DA 2BVQA 2QHAA 2GUOB 4U1HA 1MJ7H 3U7WL 4AQ1B 2ATPB 5DEFA 4UU9A 2PXYB 3DX8A 1FC1A 1UM6L 2J4WH 4TSBL 4OCSL 4JFHD 4L3CB 1YHTA 4L8DA 4Z7QE 1AHWA 2AQ1A 2HWZH 4P49A 3VFMB 1A8JH 2WBJC 2XWTA 2E0PA 5M17A 3B8YA 2GJ6D 5ANMA 1C5BH 2EYSB 1NCAL 4Y0GA 4GI8A 3EDEA 4FTVD 4CDHA 5F7UA 3SQOL 5HDOA 4K3EH 3L95A 3WFEL 3L7FA 4JZJA 1HEZA 4FZ8H 4U0RC 7FABH 1D7FA 2BNRE 5CWSA 1JNLH 4JDZA 2YPKA 3RVVD 4J3TA 5KS9F 3LRMA 1UH4A 2RCSL 5DQDH 1MCIA 1V3MA 4LKXA 1B0RB 5C0GA 4W7UA 5J13C 2ZXAA 3ZKXB 4JY5L 2WP3T 3Q0HA 5HXMA 3MMUA 1KIRA 2E9JA 3K1KC 1UM4H 1GGBH 3I2CL 1BJMA 3O8XD 5EBMA 1AGCA 5IB5A 1MWAA 1DVFD 3HZYA 3LH2H 2FNBA 5E95B 3IFLL 3NZ8A 4ZS7H 4JN1H 4WUUD 4TUJA 4QY8A 4PMRA 3RZCD 2NY0D 1TLKA 3GMMB 4MJID 2EDJA 2WVSA 3T0VA 1R3LB 5FHBL 1FL6B 3A21A 4HUKB 1GRWA 3NACH 4U1JA 3H55A 5T5NF 4UQDA 4LRNH 1VACA 1S7TB 5IB4A 3UTSD 3PWPD 2OSWA 3J8F7 1U8JB 2AABL 3QO0B 4NHUB 3W9DA 1CWYA 5D9MA 1MUJA 35C8L 4P99A 3QIWB 4KVCH 1M53A 2MCG1 1TJGL 3UJJL 4FQCL 4XNZB 2AV7A 3THDA 3WD0A 4X9GA 2WLZA 1CE1H 1RK0A 3B2VH 4ERSL 3B83A 2XN9D 5ETUB 3FAXA 4LPUA 4P2QB 4ENED 4G80A 3HS0B 1DN0A 3MGAA 4WY7H 3VXRB 3QDJA 5CQ1A 1CDYA 3MGOA 2N1KA 1BWMA 3PWLB 3CC5B 4WRLA 4AC1X 4ZPTB 1X6NA 1X5FA 2DMKA 2PO6A 2ORBL 1CD0A 2XHYA 4I4WA 1YEKH 4G8FA 4LAJH 4OUEA 4AIXA 3ZJKA 2WVVA 4Z6AT 3BFOA 4XC3H 5HDBE 3ZT7A 2RFXA 1ZLVK 4YHOH 4XMKL 1R34A 1X1NA 3RGVD 1U8LA 1RURH 4YNYB 5F3HA 1NGYB 4GMSL 3VXRE 3U7YL 3F8UB 3CCHA 2PTTB 1S7WB 1NOUA 3GH4A 3KLHD 3S5LB 1A3LL 1F6LL 1UWXH 1FVDA 1KJMB 4PMDA 2X10A 3HPJA 2PWHA 5B3NA 4MNHA 4LRNL 1QHOA 1VESA 3NGBC 3MRQB 5FHBH 2AJVH 3T8XA 5INDB 3WUWG 4NNPH 5LKNA 4AD4A 1DSFH 4X7CC 2GCYB 3RL2B 1VFFA 5FECB 3AS1A 4WU5B 3QCTL 2VDMH 2PI6A 2CIKB 2E5EA 2YWYA 4PRDA 1IGJA 3RA7H 4JAMA 4WV1A 4OI8A 4YHLH 4HS3B 1Q6CA 2VLJB 5CEXB 4K94C 2Q3AA 5HGAA 5GNZA 1ACYL 4JGMA 4OIAA 5DJZB 3KPOB 4N8CH 5IKCA 4MJ4A 1J87A 1CXKA 1GGBL 1IEAB 2C4FU 3P4OB 4BKLB 3AM8C 3QUYD 4N5UA 2DS4A 3CK0L 1UEMA 3CSYA 1UZ4A 4OZFA 4Z0XA 2P4AB 5IBUB 4GG6B 4WFGE 4R2GB 3PZQA 2CKBB 2R1WA 1OY3B 2F5BL 3VI3F 4G8EA 1EDTA 3HTLX 5CGTA 2H3NA 1A3QA 2XI9A 3ZDZE 1A6WL 1E4JA 5F96L 1INDL 4AEHH 1G84A 2EAEA 3SDAC 4H1LG 1S46A 1E73M 4LU5H 4YEFA 3P4LA 4JZJC 4X7SH 4Z95H 1WJ3A 1PX3A 5I66A 4MQ7B 2P5WE 5E5MA 2X4OB 3W2DH 2XN0A 3VOCA 4GXPA 3ARUA 5FYJH 3UR7A 4PCSA 2EYRB 4Z18A 4DM1A 3ULUL 1H3PL 3CVHL 3F65A 3N85L 3ZT6A 2ZUQC 4O5LL 3MA7B 4D6IA 1NLDL 1OD0A 4OGYH 3BUBA 5BRZA 2DGAA 1W3JA 4QRTB 3C6LB 5M5DA 5JIHA 1D9KD 4H04A 5K33A 1CICB 