1CDGA

Nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose-dependent crystal form
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
publication title Nucleotide sequence and X-ray structure of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 in a maltose-dependent crystal form.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase(glucanotransferase)
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cdgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cdgA01
1U3JA 1XIWD 3HCVA 3RY6A 3DVGA 5I8EB 4H1LB 4RWYH 1YNTA 3AY4A 1EHXA 1QSED 3GJEB 4PREA 2X0HA 1WFNA 3BX7C 4ZS6C 1PS3A 1UWGL 2D7TH 3ARBB 1OLLA 4DK3A 2OJEB 3ILPB 4NP4H 3TJEH 3VMOA 2VRKA 3VXNA 2C26A 2F1AA 1IKNC 3QJFB 5JBEA 1XD1A 1CDUA 1RI8A 4DKEL 3L1OL 4WU5A 1NLDH 3O2VH 3L7EA 1UWEL 3JWOH 1T0MA 4NQED 5CJ8A 2J6EA 1KT2B 2VABB 3AXHA 5L2KA 4R2GC 2W0FB 1E0VA 1XGPA 3V6FB 4ZS7L 1DQLH 3OG6B 3HMXL 2VZTA 2WP3T 3RL2A 3TM6A 4RBPH 4Y5VB 2CPCA 5ADPL 1RUQL 3HLAA 1RZGB 2J3SA 1T1XB 4P0DA 5JLZA 1GCYA 4LX4A 1MWAL 1DE4B 3M46A 2VE6B 1JTOA 3GI8L 4HUXB 5ADOL 4XP6L 3FT3B 3UZEA 5HDBF 5HVGB 3VXRB 3ZIZA 4G8EA 4X99B 1KC5H 3X3GL 4AWEA 1P4LB 3QI9A 3FJTA 1P7HL 1QD0A 3AAZA 1H15A 2NY0C 1ZOXA 5ILTL 3ES6A 4HTYA 3RWIA 3U0TA 2W63A 4P49A 3CFIC 3WF4A 3CSYA 5C70A 3BLPX 5EBWA 5FDWB 2CJUL 5BXFA 3VIHA 1BF8A 3QRFM 2J8HA 2VVNA 1ED3B 4NI3A 2VX6A 1NSNH 1L0YA 4I9WD 2N56A 4A3HA 4W4OC 2YD1A 2UZIL 4W84A 3HG1D 1YEIH 3IT8D 3RJYA 3PL6C 1AQMA 3WUZA 2V7NB 1K5NB 2NXZD 3OAZK 4OCWH 4GKSB 4Y4FC 5DFVD 5DRWA 4S0SD 3QBTB 3NZHL 1FBIH 4FQ1L 4X8JA 2H26A 2R29L 1T1YB 1T03L 3NCFB 1VACA 3CLWA 5TQ2L 1IC5H 1VFAA 1FYTA 1JD7A 5A2CA 4OZIF 5MI0C 4K7PX 1CPUA 2DM2A 4TVDA 4KPHL 1T66D 4PRWA 4NNPL 5J06A 3W53A 5DTFB 5T33H 5K59E 4EUPG 3RDTB 3S5ZA 4PRIE 2YHGA 2XM1A 5E9DD 5EOCL 4HIJB 2DH3A 3RVWD 2VLRE 3RL1B 5CJQL 5I1KL 2EICA 1RFDH 4MA8H 3AMCA 3ZO9A 3WL9B 3NAAH 5EBLB 1FFPB 3OKNA 1E4IA 2WMHA 4L29B 2NT1A 3TBYB 3O4OB 3QXDB 4QHUA 2D03L 1L4IA 4KKAC 2XFFA 4JHWH 4K9EH 1G9ML 2FLRT 4PMOA 2HKFH 4K23H 1O6IA 2Q7YB 1OAXH 5AC4A 3UTZA 3V5KA 2X4RB 3H9HB 3KYNA 4XNQA 4EN3B 4GMTL 2AXJA 3JTTA 1Y18B 2R56L 2OL3A 1BGXL 1QLEH 3N1FC 3ZDYE 4ZO7A 3MJ6A 3LRMA 5E6ZA 4D9QE 3GSNA 1T2QH 5C8BB 3GXDA 4HXAH 4JLRB 5AZEL 4PRPB 4BK5A 1VFMA 3HAEB 1RPQA 3KPPB 4OF5A 1R85A 1NCWL 3LHPH 3GHBL 2UY6A 3TVMD 3CUPA 3CO4A 3CBWA 3VCLA 4MS8C 1BEYH 1EFXB 3TIDB 5IB5B 1H0DB 2ORBH 2Z92A 3MMEB 4NC0B 5TH2B 4BQ5A 4GKOA 3GBEA 4PSPA 1DQTA 1M7IB 3O4LB 4IHOB 3IVKA 3K2UL 5LJYH 2BNRE 1U8KA 4AZHA 5DVMA 3ZOAA 4Y7EA 4UILH 1VSCA 1LO4L 4XP5L 4XCNB 5KN5A 2R69L 1ES0A 5BWFA 4LEOB 3GRWA 3RVXD 3AOFA 1BQHG 4F58L 3DX9A 3OGCA 4XNZB 3VRJB 1YMHA 3T2NL 4AMKH 1JRHL 1D5IH 5DQ9B 2I9TA 1OM0A 4FFZH 2IH1A 1J0JA 3FCTB 5E2WH 2RAMA 3PGDA 35C8L 4KXZH 5T1DL 2FX9H 3PWPA 1KEGH 5A3ID 2P49B 5F88A 1GC1C 2H32B 4OLEA 3QUMA 1KXVA 3OR6A 3K8MA 1N8ZA 2OZ4L 1QVOB 2XT1B 2QBWA 1HSAB 2KUTA 5EO0B 1ODZA 5I30L 5DQJB 2WZHA 4F80A 2ZCLL 5EZLA 1ZLSH 2B31A 1DDHA 5E1AA 2EIZA 1WDSA 5FV1L 3CXDL 3KPRD 3OPZH 2R2BB 5BW7C 3VSVA 1FG2A 2BNQB 5BRZE 3RX7A 2NY5H 2X4QB 4PJHA 1JTTA 5HD8C 4OLVL 4GINA 1CDCA 1MCLA 5CMAA 4PG9B 1BZ9A 4HOZA 5E8PA 4Z7VE 3RY6C 1AXSB 1LO3H 2OYPA 3AY4C 2JCCB 4HCRH 2I60L 1F13A 3GMMA 4M1DL 1A2YB 4JO3L 5CKGA 2DT0A 3VM7A 2VLJB 3AIWA 4PTTB 1FL3B 4QYOA 2CKRA 3EYVB 1F58H 3D5OF 2FHFA 3A67L 4KTEH 5BXPA 2NY2D 4XI5D 4RFOH 1K85A 3HZYB 5IK3B 4PRNA 2H1PH 4EI5D 3MV8D 5ANMA 1PG7X 3I9GH 3TFKC 4B15A 2JJTA 3U9UB 4M24A 1A3LL 1QLRA 4A6YB 4QRQA 1DCLA 3U48A 1KIQB 1DQQB 1WZLA 4Z8FH 3EZ8A 3AU1B 4G6MH 3EJRA 5E6IB 2EYRA 4PRHA 1MLBB 2DD8H 1FVCA 32C2A 1HF6A 3O3DA 3X13B 2WWKT 2NPLX 2EACA 2ZUMA 1OAZH 2Z8RA 4M00A 43C9B 2X9YA 3CK0L 2NW2B 5J11C 1QTYT 1AR2A 5C08D 3QI9C 1MFBH 2ALWA 4KHTH 2NY7H 4L3EE 1AD9B 4YHOL 4R5EA 3PIQA 4Z76B 3CZSA 1MQ8A 3GBNL 3BGFC 4AIZA 4LNRA 4HGKC 4ML4A 3T0ED 4NRZA 5MEND 3D2UD 4FZ8L 1KYOJ 4K3HA 4MXVE 2O93L 1TA3A 3VIGA 1WTGT 2AXHA 5DF0A 4HU0A 3WFLA 3RCNA 3MLWH 1U8QA 1EO5A 1KTDB 3WMSA 4PJ9A 1OGGA 3LQZA 3AIUA 3TO4D 4WFGE 3H2WA 4YDIH 4F9PA 5JHDB 1HH6B 2ARJB 2DLEA 2XWBA 4LQFL 1QSFD 4Z7UE 5GIRA 3CFEB 4XNUL 1I8IB 1K4CB 3BWAB 1NCAH 4MZ2A 3SDAB 1KB3A 5A2AA 4P5TB 4KDTA 5DJAB 6FABL 5DGQA 2ZPKH 1NC2B 3VGEA 4KKLD 1ZK9A 3HZVA 3VXUD 1IEBB 4PLJC 1TJHL 1V7MH 2B7DT 2ZX9A 1KB5L 3OGOE 1XGUA 4OIBA 4X5XA 2DQJH 4QFUA 1KELH 3SUUA 1FOBA 1GRWA 4YHGA 2FO4A 3G6AB 1JGLH 1HYRC 1F2QA 4JFXB 3V2AR 1H0IA 3OX8B 1WWCA 5I1CL 2DGAA 1VJZA 3BPCA 2EXWC 4JKMA 2F1BA 4IPNB 1J8HE 1UVQB 1X5AA 3UAJD 5FUCC 4H88L 5D9MA 4L4VB 1W8OA 1KPRA 1Q9WA 1B6DA 3KPMA 4LSVH 4R3SA 5JXAH 1KQZA 3IJ9A 1LP9E 4MYWB 2XTLA 3QB7C 4OAWA 3GSVB 3QEUA 2J8UA 2PW2A 1XCQB 5E2UL 3CVHL 5IEHA 1BJ1H 4HPYH 3ZDYF 2V5SA 4YDLC 1GJWA 1UA7A 4MXQC 2G8ZA 4J6RL 1T0OA 1D6VH 5MEOA 1Y0LA 4J1UB 1KOAA 3SGDH 2WSPA 4RMTA 2A73B 5E09A 2GCYB 4HWBA 1IGCL 1DQMH 5E8NB 1F4YH 1XCTB 4QTHB 4RFNC 4GZJA 4MCZA 5HHPB 4N1CA 5HYJB 2AI0H 4JFZL 4XZUA 4YHZL 5J7CC 1E4XI 2Y36H 2F7QA 1HKMA 3MRIA 2A6IB 1X5YA 2W0PA 3UJTL 1MFCL 1A6AA 3P4OA 1F11A 4BFIA 1FZJB 1R7OA 1IAMA 4OB5H 3VFSA 2R0LH 3TCXA 4ATWA 3RWDA 5FECB 1R5WA 2JALA 4HK0B 4Q9BA 4U7KA 1BLNB 3KLHD 1B3YA 3NPSC 