1CDGA

Nucleotide sequence and x-ray structure of cyclodextrin glycosyltransferase from bacillus circulans strain 251 in a maltose-dependent crystal form
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide sequence and X-ray structure of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 in a maltose-dependent crystal form.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase(glucanotransferase)
molecule keywords CYCLODEXTRIN GLYCOSYL-TRANSFERASE
total genus 238
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cdgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cdgA01
2R2BA 1DR9A 4GKNB 5DGQA 5CSYA 1ISYA 3PWPD 5D5MB 5FF6A 5I8OL 4OI7A 5ENWA 4EN3A 1E6OH 4MB4A 3C09C 3KEHA 2NY1B 5D7KE 5FUCE 4F33A 5KVDL 3EMCA 1TQCC 4LYRA 3D25B 4WKFA 5J6HB 1HQ4A 4DQOL 1XGPB 3MR9B 5DJYB 4U7MA 4DN3L 1T1YA 5GGRB 1AGBB 3L3GA 2ZG2A 4PJ7F 2VUOA 5KN5B 2EH7H 1KCKA 3RNQA 4HD9A 4EVNA 2FSEA 2X05A 4Y4KB 2NY2C 5LBSL 3RVVC 4RIRB 1V8HA 4M03A 1UZ6F 1PIGA 1LDPL 3BUYB 3D0LA 5GRJL 3BZEA 3JWDL 1BFVH 2EPMX 2LU7A 4WEBL 3VFOA 1ZT4A 2OYLA 3CXHK 4HWBA 4HK3N 1INEH 4JFFD 2BS9A 1I7ZA 2D9CA 3T0EB 2AV1B 1H3VA 1RI8A 4K3EH 3VG0L 3TONA 1CZ8L 1X4XA 1C7TA 4G8FB 4Z7WF 1DN2A 3FMGL 4GRLB 4YGVB 5KVGL 3WD2A 3ULUH 5TE4L 1MQPA 3W39B 1RZIB 1IGIL 3BVNA 5H35B 4M9PA 1BZ7B 3VXSE 5IQ7H 5F71A 2XA8L 4O2FB 4UQCA 1F58L 1J7VR 1MW0A 1RPKA 4RQQA 4WNQA 5A8MA 2HTKD 3LMJH 3QWOB 4AZ5A 4XVUC 4H7VA 1JMXA 1MFEL 2ZCLH 2AK4E 2FX7L 2ID5A 5DVLA 3BT2H 3RZCD 1YEKH 4UNTA 3FJTA 3VINA 1U93B 1R3IH 4F66A 4UR9A 4EDXA 3L5WB 4JN1H 4CD6A 3ZYOA 1OTTC 3L5JA 2FIKA 1K4DB 3TFKD 5ANMA 1LQSR 5DUML 1N0LA 4GZJA 1ZT7B 1ZGLP 1T1ZA 2HAZA 4HAGA 5C71A 4KAQL 5FUCC 4JCMA 5C0JB 5EC1A 1IGJA 3FO9A 5LCVH 1E6XM 2RR3A 1ZHLA 3CNKA 1XGUB 2AS5M 1F58H 1ZLUH 4M6OL 2OSXA 4UQ3B 5HYJE 2UZIH 3F7YB 4XBPA 1YC7A 3NCBB 4HS3B 5C07D 3W2DL 1IGTA 4FQJL 3OKNB 4H0IA 1AC0A 4L4VA 5HXMA 3BCDA 4EDWL 2C9AA 5F8QC 3DYPA 4EUPG 3T77A 3D6GA 1KT2B 3VIGA 5L88H 3ZKQD 4TOYH 2D1ZA 2GTZA 1J10A 4JANB 4OQ1A 3VMNA 1YEEL 3QRFM 4M1GH 1WUNT 2FHBA 4HGWB 3TBTB 1A6AA 3BCFA 1HINL 3RPKA 1KIRA 1MJ8H 4HJ0C 4KK9C 4NQCA 5DYOB 5KAQF 1T6WA 1TMQA 2Y8KA 4LLYA 4PUEA 3LD8C 2V3FA 3RJDA 3VX0A 5KSVB 1UFUA 5INCA 2QF8A 3H9SD 3V5HA 1LWRA 1BFOB 3EYOA 3QXUA 3SO3C 2C3GA 1ZS8B 3SDAB 4ZFMA 1Q6DA 4MAZA 5GJSL 5I66A 1CIDA 3WFZA 1E6JH 3D4ZA 2W4XA 2CSPA 2AXGA 1LQ0A 5CEYB 1GIGL 1BQCA 3OG2A 4IIQA 1OARL 3GSNB 4ELMF 1K3IA 3IF1A 1F90L 4NQED 1QLRA 4JLRB 2SEBB 3TTOA 4Z7WE 3PWJA 2MWCA 2OP4L 1MHPH 1OGBA 4HBQA 2HFGL 3G6DH 5EOTA 3VFUA 1UB5A 3JBG7 3S35X 1U8OA 4R2GC 2X4SB 1NC4A 4XP6L 1LEIB 1FO0H 4FABH 2Y5TA 4PP2B 1I1WA 5DUBA 1TETL 1BFTA 3C6SB 4Y16B 4M7JL 2C1OA 5E1QA 3BH4A 3L4YA 2VKWA 4JY4B 4LSRL 4DEPC 3VXOA 1LP9E 4PTMA 4UOZA 3K46A 3KLKA 4LKXB 3Q3GB 4HJ0D 1KLGB 5F21B 4B0MM 5IR1B 1NEUA 4X6FA 3MANA 1HH6A 5EO9B 4QYOA 5GJTL 5SWSD 2MHAB 3SGDH 1FHDA 2J75A 2GKIA 3HE6D 1ZVSB 1U33A 2FBJL 3V7MA 1CLYL 4ZUUA 3G5YA 5CILL 4MJ2A 4O5LL 3L3HA 3VXUA 1E27A 1KTLA 1B4JH 3BJ91 4MX7A 1YPZA 4DN4L 5I16B 1ONQB 4FQCH 3ECQA 5IESH 2VLRA 2EXWC 3SE3C 2E3ZA 1B0GA 1MIEH 3B2VL 2OI9C 3EOYG 1HK6A 1V0MA 2VQ1B 1A6VL 4PFEA 4LP5A 4KKNA 5LAXB 3N1GC 1W0VB 2R0LL 4I4WB 3FT4A 1EOMA 2I9TA 1HDMB 4X5WB 2X1IA 4N9OB 3CMOL 4Z7WB 1O7DC 4M48L 3VW3H 5IBLD 2VISB 1P4IL 5CP7A 2VSDA 3UJJL 4HAFA 5DTFB 4MJIA 1EERB 5TDPA 4L4OA 3L7EB 3DMMA 4ETYA 2HKFL 4LSTL 3I75A 2GY7B 1FNSH 1XCWA 1N4XL 1S9VB 3G6JB 3WBDA 5JPMB 4KZEH 4HUMB 1HDMA 4W8LA 5E6ZA 1N5AB 4H1LH 4J1UA 5K9KA 3WMSA 2CK0L 4F3FB 2HT2C 1QACA 3FRPG 3KPMA 3GJFH 4IOFC 3GSUB 2P5ED 3P3YA 5J4MA 2CDFB 5HVHC 3EDKA 1JJUA 5F3BA 4V2BA 1FOBA 1MIEL 4JZOA 5EMYA 3QDAA 4CNIA 3PBGA 1CBVH 5DJ8A 1S7RB 5MEOB 4JO3L 1CNVA 2DJSA 4PLKD 1G7HB 3VH8G 2XSBA 2O92A 4OLXH 1JPTL 1W9PA 4FF5A 5KN5A 1QFUL 4N68A 1UA6H 3UC0L 2AJ3B 2WC4A 4J1UB 1TA3B 1NGXA 3H8NA 1XGQB 3UBXG 1HL9A 4YHGA 2IBZY 1IM9D 2FBOJ 3BWUC 4YE4L 1P7KB 4HXAL 5IEKA 2GAZB 2YXMA 5JPMA 3GMLA 1OGSA 2HG5A 1URLA 3UEZA 5E00B 4JFQB 4JQVC 2PBGA 3O3BB 5DK2B 2HJLB 2PXYD 3L3OA 4FFYL 4LRNH 5C0BD 2J74A 1I1XA 4GS7B 5LCVL 4PRHB 3EBAA 3WF2A 2X4SA 2XN9B 3RI5K 3W2DH 1A7OL 2JIEA 1VGKB 3PDGA 3MGOB 1F45A 1KWKA 1HF6A 3QEGL 5TGBB 2DSZA 3I3BA 5EORH 4Y1AB 5DFVC 4AD5A 3WKZA 1QTYT 3ZO9A 1J0YA 3UYPA 3AHYA 5F6HJ 3T4YB 1GYAA 1W8NA 5D1QB 5EO0B 3DETD 4YHNB 1FFPA 2EDOA 1M4KA 2XQYG 4RAHA 5BQ7A 1I9IH 4KV5E 3S6CA 3K4ZA 1MHHB 4MA1B 4QRRE 3KPLB 2Z31A 3AXLB 3P4MB 1FP9A 3H7BB 4YFDB 4P46B 3DGGB 1BF2A 5FA3B 1U3JA 4N8CL 4QRRD 1LHZA 2WHJA 1OGAE 1WFNA 4G8GE 5F7UA 1VJZA 2FO4B 3JTTB 4OF0A 5HY9B 3HRZB 3AS2A 2DF3A 2IBGA 5ESQB 2DQTH 4BFIB 4XZBA 5LWYL 5ADOL 5BRZB 4R9HA 5I75C 1B0RB 5KSAB 1HXJA 2DKSA 1AY1L 3QH3A 2CDEA 3WF0A 3H3KA 2D7TH 2XFFA 3FQXA 4MCZB 3SCPA 1WE5A 2AK1L 3QG7L 2D3LA 3RVVD 1XSKA 2H32H 1MREH 3CH8A 3MGAA 2P42B 4YXKL 4PJ7B 3AXXA 4KI1A 1LDSA 1RP8A 2BRQA 3N1MC 3K2MC 2UVFA 2A9NH 1D7FA 2P7TA 3HE7D 2EKSB 3WXWL 3SY0A 3KYOB 5L7XH 3POHA 1A2YB 1B6DA 1T5WA 4XMPL 5I8KL 3ZJ7A 1XFPA 5ID0B 2BVUA 4PRAB 1R24B 1W1PA 4AENB 2C4FU 1B4RA 2IPTL 1TQCB 1UR8A 1S7SB 1MW2A 2WMFA 4E0RB 3UETA 3VIKA 4ZFGL 1J0JA 2CKRA 3HTLX 4WI7A 1OGAB 3MRLA 2GK1B 1JZ7A 1CT8B 4PJEA 