1CDGA

Nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose-dependent crystal form
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
publication title Nucleotide sequence and X-ray structure of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 in a maltose-dependent crystal form.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase(glucanotransferase)
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cdgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cdgA01
4XAWH 2VWEE 5D2LB 1UD2A 1MH5B 3TJHD 5DR5H 4RX4D 2ALWA 5SWSE 1MW1A 4GPNA 1FG2B 5I75C 2VRKA 3VG9C 4LEOA 1XF2B 2VISA 1CI5A 1YY8B 2BX5A 2FRGP 5ADPH 1NWSA 4P2OA 2D3LA 5BVPL 4N0CD 5J13C 5JMRA 5J9PA 5FDYA 1ULVA 2DT2A 4FTVE 1I9IH 4NKIH 5TDOA 3ULVL 1T6WA 1AHWA 1HJSA 4DN3L 2BVPB 4BFGA 3FOLA 4XBPA 5HYSG 1JNHA 4RRPG 2BNRE 1G9MC 5FKPB 1CXEA 4Q9BA 4PMOA 3RVUC 4FHBD 3GNOA 5I1DB 1H1NA 1GL4B 4J6RH 3GMOB 4RAUB 4NC0B 3VXMA 1TTGA 2ESVB 3NVQA 3VILA 3FT4A 4UDUA 1H09A 4FABL 1XGRB 4JCMA 2KH2B 5IB1B 1QWUA 1ZHKA 5I0DA 3UXFA 2XVKA 3ARGC 4OJFL 4TTDD 2OL3H 3N9GH 2XN9B 1H9VA 4WHTB 4GBXD 1MHEB 1AXSB 3MODH 4KDWA 4ATLA 3KPLB 3U30C 2Z31D 1S7RA 1C7SA 5HHQA 4YJZL 3STBA 1DBML 2B5IB 3L5IA 3H3PL 1H49A 1NFDA 4RGNB 3WUWA 1H3TA 4QHUA 4WU5A 4R0LA 2EKSB 1QUNA 3IJYB 2HVKB 5HGAB 3H8NA 2ICWA 2EH8L 2R2HB 1DZBA 4FZ8L 5DGQA 3L4UA 2VNCA 1KT2A 4LLVB 4KU1A 4JG0L 5CP7B 1OCWL 1IQWL 4LYQA 3X3FL 3BWUC 5FYKH 3D39B 3I3BA 4L8BB 4RQQA 1AO7B 3PWJB 4YIQB 1BJ1H 1QO3B 2APFA 1CFTA 4Q74A 1P9MA 2IGFL 4X7TA 1HILA 4X4ME 3KYNB 1IVLA 2XSAA 3QG6A 1V6UA 1YMME 1JXJA 3KXFB 5I1LA 1NCDH 1ZT7A 4X9FA 5E1QA 3MRMA 2ITCA 3TTYA 5DVNA 4UQAA 1EVUA 3SGDI 1T0OA 4DQOL 1FRGL 4OGXH 3WSUA 4MSWA 1QSFA 5FM5O 1KLGB 1LO4L 2JF1A 4S2SB 1HJQA 2JB6B 1TMCB 2X4OA 4Y4KA 2M1KA 1AQKL 5E56A 5JPNB 4JFTA 1BD2A 4OZIA 1KJ2B 3LS5L 2OXHA 4Q22A 2NTFB 1GZPB 3SGKC 2WINA 4E9LA 1J8KA 2WHLA 3U9UB 5IMKB 3T8XB 4GKZB 5C0CD 4POZC 2DGAA 4JAWA 3U83A 5T3ZL 1A9BA 4OLYL 5EBMB 1E3ZA 5BV7H 4LSPH 5EDXA 4JRYE 2APWA 4OB5L 2WSKA 2CLVB 3FJTA 3QUZD 1JGLL 1TVPA 5IQ7L 4NBZB 3VMPA 2WSPA 4Y5XA 4LU5H 2VLRB 5JHDB 4L4VD 2DBLH 3W37A 5I2IB 3L9RA 2RGMA 5FUCC 4GG8B 1TETH 1K8IB 4ZTOH 2G2RA 3SCMA 4P9HC 3MMEB 3QUYB 3ZDZF 3HG1D 3WIIH 4K71B 3BKMH 5BXFB 4L4OA 4Z78B 2EACA 3ECQA 1JF1A 4PG2C 4PYSA 4IS6B 1B2WL 5KW9H 3MJ9H 3DGGA 1MLCB 2DMKA 1IAIM 3HMWL 3GSNB 1NFDF 4NN6C 4NO3A 1T03H 3DHUA 3EJJX 1G9NH 4F3FA 3CHDA 1U8HB 2JCCE 4MADA 4JO2L 3QH3A 4RE2A 3CZFB 3GO1L 5I73B 4HS3A 1AGEB 2Z4QB 3AROA 3VWJB 2OK0H 4QLJA 2ZCLL 1UJTA 2DS4A 4HPHA 3O2VL 4OLVH 1DUYB 1QQDA 4XXDB 4KTYA 5EBWA 4AM0B 1TLKA 4DEPB 1XAUA 2F5AH 3CC5B 5DMGC 4PJXA 3BZEA 1ND0A 2EDDA 3VVGA 1B90A 5ELIA 1U0QA 2Y5EA 2IAND 3U7WL 3ZKQD 2FBJH 3OGOE 2VE6A 4UTAH 4OFPA 3RNKB 5JUEH 3TN0B 5C9JB 5C86A 5FYJL 3RHWK 3PHQB 1NBYB 5HGHA 3NH7L 1V3MA 4P7QA 4APQC 3RWEA 1R86A 3QFJB 5JXAH 3QIBC 2BNQD 3QI9B 1WKYA 2DJSA 2A9ML 3S96A 5HHOB 4OZGA 5EA0H 3BSHA 2GY5A 3N9KA 2A9NL 5K9OA 3RZCC 3S5LB 5CIPA 3S9DB 3I75B 1CWYA 1F3JA 3QCTL 1R3KB 2VVSA 5FB8B 5E5RB 2LU3A 5ISZD 4HWEL 3QEHA 3V7AG 1R3LB 2F54A 5I19H 4Z7VA 5J57B 1Q0YH 1RJYB 3ILPA 3DMMD 1OB1A 3QDMD 4PBVC 1RK1A 4LLMA 2ATKB 1FGNL 2W07A 5IESH 4Q7NA 5FOOA 3RM4A 5C0IA 3BUIA 3DX9B 3HC0B 2FX9H 4NNXA 4OCXL 4I2XE 4QXWA 4WO4C 3ZIZA 3REWA 1YPZA 1AD9A 3KPNA 4JFOA 1BVNP 4PSRA 4NQDE 4RMTA 5ECJE 1IM9A 4W5ZA 2VKXA 3FB7B 1CDIA 3V5DA 4AD2A 2HN7B 3CMGA 5TJWK 3NSMA 4YQXH 1W32A 5EU6A 1I1AC 4S1QL 5DEFB 5EUKB 4JPIA 3FCTA 1CR9H 3D3VE 2PTTB 2WHKA 1F3RB 4ATDA 1DE4B 4B3LA 5EU4B 3RJQB 4JGJA 1UD5A 2AEQH 3GZAA 2OLDA 3RDTB 2P48B 3B9KA 5L88L 2J88L 4KQ3H 5F9WB 1ITBB 2W0FA 4UFIA 3GNPA 3FO1A 3MGTA 4PB9H 4DO6A 4GRWB 3UPRA 4D9RE 4I18C 1LD9A 5D6CB 1AKJD 3D39E 3D5OF 4R3SB 5KEZA 1Z9OA 3PQYD 4N5ED 2A3HA 1YEIL 2UVEA 2VB5A 3K74B 3MOBL 4I4WB 1V3KA 4PJXF 4FQJH 1HHGB 4HH9B 1CD1B 5KBNC 4WFGD 3ZR5A 3BH4A 5E1AB 4DAGH 3GH4A 4TUOA 5TQ0L 3DVNA 1QKZL 4OLZL 43C9B 1KCLA 5AYQA 5JO5B 1WWWX 3WQ5A 5FO7A 1FNEA 1YEHH 1UQZA 1WEJL 1U3HC 1GZQA 3ARFC 1QVBA 3BQUB 2O5XH 1IAKB 4Y4FC 1YN7B 3FN3A 1XH0A 1MI5E 4TOYL 4OZGF 2QJDA 1GGBL 3LKNB 3VXSD 3W39A 2JKXA 4Q9QL 2X4SA 3EO0B 3QHOA 4FTVA 3PDDA 4MHHG 5IBLD 3NFNA 1NUDA 5DHVA 5EZLB 2MJWA 3WUFA 4XWOC 2ZG2A 1SVZA 1GW1A 2QV4A 3FY1A 4Z7VF 1A7RH 3VFRB 2F7RA 2IG2L 2BNRA 5E2VL 3UTPE 4DWSA 1GJIA 2WPGA 1GGIH 2NY4B 3V5HB 1TA3B 4NO0B 3S6CA 3OGCB 4QHLA 1E55A 1FL6A 1QNSA 2D0GA 3GB7A 4I0PB 2BOCA 2EIZA 1CTNA 4TULH 5I8KH 4CCCA 1QVOB 2BHUA 3PN8A 4N9OB 1BM3H 1S5HA 3VGFA 1YPZF 5E94B 1F4AA 3AAZA 1WBZB 4OQTA 4W87A 5D8WA 1Q1JH 2CKBB 3H2WA 1DL7L 5BRPA 2YUWA 3PE9A 1NGZA 5JHDE 4S1DC 3K1DA 4GQ9H 5HD8D 4AENA 4C56D 3QXVA 4OQ1A 5A6SA 2VOTA 4J2XA 5DEGA 4F66A 3UDWC 5AY7A 1QBML 3LHPL 3PL6A 3MBEA 4XMKH 1Y7VA 1ED3B 2XZAL 2VDKH 5FOJA 5KANI 1BYBA 4BSVA 1WFTA 4BFEA 3SBWC 2H6PB 1U2YA 4NIKB 2EEDA 2NLJB 3T2NL 2FIKA 4F57H 4JFQB 1MAML 1S9XA 2FD6L 4JRXD 4Z7OE 5EB8A 5JW4Q 3JWOH 3CFJA 1QHPA 3TCXA 4FLOA 2EYTB 2QL1A 3L3GA 2AMGA 4NQXA 1NBZB 3TO4B 4R27A 2J12B 4HKBB 1NANI 4J27A 4FG6C 1NCCH 1FH5H 3RQ3A 1WZ1H 2VLMD 4P2OC 4P4RB 3S88L 1UVQB 5L2JB 5E8PB 4OCNC 2X1IA 3RWHA 1YEFL 5H37H 3P77B 4BZYA 