1CDGA

Nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose-dependent crystal form
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase(glucanotransferase)
molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
publication title Nucleotide sequence and X-ray structure of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 in a maltose-dependent crystal form.
pubmed doi rcsb
source organism Bacillus circulans
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cdgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cdgA01
1TPXC 4Y4FB 1AGDA 1CT8A 1DE4A 1WE5A 1NLDL 2FH8A 4LP5A 1M7XA 3QHMA 4UTFA 2C5DC 1ZHBB 4POZC 1KIQA 3QCVL 5BS0A 1P2CB 4LFHD 1B30A 1UACL 1QYGL 1MAKA 3N9KA 4LSSH 4ORZC 1P4IL 2C7UB 2FIKB 4TQEL 2Z92B 4PJAB 3V7MA 5JHDB 1FCCA 2IJ0C 4LPWA 3AI0A 1TZ7A 5DS8A 5FCSH 2F5BL 3SGKA 2BCKA 4X7TB 4UILL 5D2NC 1QBBA 4TUKH 1XIWD 4GAGL 4N0UA 3SDXB 2VLJE 3AIVA 3DRQB 2XY1A 1SYVB 2EBNA 1E6ZA 4DVRL 3QUXB 3QIBD 4NKDA 2EZ0C 1DN2A 1HYRC 1H0GA 4NO5A 1JD7A 3RWEB 3QIUB 2BV9A 1YYML 3RDTB 6FABL 1G9NH 4GSDH 1E6OL 4EN3D 5IJKA 4GG6B 5L88H 4KJWD 1E28A 5LXGL 5H37H 3ULVH 1N0XH 4UNUA 2BJMH 3ZDXF 5GGTA 3DI3B 2CXKA 3G08B 2VYRE 3AS2A 4PJEA 5D7IB 3UDWA 4U7MA 3UPRB 1BG9A 3MV7A 5IV2B 2LAAA 1ND0A 3KS0J 3ARUA 4AMKH 4OAWB 3EYPA 5TQ0H 3ARQA 4U1HA 2OZ4L 3MZTA 4DZBA 1PEWA 1EAJA 1LILA 1P6FA 1DQQB 3QEGH 3PWPD 4MJ6A 3OXSA 1BFVH 3G6DL 4LBEA 5EPMA 3MYJA 1HX0A 1IQDB 4Y1AA 5D7JB 1XD0A 5K9OA 4TVPH 1FNHA 1MW1A 2DF3A 3EOTH 5A2CA 3BP6B 3GSUB 3O2DL 4JL2A 4NO2A 2NY5L 3FKUS 1GC1C 1P5VA 4G7YH 1MHPL 1X5KA 1EVUA 4EQ2A 2X1OA 2YDSA 3MLYL 1TCRA 2ZCKH 1MVUB 2H1PL 3EDFA 4PJCF 2W0PA 2X4UB 2WHJA 4RGNB 4DTGH 3RY6A 1JIBA 2BSED 1GJWA 1MPAL 5FYJD 1FH5L 2GYSA 5D6DA 1TFVA 4I3SL 5F71A 2NQCA 1BQCA 5HGDA 1D5ZA 1JF1A 2NY0C 2PW1A 1NWRA 3OL2A 1YEGH 4KHTL 3GJEB 5A8PA 1T20A 3M17A 3GSNB 4PD4J 2R69L 2ZG1A 4HIEB 4DEPB 3MJ7B 1HSAA 1A7OH 2DH3A 1I9EA 4OFIA 3F7YB 4JZ5A 4Q0XL 4HS3B 1V3MA 4MDIA 5M3WA 2NY3D 3O3UN 4QXGL 4M1GL 4J3VA 5JNYA 1U8IB 2KZWA 2EE9A 2JK5B 4HDIA 4UINL 4DN3L 3RM9A 4QOKB 5TF0A 3OLDA 1YEJH 3RVXD 3WSQH 4Y19D 4KKCC 4LVNB 5CEYA 3K1KC 4GKSA 1ACYL 4PGEB 2EDNA 3F5KA 2YD7A 3NACL 1KJVA 3BUTA 4D6CA 4MLSA 3OR7A 1NCCH 3VXOA 4QO1A 5IB2B 4DWSD 5HD8C 2Q7YA 1PKQB 3MUGB 4M62L 2HVJA 4JHWH 5I1KH 3CZSA 2CDGA 1JV5A 3NZHH 4J3OC 5A2IH 2ZUYA 4LCIL 1R46A 5E2UL 3L9RB 2VWEE 4HAFA 4OZHA 3RZCB 1P1ZB 4K8RL 4PB9H 5C9JB 3P4OA 1BWWA 2V17H 4R90H 1HNFA 2BNQE 3FQNA 1VJZA 3HMXL 3TO4C 2AERT 5AD0A 4FOMA 5I76A 1EXUA 3B4NA 2AK4E 3QOKA 3PHQB 4NWUL 4YZFF 2X4PB 3W82A 4NDMA 1K9FA 3MRPA 4MNQA 5I6XB 2GJXB 3KYKH 1HWHB 4CADB 1A7NH 5ADOH 1TQBB 1OGAA 1T1ZA 3VFOA 2PWHA 1C8YA 4UV4L 1UASA 2VZ1A 2XIIA 3PTKA 2Z1SA 5ETUA 5DI8B 3EOBA 2VLKD 1I7RA 1K8DA 1I8LA 4C83B 5HY9A 3T3ME 2Y06L 3QZWG 1UD6A 5SWZB 3QEHA 1JYVA 3S36X 3EMQA 3A47A 3PQYB 3BH9B 1P84K 4P46B 1CK0L 3SJVA 4HWBH 1UQSB 1QO3A 1GQJA 4JY5L 1V7NH 3RI5K 3TZVD 3VM5A 4D9LL 5ESQA 5C07A 1FNGA 2DD8H 4JDTL 3N15A 2D7TL 3H9SE 5D4QA 4XCFH 5EO9B 4K2UL 1CVSC 3CFEA 5HTSA 3KJ4B 3CBWA 4QGYA 1JPTH 5FM5O 3MRJB 1J9CT 1EXPA 4ACYA 3WQWA 3TYGL 5EBLA 3H0TA 5EULV 4G5ZL 4UFJA 1ECEA 2VDQH 1J0YA 2A3CA 3TF7C 4PJ5E 4YXLH 5I78A 3TM6A 2J7FA 3WJLC 4FLRA 1BD2B 1KPVA 3WNPA 1JN6B 3K4ZA 5F7LB 1OP9A 1MRDL 3HE6D 5LBSL 1A7RH 3QXAA 4OIBA 4JRYD 2GJPA 5F6IB 3MUHL 4MVBC 4HOZA 5KBNC 5I19L 1HYSD 4TN9A 5E9DD 3IAGC 1ZJAA 2AXJA 4GRWF 3G9AB 3C5ZA 3QNYB 1PG7L 3N1PC 5DJ6A 1CPUA 2YBUA 1L8NA 3D3VD 5FHBL 5EZLA 2G60H 4QLJA 3FFCD 5IP4A 3VKKA 4U33A 4I4WB 3ULVD 4PS4H 2K3TA 2VJXA 2AK1L 4RWYL 1DUZB 1T21A 1YNTA 4X6BB 4HUXB 4ALAH 2P5WB 4JE4B 4XVJH 4U7KA 3G6JE 2QQKH 4LCUA 4ELME 2QSTA 1W1YA 3D3AA 2VQUA 4PJ8A 4F7CB 5FECB 2WIMA 5EFDA 1FG2B 2WUBH 3B3IB 1EBAA 5FGCB 1OAKL 4FFVC 2H2SC 4WUUD 4PJXE 4NC0B 3FQRB 4QDMA 4HKXA 5DR5H 4F9LC 1FNEA 4NNXA 4F3FB 2CBIA 5DZLA 5GNXA 1DTUA 3BUDA 3VD5A 3KLKA 1PW3A 3ZMRA 4QYOA 4TVPD 5KSBE 1MNUH 5DTFA 1ZAGA 2G3JA 4H1LG 5LA0A 1BVLB 4IOIB 3S3SA 3UP1A 1JWSA 4U31A 4QFUA 3DUSA 4RNRB 4XVUC 4L4PA 4TSAL 3HC4H 4CMHC 1LEGA 2QHRL 1PKQA 4HXBL 5DMYA 1UD8A 1GHFH 4AZHA 3EYVB 4UU9A 1X5AA 1UXWB 2ADFH 1JPFB 4DOHB 2X1QA 2JJTC 2NY2C 5JW5A 3GI9H 4FQLH 4P23C 3L9RA 4KQ3H 3RZCA 3LQMA 1P1ZA 2X2JA 3IETA 3T77A 4RE4A 4Z0BL 4NRXB 3VGAC 3D5HA 5BROA 5FKAB 3OJVC 4PYGA 2F53B 4M7ZB 4PJFE 2H9GB 1RUQH 2Y8KA 1N0LA 4CVXA 1T2QL 1ITBB 1OGBA 4GRWB 1NBYB 4JFEE 1DVFA 2BP3A 2YA0A 3VTRA 2X4PA 4TSBH 3UJTH 3CX5K 3G5ZA 5IM7B 3ULUC 3EFFB 1EO8L 3FQWA 4LASL 3TBSB 4GINA 2YMXL 4QAWA 2DBLL 1HI6B 2HJFA 4QRPB 2AMGA 1N7ML 2EACA 2ADGB 3MBXL 1MQ8A 1Y18A 5AAMA 2VURA 4V1DE 4DUXA 1Q94B 4U1SA 3A6BL 3VXNA 3TVMA 1KGCE 3WS3B 2F2HA 4OKVA 2QADB 5CZKA 3BAEL 3UO1H 2GUYA 1V02A 3AIEA 3OIHA 3FRPA 3HZVA 4PMOA 5D7KE 1NP2A 2X70A 2P24A 4LOUD 1MFEL 4P2QD 4JPWH 2XQBL 1RZ8B 2Z0BA 5GSVA 1X4XA 4FQJH 4LAQH 4A3YA 1QPPA 4AIEA 4HUNB 2F8XC 1SYTA 3QA3B 4U1KA 1TFHA 5E70A 1LL6A 1NOUA 3DNKA 5K59E 1FA2A 3GKWL 3QI9C 4UDUB 5B21A 2EH8H 4URTB 4PJHF 3VD7A 2YKLL 1SHMA 1M7IB 4X6CF 4BFIA 3FAWA 3OKEB 3VH8G 3G6AA 5D71H 1I3RB 4G6JL 4EXPX 4HWEH 4WV1A 1P4BH 4YHIB 2EKJA 1D9KC 2IPUK 1UVQB 4Z76A 4WWKA 4OD3H 3POCA 1TDQA 