3IDIB 4Y5VC 3LDBC 1HSAA 4X0KA 3TBWA 4KUZL 1CIUA 5EU4B 3GZKA 4PLOB 2YPLB 3THML 5BMFH 3F8UB 2FBJH 1FNGA 4QHLA 3BD3A 4WHYH 3NCEB 4JRXE 2VX7A 3CLFL 4PRNA 5C0CA 4ZMAT 5DLMH 2W60A 5I1DA 4HKZB 2WVUA 4D6GA 3KDMB 2A9NL 1ZAGA 2FECL 2HVJB 4YDVB 5SWSB 3IDNB 3IDMB 4WSJA 2QKIA 1VHPA 3VD5A 4CUCA 4ZS7L 1MVUA 3BXNB 3TIDA 3BP4B 4QTHA 2IAMA 1WTLA 1NANI 1FSKB 4PJDF 5KSAD 2PYFB 2G3IA 3BXWA 1A47A 3VIIA 3DO3A 3WN5B 4QRPB 1AMYA 4GI9A 1U8PA 4HWUA 1A5FH 2R23B 2Y5EA 3BIKB 2FCBA 4PP1C 3VD4A 3V5KB 2CKBL 1A9BA 1INEL 1S8DA 3B9KB 4N8VA 4M43L 4HIJB 3HFMH 3BVWA 4NXKA 4PREB 3SOBL 3HZ3A 4I13B 2BJML 4N0UA 1BQHG 5KVGH 4RGMB 1KPVB 1RHHA 3I50H 3N04A 3QDHA 2WIMA 3O6MH 4H8VA 3JVGA 2QL1A 4JFHE 2XYCA 4L29B 2W1NA 3BGMA 3SDAD 4OUUB 1V0LA 1A7PH 5DC4B 4ZS7H 3KPQB 5KVFL 3EYFA 1CGSH 3RJQB 1U2YA 2Q7YA 2FLRT 4FNRA 2XWTB 4CCDA 4GW1B 3QIWC 5MP6L 1KTKE 4YC2B 4AG4H 4TUFA 1X5IA 1E5JA 4OLEA 1SBBA 4EJ1C 4D0DA 1MCHA 5I78A 1I1AC 4NN6C 4EIZC 3G9AB 2EO1A 2NT0A 1GGBH 3WDHA 2GK0A 3QUYB 2X7LB 4PG2C 3WENA 3W39A 1KTRL 2H41A 1UQZA 2JF1A 3S37L 1SMDA 1YYLH 1WJ3A 4YPGA 2K7PA 4LRNL 3RWJA 3RAJL 1YJDC 3RTQA 5IT2L 5IIEA 3GMMB 2HFFB 3JUZA 1CGTA 5I1KL 1JZ2A 3QDJD 4PJAA 1XCQA 4PJXE 2PN5A 3SUWA 1UKTA 2IAND 2KDGA 3TTSA 3NCOA 1ZT4B 5EORL 1RVFH 5EG6C 2VO5A 4X4XA 1T1XB 4PJ9A 2YS4A 3MXWL 4Q0XL 1BJ1J 3DROA 3GFUA 4L3EE 4GSDH 3VIMA 3V6OA 1FORL 1XGPA 2VDQL 4U3XA 1ZA3B 3L6FA 2WCAA 3F7VB 3BMWA 1T7ZA 2YPKA 4HIIA 4LU5H 5BV7L 4PRNB 1E1EA 5I1GH 4UDTB 5HGBB 1DQDL 1ERNA 5J6GB 2OI9B 5CEZD 4Y16C 1FPTH 4HKJB 3PL6A 3QUZD 5IBUB 4P8UA 4Q2ZA 4JJHA 4L3EA 4KRLB 2CDGA 4YC2C 3U9PH 4I0KA 5B39G 5ISZD 1QNZL 2J78A 4DUWA 2EDWA 4QRQA 1LO0H 1MCWW 3B8SA 1ZBKA 5I18L 1FNEA 2B4CH 3GO1L 5CSGA 4PJXA 4LK4A 3T0ED 5HBBA 1G7JB 4G80B 2KUTA 5EO1A 4JIEA 3WY4A 5CSUA 1JPGA 1YEDB 4TUOA 4E8DA 3GRWL 1E3XA 2DD8L 3VFNA 4FQXB 5F96L 1CGYA 2FNBA 5DZNA 1AQHA 3EFDH 3BIBX 1JHTA 3ARVA 3I2CH 1AXSB 4AC1X 4XHJD 3WFEL 4QRTB 5HDRA 5DD5L 4M1DL 1OAZL 1I1RA 3N85H 4L9LB 3HI1B 4ZUVB 1CU4H 2GY5A 4LU5L 1F90H 3LQAL 1RJLB 4NIKB 4HWBL 2X4NA 4OD2A 3S5YA 1BEYH 3G5VA 5DO2D 4YIQB 1MLBB 3IJSB 3NCJH 1NC2D 2CDEB 5DFTA 4EI5A 1OM3H 3JWOH 1H0GA 3MV8B 4GXUN 3QCUL 1H41A 4JDTH 3O9NA 2R2EA 4UUJA 4ZXBA 3K1DA 3VGGA 1TETH 1WBXA 3E6HB 2VZTA 4Y16D 1SZNA 4H26A 3IT8D 4LNRB 2OMNA 1WFTA 3C2AL 4WHTB 4PRPD 2XV6B 2Z0BA 3QR2A 4JQIH 3V6FA 3BHBB 3GRWH 2LQRA 4BQ6A 3OGCB 1MJUH 2Y4SA 2F19H 2I27N 2E5EA 1KV3A 3O9WD 2NY7L 1CU4L 3VXRD 5AYIA 1XH3B 5TH2B 1T3FA 5I1JH 4G3YH 4U6XB 1MW1A 1WLHA 5KSUA 2ZSVA 3HZVB 3QXDA 5TE7L 4Q7NA 1T5WB 2F5BH 1K9TA 4Y2DA 1TVHA 2WC3A 1CLOL 5E2VH 4HG4J 2VQTA 1BHGA 1ZANL 4KVCL 5MEND 4X0KB 4XCFH 3TH2T 5D9OA 1UWEH 2DPEA 3IFLH 3PDOB 3ROLB 3DV6B 3QCUH 4EQ3A 4O2CA 4RE3A 2BOCB 2JEPA 5JIWA 3SCQA 4B16A 4CD4A 1FN4A 5ICZB 2XWEA 4L8DA 4PMOA 2HG5B 4HOZA 3VW3L 2ZSWA 1AIFA 4YHEA 5C0CE 2PW2B 4JRXA 4YR6A 1HHJB 4U1IB 2E7LC 5FL1A 5DD0H 3X11A 3WL9B 5I75B 1BJ8A 5ABHA 1V03A 1F4YH 3I02A 5F7WC 1J18A 3JTSA 1IFHL 1OAXH 2MOVA 1WITA 2MCPL 3S98A 4HG4K 4ZPTB 4PJEE 1OW0C 7A3HA 5C07B 4B3KA 2OYKA 1QPXA 2DWDA 3OAYK 3NABL 1ITXA 4LIQE 3LKOB 1JZ8A 1ZLWH 3G04A 1S5HB 2QQLL 4UU9A 2E27L 1F6AB 1CENA 1EJOH 3T09A 3WEMA 4YHNA 2FH8A 4UINH 3P11H 2YRLA 1QFOA 4W6WB 4GQRA 1MFAH 4GAJL 2L7JA 4GAGL 4JEGB 4U6VL 1VACB 5HPOA 1NC2A 2P7TB 3FTGB 2CKBA 3FO1B 1CTNA 3KPRB 4JFDB 5E9DA 2YC1B 5DK0B 4CU8A 4AYSA 2VX5A 3WDRA 1KTDA 5ELIA 5T5NF 4EZMA 4HIHB 4HZAA 4KJQC 4TSAH 2E7LA 5F7DA 1CZ8H 3PDDA 3VGAB 43CAA 4WU7B 4DKFL 2O9PA 3G08A 5C86A 5FHAH 3D0VB 4K7FA 2E40A 5TE6H 3DX6A 4XX1G 5EZIL 4PMYA 3FT4B 4QGYA 4NJAL 1MCQA 3OAZK 4JFQA 5GSVA 1RUKL 1CPUA 4P46D 4AY0A 1Q9LB 2AP2A 5HGAB 4GRLC 4OSUL 1AP2A 4UU9B 1JV5A 4KQ3L 1DWHM 1I8KB 3ARGB 4OLYH 2J7BA 3LPGA 5BZDB 4M29A 3RO8A 5EUKA 5KS9B 1MFEH 4G8GA 4LSUL 1R85A 1CWYA 2FX7H 3PZGA 5T33H 4HK0B 3EOAB 4K55A 2FJHA 1CDHA 2BSTA 4LVEA 2MPAH 2HJKB 2WMPA 4AT6A 5GIRB 3GUTB 4LHJB 2VLJB 1U8KA 4U3AA 1KB5L 4ZS6C 3FO2A 4U7KA 4ODVL 1E9LA 5GNYA 1E6RA 1A7QL 1NDMB 6FABL 2B1AL 2EPKX 5IFTA 5I73B 4CVWA 2WZHA 3VFTA 1V3LA 4M5ZH 3L2MA 4W5ZA 5LWYH 5T1MB 3WD1A 3MGOA 1F4XH 2Y1VA 2B20A 1X5YA 1GGIL 1VDGA 3EOAA 4LNVA 4KJQD 5F9JB 2J8GA 3VDAA 1BG4A 4I3RH 1EEZA 5D1ZC 43CAB 5I24A 3WFEH 5I1EL 5F96H 3BUBA 4MMZC 5FK9B 3M46A 3U30C 1DVFC 1BYAA 5K9QI 3OKOA 3V4PL 5KSUB 4QXGH 4ZODA 2N7BA 1IAOB 4WK9A 1DE4B 1IGCL 1U8KB 5L88L 2WWKO 4TOYL 1SJHA 4ZTOH 4OV5A 3L3HB 3VXUB 1XGRB 4M1GL 3BAIA 4ODVH 4OLVH 2BXYA 1JGDB 1E28A 2EH8H 1LK2A 3QIWB 4CKQA 2X41A 4HUWB 5E7FA 2AERT 2ZJSH 1AR2A 5D1XD 1S5IL 3C2AH 4P9HC 4H04A 5EFIA 5DRNA 4LLYB 4JPVL 3SKOA 2K9UA 2B5IB 4YHYC 1JE6A 3GXTA 3C5JA 1T89C 4OCYH 4FQXC 4LKXA 3U36B 1X5KA 1YHTA 2P24B 5IG7B 1R3HB 1UWIA 1DN0A 1CFSB 4W70A 4DO4A 3WF1A 5T3ZL 3VO0A 2B4CL 3EDFA 1QR1B 2DIEA 2QSCH 4Y4FC 1LE9B 2ORBL 2NY3D 3U0TA 3IU3B 5KJRH 4PP2A 5D7IF 3F5JA 1H3GA 3G6MA 4QWWC 3WHE0 4Y16A 4UV4L 2D0FA 3CLFH 4MJIE 3W11D 5GGTA 3W9DA 3BD4A 5ACZB 2AQ2A 4Y4HD 4JY5L 2ZOXA 5FYLD 3TJEH 2HWZH 3MJ9L 2IANB 4KVCH 4AZIA 5K33A 4RX4D 3HPJB 2MQ3A 2DQHL 3VRIB 4V28A 4JCLA 1OAZH 3GSXB 1LO3L 5H2BB 3KLDA 2P1YA 3TTQA 1A6PA 3VRJB 3DPBA 2YMXH 4KTEH 4PG9B 1AE6H 4R8WL 3MLRL 5EC1B 1JYWA 1TJGH 