4CMMB 3QDGA 4TNWF 5EOTA 3BMVA 5C0AE 4JAMA 2CYGA 3FRPA 1HP4A 2XZQL 1AHWC 2OJZH 3QAZB 1AIFB 1ZBKA 3LY6A 4ZOEA 3LEVL 4WSJA 2XVPA 1DBJL 4N90D 3E0GA 3QPXH 4F58L 5JA9A 5HPCA 3INUH 4M9PA 1PZUB 4M56A 3ARPA 4ISVA 3K2MC 3MUJA 4LIQE 4WW1A 3FQWB 4L4TD 3GSXB 4JFEB 3QXTA 1E9LA 1RIUH 5F9AC 4JJHA 4NT6B 3KPPA 4XP6H 1J1XL 4WUUB 4Z2LA 4PJHB 5D7KD 2EO7A 5FA3B 3JV6B 4P59H 3PGDA 4D94A 3CK0L 3SDCB 4M7KH 1BFOB 1UG6A 5GS3A 1L8NA 4D3CH 3WDQA 2B2XH 3S36L 3C8KA 4ZFOA 3IDGA 4LLUB 1A3QA 4HHAA 3RY6A 3QUXA 4P5KB 2D7TL 3PZQA 3QEGL 2X6MA 3TBVA 6FABL 1CPUA 4R7DB 4JFFA 1IAII 3ULVD 1HWWA 3A6CL 5E6ZA 5GGTA 3ZKNC 4WI7A 5IJVB 2A83A 2BFVH 3FB6B 1HH9A 4Y7EA 5CEYA 3W6LA 1S7QB 2RR3A 5EN2B 3HE7D 4K8RD 4R0LC 2ZUQB 4G8GB 4Y4HB 1U8LB 3ARYA 5DJ6B 1U3YA 1KCRH 3CFCL 4ZXBA 1MVYA 5F9DC 1XH3B 2BSSB 3BP7B 2UUDH 1LEIA 4UNVA 3UCQA 2DKUA 3T0BA 1U6AH 4NGHL 4Y19A 1KTBA 5LBSL 2F74A 2XTJC 4YBQC 4GLRI 5EC1A 3KNBA 1XCQB 2Q76A 1ZAGA 1E6RA 2EYRB 3P11H 1P9MC 4AZBA 3BVNA 4JR9H 3WLBB 15C8L 4D72A 2K3TA 2EO1A 3AS3A 1MY7A 4JG1L 3GNRA 8CGTA 5L6YH 3ZO0A 2WW8A 3ARDB 2JCCA 4LAJH 2AXGB 2OL3B 1NC4B 1IC5H 4EBQH 3JV4A 4AEIL 2A73A 3WD3A 2Z1SA 1XYZA 1MUJA 1MCOL 4MJ4A 5ACZB 4F15B 2XKNB 3NAAL 4HUXB 1QR4A 5EU3A 4OT1H 4X6CE 2XVNA 3NYDA 5T5FL 1OPGH 3QEUA 4Y4KC 1BVLA 1EEZB 1I1CA 2EXWC 4MZ2A 4EIGB 4U1HA 5EORL 3WF4A 4PGBA 5IIEA 3LIZL 3OTTA 5JOFA 1P4IH 5FFLA 4P2QE 2ESVD 4OSUH 3HMXL 3QSKB 3U36B 1UKQA 3OF6D 3L3HA 4JCLA 5F7LB 4M1DH 5C09A 2VXVH 4E8DA 5H8DA 3SUSA 3MLVL 4TSAL 3S97C 1WDRA 1BYDA 1PG7L 2DIBA 1BFSA 3M8OH 1MRDL 2ZSVB 4XZBA 4Y5XC 1OGAE 3QNXB 5FYLE 1VKXA 1OP9A 3OIHA 1NUNB 3I2CL 2XN9D 3TYGL 4A6YB 5CILL 3SCMC 3WFBH 5DO2C 2WHMA 2PCPB 4PJFA 3EDJA 4XCFH 2GUOA 5EIQA 4RSVA 1INQB 5JHLH 3KPSD 2DLFL 5BJTA 1U8IA 1KBKA 1C16A 3FT3A 4RGND 1QRKA 4I2XA 2AAVA 3MNZA 4O9HL 4PR5B 2NCMA 2AJXH 3TFKD 3L95B 3ZJ6A 2G60H 2NY3B 1A9EB 4R7NB 2JK5B 3PP4H 2QSCL 1RK0B 2HRPL 1F6AA 4HPYL 1P7QB 2EADA 3L5WB 1R5VA 1HXMB 4M7JH 3RWDB 5BVPH 3RJXA 3F5KA 1AO7D 1UWGH 5T3ZD 1FDLL 2F8OA 2NQCA 3D3VA 3CUPB 2BERA 5JIHA 3WKMH 3WNOA 4B50A 4G3YL 1NOWA 2GJXB 3LPWA 3IT8D 3CX5J 4W5UA 4JDTH 1BZ9A 3T2OA 1RZ8B 3ULVH 2EJ1A 2AJVL 2AQ2A 5IMMA 4DN3H 3AB0C 3PGFL 2JCCF 4B53A 1BHGA 1XIWA 5CBAB 4K8RH 4NBYB 3E6HB 4Q6YA 5J11C 1ZLSH 1JPSL 4NSKA 4D6FA 1BX2B 1JHLL 1G7JB 1ZT1B 3V7AE 1I1FA 3GMMA 1YNKH 1E72M 1JPFB 2VDLL 3P30H 1RHHA 4U7KA 2DSKA 1JDDA 2WCSA 1CFSB 2RHEA 3N85L 4QRUA 3HI5H 1S9YB 5CJOH 1XGYH 3BIBX 2EAEA 1K5NB 5D7LA 4ONFL 3UCRA 3LV3A 1YYLH 1WF5A 5ALBL 5DYOB 3ZM8A 1YYML 2WM0A 1N59B 3N1FC 3LD8B 4GKSA 4JFEE 4Q2ZA 4KMTL 4R97B 4RAVB 4H5SB 2WBKA 3HC3L 1M6OA 1UUQA 1CDHA 4JM2B 4B16A 2EDXA 4U0RC 1J0ZA 1CDCA 3BWAB 3LPPA 1MHCB 3Q5TA 3IANA 4QY8B 1ZWIA 2OI9B 2DLGA 3IDXH 4U7MA 1DBMH 2VLRD 3BHBB 5FCUH 4ORZC 4R6UA 5MENE 3TIDB 1TZ7A 4Y89A 1A6VH 3H55A 2I9TA 4O5LH 3QUYD 4HGKC 1C5BH 5C0BB 4W93A 5FYJD 5DVKA 3FFCD 4UT7H 4GG6E 1WIPA 2R2BA 4PJFF 4UB0L 4M48H 4MLSA 1QSZA 2YZ1A 1BOGB 1F42A 4MAUL 4PRAB 1BGGA 4LSTH 3C09B 3OKYA 3U4EB 3RJDA 3DUUB 1RAMA 4MQTB 1NEZB 4WCYL 1OAQL 1TQCB 5F7FA 3WF0A 1BEYH 4GMTL 2X89A 2DQFA 3LRSB 1ZOXA 4PMZA 4H26B 3B9KC 2QQKH 2OW7A 1U8NA 5IHUH 2X05A 3MLXH 4ZO6A 4X9IA 3X13B 2BZDA 2KDGA 1A1OA 2LTQC 4PUDA 4OIIH 3Q6GL 1AGCB 2J8UE 3DX2A 1TJGL 1NAKH 2E6JA 4ZFGL 3TEUA 3T1WA 3BW9A 4JJ5A 4JDZA 5GGQH 2YD1A 1U8MB 4IMLA 1AQKH 4A2LA 2HKHH 1S78D 1R5WB 3LS5H 4PP2B 2BSED 3TN0D 1ORSA 3VIJA 2X70A 1X5YA 2VWEC 4MXWL 2UZIL 3N06B 3QFJD 4G6JH 1FHGA 2NYYD 1FNGA 1TQTA 2OJEB 5A2CA 5HHXL 5HYSA 2G41A 5T3ZH 4RRPA 2B0SH 3HCVB 1IGYA 4PLOB 4TQEL 1LEKB 3CFEB 4AH2B 4FNUA 1W1PA 5E8EA 4UZGA 4DZ8B 5B8CA 3HAEG 2BVTA 5IR1B 2WC7A 3BO8B 5IQ7H 3MV8E 3T4AA 4HPOL 5C0AA 4RMUA 3SGJA 1A7QH 5JDSB 4LF3A 1XC6A 3MUGB 3VRIB 2BY0A 4X7CC 5A2BA 4UQ2B 3VINA 4PJGA 2EDWA 4DWSC 3MRJB 2E0PA 5FV2A 1UFUA 5DHYA 1CGYA 2X4NA 2XUCA 3IXAA 5TH2B 1XYFA 1RZJH 3VE0B 2W60A 2OMBA 1RP8A 2SEBB 5DZLA 1V6XA 4JFSA 3RU8H 3ULUF 3UZEA 2CDEA 5GSVA 2IQ9L 1UWEL 3NBNA 3HG5A 2HJLB 4C83A 4JO2H 3U4AA 1A21A 4QLLA 4NQEE 1IGTB 2AXFB 2EEAA 2ERJB 4L3EA 1QEWA 2EC9U 3TYFB 3THDA 3T0EB 1LE5B 2VSCA 3PL6C 3T65B 1NMAL 3MBEC 3VGHA 2VO5A 4MDIB 1A2YA 1OD0A 2QADB 2Y06H 3HI1A 5B38B 2A6DA 5KVGL 5JW5A 4Z2JA 2V5TA 5L8LB 5F7KC 4GUPA 1FO0A 1DBBH 4EIZC 1MCLA 2OZ4A 3V4PH 5D72H 4GKLA 3PDOA 3U7WH 5I8EB 1ITCA 1UB6A 1HKMA 4NKDB 2E7HA 1T0MA 4JZ5A 2DJ4A 3Q1SL 3UTOA 4BA8A 1DBAH 4LLYA 3QXUA 3ZZ1A 3GSRB 2V2XB 2YD4A 3NH7H 1XFPA 2LAGB 3O3UN 1WNOA 1NKOA 4FQQA 1CDUA 1ZBCA 4YXKH 1V5JA 2A9MH 4W68A 1M03A 32C2B 4MNHB 4YK4C 4MA8L 5K93A 5BXRA 1NGYA 3EDDA 3N50A 2YKLH 3OJDA 1OTTD 1ACYL 4CADB 4UDTB 5FUZH 3SDYL 5I76A 4Z7OF 5HVFB 2JF6A 3QUMB 3LN9A 2GJ6B 3DX7B 4M8UA 3NIYA 4RFEA 3WJLA 4P5TD 3W0WE 3IFLL 4ONGL 4WK9A 4WNQA 2IFGA 2QQNL 3T4YB 3ZSTA 5E2TH 3M46A 5E95B 1A1MA 4L5FH 5JPMB 4PMQA 1V3JA 5C7XL 3BGFB 3ZKXB 4ZUWA 3ZDXE 3BD3A 2LE9A 4X4YB 3L7EB 4X6CA 2C3GA 4TVDA 5HI5D 1A7NH 2V7NA 4QWWD 2NY4D 4NO0D 5TE6L 4PJGF 3VD3A 4S1QH 1PVHA 3G6MA 5C08A 1ZA3A 4ETQA 1TZIA 1JNLH 4XP5L 4NM4L 4JZNB 4ZS6D 3MA7B 3RY6C 3QUXC 1NAMA 1WBXA 4LSVL 1G6RA 2ZOLB 3MU7A 4J3OC 1J0YA 3HB3C 4MJIA 2XIBA 3LDBB 4WW2B 4XGZB 3TZVB 3GYCA 