1MHPH 4PJCF 3RTQA 4ZDHB 4K7PH 2WHMA 4Q0XH 1M71B 2AABL 3PWJB 1QFHA 1T5WB 3FN9A 3WFDL 1GQIA 3IFPB 4X98B 1E6OH 2DQGL 2Y6SD 4NQCB 3MRRB 1FC2D 4O2EB 4ZTOH 1ZA6B 5ABGA 4A3YA 1S7SB 4AZBA 3PQYA 1TETL 2Q8AL 3MO4A 1F4HA 1GPOH 3LSOA 4NC1C 3AXIA 5F1IA 5IMKA 2GSIA 4HKJA 1PY9A 4X7TB 3SDCB 3AHYA 4OGAD 3MLUL 5KVDH 1BGAA 2YLAA 1QSEE 1S7WB 3QEQD 1KXVC 5TD4A 3EKCA 3JVGA 1EHNA 4JREB 2FATH 2HTKD 4L8BA 2X4PB 4U1GC 4PYHA 5F44A 1UR4A 5BROA 4XCYB 3BPLB 5SWSB 4BZYA 2DSZA 1EUTA 5E8DL 4ZPTB 1CGSH 3AS0A 1EEUA 1E56A 2B1AL 1ZLVH 3BRFA 1FO0A 3ARVA 1ZT1B 4QTIL 1LF1A 3P77B 4ONGH 3RWFA 3IDJB 1HCVA 1YEJH 2XKNB 3HUJF 5I17B 3CSPA 4Z7VF 3V79C 4U1JB 3RUGE 5ESQB 1RH9A 4MNMA 5DK3A 1RIHL 2D3NA 5EU4A 3R0MA 3OJVC 2WLYA 3EO9H 4ZUTB 4F3FB 1QHPA 5TJWK 3IFOB 3QZWG 4R26H 3T4AB 1A02N 3SCRA 3MZGB 4I48A 3LPFA 5BZWA 1U2HA 5KSBA 3BMVA 1DWHM 4N0UE 5HSFA 1C7SA 2W92A 1KUMA 1LVEA 2IMMA 4MJ4A 3X12B 3NTCH 5KZCD 1FL5B 4LVNB 3AFBA 4TUJB 3LQAL 1AKJB 2HN7A 4HC1L 5CZXC 1JNNH 4CNIA 2X6MA 3BOVA 4TOYH 1MJ7L 3S5YA 4JZNA 4ALAH 5LWYL 2VRQA 2O61B 4AT6B 3QPQD 3LS5H 3MUZ1 2R39A 4HWEL 2DBLH 3TIEB 3STBA 1ZTXL 3VFOA 1LQ0A 2IF7A 3VINA 5AAWA 3BZDA 2BOCB 4LRNH 2DTMH 1HYSD 4PJDE 4LSRL 3C6LA 3NGBC 2HTLC 2YIHA 5GHWL 2ZX7A 3U0WL 1I3GH 3FMGH 3QA3A 3QUYD 3V6OE 1RAMA 1DANU 5IR1A 1KPUB 3W24A 3WF3A 1RUKH 3ZE2F 4JR9H 4LCYA 4NO3A 1PYWB 3ZTNH 3PABA 1OPGH 1RIUH 2AKRB 4EUPH 1BZ7A 3T8XA 5DUPL 5E7FA 2XPKA 2Y5EA 4OLWH 1WPCA 3FB6B 2SEBA 5CCKH 4PUDA 4ZEPA 5T1KA 3IRZA 4KRLB 4UU9A 1KTLA 5D71L 3ZT6A 4Z18A 4P59H 4CCCA 4PRAA 4E4PA 3IDMB 4MXVF 4ZNCD 1T7ZA 4WSKA 1P9MA 4F79A 1UACL 1UENA 3IDIB 4M43H 5CFHA 1S9VB 3PP3H 2YKLH 2QHRL 2ZJSL 4PJ9C 5BJTB 5IV2B 5ICYB 4HPGA 2VH5L 1BSIA 4H5SA 4Z7UF 3EMCA 4F9PC 3ARDA 4M7ZC 3BVXA 3PBGA 1U2YA 2V5RA 3BQUA 5D5MF 1LE9B 4EXPX 4I1NB 5BOPA 5HVHC 1PG7H 2XI9A 4KDTC 3HE6A 4KTDL 1A5FH 1US2A 1QW8A 1YMMB 3QWRA 1D9KB 1TQCC 3GSUA 2NYYC 1UD3A 2JB5H 2UWEB 4YX2L 5DRXB 4PMUA 1WBXA 3MJ9H 4BSWA 3BHBB 5CIPA 4HT1H 4X7SH 4CVZA 1FPTL 1CBVH 1NWSA 1U3HC 1S9XB 4HWUA 3MRFB 4GMSL 4PTVA 2C3WA 3IDYC 4NFDA 5FUZL 4NKIH 2BVOA 5F7UA 5AG8A 5JHLL 1ZHBA 1DBBH 2HJKA 2WIMA 4PGCA 5IOPB 1BVNP 3OMZA 3MBED 4BZ2L 3BP7A 5DC4B 5CJOH 5A43C 3ZL4L 4KHXH 1Q9KA 2GKIA 3Q6FB 3DTXA 4RAUA 3OG2A 3W9EA 5C6WH 1JL8A 4PYGA 2W9EH 3KPNA 1XF2B 4NM8H 2OXHA 2XZAH 1EOMA 5ISZB 4RRPA 4OCNC 4OGZA 2W60A 4U3AA 1VFOA 1JPFB 2AK1L 2B4CH 2G2RB 5HYQA 4PFEA 1YY8B 1B0GA 4CU8A 4RWHA 4LSDA 4M61A 3EFDL 3L6FA 5C0AE 4OBRA 4JVPA 1J0IA 2VDLH 2AEQL 5B4MC 1EGJH 1P4IL 3KR3H 2BVUA 2J7DA 4JPWH 3GYCA 1AP2A 2YL9A 4NO2A 1F5WA 3T4YA 2UVFA 3CVIL 3OJMB 2GJPA 1PZ5B 3G5YA 4YR6B 4F9DA 2VLRA 1BQUA 4M1CD 3V0VA 1E28A 4MX7B 3RZCD 2XZQL 3DRQB 3RILA 4P23A 3EJSA 3C2AL 4LSSL 4M7JL 1JPSH 1FAIH 3ZDZF 1BQHA 1DBJH 2OR8A 3RTQC 3VIJA 4IUGA 3OKMA 5H94A 2YZ8A 1DUYA 25C8H 4NQXB 3U4BL 5IB2A 5KVMC 3AHTA 4WWKA 5FYJL 3MMWA 2VDML 2P43B 4NQTA 4WENB 1LE5B 2QHLA 3DRTA 1P6AB 4U7SA 2AK4E 4KMTL 1KR0A 2FB4H 5IVXE 2CD0A 3QO0B 5F7DB 1NDMB 5DHVH 4LARL 3MREB 3KPOB 2XKUA 3TJHD 2UWFA 2X4NB 4HZ7A 5HGHA 3U7VA 3CU1A 5L88H 5IMMB 1N26A 3JVGC 2NY4B 2GJZA 2NY1C 1OCWL 4YNYB 5F7LB 4FXLA 4LF3B 3UG3A 1VADA 4OUUA 3CZLA 5DMGC 1WBYA 3R06B 1P1ZB 3CZEA 3RUGF 1CXKA 1EO8H 3BE1H 4GRMB 2IGFH 1RURL 5E5RB 3OGSA 2CLRB 2FX8L 4RAVA 1FVEB 4Q6IB 1EXPA 3N9GH 4Q9QH 4GSDH 3N85L 1FH9A 1OAUH 4YHLL 4D9RD 4TSCH 4OZHB 3HR5B 2E9LA 1G1CA 3U7YL 5DMJB 4LPCA 3RNKB 1U95B 4MA7H 3MCLH 3KHOA 4DTGH 2AS5M 1RHHB 5D9SB 2BNRA 2BC4B 5CHNA 5MP6L 4J3SA 2YSSB 5IG7B 4KJQC 1SY6H 3OHXA 1AH1A 1BYAA 3D85D 4WU7A 3HI1A 1MEXL 1CZ8H 1QR1A 5FL1A 3VA2C 3EJZC 2NSXA 4GUPA 4MAUH 3MR9B 2Z91A 1A4KA 2GQHA 5C08E 3GXTA 2VURA 4Y1AD 3BRGC 4FXGB 2GT9A 4WJ5B 3C6LC 4Y4KB 3V0WL 3RQ3A 2OL3L 2DYPA 3MLXL 2BCKB 1RZKH 1X7QA 5BRZA 1UWTA 2OM5A 3EGSB 1YEKL 3DMMA 3L9RA 4XBEL 2OWWA 4V1DD 1QYGH 1UZ1A 1CLYH 3U6RB 2EDDA 1CR9L 4IRSD 2DF3A 3B3IB 4FTVD 3O8XB 4PJIB 1KJMA 1QFWH 2PKDA 4X0VA 4JAMA 4P3WA 5GGVH 5I1HH 3BO8B 1JHLL 3VG9C 4P7NA 5K9OA 2CDEB 2VXVH 1ORQA 3ZJ6A 5FM8A 4AZ5A 3UMTA 1DN0B 3KPQB 1CFBA 2BDNL 4WUUA 5D8JH 3BUIA 8FABA 5IF0B 4ZUVA 3GMLB 1KBGL 1I3UA 4YXKH 5INCB 3QQ4A 1R86A 1ZANH 4JAWA 2LFGA 5MEPB 5I8OH 1GXEA 4KROD 3X3FH 4QRRD 4UAOC 3ARDC 4PIRF 5KSVB 2IFFL 1LD9B 2E6JA 3LV3B 4LAQH 3BPOB 3EYQC 4MCYB 4NZUH 3BQUC 1YNKH 3MV9D 5CBAB 4N68A 5CZVH 3TCLA 3TBVB 3HZKA 1UD8A 3UEQA 1IQWH 4P7LA 4EZMA 2VLME 2ZSWB 3HE6C 4P2RE 4XGZB 4XPFH 2D1ZA 2VOTA 3THML 1WBZB 5JIKA 2UV3A 2C7UA 1H3PH 1R5IA 2PCPB 5F1NB 7TAAA 4LCWA 4DQOL 3KLAA 2Z31A 2J1KA 2WK2A 3Q48A 3ARRA 3B8YA 3NIFE 1MWAB 4L3EA 4ENEC 1UM5L 3K81A 1WDPA 4YBQD 4MWFA 4ORZC 3UTSA 1DWIM 1IT9H 3U1SL 3L5WB 3WFHA 4Z0BL 2VXSH 3QO1B 2X89A 4PJEE 4IMKC 2MQCA 43CAB 4X80H 3MRGA 3SOBH 3PZGA 4XBPA 2R8SH 5I78A 2XVKA 4R7NB 3RWEA 2ATPA 5ELIA 1VPOH 1ZGLB 1LWHA 2EKSB 3TA3D 4X6CB 1T6WA 2OCFD 1HSBA 3CZKA 5D72L 2YEZA 1PG7W 2ZOLA 1LEKA 5BXRA 4P9HL 1JYVA 1ZHNA 3H54A 4XXDB 3E6FB 1MJUH 3IXTB 2VDOH 2J4WL 3QNYB 2PO6D 5I5RA 4Y4HD 2XNAB 1JNEA 1ZBWA 4Z2IA 1T4KB 4HUNB 4TUOA 1BQCA 1UYQA 4ZXBA 3SE9H 2W5FA 3VXSB 1GHSA 2EDBA 2DWDA 2OR9H 4F7PA 1E4MM 1QACA 1UASA 2HVKA 1W2KT 3O41B 5D9PA 1CQKA 1U8MA 2X9WA 