4KJWD 4S1QL 3RWCB 4JPVH 4K3GA 3IK2A 2BVOB 2VLRE 5B3JF 1W1YA 1NAKL 3FRPA 5IB4B 1U3HC 3OGCA 3QZWA 1E71M 3NH7L 3V5DA 3RUGF 4TVPD 5KSBA 3OKKA 2PYED 1KTLB 4NCDA 4LSRH 4J3XA 4BUHA 3A24A 1MLCA 2HFEA 2K7QA 1KC5H 2VDNH 1WC7B 3PWNA 1OD9A 3AU1B 1JGVH 1LD9A 1DLHB 5IHBA 5IMOB 3DX7B 3F65A 2YSSB 2LE9A 4NNYA 2J7CA 3C5SA 1IFHH 1T22A 1PX8A 2R2EB 2MCPH 5C0GB 3HE7B 5F1IB 4IRJC 1FP5A 3FOLB 4HS8H 1T7YA 1XF4A 3UP1A 4EI6A 5ID1B 5JXAL 4NX0A 3W28A 2OZ4L 4PG2A 1UQYA 4FQCL 4G6JL 1DWIM 3SKNB 2Q20A 2DQHH 2YK1L 3MJ8B 4ISVA 1SY6H 3NZHH 1ZS2A 1WDRA 3IANA 4NRZB 5DHVA 2ZUYA 2O9RA 4PMDA 5I1JL 1KWGA 2X4UB 1QNOA 1CGSL 4RMUA 1LLOA 1MFDH 5I9QB 2W59A 3F7YA 2DTML 1RZFH 2YD6A 4PV8A 4TSAL 1LNUA 3VFNB 1VFOA 5DRZB 4MA7L 1BREA 1HI6B 3SN6N 3UTSD 1TVBB 4G6ML 1I3RB 5IB2B 1JRHH 4J12A 5MENB 1U3YA 3RWDA 2NXYD 3D39B 1S78C 2CO7B 2DT0A 43C9B 3TO2B 3G9VA 4KZEL 1YYLL 1FZOB 1IBGL 1ORQA 4S0TD 2DQFB 3CX5J 5I2UA 3DURB 1QSEE 4D9QD 4FP8H 1JZ3A 1T7WA 2CIPA 4WFFD 1R47A 1B3VA 4HZ8A 3BVXA 4KQ3H 3LH2H 1A6UL 3A5VA 5DHXB 3CU7A 5BXRA 2DBLH 4WDIB 2D2OA 3BPOB 4R97C 4R4FL 1EQPA 5AYQA 1JWSB 2H2PD 5F8RC 5BJTB 3LKNB 2Y72A 4PTUB 3RX5A 5EO1B 3VDHA 4I9WE 4Z18A 4PJ9B 1U6AH 1E3ZA 4JO2L 3WEXA 1ECEA 2XG9A 3EHBC 5FM4A 2XM1A 4YE4H 4HWZB 2X1WL 4L4VE 3V52H 3CDFA 4NZRL 2DQJH 3OXRA 1FFOB 3MLWL 3QIUA 4XC1H 3QDGA 2VAJA 3WMCA 4WFGE 2NW2B 4U6VH 5TPWL 2H8PA 4G9FE 3T08A 2FDBP 1HI6A 1Q1JL 2NR6D 5C09B 5I18H 3JV6B 4NWTH 1QBLH 4MTVA 4IRSA 1C16A 1NMCC 2NXYC 2VCCA 4LGXA 5CZVL 4HC1H 1OAKH 4LLDB 5IVXF 2C3VA 3SQBA 2IGTA 3BQUB 1R86A 2X4UA 1M7DB 3NFPB 4RE2A 1T5XB 1L6XA 1IT0A 2FGZA 2PW1A 1HNFA 2WIIA 4A6YA 2RQ8A 4Z95H 2EDEA 1MCIA 4EVNB 4YHKH 4HA4A 1WZ1L 3I3DA 4YXHH 5JZ7C 4HJGB 3V8OA 5DHYB 3H42L 5I1CH 3NFNB 4GW5A 2AQ1A 4PTTA 1G9EA 4OOUA 1HQ4B 1A02N 1NUFA 4WHYG 5LGHH 1G7LA 5IIEB 2XWTA 1M03A 2ZUNA 1JHLH 2OR9L 2D7PA 1NAML 3WYRA 1FL6B 1LMKA 3D25A 4DWSB 2DQJL 5I79A 1B4JL 4AM0B 4DN4H 2AK4A 5T33L 2YL9A 4PRDA 1HH9A 4H1LB 4LVHB 3BEVB 4WI8A 2DQFA 3Q1SH 3QUXB 3T3ME 4RL3A 3IDIA 5C08D 1A6VH 3MV9E 3FB8A 4ZO8A 5L2KD 5BXFA 3PGDB 3E8UH 2BXZA 1H1NA 1WAWA 1C5BL 3NVQA 4AZCB 2UUDK 4YUEH 3S4SB 4LEOB 3MLYH 4AD1A 5DDHA 2H3NB 3KPQA 1R5VA 1JNNH 3GSNH 3GKZA 2XIBA 1BVLB 4FQ1H 4P5TC 3ES6B 4E9LA 5DJAB 3H42H 5I1CL 2GJ6D 1T0PB 1TMCB 2P8MB 1EO5A 2EXYD 3DUUA 4RGOH 1DP0A 4F80A 4AZ8A 3MNWB 4Y19D 1TZ7A 1WQVT 5K59F 4RBPH 1ZLSL 2EYTA 3RZCA 1QWUA 1JHLL 1VEMA 5DJ2B 2HH0L 3I6LD 5F9AC 3PE9A 3EJTA 1V0NA 4HIEA 1TXKA 2EC9U 3QBTB 1NGQH 4P2OC 1E4XH 4ODUB 4K71B 3WY2A 5DJDA 4EDWH 1DN0B 1I3RA 5J1SC 3O3AB 4HKZA 1V7MH 3OIHA 1A6WH 3BIKA 2XFXB 3E2HC 5JXEC 4JO3H 1XF3A 4HDIA 1XR8A 4JVUA 4POYA 5ESQA 1M04A 3MREA 2PO6A 2JCCB 3UTSB 5E24E 2EDHA 3RMEA 4U6TA 1CGXA 2PUQT 1DBML 3OWEA 3ARBA 1QRND 3ZDZF 1I1AD 5FGBA 4BA8A 1D6EA 3CH1A 4K2UL 2R0WL 3OJVC 1T2QH 5GS0L 4M6AA 4PGDB 1OAXL 4WDIA 3TZVB 4PRIA 2NNAA 1NFKA 4OGZA 1Q0XL 4GUPB 1GNXA 5M03A 5H2BA 4OI8A 3AIBA 1PG7H 5CWSA 2X4TA 5HPCA 4QCEA 2VH5L 3RDTC 2B2XL 4JFHD 1M6OA 1HJQA 2WB5A 1NGZA 1HHGB 1TZIB 4QGTA 4MWFB 3OAZH 1IEBB 2C7UA 3GK8H 2OP4H 4MCZA 3FB7A 5IFPA 5DK2A 3T2PA 3CIQA 1JRHL 3MLRH 3MV8E 5CKAA 3LVEA 4KRUA 1UT9A 1OGGA 2QHRL 3GXIA 2UYLB 1RMFL 3DX7A 5CJOH 5JNYA 1TUXA 1HXMB 2OM5A 5LG1A 5B38B 1R5IA 2P48B 2DQTL 1QFWH 2UZYB 1KJ2L 1K6QL 2QMKA 1NLDH 4L8CA 2JIXD 4ZOCA 1UJTA 4C59B 4LHUB 4IPNB 1FFPB 3SCOA 3GSUA 4KPHL 3KPLA 4HS8L 5JXAH 3MRCB 3UAJD 1KJMA 1OINA 1AP2B 3MLPA 2VH5H 5HYSB 4G6JH 1DBKH 5A2IH 5E8EA 3M8OL 3WCYA 1FFRA 4OZGA 1QKZH 5CD5C 3W6LA 1JYVA 5H94A 3HG2A 1AFVH 4BFIA 4PGBA 1U95B 1MCBA 4NOFA 4NCC2 5GGSB 1PKQE 3SE3A 1HSBA 1T7XA 5HGDA 3DMMB 5TGBA 1WAAF 4WJXA 4LCYA 4NO5B 4PJBA 4NWTL 4FXGB 4NQDA 3U57A 5LQBL 4XMPH 5I8KH 1A9EB 1FO0A 4Y4HC 1UR1A 1IAKB 3DVNA 4OM0L 4XMKL 3O4LE 3CMOH 5HVWA 3CAFA 3SCTA 4DOHE 3L3OB 4MLSA 5CZVH 4ZE5A 3O3UN 2OL3B 1S7QB 4L4JA 2EAEA 1MIMH 3ZKXB 2WSPA 4HOWA 4I3RL 3UTPE 5I76A 3HI6H 5F72S 5AYUH 4A3HA 2AQ3A 3AXIA 4GJTB 2HKHL 3F5KA 2FJHB 3TA3B 3T65A 4GSDL 1NGPL 3V79C 4AT6B 3HRZA 2VDQH 1M7IB 4X9FA 1UQSA 5E9AA 4PCSA 3IRPX 4ZFOB 4QO1A 1RUAL 5CXPA 5IHSA 3HZKA 4YNYA 1Z5LB 3HZYB 1KCRH 2XNAB 4R4FH 3TOPA 5AWNH 2DSKA 3VFTB 1GOGA 4FQLH 2VX6A 3N9GH 2ENSA 4OLVL 2XTJD 4NM4L 4X80H 2PXYB 4JVPA 3JWDH 3ARQA 4JN2B 1S7QA 2GITB 5EBMA 5FK9A 1GOMA 3IAQA 1JNDA 4OUEA 3D0VA 5SWZD 4NQDB 2IXVA 5D2LB 2FHFA 1U8MA 1U8OB 1UKQA 4LSQL 3O41B 1OP3H 1OSPL 4MNHB 2AABL 4MAYD 3QXAB 1KG0B 4DZBA 4OQTH 1UEMA 4FFVC 2I60H 2E9LA 3HFML 4PGZA 5A2CA 1T1WB 2NW3B 5H94B 5ABFB 1GGCH 3MA7B 5F9WB 3U46A 2IALA 5HYSG 1JI1A 4PRHD 3P4NB 4RSVA 4XB7A 2WBJC 1FHGA 4HWBH 4J6RL 3DDFA 4Q6IC 4MXQC 1J0IA 4K9EH 2NX5B 3UR7A 3EOTL 4QHMA 4Z7VA 1MI5A 2BSTB 2XGBA 1G7HA 5SV3A 1ZBCA 2EYRB 1DANU 3U1SH 1LO4L 3EJJX 1N59B 4NRSA 3CDYA 4N0CC 4L9LC 1J8KA 3K2UH 4ZUUB 4MQ7B 3A21A 5D7JB 1W91A 2W0PA 2GCYA 5JBDA 1KNOA 1E0OB 1VEPA 2CPCA 2IH3B 5IHUH 5CCKL 4LNRA 4WW1B 2V7HB 4PJEF 2BCKB 5C1MB 3BVVA 3SJVE 4PUBH 3OSKA 2J7GA 4YR6B 2EE3A 2H2PC 4L8DB 2ZXDA 5HI4C 1NFIA 5DMJB 5JA8B 4EOWL 1BZQK 2CXKA 2VL5A 1LO5B 3RUGB 3EHBD 1P6WA 5KANI 1SJEA 1MHEA 1IE5A 4PTWA 4KVNL 5EOTB 2OL3L 1KGCD 5D71L 1PX4A 5CMAA 1N8ZB 1K3ZA 2CRYA 2W07A 5DEGB 1MREL 4GAFB 