3DX7B 3X13B 1RVFH 4CCEA 1HH9B 4MWFB 4PJ7A 2FHCA 1FORH 2X9WA 3UROR 1I85A 2Y8VA 1G6RA 2A6DA 2VOTA 4N68A 4P2RE 5CZVH 2E3VA 3AAZA 1QR4A 3KZSA 2WMGA 3Q6GH 3U0WL 4OF0A 4Y5VB 3RFZC 1DSFL 2O9PA 3C8DA 1T89C 1WDSA 1JNJA 1JDDA 3H3PL 1J8HB 5DRZA 2XTKA 1CFBA 4ZO9A 5E6IC 5L6YL 1F5WA 2R4RH 1IFHL 4PJ9C 1A4JA 3PGCB 3V6ZB 1U8HB 5IB1A 4P9HC 5HDOA 5C0CD 1AQDB 2P5WA 4FK9A 4TX8A 3MNVB 2GUOA 3CFCH 5IG7B 1DBJH 4HIJA 4YWGH 2WMKA 3UYOD 4HV8A 4P5TB 1KWGA 2ZUNA 3O41A 3TPUB 2WCGA 4Q22A 5GPRA 2XFYA 2FD6L 5E0CA 1NL0H 1MRCH 3APGA 4F8QA 1I9JL 5GZOD 4PTWA 4QHLB 1QR1A 2WUCL 3MA7B 1CDHA 5J6GA 4TSCL 2FDMA 1C5DB 4JFZH 3JV0A 2GVYA 3R0MA 3WENA 3DOSA 5AC5A 4EK7A 2NX5E 1JNEA 2EADA 5CZXD 1E4LA 4UQBA 5J1AB 4XMLH 4RDQG 3NAAH 4IRZH 4GKOA 3CUJA 2YL8A 2GT9B 2R1WA 4PY7A 5AUMA 2CLRA 1JDCA 2EEBA 2GK0A 5C0IB 4RMWA 1F02I 5DC0A 4X6CB 4WF7A 3WLBB 3J8F7 4GBXA 3S35L 4BK4A 2G8ZA 4YK4B 4R97B 3QUZD 3N1QC 5C6TL 5FOOA 3KLAB 1TZHB 2F8OA 4UNIA 1PBYA 4LRIA 3SPVA 5HNNA 1YEFH 1FCGA 4L8CB 4L3EA 3OGOE 4L3CB 3FY1A 5GS0L 2G2RB 1W8OA 2EC8A 3S2CA 1R24A 2IQAA 2KPNA 3D39A 4NKIH 3MV9B 4X6EA 2OJEA 1RZJH 2E27H 3MRMA 4U1NB 3DV6A 4O5LH 2NY1D 2DEPA 4AYFA 4WI8A 5FYKD 3W0WE 1BEYL 1IM9A 2BHZA 1P53A 2ZZUT 3ZKMC 1OSPH 1L9MA 2X4RB 3HPJB 3RAJH 4MB3A 5DD3L 1NEZA 3ARBA 4PTVA 1QKZL 1XF3A 2JELH 1MCLA 1MI5E 2ZUUA 2DI8A 3M1BA 4Z8FL 2AJYH 1JWMA 4HMCA 3GMLB 2VCAA 2NYYD 2R56L 5MEQB 2WBJA 3WN5C 4XUYA 1V3HA 2I07A 3PE9A 1NP0A 5ALBH 2ENSA 3HNSL 3OZ9H 4FTVA 5HYJD 3TBVB 1FZOA 1CZ8H 4I18C 3WIFB 2IF7A 2E8YA 4FN0A 3TA3A 3ULSB 3CZNA 4RIRA 3MTRA 3PWUB 1DUYA 2A6KA 3F62A 3GI8L 3FTGA 4LDLB 4DGYL 4OTXH 3MXWL 2BOBB 4QRRA 4JY4A 4GQQA 4L8SA 1SVZA 2OL3B 4KK6C 3CC5A 2HT3D 1MQKH 4APQB 2X5PA 2CIPA 3QA3A 3L95A 2BHUA 2HTLD 3AMKA 3DBXA 1IGJA 2OTUB 4NGHL 5JORB 4HK3J 2BVYA 4UOJA 2HVKA 3KYMB 2EABA 4RE2A 3BMWA 4XBEL 1I7UA 4JCMA 5HI5D 1OP5H 5IIEB 4S10A 3ZE1E 1CICC 4J7RA 5IB3A 2BVDA 2WMHA 2XN0A 4PRPB 1V7ML 1QNRA 1BM3L 4OD1L 3MRNB 3F6IA 4AZGA 3BIKA 2F8QA 4NZDA 1F6FB 4Y4HB 1AXIB 5C8JA 1LWJA 4G3YH 3EYOA 5KS9E 3EDJA 4LHQB 1YHTA 2GK1B 4YHIA 3MLRL 1CGTA 1ZVYA 4GW5B 3WY2A 2N7BA 3LD8B 1ISVA 2YZ8A 1ESWA 1TPXB 4IHOB 1FGNH 4TUOA 4ZOBA 3ZTNL 1GPFA 1NJ9A 1HKLH 2X09A 3ISWA 5F1SA 1EOKA 1HT6A 4MWFA 4H20H 3S7GA 4NO0D 4XPBL 1G7LB 4LU5L 4XNMA 5CMAB 3ARZA 3PGDB 4LRNL 2VXSL 4XNQB 4J3SA 3PWPE 5SWSD 3LXAA 1Q6EA 3S97C 2CJUH 5IMOB 3I3EA 5D2NB 32C2A 4R3SA 1S7VB 3UZVB 1AI1L 2W63A 3KLDA 3HN3A 5E8EB 3I50H 3CSPA 2EPMX 3HJEA 4K94H 2VZOA 2X4SA 4M6NL 5GHWH 3QDMB 3TPUA 2F58H 5D9OA 4BQ4A 5CSZA 2R2BB 1BVKA 1UH2A 3BVNA 5C08D 3LB6C 3HUJF 3ZT7A 5I1HL 4G8EA 1TTFA 2ZICA 5DGRA 1VESA 5FYJE 1CLOH 3V0WH 3BLBA 4QHLA 3HC3H 1PSKH 5F1NA 3DYOA 1IC7L 4ZPVB 3S4SB 4KZDH 1US2A 4DUWA 4LSVL 2V2XB 4RCAA 1GIGH 3O3EB 3RWIB 1NCWL 3V5HA 5IBTH 1T80A 4FQIL 3B83A 2D3VA 3UXFA 3QO0B 4EI6B 2FBJH 4ONGH 2BSRB 4OUUA 2XKSA 3DX8B 4M9OA 2VERN 4WHCA 2WSPA 1N3NA 5MENB 4FQXB 1W2PA 4MNGE 3MJGX 2WHLA 1C3FA 3RP1A 3R1GL 1VGEH 3BZEA 5DJZB 4C58B 4PJIB 4Y8AA 5LWYH 1GOGA 2EKSA 3ZJ7A 5FKPB 1NCDL 1VBRA 1MW0A 5CG0A 2AJSH 4GW1A 3BSZL 4BFEA 4CD4A 1NMBH 3S96A 4Y19E 4KDVA 3ARFB 2IGFL 3D85D 4XCCL 1CIUA 1ZWIA 4BA8A 2CPUA 1XAUA 4FQQA 3DO7A 4GXVH 2GFBB 5JQHC 5KSVB 3GJFK 2VXQH 1UD3A 4MQTB 2ICWA 1S5IL 5DHYB 4OI7A 5IB4A 5ANMB 3WEXA 1LG1A 1BPVA 1HZHL 4XI5D 4QHNA 4BH8B 5C6PB 3NIGE 5E2TL 4X0VA 1SJHA 4BS0A 2G5RA 4QT5A 1YPZE 4UDTA 1F11A 4H5SB 5JPNB 1O6IA 3RWJB 1ZGLA 1EBPA 4X0KA 2OQJA 2I9LB 5MEQA 1CL7L 3O11A 4RQQB 2DYPB 5EORH 5BRZE 1D5MB 3SQBA 1MUJA 4FXGB 4PY8J 3H53A 4ZNCD 3EBAA 1UR1A 1IT9H 1XF2A 3GDBA 2DTSA 1EHXA 1T6WA 3NCYS 3C8KB 5IOPB 3EDDA 2XZAH 3LKPA 5DEFA 3WD0A 5ACZB 4AYGA 1SEBA 1YEIL 3MACH 5DHVH 3D9AL 2IADB 8FABB 2E9BA 1UQYA 1VRXA 3WFEL 4XNUL 3QCUL 2HVMA 2VLKE 4PMXA 3MJ8A 4QY8B 3RPKA 3LRHA 4W4OA 1X6LA 5DA4A 3KYMA 2VC2H 4JFFB 3FB6B 4OFDA 5TDOA 4U1IB 1YC7A 3HI5L 4KRPB 5I1DA 5IIEA 5D1ZC 4MA1C 5DUPH 3BMVA 4KDTC 2P44B 2Q6WB 1H8SA 3H7BB 4OZFG 3UEQA 4KI5C 6TAAA 2X0YA 4U1MB 2QQLL 4H88H 4I0PC 3ELAT 4YHPA 4HJJL 2OW6A 3ZQ9A 3GJFA 3OR6B 1P7QB 2J75A 3IDUA 1A6AB 1Y7VA 3HG2A 1WEJL 4M8QB 4HS8L 2VR9A 3SDDA 4IHOA 3ZKQD 3K3QA 4K3DL 1RK0B 1ZS8A 4ZXBC 1M05B 5D4YA 5FEBA 1G7IA 1Y0LA 3PGDA 4IM4A 3FOLA 1IVLA 1MREL 1C5CL 1H3WM 3CU7A 3P2TA 2CO7B 3L3DB 4R4FL 2LFGA 2O5YH 2VIRA 4JRYE 1JGDA 1S7WB 4J2XA 3U5YA 3S37L 1MCDA 3G6MA 2G75A 1PZ3A 5E9DE 2BFVL 1TQCC 5D2NA 5HGBB 3VIGA 1FDLH 2E7HA 1DBKH 3MBEA 3NZ8B 3ZIZA 1Q8MA 2I5YH 4DK3A 2OMBA 3NN8A 3DETD 1OY3B 3DVGA 3I85A 5E8EA 1T0MA 3RILA 5T33L 4JFOB 1G9EA 3PZOA 5BJTB 4X7SL 3RUGB 1ZTXL 4ZG1A 3ARVA 4GXPA 1GGIL 2Q8AL 3RO8A 1H8NA 3NCYP 2IG2H 2W4XA 2AQ1A 4ZE4A 3FFCE 5C09D 3WIHH 3ULVE 3P30L 4WY7H 1B0WA 1F4YL 1J7VR 4MJ5B 1GGBL 3GIVB 4FS0A 4S1SH 4ZPVA 1AD9B 5J3HD 3SUSA 2E7LC 1NDMB 5KVFH 3ALWA 4OOUA 2EDJA 2FO4A 3EJUA 1GOWA 4JG0L 5L8JB 3GGWB 3EYQD 4HS6B 1EPFA 4JB9H 4XCEB 5IUSA 3WD4A 1LP9A 3PWNB 4K3EL 3RNQB 5CXPA 1KCRL 2X1XR 5GS1C 3JWDH 2VLRB 3TCLB 4UIMA 4PTUB 1X4ZA 1PX4A 5GGTL 5C9KA 4HGWA 4TVPE 1XHGA 4G7VH 3QUMA 2NW3A 3WD5H 3E8UL 2LAGB 4CD6A 4QRUA 3WL9B 3D5OF 3PABA 4G8IB 1NC4A 2X89D 1W9UA 2ITCA 2NY4C 2VVSA 4O9HH 5CHNA 2WP3O 1II4E 2ID5A 