3QUML 1FVEB 5HYIA 4LSDA 2EYSB 3W29A 4EDXA 2YRZA 4KJQC 1TE1A 3SGEH 4G8IA 2H3NA 3UJJH 3AREA 4ZXBC 2FEEL 4EVNB 4PTUA 1T21B 3MRKB 1BQSA 4LHUG 2E27H 4FQ1L 5C8JB 1MCPH 5IKCA 1MFDH 3NGBB 4R4FL 5MERA 2FECI 3CX5K 3NCFB 2BVEA 2V17L 4ZPTB 2CDFA 4PRHB 5IW1B 3RL2A 3RVVC 1SYVA 3G08B 2OTPA 2Z9TA 1HZHH 2XZZA 5DRNA 3I6GB 4KUZL 1MVUB 4CD8A 3O4LB 3NMEA 2WBGA 1G7PB 2IAMA 1J1PL 3BMWA 5I9QB 1LWJA 4Y2DA 3HPJA 4UUJB 3LS4L 4HBQA 1DWJM 4Y5YB 2NY0B 5F93C 1CE1H 6A3HA 4YPGA 5BQ7B 1T22A 3TVMA 3LPOA 4OLXL 2BVQB 3AXLB 4GQRA 1H11A 1SR0A 3S6TA 1R7OA 3OKDB 1X5IA 3OXRA 2BOBA 2QQLL 1TXKA 4GXPA 2AJ3A 3I6LD 3PV6A 2IG2H 5E2VH 4HJJL 3CXHJ 1KPRB 1OAYL 5LGJA 1CG9B 3VXNA 3MRNB 3KLLA 2PNDA 4AT6A 2PR4L 4DZBA 2OR9L 4LK4A 4N0UA 1D6VH 2PYED 4L4VE 1HKKA 3B9EA 5GNXA 4DVBB 1Q38A 5J12C 2BY2A 4ODWA 4K7PX 4NOFA 2Z91A 1X4ZA 2O9OA 4X6CF 1DTUA 3W2DL 1PBYA 1R3IH 3WXWL 4EI6A 2V9TA 2VTFA 3ESUF 3FQRB 1QBMH 2R1YA 2Q8XA 4FOMA 1B0RB 5F89A 3U57A 5I1IH 1E6SM 1ZGLB 4CDHA 3U2SB 3ARXA 4QOKB 4LSSL 1NFIA 4NYLB 1KXQE 1OF2B 5ITFB 2OM5A 1KENH 4D6HA 3NCYS 4G8GD 3HN3A 1MAMH 3FTGB 5MENA 3C6LA 1A3RL 1Q9WA 1QOKA 4IDJL 3W6MA 4IOIA 5HI4C 5DTFB 1ERNA 4AW7A 2GFBB 1NANH 3ARBB 5ESAA 5INDA 1ZKAA 4GG6A 3IVKB 1CDBA 4MQ7A 1IQDB 1VHPA 1D6EA 4QNPE 5DQ9A 1L7TH 5HYJB 3PIQA 1VESA 3KGRA 3WENA 3SE9L 1WIOA 1SYSA 1BPVA 2CESA 2ICWJ 3B2VL 4PPTA 5CEZH 1PZ2A 5HI3C 2CRYA 1I8LA 3ZE0E 1NDMB 4OKDA 3EJRA 4OD3H 4P46A 2GCYA 1NC4D 3EYQD 4U0QB 4FMKA 2B1AL 4GW1A 1J8HD 2M2DA 1YMHA 1XIWC 3V4UH 3DO7B 5AEAA 2JLLA 4QHNB 5DD1L 4JFPB 4F7PA 3QIWA 4UI2A 2WB5A 3GJFK 1XR8A 3GMNB 1FSKC 3DOSA 3GNML 4PJ8B 5HVGB 1H8SA 2J8UA 4JO1L 1J1XH 2CCRA 1U8PA 5I8OH 4X5XA 4UR9A 3QDME 1A6WL 1SMDA 2WLZA 1A7PH 4LQFL 4AMKH 2OQJB 3SQOH 1KJVA 1KOAA 2FE0A 3MBXL 4KVNH 4EUPB 1NGPL 4N68A 3CDGA 3FO2B 1QBLL 5KOVC 5TE4H 3U6RB 3QZWG 3RKPA 2DQIH 2VN4A 4UV4L 1RZGB 1FORL 3D50A 2A6JB 1O6IA 2EH7H 4KKBC 1S7TB 3AMGA 1KN2L 4U6HA 5MEOB 2R0ZL 6FABH 3WFLA 1FVCB 3QQ9C 4D0CB 5MHSD 3SCOA 1IAIH 3A6CH 3GUTB 1HSBB 1A6TB 4HV8A 5DEZA 3UTTB 1BVKB 3MV9A 4DK6A 4X7EC 5CAYB 3ULUC 1HTYA 5HVHB 1XGQA 2BHYA 4W8AA 1OINA 4UINH 1S7UB 1TNNA 4LEXH 5ETUB 1OD9A 3LKPB 1CK0L 5CJQH 5B4MC 4PJBB 4MZ3A 4LQ1A 2WVSA 5GSRB 2AJSH 5BS0A 5GNZA 1BGXH 1ZHBA 3OB0K 5DJZA 2VZSA 1H3UA 5ABFA 4ELME 4MA3A 3K3QA 5FO9A 5C6TH 4LCIL 1LJYA 1R3HB 1FN4B 3CZKA 1H4PA 2P8MB 4JG1H 3PQYE 4L8CB 3IYLW 4OOUA 4OF7A 3WHXB 2A77H 2DD8H 3QNZB 2V5YA 2XRAL 3M6DA 4LVHC 4NQEA 5ANMB 4GG6F 3WN5B 1YECL 3PP3H 4JY6B 3SCSA 5KN5A 1GONA 2J6EL 1RJLB 4W81A 5CEXA 1HQ4A 3DROA 4H8UA 2P5ED 5IB5B 2GJZB 3DURB 5DJ2A 2FJFB 2DN7A 3BRGC 1B0GA 1C8XA 2D23A 3AUVA 3DV4B 4OM1L 3AU1A 3BZ4B 3S2CA 4G6AC 1FYTB 4Z77B 5EORH 1FZOB 3LXCA 1GCYA 1MCDA 3C6SA 3VXSE 1NLDL 3IKCB 3S7GA 1BBJB 3LXAA 4J1UA 5B39B 2Y2WA 4M7ZB 5DFTA 2D0FA 2K1MA 1CZ1A 3HMXH 4JL2A 2YA2A 2J8UF 2UVFA 4U1NB 3DSFL 4XCEB 1MW2A 3BIAX 3V0VB 3C9NA 2R9HC 5C07B 4JY4B 3MLVH 3NZHL 5B8CC 4OGZA 3S37L 1QLEH 3VCLA 2OYLA 2F53B 1PG7H 2D22A 4NZTL 1QWNA 1MRDH 5FM8A 4F7CA 4LNVA 2PO6B 1C5CH 3SGJC 4NO5A 2XHYA 2ZX5A 3VH8A 5HY9B 1XD0A 1EO8H 2D7NA 2V7HB 3N15A 1H15A 3MLSH 4JM2D 2H9GB 3MJ9A 1GGCH 4PREB 4OZFH 3MFFB 5IG7B 3BLBA 3OKNA 5GS0C 1JGVL 2Y6SC 2DLFH 5M5DA 2YWYA 4NQCD 5ACMA 1EHAA 2Q7YA 4YO0A 3PWUA 5BXSA 2GAZB 4BFIA 1E6JH 3DVGA 4KK8D 2J4GA 3K8KA 5C0BD 2ICEB 3ZL4H 1P84J 2DQJL 3N18A 3HZMA 3OKOA 3VDHA 1CXLA 1FAIH 3Q3GB 1V7NH 3V6FA 3RIAK 1Z6JT 3ALPA 1DUZA 5EG6C 3RIFF 4GBXA 5C3LD 4ACPA 4D8PA 4QHMA 2Z31A 2PW2A 1U36A 4AEHH 2XVGA 3L4WA 5DT1H 3VW3H 1LILA 3CDYA 1U2HA 3W5NA 4RE3A 5GXBB 2AJVH 1UKTA 3LKOA 4HQQH 5IOPB 3W11D 4IRSD 1N0XL 1S9WB 3PGFH 3AIVA 4DOHE 3RY4A 3AJ7A 3N1GC 3OX8B 5C0JB 4MVBC 4X6DB 4HX1A 4JREC 1JHLH 1JPGA 5EC2A 2IPTH 2FO4A 3H9SD 4RNRB 2VDLH 3PHAA 4ZUVB 3S8WA 2YA0A 2JB5L 3WBEA 3IDUA 3CPLB 3N85H 4N90E 5CJ8A 3CSPA 2HFGL 3CPUA 1SYTA 4HGWB 4HJGB 5JORA 1UWXK 5D70H 4OBRA 4XVUD 4XPAL 1L9NA 3SPVB 4KHXH 4OUEA 4UFLA 5ESQA 1CDYA 3CXHK 1FLRL 1H0GA 2R4RL 1QSEE 3WJLC 2FEDD 1MFCH 1IGJB 4AQ1B 7TAAA 2WP3O 3B8YA 5LA0A 1BFTA 1Z0MA 1KB3A 1QFWM 4LLWA 5KANG 1IBGH 3QRGH 1KG0B 3NIFE 5BRZB 2IC2A 3I9GL 2NXZC 1TZHB 5C0CA 4LPUA 3ISWA 1MEXH 1M71A 2CBJA 2QR0A 3MCLH 4I48A 4MNGB 3QDAA 4ZFMA 3ULVE 4WSKA 1I3GL 2EDKA 3C08L 5C0RH 3VJ6A 5I30L 2FCBA 2ICWI 5GRUL 3GRWA 3QUZA 4MAUH 4U05A 5E2UL 1KB9J 4HUUA 5I1CL 3QWRD 1BVZA 1QLRB 4L4VA 1AQMA 3ZDXF 4LSQH 5BMFL 1IAOA 1MAKA 4GMTH 4M6AA 3W38A 4CJ1A 3BZDA 5BWFA 1WP6A 3VXTA 5GGUA 3AMCA 4CVXB 3WL1A 2OBGA 3EKCA 3HG1A 1RMFL 3GSUA 3W82A 3CFDB 1EBAA 5F7DB 4H25A 3AMLA 3MACH 2PBOA 1I7ZB 3HMCA 3AREC 3DI2B 3SQBA 2HT2D 1HHHA 1RZ7L 3VMNA 1VFBB 5E6ID 3MROB 2P8PA 1ZLUK 1OAKL 1FFNB 4G8FA 3O4OB 4X5WB 4LKXB 5A2AA 5FYKU 1QACA 3UTSE 2LFGA 3D48R 2WANA 1FE8L 1NARA 1BLNB 4MXWH 5ACLA 4G43A 1XF5A 3O3EA 3JTTA 2OWCA 2IAMC 2MTPA 4AZHA 2V9QA 5IFAL 5HHXH 2DL2A 3IGUA 3NFSH 4ZO9A 1HDMB 4LVNC 4TQEH 2ZUNA 4UQEA 1A7OL 4Y2DC 1HCFX 4AD3A 3F7YB 2IANA 3UEQA 3CH9A 2HJFA 4V28A 3T1FB 3TVMC 1ADQH 4RWHA 3CVIH 3ROLB 1CGSL 4QT5B 5DQDL 1ISXA 2XNAA 4BKLB 2AABL 5FCZA 2GJ6D 3L2LA 1KYOJ 5SX5K 2IBBA 4YX2L 1L0XA 3SDDD 3TBWB 2RJMA 2BNQA 4NRXB 1AGBB 4M1CD 4G7VH 2X7LA 5FK9A 