4N9GA 2E6QA 3RNQB 1H3UA 2GFBB 3F6LA 5EB9A 4HX1A 3MNZA 3U9PL 5DA4A 3S37L 4PMXA 1LGVA 1UJTA 3RDKA 1V03A 4DCQB 3BPNC 4PP2B 4HWZA 1NUGA 5FYKE 1S7RB 4HPOL 1J8HA 4M93C 4M6ML 4KRPB 3QEQE 3RP1A 3U7WH 4LLMA 4DGYL 4RFEB 4PJ5E 3BSHA 1LP9A 3BT2H 5C0EB 1AGEA 4GPNA 1CICB 3HI6H 1JI2A 1RZ8B 3T77B 1JMZA 3UR7A 2HLAA 5IVZA 1JYNA 4JRXB 1GUVA 5BRQA 1VFBA 5IVXF 4KMQA 4S1SL 1JV5B 3MRNA 1BM3H 2ESVA 4G9FB 4OLXL 1INEH 4HKZB 5DVLA 5JIPA 1AJ7H 5D7SL 4WI9A 3WN5B 5HOSA 4D6GA 3FQNA 4OZGE 1HJVA 3KWWA 3DSFH 2DDQH 4ACZB 3S36L 2GK0B 3CCHB 4FNLL 1KJVB 4TTDC 5T3XH 2XA3A 3FXYA 5DJCB 2VDNH 1XR8A 2YPLA 4PJ7B 1ADQA 4WCYH 3QZWA 1MRDL 4OCMC 3FB8B 4M48L 4UNUA 5FA3A 2WMIA 1S7XB 1QRNB 4UZUA 4G3YL 5DC9B 4OCXL 2XY1A 4YHYC 2X4SA 5I76A 2DQXA 3OIHA 4P2OA 4C7DA 4ZFOA 4MQ7B 5J4MA 1WQVT 2CMRL 1HXJA 4PLOB 4KQ3H 2XYCA 5GRXG 1S5IH 1TPXC 3AC0A 3SCSA 4UIKL 1QSZA 2XVGA 1YC8A 4LLYA 5IMLA 3PP4H 5FCUH 5GISL 1XGRB 3FFDA 5D7JB 1PKQB 3F7YB 1JGDA 2B2XL 2IUZA 2WIIA 2Y5TB 3JV5A 1G7LA 4OKDA 1N82A 4FQJL 4OIIH 3V0AC 4ELKA 5H8DA 3W0KA 5JBDA 1QSEA 4PMYA 4R90L 1NAKL 2R1WB 1A1OB 4WW2B 4AEEA 1ZHKB 3LS4L 3AZSA 1NCCL 3PHQB 1CL7H 2YDRA 4R4BB 4TRPL 3W0WD 3QIUC 4ZYKB 3GHEL 5I1LB 3WKNA 3VXRE 2A9MH 4LK4A 1J1PH 3ZE1F 3BRDA 3CFBB 1J0ZA 2J47A 3DMMC 1JN6B 3HMWL 1PEWA 2DQEH 2H8PB 4U6TA 2X2HA 3MYJB 3RM8A 2EECA 5BV7C 3S7GA 4DOHE 1R5VB 2RFXA 2V17L 4EI6A 4L8CA 4H1LG 4XMPL 4X5WB 3DX7B 5DT7A 4PV9B 1BQLL 4S2SA 4N0UA 1K6AA 3U30B 4EAMA 2Z8SA 1JHTA 2YBRA 4WNQB 4H2CA 1Q1JH 4ATLA 3ARZA 1W0VA 5E4IA 3VXMD 1E4WL 5BO1H 1QFUL 1WLHA 1RJLA 3NZ8B 3ZDXE 3AMLA 5HXMA 3W11C 4ODWB 5DVOA 2V7HA 4J3OC 2DRUA 5E1HB 3PP3K 4NQVB 4EIZC 1NBZA 2EAEA 1DVFB 4JO1H 2I26N 4ODUB 3EMZA 1T3FA 3WMBA 4XVJL 2XQBL 5LCVL 5IESH 4YAQA 5ACZA 4NKMB 1JJUA 1TVHA 4F9JA 4GRLD 3BN3B 3I6GA 4PJDA 2EDTA 4MNGE 5AUMB 5JR1H 2E27L 3SKJH 1CK0H 4Z2KA 3IETA 2G5BA 1N5YH 1KPVB 3V6OA 1CXIA 4YDJA 4G6AC 2IPUK 2DQCH 1D5BA 3BD4A 1A14L 5TDNB 1QO3A 2QQLL 1E0XA 5EORL 1R87A 3M6DA 1A6TB 2XFXB 1E6PA 3UJJH 3NIFF 2YDSA 2Z31C 1R7AA 3QIWD 4PRBA 1FO0L 1LDPL 3H55A 1K2DA 4XV0A 1X9QA 1MVUA 2F8OA 5JORB 2FEEI 1WEJL 4PJEF 5D1ZA 3PGFL 1OF2B 1NGYB 1FFOB 3DLQR 4NHCL 1R3HA 4RGNB 1HVXA 3WIHA 1F4WH 3OTTA 1UD4A 5GPRA 4ACYA 2IANB 4LVHB 1MCEA 4QT5A 4I13B 5EPMB 2XFRA 1JWUA 5HHMB 4V2BA 1EEYA 2KKQA 4HUVB 5IJVA 3CTTA 3DROA 5E9DA 3TO2A 5B3NA 5EIIB 1KGCD 5LQBH 1C12B 1W72H 1IL1B 5I18L 2GTZA 4PRPE 1KBBA 3WQ8A 4BA8A 2A6KA 4LHUB 4R0LA 1UYWH 1DZBA 3SJVD 4ZXBC 1G6VK 1P84J 2PYEB 4JGJA 4OD2B 3K80A 1YHTA 1M01A 2WINA 3GKZA 4GKZB 5IEKB 3VX1A 3FO0L 4XTRC 3M17B 2F54D 5T3XD 1ZS8B 3AHVA 4F7TB 3QFJB 1F4AA 3RWCA 2VXQL 1CF8H 1YZZA 3D4YA 1S9WB 4FLSA 2JELL 3UR8A 4BQ8A 2YFNA 3U5UA 3B8SA 3QQ3B 4Q2ZB 3O4LE 5DR5H 2VKXA 3SHSA 1KB5B 2R0ZH 4KK5C 4MMXC 4UT6L 4L3AA 2XN9D 5KAQG 1W9DM 1VRXA 3MLVH 1D6EA 4KK9C 3LIZL 2F9BT 4HIEA 3V6ZA 3BZ4B 4JFDE 1RV6X 5D7IA 2DLTA 1JCKA 4HLJA 4XC1H 4WRLA 5F3HA 2J62A 3RWHA 3MMUA 1FVDA 3TVMA 1TZHA 2XACC 1GHRA 1GQKA 4HU8A 4X7CC 2A9NH 1WFOA 4OZGF 3BEWA 1H9VA 4APQD 2CRIA 3UYOD 3I50H 5EZJA 1S7UB 3CVHB 3NMEA 1ZS2A 2BNQE 3UG4A 4PJ8D 1U8NB 1P7QD 2WLZA 3OKLB 2WZPD 2J74A 3TTSA 2G3IA 4UOW1 4G80B 5C9KA 4Y88A 5EBMB 3DOSA 3D39B 3HI5H 5IM7A 3HAEG 2JCCE 5EWIH 4JFTA 1MHCA 4HHAB 2HJFB 1IGTA 3CC1A 4D1JA 3TESA 2EH8L 4F66A 2VLJE 5LGJA 3G6DL 4MLSA 1UCTA 1VGKA 4P2OC 5FHAL 3IF1A 3WV0A 4Z7WA 1I8MB 1TUXA 3U2SA 1FH5L 3L7FA 3PDGA 5CP3H 1NANI 4QY8A 3RKPA 3FOLA 4JFUA 4L5FH 1KIRA 5CP7A 2YC1A 3FRPG 3KXFB 4N5EC 1Q72L 1FP8A 4HJ0D 4NZRH 4M1GL 2AK4A 4O4YL 4YDKL 4V1DE 4K2UH 4AZCA 1HXMA 2H9GA 4I3RH 4NN5B 3QXTA 1B31A 1WIUA 4GOSA 4OJFH 3QIBB 4E41B 1RU9H 1J11A 1ITXA 3OWEA 5BXTA 2Y06L 4WW1A 4FLRA 3X14B 1MIML 1BQSA 5A8MA 2WUBH 2OYMA 1IBGL 2ICWA 5E5MA 5F9OL 3SDYH 1E5NA 3OXRA 4E8DA 4N0YH 5FGCB 3H3PH 3VD3A 3GEWB 3HNTH 3WLBA 4ZD3L 2LU7A 5KSAA 4H8WH 1NUDA 4XB7A 4MJ5A 3MV8A 3RA7H 3WY1A 4YIQA 3PL6B 3QCUL 3K3QA 4Y4FB 4LOUC 4KUZH 1HXYA 4JPIB 1ZAGA 5DO2D 1W0WB 4GQPH 3K0WA 3WHXA 2ESCA 1NGZA 5HGDA 2PB1A 5T3ZH 3P73A 4U6YA 1INDH 3D5HA 3BH9B 3MRKB 5IT2L 4O2FB 2GUOB 1YC7A 1BVKA 5FGRA 1OP9A 4E5XA 5DUBA 3ZDXF 4PV8A 4XMLH 1F45A 3OF6A 3VI3E 2DLIA 1A7PH 2X4OA 4HIXH 1I8KA 1U58A 3LXBA 2ZICA 1N6VA 5L7XH 4Q9RL 4LPVA 1EJ6A 5C08A 1K9TA 4AL8H 5EOTB 3SPVB 5C7XH 1OARH 3UZQA 3ZKSD 4LMQI 2IPUG 4OKVA 3IXAA 4OF6A 4O2CB 5DQDL 4ZAKA 5ID0A 2CNCA 1MI5D 4E2OA 3V6OC 3IFNL 4KVNL 1E4XH 2C1PB 2F5AL 2HKHH 4W6YB 5EUKB 1DQJA 3A4WA 5KAQF 3D2UA 3SKOA 5CLTA 1RULL 2ILLA 4JHAL 4POUB 1WFUA 1G0XA 1HWGB 4LLWB 5CPQA 3WQVA 1FGVH 3QEHA 4PGBA 5FYJU 4EVNA 1PIFA 1WUNT 2BHYA 4IDLA 5C0GA 4L4VE 4MNQD 2Q8BH 2ZE0A 1A6ZB 5DJDA 4O9HH 4P99A 1IC4L 1A7RH 1BBDH 3IJSB 1J01A 5D1ZC 4M4RA 3F8UB 5KW9H 1QNPA 4PMVA 1GH7A 1J0HA 4RMWA 3NOIA 3O3EB 4ODVL 3VXUA 5C0DA 1NBVH 2QV4A 3L4WA 4ZE4A 1JDAA 5IW3A 2AJVH 3CDGB 3CH1A 3KL3A 2QF8A 4WTXA 4F2MB 3WS3B 5DMYA 4MB1A 5LAXB 3T2PA 5DD5L 2EZ0D 1YEDB 2APFA 3LPPA 3FQWB 1OTTC 4HUWB 1CE1L 2ZSVB 4HGWA 5CBEB 4J12A 4M6NH 4YUEH 1SJHA 1N4XH 4R0LC 3I75A 2V2XB 1MJJA 3IU4H 2CKBH 5FM5M 3JV4B 3G6LA 3G5ZB 5ICXA 4DUVA 3AGVA 2XWTA 1HXKA 2HISA 1LO2L 4KFZC 4QLRA 3AICA 3VXTB 2Q86B 1GOOA 3MACL 2VT0A 3RIKA 