1NDGB 5J56B 4HJGA 1JHKL 4P2RE 4DVBA 4R26L 4OQ1A 5TJWK 3W28A 2ZCKH 3RZCC 3DBXA 5CIPB 2F2HA 5FA4B 3PBGA 4PGCA 3BQUB 1X5JA 3LIZH 3BAKA 5I1CH 3MNVB 1OTSC 5CBAB 5FF6A 3CZNA 1L7IH 1S7XA 3QIBB 4HEME 4MMXC 2X2YA 1HI6A 1HZHL 1LL4A 5FGCE 3MRGB 1MPAH 1TTFA 2V5SA 3IETA 5IW6B 2UWFA 4M62H 4WU7B 4PJ9B 1E70M 1H49A 4JG1L 1TZIA 5CUSL 3U4AA 3ZYOA 4U2YA 2ZG2A 4UT7L 4OFYA 1ZBWA 1MIEH 3KEHA 1R87A 3MODL 2DN7A 1MLCB 2ZCLL 5FM4A 1UWXK 4XNXH 5C0EA 5C08B 5H35B 5FDWB 4C56D 3N12A 4JFDE 1A7PL 5ABGA 1L0PA 3VX0A 5DZNA 3P73B 4UT7H 5D9SA 2QMKA 5IQ7L 5GGUB 2WC3A 3MBED 3VIMA 4U6HB 3MMEA 1I3RB 4HUNB 1AHWB 4XX1G 2JB6A 2EIZB 2R29H 3RVWD 3RUGB 3VDHA 4Y89A 5CPTA 4MDJA 3JV4A 4JLRA 5C7XL 1IAKB 4MXVE 2R0WL 4WGVB 3TYGL 1HOCB 2VR4A 3D3VA 4G9FA 4JKPH 1MI5B 1JYVA 4S3JA 3W37A 3D39E 1I7TA 3DSNA 4MCYA 1MQQA 1BVLA 1KCRH 2B20A 2ICEA 3DNKA 3RNKB 5CD5D 2VABB 4DN3H 3KXFB 4F7TA 4LEXL 1BVKB 1TVDA 4FFZH 5C0AB 2IG2L 4MS8D 5ESQB 1MCRA 3A23A 3K3QA 2XZAL 2X7LA 2DLFH 3L3JB 5C0BA 1UD2A 3CHCA 4YO0B 4X8JB 4LPXA 3WFBL 2AJXH 3KXFD 2HA1A 5B4MD 4UZUA 2Y5EA 4PJ5A 4UDUB 1S78D 1Q4NX 4UR9A 4PJDE 1J9YA 3C2AL 2OYMA 1P7HL 4G9DB 3GJFK 3KYOB 3RVUC 1BQHB 4XXDA 2P8MA 5J3HC 1K8IB 2Y07H 3NN8B 1MCWM 1YUHA 5BZWB 3CZLA 1W3HA 4U1JB 3UO1L 4DN4H 1SEBA 5DURB 2NW3B 5A8NA 1MQKH 1DLHB 4XX1E 4MHHI 4UCFA 2HN7B 3OKLA 4WCYL 2AS5M 4ELMF 1HF6A 4A3YA 4EN3A 1FIEA 2GTWB 2J8GA 2N56A 2PB1A 2DM7A 1VADB 3DX6A 3DX9B 4FN0A 4X4XA 3N1FC 1H0DB 3RY6A 3NCJL 4AT6A 4F7MA 3ZHKA 1OWQA 3QCVH 1W0YT 2HG5B 3GHBH 1CD9B 3IRPX 2W07A 2EYTA 2YD5A 3RL1A 2EPNA 4LSVL 4BYHA 1KPVA 1S9WB 3NCMA 4YGVB 1S9KC 5EZOH 1N5YL 2CPUA 3Q5TA 1IZJA 1JL8A 2JKXA 5F9JA 1U8IB 3WMSA 4OSUL 1R0AL 2VZOA 1F58L 1RUQL 1A6TA 2RFXB 3MBXH 5LXGL 3WFZA 1KB5A 3BD4A 4K2UH 1TR1A 2DKMA 1J8HD 5DA4A 1ZAGA 4XI5D 2X2HA 3KYKL 2FJFA 4ONGL 4UINH 2QJDA 2NTSP 4AMWA 1SJVA 4I18C 2XQYK 2IG2H 2BSED 1C8YA 5DJ2A 4ZFFA 4JFFA 2WUBH 3HPJB 5KTEL 4MNHB 3STLA 4J3WA 1JUFB 5C09D 1XF5B 3K2UH 5EOQL 4YAQB 1HHHA 4M8QA 4LCUB 2Z92B 2YHGA 1ZTXH 3F58H 1OLLA 4XVUC 1M01A 1YMMD 2R0WH 3I6KA 2F5AH 1D9KC 3VIFA 1E0OB 4LOUC 2H32A 3TO4C 5HVWA 4NX0A 1LO0L 3IK2A 2D3LA 1WIOA 3MRJB 2W9LA 3O2WL 1AXIB 1T7ZA 4OZIF 1MREL 5DTFA 2F54A 5DYOA 5I74C 3S6CA 5IJVA 2NY7H 5I8EB 2D3NA 1XGPA 4GMTH 1MAMH 4M4RA 3DI3B 2CRYA 2L0DA 2NXZB 1R3IH 5C0FA 2YD6A 3W81A 3MSGA 2VLRB 4D94A 4WW1A 5I75C 1NGXB 2A6KA 4JO1L 4R7NA 3ZKNC 1U3YA 2E9MA 1J0ZA 2WCAA 1C5CL 3MLVL 1FE8H 4PFEA 1BP3B 2BSSA 4F2MA 4DKEL 4JDVA 