3VI3E 2PF6A 5EIIB 1G7HB 5F96L 1I4FA 2CMRH 1KB5L 5C07E 3BSZL 3HNSH 4G8EA 4AL8L 2BMKA 3GSQA 1VGKB 5ISZA 1KBBA 2CHOA 4Z2GA 3O3AB 5K9QI 4OKVA 4LBEA 3QDMA 4M61B 5CZXC 2RFXB 1G0DA 1CGUA 1MCCA 3L3OA 1K2DB 5E4EB 1HXJA 3KPSE 1DDHB 1JGUH 1T66C 1KUMA 5JLZA 5F44A 1JNDA 3IAQA 1U8OB 3QHZL 4XB3A 5KVGH 3TZVD 1K9EA 4B7IA 3CH1B 4XB8A 1M53A 1KWGA 3EDKA 3O11A 2EDQA 4L4PA 5KSAD 3NSXA 3BRDA 1WC7A 2AAAA 3APGA 5CWSA 5T3ZE 4ODUA 3C6LC 3DBXA 4HULB 2AEIT 3AIUA 1WJ3A 1F8TL 3VFWA 3VFSB 3OZOA 2IQAB 1UG9A 2VDNL 1G9MH 1FNFA 3DUHA 2V3DA 4QRPE 3BH8B 1GQJA 2A3AA 4LLQB 3QHMA 3RPMA 3TTOA 2O5YL 4PRHD 4K3DH 3OGSA 1JHTB 4XCNB 3N04A 4MB3A 3SCTA 4U5IA 2Z93B 4PRDB 3NCBB 1AR1D 4JN2A 4MA1B 5GS2D 3FQNA 3R0MA 5F9JA 5ERWA 1MWAH 2DBJA 1CE6A 2E40A 4KROB 2FJGA 1I8LC 1LK2B 3KJ4C 2ATPB 2EZ0C 1AKJA 2Y72A 3PQYA 5AZEH 1UENA 3MNWB 2GDUA 2HFFB 4WENB 1I1WA 2HTKD 2X2YA 4GS7C 2HMID 4NO2B 3QIWC 3TLRA 4P4KB 1AGDA 3P4NA 3QA3B 1ODZA 3NUKA 2WAGA 4P3CL 1E0OB 2DT1A 3IF1A 5I18H 1OW0A 4OZFG 3QXAA 2X1PA 3BKYL 5GJTL 1B6DA 2R4SH 1Q9OB 3ZE0F 2ZCHL 4ZDHA 5GRZA 5I8CA 1KQYA 5KSVA 4AIZA 3HAEA 5TE6H 4NPYA 3VFOB 1NMBH 3IDJA 4ACZA 5GGRY 3VXSA 1ZHNA 1K6QL 2V6HA 3EFDL 5I78A 1QPXA 3QEQD 4I5BA 5DJCA 3QJFA 4L29A 5FUOL 1QR1A 3L2MA 2D7PA 3QHTC 4WDIB 1TFHA 2HLAA 3VX0A 1W9DM 1CBVL 5EFIA 4G5ZL 4WHDA 2YEZA 3MRPA 3RUGE 3W5MA 4LSVH 1QI3A 3WO4C 1UD8A 2NW0A 1JK8B 1Z5LA 2PXYB 1U95B 4HAGA 1LP9E 3VGEA 2FYYA 2OWWA 1IC7L 1UJ3B 4MNQB 1P84K 1R0AL 2YFOA 1VRXA 1NWUA 1HSAA 3WMBA 4QHKJ 3MRBA 1T20B 4OTXL 4M03A 3AI0A 2CLRA 1G7MB 1IAMA 5E1HB 4QOKD 1V02E 1G0CA 2CDGA 4BK4A 1BFVL 2AV7A 3RWJB 5D4QA 3ALGA 1BWWA 3TM6A 1EHXA 1V6VA 4FXKB 4C56A 3SKNA 2ORBL 4S1SH 1AY1H 1NCAH 5DJAB 2DTML 4FXLA 1FCCA 4FA8A 1SBBA 4GRLC 4RGMC 3ARBD 1MFVA 4P8WA 4NN5C 5TDPB 3BAEL 2R2EB 4MJ5A 4HJ0D 3RA7L 1WGOA 1T5XA 4ERSH 5HYJD 1GIGH 5T5NG 1IEBB 1MOEA 4PCSA 2DQEH 2I5YL 5KG9A 4JRXA 1XR9B 4OLXH 2J8GA 3TJHC 3KLAA 4ELMF 1LG2A 5J3HD 1WDSA 1S9KC 2CD0A 4AY0A 1RUPL 4YR6A 3CAFA 5D1ZD 5E8NB 1UWTA 2C7UB 1BQHB 3AYRA 2D03L 4N0CC 4GI9A 1H0DB 1WAAA 4OFVA 2BS9A 3WHE1 1AGFB 1EEYA 3RFZC 3WIHA 1NSNH 4PJ8D 3QFDA 5GRYA 4HS8L 3B5TA 4DVRH 5BV7C 5D7SL 1NQ6A 4UAOB 4FQXD 2JJSA 1LO0H 3IDNB 2BVOB 3ES6B 1ZVSA 3RVWD 1HWGB 4S3JA 5HBFA 1AH1A 3HLAA 2F7QA 1QFWI 3MR9B 4H1LH 2VI0A 3W2DH 2AQ3A 3VA2C 3E3QE 2GKIA 3VUPA 4PRPB 4AWEA 7A3HA 2WYSA 2BC4B 2VLKB 4L4TA 1I1YB 2Q6WA 5CBEB 3VGAB 4ACYA 4JO3L 4KTEL 3BUYA 2UYLA 4OIFA 1QSEA 3VXUD 5FIPA 1VA9A 1PAMA 3NZ8A 4E42B 1DQTA 4H20H 3FXYA 3G5ZA 4CJ0A 3AMKA 1KB9K 2G5BA 3D4YA 4LSSH 5TFSL 3GSOB 1MPAL 3WF2A 1DN2A 4DGYH 1OLLA 3EYFB 1MHPL 4J4PD 2AS5M 1U3ZA 4DCQA 1R3JA 5SX4I 4K7FA 4DKFL 4KZDL 1LGVA 3F58H 4AMCA 3W25A 4PY8I 3U7YL 4AG4H 1FBIL 5IVXA 3GJFH 4Z76A 4NFCA 4GBXC 1NBVH 2VT0A 2W65A 1W0VA 1QYGL 2Z31C 4OZHB 2NW3B 3CH8A 4YNYB 5GJSL 3PJSB 4LMQE 2FL5B 4MCZA 3SE9H 1INDL 2H26A 3STLB 3LQZB 3N13A 4HZ8A 2QLVB 3WQWA 3DX4A 3HE7A 3VU2A 1S7VB 2WC3A 3U0WH 4HK0A 1OTUD 2IH3A 1AD0A 4U2YA 3U7AA 3O3BB 5DD1H 2OTUB 1MELA 1DQJB 1BOYA 3Q6FA 4R26L 3I6KA 4QDMA 1IL1B 4M6OH 4R4BA 1LDPL 1A4KA 4RIRB 2F7OA 3VXOB 2GSJA 1FG2A 3GNMH 2Q86B 4XBGB 2VDQH 1XF2A 4JO1H 1YY8A 4WJ5A 1I9JH 5I77A 4WWKB 1XF3A 3WFEL 1A6WH 3NPSB 3HJEA 1MYRA 5GNYA 1LL4A 5A6LA 4YDJB 3MBXH 5I6XC 2APXA 1MREL 1SVCP 4TPRH 2P4AB 1IC4H 3OB0H 1I9EA 1AQ0A 4LPXA 1KTDB 3WQ6A 1FL5B 2BVPA 5DUPL 2FB4L 3EGSA 1NCNA 2PYFB 5ICYB 2RIKA 1WDQA 1PLGL 1VERA 2AJUH 2RB8A 2F53D 2QSTA 1IGCH 2P1YA 4U1IA 4DFIA 2VIRA 4KUCD 5IJKA 3O81A 4CVWA 1F4XH 3QWOA 1GYAA 3CZSA 1CT8A 1NL0L 4GQPH 3C8DA 3M17A 5D2NB 4GSDL 5EULV 4KQ4L 3BDYL 3OF6A 2VVNA 3B3IB 3P4MA 1TQSA 1P7KB 5A6AA 5CEZE 4OD1H 5D96B 3QDJB 1OY3B 2F7PA 4K7PH 4TUKH 5D8ZA 3QUZC 2XI9A 2YHGA 4PGCA 3O8XB 2N7AA 3EJPA 4LDLB 3NIFF 2JJTA 4QLRA 1VBUA 1P4LA 2XN9A 3OHXA 3F7PC 4HUWA 4UBDD 4FQ2H 4LCCB 5GPRA 5DUBB 1SY6H 3BX7C 5CSZB 5BW7C 3KPSA 5DC0A 4JL1A 3ULVF 3I02B 5J0BA 1KN4L 1IGMH 1YECH 5CP3A 2J7HA 4G9DB 2VZUA 3P3YA 4TSBH 2J6EH 5FCSH 1MQKH 3NFPA 3H6JA 2JE8A 2ZJSL 3ZTJH 4YEFA 5J8OA 2R1WB 4PGZA 1V8HA 3O6ML 1N0LA 2YBRB 9CGTA 1P1ZA 1URLA 3ECBA 1AQHA 1WWAX 4LLVA 3AISA 3PWLB 3FO9A 3KEHA 3OAYK 1QRND 5KSBE 1TPXC 2MWCA 4JN1L 3RM8A 3BGMA 4QRSB 1AO7A 4K94L 3WEOA 1NLDH 5A2FA 2R0WH 1VSCA 4CN6A 3MLYH 5AYUL 1JMXA 1JZ4A 2J7EA 2WMHA 3WNMA 4FLSA 1KNOB 2P5WD 4S11A 1PFCA 2VZTA 5FM5M 2YL8A 4NZCA 4BQ3A 2VKWA 5MI0C 3I6LE 3LKQB 1KTRL 4DKEL 2V5RA 4EEEA 4NQTA 2WHJA 2C3HA 5FDWA 3BPOB 4HC1L 3UTQB 4HWNA 4PV9B 6TAAA 3P4OB 3CFKB 8FABA 4S2SA 1UZ1A 1UA6L 5A6JA 1EGJH 2I60H 2PYEE 1JVKA 5GRWA 5J56B 1FFPB 5L8JB 1UACL 5JPNA 4GZEA 1RY7B 2Z1KA 3IAGC 4JM4L 4CW1A 5DD5L 5IHZB 1HKLL 3BP6B 4HS6B 3IFPB 2ZP0T 3EO1B 5BRZD 3MRHA 2F1AA 3DC0A 3MLPA 2WMKA 4LNRB 3KLSA 1Q0XL 4GKZA 1TQWA 5HPMB 2JFEX 4AZIA 4V1DE 1AFVH 1P4BH 3KYKL 1MCIA 4NUJA 4KGLA 5D1QD 2R0KL 2NZ9D 2CO6B 2DQJH 3JBG7 2XGIA 4GAGH 4WV1B 4HW6A 1J9CT 4M6ML 5IGXL 4OV5B 4XVJH 2MQCA 3FMGH 4UZUA 4ONHB 2NXYD 4JKKA 2CLVA 3KR3L 5SWZE 2L7JA 5ADOL 4ZS7H 1C92A 1R34A 5E00A 2VX5A 2B4CC 2NY1B 2VXUH 3PXJA 2VLRA 3P9MB 3U9PL 2W4XA 3O6FD 5GGSY 5I2IA 4GAFB 1C12B 2HT4D 1FNHA 1J05A 5ALCH 1UWXH 2EE2A 2DQCL 2YMXH 2FJHA 3L3IB 