1T7YA 2XGBA 4ZPVB 1MCFA 1QQDA 3WIFB 3D87B 5JQ6H 4IDJL 1JE6A 4NQCE 4OZ4B 5FO8B 2K7QA 4GFTB 4PPTA 4JHOA 1N7MH 3SE4A 6A3HA 3NA4A 4NZTH 2CR6A 4WO4D 3S3PA 3WN6A 4GS7B 1X44A 3O3AA 3UTTB 3C5ZA 4ETQA 5DMKA 3ZZ1A 3G04A 3VD4A 3QQNA 4I5BB 2VJXA 4IOIB 2AJ3A 2WWMC 3HCVB 3FO2A 5FYKH 4JZ5A 3TVMC 1ZKAA 4G8IA 5A1AA 4ZXOA 4UQCA 3GMQA 1YNTB 1T0NB 5CEZL 5IHZA 4PREB 5SWSE 3VGHA 3FQUA 4FQCL 1B2WH 4BQ9A 5AZ2H 3MLTA 4W5ZA 5IHBA 3Q3GB 4PG2A 2DT2A 4QXUL 1GZQA 4O58H 4Y16B 2V5YA 3BVUA 4QLJA 1V3KA 1BWMA 5GRUL 1US3A 2JCCF 4WU5B 5AAMA 4UV7H 5GGTA 3G08A 1IKFL 3L7EB 2LTQC 1T0MB 5AY7A 2ZUSA 2FYVA 5EU6D 1RP9A 1ZWIA 5L2KB 2NXYB 3HKFA 5IFAL 5CILH 3KPSB 2X2JA 1C8QA 1XGPB 2IJ0C 4NUJB 4K94C 4HZ8A 4ZFMA 2VLKD 4Y2DD 1CS6A 5DJ6A 3WFBL 4DKFL 3QEQA 3QUZD 3UC0L 1GVYA 4JEGB 4MXWH 1GZPB 3HLAB 3MOQA 1IQDA 2YD2A 3MV7D 5JLZB 2Y24A 4RCAA 1UH3A 5GS1A 2WBGA 3ZJKA 2CLZB 3L5XL 3TEUA 2V3FA 1UG6A 1U91A 3SKNB 5J11B 1F6AB 1JUFB 3QCTH 5HYFA 4G8EB 1QI5A 3QISA 3RPIA 2D31A 3QI9B 3D51A 1OT2A 3GNML 5I71B 1YECL 2RB8A 5KZ6A 3CX5K 3JWDC 3RWIB 1SYTA 3U0TB 1Q0YH 4JY4B 1AGBA 1WFTA 3P0YL 3CSYB 1KTRL 5EBWB 4KJWD 3ELAT 5BXFB 1FNSL 1CE6A 1WCBA 2IQ9L 2CBJA 4UT7L 3AREB 2OWXA 1EERB 1Q94A 1WGOA 3B9AA 5I8EA 4H1LA 3ARXA 5KSAC 1MCDA 4FQIH 1MYRA 3C9NA 1P2CA 2CDFB 2UYLA 3AUVA 1DWAM 2WP3O 1TJGH 3KLSA 2OJEA 4G6FB 5DRWB 3ILPA 3E2HC 1OOAA 3MV01 3MI6A 4X8JB 2QSCH 1G9NC 3QJFA 3DI2B 4CD8A 1VACB 2E8YA 3WBDA 2KQMA 3RFZC 5KVEH 3MRHA 4EXKA 5FHBL 4BELD 3WDPP 3ULVE 1UA6L 5F6HJ 3ESUF 3V6FA 1W8NA 1LO0L 3UPAA 1IGIH 1FIGH 4Y5VA 4BQ6A 1A3RH 3CLEL 1FZKB 5C0BD 1NMAL 2XWJA 2RQ8A 3VFNA 3OKNB 1YMME 4P4KA 4DFHA 1I4FB 4QHUB 2VE6A 4ZAKC 4ZSOA 4HUXA 5HHXH 2UWEE 1CFVL 4F15C 5GJSL 5I15H 1OGBA 2VN4A 3BKCH 2JIXB 3OZ9H 3S97C 3OZOA 4K8RC 3NDYA 3V5KB 1Z9SA 3KYNB 4XNQB 5GRJH 5IIEB 3JTTB 3NFNB 5IW6B 4OV5B 3EYOB 3H9ZA 4JY5L 4YDLB 2OL3B 4ODSH 5CGYC 3IS0X 1QX1A 5KJRL 2P5ED 4JM2A 1E15A 1ED3A 5IFHH 4U1MA 1EQPA 1G0DA 4FFWC 5F1KC 3ZTJH 3OLGA 2H6PA 5I9QC 5JW5A 1UEMA 4UZSA 1WTLA 3AS1A 4ZTPH 3N15A 5E08L 4KKLC 3VG0L 3VTRA 1V7NH 4LGSB 1ZE3C 2XYLA 4ZFOL 3DARA 4TVCA 1C8YA 5ISZE 3DUUA 4TUKH 1WE5A 1IC1A 4YN5A 3GI9H 3GO1H 4OLYH 3AIVA 1FRGH 3UG5A 2Z92B 4LRIA 2B0SH 4ZFZB 1P69B 3G6MA 4MNGA 4IRJB 1A6UL 5DTFA 4XPAL 1FLRH 3IVKB 4XPTL 2XN0A 5ESAA 4CW1A 1U8KB 2R2EA 5DWUL 3MBEA 2F8XC 5KN5B 1ND0A 1ES0B 1C8PA 3DX9B 3OGCB 1YMHB 3LKQA 3VXQA 2I9TB 2D7NA 1FZMA 1CEOA 3WL9A 2IH1B 2OQJA 4YQXL 3Q1SH 2GFTA 4R8WL 3PGDB 4KKBC 3TBYA 3O0RL 4DZ8A 5JOFA 5J1AA 4LDEB 3KYKL 1HOCA 2W0LA 1N8ZB 1WAAE 3KNBA 4WI7A 5SX4I 4JFQA 4OD3H 5M94B 1QFWM 4MSWA 1NKOA 2BY0A 1ZJAA 1DDHB 1TNMA 4N0RA 2X4RA 4FFVD 4N1EA 4BZ1H 5A2BA 1B3ZA 3SCMB 4XVSH 3C5ZC 1XGYL 1S7TA 4PJHB 4KJPD 4XC3H 5CMAB 3W6MA 1BZ9B 1A21A 3O2WH 2NNAB 4V28A 1HJSA 2HH0H 4AD4A 4OJYA 1WWWX 3KS0H 5F21B 2M26A 2PTUA 3GMMB 4PRPA 5C2BH 4EKJA 2D24A 4D9LH 2DMBA 4S3JA 4X6DA 4QYOB 1HDMB 4PG2C 5E8OA 2BVPA 3MLSH 4MZ3A 3HNSL 4OLZL 2VDQH 1SMAA 3UXFA 2V38A 2H32H 2Y6SC 1K8IB 2C4FT 3MMEA 3KEHA 4JVUA 3ECBB 3SQBA 2FGLA 4HFUL 5TH2A 3C2SA 4KV5E 4N0CC 4Y2OA 4HAFA 5GSRA 1QFPA 1QI3A 4RGOL 1UM4L 5I1AA 3BP5A 3FRPA 5MERA 2EYRB 5FD0A 4PRHB 2HFEA 1FVCB 2OXGA 4XNYH 32C2B 3WXVL 3JUYA 2HTKC 3B5GA 3QUXB 3VRJA 3W6LA 5DI8B 3UCQA 4JFDA 3F7VA 5GS1C 4U1KA 4R96A 2A74A 4MD0A 2ADGA 1UR8A 4NQDB 2VR4A 1FP5A 2UY7A 5EO0A 3J8F7 1AQKH 4G8FB 1QA9A 3BAKA 3MANA 3V4VL 4JN1H 1U8JB 3P4NA 1VB9A 1JGIA 3V4PL 5A6MA 3PIQB 2BFGA 2BNQA 5TE6L 2EXYD 3ARWA 4AIZB 5ICZA 1OTSD 1V08A 4QWWC 4RE3A 2WMJA 3ZM8A 5KOMC 4D0BA 4AIEA 1MFDL 1TA3B 2UZYB 3OKYA 2FEDC 5FO7A 4NRXB 2ITCA 3D85A 1U8QB 4UQEA 4PJ9B 3RAJL 1A2YA 4PJIE 1XEDA 3LQZB 1MOEA 5IVNA 3S88H 2RBLA 3VUPA 3L3KA 3ARBC 1I9EA 2VLJA 4NHUA 1NQ6A 4PB9L 4M7ZB 1FL3A 3VW3L 2WWKO 5GQBA 3S35X 1QSVA 2YXMA 1TE1A 4HMEA 3HZYA 2EO7A 3P4LA 5HVHB 3QXAB 4ZUWA 4KVCH 3RDTD 1BAGA 2YD8A 4CKVX 4XAKE 4MB3A 3U9UA 1G6RH 1WISA 4G43A 3VI4F 3OKKA 4A6YA 5CKAA 4QOKB 1NM9A 3KDMB 3H8NA 5ABEA 3QAZC 2BMKB 1DQDH 3AI0A 4JO2H 2EDWA 5CEYB 5DT1H 1XGUB 4X5XB 4JZOA 1JZ4A 4V1DA 4WHTA 1YEFH 3IFLH 2AJYL 3LEVL 5E6IA 1S7VA 4UIMB 2WBJB 2YXFA 1OT1A 1IGJB 1K6QL 1SBSL 3QHTC 4IRSA 3MLZL 4Y5VC 1YY9C 2YN3A 4C58B 4FTVA 3IDYB 4P2QD 3HG3A 3ULSA 1K3IA 1TTGA 1NL0L 4FFYL 2VDRL 4F37K 1P6FA 2UWEF 1U0QA 2A3HA 2PNDA 1UQZA 4P4KC 5SWZD 4HSQA 4AYGA 1MRFH 3F12A 2F7RA 1MCKA 1MAJA 1Q9WB 1JYXA 3KPMB 1IGFL 5F6IB 4F8XA 4I77L 3L3IA 4P7QA 4OAWB 3QEUB 3QQ9D 2HT3C 2J8UB 5IBTH 2PW2B 2DQTH 4HULB 2YD3A 5IEHB 3S8WA 2XTJB 3EMQA 4KU1A 4LSUH 2LABA 3QHOA 2XQYG 1Y0LB 1DEEB 2D7TL 2PYFA 3CFDA 3SGKA 1F3DH 2ZCKH 4JM2C 4NP4L 3TJEL 2VDKH 5CUSH 1VKXA 3TV3H 3FN3A 5AYUL 2EC9T 4MCZB 3MV9A 5CSUA 4DWHA 4XZUB 2BY1A 1HNYA 4ZOEA 1NLDL 3O2VL 1S9KC 3DI3B 4S3KA 2CUMA 1F00I 3LB6C 3JWOL 2EIDA 1PZ3A 3P4OB 1A6AB 5LGHL 4BFIB 2J79A 3V6BR 2ARJA 2MOVA 4XZBA 1MF2H 1E3XA 3RWDB 3SDAA 5GNXA 4D6HA 1OVZA 1DQLL 5HYEA 1R6VA 4K55A 4JE4B 2QQNH 4LRIC 4M9PA 4CRPA 3VXSE 2VXUL 1PPIA 4W81A 3SCTA 2VXTL 3W26A 1EZVY 2GJRA 5KBNC 3QG7H 1EA9C 4PCSA 3MBEC 2DKUA 5IHUH 1UH2A 3JWDL 3PQYB 4YHIB 1KC5L 1Q9OB 3LSOB 3VDAA 5JZ7D 2HVMA 3CLFH 5JMRA 2AJUL 5F1IB 3TA3A 5IMKB 2GSIB 4HKJB 1UVQA 