4JFWA 1U8KB 2EO7A 5DJYA 3PWLB 4QNPE 1OTTC 2HJLA 4OCSH 1OW0C 3SGEI 2WWKT 5J12B 4LSPH 2IFGA 3WIIH 4BH8A 3PN8A 2A3AA 1PLGL 5C92A 2DMBA 1IV8A 2JLLA 4HIHA 3QOMA 5H8DA 3B9VA 4UFMA 3BGMA 3RBGA 1CDGA 1NC2A 5EFIB 1AD0A 1JE6A 1FVCB 1NWUA 3QHTC 5D1XC 4AZCB 4V2CB 4MXVE 4X9GA 5FDWB 3SQOL 1KF9B 4ODTL 4OZIB 3EYFB 4FXGA 3ZE2E 3PUCA 3V6FA 3B9KA 3GEWB 4YJZL 2C1OB 3PP4L 5GGRA 1LO2H 1MCWM 5LJYH 1LF1A 3IFNH 4UTAH 4DVBA 4X6DB 1FL5B 2GITB 4PJEF 2WWCA 2NTSP 1JPGB 3FT2A 3ZE0F 3FCTB 2ATKB 4ZOEA 3U48A 5GJTH 3OX8B 4JVUA 5E8PB 2RCSH 4Y4KD 2A6IA 3MYZA 3MCKA 3O8XC 4K7PL 3FB6A 3L2LA 3FQTB 5IB5A 4U1IA 2B1AL 1U30A 2ED9A 2WW8A 2R4SH 3BH8A 15C8L 5ADPH 1DWFM 5CCKH 4P5KB 3HFMH 1UD5A 1PKOA 4H26A 1UM5H 3EJZC 1WFNA 1AGBB 5F89A 4NPYB 2YPVH 4D0CB 3N13A 1H5BC 1LK2A 2XN9B 3OR6A 4HLJA 3LPWA 4NNYB 5E4EC 5BZDA 4KZEL 1A6AA 1ORQB 2D73A 2VN7A 1HXMB 1YUHB 2YHGA 1BQSA 1ZLUH 3H9ZA 2AV7A 3GSNH 4YFLF 2W62A 1JZ3A 1MCNA 2ATPA 2F7QA 3LQZA 1AH1A 4G9FB 3TO4A 4XP6L 3QIWC 2ICCA 2YRLA 5B3JE 5EU3B 2VL5A 3HG1B 2X6MA 3QZWA 3P40A 3PHOB 1R0AL 4PP1C 1BYCA 5TH2B 1BLNB 1DQML 2I9TA 2R29H 2WB5A 1E43A 2B0SH 3DHJA 5IFJB 5FYLH 1ZBCA 2RR3A 3VI3F 4WFED 1ORSB 5KJRL 1REIA 3WE6A 4U6TA 1EEYA 2JB6B 5BRQA 5INCB 5DT7A 3CMJA 2VDPH 2G5BA 2CRYA 3DXAB 1KUMA 1XGZA 1DZBA 3X12A 2JJWA 1C12B 1KG0B 1NLDH 4W81A 2WBWB 1LEIB 1AGEA 3BZ4B 4JM4L 4UQCA 1JPSH 5EBWA 5EU4A 1D7FA 4O4YH 3PIQB 4LLYA 4M5YL 2OWXA 1UACH 1QYGH 3C09C 1I8KB 5D2LB 3ZYIA 1KC5L 5F7DB 5DQ9A 1UUQA 4Z7WA 1P4IH 4Y5XB 3VCLA 1MY5A 4W8AA 4XRCB 4MA7L 3BUIA 2B4CC 1G0XA 3J7HA 2FO1A 5H2BB 5C0CE 1NDMA 2P5EA 4Y2DC 5EUKA 5HJ3A 2F74A 4C4KO 2X1IA 1KJ2A 3JUYA 3QI9B 4G6FB 5CD3A 5LQBL 3IXAA 1UEMA 4DVRH 2NXYC 7FABH 5E8OA 1CG9B 1EUTA 4PRBB 3P73B 3DGCR 3WJLA 4FLOA 3PWNA 3CUHA 2DL9A 2P8PA 3WV0A 3BAJA 6FABH 2Y7QB 1E6OH 4PTUA 1J5OL 3IDIB 3QJHB 4OI9A 5LXGH 4Q9QL 2FHFA 4P4KA 1MIEH 1BX2B 1D9KB 3ALGA 5HGGS 3NOIA 1KPUB 1XF5A 4XCYB 5DWUL 2AJ3A 1QG3A 2XVLA 2A1WH 4LEXL 4OLUL 1KTDA 4Q6IB 3IJHB 43CAA 2A73A 3D0LB 1YNKH 4AZ8A 3QXTA 3O6LH 3HZKB 2JCCF 5BYWA 3GXFA 1NFDB 5I71C 4LLDB 3CCHB 2DS4A 3U4BL 3RX7A 5E6IB 2J7CA 2EDOA 1ZVSA 5D1QB 5T1KD 4BQBA 1WIUA 4PJ9B 1UXSA 1V5JA 4RA0C 3O2DH 1KCLA 1HINL 1INQA 3EYSL 4FFYL 4HT1L 4NKQB 1H4PA 4A3HA 3FZUD 1U8JB 3LV3B 2PI6A 4N9GA 2KZ1B 4XB8A 3ROLA 3RVWC 5IJVB 4MNQD 1XH0A 2X44D 4W89A 2IBZX 3NA9H 5C0EA 4P8UA 5FYKE 1KIUA 2H2PD 1LHZA 1EGJH 5JHDD 3WKNA 4NQDB 1FH5H 4B7IA 1Z9SA 3MSGA 4ZQKB 1H0DA 3JWNC 2VC9A 3O4LA 1GXEA 4QP0A 4KHTH 4NHUA 3MGOA 3QHFL 1JF6A 4WEBL 2ZCHH 5HYJE 2HA1A 3QUXD 4JGJA 3SJVD 3D18A 3DROA 3G9VA 5EO0B 1WBYB 5JZ7D 4YDIH 5C07D 4EJ1C 1AMYA 2V2WB 3QIUD 5JLZB 3RDTD 2FEEI 5D5ME 5J9PA 4YIQB 4LEOA 4AWEA 3QXVA 4UINH 4DN3H 2VABA 3OF6A 3VRJA 4N0CC 4P23A 4GW4A 3B8SA 4PLNC 5IVXB 3DVIA 1A6PA 1OGGA 1ACYH 4JFDE 1A1NA 1IEAB 4ZS6D 4LLVA 1E6JH 1ITCA 1QA9B 2IMMA 2WVVB 5FF6B 5AYBA 1E4MM 3AB0C 2HN7B 1EMTL 3QULA 2DQEL 3RI5F 2ZX6A 1GGTA 1EZVY 4GMTL 2J74A 5D7JD 2JCCB 1XFPA 3LQAL 4LCIH 3FN0L 4NRZA 4TUFA 3CLWA 1NLBL 4NZFA 1DQTA 1IAKB 3GBDA 2FJHB 4LPUA 2A38A 5J6HB 3D6GA 3WN5B 5E8DH 3CNKA 2W38A 5I1GL 5IHBA 1V6YA 5A6AA 4ZO6A 1I1YB 3C5ZD 1GL4B 3TN0A 1T0NB 2OTWB 4JLRA 4R7DB 4YQXH 2FJGB 4HMEA 2DBJA 4YDJA 4LX4A 4L9LC 1I9RL 1RSFA 4NWUH 3RA7L 2BNUA 2ED8A 5F1OB 4MNLA 4RGND 2WAGA 5F7FA 1GZPA 1A7PL 3UC0L 2AJZA 1WC7B 4JFYA 1RUML 5SWSE 3VFUB 2X0HA 3WFZA 4W88A 2JJSC 5IW1A 3BT2L 1RPQA 2OWCA 1SMAA 3WMBA 4IIQC 2XFXA 3L1OH 2YD8A 5C0FB 3OKYA 5GISL 4E8DA 2AS5M 3GBNL 5I73C 1J8KA 3IJSB 4NYLB 3M46A 1CWYA 3FMGL 1EHLL 4GRWH 1NCBL 1FNLA 1ZJBA 4HJGA 1T1XB 1X5ZA 2EDRA 4M93C 4LARL 1VFFA 2YA2A 1J9YA 5FA4B 4PTMA 4D9LH 2FATL 4PY8I 4XP9H 3DMMB 4JDTH 4MNHB 5C08E 5FO9A 5L2JA 3U0PB 1R5IB 2D7TH 4YDVB 1WCBA 5C0JA 1KCSH 4WI5A 1EIBA 2IPTL 3QJHA 3WLWC 1A6UH 2VXVH 4LFHG 1ZT4A 4JG1L 5KAQG 3TYGH 4C59B 2YDRA 3I6GB 3SE9L 4EDWH 4G5ZH 1S7XA 3VFMB 1CIDA 4A6YB 1CXKA 1BIIA 1E4XI 5B3NA 4L8BA 2PCPB 1K2DA 3RWGA 4F7TA 2OYKA 4NKMA 1XCQA 3HZKA 4EN3C 1U93A 1MRDH 2E7MA 2H32A 3CFJA 5LBSH 3VXTA 1T89A 1H3PH 3ZR5A 2W0FB 3QSKB 1AY1L 3E2HC 3RZCD 4PCSA 3WBDA 3CCHA 1TZIA 4HF5H 5E6IA 4NJAL 1RZGB 1MWAL 4PJDB 4PN2A 5I19H 4WU5B 1CFVL 1G6RL 5MEOB 1F3JB 3DHPA 3GXNA 3V52L 4ZFGL 2HT4C 4K68A 4JKPH 3QDJE 4GKNA 1OINA 4F7PA 4LKXA 5FHBH 4GRMA 4IOSD 5IF0B 2W91A 3MNZA 2FNBA 4JO4L 1Z2KA 4OM1L 3RTQC 1JZ4A 3RY5A 5B4MD 3QPQD 3MJ9A 2AK1H 3SDAB 2Z35B 2Y5TA 3LZFH 5DJ0A 3RIFK 5SWZD 4XVTL 1UR4A 4UQ3B 4B41A 1G7HA 3PQYD 4P46D 1GOOA 1C16B 5TE7H 3VGHA 1DN0B 4GQPH 1J86A 3PL6A 3VXUB 5DEGA 4NQTA 4R96A 4EOWH 4EIGB 3QWOB 2VQ1B 3DWTA 2ESVA 3RWHA 5C86A 4LL9A 4GG8B 4LCWB 1X5XA 4PJ7F 2V9QA 4DKAA 1S78C 1AXSB 1EHNA 4PG2C 2V5DA 3M8OL 4M00A 4LLMA 1DLHB 4ZFFA 2EE3A 5GNZA 4H2CA 3JBG7 4TSAH 3HCVA 4QXUL 4M48H 3CIVA 4MJIB 1NAMB 4HXBH 4AD0A 1HDMA 5CIPH 1A9EB 4JAMB 4JY6B 1F6AA 4HUWB 3WY3A 1LJYA 1QEWA 1HILB 3IDJA 1WZMA 1RJZB 1SBBA 3RVXC 1PQZA 4XHJC 1ADQA 1X5JA 4XMPL 1K9EA 4UB0L 5SWQB 1S5HA 1XF4B 5IESL 3QG7L 1QNQA 2AQ3A 1G94A 3VGEA 2HFEB 3MGTB 3EYUL 3KXFB 3QUYC 3DC0A 4KVNL 4AD5A 4MAYC 4P3DA 1FGVL 1FZJA 4I18A 1T2QH 5E5MB 3VFPA 3GH7A 3SCVA 1A3HA 4KFZC 1U8PB 4JKKA 4AM0A 2EYSB 4LASH 1FP5A 3IFOA 