3AISA 3MCLL 4RGOL 4PJAF 2XYLA 3SDDA 4CVXA 4XPAH 4GRLD 5I66B 4HBCH 3K4AA 4KI5E 1VADB 5L7XL 2IQAB 2X4PA 5C07A 5TDOB 4P3DA 2ZUQC 4GG8B 4PUBL 4GBXC 1HP4A 5AY7A 2JCCA 5FYKU 2VOTA 4KK5C 3P9LA 3RTQC 1K4DA 5DEZA 4O58H 4AZBA 4J8RB 3AUVA 1W9XA 2ICEB 4D0BB 2IXUA 3EFFA 4XP4H 1WBYB 2CBVA 3D2UB 3O3AA 1OQXA 1QFWL 3WNMA 5HHNA 3BRDA 5DD3L 3IJHB 1K6QH 4JM2B 4KUZH 5BRZE 4H41A 2C3XA 1J1XL 2QV2A 3VXOB 4Q97A 3ARDB 3O45A 4EI5B 3MXVH 2EDNA 2EPNA 2AI0H 3DX8A 4K7PY 1P4BL 3W0WE 1RUQH 3VXMA 2CLVB 1A6UH 3B2UC 1RSFA 1IEBA 4NQEB 3V6ZA 4AIZA 3QHFH 4R7NB 2WW5A 4P2OB 4M6OH 4P0DA 2W65B 4CMHB 1YQVL 1B2WL 3RWFA 3WD4A 3BPCA 1S7VA 2DM7A 3S97C 3ZHLA 4XWGH 2P8MA 1E5NA 4P5KB 2ARJQ 2P8LA 1ZHBA 2CBIA 3MRNB 3EJYC 2M1KA 2B2XH 1G0XA 4I2XA 2OK0L 4UQ3A 4X9IA 4LLVB 1PYWA 1EMTH 4EN3C 1PAMA 4TUKL 3H3PH 4P59L 4RGNC 2DDQH 1F42A 4P23B 4XZUA 1OM3L 4DJMA 3QCVH 5GGUA 2WWMC 3QUKA 3T77B 1KQZA 4FTVE 3RTQD 1QLFA 4PY8I 4APQA 3VRLE 3VXTB 4Y4KA 2OXGA 3UZVB 4OUOA 3LS4L 5GZNC 1EFXA 5IVNA 3H3BC 5INDA 4GRWH 4GLRI 4ETQA 4I0PC 3MRBB 5CSZB 1G0DA 5B4MD 4HFUL 4Z0BL 3DSNA 1A8JH 1JD9A 1FC1A 4F33B 2HLFC 1MW3A 3RWIB 5I74C 3TT3H 1WT5C 2WLZA 3AM8C 3TN0C 3TPUA 4HKXA 1CVSC 4RMSA 2K3TA 1NEZB 3GSRB 2MPAL 5BZWB 1G7JA 2E6JA 2EDTA 3EJZC 2ADFL 4E41A 2VWEC 3SDDD 2V9RA 4G3YL 2V2XA 4FTVB 4XRCA 1ES0B 1NMAH 5IB5B 5IQ9B 1JFQL 4AMKH 4EANA 5C08A 3H54A 5J7CC 4WVRA 4NNXA 4TVPH 4U1HA 4N1CA 3SCVA 3H9SE 4DWSA 4IJ3C 1JFXA 2QADB 3WDPP 5JUVA 4OGXL 1WCQA 4L3AA 2XWJA 2OQJB 4WW2C 1W9UA 4NSKA 4JFUA 4PBGA 4RAVB 5GHWL 1MFBH 1ZKAA 2OTUA 4OD2B 4XHJC 5C0JA 4GG6A 1SBSH 4HWZA 3RILA 1WP6A 2NZ9C 4X7FC 3PQYE 2Y2WA 2FGWH 5EOQH 3QOMA 3QIUB 1RJCA 1YA5A 4O2FA 3GSRA 3WFBL 3HHRB 1AI1L 3GSVB 2FE0A 2CK0H 4N5UA 3L4XA 1HHKA 1QSFE 2HKHH 3CUFA 4LLUA 2AK4B 1Y7VA 1OLLA 2J5LC 4OCSH 1J8HE 3WY3A 5ENWB 1BQSA 1HWHB 3LMJL 2E6QA 1I7TA 2F61A 3BVUA 1XR9A 3D3VD 2UY4A 4HZLA 3VNYA 2VABB 3LKRA 3HG4A 4UT6L 5T1LD 1J9CT 4IM4A 1FFOA 1RUMH 3B2VH 3UTTE 1T0OA 4FQLL 4XRCB 2A1WL 4RWYL 1FG2A 3BW9A 3IXAA 5CAYB 1WIPA 3BPLC 3DI3B 3RNKB 3WLBA 1F3RB 3BDXA 3OR7B 1TVBA 4KZDH 2R56H 2IBZX 4M48H 2HFFA 2OL3H 3V4VL 3PF2A 5ACMA 2G3JA 4UFHA 4GMTH 4G8FA 3ECBA 5DD1H 2MTPA 3GSWB 1N0XL 4W89A 1OL0A 2XACC 4OQTA 3UYRL 2XVLA 1UACL 3WHXB 4PGCA 2VLKA 1CLZL 2O26U 3RWFB 5IFJA 1PLGH 1ISXA 3PWPB 2IQ9L 3A6BH 4ZAKD 1ODUA 4GO9A 3NN8A 1X5GA 5IV2A 1MJ7H 5DRXB 1I9IL 5D5ME 2NT1A 1NARA 3X13A 2V5SA 2XWJB 4K3DH 3J8F7 3TYGH 3FOLA 4I2XB 4OLZH 2OJEA 2WLYA 3I6GB 2EYSB 3QULB 3GMPA 4FZEH 3WN5A 1CN4A 1AR1C 1WC7A 4BYHA 3EJSA 3DIFB 3RM4A 4PLJD 4UFMA 1KB9K 2IF7A 3AU1A 5D7IB 4X0NA 1IRAY 2LV4A 1FA2A 3ZDYF 3BKCH 1XIWB 3EGSB 4J3VA 1QLFB 2M26A 5HHOE 3SO5A 4LLQA 1IT9H 1MNUH 1Q4NX 2YWYA 1FAKT 4PRID 5DD3H 3TO2A 1IAIL 1JXKA 1EHNA 5GNXA 1BQUA 5A2KH 3OLDA 3MRHB 3RI5F 3GBNL 3BPOC 3ZT6A 4JM2F 5FO8A 5A2AA 3NPZB 2FR4A 3F5WA 4FFYH 3QUMA 2CO6B 3JV0A 3H53A 1H5BB 5C0BA 1M1SA 1HILA 1S7UB 1A7OH 1VBRA 2G3MA 3A6BL 2VLLB 3P9WB 4LXFA 4ESKA 5SWQB 2WKGA 4OLZL 4P2OA 4BH8B 3BZ4A 3CFJA 3U6RB 2O61B 1NWRA 4GQ9H 3AIQA 2IPTH 2QKIB 4XPAL 3IDNA 1SVCP 3RWCA 4U4BA 4XNUH 1KSRA 2VLKD 1LVEA 3IS0X 5AD0B 4FFZL 1KEGH 3JSSA 3ULUF 4JFFE 1T80A 4I3SH 3ZR6A 4CVXB 4F7PA 1CXKA 4W5UA 3WD5H 4N0YL 4OF6A 2VYRE 1A0QL 1JWUB 4OM0H 3HPJA 3MUJA 2EKSA 2MJWA 1WAAE 4JO4L 4KROC 4LCWB 1YEIL 5EU7C 3DGGA 5FA3A 2EYRA 3MNZA 1S7VB 4M7ZB 2CYGA 1V6YA 4S1RH 4ZTPH 3CUJA 5FXCH 4JM4H 2G41A 1NFDA 3TVMD 4AL8H 1CDUA 5D7LB 1BWMA 5DJXA 3N0PB 3CFEB 3WQ8A 4WWID 5HHNB 2ITCA 3IU4H 3T0AA 2FEDC 4YPJA 4PJCE 3NABH 5IESL 3RY5A 5L2JB 1H3TA 2GJPA 2A38A 3ZE2E 3MLZH 1A3HA 5CILH 4F8QA 4G42A 3A4WA 1KCVH 4JPIA 2F8XC 1MFVA 5LA0A 1CDCA 1EUTA 5MERA 2Y8VA 5CP3H 3D1MC 1F5WA 4Q6IB 2EKJA 5TPWH 4WTXA 3TYFB 3SGKC 1JXJA 2OJZH 5HDQH 5E00A 4G9FD 4PG9A 3INUH 5DJ6A 4Z78A 2A0LD 1Z9MA 2FGWL 1MFBL 1QHPA 2O5YH 5EOQL 5IB4A 1RHFA 2DQGH 1P2CB 1K8DB 2Q3AA 3CC5A 3BKML 4JN2A 1AO7B 4U1GC 4S2SB 2ATPA 4NQVB 3C2SA 3MA9H 5JXED 4P7RA 2AABH 2IANA 4CD5A 4YNYB 4YFEA 3W37A 5DRNB 5ISZE 4HCRL 1S7XA 4YGAB 1N26A 1GGCL 2GFTA 5AZ2L 3QQ3B 3A3HA 4CCCA 1FCGA 2EIZB 5JO5B 5AYBA 2RB8A 1U8NB 1RUML 3KLAB 5MP6H 1OAQL 3GRWA 4P2CG 4LPVA 1GONA 1UKOA 3QYCA 3EJUA 3ZSSA 3GHEH 2JKXA 3DX6B 1KJVA 1CLCA 4OLXL 4HUKB 5IBTH 2P5WE 1A4KA 5CIPH 3PZUA 5CJXC 2DQEL 2KQNA 4GKOA 2F53E 2IH1B 3MRRA 3FFDB 1JPTH 3V4VH 5TQ0H 1CD1A 1KJ3L 4ZFOA 4HXAH 1DVFB 2AJXL 5F7DB 3UTZA 3HUJE 5BZDA 2YFOA 3PHAA 1MJJB 4BM7A 1UACH 3RL1B 1HJVA 3H0TA 1JTPA 3S5ZA 1GGIH 2ZIDA 2YPVH 4HOXA 2GUOA 5JDJA 3SOBH 4Y1AA 2C8NA 4KVNH 3D3VA 5FOJA 3KPNB 1B3XA 3REWB 5T1LA 3TVMA 3MOAH 3MX0A 4P2QE 4M8QA 3FXYA 3T0XA 5C3LD 3MRFA 4C56D 4KJWC 4OZIE 1DVFA 1OAQH 3MCKB 2PTUA 5EUOE 3MCLH 2UY2A 2WWMD 1WWWX 1FO0B 3QSKB 1L7IL 2VZSA 3LEVH 4L3ED 4MJIB 3D50A 1GC1C 4WRLA 5T1MA 4FG6D 4PJIF 4I9WD 5F9JA 3CMJA 2YD2A 1PZ5A 1FPTL 4U1NA 2PXYA 4G5ZL 5J3HC 3AHTA 4MJ4A 4G9FB 1BD2E 3R0MA 1JL8A 4MMXC 5HVFB 5AG8A 1TVNA 1NGXB 3RPIA 2JJVA 2VXSL 4G7VH 4M62L 3KPPB 3QDJA 1T2XA 2XUCA 2AV7A 4PUDA 1UHVA 1J11A 1VFMA 2X1QA 1TZIA 3S37X 3A4XA 4XP4L 5KVMC 4CVZA 4HHAA 4NCC1 3ABZA 5IBLC 4MXVF 5KZCB 2EIZA 2WMKA 3UPCA 1I8KA 2WWDA 2UZIL 2VISA 4Z7NF 3PDOA 3ROLA 4ZENA 1UH3A 