2VJXA 3KWXA 3NCJL 1MFAH 1AXTL 3JWOC 3FFCA 5DJYB 1FPTH 3I50L 2MCG1 1ZTXL 4Z78A 4PJDB 1LP9A 2AEPH 4WU7B 4YDKL 3MNVA 4XPHH 1TCMA 5C2BH 5CGTA 2FX8L 1UHVA 4N1HB 4OZHE 4J8RB 2FNBA 3F7QA 2Y7QB 1U8HA 5BO1L 5HDOA 4S1RL 2D31A 3MQIA 2G3IA 3CMJA 3SE8L 2XZCL 2WQ8A 1J8HE 2HFGH 4R96B 2R69L 3QXDB 5HHPB 1NDGB 3RWFB 3JWDL 1DUYA 4KMLB 2VLJD 4AM0A 1JTOA 3VG9B 4ZENA 1F5WA 4XPAH 4HIIB 4RFOH 4QLKA 1OVZA 1Q6CA 3CC5A 4N5EC 4RFNC 1Z9SA 3RAJL 3WH6A 5T1KD 5T3XH 2IF7A 3S35X 5J13B 3A4WA 4WFFE 2ADFL 3JV5A 4WEUD 5HGDA 1BQLH 2C3XA 2BDNL 4E41D 3TN0A 2F18A 4YHYB 3HG4A 3ZMRA 2UY7A 3PHQA 3M07A 3VG0L 4X7SH 1OW0C 4Z5RB 4HIJA 2UWEB 3QFJA 1OSPL 2Y5TA 3MPCA 1ZBVA 4FZEH 3PUCA 5AD0B 1GC1C 1HH6B 3N1PC 3CSYB 5HDBE 3LRKA 1H41A 4KRPD 4D6GA 1JWSA 4D9LL 5MHSE 1JPST 1P5UA 3S5LA 2OSXA 3I75A 4NSBA 1ZLUH 5AG8A 1F11A 1M7IB 4I0CC 2DQTH 4HMDA 3RHWF 1G5AA 4DGVH 4D9QD 4YWGL 5AYIA 5IBLC 1H3PH 5I1CH 1RJYA 5F7EH 3UR7A 4XNQB 1U91B 2ATKA 5BMFH 4TUJB 1KPVB 5DA4A 3TBSB 2Y36H 3FAWA 1JUFB 2H1PH 3WY1A 5HGBB 3EO9L 4MJ2A 4X9HA 1M05B 4JHOA 3ARGB 3G5XA 2VUYA 3D2UB 1S7XB 3EJZD 2VDPL 3FB7A 3UPCA 5JXED 1MQQA 4WWID 1U58A 1ZE3C 1JHKL 1RZ7H 2ARJB 3MXVH 1UD4A 3WUBA 3RUGF 4M02A 4MCYB 5F3HB 3CC1A 5JW4M 1RFDL 4AMXA 5EUKA 3KDMB 3CDFA 5SX5H 5HD8C 2P24A 1JWMB 4YHNA 4UT9H 1EH9A 43CAA 2PTTA 1LP9F 2DM3A 1FL3A 1DE4A 1V6YA 3DHJA 1EDQA 1CLZH 5EU4A 2PF0A 3AVEA 2YD5A 2P5EE 4FP8L 2V38A 5I1EL 1WQVT 2OX5A 1ZJBA 4PJAE 4MXVE 2DLEA 2VX7A 4HCRL 1CVRA 4U6VL 5DD6A 4CCDA 7CGTA 3DPBA 1YEDA 4WVRA 5I1JL 4KROD 1B3YA 5D8JL 1RZFH 2FR4A 5DQDH 1L0QA 3WD2A 2AABH 5D6DA 2W5FA 2Q87A 3O6AA 4W85A 3EIFA 3V6ZB 3A67L 3IFNL 4ELKB 1F2QA 3L3JB 3RILA 4HH9A 1FC2D 1IKFH 3MLTA 4XZWA 2D2OA 4P4KD 5E1AA 4M8QA 4PMXA 2MKLC 1KB5H 2CK0H 2Q8BH 3PWVA 1QI0A 3GM8A 5IP4A 2AJZB 1VAHA 2JJSC 3BXNA 2IH1A 5C0GA 5DT5A 3EYSH 4HIHB 5FL1A 1E4KA 4PJ5B 1IAKA 5JIPA 3OKLB 4OLUL 1NBQA 5D93C 1J18A 1ES0B 2DIJA 1RULL 1KXHA 1WBYB 4P5TA 5A43C 4UCFA 5CMAB 5EUOA 1Y6KR 3BIKA 2VZ3A 3EO0A 4HK3J 2EIBA 1Z9MA 4F7TB 5CXPA 4W6WB 3UJIH 3MJ7A 1HHJB 4YHML 2GSGA 4AD5A 3LKSA 3O9NA 4PGJA 4KRTA 5TQ2L 35C8L 3VFRA 3RP1A 3IAPA 5DQJA 1GHRA 5EZOH 3GMQA 3ZE1E 3B2UD 3V5HA 3RL1A 1HE7A 4NO0A 4PGEB 3QRFM 4BSJA 3ZTJG 1HJWA 2X09A 3MV7D 4HF5L 3VKKA 4L4JA 4AYGA 4F33A 1DQDH 4HIEB 3KPMB 4FFYL 3WIFA 3LSOB 1R75A 2X41A 3OKKB 4KJYB 2VMFA 2P47B 3G6JB 4U1KA 1UKOA 4H1LB 3ULVC 1D5IL 3GTNA 3UETA 2CIKB 2DDQH 5LAXA 2XG5A 2YPKB 3GIZH 3VIHA 3D9AH 1YEKH 2QF8A 4UV7L 5IK3A 1FHDA 3HE7C 1GGYA 4K8RC 2I9LB 3H9SE 3MRIB 2VERN 1BP3B 3S34L 1C3FA 2GTZB 1BZ7A 3HU7A 1F4WH 4OCYL 5CIPH 1MIEL 2ZCKH 2NLJA 4L1HA 3WFHB 5I1HL 2YPLB 3BAJA 1HT6A 2IBZX 4HZ7A 5E8OB 5HDLA 2CK2A 4OCWL 2C1PA 4P3CH 4W70A 2EYTA 1W72H 3O9WD 3O0RL 1HKIA 1YEJH 4P23D 1T0NB 1N5AA 3BP4A 4ONOA 1K3IA 4P4RA 1HIZA 1RIHL 1H8OA 2ADIA 4P9HL 4TN9A 5FA4A 3TIEB 5KSBA 2RGLA 3LPGA 4NZRL 1QA9A 5JW4R 5DD0L 4BF7A 3P77A 2YC1A 4APQB 1K6QH 4Q58C 3WXVL 1EOMA 4Z95H 3OR7B 3QIBB 5FUOH 1WCBA 4NKQB 1PQZB 5T33L 5IB3A 4FS0A 5EOCL 3SN6N 1CBVH 4XPGH 4G5ZH 4N8VB 3AXHA 4HUMB 1T3FB 3AS0A 2XFXB 5IT2H 2R56L 3C87A 4JZOB 4PRPD 4B7LA 5T1MB 3W9DA 5LCVL 4OD2B 5INCB 5IJKC 1G9EA 4LSUL 5FIEA 5EUOF 2DQXA 3T77B 3U0PB 4JB9L 5FOBB 3HNVH 1ORQB 3ZJ8A 4CD4A 1DLHA 3LH2L 4ODTH 2PYEA 4PV8A 2YPVH 1U8KB 1MCHA 2FH8A 4B15A 1EJOH 3KJ6H 4KI5D 4WO4B 4X6FB 2C7FA 2ORBH 1ACZA 2EE3A 1IEHA 3M1BB 4C7GA 4V1DA 5E2WH 2JJTC 4OFYD 5EBLA 3T08A 4P5KA 1I1AB 1F4YH 3MS8A 3BAEH 3N11A 3C5JB 4R7DA 3MXWH 2D4DA 1DWIM 5IJVA 2J5LC 4BUHA 1KIRB 3EAKA 1VACB 4JPKL 2BSTA 2VAJA 4NRZB 1S7QA 2O5ZH 1EUTA 1MFBL 4RGNC 2I5YH 1S3KL 3OJVC 4G8GA 5DJ6A 3O6LH 1JZ2A 2ENSA 4QYOA 3TFKC 5A8MA 3H0TB 4JKPL 1J12A 1JP5A 3BP7A 1W0WA 3QHFL 1HKFA 1PJ9A 2FGWH 2CGRL 1T1WA 3HMXA 3VXQB 2FHFA 4PJIE 3FB8A 3RVXD 1JDAA 3KPRD 1KELL 1H2JA 4NJ9H 1F45A 1YN6B 4PGDB 2C5DC 5IBUB 1VFFA 4CD5A 3MLWL 3W26A 1NGQH 2BSRA 1U8JA 5BVJB 2DTSA 2AXGA 4G42B 1NC4A 5IUSA 3U48A 1QFWH 1JV5A 4HD9A 1E4JA 4YC2C 4N1EA 1G7QB 1BAFL 5EOQL 3RWIA 1J8HA 1UQSB 2EO9A 3ARZA 2BJML 5KSBF 5F7UA 1KGCE 3RX5A 4UQDA 3ZTNL 1Z9LA 1YQVH 3BH9A 4OZFA 2XKNA 1BZQK 4ZNCD 4C55A 1LG1A 2FZ3A 1YNTB 1DN0B 4Y4FB 4O02H 4CVZB 2W91A 1E6XM 1U42A 4JO3H 4HKXA 1QLFA 1UM5L 2KQNA 5IW6B 4UTFA 1FP9A 1H5BA 1UZ8B 4LPTA 1AE6L 4NI3A 2Z92B 4TX8A 3VXRB 2DQUL 3B43A 5SX4H 3GH7A 5EPMA 4DKFH 1EHLL 3L4TA 1PYWA 3S4SB 4H8WL 4TVPH 5DVLA 4P0DA 3EMCA 3W81A 5DDHA 3U7YH 2ZUSA 4KRMB 2J7CA 3QDJD 1XGPA 2ZXBA 2CKNA 4XMPL 2WK2A 5T1LB 5DFVD 3GXMA 4GAYA 1IRAY 2ZSVA 3SDAD 3O8XD 4OCMC 1JE6A 3DXAB 5GJSH 5CPQA 1INDH 5CD3A 3UYRL 5F6IB 2HT3C 2VDRH 5KS9B 1W9BM 3NCOA 1RJZA 2GW5A 3VFPB 4CKQA 2F61A 4XNMA 3QUYC 1XF4B 2PCPA 4YHIA 1VJSA 1ZBWA 3AIBA 1CQYA 4OFIA 4K71C 3WS3A 1INQA 3PZIA 3TC9A 4KMQA 5DWUL 3S3JA 1N26A 3IJ7A 2EECA 3LVEA 4YXLL 2OTWB 2X4PA 4PR5A 1JI2A 2D9QB 5EO9A 5I17A 1B2YA 5K33A 4JE4B 3LOWA 1AQDA 2HYMA 4OLEA 1B1YA 4X0KA 5F9OL 3FNDA 1A9EA 4DUXA 3EYUL 1N3NB 4M62H 1PZ3A 1ZEAH 5EBGA 1O5DT 4CMHB 3WFEH 5I73C 3RWCA 2RCSH 3RWDA 3DX6B 3CUPA 5LGHL 4LSRL 1I9RL 2YPLE 2IBZY 2VISB 1RZ8A 3S3PA 4P2OB 2XY2A 3DLQR 2P5EA 1MHHA 3Q0HA 1J1OH 4YHZL 4K9EL 1KWKA 1QNQA 4D0BB 1BQUA 3IRPX 3QO1A 3CZLA 3EJQA 