5HPOA 5GNYA 2VRQA 3P4MB 2P5WD 3EJSA 1NKOA 1GSMA 2YD2A 2J8GA 5BMFL 3HAEH 1J05B 4BZYA 5ICYA 1CD8A 4HGKC 4TTGA 4IRSB 3A6BH 1T66C 5J56B 1UKSA 5C0AB 4YAQB 5D1ZB 3BAEH 1CICA 2PW2B 4O02L 4X7CC 3BP4B 5CEXA 3F5WB 3NIYA 1YEEL 5IMLA 3CZEA 4HLZH 2V5YA 5GRXG 4QTIL 5C0BA 1IGTA 1KTLA 2HFGL 4HC1A 2XKNB 4YH6A 5M7QA 3U0PA 1I8MB 3MLXL 1H9VA 2ERJC 3IU3A 3E1F1 4FQ2H 2F5AL 1UWGL 4X4ZA 5CEZD 5IMKB 1F4AA 1MCPL 4QHUB 4DKEL 3IKCB 3U46A 1W8NA 5CP3H 1JZ8A 4XCNB 2VDLL 5ACMA 3GKWH 1W72L 3KJ6H 4JQVC 3PNWA 3KYOA 1S9XB 1AQ0A 3TIEB 2YKLH 4PP2B 2YPLA 1WBZA 2PC8A 1DBAH 1DBBH 2IBGA 3O45B 1OLLA 1O5DT 1AE6L 5LKNA 3NIFE 5DMIH 1E4IA 1CE1L 1NBZB 1KCKA 1UM6L 2OL3H 2W0FA 4I2XE 4LSDA 3BDBA 5EUOA 1XGQB 3TYFA 2IANB 3KDMB 3C8HA 4P8VA 1A9BB 3N9GH 1W91A 2OMNA 2CK0H 3QQ4A 3D39D 2F53D 1LWHA 3QT2A 43C9A 5CKGA 5EBMB 4S11A 5DLML 4O2FB 4FRWA 1IC4L 2AI0L 2HLAB 1IM9D 4FQHA 4JZJC 1JGVH 2XVKA 5ECUA 4H41A 3U0WH 3OKDA 5HDQH 1A2YB 1DSFH 3T0WA 1Q6CA 3I6KA 3DHMA 1XSJA 1NCAL 1K6QH 3VXPB 1AGCB 3H3PH 1BZQK 2O26U 4QRPD 2ZP0T 5D9NA 5L7XL 4G80A 3CJJA 3JV5A 1VDGA 1C90A 3WFHB 1WZLA 3DYMA 1WBXA 4OGYH 1M7DB 4K7PY 1A7QH 2CIIA 2VLJA 3CSBA 3VFGL 2J8HA 2QADD 5JW3H 3IRZA 5GGVL 5JR1H 3CFIC 3OAZH 3QJFA 3P0VL 3BP7A 1EVTC 5IHZB 2UUDH 3ZTJG 1G9NC 5GS1B 3BIBX 2FD6H 5J13C 5IMMA 1EQPA 3U9UA 3WH8A 5C70A 2QPUA 4JFTA 3BW9B 2C4FU 1I9JH 4Y16A 3RZWA 5EC2A 5ALCL 1X3DA 5JMRA 3FXYA 1ZS2A 2V2TA 3NJ3A 2WUCH 4YHOL 5T1MA 5DC4B 2CLZB 2ZCLL 4ODHL 1KLGB 4HKJB 5GRUL 2CBUA 5DMKB 3L7EA 4YLQT 4N0UE 4ODUB 3VFRB 5HYFA 4YHYC 4GS7C 2YRZA 2VDNL 2ZUTA 2N1KA 25C8H 4ATLA 1XD1A 3ECBA 1B1YA 4M3JA 2QTEA 5DA0B 2RB8A 4Z18A 4YX2H 2EDEA 5JDJA 2WMIB 2R8SL 2DQIH 1RMFL 2DQDL 3WNMA 4JAMA 4POYA 3S35H 1AHWC 5C6TH 3Q48A 4EUPB 4B15A 5SWQA 2E6PA 3BP5B 1XF4A 4MD4A 3PXHA 1KFAH 2KH2B 3RGHA 2VDOL 2WMPA 2I60L 3GSOB 5JIKA 1JPST 5GS0H 5D9PA 3MGTA 1TNNA 2NY7L 2C1PB 5GRJH 1NEUA 4XNZC 3VDHA 4LF3B 4HIIA 5JXAH 2YSSA 4J4PC 4M7LL 2X2IA 1E5NA 2MTPA 2CKBA 5KSAC 1GOHA 4P48A 4L5FH 4HIXH 4WUKL 4Y88A 2Q8XA 3LSOB 1QKZH 4JGMA 3X11B 1D6VL 4F33A 3HC0B 4CVZB 4HD9A 4OZFA 1KCUL 1OGTA 1C91A 1RUPL 2B5IB 1G84A 2NPLX 3VXQA 4AY0A 2R56H 1B88A 4GAYB 3E6FA 3DX2A 4IMKC 1IAIL 3HNSH 4HPYL 1W72B 3SO5A 3VXSB 2ZPKL 4YAQA 2M26A 1W32A 4KDTA 4I1NB 3F5WA 5IEHB 1C8QA 4NO3B 2WZEA 1CS6A 1TVBB 4H0IA 3MC0A 1IAOB 1BP3B 1TUXA 4I0PA 1I8MA 2LU4A 4MQXC 3C6LA 4N8VB 1F58L 5E4EB 4M02A 3VFWA 4NGHH 4G42B 4GPNA 3AIRA 1YDPA 4M61B 3IDMB 3MOAH 1U8MB 4XCNA 4ZDHA 4XBEH 3O0RL 4G6KL 1H49A 4H25A 4JQXC 1RV6X 4ZXBA 3QIWB 4LOUC 5ESVB 1EV2E 4CW1B 1MHEA 2D7QA 4PREB 1PEZA 1V7MH 4PLKD 1TVHB 1BM3H 4HAGA 1V0LA 5EU5B 3BKJL 2LTQC 5C0DB 4YE4H 1PPIA 2EDLA 5A16A 5HYSG 2BNQA 2GTZA 3FAXA 4JHAL 4O2EA 3DGGA 3ME0A 3QEQB 4Y2OA 1RY7B 2J8UE 2Z31A 3MV9D 4L4VE 3C5SB 2IUZA 4UFKA 4CN1A 4UOQA 2KBGA 4XPBH 5INDA 3PZMA 1QUNA 4LRNH 2EDKA 4L4OA 5K9QI 2H26A 1I1AB 2VXSH 3NCFB 1U3HB 1A2YA 1KELL 3C09B 3K2MC 3MNWB 3SO3C 4XNYH 3UTPD 2VAAA 4XWGL 3D69B 4OJFH 5JUVA 1NGZA 5EIIA 2WC4A 1OD7A 2W9EH 2YZ1A 5GGSA 2OSWA 5DD0L 1CXLA 1K4DA 1CGUA 5C7XL 5HHPA 4R4ND 3T0VA 3BRGC 2NZ9D 1AI1H 3OG6B 5E8NB 4PJGF 4NRYA 2NXYB 3DARA 2OYMA 1UZ4A 4M6NH 1OPGL 3MOBL 2A9NH 4KK9C 4UUJA 2AEPL 3QUKB 3H9SA 5GS1A 2DQJL 2Y1VA 2PBOA 5FOBB 3AXLA 3U7YH 4PJAE 5JHDE 4ISVA 1YY9C 4YHML 4APQD 3UR8A 1JWUA 1IC7H 2F7OA 3DTXB 4FNLH 4LSVH 4RFNC 4UBDD 3S88L 3AIUA 2H6PB 1KIPA 1OAYH 4AQ1B 1KLGA 2FSEA 4DO4A 4RX4A 1HIML 2UYLA 2NXZB 1NCWH 1KCVL 3OKNA 3SDXE 3U30C 4MA3A 3GMMA 1DL7L 3PV6B 5F97E 1S9VA 5JQ6L 5DQDL 1U58A 3L2MA 3IDGA 4PRPD 5DEZA 3KGRA 4X8XA 1JDAA 2IPKA 4WNQB 4KY1L 1D5BA 4W5ZA 3REWB 4Y4HD 3REVA 4AENB 3PHSA 4HEPG 5F9OL 5I71B 5K9JH 3LPPA 4S3JA 1OW0A 4AH2B 3QUML 4YPGA 1Q9KA 4GG6E 3MRIA 4HXAL 2CLVB 1NCDH 2P8MB 4B53A 1SY6L 3BSZH 2W67A 4Q9RL 4AL8L 1GC1L 4AY1A 5I1EH 5EN2A 3SDDD 4CMMA 3ZDZE 2IGFH 1VEMA 4XCCH 5CZXC 5D7IE 2RAMA 4WJXA 3HNVL 5D1XA 4F37K 2ORBH 1R5VA 2PTUA 2YD4A 1OWRM 3THDA 2VLLB 2HMIC 3WF2A 4POZD 1S5IH 4ZSOB 4G9DA 2ZUSA 4L29B 1MFAL 1WCGA 1HXKA 1Z5LA 2Y5EA 5A6MA 5E2TH 5SX4H 1HXYA 3X11A 2WSKA 2WLYA 3NH7H 5LGKA 3G6JA 2VISB 4QHMA 5ERWB 1DANT 4ELMA 1A7BA 1MJJA 2E6JA 5KG9B 3GMNA 4JN2A 1T22B 1CL7H 3DPBA 3MLTB 5FGBA 1M03A 4Z2KA 3O8XA 1KTCA 2MFNA 4ELKA 2EZ0D 3VDCA 4PJXA 2XGBA 4XPHH 3QDMD 5D70L 4U1GC 1X5GA 4PJGB 4M4PA 3UYPA 2B39A 5L9DL 4RGNE 1TJHL 1RD6A 4R2GC 1EEZB 1YMHB 3LHPH 2GCYA 5KSBA 4AJ0A 1IEBA 5ENWB 2YBRA 5HHVH 4X5WA 1YEIH 3HZYB 3D9AH 3CHDA 4L8DA 4N0FB 3WFEH 2G41A 4YPJA 1H5BA 4UZGA 1A6WL 2B2XL 1H11A 4U05A 1WICA 1VKXB 1JK8A 5D9SB 5MEND 3HI5H 4I0KA 3GB7B 3SCWA 3U2SA 3G5XB 3AB0B 1E6RA 2WZHA 4HUKB 4R27A 3DURA 2GDVA 1OCWL 2BX5A 4ZAKA 1IGCH 5GS3A 5FYLE 1PS3A 4QOKE 2O9TA 3QDGB 4HJJH 1LEKB 3FQXB 1M6OA 1YEDB 5BXFB 1WEJH 2HG5B 1EA9C 3ZYZA 4PJFA 1MFCL 3CDFA 4WCYH 1A3RL 4F9PC 3MS8A 1CGSL 2D03L 3RL2A 3F6LA 4DAGL 1E4KC 4JFEA 3IXTA 2BY1A 5CUSH 1PKQE 3F7PC 2OYLA 1RP9A 3NSMA 2WHKA 1KXTB 5HVHB 1CD0A 2O9OA 1W9XA 1XSIA 3VIJA 2UZIL 1ISXA 3IDXL 1UZ8B 3MNWA 4HFWB 1OARH 2MOVA 4D9RD 4HG4J 2IAMB 4RGOH 1FP9A 3T3PE 3N0PB 1IKFL 2NY0D 3EJTA 3S37H 2ZOXA 4IIQB 1KN4H 5F7NC 4Z77B 2BFVH 4FNTA 1TE1A 2WVTA 4Y2DA 3G5VB 3QAZC 1FSKB 