2OJZH 4X9IA 5HGAA 4L4VA 1GGBH 2ICES 1MJ8H 3ARFD 4UINH 4E42B 1Y6NR 2NY1B 2ERJB 4HPHA 2I24N 1MCRA 2BJMH 4FQHB 4Y4HA 1NSNL 1S9YB 2IPTH 1TXKA 5KOVC 2EJ1A 2YMXH 3OJDA 3UPCA 1FO0B 1N0XH 1T0PB 4GI9A 4G9FE 3MRBA 4UB0H 5H35B 3HRZA 3RWFB 1E71M 4I2XA 4NJ9H 1YEIL 3H0TA 1B0WA 5GRYA 4OCWL 5EU4B 3MCG1 4U31A 1X6LA 4FXKA 1FBIL 2DPEA 1Q0XH 1XCTA 4QTHA 4FQXD 4RMQA 4M1CC 1X6NA 1LILA 2HT2C 4XX6A 3HC0B 4S1QH 3WUEA 1IC5L 4L4TD 4I48B 5BZWB 2A6IA 4UFKA 5KSBB 1IGMH 4Z95H 5E2JA 3B6SB 1TCMA 4C56D 3UBXI 4CNIB 4H8VA 5FECA 2WNWA 1WAWA 1UQYA 4OZHF 4HK0A 4JZNB 1LQSR 1QRNE 4KV5F 4LEXH 5ALCH 5B3JF 2JLLA 3PZ9A 1XGTA 1SY6A 1M71A 4MA8L 5J3HC 4UOQA 1T5WA 2AEWA 5C0NC 1KN2H 3NAAL 4HOWA 5TQ0H 4X98A 4Y19B 2GAZA 3U83A 1ZA6A 4YE4H 1B4JH 4JHWL 3VIFA 1PKQE 2HKFL 4K23L 4XNZC 1E4LA 4YFLI 1OAXL 5IR1B 4BH8A 2XWDA 3VILA 4NO3B 4J3XA 3EYPA 3PABB 1QLEL 4YEEA 3GM8A 2WC3A 4XB3A 3BC9A 2X4PA 3T8XB 1CIUA 1T2QL 2VSDA 4N9OB 3TF7C 4X8XA 1T20A 4LIQL 1H0GA 5T1KB 4GO9A 3CZNA 1Z3GH 4HXAL 2PR4H 4PB0H 2B1HH 1KTLB 4UU9B 3P77A 5IP4A 1WWBX 3IDJA 4C7GA 1R3JA 3BVVA 2WCGA 4P3DA 1ACYL 1KBKA 4PRAB 3WQ5A 2K1MA 3A4AA 4EOWH 2F15A 1J8KA 1B90A 4BUGA 1OD9A 2BHUA 3BWUC 4QRSB 1H11A 1KLUB 1BEYL 3OAYK 1F42A 5C0JA 5EIQA 1QP1A 2ORBL 1URLA 4TVPH 4P46A 4P5TD 1U8OA 3ARDB 1UKSA 3X12A 4X0NA 1RK0B 3BQUB 2DICA 1KG0A 3BXNA 4NFCA 4NKOA 4QEGA 1DN2A 2PWDA 1B0RB 4UCFA 4ODTH 1SYVB 3W0WA 1L9NA 3C8KA 4XP9H 4IIQA 1WO2A 1D5IL 4PJXA 1CDGA 1WBXB 5E2WL 2FX9L 5CIPB 2ZOXA 3VWKA 5E6IC 4CVZB 2IBZX 2EDXA 1YEGH 1RUAH 2BVOB 4R97C 4Z2HA 1ZHBB 1M05A 4GXUM 5D70H 1OAKH 4PGCB 2P44B 3FFCE 2I5YH 3OPZL 1PYWA 3WJJA 3QEGH 5I6SA 5HVFB 2NY5L 4RSVA 2XSBA 3AIBA 1Q9KB 1JI1A 3VXMA 4RAUB 3W9EB 3NJ3A 2F61A 1N3NB 1LO3L 5TPWL 3MKKA 1G7HA 2VYRE 4WSJA 4HCRL 2GJ6D 5HI4D 3NVQA 5HYJD 5BRPA 3SGKC 4KROC 2D3LA 4RGNE 5HYQB 4KTEL 1B0GB 4GRLA 4RFOL 3U57A 2IANE 3DUSB 2YL5A 3I84A 4X6CF 4NDMA 2H1PL 2KBGA 3LEYH 3I6KB 5HHME 3I9GL 4ZMAT 2JJSC 4P3CH 4QHKJ 3EAKA 1AP2B 5HGGS 4NO2B 3T4YB 3S35H 4DWSD 4F33A 3G5YB 1HILB 2QQQA 2VLRB 4Z8FL 3L3OA 3V0VB 1E28B 3V5HA 3SDAC 4G6ML 4P23B 3FHAA 5GGQH 2DD8L 2O9PA 4M93B 2PYEE 2CQVA 4PJBA 2FJFA 3OKMB 5H94B 1DUYB 2CBVA 1OAZL 5IB2B 4WWKB 3VMPA 1A6VL 1K9FA 1OGAD 3K1DA 3QFJE 1GAFH 1H8SA 5I1IH 4DN4L 3RY4A 1UWQA 2NZIA 3L4TA 1UD5A 3O6KH 4G8GD 2J8GA 1S9XA 2D0FA 3MRFA 3GTNA 3MGOB 3RBSA 2J5LB 1JWSA 2NX5D 1MFBL 3ULUD 3TA3C 2NY7L 1MVYA 4M7LH 1R8LA 3DXAD 3OKEA 3S5LA 2R4SH 1CLZH 5HGHB 4Z7NE 2GY5A 4FNRA 4P48A 2P5WD 4QRPD 3KJ4B 2W67A 1UFUA 1VADB 3SJVA 1EHLH 1WBYB 4U1SA 3K4DA 1KSRA 3MLWL 1XF2A 3DJ9A 1I7TA 2VQ1B 4YDIL 2HT4D 2E9BA 1EDGA 1JPFA 3MZTA 4OTXH 1YY8A 4HH8A 3BH4A 1U41A 1NCAL 2O5ZH 5CD3B 1YJDC 4PJ7F 1RUML 1S78D 4X4XB 5GRWA 1GVIA 4TULH 2ZPKL 3GMNA 4P4RB 3UP1A 2XN9A 5FB8B 2RCSL 1DLHA 1KFWA 4LHUG 1C5CH 2F74B 3OHXB 1BECA 4LASH 3BLBA 2PF0A 4LAJH 2DQJL 1KELL 4WU7B 3H53A 8A3HA 3GBDA 2AV1B 1BIHA 1JGLL 1DUZB 2V9TA 1NAMA 1UZ8A 1QR1B 5F9JA 1CDBA 4GQ9L 2D20A 3VM5A 3MRDB 1A6WH 1WAAA 1ZA3B 2FHBA 3D3VB 5C09D 4TVPD 3MGTB 5DURB 3SQOH 2GT9B 1W3HA 4WV1B 3BP6B 3KXFE 2E9WA 3H9YA 4LSVL 2VSCA 1H5BA 5JXAL 2CBUA 1LE5A 5FCZA 1AY1H 3NCJH 1Z32X 4PJ8A 1TZGH 3SO3B 1FNLA 4OF3A 3QO0A 3MO1A 2O9OA 2YFOA 4ZFFB 3KPOA 3SDCC 5I16A 3FONB 5EOQL 3WENA 1OAQH 4M29A 4FN0A 4XUYA 4WW2F 4D6FA 1D6VL 5BV7B 3ARYA 4E41E 4JREC 3CX2A 4QXTB 3S98A 4WFHD 2F58L 3BPLC 5HI3D 1DQML 4POZD 1F4YL 3BSZH 1U8HA 3TN0D 4L8SA 3LY6A 5FGCE 2AI0L 1JP5A 3R06A 2Y36L 2QR0B 2YPVH 5K9OB 3B2VH 1O7AA 2BSTB 1ORQB 3ROLA 2B20A 2CLRA 3B9KB 4OB5L 4WUUB 4Y5XA 8FABB 2R0LL 2ENYA 2BRRH 5H37G 1DJSA 2Z8VC 3HR5A 1CZ1A 1ZLWK 1D3CA 3D0VA 2DL9A 1MHPL 3W39A 3A6BH 5JXED 4K7PL 4CVWA 4P46C 4B7IA 3WNMA 2YSSA 4LVNC 4ONFH 3BZEA 2E7HA 4P2QE 4UQAA 3TCLB 1XF5B 1E6OL 1CDJA 2FZ3A 3SUVA 4ZTOL 3EOTH 5ALBL 1CD1B 1K3ZA 1W3JA 4NYLA 2A0LC 1Q6CA 2C7UB 1UKTA 3GB7A 1GPOL 4IIQC 4X4YA 3WLWC 5ECUA 4NM4H 4TTUA 2APVA 4LCWB 3L3HA 1HX0A 1VFFA 1EAPA 4R4ND 3KLAB 2Z31B 5KVDL 3VWKC 2BV9A 1DBML 1IJ9A 3LVEA 4WJ5A 4JQVA 2FATL 4L3EB 1RQ5A 4FMKA 2BX5A 1OY3B 1SM3H 2BCKA 2DIBA 3FO1A 4CL7A 4MWFB 4POYA 3UTSB 1CGSL 1OM3H 4H41A 3WFHB 1X4ZA 3LKOB 1RK1A 1U3ZA 4MHHI 4ONGL 4XX1E 3U46A 3WJJC 5C0IA 4LNVA 3U6RA 3L1OH 4XBPB 2DSKA 2MSPA 3ARGB 3RWEB 3B3IA 4NPYA 4YLQT 3EO9L 2AEIT 4PJIA 1AQHA 1MPAH 2ZKHH 1HEZA 4U1IB 2A3BA 3IGUA 1KJ2H 4R26L 2BNJA 4LSTH 4HZ6A 3LN9A 2YEZB 3I6LD 2ZOLB 2GHWB 5KANG 3WFZA 1IEHA 1DN0A 1IAII 4U0RC 3KPQA 3NTCL 3AB0C 4YO0A 1V6YA 3QDJD 4TUOB 3VU2A 4ZXBB 3BAEH 4NN6B 5IF0A 1N2RA 2XHYA 2CKSA 3DETD 2EEXA 1JNNL 2DWDB 5EN2B 4TOYL 4F7PB 4WLCA 2NQCA 1E40A 1MWAH 2HVKB 4ALAL 3GMOB 3ULVC 3GI8H 4N9GB 4IJ3C 3LS5L 2QMKA 4HX1B 3MNZB 2QEJA 1BD2B 3CDCA 2DBLL 3DVNA 1JYWA 1HWHB 5BZDB 4HDIB 3LV3A 3WDJA 3BUBA 2W62A 2GK2A 5IHSA 3RPMA 3UPRA 4CMHB 2GSGA 4JCMA 3TONA 4LRNL 5F1SA 4GXPA 4XGZA 3C08H 3SCUA 4MNQA 4UNTA 1I3GL 3S9DB 3FMGL 4KK6C 1T89C 4LLMB 2FDMA 3HMXA 4PJFF 4UZGA 1RUKL 3GH4A 1ZBCA 4OFKA 1Z6JT 4JR9L 2HMID 1AGEB 1KFAL 1P4BH 1VGEH 2FSEA 3ZTNL 1OPGL 5B39A 5IVZB 5DA0B 1GOIA 1RIUL 1VFBB 1RZJH 2BVYA 1PZ2A 4I3GA 2ESVB 3O9WB 4XX1G 4XCFH 4GAJH 4AISA 4OLWL 3KE0A 5CCKL 4OOUA 5BS0B 5K9QI 3QO1A 1T03H 