5J9PB 1JI1A 1WZKA 5JTWA 1S78C 2W9EL 1DFBH 5A2KH 5C0EB 1CWVA 3TN0C 1EEUA 1K3ZA 1G7JA 2DT3A 4HXAL 1AHWB 2HP4A 3PWPE 1D5ZB 4LVOB 3GSVB 2KUTA 4L3CA 4XX6A 1ZK9A 3FOLB 4XBPB 1JNHB 4KRNA 2EE9A 4G9FD 2NYYC 4ZE5A 3J7HA 3R4DA 4GKNA 1S9YA 4NKMB 2CKRA 4YEEA 5DJXA 3WEMA 2ZUMA 1T7YA 3UJTH 3VXMB 1E1EA 3MRCA 3PZOA 2WUBH 1HEZA 2JELL 4KHTH 4Y1AD 4TVUA 4UDUB 4ODHL 2EXYD 3BZFB 5D5ME 2FWOB 2DQGH 4JM2A 2C4FT 2PWEA 3U7BA 1WK0A 3E3QC 4QY8A 3MUZ1 4GXUM 5HDBF 1OT1A 4GI6A 4MB1A 1TDQA 3GHEL 5IFTA 5DLML 1A6AA 4NQCA 2XYLA 3UR8A 1WTGT 3HR5A 2MCPL 3TJEL 4BELD 4LCWD 1F90L 3HZYA 1OM3L 3KLHD 5HDQL 5C0BA 1T1YA 1S7RB 5L7XL 5HHQB 3FHAA 3DIFB 2F19L 2UV3A 1D7FA 3QOKA 3GI9L 2AK4D 1E28B 4JFYA 1NFDB 1E15A 3WUWB 1TJHL 4QHUB 2F8XC 3EFFA 3X3GH 4R0LB 3WDRA 5C0FA 3QIUD 1L0PA 4EXPX 1UXSA 1W8OA 4H0HB 1GVIA 4K94H 4KAQH 4MQSB 4AZ8A 5H2BB 3TBYB 1EXUB 3DUUA 4N1CA 2FYVA 1QW8A 1G0XA 1NM9A 2AGJH 3RKDD 4ENED 2NY2B 2X5PA 4M1GH 4IRSA 1MJJA 4RQQB 5T5NF 4HZLA 4G6MH 4DKEH 4X7TB 1HILB 3X13A 3NIGE 2W66A 5GGVY 3HC4L 5A8PA 4M6NH 3D51A 5D6DC 1FNSL 3H9SA 1ZT7B 4XT1C 3MRMB 3ZO9A 1U8MA 5E9DD 2ITCB 1G9HA 1UACH 1UEMA 1UWQA 3MRGA 1QOXA 1R5WA 4G7YL 4QRRE 3ZT7A 3CLWA 4MSWB 4PJAF 1QSFB 4MXVF 4MTVA 1QI4A 1HKLH 4YE4H 1OTTC 2FHBA 1Q0XH 1Y18A 4RDQG 3BJ91 2QPSA 2BVYA 2X4OB 4Y4KB 3H9ZA 1E4KC 4HAFA 5DJ8B 1BD2B 3HCVA 2NX5D 1LEKA 2WINB 2B1HL 3GJEB 2GTWA 4YDLB 1LWHA 4P5TC 1CZ8L 4KK5D 4CAGA 5HHMD 4DZ8A 3D25B 2G8ZA 2VCAA 3MMDA 2HH0L 3BO8A 5EMYA 1KFAL 3L5XL 3SY0B 1XGTB 3U9PH 5L0QC 1A9BB 4HH8A 3MUGA 3TWCH 5IV2A 4GMSL 3WFZA 1OP5K 4DTGH 4UQ2A 4LCYA 4C4KT 3NCJH 4XC3L 1AXTH 5HI5C 3R0NA 3K2UH 2NY4C 4QWWC 4WEBH 5HHVH 5HYQA 4Y5XB 4GW5A 1ZXQA 4H7VA 1FIGL 5TH2A 2NY6D 3ARGD 2MQ0A 4WI4A 4YDKH 2DYPD 3D2UD 3L9RB 4B0MM 3A3HA 3WSQL 1Q9LA 4JZJB 3SCMB 2VL5B 4ZS6C 4KH2A 3BUQA 4M7LL 3QWRA 5BO1H 4I3GA 1JF1B 3SCRA 1MWAA 2V9RA 1TCRA 5DD3L 5FO8B 3PGCA 3ILQD 1GZJA 3TYFA 3ZE1F 5LVEA 1FFOB 1QPKA 3WY3A 5CQ1A 3WHE0 4NO3B 4HEME 4XPFL 4MDIA 5A3ID 2DM2A 1I7TA 4GAJL 4WUKL 3EOAA 4HS3B 4NHCL 3FFDB 1VEPA 2D9CA 3FB5A 2QQQA 1MFEH 3QWQB 5E6IA 2ZUYA 4LL9A 1QQDB 4CU7A 3EJSA 4NCC1 4W7WA 3OKMA 4BZ1H 3GSRA 4PJXB 3BZEB 1ND0B 1SMOA 2YIHA 2JALA 1NCWH 3MO4A 5FECB 4M5ZH 5HYFA 1DSFL 1T5WB 4XBEL 1DEEA 2YL5A 4E4PA 32C2A 4KY1L 1XH2A 2NY5L 3K7UA 1W3JA 2Y8KA 3ULUH 4D9LH 1W2KT 5HGHB 5JIKA 1Q4NX 2BNUB 3RWEB 4MWFB 2GT9B 2VH5L 2O9TA 3GK8H 2WUCL 5AWNL 3SO3B 3RVTD 4PJ5D 2DPEA 2GJ6A 4OZGB 5HJ3A 1G0YR 3DX7A 2ED7A 3SDDA 1ODAA 5A2LH 3MZGB 3EOTL 3PZGA 3EW3B 5CIPB 1F3JB 3H42H 3QEHB 1P7HL 3Q48A 4P49A 2DI7A 3NABL 1MRCH 4Z7VB 3SCUA 3ILPB 1EAPA 1OB1B 4WJXA 1MW0A 4Z6AT 4LLMB 3WDJA 2V5CA 3QG7L 4MS8D 4U0RB 4FQCL 5C0IB 1EFXA 1D9KD 5HOSA 3VIGA 4NNXB 4XH2A 1C8YA 1FZJA 4NZDA 5TPWL 1YPZB 1AD9B 1EHNA 3BKCL 3KPNB 2QBWA 3WDIA 2F8VA 3MJ6A 5T3XE 6CGTA 1KCVH 1LO3L 1HVXA 3LCYA 1EX0A 3VA6A 2BCKA 5SV4A 2ZOLA 2W0KA 4FP8H 1PX3A 4JPIB 3FCTB 5C71A 3BN3B 5I1EH 3X14A 3AIQA 2VAAB 3L4YA 5ILTL 2X4RA 1M4KA 5KSAA 3JXAA 1ZANH 1ZJAA 4Z2IA 2ZUQC 3LX9A 1PZ5B 3ZHLA 3EYOA 1JZ6A 2DLHA 2E9MA 4G6KL 2E8YA 2ZSWA 2P5WE 3IFNH 5C92A 3G6DH 1SEQL 2J7GA 3MGTB 4PRHA 4XRCA 5DJDB 1EQPA 3UPRB 1Q9KB 3AXXA 1EK3A 2LTQB 4HGMA 2XTJE 4KZEL 3TPUA 1N6QL 1C90A 1MVUA 2XN1A 1JZ7A 4WGVB 2ZE0A 3NOIA 4HMEA 5GS0H 3NTCH 5A6BD 3RGVD 5H94B 3EYQC 5KVFH 4HZ6A 3RO8A 1F6LL 1EJ6A 4UUJA 1RU9H 2EDYA 3ZKMD 1PKQA 4X80L 5SV3A 4KVCL 5FO7B 4K3EL 4PJIF 4R8WL 1FNEB 3OQ3B 2BVQA 4F15C 5E08L 5DVMA 1KTCA 4MNJA 2AERT 1II4E 1GZQB 4U1GB 4LGPB 1K8DB 2W9DL 2OP4H 1NOUA 4KKAD 5JQ6L 2YRLA 1HYSD 5TQ2H 3EZJB 4N0FA 1MFUA 2R23A 2HRLA 1H5BC 4JFZH 2NTSP 4OZIE 1KPRA 3WH7A 4CKVX 4FTVB 4RMSA 5DHVB 3BYYA 2MMXA 3GJFA 1P6WA 1OQOA 4HF5H 3ZKSD 1FO0H 1UM4L 3A21A 3QEQA 2XV6B 1U93A 4FFZH 4ZAKB 4QCIB 3EYVB 1QNZL 1YUHA 4FXGA 2BNRB 1OP3K 3C60D 2Q8AL 4JPWL 4LKCA 3V0WH 4EI5D 2M8XA 3DRTA 3A47A 3AC0A 4NWUL 4QHLB 1FL6B 4QXTA 3GB7B 1D5IH 2BOCB 3TNNB 2AI0L 2BXZA 4KK9D 4PRID 4ZOCA 1B3VA 3BEWA 4MD4A 1S5HB 3LEYH 1BJ8A 5I15L 3EHBD 3B83A 5LA1A 4JFHD 1I1AD 1NGZB 4JY5L 5D5MA 4UOQA 4AENB 4QOKA 3CV5A 1INEL 2ZNXA 1MCKA 1OF2A 2DRUA 5I1HH 5ITFA 2W62A 1PKOA 3MBEB 1OAUH 4YN5A 2CRZA 2VLJE 4BSVB 4NRRA 1B4JL 2OSYA 4GO8A 1CGXA 3VSUA 5DS8A 1QFUL 2QSQA 4E2OA 1FZKA 2EPNA 2CEQA 3KPTA 1S9XB 1RIHH 5D71L 1ZS8A 1ZT4B 4R4ND 4WI8A 5HYJA 3CFJB 4E41E 3L3GB 3T0XA 3BEVA 3EBAA 1J7VR 1NDMA 2K7PA 4OCSH 5KTEL 3CLFL 4Z0BL 2IMNA 3VNYA 4DM2A 1N6UA 4YK4B 5DZOA 4PJXE 4OQTL 3RWHB 4WLCA 1LMKA 5DRXB 4P9ML 2AQ1A 2VQ1A 5D1ZA 4QHNA 4Y2OA 2R56H 4JFPA 1A5FL 4LSUH 1L7IH 5EOTB 4JAMB 2J62A 4QXGL 5K9KA 3DO3A 4PTWA 1UWSA 2O9RA 2EDRA 1DQML 3DDGA 3NA9L 2OMNA 4WFED 4D9QE 2XTKA 4LLDB 4FQXA 1I7UA 4JPVH 2J74A 4NRYA 1VEMA 4EKJA 3L7FA 2HVJA 3BT2H 1F58H 4ISVB 4WW1B 2YD7A 1I8MA 3RWGA 4X9YA 1AJ7L 3O2DH 4JQIH 3VXRD 4MXQD 4P3DA 1X44A 4Z18A 1J5OL 1GRWA 3NJ3A 2E9IA 2Y9RT 3LD8C 5CUSH 2F54E 4R97C 4CGTA 3O41A 1Q94A 3VSVA 3VWKD 3LMJL 4JO4H 2EPLX 4JM2C 4ZSOE 5ITBH 4HFWA 2J6EA 4P7LA 1NPUA 3VXUA 3DXAD 4JFXA 3LQAL 3C8KB 4ZFOB 4J4PA 4HHAB 3G9VA 4OF6A 3QUXB 4ALAH 1GOOA 5BZDA 5T1DH 4OAWB 5I0ZA 3TBVB 2J4WH 5ETUA 4KK8C 3B5GA 2NMSA 4JRYB 2A83B 5D5MF 1JNJA 3WFDL 1HH9B 