4BF7A 3A67L 3T0XA 1RP8A 1ISWA 1CLZL 1BFOB 1RZIB 3P3YA 5IEKA 5T33H 1BVNP 4MQ7B 4M93B 4R26L 4X7SH 3ULUH 1ZTXH 1FLRL 1PY4A 4EKXA 1MFVA 1GGIH 1HHKA 5DJ2B 1FIEA 2Y25A 3HS0B 2YDQA 3V4VL 3PDOB 2OSYA 3GSRB 1IARB 1VGKB 4OQ1A 3P30H 4KKCD 3X3FH 3F7QA 4NBYB 3SKOA 1KJ2L 2FYYA 1CE6A 3LMJH 4KUCF 5SWZE 3SY0B 4JFFD 1T3FB 2ADIA 4KRPD 4JG0H 2BSTB 1TTUA 8A3HA 3PQYE 5JOFB 4PMYA 3D87B 3I02A 2FX8L 2BDNL 3TONA 3BKMH 3EDKA 4NT6A 4HBCL 3TEUA 2WWMC 3LPOA 4ZPTB 3LEYL 4XNXL 1QX1A 1N59B 2WKLA 1P7QD 3DRTA 3EHBC 3IK2A 3RKPA 2W0LA 1HEZB 2HKFL 4XPTH 4PUBL 4XZBA 3BAIA 5JBDA 1MEXL 3V8OA 3NMEA 1NGYA 3CTTA 4P2RA 4MNJA 4Z7WF 4PGJA 4M6OL 3F7VA 1CCZA 2ENYA 3S34L 2F8VA 5B8CB 3OZOA 3IF1A 1TJGH 4PGBA 4L29A 3RQ3A 1JZ5A 2BVTA 5E99L 2HTKC 4HKBB 5CP7B 3RTQB 3L3JB 3BDXA 1QRKA 3RVTD 3H54A 4Q2ZB 4CD5A 1OD8A 4QTHA 4AG4L 1T4KB 1HHHB 1UB5A 2IEPA 5KG9A 3MMUA 4HH9A 1IZKA 1FAIL 3MLTA 3OPZL 2BC4B 1MAMH 3GSWB 2X10A 3ZDYE 3TH2T 1GQLA 4FQ1L 2QF8A 3LRKA 2GJZA 4YZFE 3ARXA 2PYFB 3LRSB 1XR9A 4FNUA 4LIQL 1BFNA 5HVGB 2CD0A 1IGYA 2R2HA 3QPXH 4HWNA 1K4CB 4FP8L 2UY2A 4D6DA 2BVQB 2P5WE 1QFWL 4P9HH 2P5ED 2QL1A 5T3XD 2PO6A 2NX5A 4BFBD 1WWAX 3GHBL 4G43A 3FOMB 4U6HB 3SE3C 5FGCE 5TD4A 2B1AH 2ITDB 1D6EA 1XZ0A 1W0VB 3KWWA 4ZFZA 4KQ4H 2YBTA 1ZGLP 2VLRD 3G5XA 2FZ3B 3EJYC 1QHOA 4PV9A 2P8LA 5DT1L 5IFPA 4NZJA 2Y2WA 4MVBD 3WF3A 4ZODA 4IDLA 5I16A 3GRWA 1KPRB 2VDMH 3MRDB 1Q1JL 1QBML 3U57A 4KVCL 4YHNA 2AXFA 5C3LD 4P99A 4XBPB 4F57L 4TULL 4OCRH 3W0WA 4L9LA 4MDOA 2Z91A 3ARDC 4CNIA 1AO7B 1KXTA 1SJEA 4JKWA 3F12B 2VUOA 4DOHE 2FX9L 2VE6B 3Q3GA 1DQMH 1MI5A 1WK0A 1UZ8A 4JQIL 4DGIH 3RDKA 4JRXB 2DLFL 1NSNL 4NZUH 3H9HB 5DJXB 2VXTL 3EFDL 3MR9B 3GMPA 1HCVA 1QOKA 4RFEB 1KBBA 5GGVY 3HMWH 1HKJA 5L2KB 2F53E 1CBGA 4JDVB 1DEEB 1CF8L 3BWAA 1E56A 4GRWE 1UH4A 4FFVD 2H2SD 4XTRC 4JM4H 2R2EB 1BIHA 2Z8WC 1RIHL 4M5YH 1XGUB 1KC5H 4U2YA 3CMOL 4AZ5A 3CZFB 1U8NB 2D31A 1B0GA 4QRPE 1N6QH 4GXUN 4HJ0C 3CFBB 3L4WA 3UCQA 2AEIT 3O4LD 4XPAL 1U3YA 2QHLA 5F96L 5F9JB 3UJIH 4RAVB 3VWJC 1INDH 3QNZA 1HHGA 1YY8B 1YQVH 1RU9L 1KJMB 4S1RL 3A3HA 1T3FA 4TX6A 4RAUB 2Q3ZA 3QIBA 3CVIL 2D9QB 5ILTH 3CXHJ 1FNAA 1GJIA 3OKLA 1CLXA 4NZRH 4HCRH 1UGNA 3IFPA 3GUTA 4M24A 4GUPB 2CR6A 2XKUA 2DAVA 4KROB 5GSRA 1H3GA 1YEKH 1ETZA 4EN3A 4GZJA 5KS9A 3N1GC 3O6KL 1WIOA 2NY2D 4UR9A 2V7HB 4P23D 3DVNB 3T0AA 1MJ7L 2AOSA 3MRLB 2J6EA 2XN9D 4Q9QH 1CEOA 1FV1B 2IMNA 4XP5H 1HK6A 3CZ8A 4F9JA 4P59H 1U2HA 2YPKA 3L5HA 3SN6N 4JAWA 4J12A 5DWUH 1I4FA 2BY0A 3JTTA 5KVDL 4LEXH 4OLUH 4Q7NA 4G9FD 4H1LB 5D8ZA 4Z5RB 3C6SA 3HB3C 1KT2A 1NGQL 4JZJB 4M1DL 4PRNA 3ULUD 2P7TB 4OZGF 1WIPA 3PWPA 3TV3H 1WAAE 4HUVA 4HKBA 3BQUC 4CVUA 1X7QB 1XR8B 3G5YA 3LKQA 3U4BH 3VSVA 5CJXC 1F6LL 2EDTA 2DDQL 2X4QA 4UT6H 4YGVA 3EYSH 1HINH 1AJ7H 1DFBL 4HZLB 4FNPA 1T5XB 1TQWA 1T4KA 4K94C 3DXAD 3AMGA 5FL0A 4A6YH 1FIGL 2Q76A 4X98A 5T1LB 3QG6A 5DZOA 2AJUL 3NCJL 3W9EA 5FA3B 3STLA 1HTYA 4X8JA 5F7KC 2DTMH 4WEUD 5DO2D 1U8OA 4YHZL 1PG7X 1J8HE 3MJ9L 1JFXA 5H94B 2EDYA 2EYRB 4R9HA 1B3YA 4OGZA 4XAWL 1OF2B 4FQCL 3NFNA 2XZCL 5J57B 1MSPA 2D20A 4H7VA 3K80A 4I13B 3QI9D 4G6FD 5F9DC 3D1MC 2GTWA 4YHYB 4GS7B 4WEBH 3VWKC 4OZ4A 1LK3L 3FOMA 4XPFH 4MNGA 3W9DB 1HSBB 2WVSA 4BCEA 5FM5M 4W85A 5BVJA 4ONHA 1UR9A 4NUJA 5IVZA 5TPWH 5FUZL 3CU1A 2EIEA 3TH4T 2FZ3A 4WSKA 5IW6B 3BEVA 1WZ1H 1AHWB 2V5TA 4WWID 4Y19A 3GSQB 1D9KD 2BS9A 2DKUA 3AS3A 2VB5A 4Y4KC 2J7LA 4F8TA 5DUBB 2HLFC 3L5WA 1S3KL 1QRNB 2QSQA 4OIIL 4QWWC 4XNZB 3U0TA 3HI6H 1N2RB 3QUYA 3V0VB 4MAYA 5FCUL 1RJYB 1US3A 2XUCA 4RDQF 4K9EC 4CKVX 3V6OE 3SKJH 5HOSA 4X6CE 3QDAA 4UOZA 1S7TB 1ADQL 3F12A 1EMTH 2FWOB 4MAVA 1YPZA 2DQEH 5C8BB 3JV4B 2WCSA 4GMTH 4OZGB 5E6ID 1N64H 2W9DH 1ONQA 2YRPA 3LQAH 3VH8B 5F88A 4PJ9D 1U3ZA 1DLFL 3MRQB 3VIHA 1S7QB 1BFTA 1NLBH 5DC9B 3W2DH 2ZWYA 1XSKA 3MRBB 5CFHA 5FHAH 5BRZA 4KC3B 5KW9L 1WTLA 2DQCH 2L7UA 3MV9E 3RGVB 5KANG 4GQ9H 1DDHA 1CYGA 1F4XL 3P9MB 1HP4A 1I9RH 1NAMH 5DJAB 1A7PH 3UC0H 3LDBC 2E8ZA 4C7DA 5LA1A 3T0EC 1OB1B 1RUMH 1RZKH 4NQDD 1UKOA 2BNRB 3CZFA 2VLKA 1H3XA 1NDGB 5HHMB 5JOEA 2VXUL 2J25A 2CUIA 4Z2LA 3FB8B 3ARGC 4ODXA 3FT3B 2NTFB 5GISH 4KV5E 1M4KA 1YY8A 1PZUB 1KJMA 2OI9C 3GBNH 1U0QA 1JHKL 2D0GA 2J88H 1EHLH 1T5WA 3TZVA 4Z7UF 1MCOH 2Z4QB 3VE0A 3B9AA 1MHHA 4HPOH 3U79A 3NFSL 1BYDA 5I0DA 5HPMA 1OWQA 1TIUA 2JIXB 3U6RA 4S2SB 1YNLL 5EO1A 1S9WB 2H3NA 3DVNA 3ALXA 5I23A 3MRLA 3MROB 4XP1H 2VRKA 5D7SL 3SCOA 1I7ZA 4JG1H 4HBQA 4X5XB 3WO4C 4JM2C 3BLKA 1FZMB 4WHTB 3Q5OA 3RIFF 5DFWH 2XWTA 1OL0A 1AIFA 4KKLD 4FHBD 2EPNA 4PRPE 1M71B 3OHXA 1CDIA 4JZJA 3HE6A 3ZKMD 5DD6A 2ICEA 4WI3A 4JVWA 5BXSA 3L6FB 1FL6B 4JRYA 3O2VL 1BWMA 4BQ3A 1NQ6A 3ROOB 1F90L 1AY1H 1BZ9A 3RPIA 5E9DA 1MWAH 1R5WB 4X83A 3VXMB 4WKHA 4I48B 3WQVA 5GGRY 4NCC1 1A22B 1L0XA 1UJ3A 5AWNL 1QW9A 4LQFL 3MRHA 1TVPA 5HPCA 1T5XA 5IXEA 5I8CA 1MVFA 4AMXA 1A02N 2Q8BH 4D0DA 2WHMA 1L6ZA 4MAZA 2JE8A 4ETQB 3LS5H 5SX5K 1EEQA 1XGYL 3FFCA 4TRPL 2ZUMA 3VIMA 3S36H 3S5YA 4JO4H 2FB4L 4OM1H 1QQDB 1G9ML 4F15B 2O5ZH 2DLIA 3BUYA 4ZFOA 3WUBA 3FZUC 35C8H 3IDYC 4Y4FC 1RIUL 5D2NE 3U30B 4XVTH 5E2VH 5EZJB 2EC9T 3BC9A 1QFUL 2FBOJ 1CICD 3ZL4L 3VRLE 3L4YA 1A64A 2Z93B 3QO1B 3W9DA 