5AG8A 5EA0L 4MQSB 3SGEI 2XFXA 1JAEA 2VXQL 1JYNA 3H0TB 4TRPH 5EU3A 4WLCA 4FXLA 4DWSD 4OKDA 3WQVA 2GFBB 3U36A 1QLEL 3ETBF 4K07A 2BVPA 5KW9H 3PZNA 3RVTD 1NAMB 2ZSVA 4RISH 5K9JH 3VCLA 3DX0A 1KJ2B 3JUYA 2VLJD 5KSBB 4A6YL 1F58H 4PG2C 3RTQC 1KACB 1NAMH 2E7CA 5LA1A 4S0SD 3V0VB 1KJVB 3VFWB 4OLYL 4OZIE 3OR6B 4UILH 2BRRH 4YXKL 3MMWA 3ZE0F 4L9LA 4D0CB 3MXWL 3AIWA 2BFVH 5TD4A 4NZTL 4Z8FH 3TN0B 3U30C 5EUOF 1N6QH 2WYSA 3SE3A 1NGWB 2Z93A 4LHUG 4P46D 3F4VA 5EOTA 4OCYL 4U1SA 1KEGH 3LS5H 1AGEA 4DO5A 3WJLA 3N85H 4IRSD 3EHBD 3U7VA 2A38A 1ORSB 4ZUTB 3ZKMD 4CL7A 5D6DA 1LP9F 4WJXA 2SEBB 4HWBH 4PV8B 4HWZB 5C0ND 5C09A 1UYWH 4FNSA 2WZIA 4LAQL 5EBLB 4ZFOL 4K3EL 3LMJH 3O2LA 5EFFA 1DQQA 5F7LB 4NCC1 1DWGM 4JVUA 3MJ6A 4L4OA 5IHLB 1C5BL 5ESAB 5F96H 1CFTA 1ED3A 4H20H 3W0WA 4O58L 5FCSH 2Y07L 1YEFH 1LEGB 4AZBA 4FXKA 2BOBB 1BGGA 4LVOC 1LP9E 1YYML 4E42A 4NN5B 2F5BH 5I0DA 3P77A 2VC9A 4ZAKA 2J8UE 3X14B 1BF2A 4EN3D 1T1ZB 3JWDC 2GJZB 4TVPD 3RWDB 1WB0A 4AENA 3QDAA 3U7AA 2VDNH 3TJEL 1FBIL 1NLBH 3NYDA 5KS9E 4NO5B 1NARA 3FO9A 2C1OA 2VITA 4OZIB 3OB0H 4Y5VB 5LJYH 3BEVA 4UQCA 3MMEB 1ZHKB 3LVEA 3VH8A 1FL3B 1AVAA 4F15B 4ZO9A 3QA3B 3SCNA 4ZFGH 2QPSA 1W0VB 4YHLL 5C0IB 2P5WA 4MX7A 4XBEL 2HVJA 1I1AA 1VEOA 1H5VA 3NFPB 2ZKHH 4XPFH 3AU1B 4DCQA 1H0IA 4I2XB 3M45A 3PQYB 4J7RA 4J3XA 4HA4A 3FO0H 2JELL 1B88A 2TAAA 1N6VA 2AEIT 5EU6E 4H8WL 2DL2A 3KLAA 4PGBA 4QWWC 3EOYG 2B31A 1R3KA 1WZMA 1IKNC 3IDYB 4JZNB 1CNVA 5BXRA 4AZIA 3VXQB 3HE6C 4NZRH 2BC4B 1VBUA 2I25N 4M9PA 4GG6E 5E6ID 5JHDD 1ZANL 1JK8A 1W72B 4FQIH 4MD4B 2UY3A 1Q8MA 1FZKB 3LEYL 1CDUA 3NSNA 2XIBA 4M6AA 2FDBP 3SBWC 2OXHA 3O9WA 1AKJA 1W9BM 4GO6B 3PZTA 3RIAF 2XXMB 5E94B 4NRXB 1GZPB 4L4VD 4L3EB 3KAAA 4OLWH 4QDMA 3CDCA 4Y4FC 5E2WH 2E7BA 4RBPH 5C0DB 4UIMB 1WDRA 2EECA 4G8IB 3AB0B 3KPRB 1LK2B 4ODXB 3WY1A 3Q6FB 3AC0A 1I1FA 2GY5A 3O9WD 4X5XA 3LRLA 2PYEE 2J6EL 2V7HA 1GPOH 4OZGA 3ZOAA 1VADA 2YIHA 1QKZL 4NT6B 2XWJA 2QPUA 3TNNA 4YHIB 3WKMH 4F7MB 4JR9H 1MCEA 2XIDA 4QT5B 2C3HA 3UZVB 4XP4H 1B4JL 4Z7VE 5D4QA 1X4XA 3VMOA 4M4PA 5FEBA 1YJDL 2VX7A 1S7RA 4YXHL 3TGXA 3X11A 3KHQA 3WF0A 5HPCA 2EC9U 43CAA 2AKRA 5I15H 4J28A 3QDJE 4I77L 1N0XH 5D1QA 4D0BA 2V3FA 2X4PB 3U48A 3MV8B 4P57B 1IGFL 5GS2H 3HC4L 1TCRA 5T1KD 4EKJA 2NQCA 2GK0A 2K1MA 4XCYA 1RUMH 3C09C 4N90E 3SJVD 3WD5L 2BHZA 2VDPH 4PN2A 3GUTA 3O8XA 2X4QA 4JFFB 2NLJB 5SWQB 3C9NA 1E0XA 4Q6IB 1LO2H 3S7GA 4CJ0A 4WEMB 5TDPA 3VUPA 1KQZA 4JM4H 3QJFB 4MWFA 1G9NC 1S7SA 