4P59L 4PGJA 5EUOB 3T1WA 4GRWB 4RL3A 3UTTE 2EE2A 5F7WC 1ZGLP 1JF1B 3O6LH 1U8LB 4R7NA 3SO5A 3P30H 4HJGA 2EE9A 3L5HA 1XR8B 2YPLB 1HIZA 4HF5L 4ZOBA 2YKLL 4TPRH 2YJQA 2H45A 4JRYD 3SDDD 3N13A 3MU7A 2X4TA 3ZSTA 3C60A 3S3SA 3E6FA 2PW1B 2XG4A 5A3HA 1Q6FA 2XNAA 3N11A 4BCEA 1T04A 1QNRA 1VCAA 2JF6A 4K3EH 3VXSA 3WXWH 3REWA 5K9KA 3RHWF 1PG7L 4ZFOB 4KRMB 3O41A 1A5FL 4XHJD 3RNQA 7CGTA 2AMGA 4LLYB 3BD5A 4J28A 4WO4A 2JB5L 4AXNA 5IMLB 3KG5A 2EXOA 3MJ9L 5CP3A 3FFDB 2G75B 2CO6B 3SGDI 4DCQA 1JGDB 4HT1L 4X7SL 5L2KE 2WIIB 4PP2A 2CDGB 3KPSE 3UTPE 4QNPE 4AW7A 1CBVL 3Q5TA 3WMCA 3FZUC 5C2UB 5SV4A 4ELKB 1A7BA 2UZXB 4NKIL 1QSEB 3D69A 3MBXH 1Y7VA 1DBBL 2IFGA 3BD3A 4N5UA 5TE4H 1L0QA 5CJOL 5T1LD 1H5BC 3WO3B 4KHXL 4PJ8C 4G9FA 1IM9D 3DGGA 4OM1H 2JE8A 2W9EL 5FYJE 5DHYA 4W93A 3WN5A 3S3JA 3BUQA 1EGZA 3QDMD 2X7LA 4NQEB 3CFJA 1FIEA 3RI5K 2RFXB 3G5XA 4EI6B 2NY4C 3MUJA 4ACZA 3B43A 1CGVA 5A2IH 3OJ2C 5A2FA 4M82A 4Y2DA 3BKYH 2VDLL 2DQUH 1T83A 3QUZA 1JHTB 3RRQA 1EGJL 2WHLA 2CK2A 2F53D 1UZ4A 3KR3L 1LO4H 1E1FA 3FRUB 4JPWL 4ELMB 1J1XH 4LVOC 3HPJA 3MV7A 3JUZA 2GYSA 1OGTB 1S8DA 4NSBA 1S7XA 4Y5XC 1A7OH 3TLRA 1KACB 2J7FA 5F72S 1NBZB 4HJ0C 4CUCA 2D7QA 4EQ2A 1RJZA 5D4QA 5E2TH 1T3FB 2DKSA 1JPSL 2EQDA 2G41A 3IKKA 1DBJL 4D6DA 5DJYB 3H9SD 1QBLH 3D48R 5ACZB 1BJ1J 4N8CH 5I30H 25C8L 1R0AH 4JG1H 4PJDB 5ERWB 4FHBD 3MLRH 4MGXA 1XGRA 2OI9B 1MIEH 3IETB 5DZOA 3TH4T 2G5BB 3F7YA 1QPPA 4YDJB 4LU5H 5MHSD 3V5DA 5FGSA 1D5BB 3GKWH 4KRUA 2AP2A 1QO3B 2FB4L 2XN2A 4PMRA 2R2HA 1J5OH 2WWDA 3F5KA 1EFQA 3HG1B 1CNVA 2BVQB 1TQUA 2I60H 5HTSA 5L88L 1NCDH 2NXZB 5T5NG 4JQVC 5J57B 4R4BA 2VR5A 5FO9A 2FH6A 1NLBH 4JFED 1SEBB 4AK1A 2OZ4A 3CFBA 1KEMH 1HIMH 1HT6A 1JN6A 3D3AA 3T2QA 3BGAA 2H8PA 1OP5K 1EO8L 3BE1L 4ZENA 5A40E 2IGFL 3MYJA 4RNRA 3CZJA 3PXHA 3IDNB 4WDIA 1R5VA 4CVXA 2E7LA 1LHZA 1A3LH 3W37A 2J7GA 3GGWA 1JWUB 1J0YA 1C1EL 3O8XC 3OSKA 4GSDL 5IB3A 2CYGA 5E9DB 4TSCL 3TO2B 1C8XA 4W86A 1CLOH 5I8CB 4TOQA 5F97E 4MA7L 3MCLL 2FJHA 1VBUA 1NUNB 5C0BA 5BQ7A 2WVVA 2A6KB 1Q6DA 4R0LB 5SX4H 3NZ8A 1Z0MA 1SY6L 3WBAA 4ODWA 2L7JA 3N1GC 2WINB 1DVFA 4TNVF 1B3XA 4JIEA 4HIIB 1OTUD 5AYQA 3WDQA 3RWCB 1AO7D 4JJ5B 1M7XA 4NKMA 4MAUL 3BPOC 1MCPH 4Z0XA 4BUHA 1KNOA 1KPVA 4Y8AA 4F8QA 5JOPE 2QPSA 3JTSB 3ARUA 5D8WA 3FFCA 5FDYA 3MXWH 1D7FA 3S4SA 4JRXD 2E7MA 1RZKL 3V6ZB 1NCTA 4W8BA 5A69A 1QYGL 2DMKA 5C92A 1CLYL 5D7IB 4YFLF 2DM7A 5F3HB 3RWHB 4XH2B 1FVDB 3TVMB 5CS7A 1JGUH 4NCC1 4I0PD 1QFWL 2Q1EA 2EPNA 3LRKA 4RE4A 3O6FD 2WMGA 3BEWB 1FAKT 5GGVL 3DYMA 1FFOA 5ABFB 2ZUXA 3A23A 2EDRA 2VXVL 2EZ0C 3QNXA 3AZRA 4S1DC 5JA9A 4QHMB 4HW6A 1Z9LA 1F2XK 4X0KA 4WVRA 4PJHE 5D8JL 5JNYA 1G7IA 4IM8A 3ISWA 3M7SA 3N1PC 1KB5H 5HHVH 2CO7B 3S96B 3U82B 4C54A 4YXKL 1ZANL 1FL6B 5TF1H 3WNNA 2A6DA 5JPNA 5I8OL 4KI5E 4QKXB 5FUOH 3C60C 3X3FL 1MHCB 1YPZA 4TSBH 1NOFA 3AIEA 2AJSH 1I1AD 1VGKB 4E8CA 4LAQL 4NZUL 1YNKL 1XF3A 4OD2A 5CZVL 2PYEA 4MNJA 2BXZA 4H26B 3IF1B 4BQ4A 3QG6B 3MPCA 4Z7WB 4XPFL 5C09E 3U2SB 5TE7H 3L7FB 1O7SA 3MROA 1IMHC 1MQQA 2PWEA 2ED7A 1MQKH 5CINL 4F7TA 3QFJA 1CXEA 1KIRB 5CP7B 4HZAA 4LPTA 4WO4C 1NGQL 4QNPF 2Q76B 5C07D 2AK4B 3V4UH 4AZCB 1HXMB 2H9GB 4IISA 1ZBVA 4PRHE 3OKOA 1NKRA 4KRPC 4D6CA 3IU3A 2FO1A 1IT9L 2VXSL 3P9LA 4WW1B 1H3XA 3ZYJA 1GGIH 2W1NA 4JFZH 1VBRA 4X80L 2AEPH 3OXRB 3SOBL 1C93A 2VZ3A 1MQPA 2R8SL 5T5NF 3T0WA 4GW4B 3VIMA 1A9EB 3F7RA 2NY2B 4O51B 5GS3A 2VIRA 1VPOL 4NQDE 5KSAB 3MV8B 3O81A 1WJ3A 2XG5A 3KLKA 1G9MC 5J6HB 3WN5C 4JGUA 2WAGA 1RZ7H 4PRDB 1S3KH 1MJUL 2VDOL 3E2HB 1HXYB 1XYZA 2LVCA 3WHXB 3UETA 4OQ1A 2AABH 1NGZB 2VZUA 3FT4A 4YHPB 3L5IA 3NIGE 5EO9A 5HGDB 4BH7A 3SE9L 3P73B 3P9MB 1QKZL 2GIYA 4U6YB 4XPBH 2YRPA 1I75A 1ZU8A 3QUZC 4OQTH 4FQ2H 4LVEA 4E5XB 4MJID 5DUBB 3V95A 4UFMA 4PV8B 5HHQA 4HHAA 5EIVA 5LYRA 1A1NA 3W38A 1KCRH 2HJFA 2PXYD 1V3HA 2JJVA 3TZVD 5C6PB 1LEIB 2VZSA 1I8KB 1U58B 1W91A 1CI5A 2VX5A 1XV8A 3QHZH 4OSUH 5C08B 4AY0A 1WVZA 3NSXA 3GK8H 1PQZA 3U7WL 3CFKA 2CIIA 4OKVB 4QOKE 3KXFA 4HA1A 3IXAB 5GS0H 3EDEA 2VI0A 3BT2L 4X6FA 3HI6L 5DD3H 4F15B 5D7JC 2X70B 1CU4H 3DURA 1EVUA 5KTEH 2HLFD 4X7EC 1BM3L 5MENB 3D2UB 3QXUA 4PTUA 3IJ7A 1INEL 1BMGA 3QIBA 4LKCA 4E41A 3QFDB 3QEHB 1AJ7L 4PGBB 4TNWF 1H2JA 4EVNB 3PTMA 4WW2C 3M45A 1WZ1H 3D0LA 3DSFL 5BVJB 4CCDA 4G5ZH 1XGZA 2DDQL 4NCDA 4OZFA 5DJDB 3CXHJ 1QSFB 3V9FA 5T3XL 3RJDA 2VDNL 1SEQH 5I9QB 3NDZA 4FLQA 1FV1A 2J8UE 1I1XA 2V3GA 2CUIA 2YBUA 4DGVH 2F8QA 2XTJE 3VXUB 4IRZH 3LMJH 5C0DB 3QUKA 3ECQA 3F62A 2E7LC 3TT1H 1W0WA 2VQUA 1ZTXH 4YDVB 1MAMH 3INUL 4ACPA 3BH9A 3U30C 4W6XB 4KKNA 4O2FA 3DX3A 1H09A 5EZOH 1MHHA 4HLZH 4KQ3L 4P2QA 2C1OA 5DZLA 2X0YA 1S5IL 1TMQA 4HGWB 2G3NA 4JFHE 3MA7A 1SJHB 1QPKA 3I75B 4LLUA 3U0WH 2X5PA 1MJJB 3PP4L 5FCUL 1RZIA 1XC6A 5ICXB 4OLUL 4F57H 5T5FH 1HL9A 2XWTB 1DVFC 4B0MM 3NCCB 3DBXA 1QFWI 4HC1A 2NZ9D 3RIFF 3G5VA 4PY8I 1GOFA 3HB3D 5A8QA 1HJUA 4R27A 2W07A 4OIIL 2WPGA 1OP3K 2H3NA 2WHJA 5DUPH 4O2CA 1W3KA 2QLVB 5FM4A 5D6DA 3RGVA 1I85A 3GDBA 4ODXB 1DL7L 3GFUA 5A2LH 2IBBA 3O2DA 3F4VA 4C4KO 2C1PA 1JG9A 2A9ML 3PQYE 1J1PL 5DK0A 3O3AB 4ETQB 1XYFA 4KJYA 5DMKB 2WBWB 3AFLA 1Z0NA 2DQEL 4ZOAA 2QHRH 2VITA 1RD6A 2AJ3B 