5ID0A 3JWDC 4R5EA 1QLRB 3KVQA 3QDME 5GRVK 1XGPB 5MI0B 5C0BD 1TENA 4K3JL 4OCWH 4Z7UB 4UTBL 4QRSA 3WH9A 3FB7B 3PDDA 3U36A 1A4KB 5FIPA 3MLSL 1ODAA 3JWOL 4FXKA 4WW1B 3CHFA 3ZO9A 4RSVA 4XZUA 1MF2H 4YBQC 3EUUA 3SE4C 3QUXC 1JP5A 5EG6C 1KFWA 1I1FA 2FJFA 3M8OH 3VG0L 1P7KA 2AJXH 5MENE 3BE1L 3T04D 3BPOB 1FYTB 3RDTC 2C3WA 1IGIH 1INEH 2ZUQC 4PJIE 5KSAA 3FB5A 1IC1A 3JV4A 3GHEH 2GDUA 3ECQA 4WHYH 3ZLQC 2ZKHL 4UB0H 7CGTA 1F3RB 3S5LA 5IESH 3QG7H 5GRZA 4OSUL 3S35X 4D2NA 3SUVA 1V6VA 3MGAA 1Q9LB 4E2OA 1RURH 1FAKT 4IMKA 4JO3H 5E24E 1AQHA 5I1AB 3QDHA 1JZ7A 5ANME 4KK5C 3A24A 2AKRA 4U1GB 1BSIA 5DJAA 3LB6D 3WJJC 2YLLA 3VIFA 1EFXA 5I8EB 3TV8A 2X4OB 5ABFA 3BEWB 3P11H 5KVGL 1OB1A 1ZA6B 4LCCC 4D9RE 3BKCL 4JDZA 5MP6L 4EUPH 3IS1X 4WW2A 5BZWB 3SDAD 5IQ7H 1J1PL 1WSST 4YDKL 1U95A 3DX9B 4PRHB 3FT3A 4X99A 3QFDA 2BY3A 3ETBF 1G7JA 1GZQA 4JQXA 5JPMB 2MHAA 3VXUD 4KPHL 2I24N 4HTYA 3CDGA 3ZSTA 1Q6GA 4PR5B 1UJTA 3CFKA 1NBVH 3TO2A 2VT0A 1NGWA 5J7CC 1GNXA 5DD5L 3MQIA 1L7IH 4LCWD 1KXVC 2AAVA 4P49A 4S2SA 5MHSD 2F5AH 1MJ8L 4PGCA 2V5CA 1KB5B 1MCPH 2R0ZH 1QLEH 4DQOH 4D8PB 3QYCA 4C56B 1FJ1A 4JFFE 2VDLH 1W72H 2FGZA 1UENA 4CD8A 1B6DA 4PRIB 1FFOB 4DO6A 1SMDA 3WY1A 2HJKB 2AEQH 3PGFL 2YL6A 4XV0A 4W86A 3V2AR 2YEZB 5CBAA 4UQ2B 3PG2A 5ITFB 1CE1H 1H15A 4LVNC 4OLVL 3GNPA 1RJLB 1FFNA 3SUUA 1UZ6E 2W65A 2XM1A 2XG4A 3BOVA 1MCBA 1RI8A 2XWBB 3VXMA 3UG4A 2P4AB 3VFNB 1HJUA 2DICA 4UV7L 2PXYC 4HWBA 4NM4L 4IOFC 1BZ7A 1IC4H 4D72A 5I0ZA 1QSFB 4M6MH 1DQJA 3MREA 3RWCB 3SCMC 3T65A 3HR6A 4EZMA 1PFCA 1MJUL 1QFPA 5L7XH 3M45A 3PDGA 4QXTB 5C0CA 3U4AA 3FRUB 4XVSH 2QLYA 3FONB 1KV3A 5A6BD 5DYOA 4N0RA 3TBWB 3AIQA 1QVOB 1B0RB 5D7LB 3MPCA 4HULB 2XG9A 3VFGH 3K8LA 5C0AD 5D1ZD 5FXCH 1EZVX 5I6XC 1Q72H 4WFGD 3GXIA 4MXWH 1LE9B 5DRXA 3V7AE 1WZAA 5I18L 3RUGE 3T8XA 3P0VH 4KI5D 4N42A 5HSFA 1WDPA 1IKNC 4KI1A 4NCDA 4P57A 5C6WH 5HYIA 3L3GB 3DX6B 2VZVA 2DMCA 3QPQC 3POHA 1XT5A 4DKFL 3E6HA 4UQDA 4YHKL 3L5XH 1LO0L 4H8WH 5ALCH 1C5BL 4NQCB 2B4CH 3FO1B 2R1YB 4YHOH 3C2SA 2ZCLH 4KKBC 1ZHNB 3AC0A 5LGJB 5GRUH 4Z7VB 4NWTL 1CXFA 1GORA 3GIZL 4ZXBD 3O9WC 4EVNA 1H2JA 4IJ3B 5KSUB 2I27N 2WINA 1H41A 3D25A 3T3MF 2VLRE 3H7LA 3QFJB 3D2UA 2BVPA 3KJ4C 1R3HB 3LN5B 3QUZA 1E55A 1M04A 3SKNB 2IAND 2NY5C 1OAZH 2IALB 4P4RB 2VDOH 3TJEH 2I60H 2A6JA 3BKYL 4BJLA 4OFVA 3D50A 3W37A 2N7AA 3IKKA 2AXGB 1HNYA 3QNXA 5I1JL 1QWNA 5F6IC 3LRLA 5I8EA 3A5VA 2WIIA 1LE5A 4E8CA 4BQ8A 2H8PB 3LRGA 1D6VH 1BQHB 1MCKA 1KCUH 1IMHC 4DJMA 2CDEA 2DJUA 1RUPH 4HUUB 2HKHH 1OSZA 4M43L 5HYJA 2XZZA 2MCPL 4OZIE 1CLCA 5EC1A 2ZPKH 2DDXA 1EAPA 4ML4A 1GAFH 3HKFA 3Q0HA 4KJPC 1A1MA 4WTWA 4YXKL 1L7TH 4Q97A 2CRMA 4X6DE 3TLRA 2VH5L 2B1HL 1W2VA 4UFHA 4Z2JA 5TF1H 4JFDA 4D71A 3O4LE 1F58H 3BO8B 4ZXOA 2LU3A 2A3HA 3R06B 1HQ4B 2APVA 4BFGA 4JFPA 2ZG3A 2NMSA 2NY4D 3U9PL 1SYSA 1A21A 4D8PA 1E72M 1V6XA 2MKWA 3P9LA 4F9PA 1CTOA 2DQFB 5D6CA 2G9HA 4LNRB 4PRAA 3LEXA 4PSRA 5D8JL 2BSSB 1AGFA 1E4KA 4OV5B 3D0VB 3O9NA 3UTSB 1J88A 1OTTD 1PVHA 4GZIA 3OQ3B 4ZXLA 1R3KA 3BKJH 2X4TB 4O2CA 1FVEB 4LLQA 4K8RC 4UQ2A 3CSYA 4J28A 4ZUSA 2VITA 4JZOB 5DRWB 5TE4L 3TBTA 1YYLL 2XN9E 1FRGL 1FOBA 3Q5YA 4Q7DA 2PYEB 5B39A 5FAAA 5I17A 4MD5A 4PJXF 4MSWA 3CSGA 4LSQL 3NCEB 5DFVC 2CKRA 3VFNA 3ZHDA 4NO0A 4G9FE 5KSBF 2M2DA 3H3KA 3KPMB 3LN4B 2NNAB 3FW6A 2F7PA 1IGML 5IDIA 3HG1E 2XNAB 3JTSA 3ULUE 1UYQA 4P7LA 2GJJA 3RPMA 5GIRB 5SWSA 1X5FA 1T2XA 4GZEA 4ZUWA 1KELH 4U0RB 3HHRB 5KN5B 4OF5A 4Z95L 4U6XA 2DQUH 4XWGH 1BYAA 5E00B 1R34A 2IPUG 3MFFB 4QXTA 2CKSA 5CWSB 1B2YA 1JXKA 5FB8A 3QXUA 3VWJB 1HH6B 1U41A 4HWZB 4PJ5B 4WU7B 1B0RA 3O8XD 4PV8A 3QEUB 3DXAE 3VXSD 1FO0B 4CBPA 2ZX5A 4YHGA 2F19L 4F37F 5FO8B 4UFLA 4X7DC 3MO1A 5D8WA 3UTZA 4O51A 2IGTA 1OPGH 5C08A 2HFFB 5D2LE 2DQJH 1RJCA 5E94A 3QXDB 3R8BB 4U1LB 4I5BA 4PJFF 5EWIH 3NPZB 3VXRB 3VDAA 4F66A 1ZT1A 4YHMH 4X4ME 4JO1H 2ADJB 3S88H 4ZUUB 1A6TB 2AV1A 5HYQA 2WNWA 3PZUA 2QADC 1HIMH 1HHIB 3NABL 3OKMA 2PTTB 5HGAB 2PUQT 5EOTA 4EXKA 3QIWD 3VD4A 7A3HA 1MY7A 1XGTB 1C08B 4JFXB 2N56A 1K6AA 2PWFA 5H35B 4PP1D 5CLWA 2R2CA 1AKJB 1D5XB 5I8OH 3EO1B 4PG9A 4UQAA 3CH8A 4HXAH 3MSDA 4MCZB 2EXOA 1SY6H 3WFBL 4ONFH 4OT1L 4FFZH 5ESAA 3TT3L 3EOAB 4AL8H 3DX3A 1Z3GL 3LMYA 1L6XA 4XGZB 1Q0YH 1JGLL 1KGWA 3HNVH 3BAKA 5I66A 5EZIL 2RGSA 1M1SA 5T5NG 4NRRA 3QDJA 5DFTA 4HX1B 1CLVA 1AP2B 2YXMA 2NY6B 4ZUVA 3T2NH 4NZTL 4YHLL 2CNCA 3INUH 1U3HD 3KL0A 1NFDE 5K59F 3NCOA 2O61B 1LO3H 3PJSA 4X6FA 3B5HA 3OBAA 4HK0B 5KEZA 3HNTL 1OHQA 1VFUA 3V79C 1FVDB 3UBXI 1BQHA 4Y2DD 4GRLB 3EJPA 3WL0A 1PZ5B 3VI3E 3DYPA 4HPGA 5D7KD 4YFEA 2NXYD 1JAKA 4LLWB 3IFLL 5HHNA 4Z2IA 4DGVL 3SE3A 3BAYA 3PWVB 4F7MA 2Z8RA 1LQ0A 1ERNA 3EMZA 5L9DH 1OAQL 1OP5K 1W0WB 1F3DJ 1TJHH 4RISH 2I26N 3AXHA 2FGWH 1KBGH 1BQLL 4M7KH 4DCQB 2YD6A 4NQDE 5A3IC 4FZEL 5B38B 5T1DH 5LA2A 4PMDA 2NXZD 3UTQB 2E7CA 4BSWB 1A6WH 1GONA 3LKRB 4LHJB 3HLAA 2WBGA 4P5TC 3GMQA 3O3BB 3SGJA 4LNRA 3L3KA 3W81A 5F6HJ 1BJMA 1CGYA 2E5EA 4NXKA 3D0VA 1KIRB 1OTSC 1QI3A 4B16A 3ARDA 2QKIB 3KPSB 2J5LB 2GJ6B 4N5UA 3ZJ6A 4XXDB 4K7PX 4R0LC 3LEVH 3DHUA 3C60B 2R23B 1OCWH 3VIPA 3GRWL 1F4HA 5IVXE 4AIOA 5HDRA 3FNDA 5F7HA 3QRGL 1Q6FA 2PR4L 2CDFA 