4TSCL 1A14H 5GRZA 4ZXBC 2O61A 1O5DT 2WUCL 3LN4A 2V38A 4LLQA 3BWAB 5FUCE 3R4DA 4MZ2A 1B30A 1Q9KA 3MV11 4H1LA 5M03A 4JO4L 1C08B 1V6WA 1MHPL 2QADD 5IMLB 5DO2C 1TNMA 2IAMD 1FAIL 3WXWL 3V4UH 3O3AB 3HE6D 1IT9H 2A74A 1ND0B 5AAMA 4M7JH 5I71C 2R4RL 5IFHH 3BAXA 1HYRC 4KUZH 1V0NA 2OYKA 2EC9T 2F53D 3O4LB 1NCCL 2MNUA 4OF3A 3MV8E 4M24A 5HI4C 4JR9L 1NP2A 4ZTOL 4PLJD 5D5MF 4OZOA 1BECA 1CVSC 4KMTL 3WO4B 3NJ3A 1LWHA 4IEFB 4FOMA 2V9QA 4LLDB 1DVFB 4NN5C 3LPWA 3S88H 5JBDA 2R39A 1FYTA 4O2FA 5FD0A 3VD4A 1NKOA 1C8QA 4PMXA 4UBDD 4BUGA 4NNYA 1AC6A 4Z7UB 3LD8B 1EQPA 1OCWH 4WO4D 3PABA 3GXPA 1E28B 5DMGD 4D0CA 4MA1C 2DT3A 1U8PB 4ZOBA 4ORGA 3DDFA 1U8HA 1ZLWK 4UNVA 2FYVA 1X5KA 2DQDL 1M6OA 4CCCA 4JZOA 5KVMC 3PIQB 1KPUB 3ARXA 2Q76A 1ADQL 3O3DA 1EXPA 4CKVX 5CP3H 2J1KA 3SCMC 1I3GL 3QHTC 5CGYC 2DT1A 3PWVA 3ISWA 3DX8B 2PTUA 3QQ9D 5FCUL 1SM3H 2Z8RA 1B6UA 4AEFA 3EYPA 2CDFB 1IC7L 4PJHF 4HKZB 1XH3A 5DVLA 4PJ7E 4CU7A 3OGSA 1XF3B 1VFBB 2BVOB 4K8RD 2GK1B 4LDEB 1H4PA 5CWSB 3KS0H 3QEQE 2VC2L 1DEEA 2H6PB 4L1DA 3WN5B 2E3VA 3P77B 1T80A 1BYCA 5DEFB 2AK1H 2Z8SA 5D96C 3IFNH 4QXUH 5CSBA 4Y16A 1F45A 1TPXC 4J23A 1RU9L 2D7OA 3MREA 3BJ91 1CECA 1KIRB 3NCYS 1BIIA 4NWUH 5ANMB 5FO7A 5D1ZB 1KN4L 3SOBH 4Y1AE 4R4FH 1U3HC 2X05A 3TJEH 5EBMB 4UQ3A 3PWUA 3RTQD 5EH1A 2BNRB 1B0GB 4OM0H 5IBLC 1UWGL 5ACZB 2KL6A 1HJWA 4XZUA 5I1IL 2VVSA 2H9GB 1Q1JH 1NBQA 3L7EB 1P7QD 1A5FH 1PJ9A 4MX7B 1OQOA 1OGAD 4OZHF 3IVKB 3S6TA 1UD8A 1L0QA 3PUCA 1CEOA 1DLFH 4LKXB 1LJYA 3NFPA 5FO9A 5GGVL 4C83B 2A83A 3PQYA 3S97C 1W9PA 1KV3A 4LF3B 2CESA 3IFOB 1CENA 2Z91A 1L4IA 4HS8H 1WEJH 3SE9H 4MNQA 4HD9A 4H7VA 3O41B 2WKLA 3MV9A 2YLLA 5HD8C 1W72H 3QO0A 4MJ6B 4NHUA 3W9DB 5A2AA 1B3WA 2VDLH 3GSUA 3T0ED 3BPOB 3MO1A 4Y19D 1U95A 4X0KB 4GW4A 1FORL 1F4XL 2WVUA 1WAAA 1ESWA 2Z31D 4Z7VF 4HIHB 4NKIL 4U1GC 2O5YL 1GZQA 3HG1A 5FGCB 3RWIB 1FL6A 5E99H 4TULH 4HF5L 4YQXH 5EG6C 4J12A 5CAYB 5I74B 2VURA 5DMKA 1UC6A 1RZFH 3WH9A 3CC5A 1GHRA 4P4KD 4D9LH 4X6CA 1QKZH 1X4YA 1F42A 1XR9A 3L5HA 3MRPA 5I1LB 1E4NA 1F5WA 1NCNA 3OX8B 4Y1AD 2X4UA 3QQ4A 5FYJU 2BRQA 4Y4KC 1T03H 2V2TA 3UG5A 1HXJA 3S98A 5C3LD 4JFWA 2CIPA 3KPLB 1TJHH 4OZGB 3ARGD 3BSZL 5D1XA 1KLUA 3P9MA 4MA3B 4F37F 1R7AA 4QRRA 2DQFB 4E0RA 1GGIH 3MGOB 3WFCH 1GQKA 2XY2A 3JV0A 4HXBH 3ARTA 1HP5A 2FIKB 1QYGL 3GFUA 3AZTA 2GCYA 4Z2LA 5HGHA 2J88L 5DHVA 2XRAL 5EFIA 1YEJH 2YN3A 4JRYB 5CKGA 1QVOA 1TZGH 5D72L 5BROA 1R5VA 4PB0L 4FQXB 2G75B 2YD2A 3GSQA 1CLZL 1XF4A 