5KJRL 3SIMA 3H2WA 2X4TB 4B15A 4CJ1A 5D93C 3TNNB 4IMKA 1AO7A 3GTNA 3IDXH 4NPYB 2ZUWA 1AIFB 1FGNH 3PL6D 1LF1A 1WZ1H 4UILL 4OZIB 5E94B 4ZNEE 4YXKH 2B4CC 4JFYB 4KU1A 3GMRB 1CDYA 1N5YL 1G7QB 2BVYA 1GJUA 4L4TA 2XM2A 4N0YH 2OR9H 3MV9B 4FG6C 1QI2A 1B3ZA 4WHTA 4I3SL 4AH2A 1HSBB 5HGDB 3FO1A 2Y9RT 3NOIA 5KSVA 4FXGA 1YY8A 2A73B 5FYJD 4Y4KD 2VVSA 3DXAE 1EVTC 3B3IA 3TBTA 1HEZA 4GQQA 5IOPB 2PCPB 4GKLA 3LPPA 3D87B 2AXGB 1XF1A 3VU2A 5BMFL 3O4OC 5T1DH 4DCQA 2E7BA 1JF1B 3GDBA 4HQQL 5E0QA 3CFJB 2VERN 1EO8L 2GTZB 4JANA 4K3JL 4LLQB 5JOPD 1AD9B 4PJIB 1CFQA 3HR6A 3TNMA 2BC4A 5EU6B 1UB5B 3X11B 1U0QA 1MCCA 2OLHA 4YXLL 2N1KA 3NZHL 1ZANH 1AHWB 5BCAA 3H9SB 4LKCB 3ZO0A 4XP6H 2YOCA 3LQAH 4PIRF 4JY4A 2OBGA 1AJ7H 5IF0B 5CLWA 1WNOA 3BFOA 3FB7B 5DRXA 2ESCA 3S35L 2W62A 1YEJL 3BKYL 4OTXL 4FN0A 4R7DA 1Q9OB 3S3PA 2B1HL 4GRMB 3QUML 1AGFB 1A6WL 3SCNA 1RJZB 2DB8A 4ZAKC 4ZPVB 4NO0A 2FWOA 3QWQB 3TBVA 3V6FB 1FL5A 4UFIA 2VRJA 3VDCA 4XAWH 5JMRA 4PJ8D 4A3YA 3PHQA 3ZZ1A 5TF1L 3MR9A 5DJYA 2PBOA 1X5JA 1CQYA 3WO3B 4DKAA 4HU8A 3V7AG 5I19H 2VXQH 2F54B 2FYVA 1DUYB 1W72B 1Y18A 4X8JA 3UBXB 5DHYA 2F7PA 1XH3A 3AS1A 5TH2A 4YIQA 4DTGL 2W5FA 1KIQB 1D5BA 4M56A 1EJOL 1WISA 3DROB 3P11L 1RZ8B 1TJHL 4RISH 3KS0J 3VRLF 4NI3A 2X2JA 1T66C 1LEGA 3H7LA 4MCYA 2VXVL 4ZXLA 2G75B 3MU7A 1Z9LA 3F5LA 2XTJE 4JPWL 3TEUA 5FGCE 5HGBA 1A6AB 1WEJL 5GGQL 3NA4A 4JDZA 2A1WH 4RWYH 2PYEE 2AV1A 8FABA 1R7AA 1SFSA 4QF1B 4XNZC 3R1GH 1XGTA 5JPNA 5HPMA 3GK8L 3ULVD 3QDGB 1GZQB 4ELME 4GXUM 4HIEB 3T0EA 2R56L 4ODUA 3B9DA 1N6UA 2VZVA 4RZCB 3DHUA 4GBXD 1M01A 4OZHB 2DKMA 3MOAL 4OT1L 2CDGB 3VH8A 5F89B 1NP2A 5F7MC 4JRYA 2VABA 3F7QA 1KJ2H 2KQMA 1JAEA 3MXWH 3MGTB 1NCNA 4GKSA 2RAMA 3ZE1E 1ZVYA 1CE1H 3ZQ9A 3RNKA 4KPHH 3GI8H 3S5LB 4HU0A 1FLTX 1GGYA 1KLUB 2ED8A 3GSVA 3EDEA 3VIOA 4G7VL 4Y2DD 5A6LA 2XN0A 1UWGL 3MMEB 1EOKA 3BT2L 2GHWB 5F97E 4HH9A 4QTIL 3O6KH 4EAMA 2VXSH 4M62H 2QADD 5IBTL 3QDMA 1KCSL 1MCLA 1QRNE 5C9JA 2OMBA 4GOSA 2WC7A 4NSKB 3TWCH 3RVUD 2F54A 3BKCL 2LABA 3V0VA 5TQ0L 3WH6A 1GAFH 2NSXA 2ARWA 3BUPA 3ARBD 4C54A 4M93B 1T7VA 1E4WH 4PJBF 4JRYB 1NGYB 4ACPA 3MMUA 1IAIH 1BLNA 1CXEA 1MQKL 1U8PB 2YN3A 3BWAA 7TAAA 2CKNA 3GBNH 3GKWL 4EN3D 1PKQB 2XZCL 1QFWM 4OGYH 1YPZF 4LQFH 4AIOA 1HXYA 1MEXL 5ALCH 4OZHA 2IBBA 4KI5F 4X4XB 2XN9D 1GOOA 3DV4A 2OWXA 4HV8A 1L9MA 2DL9A 2EDYA 2NYYC 3MJ8A 3SDXB 5A95A 4HEPG 4F8XA 4ZTOL 5GS0C 5D8ZA 3G5ZA 3HMXH 5HGHB 4L1DA 4LDOB 2A6IB 2WP3T 3ME0A 4XC3L 2OW6A 2C1PA 4IHOA 2EPLX 4PV8B 1JTOA 3O6KL 4MQTB 2DIJA 1FJ1A 1KPUB 1M05B 3NCJL 4HGKC 5CHNB 3X14A 5AWNL 1BEYL 2E8YA 4TVUA 2UV3A 3MV7A 3RGVD 1RJZA 3MMEA 4X80L 1EXUA 3O2WH 4IRJB 3DO7A 5TJWK 4M00A 3O6FA 1MJ8L 5TDOA 4B5EA 1ISZA 1P1ZB 3QO0A 2NTSP 4JFZL 4P5TB 3RVUC 5T1DL 3VIPA 1JDCA 1V6WA 2HVMA 2P5EE 2R4SL 4ZDHB 2IMNA 1PD6A 3VFWB 4HX1B 4JFXB 2VITB 5DSCB 1VFUA 4XP5H 3UJTH 2BFVH 1S9XA 4D0BA 4D6CA 3GSXA 5CD5D 1XD1A 4Z7QF 3SGEI 2VDOL 4AL8L 1KXTB 3WXWH 2R9HC 4NBXB 3MBEC 2J8HA 1FBIL 3FO0H 2NXZB 1AD9A 4EUPB 5E8DH 2F5BL 5E09A 2GJ6E 1WDPA 3AHVA 5KSBB 4ZG1A 2YMXL 3LS5H 4PREA 3ZHDA 5F1SA 3BPNB 4S1QH 4WW2F 2CLZA 4FFWC 4F58L 1UA7A 5JPNB 3WFHB 5IJKC 2FATL 4QF1A 4PMVA 3O2DL 3LEYH 1BIHA 1LD9B 1KBBA 5F93C 4MZ2A 3THMH 3ZE1F 1ITBB 5LVEA 4OF8A 4WW1A 4PJIA 3WNOA 2DQGL 2FJFB 2WUCL 5DJZA 3SGJA 2VXQL 3OGOE 3GGWA 4Y88A 4FQPA 3O0RH 4LEXL 5DXWA 1YJDL 5ICXA 4FMFA 4PRPE 3ARSA 3T0EC 3ARFB 3ARDA 1KUMA 3KR3H 3O45B 2CBJA 2BVOA 4QHMB 4Z7VB 1NLDL 5IW1B 1V3JA 2J8UF 2EECA 1MAKA 1QG3A 3AMGA 4TULL 1DEEB 4MJ5A 3AJ7A 1TJHH 4NRYA 5D1QA 5EO0A 2JELL 2P24A 2G5BA 5E8DL 4WUUD 2R2HA 2ICEA 3VXQB 1S7WB 5IM7A 1HHIB 5ETUA 1NMAL 3MLVH 3PIQB 3D2UA 1CQKA 1VAHA 4KDWA 3ZSTA 5IKCA 3SQOL 2D7QA 3HKFA 4ODXB 5FIEA 4GG6F 4GAGH 4MD0A 4JKLA 4P2RD 4NQXB 3KLSA 3AREA 4WFFE 5E6IA 4HGMA 4U5IA 2L4OA 1LE9A 4M1CD 3EBVA 4XX6A 1UXWA 4OKVB 4RAUA 2ZOKB 3G6JF 3QNZB 2GAZA 5GGTL 2XZQH 3NIYA 3OHXA 2J88H 5GIRA 3GUTA 4PRAA 4MNJA 3RDKA 2R4RH 3MFFB 1W9VA 3NAAL 3QXAA 5FM5M 4DZBB 4J4PC 4AD0A 4NQCD 5DR5L 4Y7EA 2NMSA 2IH3A 4D3CL 4P7NA 1YUHB 4N0FB 2Y36L 3V2AR 3P4LA 5EUKB 4WUUE 2ESVA 2XN9A 2IC2A 4QRSA 3DRTB 3X3FL 4CNIB 1LE5A 4A6YL 4Y4KC 5ESAB 1L6ZA 4ZAKA 4DCQB 1TCMA 1BIIB 1HHHA 4Z5RB 1JPST 4X9HA 1U6AL 4OIIL 3KYKL 1NC4D 1H3UA 1U8JB 1DE4A 4P5MA 2ZX7A 4KXZH 1E4XI 3QHFL 3SUUA 1R3HA 4LLAA 1A14L 4JRYD 4R0LB 2C5DC 1FP8A 1B2WH 4MAYA 1PDKA 5HI4D 3TC9A 3KHOA 3EMZA 4U6HA 1LL4A 5I17A 3L4VA 4D9RD 4GXPA 2UY7A 3UJIH 3QIWA 4KZDL 2JJSA 2YC1A 2XN9E 4WUUA 4BSJA 3K74B 3ZKMC 1EBAA 2GJZA 1GAFL 5IT2H 3RIKA 1BZ9B 4M1CC 1O7AA 5GS3A 1W0YT 5IVOA 4ONOA 4JFYA 4P9HH 3U46B 3HE7C 5A69A 3PZMA 3QXWA 1FVEB 1EHLL 4RNRA 3MQIA 4JE4B 2Z8WC 2I9LB 2EDFA 3MNVB 3OV6A 4G6KH 3W6MA 4DKDC 5JA9A 1K9EA 1MYRA 5EOCH 3HZKB 2H32A 4NN7B 3T0BA 3TO4C 4BZ2L 1FLRH 5E5UB 4HIHA 15C8H 1EZVY 3IDXL 4PYSA 4QXGL 5KS9A 3CDGB 3FT3A 1CE1L 3Q5OA 2ICCA 1N2RA 1OSZA 4I1NB 4PJDB 2ADFH 4HMCA 5TFSL 5CJXA 1QW9A 5GS2D 1ZA6A 3ELAT 1D5MA 5M17A 1HYRC 5LGJA 4XT1C 1UM4L 5A2JH 3PJSB 1TQUA 5HHVL 2VLRB 4MA8L 4QRSB 4QHUB 4CU7A 1HIML 1GH7A 4ZQKB 2MANA 6CGTA 3GGWB 1DQLH 4KMTL 4ZPTA 2ZX5A 1KACB 2VDOH 4KHXH 4DO6A 5DRWB 4XP5L 3UJTL 3B43A 3RGVA 1KELL 1P5UA 