1JGEB 5IR1A 3CFDB 5EOCL 4P2RD 3FO9B 3CUPA 1G01A 3WKMH 1A3RH 1YECH 2XWJB 2RHEA 3MLZH 2D03H 4KK8D 1C7SA 3V6OC 5AZEH 1L0YA 4M7JH 4JANB 1YMMB 4F58H 4UOW1 1U2YA 5E2WL 2CSPA 1Q0XL 1K9DA 2UZIH 2O5XL 4Z0XB 3T0EB 2QPSA 1HQRB 3BWUC 4OM0L 3L4ZA 2E9MA 2FHBA 1FG9C 1RZ7L 3MRFB 5CINL 3QCTL 3IS0X 3RL1B 5IW3A 1IKFH 5CS7A 2WMJA 1T1YB 4KMQA 2ZJSL 3VWJA 2Z1KA 2OI9B 1BBJA 1E73M 4JJHA 1QLFB 2Y24A 3PZIA 1DQLL 3KR3H 5FO8A 1ZK9A 1J01A 4R26H 5DJ8B 4ZO8A 1K9TA 1CFQB 3LKOA 3DECA 4GKLA 3OB0H 4QCIA 3AIBA 3GMOB 1J1OL 3FN9A 3V4PL 3AIWA 4N0CD 4U1LA 3V4VH 4B3KA 3PZNA 2NX5D 4P2OB 1KJ2H 2BRRL 4I3GA 1UH3A 4QF1A 4JM2B 1HHIA 2GK2A 1A14L 3WUGA 4X80L 4RZCA 4R7NA 2EYTB 4OGAC 2PTVA 4GAJH 3RU8L 1C08A 1SEQL 4OD2B 3IAPA 5DD1L 4JFXA 4XBGA 1NKRA 2IH1B 2D7NA 4RMUA 2J6EL 4I2XA 2J7GA 3TBYA 4APQC 3LEYH 1R3IL 4BH7A 4UIKH 3BQUA 4G8GB 5JO5B 4ATWA 1J11A 4N8CL 4WO4C 2EIZA 3WDJA 3MA9H 2APTA 4E42B 2X89A 4G6AD 5HHQA 4PUBH 3W27A 3DV4A 5I1LA 5KAQF 2X8RA 4EKJA 3TNMA 3OLEA 3O6ML 1P5UA 1IZJA 1XGRB 1U9KA 2CIKB 4PBXA 1FFPA 3HG5A 2J8FA 2XOTA 3IDNB 3GMRB 3V8CA 5E99H 2WP3T 3V4UL 1DCLA 2OP4L 5HI4D 2IAMD 3WHE0 2FX7H 4FFWC 3ZE1F 3LD8C 2IH3B 3PWJA 4KRNA 4PJDE 2EC9U 4QCEA 2F9BT 5TDPB 3IDYB 3MMWA 1UKQA 3AHYA 4D0BA 1H0IA 5DZNA 1CFNB 2DIJA 2BVUA 3GSXB 3VFSB 3KYNA 4H1LH 1FAIH 5HGHB 3OPZH 3VWKA 1JRHH 2QQNL 1IL1B 1X5LA 5FYJL 4NUGL 3O3AA 4FQ1H 1WZKA 4TPRL 4N90D 4H8HA 5E6YA 3LKNA 1GGUA 4LIQH 3THML 3SCRA 4KMTL 3O6FB 2ZE0A 4GMSL 4J8RB 4MPKA 3WLWD 4D3CL 4Y5YC 1QFWH 3VFTB 3MLWL 5F72S 4Z78B 4OCXH 4Y4KA 4UQEA 2AGJH 5I2IB 3GHBH 4KU1A 3RVUC 1IJ9A 3GO1L 2ARJA 4XH2B 3VXUE 1A3LH 1MLCA 4EI5B 2ZUQB 1DJSA 5FIEA 2MANA 1CFTB 4LCWE 4EDXB 5MHSE 2A74A 5GS0C 1RHHB 4AZBA 2VX5A 2FEDD 2W60B 5IFHL 2QBWA 2ZSVA 4L1HA 1P84J 1QBMH 4FQXC 4ACZA 2OSLB 2HT4D 1BGAA 2WC7A 3S4SG 4F57H 3NTCL 1XV8A 1N6UA 5HVWA 1I9IL 5A2FA 4JANA 4M5ZL 4MJIE 2V5RA 4PGDA 5GGSY 1UWEL 1QHPA 2FX9H 5DHVA 3RTQD 1HL9A 1U6AH 2XN1A 3GYCA 1YN6B 3L3HA 3BHBA 5C2UB 4JQIH 4LCCB 3ARFC 2IC2A 1FPTL 1MFNA 2YL9A 1S7UA 2VXTH 1JL8A 4CDGC 3KNBB 2D9CA 3EFDH 2BY2A 1O7AA 1UYWL 3ARGA 3KXFE 4KTDH 4UT9L 3CDCA 1CF8H 1WVZA 4CU8A 4OCMC 1OB0A 5D93B 4N1HB 5JA8B 5T5FH 3TNNB 5FO7B 1G7MB 2DWEA 5BV7L 3VNZA 1P4LB 3K8KA 5E0QA 3C9NA 5GGUB 4WDIA 1ED3B 1MRFH 1VHPA 2QSCH 2JF6A 4U6YA 5BXRA 1S78D 4UI2A 2ARJQ 4XPAH 4YGAB 5IK3B 4QRQB 3K81A 3SBWC 2FE0A 3GK8H 4I3RL 1N4XL 5JIHA 3W26A 5ID1B 1JMZA 3JZ7A 3SKMA 3FT4A 3NIGF 4JM2A 4S1RH 3RJQB 4LYPA 5BO1L 3WQ5A 5C0AE 4ZTOH 1E15A 1MH5B 1YPZF 1S9YA 3GBMH 4IRJC 4WFGE 4BSVB 1J0HA 1CZ1A 1K8IB 4ZTPH 3DSNA 4C4KT 4KI5E 5KVEL 2X7LB 1BBDL 2VR5A 2Q86B 4XHJD 4YO0A 3CX2A 4B3LA 1ZOXA 1KQZA 3QGVA 3DX0A 4DZ8A 4JREC 3NPSB 2QR0A 1FN4A 5A2KH 1D5IH 2J8UA 1XH3B 1DWGM 4KRPC 4L4VA 4E5XB 5I15L 5DJCA 3QUYD 1JGUL 5CD5C 4MAYD 3QBTB 2PXYB 4POUB 3AZRA 4GFTB 4LSSL 4U4BA 1L9NA 4JR9H 3OKKB 3T4AA 4J1UA 5SX4I 2AVGA 1U92B 1I1XA 3WIHA 4JZNA 4BQ5A 3SCMB 4U2ZA 3WDHA 4JRXD 4TUKL 5T1KA 4XMKH 2BOCB 3KPOA 1CL7I 2IANE 3W39B 2A83B 5BRZD 2IQ9L 4Y4FA 4Z7OE 4PJBF 5L2KD 3IVKB 1T66D 4CCCA 4Y0GA 1CFNA 2R15A 3WHE1 3KWXA 1JNLH 1FIGH 1HHJB 5HGHA 3EZJB 1ZHBA 4L4JA 4I77H 1G9NL 4GSDL 1P2CA 1IL1A 3HPLB 5L88L 1I1RA 4PJCB 3ULVL 4JFUA 1MAJA 1N0XL 2BJML 4PSPA 2C7UA 2FIKA 2Z92A 4PJAA 4ZFOL 3OAUH 5JHDA 3DIFB 4HG4K 3UCRA 2EO9A 3PZ9A 3X3GH 1BF8A 3BI9X 3RVTC 4XAWH 4X7TA 4AMKL 2XZCH 3SDXA 4GXUM 1EH9A 3DRQA 5TQ0L 4DWSB 1SYVA 5IWLA 4KRMB 2MQ3A 3EBVA 3C2AL 4XXCC 3QUXA 3O9WB 3MRGB 3BH4A 4LVHB 5I2IA 5EU7C 3QEGL 4WVRA 2XV6B 1E27B 3CX5J 1LK3H 2HRPL 4NFBA 1BFVL 4YBHA 1YC8A 5DK0B 5TGBB 3Q1SH 1FBIH 5JW4N 1ZLUK 3RWEA 3QIUA 4G6MH 1XEDA 4TVPL 5AG8A 1W9PA 3RDTA 3EOTL 1EDTA 1YJDH 1VADB 3U7AA 4GG6A 4CKQA 2DSUA 3BPCB 5FUZH 2CHNA 4G7YL 1VJSA 3CZGA 5J4MA 1IRAY 3V7AG 1O7SA 1OAUL 2Y6SC 3G08A 3IGAB 2NW2B 3JUZA 5EZOH 5D7IA 5BVPL 3UPRA 3W29A 2OTPA 5IV2A 2MQ0A 3B2VL 4MX7B 3WF1A 2ZOKB 4OAWA 4DTGL 4ZYKB 1V3KA 3ULVF 5FCUH 2CETA 2OJZH 4PTTB 1DQQA 4EEEA 4S1QH 2Y72A 1IQDA 1NQBA 5E95B 3WJJA 5D7JA 5BV7B 1KLUB 3C5JB 3CGTA 1UA6L 1K5NB 4P2YA 2FL5B 4WJ5B 3BP6A 3GSUA 3VX1A 4W4NA 4LSRH 4LKCB 5CJBA 2V3GA 3KNBA 3WBAA 3BXNB 1G0DA 3EOYG 1G9HA 1MVUA 5T1LD 2A0LC 4PJBB 1B3ZA 2X4UA 3RM4A 5J12C 5I1IL 1UHVA 1YEJL 3P9WB 4X4XB 3WSQL 1U8LB 5ICZB 2E9LA 1EEUA 5GRVL 2DSWA 1UWUA 2X05A 4AT6B 3GJEA 1NCCL 5BW7C 2VXUH 5JHLL 3GSNA 5K9KB 1JHTB 4QNPF 4HIEA 4U49A 5HI3C 2BMKB 3CVHL 3MJ7A 5ICXB 3NFPB 4BKLB 4JHWL 5I1KL 3OLIA 5F1IB 1GZJA 1GOFA 3F8UB 3VXSE 3F7YA 1JHKH 3B43A 3MRKB 4HS3A 3WN6A 3HZ3A 3U1SH 4JGUA 5DVMA 1U8IA 4MDJB 1ZT7B 4OF7A 4JN1L 4DM1A 4PB9L 1C1EH 2JK5A 2D24A 3T1FB 2UWEF 2V17L 4OBSA 2LABA 4MXVF 4QOKA 4NM8L 2XN2A 3AXIA 4NP4L 1LNUB 1YNLH 2Q86A 3WD2A 4PGEA 4HH8A 4U6VL 1S7RB 2XYLA 5M95B 4OIFA 1GGCH 5IB2A 1QRND 4OB5L 3D3VB 5DHXB 5C0RL 4B9YA 1A7NL 4TYUA 4TVDA 2DKMA 3WUWB 3MUGA 2PXYA 4J4PD 5AY7A 4WW2F 5KSAD 3MUAA 3HRPA 3KPNB 4E0RB 1KYOK 1IGFL 4OIAA 3AREC 4K7FB 4A2MA 5F6HI 4M4RA 5C9JA 5I30L 4TOQA 1Q9OB 1F90H 4U5IA 2DWDB 4KH2A 2FR4B 2APWA 4ODWB 1E1EA 3EGSB 1KB5H 2AAAA 1TMCB 3BVWA 4YUEL 1SJXA 3QEQE 1OCQA 4YFLI 1V7NL 2Z8SA 3Q6FB 5AWNH 3RGVD 3PHQA 4WUUB 2DD8L 4HA1A 2GJXA 1NUDA 4MCYB 1OWWA 4TNWK 