1E55A 4Z0BL 1O7VA 4O9HL 3S5LA 4TX6A 5KSVA 3SIMA 2DQHL 4RWYL 1SY6A 1P53A 4U1NA 3OLGA 3OXSB 4X6DA 5FDYA 5HPMA 2P8LB 4OJFH 4PV9A 4LCWB 3WO3B 5AC5A 4ACPA 4Q6IA 5HGGS 3A67L 3GMRA 3BZEB 3ARZA 3OBAA 5F7WC 4YHGA 4B3LA 4TTDC 4HS3A 1G6RA 1CG9B 1IC4H 3EJQA 1OGBA 1F90H 2O61B 3MV7D 4JQVC 3WELA 2H2SC 4MA1B 1WAAE 3OGCA 1NWRA 3VIGA 3BUDA 4MJ5B 1N7MH 4FQLH 3U5YA 4BZ1L 4IS6B 5MHSE 2OQJA 3QEHA 3KL5A 2HP4A 4FQJL 1P6AB 1C08A 3CMOL 1CTNA 4QKXB 4ZO7A 5LQBL 1A21A 1PBGA 3GI8L 3MV9E 2BSTB 3RBGA 4K3HA 3NMEA 4MNQE 3SY0A 3SCMB 1YNLH 4NZDA 4L29B 1W1YA 3GMNB 3PQYE 5AYBA 1IM9A 4BZ2H 2C5DC 1LEKB 1NCDH 3WIFA 4UAOB 2XTJE 4FQ1H 1T66C 2FL5A 2Q7YA 1FNEA 2PYFB 3AM8A 4MNGB 4M5ZH 3VFUA 5LCVL 3HZ3A 4TQEL 3H3PL 4CMMB 1EAPA 1VGKB 2YD9A 2X4OA 3CSPA 3GHEH 5FA4A 4PGCB 2EE9A 3WUBA 4Y2DD 2VAJA 1E71M 3GH7A 5A2IH 5MP6H 5CBAA 2FR4A 3I50H 1HX0A 5D1QC 4KRNA 1UKSA 4AJ0A 4CRPA 5JIWA 1HSBB 2ZCHH 3A6BH 1ZT7B 1E28A 3GZKA 3ILQD 1N6QL 1FO0A 5JXED 1EBPA 3RPKA 3RM8A 4OCRL 4M29A 3UP1A 4HJGB 5MEQB 3ROOB 1DR9A 2LE9A 1WBYB 2BNRD 3ZO0A 3GSVB 5IEHA 3E6FA 1QP1A 4JL2A 5BVPH 4FTVA 2XQYG 3C5ZC 1VF8A 3QEUB 5GGUA 4TUOA 5FYLH 3CZKA 3M7SA 2IAMA 2WAGA 4KUCD 2UZIL 3MLUH 5EZJA 1OP3K 5ABFB 5DD1H 3I75A 5DD6B 3JV4B 4JLRB 5EA0H 2Z31A 3B3IA 1EVUA 3J7HA 1XF3A 4JFPB 2VR9A 4KTEH 4PJAB 2FJGB 2C7UA 3WEZA 4HLZG 4U1MA 1KGCE 5D70H 5ITBH 3T0EA 3IJSA 3KPRD 3WN5A 1TE1A 4L5FH 3QXWA 4FLQA 4PRBB 1IJ9A 4KZEL 5HY9A 5B38B 3MREB 2R29L 4WEBH 1K8DB 5C0BB 4W84A 3IDJA 1T0OA 2C3GA 3WJJC 3NZHH 1M71A 3U0PB 4XNXL 5EO0B 3FO1A 5TE6H 3R1GH 3DURB 2YDQA 3KYMA 3BRDA 1HVQA 3WF1A 4WI4A 4X4YA 4N0UE 4G9DA 1K4CA 1IQWH 1TCMA 1UM5H 3RY5A 4ZSOE 4IM8A 1EMTL 1BYBA 4M62L 5E8DH 2J7CA 2A3EA 2A83B 4I0PA 1QEWB 2E8ZA 2F53E 4PJDF 1FNAA 4WWKA 3MV9B 1UH2A 1PZUB 1Q0XL 2VB5A 2NY2D 2ZOLB 1RJYA 2A2QT 2WSPA 5GNXA 2ARJB 3L1OL 4N90D 2C1PB 1Y0LB 4HZLB 3A4WA 2AAVA 2HG5A 1YUHB 3NN8A 1R5IA 5BZWA 4W4OA 4PREB 3KZSA 5A95A 1Q0YL 1QNZL 2MWCA 3ARDB 1WFOA 2EDQA 2XFYA 4TVCA 3GMQB 1N26A 4X6CB 2YA2A 4RNRA 3PGFL 2VDKL 2DYPD 2HJFA 5HHOE 4GW5A 2EADA 5E09A 3BT2L 1HH9B 4RFEA 1GW1A 4HIEB 3UYOD 5I9QC 3G6DL 2QR0B 3MX0A 2HT4C 2W0FA 2AXJA 5DSCA 3CTTA 5T33H 1FO0L 3MLZL 3OZ9L 4MADA 4YX2H 3QHFL 2BHYA 2D4DA 2NY4B 3RBSA 2C3XA 1VENA 1E27A 4YHNA 3WMBA 1SMDA 3BXWA 1CT8B 5HOSA 1UGNA 1WDSA 2CGRH 3GNMH 5AYQA 1JJUA 2AV1A 4WUUA 3AS2A 4QCEA 4GS7C 3ZKND 1JGUL 5DTFB 5DYOB 3OHXA 3TN0D 3NSMA 5BOZG 4AYGA 3BYTA 2R2CA 1JPTH 5EC1A 5KSVB 3MJGX 3FO2A 3NFNA 4K55A 