4ZS6D 4JRYE 3FO2B 2XOTA 1QFOA 3FO9A 4G8IB 4NCC2 3GMQB 2J7LA 3DYOA 2FHCA 3MJGX 3IJSA 4GLRI 3J7HA 3R8BB 3NSMA 4JANA 3FQUB 4K7PY 3VNZA 3PV6A 3RVVD 3WYRA 1MNUH 2ZUTA 5I0ZA 1Q1JL 4PJHF 4Z7OE 4LVHC 2IG2H 5IB1B 1GZQB 4I4WA 5BO1L 3D39D 4OV6F 4Z9KB 1WZAA 4J4PD 1GC1H 1EMTH 3WEZA 2PTTA 3BDXA 3CDGA 2OLDA 4R2GD 4UBDC 3G08B 3FKUS 1I3RA 5L9DH 4JO1L 4W8AA 2P24A 4NNYB 1YEDA 4X4ME 4PGEA 4WKHA 3STZA 4HUWA 1ZWIB 5IESL 1B88A 4U6VH 2YA2A 2J7HA 3DX8A 5JR1L 3SKJL 5DJ6B 3JV4A 3QEQB 5CJBA 1N5YL 4PGDB 1UG9A 2B8OT 5DHXB 1MFEH 2DQCL 2BSSA 1IQDB 2LAAA 1JBJA 3WNPA 1G7QA 2NY0D 3UJJL 3CMOH 5DJ8A 4UUJA 4Y19E 5EFIB 2D31B 2FIKA 5IROA 3VWJA 1ONQB 5FO8A 3UJIH 1HZHL 4U49A 2IC2A 3WO4C 3UTTA 1AGBB 3EFDH 4L4TA 4M62H 2YLLA 3U4AA 1F4WL 4X9FA 5JIIA 2J6EH 3RMEA 2OTUB 1CE6B 3TNMA 5KZCB 5GS0D 3EZJB 2Y2WA 1Q94B 1G7JB 4C56A 2QPUA 1T0NA 1OB1B 3C9NB 5HYSA 1P2CB 5HDRA 2UYLB 3APGA 1E27A 5LQBL 1W72L 2XZQH 4ZUSA 3C2AH 3QDAA 3Q3GA 3KJ6H 1OWWA 3NIGF 3KZSA 1ULVA 3N50A 4Y16A 3PHAA 1WP6A 2UY5A 1UYWL 4UNVA 4HP5A 5FM5O 5HHOD 1XSJA 4S1RH 6CGTA 2R4RH 1NEZB 4MD4A 2VVSA 5FYJH 5DS8B 1PVHA 3SDXB 3OB0H 2FH8A 3MRHB 3QAZB 4CVUA 3QUYB 4Q6YA 3EYFA 5DJ0B 5MHSE 2ZUNA 1CF8L 3PGCB 1XSIA 1H49A 3KPSA 4HS6A 4WTWA 4NUJA 2XIDA 5DR5L 4KKAD 4G6JH 1GZPA 5DMIH 4AZ7A 5D2NB 3D18B 2XWJB 4JFFD 3VNYA 3VFNB 4TVSa 3MLVL 3L4UA 3IDXH 2DQIH 1NBYB 4P4KB 5F1OB 2CLZA 1M7DA 4QO1A 2HFGH 4ZSOB 2R0KL 3SKNA 5I74B 1F6AA 1JUFA 2EXYC 4HH9B 4XC1L 1OSPH 5EFDA 1X4YA 3WH5A 4NN5C 2FX8H 3ZR5A 5IDIA 2G60H 3U4EA 1MCBA 2A9NL 4WFFE 1J05B 3QIBC 4W68A 3FHQA 3QHFH 4DOHB 5HHNA 4JY4A 3RIAF 4GAGL 3IANA 4CDHA 3U7YH 3I50L 4JM2B 4KZDH 2YD5A 3AREA 2VO5A 1OQXA 4U1MB 5I1GH 3LN5A 1YN7A 2J8UF 5MP6H 5C8JB 3WF2A 5F7EH 2Y72A 2H6PB 5JW5B 4E0RA 4MS8D 4JQIH 1JFHA 2CDFA 2DL2A 3I2CL 5EWIL 3SKUD 3SCVA 4AEIH 2JEPA 1ZLUH 1F3RB 1T7WA 3DUUB 4U1HA 2E0PA 2ZUQB 5EU7E 1BZQK 1CL7I 4Z7QF 3ABZA 3G9VA 2J7BA 1BPVA 1CTNA 4U2ZA 1H3VA 3L5JA 4FP8H 4MNGB 5A6JA 4L5FL 2PTVA 1HKLH 2VL4A 5ESAB 4CW1B 3EYUH 2R2EB 3MBEB 3MRQB 4NZRL 1ND0B 4XBEH 5FYLD 1DWGM 3GIZH 3GSNH 3K1KC 3LQAC 4OM0H 4K2UL 3LKQB 3VXQB 1FZKA 4I3RL 1FZMB 4R7DA 2OQJB 4OJFL 1BHGA 4M3JA 1V3JA 3BISA 4WEMB 2GJ6A 1RU9L 3L3GB 4DZ8B 3WIIH 1I4FA 5JOFB 5J1AB 2IXUA 4LGRB 3IS1X 1HOCB 4UR9A 2AOSA 2BFVH 3KNBB 4FF5A 3SDYL 3RGVC 12E8L 5IMOB 4JFQB 4M7LT 2CR3A 4N0YL 2JIXA 3H3PL 2EDOA 4OCSL 4MSWB 3PWNB 5SWQA 2CLVA 5D7LD 4WTZA 5HD8D 1I1YA 3HNTL 4KY1L 4GKLA 1X3DA 3B4NA 4H8WL 4YHEA 5IIEA 1CWYA 3NFNA 5IW6A 3RA7L 3EYOA 3WNKA 4EQ3A 4OV5A 3MSGA 1S7TB 2JK5A 4AIXA 4DVRH 1KBGH 1NBQA 3DX4A 2CXGA 4DWSA 2X8RA 3QR3A 1KQYA 2PWGA 3RZCB 4JDTH 4D71A 2GK1A 5T3ZL 1OWRM 3GRWH 3CUJA 1INDL 3VXPA 5F7NC 1DANT 1X5JA 2A2QT 4RRPG 3L3JB 4X6DB 3VOCA 4D6EA 1V5JA 3TFKD 4XMLL 5E8OB 2BVPB 3CX5J 3JXAA 4LGXA 1WT5A 2ZNWA 4UOW0 1OGAA 2GITB 3QUMH 1A7PL 4MDJA 1KCUH 4M6OH 2MANA 3UTOA 3PTKA 3N1QC 4ZFZA 5KSBF 5C07E 5GSRB 1WZKA 2NX5A 2AAVA 4AL8L 3HPLA 4IRJA 1OARL 5I1AB 4N42A 5CPSA 3BP5B 2LV4A 3DXAA 2YD7A 5MERB 1C08B 1NMCB 3N0PB 3U1SH 2HFEB 2OSWA 1E3ZA 1BX2B 2P5WA 1EPFA 4QRPA 2NW3A 1E4XL 3WKML 2HKHL 3TT3H 2XWEA 2HRPH 4JFDB 3TGXA 4RQQA 4C57C 2NY6D 3F7VB 3QI9D 4U1KB 1UWRA 3VKKA 5J1TC 4R96B 1FGVL 2A74B 4MD0B 1E43A 1S7QA 1UWXK 2ADGB 1FHDA 2UY4A 1FNGA 3D3VE 4OGXH 1QUNA 1B1YA 3H6JA 1QA9B 5IROC 3VWJC 2FJGB 4O9HL 1TNNA 5JW3H 4OZOA 2J4WH 2R1YA 1NC4D 1A7RL 1BBDL 2VISB 3P4NB 3T2OA 3SCMA 3T3PE 4GS7C 3GZAA 5ICZB 1AXIB 1N6UA 2ZXAA 3WF1A 1XSKA 1R3IH 2YN5A 4WFEE 3T1FA 4D0BB 2NNAA 1QHOA 2GY7B 5FO7B 1SYSB 5CD5C 3D85B 2BERA 2ITCB 3U9PH 2Q3ZA 2AJVL 2DB8A 2PUQT 2OW6A 4WUKH 3DSNA 3L3KB 4NHUB 3UYRL 4Z5RB 2EEAA 1V0NA 1HDMA 1FYTD 2AVGA 3EUUA 2VC2H 4M6NL 4Y16C 2QQKH 3BKJH 1Y6KR 1N4XL 4YUEL 3REVA 5CEZE 4MQXC 5C09A 4ZUWB 4F7MA 4DGYH 3IU4L 4IOFC 4WUUE 2CKBL 1K8IA 4XWGH 3WD5H 1QWUA 1YYLL 4G43B 3OKKB 3ECBA 1WDQA 1U9KA 5L6YH 1OIFA 1EZVX 1KCSH 1AXTH 1XD0A 2NXYC 4JZOB 5D7KD 2EXWD 4V1DB 4WHTB 3LN4A 1DP0A 1S7VB 2A3EA 2W38A 4YBLC 2EPOA 5JQ6L 4IRSB 3WY3A 1TG7A 4FTVB 3QUXA 1KWGA 3ULSB 1NCBL 4R97B 5J56B 4YXHL 1N7ML 5DI8A 3EO1A 3TN0A 4NZTL 2Y07H 4HUKB 4OFPA 3V8OA 1J12A 1IAIH 5IW1A 3GNOA 4FNLH 3F12B 2BOBB 4DKAA 4CMMA 5MEQA 1J1OH 1MRDH 4NQDA 4LCWE 4NSKB 1KCKA 3L3IB 1XZ0B 4MXQD 3CIQA 4G8FA 2ICWI 3AQUA 1GGUA 5EC2B 2RGMA 5I71C 1U8JA 4PJGA 4JDZA 1R24A 3TBWB 4BQCA 4HXBH 4G3YH 4Y7MA 4Z78A 2RGSA 1B2WL 3UTSE 5F9WB 4JVWA 2PYFB 5AZ2L 3CFDB 3U36B 4KROB 3VE0A 3QDGD 4QRRB 1W1VA 3AREC 1VKXB 5FKAB 2NLJB 3NCYS 4N90D 3MV9B 4UIKH 5BOZG 4NRXA 1OW0A 1W2PA 4RMSA 4UV7L 1TFHA 3SKMA 3AMKA 2B2XH 3SY0A 2YDQA 4CN1A 5D93C 4PMDA 2N4IA 1BAFH 2Q6WB 2B39A 3VFGH 3AZTA 5CILL 3BUYA 4G7YL 3QXAA 3VSUA 5A94A 4HJJH 3NCBB 5B8CA 5DEZA 5K59F 1RPKA 4MXWL 4RDQG 4QOKA 3LS4H 4L9DA 5E2VH 3KDMA 4CCEA 4A2LA 1NCCH 2BMKA 3KPLA 1OCQA 2CITA 5CEYA 3NYDA 1BFNA 3CC5B 4WEUD 2LU3A 1BD2E 1S5HA 4UIMA 2WBJA 3MUGA 4HWBH 1FFQA 5EZIL 1IGJA 4BQBA 1RMFH 3QCTL 3PWPD 1C3FA 1IAOA 1VENA 3ESVF 4YBHA 2UUDK 3TA3B 1ZL1A 1FE8H 4PJAA 2VDPH 2DMCA 3PWUA 1HNFA 1NOWA 1Q0YL 5HGAB 2I27N 5JW4M 2XRAH 4M6AA 4MD5A 1AGDB 2PO6B 4Y4HB 3QDJA 3UYPA 3L4VA 3WDRA 3OJDB 4YWGH 3HZMA 4DK6A 1QFUH 1JGEB 1NGPH 