4TX6A 4OJFL 1FBIH 4BQBA 1HHJA 3REWA 3TVMB 4X6FB 3P4NA 2XZCH 3PWJB 2R2HB 5FM8A 3KPMB 3RWEA 2OL3A 15C8L 3M7SA 3WXVH 4P46C 5CPTA 2ZSWB 1BAFH 4OZFH 4WO4D 3U0PA 5GRYA 5FAAA 1C1EH 4G8EA 1M71A 1BPVA 3TJEL 2HWZL 3MJ9H 3C6SA 5DVMA 1E27B 4WFHE 3VUPA 3SDAA 1KTDB 4EUPA 4JFEB 2ZP0T 1BQHB 2BY3A 4NQXA 4KTEL 5SV4A 1DWJM 4JHZA 5GGSA 2DJUA 5SWQA 1DTUA 1OAUL 1NKOA 4D8PB 3OB0K 2JFEX 2AXFB 2R1XA 2DMCA 3CPUA 4I0PD 5HHXH 2B1HH 1V3MA 4KMQA 3BSHA 4MSWB 2VDPH 4EI5C 5IFHL 4GS7C 2GI7A 1KJMB 2C4FT 3ORJA 5E03A 3VFSA 3DMMC 2R29H 4Q9CA 2OTPA 1PVHA 2QQQA 3BAKA 5D72H 3X3GL 2GYSA 4IM8A 5I1IH 4XNMA 4HUVB 3X12A 3P30L 3M17A 1P7QB 1ZS8A 4JGMA 5TF1H 3VSUA 1SMAA 4AD2A 4LFHG 1KB3A 2NY0D 1UYWL 4JG1L 3DRTA 5DI8B 1SEBB 1JNNL 2YUXA 3NGBB 4WFHD 2R4SH 4YWGL 5D1ZD 3OF6A 1Q0XH 5D7IA 5B38A 1W2PA 2VQUA 1B3YA 1RUQL 4WFED 3O8XB 5I1LB 4X7TA 4D0CB 1OSEA 3BSGA 1SY6L 4LOUC 5J1AB 4XBPB 1FNFA 3BP5A 3EOBB 2HH0H 5E4EC 3MLTB 4NKDB 5IVXA 1BX2A 3DRQB 3OZ9L 1S3KH 1XCTB 3LN5A 5DEFB 3T1FA 4LEOA 1MFDL 4JPWH 5HYEA 2O5YL 3IYLW 4G6MH 4R4ND 4ZO9A 1HXYB 5CLTA 4F2MA 1W9BM 1DQJA 1EMTL 1JN6A 3ZJKA 4WI4A 3WJLA 1UC6A 3ZM8A 2CKBH 1ZHKA 1LO2H 4TVDA 1NGWA 2Y36H 1U93A 4ATWA 1RZJL 4E2OA 4PJDE 3IF1B 3QG6B 4Y2DB 5D9PA 4ZUTB 4ZUWA 3OKLA 3S9DB 3TESA 5JW4Q 4HA1A 1DEEA 4KQ4H 2F54E 3K8MA 1U30A 3O6FB 4KKCD 4MNKA 3QDMB 4HWNA 4QLKA 3QDME 3VIFA 5FYJU 4AMWA 3C9NB 1T1ZB 5KANG 1KXHA 2X4NB 4IDLA 1QI5A 2QPSA 1TTFA 3AZSA 2E3VA 4IRJA 5FKPB 3CCHB 2DQUL 1IMHC 3DIFA 5F7YC 2D20A 4P7LA 2ITDA 2R0KL 3MCG1 3MLVL 5HI5D 3RVWD 1FL6A 2IUZA 4BCEA 5CHNA 4Z9KB 3X14B 3W0WD 4UDUB 2WBJB 2EEXA 4KKBC 4KTDL 3HC3L 5DK3A 2CIKA 4NYLB 4DKFH 4HW6A 3AAZA 3V52L 2J62A 3QPQD 5L6YH 2CHNA 3VH8B 5IHRA 4N1EA 1NUNB 4HH9B 5EZIH 5JW4R 3CFCL 5EOCJ 3N15A 2EYTB 1RUKH 1I9RH 1HHGA 1T5XA 3U4BH 3KWWB 4Y5YC 5GHWH 3S37H 1AQMA 2VC2H 2XZZA 1WF5A 5FEBA 1SBSL 3NFSL 2DQIH 1WO2A 4P7OA 3HLAB 4Z95L 1T6VN 1WCGA 2PYEA 4JHBA 1V3IA 1KPVA 4LPUA 1L4IA 2WNGA 3UO1L 4H8WC 1P1ZA 1DZBA 4NO0D 3MRHA 5CQ1A 1GL4B 4JKMA 5IQ9A 3KLHC 5DFAA 1PPIA 3QNYA 4KJYB 3ARGC 5C2BH 3OJDA 2X89D 3WEXB 3PGDA 4PJ8B 1YN7B 5HHVH 4XB3A 5HI5C 1RZGA 3ZKXC 2YD7A 1T03L 2OQJA 3T4AA 3WN6A 1XR8B 1E0WA 2BOBA 2D24A 1Q6CA 2N4IA 4LLUB 4OCRH 1OW0A 1MHCA 4GKZB 4X5XA 1BFVL 3HLAA 2AEWA 4JFZH 1U8LB 4X5LA 2Y23A 5CEXB 4Y5XB 5F89A 4NN5B 2G3NA 5CJBA 1G5AA 1NDGB 5C0NC 5I2IB 2E8ZA 2F54D 4AEIL 2ZX6A 1JFHA 5DJ2A 3ARUA 4PS4H 3GH4A 3NIFE 5JR1H 2ED7A 4CW1A 4J6RH 3VILA 2WMGA 1QHOA 4O02L 5EU6D 3FQTB 3S88L 4HSQA 1JZ5A 1DUYA 1W72A 1Y18B 4X5XB 5ID1A 2WANA 3AAZB 2NY0B 3N85L 1REIA 1JDDA 5AZ2H 2H45A 1EV2E 4FNPA 4BH7A 4P5KA 3T4AB 1BTCA 2J7DA 3FT2B 2NTFB 5C8BB 3TBWB 5SWZA 4NJ9H 2R2BB 2NXYB 1EIBA 2WWCA 5BVPL 5FCUL 4NM4H 4PRPB 4JY6A 4NQEA 2VDMH 1Q9OA 4Z7QE 4G8IA 4NKOB 2Q7YB 1T66D 3MYJB 5GGVL 3TVMC 3L5IA 4JG1H 2W60B 5DC0A 2WUCH 3L3GB 5I1IL 4YWGH 4MZ3A 3KXFE 3GB7A 2NR6C 5KG9A 1EO8H 4ZO6A 4NN7C 4LSQH 1ZHBB 3EJQA 1QFHA 4UTBH 4Y89A 5JIHA 5HYFA 5JTWA 3HAEG 1HSAB 1QFPA 4K2UH 2BHZA 2NW0A 2YUWA 3K80A 4N5ED 2Q86A 3VWJA 2GJ6B 1M7DA 3NFPA 4L4TE 3SKMB 3VXMB 3WXVL 4FMKA 1J87A 1I7UB 3IJYB 4XNYH 1A3LH 3VJ6A 1JAKA 3E6FA 4ZNEA 1GHFL 1OWWA 1V5JA 2JLLA 1AQKL 4V2CB 1AHWC 3BP5B 3CVHH 3CVHB 4W84A 4PJ5D 2JIWA 5L0QC 4BQCA 2H1PL 2VZUA 3W5NA 3QH3B 2Z35B 4NKDA 5IVXB 1MXDA 1RU9H 5HTSA 4NO3A 1ZLVK 3CZLA 5E2UH 4ML4A 5HYIA 2EPOA 2FL5A 3GMQA 3O11A 1PBGA 1T83C 5L2KB 5EUOB 1JGVL 1HVXA 2NY5C 2QJDA 5MEPB 4CAGA 4N0CD 2XZQL 1P7QA 3SE8H 3L3JA 2IWGA 2JJTC 1RD6A 1JF1A 2WVVA 5DD0L 2CIIA 1A3RH 1PX3A 1RK1B 1F4YL 3TP4A 2YSSA 1TR1A 3MUGB 3X3FH 1T0NA 1VBUA 3T2OA 3PG2A 1BD2A 1KFWA 2DMBA 5BRQA 2DDXA 4LLMB 2D0HA 4ZFFA 1VGEH 1DBKL 4PRWA 4YX2H 1P7HL 1GIGH 1CT8A 5IHLB 1LK2B 5EZLA 4LRIA 3GIVB 1WEJH 3EDJA 3CX2A 3O9WA 3WS6C 2H26A 4S1SH 3ZT7A 3S8WA 1QKZL 1KF9B 3R1GL 4YBLC 4P3DB 1EGZA 4OZIA 4ATDA 3FZUC 4HC1A 2VL5B 1S7TA 1YNKL 3KPNA 1G7QA 4L4PA 4TNWK 5I1HL 2OR8A 1DCLA 4CJ0A 5A2FA 5ABFA 4Y1AE 3TCXA 5MEQA 3C8DA 3AMDA 3PABA 4FP8L 4NOBA 4B53A 5EFFA 3QAZB 4CDGC 3TF7C 2XG5A 1H49A 3HNSL 3I9GH 4LSPH 3LH2L 3JTTA 3WUWG 5DRWA 4AYGA 1XF5B 1AGDB 3MA9L 3HG3A 2Y7QB 4PJ7A 5IHZB 4I5BB 1YEHH 3SE9H 5IB3B 5CJQL 4OSUH 1QVOA 2APBA 3HMWL 2DN7A 2AI0L 1A1OB 2OSLB 5KSAA 1A4KB 2J1KA 4I8DA 1DWFM 2D03L 2P5WA 4BH7B 3QP3A 1N3NB 1QX1A 3L3IB 3IJHA 4JM2A 4NNYB 3M6DA 5E8NA 1UWXK 5CEZE 3FB5B 4K07A 2R2CA 3ZYIA 2ZUSA 3G6JA 3A23A 2VXTL 3I75B 3MYZA 5D8JH 3HMCA 1K9FA 3P77A 3B2UD 1KCRL 4PGEB 5IXEA 3IJ7A 5I1HH 3QA3B 1P84K 1GXEA 4QWWD 1FC2D 4ODSH 4FMVA 3L7FA 3N9GL 4HUWA 1CDIA 1W0WA 2DQEH 1MHHA 1S7XB 3QEUB 1A7QH 6FABH 4H0HB 1E4WL 5ISZA 3WE6A 3WO4C 4TUKH 3S5LG 4P59H 3O3BA 3EMQA 4FXKA 2CKBB 3C8KB 2IANE 1WCBA 5E94A 1U36A 4ODWA 3ARDC 3BP7A 2W0LA 3SBWA 1T1WA 1G9NL 1MH5B 5F9OL 1YZZA 2FHCA 3FN3A 4YK4B 2DOCA 1MJJA 3V0WL 1N4XH 4OJFH 3U0WH 4WUUB 4G9DA 3UTQB 4W68A 5LGHL 4R4NC 1VF8A 1ZWIA 1BZ9A 4R3SA 1A9EA 5DMIL 4XC3H 4BSVB 2A3EA 4PGEA 3CUHA 5I19L 1Q38A 3RA7H 1HQRB 3DLQR 1RIVL 3QA3A 2JB6B 1W1TA 3W53A 3B5TA 4R0LA 3LMYA 2DKUA 1MVYA 1XV8A 1MQRA 1GGTA 1U2HA 1QFWI 1FH9A 4U6HB 3ARYA 4JAWA 2HLFD 3A0OA 3D2UD 4PJCA 5ITFB 4HPHA 2CNCA 4P2RB 3N9KA 2D9QB 1LO4H 5CCKH 3MLXL 1KJ2B 