3KPRE 5DJ8A 4JQXC 1HKIA 5CZKA 2ZICA 5C0FB 4HC1A 1U2HA 2ZUYA 4EEEA 2MQ3A 4KRPB 4AEIH 5CP7A 3AXHA 3P30L 4RMWA 3WIIH 2J62A 4XBPB 2DJSA 1YEGL 4MXVF 4DEPC 3BZEA 1VSCA 2JK5B 5IF0A 3NBNA 3JTTA 4RGND 1QSFD 5LA2A 5I1EL 1QBBA 1HINL 1JHLH 3FQNB 4YPJA 4JFEE 2XICA 2F54B 5AYUL 2NY2B 5TF1L 1YMMB 3P4NA 1G6RL 1YEHH 3JV6A 3TA3C 1KJ2A 5KSBA 1F11B 5IWLA 2NXYB 1OB1A 3LB6C 3SDCD 3C6SA 4W8LA 1S7VB 5AUMB 4J8RA 5T33L 3HI1A 1E4IA 2DEPA 4XHJC 4G3YH 1V08A 2NXZD 3FRPA 2Y06L 4MXQD 1GGIL 3A4XA 2NY3D 4L29A 4LP4A 1E40A 4RIRB 1DDHA 4AMKL 5IJKA 1FZMA 2YXMA 4MLSA 3RWGB 3DUSA 2FL5B 3GMPB 2BXYA 4U1LB 4FFWD 5E6IB 1T1XA 3LY6A 4U1SB 2ZUMA 1AGEB 4OTXL 2RGSA 3QUMA 1NWUA 4FMKA 3LRKA 4C57C 5DT7A 4WNQA 3RWCA 1RHHA 4JN2A 5IB2B 1NMBL 4WI3A 2ZXQA 3MLSL 1Q0YH 4U7SA 2ICWJ 2OSLA 3AIBA 1NH6A 1MWOA 2IEPA 3DX7A 4LSTH 4JFDB 3QNXB 3HUJE 5L9DH 5K9QG 2OCFD 4GRMB 1WTLA 4YWGL 1LP9A 4M7JL 1I75A 3RDTA 5T3XE 5T1LB 1J0IA 3W0WE 5IEHB 2O5XH 4CVUA 4ESKA 4H8HA 3VWKB 5D9PA 4M48L 3TWCL 1CGUA 2BK8A 2R56H 3RI5K 3EFDL 5GS0L 4YHYC 4FLRA 3AREA 5CPQA 1N64H 3EJJX 4P9HL 2VSDA 4X7SL 2DH3A 3OQ3B 1IAIH 5I1HL 3NCYP 4XRCA 4WSKA 1HK6A 4KMQA 2OMNA 3GRWL 1EO8L 4X7TA 4NZUL 4QOKD 3VXPA 1CFTB 4JZJB 5E2VL 2AJUL 4P0DA 2EABA 3LPFA 2J75A 1T7WA 2HT3D 1IM3B 1PS3A 4FXKB 1GOIA 3RM4A 1U8QB 5C0IA 2BMKB 1OAYH 2FJGA 4KGLA 4NM8L 3ZO9A 3PGDB 3SPVB 3IFPA 1ULVA 4OQTL 1GCYA 1N4XH 4JY4A 5KS9B 3MRCB 4AM0B 5D9NA 1UXSA 3EJTA 2YDSA 2X5PA 1I8KB 3VXOA 1L9NA 1WT5A 3NCCB 3IGUA 3QDMD 3FO9B 2VITB 1NCAH 4OZIA 4PGBB 4F7CA 1SHMA 3AREC 2AERT 1HHIB 4K9EC 4V1DD 3TVMB 2YUZA 2HVKA 3CNKA 1I7RB 5HYJD 3LAFA 4W86A 1MI5E 3TV3H 1JRHH 4PYGA 1TQWA 4P2OD 4YXHH 1NCUA 2A77L 4MD4A 4O51B 1OBAA 2P5WD 4LSPH 2XNAA 4NQCD 5J6HA 2IPUK 1J0JA 5B21A 3PXJA 4XWOD 4DK6A 5DT1L 4N8VG 3FFDB 3QDMB 1MCSA 1VDGA 4OLXH 3MRRB 5F9WC 3RM9A 1J5OL 1JTPA 1JNNH 1YZZA 3U46A 1GOWA 4PJXA 3MRHA 5JLZA 3S3SA 3MLPA 1YN6A 4UNIA 4XCEB 3PNWB 3FQWB 3QIWA 5A3HA 3R8BB 25C8H 4HJJH 1X5ZA 3INUH 2ZOLA 1MI5D 4LVNC 1RH9A 4APQD 3ULVL 2BY1A 2PBOA 4NJAL 5GXBB 3HZMA 4YDLC 4HZLA 5ADPH 1E1FA 2DDXA 1TETL 2WBKA 4FG6C 5CGMA 2PF6A 4NRXA 2PR4H 2ESVE 3E1F1 1JFQH 4Y5XB 3TO4A 4QF1B 3HG1D 3LEYH 3TJHC 2YD8A 2EDDA 3OG6B 3ZKSD 2R2BB 5TDOA 1GGCL 4X99B 5L2KE 3QUZB 2IPTL 4BH7B 2PTTA 4HWUA 4POUB 4FQXD 2HT2D 3QNZB 5FYJE 2XWJB 3D9AL 4JFDD 3WQ5A 2FCBA 2W0FB 2X40A 5TF0A 3CZFA 5MHSD 4MAVA 4R90L 1A7OH 1WC7A 5GJSH 5DJDA 4GRWB 3KVQA 5GGQH 1E6NA 2FB4H 4PTUA 4FXGA 2GJXB 1SY6H 2VXVH 