4FQIL 1GIGH 2ESVE 3MRBB 5HDQH 3HRZB 4I2XB 3WD4A 1DEEA 3H0TB 5BS0E 5HJ3A 4PMZA 3NFPA 3ZYIA 1MQRA 4FXKB 3CSBA 3MRPB 5EUOE 5HNNA 4DWSC 5EOCJ 2QSCL 2IALA 4GRWE 1EIBA 1S46A 2AJZA 1W9PA 3G6JA 2G5RA 4XT1C 2YPLE 3LD8C 5KVEL 4HS8H 4EDXB 2D23A 1CYGA 3WUGA 5DJXA 3MS8A 4HZLA 1WT5C 4ZQKA 3MMDA 5D2LE 2QQLH 4N8PA 4D3CL 1HTYA 3IJ8A 1XGTB 1DLFH 1FIGL 1IGIL 4H8HA 4AMXA 5CSGA 4KGLA 1NFIB 1LJYA 3L2LA 3QNZB 4NUGH 3ULUC 4HMCA 2HVJA 4IRJC 5J12B 1OAYH 4DM2A 5IB4A 4TUFA 2GAZB 3WUWB 4UQ3A 1XH3B 1H8NA 5HHXL 1SFSA 3EO0A 5I15L 3K7UA 2CEQA 3BKCL 4YHIA 1Q9OA 3MOBH 1DTUA 4BH8B 4AZIA 3KYOA 5GRJL 4W6WB 15C8H 3A24A 1JNDA 1WF5A 4JRYA 4ODSL 4YGAB 3SDDA 4BKLA 2XY2A 4E42A 3MC0A 1VJSA 3K2MC 5I18H 3P11L 1TZIA 1E70M 2X40A 5K9JH 3T3PF 4FQHA 5IFHL 3FQXA 1S9YA 4GW1A 1T20B 2YZ1A 1BG4A 2J88H 1FGNH 3SCMC 1O7DC 1ORSB 5H35A 1R3JB 1ETZB 1F97A 5M7QA 4ZTPL 4P3DB 3K4ZA 1HNGA 3BZFA 4KDVA 1V7NL 3SCQA 1KTBA 2F18A 3TBTA 3LOWA 4BYHA 4NQEE 4TUKL 3AXXA 1GOHA 4NWUH 4S10A 3VH8A 4X4MA 5C0JB 3GI9L 4KI5C 3HC0A 2JELH 3RU8H 1FRGL 2B0SL 4ATDA 4P46B 1U8OB 1LWRA 3B6SA 1O5DT 4UT6H 1KG0B 3BXNB 4ELME 3C5SA 4P9HC 4JFFE 4NKOB 4LCUA 4JZJB 2E8ZA 2JJTC 3QCVH 3W0WB 3QHMA 3C8KB 4IIQB 2DQFB 4RDQF 3CHFA 4PJXB 1U3HD 2F8VA 4XMKH 1F90H 3Q1SL 3O2DL 2ATKB 4Y19A 3VWKB 1V6WA 1AQ0A 4HK3J 4RBPK 4OD3L 2A6JB 4FABH 3QUXC 5JUEH 4QHNA 2Y4SA 3R8QA 1IFHH 1M05B 5B22A 3TN0C 4BZ1L 4XVSL 5D5MB 1A0QH 1KULA 4I9WE 4RE2A 2F53A 4IMLA 1U8IA 2F19H 4XC3L 5DJZA 3HG1E 3VXMB 3O11A 5LGKA 3O2WL 5ETUA 1NWUA 4O02H 2HH0L 1G7HB 4K71C 2MKLC 1NDGB 1XH2A 4JKKA 4RA3A 5A8PA 4P2CG 2JEQA 5C2BL 2QV2A 2E7BA 1LO5B 1UADC 5FHAH 5B4MD 1JPGB 2EO9A 1KJ2A 3H9SA 4U0RB 2X10A 5D1XD 3AB0B 1IAKA 4LXFA 4M8UA 4GRLB 5TGBB 3RVTC 3JSSA 3MLSL 4WHCA 2VDQL 5CIPH 4NDMB 4QRSA 5FA4A 2LVEA 1KLUA 4QCFA 3BH8B 3O6MH 2DI9A 2Z1KA 5I1EH 4MVBC 4WY7H 4IJ3B 5E9DE 1JF6A 1X5KA 4UDUA 4UQ2A 5FF6B 1UQSA 4XVTH 3VX0A 4F33B 1ZLUK 1B6UA 1HHHB 3LX9A 4U3HA 4MNHB 4X9GA 4ZO8A 3HFML 1RK0A 4PP1C 5SX5H 4H20L 3L3OB 4ODBD 1JVKA 3V5HB 3EIFA 4UTAL 2CHNA 2I9LA 2APXA 2MCPH 5J8OA 2X1IA 1HHJA 3LDBC 3QIWB 4XNYL 1B0RA 5B8CC 1SYVA 4PJBB 3NIDE 2FJFB 4JFEA 4JFYB 3OV6A 4QAWA 5JQHC 4LLAA 1U2CA 4JL1A 4ZD3H 3ALPA 2WBJC 1W0YT 1AQKL 1GGTA 4Q97A 1JWSB 1NPUA 4YPJA 4JN1L 5GZOD 1UR9A 4L1HA 3OKEB 4XWOC 3S5LB 5F96H 1NMBH 3HZ3A 1LP9F 5FXCH 4JFOB 4H8UA 3AMGA 3D9AH 5F6IC 3ZLQC 5ITBH 5D7IE 3SJVB 4U1SB 1N3NA 2K9UA 3DETC 2IGTA 5TDOA 2XTJC 4JG0H 3BN9D 3NFSH 2F54B 3S88L 1I7TB 2QJDA 3ZHDA 3EOYG 4M81A 2ZXBA 3SUTA 1AO7A 2EBNA 4UFIA 3CH8A 2OP4H 3DUSA 1FC1A 2ED9A 4KVCL 2IAMD 4L8DB 3I6KA 1C5BH 3GMNB 1G6RL 4QRUB 4JKPH 2J2ZA 2XN9B 3O9NA 1CFNA 1DLHB 3IFNH 5AWNH 4PS4H 1DQDL 1E5JA 3DYPA 4JO2L 5DT1L 1RIVH 3EJZD 1HILA 3P0VH 2VC9A 1KB9J 1A3QA 3BXWA 2XZZA 1YEFL 3IFLL 1L7IH 2E9JA 3RVUD 3THCA 1NAMB 1UZ8B 1ISXA 2DT1A 5F9JB 2EYSA 3QXWA 1XMWA 1KLGA 3C6LD 4Z7WE 1KJ3H 1JTPA 3ET9F 3O6FA 1J7VR 2NTFA 3E8UH 4GW5B 3MA9H 1H5BB 2XUCA 4L4OA 1A7NL 3KPRE 4KH2A 1BBJA 5D9OA 4PJ8B 4R4FH 3MGOA 1P7QB 5IBTL 3MO1B 1FSKC 2DQTL 2NR6C 4LL9A 5I16B 2DAVA 4LSUL 2Y7QA 4YHNA 4XPHH 4OCLC 1T2XA 1MW2A 2ZCKL 4PYSA 2ERJC 5DD5H 3TV3L 4DAGH 1U8HB 1I1AA 4L8SB 1R3LB 3BAYA 4M56A 4GBXD 5B38G 5L2JA 1E4JA 3MV8E 3ROLB 2MFNA 3GJFH 2VQ1A 4LVOB 2M8XA 1DFBH 5I2UA 2GW5A 1IC7H 1NFDE 4Y5XB 2KZ1B 1MF2L 4H0IA 1I1FA 3O6AA 4HAGA 5J1SC 2ADFL 5CD3A 4XHQA 5C07A 4X4XA 5D7KE 4LLQB 4PUBH 3D0VB 5AD0A 2QQNL 3W39B 3FAWA 4P4RA 3ETBF 1LMKA 5FB8A 3HE6D 1XHGA 3NSNA 2VRAA 2F74A 3BZEB 3QWRD 5C6TH 1OD7A 1WIPA 1LK2A 4K68A 5BV7H 4NO0D 2FZ3B 2A77H 3QG7L 4UOJA 3VFUA 3RJXA 1HHIA 2AV1A 5IHUL 4BJLA 1E6SM 1VFUA 1DUZA 4NYLB 1B3VA 1N5AA 2FGZA 2L4OA 1BVZA 3N12A 3GB7B 2E7CA 4X4YB 1R75A 5D8ZA 3OAZH 3MRDA 4UTFA 2BZDA 4YFEA 3QGVA 2CPUA 1KTKE 1ZA3A 2R0WH 3L3HB 3MJ8B 1FZOA 2OJZL 3D3VA 1EAPB 4PJDF 5I3DA 3MGTA 1GGBL 4WV1A 3BP6A 4UINL 2DH2A 3MNWB 4R9HA 1I9JL 1T7VA 1U6AL 2BJML 4N1HB 3FO1B 3BCDA 2IPTL 4J3WA 1PLGL 2YMXL 5FAAA 1RK1B 3T0EE 4NIKB 1V8HA 1N0XL 3RO8A 3CZGA 5MENE 4UB0L 5C0IB 4ZFFA 3U46B 3IAQA 3FONA 4NJ9L 4UTBH 4YFDB 4MJIA 2F5BH 3LKSB 4QXTA 1VESA 3QWOA 5DSCB 3VD7A 1P7KB 1K4DA 4NPYB 2PXYA 1Q0XL 1HEZB 5HPCA 2DQDH 1QSFE 2WUCH 4S1QL 2QR0A 1UGNA 5CLWA 1OINA 4UDTA 2BSTA 5DVKA 1IGML 4DKFH 4MTVA 3GSXA 1KXHA 3B9KA 3PE9A 4YO0B 1P9MC 3II1A 1W72B 4LIQE 4X7DC 3VXUE 1N2RB 4PRID 3EOBB 4UT9H 4UMGA 4LGPB 2KZWA 3ULUL 4AD2A 4LEXL 2VLRD 1MI5B 5ALCL 2X1WL 5KS9A 1DEDA 1DSFH 1CIDA 1UWUA 3DVNB 5F3BA 1CXHA 3WL0A 4HIHA 1KN2L 2VL5B 2ADJB 1JNLH 1GQLA 5TQ0L 3UPRB 3NCEB 4PSRA 1XF5A 2GSGB 4XVUD 1N59A 3HHRB 4GLRH 2NW0A 1ZSDA 4YE4L 4NNXA 1CD1A 4RISH 4K07A 2YK1H 1B4JL 3BVNB 4MNQB 3HMCA 5JIHA 2AAAA 1TQBB 1U93B 1CFSA 2FSEB 3R4DA 5B39B 4ZO9A 1AE6H 3OR7B 4D9QD 3F58H 3RKDC 4XPGH 3ALWA 4FA8A 1HI6A 3LKOA 3LMYA 1Z3GL 4NQSA 5HYIA 4TTDD 4PB0L 3VRLE 2B1HL 2ZOKA 3ZKMC 1L0XA 1AQDA 2APWA 2XKSA 4OI7A 2XXCB 5D7IF 2R9HD 2P8PB 3ARGA 3CDYA 2BHZA 4HJGB 5HGBB 2V5CA 3DHUA 4U1IA 2BY2A 2D2OA 4OF7A 4UFJA 2WCSA 2X4TB 3C60B 2AV7A 4WI8A 3WIJA 3B9DA 4TVPL 1ISZA 3CDFA 4FZEH 3CLEH 4Y5YA 5EU7C 1T04B 2BNRD 2XJ7A 4CU7A 4ETYA 3REWB 5K9KB 2FEEL 5EN2A 3WCYA 2XA8H 2ICCA 3QRGH 3GMOA 1FN4B