3GHBL 5CEYB 1NMCC 1JTTA 3CFBA 5EU6E 5C6WH 4NHUA 1AMYA 2XPKA 4AK1A 4ZXBB 1KELH 3BD5A 1DWGM 1KR0A 2WWDA 3ROOA 4FRWA 1R3HA 1TQCC 3R06B 4U49A 4CD6A 3MLWH 4L8CA 4Y19B 4HTYA 3W11C 4IRSC 4PB0H 5D9OA 4DGIL 3KNBB 2Q76B 3VIIA 2H2SC 1A6PA 3BVNB 3V8CA 4DN4H 2NNAA 4XMLH 4ORGB 3QULA 3DV6A 2JCCB 4X4ZA 3P40A 1H8NA 2GJZA 3JV4B 4ZFOL 2WCGA 1IC1A 4B3KA 5E0QA 1MUJB 3DV4A 3QO0B 1T04A 5GGSB 3OGRA 5F1IA 4NM8H 5KJRH 2PWGA 3IJ8A 4JHAH 4Q0XL 4R2GD 5CZVL 3IKCA 3KWWA 3NACH 5MP6L 2P44B 2FGLA 4XVUC 3NIGF 1EHLH 1OTSD 1BVLB 2X2HA 4PRNA 5LKNA 3UPAA 3CLEL 3LZFL 2R39A 2ZX8A 4PGBB 5IIEB 1CIDA 4HWZB 4JY4A 2FEDC 4XMPH 3VSTA 2CKSA 2F53A 2HVMA 3T2PA 1FZMA 3N17A 4IRJD 4X6BB 5E6YA 3B5HA 1SM3H 5I6SA 1JWUA 4OCRH 4PJEE 3SE3A 3L3HB 1QI2A 2H2PC 5F7NC 2ZX9A 4LGRB 2VABA 2ESCA 3HA0A 3L6FA 2H9GA 3V4VL 4PREA 4ODXA 4B41A 1SJEA 3E8UL 5IG7A 2XQBH 1ZVYA 1RUAL 5JIIA 1VKXB 3AS1A 4YBLC 4WIQA 2XG9A 4YXLH 3NDYA 4FQLH 1MY5A 4XVTH 4CRPA 4PJFB 3UBXI 4H88L 3STZA 5F9OH 3EYUH 4JFDD 1IGFL 3PZMA 4XPBL 3FT3B 2G3NA 4I2XB 5IB4A 3MNZB 2H8PA 4P2CG 2YK1L 2AJYL 1LE9A 3II1A 1T1XB 5IBTL 4NQDB 4QKXB 3OZ9L 1JJUA 4K23L 1JFQL 2GQHA 3U82B 2R29L 1OARL 2E6PA 3HE6B 5F1OB 2H32B 4I77H 1F6AB 2NY2D 2HT2C 4DW2H 1KXVA 1S9WA 4YHZH 3RIAF 5E6IC 1JPTH 3D3VB 3PHOB 3BAKA 4HG4J 4TVPE 5C0JA 1S5IH 1QRNA 2AV1A 2MQ3A 5EWIH 3MLZH 5F71A 4RMWA 1BZ9B 4LOUC 3BVXA 2V2TB 4XX1G 3U1SL 5KZCB 2P5WA 3CPLA 4XWGL 4R9HA 2X4QB 2DIEA 4NSKB 3MOQA 1TZGH 1CICD 5EB9A 3WFCL 3LN5A 1I1FB 5KVEL 2IXVA 3GMMB 1FSKB 4XNYH 1RHHB 3HFML 3UYOD 1NGXB 3VFUB 3QDGE 4YDIH 4QRUB 4CN1A 2XWTA 1TG7A 2CJUH 4PMNA 3FN0L 4Z8FH 1X1NA 5ABEA 4LAQL 2D7OA 1JNEA 5IXEA 1MCSA 1FYHB 3SDDC 3LV3B 1FH7A 4I9WD 4IMKA 1IGJA 1ZA6A 1KBGH 3OG2A 4M1CC 1KCSH 4WY7H 1X6NA 3VFMB 1DANT 4YHKL 1T7ZA 4GKSB 5BRZA 3BGFC 3MUY1 3ZKXC 3CVHB 4Q2ZB 4XP1H 2VSDA 2VXQL 1HHKB 4B9ZA 1HL8A 1AP2A 1K4CB 4WI5A 1M6OB 1XHGA 1MI5B 5D1QA 3E2HC 4MNGA 1ZWIB 1E6OL 5ID0A 4M9OA 4GW4B 2X0YA 3BFOA 2LV4A 1KCUL 2I9TB 1X5LA 2JTDA 2F2HA 1E5JA 3OG6B 4TSCL 5CPTA 3GM0A 4P2RD 1TJIH 3O6FA 4AMWA 5LXGL 3PABA 4U4BA 1U2CA 3LDBC 4OLWL 4ZUUB 3TZVC 2MANA 2YOCA 1KIQA 4FNLH 4JFFE 5GRJL 5IM7A 5KSAC 3CFDA 5F7DA 1ZMYA 1UD6A 2ARJQ 5A2IH 4URIA 1HX0A 1I7ZA 3KPRE 4HUNB 1Z0NA 2HTLD 2IEPA 4KKCD 4N8CH 5EO0A 3ZQ9A 2AEWA 4HBCL 1TFVA 1UZ4A 1JL8A 3TT1L 3ZYOA 4LVHB 1U8NB 3CVHL 1KB5A 4J23A 4XVSH 3ZT5A 3GBNL 4LASL 1U30A 1OM0A 4Y19E 5L9DL 1A1OB 1AR1C 4X6EA 3WKZA 5ESVA 1A6UL 1EV2E 2IFFL 5FHBL 1BGAA 3EOBA 2VLJA 1KJ2L 4JDZB 5LWYH 4FQHA 1MJUL 4O2CA 2BRRH 1VADB 5GISH 1PG7W 3GKWH 2XM1A 1HDMA 4O4YL 1ORSB 2VXTL 5T1KA 4PLKD 5EO1A 2X70B 2XICA 3WEXA 1CZ8H 2HTKC 3A0OA 4HIXL 2HMIC 5BOPA 4YXHL 1HN1A 2HH0H 4E41A 1WO2A 2GVYA 4BKLA 1DLFL 3L5XH 5HYSB 2Z8SA 3QCVH 1IGYB 2JIXD 2R0LH 3MYJA 2W9LA 4GMSH 4KJPD 4E5XB 5KVDL 5B8CB 2FGZA 4N8PA 2YBUA 4QEGA 5CINH 3T4AB 5EIIA 4M24A 5C0AB 1FIGH 3B9DA 3OA5A 3E1F1 5F72S 4PJGB 4K2UH 1CFQA 3O3AA 4M7LH 4NXSA 4PD4K 5FHAH 2X4NB 4EDWH 4XNXL 4U3AA 1OL0A 3DRQB 3GSNL 2RFXA 5C09E 4P7NA 2VDOH 1K2DA 5DD3H 2X9XA 2W60B 2AKRA 1E71M 4LRNL 1DDHA 4OZIF 1W1VA 1T6VN 2XIIA 4HOWA 2CDEB 5D9SB 5GSVB 2I26N 3C2SA 4C83B 1RPQA 1TVHA 5JXEA 3WJJA 2LAAA 4NHCH 4L3EB 2Y07L 4Y88A 3KL3A 4ZSOA 4PJFE 25C8L 1QEWB 3ELAT 5DURB 3UYPA 1W72A 3L1OL 1H5VA 2OYPA 4L3AA 4S10A 2P7TB 3HI1B 4DK3A 2A6DB 3TBTB 5IWLA 2G4FA 3SJVD 5GS1A 1XCWA 4KKLD 2PKDA 5F21B 2ZPKH 3ARBC 4DUWA 3BPNB 3PDOB 5DMIL 1DSFH 1UB6B 1T0MB 2EQDA 4HJ0C 3S3SA 3CO4A 4JREB 3RGHA 1VGEL 4XP4L 4QF1A 4P57B 3ABZA 4LIQL 5LYRA 2V3GA 1D5MA 2B31A 2PWHA 1EO5A 5FXCH 1LK2A 5I24A 4RAHA 4NDMB 5J3HC 5DRZA 4G9FE 4FNPA 4PUBL 3B9VA 4XTRD 1NGYB 3GRWH 5D1ZC 2XWBB 3S35L 1QNPA 4HXBL 4IRZH 4NO2A 5SWSD 3LMYA 2RQ8A 4Z0XA 4P4KA 3AY4A 3C5ZD 2WXDM 4AZ6A 4PJ8C 2ZOKB 5IFJA 4FK9A 4YUEL 1X4YA 3BKJL 4FQXC 4Y1AE 1YNLL 3QG7H 3RVWC 1T2QH 4WNQB 4NCDA 2JJUA 5D7LE 1A1MB 2OZ4L 3VFOA 1R87A 3BDBA 3FO0L 1EDGA 4ZUWB 2NXZB 4HFUL 4D6JA 4X6CB 2YL6A 4WDIA 4ZAKD 3H9YA 3EDFA 4UILL 1LO3H 4LCWE 3V52H 5K9JL 1S7SA 5IFHL 3LXBA 5E24E 2E7BA 5C08B 1ZA3B 5A6KA 4ETQB 1YJDL 2A2QT 1TZIB 5EU5B 2DSVA 4P2QB 2AK4E 3IS0X 5ILTH 3H3BC 4J4PC 4PTMA 4PJEA 1NAMB 4BSWA 4BQ8A 3MV7A 1WBXB 3V6OE 1G6RB 3ULUE 1FCGA 4QTIL 4MJIB 3MX0A 4JVWA 3OKEB 1NGWA 3TNMB 5TE7H 1LEGB 2ZX7A 1A4JB 4QRTA 4EDXB 2X42A 4JKLA 5CJXA 1KJMA 1OGAB 4G8IB 5MEQB 3GBML 3AREB 3IJHA 4PTUB 2DF3A 4MJ6B 3NIDE 1HIML 5TDPA 4HG4K 1K9DA 5IKCB 1E0XA 4NNPH 3RL2B 1OTUC 1SYVB 5AC5A 3THMH 4XPTH 4G6FB 3WLWD 1LQSR 1UM6H 2F5BH 5DRNB 4X80H 2CIIA 1UKSA 3F12A 4HKZA 3EDEA 2J2ZA 3HZVA 4HWBL 4NKOB 1MCBA 3O9WA 3MRFA 3FONB 2NW2B 4N9GA 4P23A 5E8NA 4OCLC 2VL4A 1UB5A 3MZTA 2NX5E 2B4CH 2GK1A 5EZIL 4S0SD 1T22B 1H0DA 2F58H 2I27N 4KKNA 3TVMB 1AGFA 3OXSA 5HHME 4AIUA 1XT5A 4IIQB 4MAYB 1YMMD 4EOWL 2NY7H 4RDQF 2BOBB 4EQ3A 2WVUA 4NUGH 5E99H 1RUQL 3CMOH 4AYFA 2YDQA 3MR9A 1ZSDA 5LGJB 4EJ1C 1IGIH 4PJ9D 3OPZH 3VXNB 1TNMA 5JOPD 2A3BA 4PRPA 1I8IA 4AT6B 2PETA 4DZBB 1IFHH 1E1FA 2CKBL 2JIEA 3UESA 3SE3C 3RTQD 1VDGA 4ODWB 2Z91B 1KIPA 3FOMB 4JY5H 3IU4L 1LLOA 5AZ2H 1OAXH 1JGDA 1PG7X 4Z7WE 3O6KL 4PJGE 4U1JA 1YEEL 3TESA 1INEH 1Z3GL 4NN7B 3F65A 1OGTB 3MRDB 3EYFA 2I07B 2X9YA 