5GJSL 4CADA 4XCFL 1EFXD 4X7FC 4PJCA 2OXGA 1IKNA 3MU7A 1JPTL 4UZSA 3AM8A 3V5DB 3A23A 1FLTX 5DI8A 2BNRD 4TUJB 3WNNA 3VFVB 5HHMD 1YEHL 4MQXD 4RFOH 4YNYB 4C83A 2C26A 2EIDA 3MX0A 1W9DM 2VDQL 5B3JF 4LVOC 5IBUB 3OZPA 5SWZA 1KTKE 1BAFH 1WISA 1MIML 1TZGL 3PQYA 3BH9A 4P46A 1NM9A 3ZL4H 1UQSA 1RZFH 1UWIA 5IJKC 4NHCL 1JYNA 1CENA 5DO2C 1QSEB 4Y5XC 1WF5A 2JIXD 5EO9A 1OLZA 1GJUA 1PAMA 4EE9A 4W6YB 3MRJA 3O2DA 5FUCC 2UWEB 7TAAA 3BYTA 3GXTA 4MMXC 1YN7B 5HHOB 4GKZB 3CUGA 4HA3A 4KGJA 2NLJB 3VG0H 3RVVC 4QRTB 1BD2A 5DJDB 1JN6A 1P7HL 4NSKB 5JUEH 1I7TB 3VI4E 2EDBA 4PS4L 3WFDL 1EGJA 3WNLA 4XVJL 1QFWM 1ACZA 5B22A 3AMCA 1QI0A 3ALFA 2FL5A 3P0GB 4WJ5A 5I77A 3VXMD 1OAXH 2WUBL 2ZNWA 4Q6IC 2DLEA 2UV3A 3QNYA 3CVHB 4NSBA 1MLBB 5HYSB 5FYKL 4AIXA 2JIEA 4GOSA 5DR5L 4P2QB 5F9WC 1CD1B 5A2JH 4KK9D 4ZSOE 1CGWA 1MNUL 4KAQL 3QH3B 1GHSA 1QP1A 4PBVC 3BD5A 4I4WA 5D1QC 1DUZA 2YL5A 1YY9D 4X6BA 4HUXA 5KVGH 2G3NA 3SE8H 3BKCH 5MP6H 2ICES 4ODVH 2Y36L 3HC4L 4B5EA 4AD2A 2CUMA 4AQOA 4F7CA 4YDKH 5FECA 1FG2A 3B3IA 1GHFL 5ICXA 3T4YB 3G04B 1W3KA 2ADFL 5DMGC 3QQ3B 4H0HB 2V7NB 3FQRA 5CIPB 1OVZA 2W07A 4PJGE 4KPHH 1J0KA 4F3FA 5FDYA 4MNKA 4KQ3L 4LLUB 4R0LB 1KR1A 3DUHA 2K1MA 4V2BA 4Z7NF 2K7PA 4HHAB 1BVLA 3VW3H 3GZAA 2LE9A 4IOIA 1MJ8H 1RUQL 5E09A 5ISZB 4HOXA 2R9HC 1MXGA 5ELIA 5ACLA 4RNRA 4DN4L 4JPVH 4TSBL 3UJTL 3KPRB 1T03L 3WUEA 1E0OB 2B7DT 3MMEB 2HMID 4FZ8H 5F70A 4PJHB 4QKXB 1F2XK 3EYVA 1X1NA 1UXWA 1TA3B 1JPFA 3BZFB 1MOEA 5IHSA 2DMKA 2X1WL 5CILH 3D2UD 3KPNA 5E7BA 4HKZB 4IS6B 3RHWF 1MHCB 4TVSa 3ARTA 3QDGE 1S7SB 2GSGB 3HAEB 9CGTA 3HTLX 1WTGT 2D23A 3UO1L 2RIKA 4NRXA 2FR4A 3EGSA 4C7GA 5FKAA 2D7MA 3UBXB 4AEIH 4Z2HA 2F53A 4TTDC 2H9GA 5D5MF 3GXDA 2L4OA 5J1TC 4KKLC 4JPWL 1NBYA 3RWDB 4UV7H 2F1AA 1PX3A 1W1VA 4FQJL 4NM4H 5IM7A 3KG5A 3EFFA 1V0MA 4R2GD 3TBSA 1QBLL 1ZU8A 4LP4A 3AGVA 4NN7B 1HI6A 4QRPA 4J6RL 4HP5A 2VSCA 2ADGA 1MJUH 4F80A 3WKZA 2EH8L 2FECL 1Q94A 5DURB 5ITBL 2XZQH 4PRHD 3WS3A 3ZZ1A 1A6ZB 4NKOB 3JV6B 5GS2H 4PMNA 4L4TB 4HWEL 1I8IB 1P4BL 5JDSB 1A1OB 1RZ8A 5I18H 1WCQA 5AZ2L 1OP3K 1ZEAL 1T7ZA 4N90E 2D3NA 4OD3L 4DKFH 4YHKH 4JFDD 4WO4B 3S6CA 1C5BH 2Y9RT 3V5KB 2XSBA 5DQJB 5E5RB 5CZVL 5IHUL 4NWTH 3MI6A 4UDUA 3B2UC 3Q6GL 3GIZH 1UCBL 1M7IA 1FO0H 1MELA 4AIZB 3OKEA 1OSEA 2FRGP 1I3RA 3DMMC 1NGXB 2R4RL 1ES0B 4WHDA 3EO0B 1WAAA 3BD3A 4LGPB 2XIDA 4YFDB 4LGSB 1DBJL 3DUUB 1UVQA 2GSIB 1JNHB 3VM7A 1T04B 5FK9B 3DX7A 3X13A 3DDFA 3EMCA 3VO0A 2GW5A 1HH9A 1QACA 5CGTA 2CPCA 5E08L 3BKYH 3BRDA 4MAUL 1R3JB 3HRZB 4P3CH 2B20A 3VIIA 4Y5VA 2YWYA 5HBFA 2APBA 2PB1A 1QSFD 1CLYL 1J8HA 4X9IA 1Y6NR 4JFZL 5BCAA 2HP4A 3PGCA 1T83A 3V6ZA 1N8ZB 1U8HA 5FCZA 3L5JA 1AQDA 1DP0A 4OLWH 4PJ8C 3MNVA 3WCYA 4Y5YB 5IG7A 1KXHA 2XRAL 4XMLL 4QXWA 3NAAL 5D7LD 1B3XA 3UMTA 3T1WA 1DEDA 2XPKA 1FFQA 4J3UA 4M43H 4X4YB 3QQ9C 4P5TA 4HUMB 3FQUB 2X9XA 4EBQH 5CBEB 2CH8A 4MD0B 5GQBA 1RUKH 2JB5L 4XT1C 1UB6B 1EJOH 3T0BA 2WWMD 5T3ZH 3VILA 1XMWA 4NQEB 4YXKH 1YEFL 3MA7A 2XTJB 3SDAC 1JMXA 3EHBD 2B1HH 4NQCD 1C5DA 5CJOL 4OQTH 2F18A 1R33A 2DM4A 4LSUH 1RZJL 2E27L 5J1AA 1JUFB 4WENB 4ATDA 1OSPL 1WWWX 2AQ2A 1FZKB 3RAJL 2GT9A 2E9JA 3V6OA 5C0IA 1JFHA 2JELL 3GM8A 4X6CA 1KN2H 3VSUA 3WLBA 1QI2A 1UZ1A 2P46B 3OJDB 4U7SA 4TVUA 2AJYL 2HTKD 4O58H 4YEFA 1MCQA 3RWFB 3LQAC 3QFJD 1U8QB 3KLAA 1TZHA 1KWKA 1VFAB 2WM0A 5ALBL 4L8CA 2E7BA 4L3CA 1FRGH 2G2RA 3ILPB 4H0GA 4DFIA 1CZ8L 1ZHLB 4IBLT 5BQ7B 1I1CA 4GLRH 3B6SB 3CXDH 3MUY1 2OR9H 2D1ZA 1DVFC 3VGFA 3MV9A 1ZSDB 5CJQH 2XVNA 5IROC 1OIMA 3QDJD 4U1NA 1PYWB 1MW3A 4N8PA 4OTXL 1LD9B 1JZ6A 4K9EH 3HPJA 2X4RA 4K23H 1AO7E 4MS8C 3VRIB 3OV6A 4X9FA 1MQKL 1RZKC 2ARWA 2YK1H 3MLVH 4XB3A 3MZGB 3OAZK 4MHHI 4CJ0A 3GMLA 4JRXE 3GNMH 4TOYL 4Z95H 1HKKA 1ZXQA 4YBLC 2YUXA 5CP3A 3NCBB 2C8NA 3TBVA 4D6JA 5L2KE 1HJQA 3WIFA 1K3IA 3WF0A 3ULSA 2HFTA 3WS6C 3PWUA 1HE7A 2VNCA 4IRJB 3TH3T 1UG6A 2F19H 3IJ9A 4G3YL 3L3IB 2BOBA 4X9HA 4MJ2A 3EJYD 1W9VA 2OL3A 3HUJB 3BIAX 2M1KA 5EOQH 5IT2H 4NQXB 4APQA 1FGNL 3HMCA 4C55A 4IMLB 3D85B 1VPOL 1YA5A 2OTUA 5JORA 4JREB 4H20L 5A6SA 4IRSC 5DQJA 2R0LL 3AFBA 1RFDH 2W92A 4OLZL 4YR6B 1CXHA 1JFQL 1QOXA 1HKFA 3NABH 1ZANH 3MCLL 2X4NB 4PRPA 4CN6A 3UR7A 3MRNA 3ARDD 4HWUA 1A5FH 3TIDB 1S8DB 1EGZA 4Y4HA 2CJUL 2SEBB 2MJWA 2YA1A 2EPOA 4AW7A 1NFIB 1HCFX 3LIZH 2GK1A 2YC1B 4AD3A 4GW5A 4QGTA 2PYED 2PWDA 3QWRD 3TT3H 2ZOLB 3I50L 1ZA3B 1OBAA 1LGVA 4DFHA 4E41B 5FUOL 1ZHKB 4Z7QF 3VG9B 1EO5A 2F58L 3L4VA 1G7LA 5CMAA 5CJ5A 5EZIH 3L7FB 4XTRD 3V0WL 4XNQA 1CLOL 1VACB 1PSKL 3QHNA 2V6HA 3A6CL 1CD9B 4GI9A 1W3LA 4MLIA 1GIGL 4LIQE 3QXWA 1TG7A 4HJ0D 5IMOA 2EXWC 3I9GH 3MKKA 2FBJL 4R8WH 4P0DA 4RGMB 1QFHA 4Y5YA 4YXHH 1S7VA 3VWJD 1WP6A 3NIDF 2KQMA 3OA5A 1VGEL 3NIFF 1URLA 4GJTB 4X0NA 3PZGA 1B4JL 3FQUA 3QDMA 5JA9A 1NANH 2R2BA 1BOYA 2AJSL 4MHHG 2FCBA 4XZWA 3SDYL 3G6LA 1NMBL 1CDJA 1SM3H 1OAQH 5A6JA 3RNKB 2CBVA 2ZUWA 3GTNA 1BQLH 3S4SA 1ISYA 2V2XA 3VD3A 3O3EA 4FZEH 3RWIA 2VRAA 1F8TH 4GXVL 2VXQL 3HR5B 3DDGA 3QO0A 4EI6A 3CPLB 2BSRA 4ORGB 4MADA 3DX8A 4WI7A 5MENA 4NQVB 3CLEH 4FQXA 3HB3D 4GBXC 1QNOA 1LDPL 4QHKJ 1B2WH 5C3TA 2EDXA 4G8FB 5DJZA 4PJIA 5E2JA 3SDCB 4LRIC 1AKJD 1BOGB 1RH9A 5FKPA