4KY1L 5DK2A 3KR3L 4RMUA 5JW5B 4TPRL 4ZS7L 2XTLA 2BNQE 4JAMB 4WV1B 4N68A 1JPTL 1UVQA 3ALGA 5D1QB 4QP0A 1CT8A 3MLRL 4KZDH 2X2JA 1RHFA 3VDAA 3CX5J 3DLQR 2LV4A 3VVGA 4D71A 4WF7A 4JFYB 1XCXA 4QCFA 1WUNT 2BERA 1LF1A 3F7YA 5TGBB 3IDUA 5JBFA 3JVGA 2I07B 4LNRA 2Z9TA 2XV6B 3HC0A 5SWQA 3VKKA 4YR6A 1TA3A 1A47A 4C56A 3MTRA 2JJWA 1ORQA 2FATL 2NPLX 4Y7EA 3O4LA 3ZIZA 3TT3L 1Q9LA 2WNGA 4ODTH 5L2KB 5I19L 3DC0A 3LRSA 1MFUA 3DV6A 3BWAA 2NTFB 3G6DH 3BI9X 4K3DL 2E9IA 3ZKQD 2J3SA 4LAQH 1F4YL 4PJIB 1FHDA 5I66B 2GSGA 5JHDA 5ALBH 3UZQA 1J1OH 3QDGB 5IMLA 1DVFA 1YMMA 2HFFA 2LVCA 2JEQA 2X2IA 2K9UA 4YHPB 1U2CA 1R5WA 3EBVA 2RGLA 3HRZA 3BIKB 4KFZC 4QLJA 4NO0A 2EO1A 5HHOD 4K7PH 5JIPA 3GSOA 3U0WH 3PABB 3OLEA 4PMQA 4NRRA 4F33A 2H1PH 3INUL 4RIRA 4NZTH 3RGVC 4Z8FL 1OGAB 4PJCE 1G7PA 1L7TH 4XAWH 1F4WL 2B1HH 3THMH 1P7QB 3UYRL 2VRAA 1KGXA 1E6OL 1D9KA 5D7JB 5H94B 3SKUD 4A2MA 5KVDL 4OV6F 4AMXA 2CKSA 5E6IA 3LKOB 4LARH 1D5XA 5CSZA 4QRSA 2GI7A 3PIQA 3BESR 2WMKA 4XZBA 2NY4D 3KDMB 2VT0A 3PHQB 3F6IA 1H3WM 4UOW1 4O2FB 2A6IA 1KJ3L 2GAZA 2B4CH 5DT1H 2H2PC 2G3NA 1AE6L 1HWGB 4HW6A 4V2BA 2VX6A 2XZQL 4CU6A 5D8ZA 5E8DL 1H8NA 4JFDA 2ARWA 4UT6L 3H9SE 1LK3H 1K6AA 2CXGA 2WWDA 5EZIL 3OLIA 1TVBB 4HKZA 5HI3C 4R3SA 4PMUA 4HBCL 4NKQB 3GZAA 1EFXB 2O9TA 4XVTL 2MHAA 5AD0A 2M8XA 1O7AA 1NBZA 4WHDA 2GK1A 3EO1B 1DEEB 1JCKA 3QIWD 3QPQD 5DD3H 5C08A 4XTRD 5HI4D 5LGHH 2DIJA 5FDWA 3BO8A 2WIIA 5DR5L 4LRIA 2AJYL 2YXFA 3SJVE 3VMNA 2GJ6A 2OK0H 4UFKA 2P43B 3WJJA 3D4YA 2J77A 1J0HA 3BXNA 4AL8H 5GZOC 4KZEH 3P0YL 1JP5A 4ODVL 2JE8A 1H1NA 3G5XB 1E1EA 3VI4F 1HYSD 3RO8A 2ZKHL 3PWUB 4XPFL 3IU3A 2IBZY 5D8JL 1IQDA 3F58L 1XGQA 1YQVH 4PJ9D 5T3XD 4UZGA 4FQHB 5CBEA 1A3RL 3L7EA 5I1HH 4P9HH 4PP2A 4I18B 1U3ZA 1P4BH 4WO4B 4RX4D 1CGTA 3QWQB 2V5YA 4NFDA 1P7KB 1B2WH 2Y23A 5IHZA 5ESQA 3VGAB 3IFOA 3VD3A 1AXSA 3RP1A 4XNQA 1BIIB 5FO7B 1I8MB 3K4ZA 1IFHL 5ERWA 4YO0A 1DL7H 4I0PC 1KIQA 4X4MA 5CIPH 2VDNL 3UJIL 3AJ7A 1EGZA 4PRWA 2WK2A 4PJ8A 2H45A 3TONA 3QB7C 5E9DB 4JFZL 2Q8BL 4CKQA 1KELH 5GRVL 4U0QB 3X3GH 4S2SA 5EIVA 2P8PA 1X5HA 5GGTA 5A3IC 1T0PB 3ZDYE 3ZJ8A 1PG7L 3GH5A 1T4KB 1SM3L 2LU4A 1GYAA 1E6XM 3CFCH 3KGRA 1ZL1A 1Q72L 2DMBA 1SEBB 2ZUVA 1DWFM 1MFBL 4XNZC 3TEUA 3D50A 3VXME 3FOMB 1F02I 1I3VA 3JVGC 3SCWA 5J4MA 3ZE2F 4KROD 1XR9B 1K3ZA 4XPTH 1VFAA 2R8SH 4Y4FA 4DW2H 4DVRH 4KHXL 1VKXA 1ZE3C 3L4ZA 1X44A 1IAOA 3FN9A 1TJIL 2YFNA 1AGFB 4GW4B 3VWJB 1KQYA 1FGNL 1KB9J 4LHUA 4WEUD 3CVIH 2BCKB 4MNGE 