3GMNA 4AWEA 5E4EB 1C5BH 1MCPL 4DWSC 1PZ5B 4XVJL 2JJSC 5EIIB 5IHUL 2Y7QA 1YPZB 3SDDC 5I16A 1NFDE 3ZYJA 3MLYL 2JALA 1V3KA 2ESVB 5F9WC 4M7LH 3MRKA 2P8PA 4NO5A 3S96A 1I75A 4G9DB 3UTQA 1UB6B 3IDGA 1FQ9C 1RQ5A 2FZ3B 4QY8B 3ALFA 3BKJL 1QLRB 1PKOA 1LL7A 3LAFA 3VM7A 1JGLH 4TNVF 1ZJAA 3RIAF 5KOVC 4LHUD 1ND0B 2VZOA 4OZGB 4HF5L 4V1DE 1KXVC 4JFFA 1T2JA 8A3HA 2ATPB 3B9EA 3AHZA 1EAPB 4LCWD 4HFWA 3L7EA 3LS5L 2WUBH 3GIVA 1EGJL 4DM2A 5C0FA 4IOSD 5D4YA 1SY6A 3LOWA 1JDAA 4BFEA 1U8MB 3O2VH 1AVAA 3BLKA 3ALPA 4HBCL 2W92A 3WSUA 4Q6IA 1FH5H 1B3JA 4KTYA 1DEDA 1MY7A 1I1FA 3K7UA 4PJ8C 4M7ZC 4OD1L 4WTZG 3WEZA 3QEHA 5C0BE 3L3IA 4AQOA 3SJVB 2AKRB 2MQCA 3W9EB 4IRZH 2CQVA 5CEYA 2NXZD 2A3HA 2ITCB 3ARFA 2EBNA 3HNTH 5IP4A 2DWDB 4LSSL 12E8H 1MCWM 2XRAH 3U30B 5I8EA 3EYUL 1X6NA 3V5HB 3GXDA 3S34H 1TENA 3O81A 1BJMA 3PWPE 5MHSE 4HQQH 3VXRB 4RGMC 4I77H 1MRFH 2ZCHL 2A6DA 3LKQA 1P7QD 2BY0A 1K2DA 2PW2A 1XCTA 4LCIH 5BXPA 3WLWD 1P4BH 4YX2L 5ICYB 4PRIB 1MEXH 3CSBA 3D85B 4JAMA 1F6FB 3CZKA 1BBDH 3CC5B 4M4PA 2XPKA 1WZMA 4RE4A 3NIDE 3MUIA 1I9EA 5IUSA 4PJFB 3QXVA 4K7FB 1KR1A 3ARBB 5E1HB 1FN4B 4XWGL 5ICZA 2C1OB 3TO4D 4ONHB 3CMGA 4MWFA 1I7RB 5A2LH 5C0AE 2H1PH 2Y5TB 2AMGA 2FB4L 2V38A 4FZEL 4OFKA 5HGGS 5I8EB 4BZ1L 2WM0A 4OTXH 3I9GL 5ANMB 4LSPL 1QI0A 4JPIB 3J7HA 4CDHA 4GW4A 2X5PA 5IJKA 5IEHA 25C8H 5D7SH 5JOPE 1R33A 1YEIH 3DX1A 1ORSA 4Y5XC 3FAWA 3RZCC 3U4BL 2ZSVB 4YDLB 5CJQH 3SDYL 1BVKB 1RK1A 3OKYA 2VC2L 3BESR 4M3KB 4G8IB 3NSXA 1D5ZA 4NKMB 3VI3F 5CPSA 2DQIL 3PHSA 1OTTD 4P5TA 3P9MA 4JQXC 4P4KD 4QXUL 4PJXB 1XIWA 3EGSA 1RJLA 1VFAB 4Y2DC 5JUEL 2W0FA 3ALWA 4I18C 4JY6B 3RJXA 2WBGA 5H35A 4U3HA 5C0AD 3WFDL 1ZJBA 1OTUD 4HKJA 4DGYH 1ZTXH 4D6IA 3GJFA 4DWHA 4DGIL 1NP0A 1UH4A 1FFQA 5H8DA 1W2KT 2NTFA 3QIUD 3DX0A 4JRXB 5EU3B 4IDJL 3CZ8A 1IC5H 1EBPA 1ZA3A 3L6FB 5AD0A 3IJ8A 3WBEA 3BOVA 3VJ6B 4AISA 4P4RB 1IILE 3I84A 5C8JA 1CL7H 4N5EC 1MIML 2X9XA 2D7OA 1KGUA 3PQYA 1G9NH 2FIKB 4QRTA 5F9OH 1QBLL 4P3WA 1KXTA 2PC8A 1T04A 3PP3H 2BZDA 1Q94A 3A6CL 2NX5D 4X4ME 5C09A 1KLFA 4JO1H 3PWLB 2BJMH 1RIVH 4EK7A 1FLRL 1GZPA 4J28A 1I3VA 3MJ7A 3RHWF 4J4PA 3WFBH 4JDVB 4LPCA 4JFOB 1A4JB 1DDHB 3SPVA 4IDJH 5KVDH 3RGVC 3ZTJH 4E41B 3BW9B 1X7QA 2E9BA 4E41E 5A40E 4DN3H 3AOFA 2BNQD 5CS7A 4OFYD 5HYQB 1MCOL 4M7LL 3BEVA 5CJ8A 5D8JL 5C92A 1XGZA 1GVYA 3WS3A 1AQ0A 3QIBB 1CDBA 4KWUA 2M2DA 4I3GA 1KCUH 4MJ6B 4U2YA 5A6AA 4LOUD 5BVPH 5E4IA 3EJYD 1J8HB 1I8IA 3BP7B 3F58L 4CMMB 5FDWA 1PY4A 2IG2H 3UCRA 1GGBL 1NKRA 5GGVH 2FDMA 5A8NA 1U91B 3L3KA 4DZ8A 1Y6MR 3WH9A 4AD4A 4ZD3H 2I60L 4HV8B 2V5DA 5I23A 1ISWA 3QNXB 1WBZB 5HHOB 4FTVA 3BRGC 3AFBA 5ECJE 5IFJB 2E0PA 2DLHA 4X6CE 2VC9A 5CIPA 3CFBB 5DT1L 2JEQA 5DURD 2YDSA 1CICA 5GISL 1PZ3A 4XCYB 4GRWE 3RWDB 1KYOJ 3IDMA 4X4YA 3V5KA 1Q9WB 2BDNL 3NPSB 2VLJE 3OMZA 4OF7A 4TQEH 4I2XE 5ECUA 1L7IH 3MRNA 1MPAL 1R5VB 2IFFL 4TPRL 1JIBA 4U5KA 1PS3A 3K2UL 3B9VA 1CICC 1G6VK 1U2CA 1RHHB 1OAUH 1U8IB 1EAJA 1UJ3A 4XVTH 4MPKA 5EFDA 4PRHE 5HHXL 4NBZB 2EC9T 5BZWA 2W0FB 1A14H 4PMXA 1I3GH 1IQDA 3VXME 5JW4N 3W0WA 2ZWYA 5BJTA 4PMUA 5JW3L 4EI6B 3EYFB 1S7SA 3HNTL 3WIFA 1UR2A 1MCPH 1PYWB 3CFKB 4LSSH 3S34L 4HLZH 12E8L 3WUEA 1LO0L 1BVKA 4Z7VF 3KNBA 1NGWB 5FYLE 3RWIA 2A9ML 5J6HA 4PYHA 2P8LB 4YHPA 4U1SA 3QG6A 4IRSD 3MZGB 1MOEA 3WH7A 2BDNH 1A3RL 3DJ9A 2NZ9D 3W25A 1BM3L 1LG1A 3CIVA 3RIFK 2VR9A 5GS0H 1QZ1A 4S1DC 4R7DB 4RZCA 5BS0A 4IOIA 5C07E 1FGNL 3TV8A 2HA1A 4PRBA 4HF5H 3LN5B 5GGUB 5SWSA 1UM6H 4LLDA 3LXAA 1T0MB 3S2CA 4XVTL 2CERA 1NFDF 4AYFA 2WBJA 3D85A 4JAMB 3WH5A 1SM3L 5C0RH 1VKXA 1G7IB 1X6LA 1CICD 5CFHA 1BJ1H 3QQ9C 5D9SA 2X7LA 4MQSB 3AS3A 1CGVA 5C08B 3CSPA 3OXRB 1TG7A 5T5FL 3QUXD 3KLHD 3BPCB 4ONFH 4XPFL 3LEYL 2BNRE 1OWRM 2QHRH 3BSZH 2VNCA 4BSWA 2C7FA 3WD5L 3VFSB 3V6ZB 1RMFH 2W67A 1RUPH 3PZNA 2BHUA 1ZE3C 1MFNA 3Q2CA 4BK5A 2ZUTA 1VENA 1D9KA 3O0RL 4LEXH 1NMCB 2AK4D 2JB5H 4KMTH 2VDLL 3SJVA 2GFBB 5TQ2H 4HUUA 3KYOA 4D8PA 2F19L 5KZCD 1YY8B 3GMOA 2AJSH 4WGWB 1UCBH 2PB1A 2VCBA 3SUTA 3FQWA 1K4CA 2ZUUA 4DK3A 3TA9A 4YO0A 4OAWB 1JGDA 4OFYA 2GEEA 2B39A 2FYYA 3WUWB 2A6JA 4HPOH 4GRMA 4XZUB 1C93A 3HC3H 2GK1A 1UM5H 3ARXA 1HNYA 4XPGH 1MHPL 3SGJC 4TTGA 1CXFA 1M71B 2W0KA 5C09D 2UUDH 4FFVD 4GRWF 5HDQL 2VZ1A 2FIRT 1FO0L 4NDMB 4FABL 1DUZA 1NBZB 5JHLL 4QXWA 4JG0H 4LF3A 4BFGA 4GBXA 4C56B 1TTUA 1I8MB 2W65A 1KBGH 2V7NB 1N8ZA 2E9WA 3U0TB 1A1MA 2VJXA 4P46A 3NAAH 1ZBVA 3HI6L 5AYUL 2EADA 1CLXA 4DOHB 2VAAB 5I3DA 4BZYA 2V5MA 4XH2B 4DVRH 3VG9B 2DRUA 5C0CB 3RPIB 3RVTC 1QEWB 4J7RA 3OKOB 4NQDD 4HP5A 1JNLL 4XAKD 3QFDA 2R1XB 3SCMB 1OSZB 1MF2L 4PJ5E 3MJ6A 5E8PA 3P9LB 2VN7A 3AMCA 3W27A 9CGTA 1AJ7L 4CADB 3OKKB 3ARGA 5BQ7B 4WIWA 3NIGE 2E6PA 2V3GA 2VURA 2GTWA 2Z31B 3AXLA 3P4MA 4KDTA 2BMKB 4M80A 4NT6B 1UZ8B 3IRZA 3FQNA 3IXTB 3HPLA 2QTEA 2MQ0A 3MBXL 1DBBL 3VFPA 4NWUH 4MS8D 5DJ0A 4I4WA 3FL7A 4N0RA 3RM9A 3D3VB 2Q87A 3ALXA 4PS4L 4V1DB 1MCNA 4OZHF 2PR4L 4LASH 1RAMA 5T3ZD 3DHPA 4YDJA 1SHMA 3GXPA 4LHUG 2XN2A 4ZO7A 3O4LA 1I4FA 3I85A 4KRTA 3S96B 3DYOA 5D2LA 3RU8L 4W81A 3PV6A 4NQSB 4M9OA 4NQDE 2G8ZA 5EN2A 4S3JA 4PJBE 5D7LD 4HHAB 4KK5D 4S3KA 2FGLA 5JBFA 1UH2A 4AJ0A 3QT2A 3TA3A 3ULVL 1HJUA 4M5YL 2CXGA 