4MB4A 3AZSA 4ODVL 3A5VA 3MUIA 1VFOA 3E6FB 5F89B 3K1KC 4PJEF 4ZTPL 1N7MH 1OQXA 1X5JA 1SBSH 4JRYD 3SDXE 4OFYA 4YAQB 1QFUH 2HKFL 3VH8G 4PG9A 4MQXD 1GOMA 1MF2H 4UBDC 1XEDA 3TTSA 5IQ9A 2VQTA 3WD5L 5LQBL 5MENB 3SUVA 3C6LB 1Q9WB 3P0VH 4L3EE 3PJSA 3GBLA 3MGOA 1DVFD 3STLA 3LQZA 2ZWYA 3MSGA 3FT2A 4XX1E 1WT5C 1GC1H 5INDB 3HAEH 3WD4A 4GG6B 4MQ7B 1KXVC 5KTEH 1D6EB 1AI1H 5DQ9B 2OYKA 2OTUA 1SYSB 3V0AC 3KPOB 3TV3L 1Q6GA 2UY2A 3L5JA 3T3PF 4QXGH 4RIRA 1UQYA 3IDIB 3KPRA 1NOFA 3KJ4B 4P46B 3BUBA 5I66A 2Q86A 3ZLQC 1GHFH 4GW1B 5BZWA 3TCLA 1YMHB 4M93B 4OI8A 1OGGA 5L2KD 4GS7B 4F7PB 5GZOD 4XAWL 1CL7H 2I25N 1KXTA 5E09A 5F7YC 3UTZB 5DR5L 3RBGA 1XR8B 3F5WA 2J8UB 2EXOA 3MLRH 4XC1H 4O2EA 1J9YA 1U8PB 2PWFA 1LL6A 4X5XB 5ADPL 5J1SC 1J5OH 3MLUL 1KTDA 5CFHA 1FL5A 4LXFA 4Q97A 3UG3A 1HP5A 1KJVB 3IRZA 4IMKC 3LMJH 2C1OA 4IJ3C 3WNKA 2QHLA 2QSVA 1FV1B 4KTDL 4F7EB 1QP1A 2X4TA 1DBKL 3CDGB 1MCNA 4KXZI 4NKIL 1F97A 5JOEA 1EDTA 3ULSA 5KSUB 3CXDH 5F88A 4FFWD 2DWEA 1P6FA 3WQ8A 4U6HB 3WO4B 4QXUH 3VFTB 5D1QC 2NZ9C 1LK3L 4V2CB 4HV8B 1FGVH 4UIKH 4RE4A 4J6RL 3QDJA 4Q9RL 2Z8VC 2ITDA 2NXYC 2DI9A 3MV8B 2J8FA 3CUJA 1W3LA 5C08E 1BYCA 1RVFH 1KLUA 1EA9C 3O8XA 4KI5F 4KI1A 3SDAA 5M3WA 1X5XA 4AIOA 4F9PA 4XI5D 2WZHA 3O6FC 4L9LB 2D7MA 2HT4C 2ZZUT 4LCCA 4M5YH 3WIHH 1REIA 4HC1A 1JN6A 1ZHBB 2HLFC 3VDCA 4MJIE 5DJZB 1EXPA 2XWJA 2YBTA 4F8TA 1RD6A 5ABFB 4NQDD 3I02A 4MA3B 5FO9B 3TT3H 3V5KB 5FF6B 5FV1L 3HE6D 4RGMB 4P7OA 5AUMA 2OL3L 3N9GL 1F6FB 4NN5B 4OGAD 5DMYA 3WIJA 4O2FA 1N64L 3MODL 2XGBA 2XYCA 4XNUH 2YBRA 4NQEB 1QW9A 1LNUB 3O4OC 3BLKA 3GSWA 2OSLA 3HKFA 3RIKA 2IALB 2Z8RA 2HJKA 5GGVL 4U3XA 2IWGA 2G9HA 3QJHA 5CEXB 1HQ4B 3KYMA 3S5ZA 3F7VB 4E0RB 4UNIA 4YGVB 5DJ2B 4OI7A 1B0GB 1J0IA 5DK2A 1NKRA 3RBSA 3WDHA 2ZIDA 3AU1B 5FYKL 4BH8B 3SCVA 2IADA 3LZFH 4M3KB 3SCQA 4OI9A 5IB2A 2CITA 3C6SB 1S8DA 4PJ7E 2K9UA 1DWAM 4EZMA 3D39D 4OM0L 4J1UB 1XSIA 1DWHM 5BV7B 5A3HA 4MPKA 4PV9A 3P4OA 1NCDL 5C3TA 3F4VA 3MJ8A 4HA4A 1U3JA 3KXFD 2L0DA 1C5DA 4KK6D 1HI6B 4G9FA 3V4VH 3VCLB 4OGXL 4PEEA 5IHZA 4KRPC 3BP6A 4HS6A 3IFPA 4A6YL 2KBGA 3BAWA 4NO5B 4LNRA 3EBVA 5C1MB 1CFNA 5IEKB 5HPMA 3SE4A 1MI5D 4OZOA 4JEGB 4JDVA 4JFHE 4N0UE 4Y16A 1F00I 4Y1AA 3W0WB 5BCAA 2VR9A 1SMAA 4ONHA 5E0FA 2Q7YB 4L8SA 1M7DA 4YO0B 3PWUB 5MEPB 1B4RA 1US2A 4FABH 1XGUA 2WZPD 4BFIB 2YK1H 3DVGB 1CD9B 3P9MA 3OLEA 4K23H 1JFQH 2CUMA 2DB8A 3OKOB 1ETZB 5BV7L 4B9YA 1UWIA 2E5EA 4LCWA 3EJZC 4LSPL 1C8PA 1DUZB 5JXEC 3L3IA 4JFVA 2EPKX 4GOSA 4ZUTA 4GBXB 3WJJC 1ITXA 4OJFH 2Z31B 4QHMB 1UD3A 1IM3A 3LRLA 1JTPA 4PJDA 2AK4A 4M81A 1I3VA 1TETL 3B4NA 4WFHE 3FW6A 3OLGA 4ZTOL 5IWLC 1A64A 2X89D 3QIUA 4MD0A 5JHDD 1RP9A 3TTQA 5GS1C 1CLYL 5HBBA 3H3PH 3V6OA 4J8RA 3WIIL 2J7DA 3BKML 1UWUA 1T89A 1TQVA 3HRZA 3U1SH 2ZG1A 4D0DB 1V03A 2NSXA 2CBVA 5FKAB 2EH8H 4ZYKA 4FZ8H 2OYMA 2D0HA 1JPGB 5EC2B 4MA1C 4JANA 5HHPA 2FO4B 4JG0H 1T03L 1OCWH 1IQWH 3X3FH 1G9NL 4MDOA 1E5NA 3MRQA 2J75A 4J28A 2IGFH 4WFEE 2OK0L 3WL9B 1NCUA 1L9MA 2GI7A 3H9HA 3T3MF 5E9DA 5JORB 5GZND 3C5SA 4OLVL 5CKGA 3VWJD 3HZKB 3MKKA 2KZWA 3WQ4A 2LVCA 4P4KC 3AY4C 3AHXA 2W67A 3BPCA 2D1ZA 5ESQB 3SGDH 4DQOH 1UCBL 1FRGH 1D5XB 1NC2B 5EIVA 2CETA 1IILE 4BH7A 4UTAL 5BROA 1LO4H 3TOPA 2CXGA 5JUEL 1UT9A 5CP3H 2NX5A 5C0AD 2NT1A 1AC6A 5JXAL 1KCUH 4NWTL 1OWWA 2HFEA 1M71B 2WV3A 5EA0L 2QR0B 2VURA 4HCRA 2CR6A 4I48B 3HG3A 3QI9D 4HMCA 1ZGLM 4H8HA 5IVNA 4DUVA 5E8DL 4TUJA 1KPVA 4GRMB 5HHOD 3TBSA 3VJ6B 3OR6B 4OLYH 1FFQA 5GRJH 3B2UC 4JVPA 5HGBA 1Q0YL 4OB5H 1NP0A 3MV9E 4L4VB 2DYPA 1JGLH 2ADGA 3D2UA 5ABDE 4Y5VA 1IAOB 5IESL 1V0LA 3WKNA 1HVQA 3VXTB 1I7RB 3B9AA 5GGUB 3K4ZA 1A22B 3GSUB 3TT1H 4C57C 2XFRA 4ZO7A 4Z7WA 4H25B 3KDMA 5CJXC 1JWMA 1M7XA 5JDJA 2A6KA 1UXWA 4ZPVA 5L9DH 5BS0E 4ODSL 2VZ1A 1B2WH 1HHHB 1A6UH 5JNYB 2IFFH 5CJBA 5FHBH 1KJ2H 3HMWH 2MSPA 2P8PB 3SDXA 4G8FB 1E6NA 4JLRA 4ZODA 4KPHL 1T4KB 2VXTH 5ICZA 2XACC 4UU9A 3GO1H 3OZPA 4KWUA 4ZFZA 4HIXH 4G43B 2ZCLH 3IJSA 3O3EB 4YXHH 2AEQL 3O2VH 5DO8A 2PW1B 3WS6A 3AM8C 3V6ZA 4KQ3L 3NIDF 4ELKA 3O9WC 1X7QB 4JQVA 2OXGA 3L3JA 4P23C 5GQBA 5MI0B 3RDTD 4XCCL 3WF1A 2EKJA 2HJFB 3A6OA 5KVDH 3CHFA 4TRPL 2J8HA 5F3BA 2YXMA 3EJYD 1L4IA 2XNAB 2CBIA 1CFBA 1GOFA 1X9QA 4YHGA 4UAOC 5KOMC 4ZXOA 3NPZB 1EFQA 5FYJH 1I85A 4HIHA 2BNQB 4KV5E 1TVNA 1V0NA 4PJ5A 4AZ5A 2X7LB 5DK0B 1EAJA 3L3DA 3FQUB 4QGTA 4BQCA 5J6GA 3GSNH 1I4FB 5LG1A 2WVVA 5GRVL 1OD7A 3G5YA 4G8EB 4R5EA 1CXIA 2BMKB 5I2UA 1YEHL 2EE6A 2A9NH 2O5XL 4FNSA 1UA7A 3QCTH 5CGYD 4OKVB 4LBEB 1EQCA 4HWEH 3QDMB 4TXEA 4TVCA 3BQUD 2XOTA 3QISA 4PRBB 3SKOA 4LRIA 4P2QD 3VD9A 25C8H 1D9KA 4JFDE 1FGNH 1RIVL 3HNTL 4XZUA 4NFBA 3UZVB 4PGEA 5IVZA 4MDJA 3EJUA 2XJ7A 4KI5C 4L8DA 4UQ9A 3ESVF 3TH2T 4OCXH 1A7RL 3KPMA 3LSOA 3AICA 3O11B 2Z8WC 1GGIL 1W9XA 5GRVK 3OKKA 4KJYA 1WC7B 4RZCA 5DMIH 1ONQA 3G6JA 5A16A 5CWSB 1OGAD 4TULL 5I8KL 4ODUB 4Z7WF 3KG5A 1BM3L 2W61A 1K4DA 2PC8A 4I0PD 3TA3B 1Q1JL 2X4UA 5I71B 3BISA 2I9LA 1MCJA 5ECUA 5JQHC 2P42B 5DT7A 1A14L 3WF3A 4M7LT 3EZ8A 4UIMA 4O51A 4G6FD 3SDXF 4CN4A 5GIRA 4JN2B 3WFHA 2OLHA 3FQNB 5F9JB 2FX7L 5DSCA 4PTXA 5L88H 5ERWB 4PY7A 2J88H 2VDKL 5C0DA 4ELMB 3RJYA 2FJGB 4IDLA 2C3VB