4P23C 3PHOA 5E8EB 1GZQB 3QWRD 1BGAA 1QPPA 1MNUH 4DZBB 3VXMD 3WIHA 2GJ6E 2DQFA 4E0RB 4NKDA 2ITDA 3SUVA 3NIFF 2F8QA 5TF1H 4N1CA 2PKDA 1V02A 1QBLL 3QUYB 4UIKH 5I30L 3PZMA 4KUCF 3HPLA 1G9HA 3MNZB 4ALAH 2IQAA 2E4TA 2NY6B 1EH9A 2NY6D 5EWIH 1HNGA 1RV6X 1JGVH 1ZHNB 4FNLL 4UB0L 1IGMH 3ARDC 1E9LA 5DJ2B 1UJ3C 5E6IC 1J11A 4ZO6A 2XT1B 1QNRA 4EQ3A 3ULUF 2DQJL 1F4HA 1MW1A 2CKRA 4EVNA 1MJ8H 2A0LD 1ZXQA 1FLRL 3Q3GA 5IJKC 1MHPH 1PY9A 1RZGA 1X3DA 3CDGB 1F3RB 3T0BA 3GBNH 1EV2E 1IEHA 2A3CA 3I6KB 2OL3B 4G6KH 1XHGA 1NANI 3BJLA 5GS3A 4JRYA 4MAUH 1CG9A 1EEUA 1CFQA 2NT1A 5L8LB 4ZUSA 2F74B 3BAEH 5J7CC 3RGVB 3VA2C 3NAAL 2LU3A 3I02B 4KK8C 4BFIA 4PJ8C 5I8EA 3MKKA 2MKWA 1UZ6E 5KANI 3SDDB 4KDWA 5I18H 2VRKA 2XRAH 1C7TA 4JKMA 3MYJB 2VOTA 1V3KA 3U4BL 4LCWE 4K94L 4KJWD 1IARB 3GSNB 5A6MA 2I07A 1RFDL 1FCGA 3WD5H 4ODHL 1G7MB 1HQRB 3K2UL 5JHDE 5L2JB 3UEQA 1NBVL 1N64L 4APQA 5J0BA 1G6RB 4PTTA 1CU4H 3MV7B 1W9DM 1Q9LB 3ILQC 3GBML 4GH7B 2EE2A 1UD4A 2VH5H 4HUVA 2JCCE 3RJDA 1JXJA 4ZEPA 1NAMA 2ZSVB 2NY1C 4YDKL 3V0WL 4EJ1C 5JHDB 4LCWD 1JZ3A 4CMMA 1FQ9C 2UWEA 3FL7A 2WMIA 1G7IB 5J1SC 2HFFB 4XP4L 4HX1A 2Y6SD 4Q97A 2DSKA 1KJVA 5IBUG 1ONQB 2Q86A 3WL9A 3HRZB 2PW2A 4X80H 3ZZ1A 4K7PY 3R8QA 3MCLH 5L6YH 4X0VA 4M7KL 4N0YH 4G7VH 5JOPE 3AIRA 5ECUA 5JNYB 5EOTB 2ADFL 4F33B 3VGDA 1NEZG 2VQ1A 4KQ3L 1KCSH 2J74A 4YGAB 4JRYD 5A6AA 3WN6A 2GY7B 5HJ3A 2OYPA 1CXLA 2NXYC 3D0LB 4S1DD 2BNQA 3LN9A 3QIBC 3D25A 3EJRA 4I3SL 1GONA 3VRJA 5FUZH 2RBLA 3OB0K 5HHXH 4FFYH 4QRUB 3IT8D 5ICXA 1M4KA 1ZGLB 3BLKA 3GBLA 4HJ0D 2LU7A 3TYFA 2A73B 1MCFA 1QWNA 2F7PA 3IGAA 4FF5A 1PQZA 2JALA 2GAZB 1KPRA 5D2LF 2DQEH 2EPOA 2VWEE 3BKYH 3T2NL 3WCYA 5DI8A 1A7RL 1HXYB 3K2MC 5FYKH 1CGSH 2YK1L 4DAGL 4Z76B 5MENB 2FH6A 5ADOH 4XP5H 1UZ6F 3VXUA 3LKPB 3W9EB 1GJIA 3F5JA 4PJFE 2CLRB 2DICA 5TE7L 5AD0B 4R8WH 3BH8B 2OTPA 3E6FB 3RKPA 2CBVA 1FL5A 4OM0L 3SCQA 5J1TC 3K80A 2KQNA 4JKWA 4EOWL 4LGRB 4K8RL 5BCAA 1V05A 4E4PA 1TIUA 5B39A 3MGTA 3QEUA 1HJVA 1F97A 1OSPH 3AMGA 5C0AE 3BEVB 2BZDA 3EOBA 3NTCH 4L3AA 3VFOA 1FRGL 3WSUA 5AZ2L 4RQQB 4MTVA 5ABFA 5EZLA 4YBLC 3TBTA 3QXVA 4X4ZA 4IDJH 1DQML 3TBVB 3WD3A 3QEQB 3WUZA 2P5WB 4XTRC 3SKMA 1UWEL 3S3PA 1RPKA 2HVJB 4U5IA 1UR0A 4P2OB 4YFLF 5MEOA 5A8MA 1BOYA 3B9KC 2OWXA 5KVFH 3TA9A 2J8FA 4NC1E 5C07B 3WS3A 5EOCL 2M2DA 4MQXD 4LLUB 3RPIB 2X4SA 5IHZB 4FA8A 4MSWB 5L0QC 3KE0A 5FHAL 1KXVC 2D4FA 5EU5A 5CHNB 2YMXH 4XMKH 1DWAM 1SJEB 5FYJD 4F3FB 1J8HA 4IRZL 4KK9C 3T2NH</