3DUSA 1BOGA 3B83A 1CBVL 1UWGH 4OZGE 5EC2B 4XPHL 3ULVF 4X6DA 3CTTA 3TCLA 3WKML 1CFTB 2XNAA 4UIMA 5IEKB 3BLBA 2DH3A 4WHCA 4G5ZH 3DMMD 4GO6B 3C6LC 1OP5H 2HYMA 4W6YB 4KRPD 5T1KA 4URIA 3N1AA 4ZEPA 5J11C 3QR3A 3LSOB 3B6SA 4XAKE 1UM4H 4IRZL 3RVXC 3HC0B 1NMBL 1JV5B 1AQDB 3WL9A 1HH6B 2RHEA 1F3JA 4KJPC 5F3BB 3ISWA 4EXKA 1N6VA 2YEZB 1MAML 4OGYL 1GW1A 2VVNA 4DM1A 2Z31C 3EYUH 4NKQB 2YIHA 4MAUL 5LAXA 8FABB 1PLGL 3W82A 3OHXB 2GUOB 4OT1H 1UJ3C 4UV7H 1U8QA 3LKOA 1KG0A 2UWFA 3KPSA 1Z6JT 1O5DT 3P40A 4WFGD 4NO2A 3BN9C 3QB7C 4JPKL 3TZVD 5IW6A 2Y07H 4N9GA 5FYKE 4M3JA 3CVHL 1T21A 4UBDD 4UILH 1VCAA 4HPGA 5HHMD 3WIHL 2HLAA 5JLZA 2F5AL 1IEAA 3SDCA 2AEPH 5KZ6A 1H0IA 3KPRA 4JFDA 5E9DB 3QFJD 4F9PC 3N1PC 4U1IA 4XNXH 4GUPA 2WK2A 5BRZD 4N8CH 3SDAC 4PRIE 5DJXB 1V05A 2UWEE 4C4KO 2YLAA 4BZ1H 5A2BA 4PJGE 2CEQA 5FB8A 35C8H 3KL3A 2DWEA 3C6LD 3BAXA 1FCCA 4LHUA 3V6OC 4KKCC 3PZQA 3QIWD 4KK6C 1IEHA 4OBRA 1JF6A 2Q8XA 2F7QA 3VXNB 1A1MB 2EIBA 1E6QM 5EU5A 1ZVSA 3U7AA 3BUIA 1ZU8A 1S7RA 2X89A 1WKYA 1MQKH 2QR0B 4YEEA 2XVPA 5MEPA 5D1QD 3DX2A 1JK8B 3GKWH 3PNWB 3HR5A 5T1KD 4PB0H 3HZVA 4LQFL 1WICA 4AEIH 3BPLB 4POZC 3GSNA 3MRPB 1P2CA 1NCWL 2F5AH 3P0VH 1VESA 4YXLH 1B9ZA 5D7JC 1NJ9B 1S7TB 2R69L 4O02H 5I1LA 1HWGB 2XPGB 4LSDA 4XNXL 5IVZB 1R0AH 5HDBE 1ZLVH 1UKPA 3H9HA 4X6CB 1E72M 3WIJA 4LRIC 4GRWB 4TVPE 4JG0L 2BERA 1HILB 1S7UA 2XTJB 2C4XA 3TZVA 4EDXB 4IIQB 4NFDA 5ABGA 1BP3B 2Q76A 1XGUA 4ZTPL 3QCVL 3W24A 1V3HA 2IMMA 3B3IB 1WWAX 3FFCD 5SX4I 3DC0A 4LX4A 4ZSOB 3WL0A 3ULVE 5D6CB 4PB0L 1I7RA 3A6CH 3PWVA 3VXSB 4JO1L 3SDXF 3IU4L 3MV9A 3ARGD 2L7UA 4GMSL 4OB5H 5L2KA 1FJ1B 1KPUA 1M05A 1R6VA 3AIEA 4POUB 3FOMB 2W9DL 2AJSL 1JP5A 2EYSA 1HKFA 2VLRD 5EPMA 1JWUA 2DLGA 2R15A 4HGWA 3HS0A 5D2NB 1G6RA 2DSWA 4HDIB 1TFVA 1KIRB 2CLZB 4QOKB 4RISL 4UOJA 3QDGD 3U7YL 3INUL 3S4SA 1A3LL 2X6MA 1TQTA 3MBED 2C7UB 3UTTB 2ZNXA 3B6SB 2QR0A 4JFEE 4UI2A 4P8WA 3D0LB 5CUSL 1DBBH 3MUHL 5A1AA 3IS1X 4L3EB 4MJID 3HA0A 4L4VB 1HE7A 5L6YL 1PGRB 4NC2B 3CFCH 1J05A 1R5WB 5DF0A 3OKMB 4YHPB 4HPYH 1UZ1A 5D9MA 5GGRA 3FQRB 1Z0MA 3ZOAA 3AMKA 3F7VA 5EULV 4G9FA 2QV4A 2H8PB 1VPOL 3V0VB 4U6YA 2NXZC 2NW2A 3BQUD 1G7PA 4NKOA 1ZT7A 3QDGE 4ELMB 2VXUL 3GSQB 4XZWA 4OIIH 4C4KT 4N9GB 3FFCE 1RIUH 2VDRL 5A6MA 2HLAB 2XTLA 1YDPB 5JLZB 2W63A 5IMKA 3WUFA 4UT7L 3HU7A 5FM5O 3D4YA 1OP3K 2C3VB 5SWZB 4RMRA 1JNLH 1VIWA 5JW5A 3BO8A 4OZFB 4LIQH 1R46A 2ZUMA 1TZHB 1D5IH 4WWKA 1U92B 1GHRA 1MF2H 4O4YH 4ZNCD 1GOFA 3QRGL 3LPFA 2X4QA 1TIUA 4K8RD 4R4BA 5A6JA 4Q74A 4PV9B 1I7TB 2BRRH 4H88H 1BYDA 3VSTA 4QEGA 3WNPA 4D6FA 1I3GL 4NZRH 3SO3B 1HL8A 4P48A 1BGGA 1RPQA 3OPZH 1UB6A 1YN6A 3IDGB 3NMEA 1G7LB 5FGBC 2GTWB 1FFNA 3ARED 5E6ID 2XHYA 4YHOH 4QT5A 3VWKA 1MUJB 3ET9F 1QSEA 2PWHA 5A8PA 3MACL 1FZKA 1VA9A 4O00A 1OB1B 4OCRL 4D6EA 1IAII 2J88L 3MSPA 5J57B 4UV7L 1OIMA 2BHYA 1N7ML 2AOSA 2R4RL 3MUY1 5F44A 1UWSA 3P77B 5MENA 5DR5H 3JWDC 1N0XH 2X42A 3UYRH 1QNRA 3F6IA 3NCCB 3PTMA 4CMMA 1CFTA 2DM4A 4UIMB 3K3QA 1RIUL 4XCCL 5F7HA 3RTQB 4JPKH 4YGVA 3II1A 3DYMA 3KJ6L 3QO1B 3KVQA 1LP9F 2YKKA 2VB5A 2EDBA 1UASA 3GNOA 2Z92A 3D39D 1EEUA 1YN7A 3Q48A 3PWUA 1D5IL 2X2YA 4OLUH 4P4KC 3OB8A 4R90L 3TIDB 3HMXL 4KROD 1A1NA 2ATKA 3GHBH 3QHZH 3UDWA 2CMRL 5I1GL 35C8L 4W4OA 5EN2B 2EDDA 1JGEA 4U0QB 4TXEA 4X98B 3TPUB 4TSCL 1A9BB 2ADIB 1NEZA 3UJIL 1NQBA 4HJJH 1RJYB 3VXPA 2WNWA 3V95A 4NQVA 5F1NB 3UDWC 3MKKA 4IUGA 2FH6A 4IPLA 1QA9A 5HOSA 4P23C 3ULVC 5HHQA 4PTTB 2NX5E 4Z8FL 2BMKA 1ETZA 3NZ8B 4KI5D 4GINA 1H15A 2FX9L 4RQQB 4WNQB 1G94A 3F7PC 4MDIB 1P6AB 2VDLH 4ODXA 3THCA 5ITBH 4N8VB 4O51B 1C5CH 3I2CL 5KSBE 4F57H 1WT5A 4EBQL 4C55A 1PG7X 4C58B 5DD5H 1X4YA 3VWKD 4EIGB 4B9YA 1NLBL 4F7TA 4C7FA 3FO0L 1VRXA 2A0LC 4HUUB 3MI6A 2X4RB 4OLUL 5JW4M 3QFDB 3UR8A 5D1XA 3KHQA 1ZOXA 4JDZB 4YPGB 3RWJB 3T2QA 5DMIH 1XCXA 1UVQA 3RQ3A 4JFVA 3OKEB 1OGAD 2Z9TA 1U58B 1E4XL 2I24N 5FOBB 2GK0B 3MRQA 1P9MC 5DQDL 4GQPH 4HJJL 2AAVA 5B39B 3U9UB 4PJCF 5DMYA 2ZWZA 3K1KC 1C91A 3O2DH 4QOKD 4JVWA 4BS0A 3EO1A 1LL6A 2QADC 5D1ZA 2WVSA 3V7AE 5C0GA 3SE4C 2YA2A 4J27A 1VKXB 1XF4B 5IMOA 4ZS6D 5ID0A 1JI2A 3GH5A 3WJJC 4NQUA 3GXNA 3K0WA 2OR7A 4KV5F 5IEHB 2WKLA 3QI9A 3B9KC 2BVPA 3SCSA 2FO1A 1P4LB 4XXDA 2A6JB 4TULH 3WFDH 4I48B 2FWOB 1FVDA 3U83A 1RZJC 3KZSA 1JGUH 2XKUA 3IKKA 4X7EC 3LXCA 5TE7H 1S3KL 1QBML 5FO7A 1JUFB 4KJPD 3ZJ8A 1PBYA 4BFBD 1CFNA 3LQZB 1BECA 1DVFD 1MI5D 1UADC 1EHXA 2JK5B 3QUMH 3GMOB 1N82A 3QAZC 3VFWA 5C0BB 4OFDA 4NPYA 2CIIB 2WINA 3RY6A 1WZAA 3C5JB 1K2DB 1A2YA 1L9NA 1XMWA 2PTTB 2A6DB 4D0CA 2EDQA 4BA0A 3QHOA 4LGRB 2AJYH 2VL4A 3NCYS 4P2QB 4U1LA 4OD1H 1MHEB 4UBDC 3BIAX 3QEQD 4LGPB 3JVGC 4NWUL 3O4LD 2HISA 5KTEL 3APGA 3H7BA 4KQ4L 1HT6A 1Q6EA 3GJEA 3QPXH 5D2LF 1A6TB 2M8XA 4M7LT 3L2LA 4E42A 3VKKA 3UERA 3TV3H 2DM3A 5IOPA 4IHOB 1G7IA 1KGXA 4OZOA 5BXSA 4A6YH 2QSTA 1H5VA 5LKNA 1TA3A 1BF8A 4UOQA 2BVEA 2QEJA 4X8XA 4JQXA 2AXFA 4LYQA 1YQ2A 2DLTA 1V02A 2VTFA 1YNTB 3DV4B 4LCIL 1BGAA 2DSUA 3FONB 3FT3B 4N8VG 5DJ8B 3NCMA 3VMOA 3OPZL 4S1DD 4O51A 1KR0A 1OT1A 2ZCKH 1PEWA 1BBDL 4Y5XA 2IQAA 2X4PB 4WI2A 4CN4A 4YHOL 2EDRA 3JUYA 4Z2LA 1R87A 5HDOA 1H09A 5IWLC 3MACH 4JKPL 3U7YH 2IADA 5K9KB</