1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
b'MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxyribose-5-phosphate aldolase
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
molecule tags Structural genomics, lyase
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
3TR2A 4XBSA 3UYCA 1KFEA 3TQ0A 4O54A 1TTQA 4ALDA 1G69A 1YPFA 3TJXA 3UWQA 5LNUA 1JCLA 1M7OA 1TV5A 1O5KA 4JTGA 3TROA 2X1RA 2KZHA 1L9WA 2QCNA 1LOSA 3S1UA 3O05A 3LCXA 4O19A 4LVFA 1R2SA 1EP2A 2GOUA 2Q3OA 3THAA 5SWUA 3HBLA 3M43A 2RH9A 4JTTA 3M5XA 5K9DA 4BK9A 2ZRZA 5CPMA 5K4ZA 2CW6A 2EKCA 4MY9A 5D04C 1SQ7A 4RKAA 5D2TA 1AL7A 4Z0SA 3G1DA 3W2JA 4U4MA 2PC4A 3P61A 1XDMA 2YGYA 1DORA 4E0CA 1C9DA 2VEMA 4Z1DA 4QNWA 3P67A 3DAQA 5CPNA 3S1WA 1X6UA 2WSYA 3EKZA 1XBXA 2NUWA 3CEUA 3JS3A 5LZLA 4RJEA 3BG5A 1XBYA 1MEIA 2YFOA 4ORIA 2RDTA 3EXTA 3A23A 2VKZG 4UTLA 3TAKA 1HUVA 3P5YA 4LU0A 3TW7A 4WOQA 4Z1AA 5C5YA 3CB8A 5T26A 4JX4A 3BV4A 3W1LA 4A3UA 3HG4A 4BI7A 3CHVA 1XBZA 2OJPA 3EX4A 5AYXA 1VH7A 2EPHA 2WSRA 2QDGA 3NZ1A 2YR1A 8TIMA 1EB3A 1LBMA 5CZ0A 3NR0A 1QFEA 3M41A 1GVOA 3P81A 4GNJA 4CLMA 4XKYB 1PL9A 3CWNA 1YDVA 2BXVA 3ZWSA 4MLJA 4OWGA 1JVNA 3QFEA 2JKPA 5J5DA 2UV8G 3LOTA 3NQVA 1LORA 1BKSA 4R33A 4BFAA 1PHQA 1AW2A 2AGKA 5FF3A 3QMTA 1JQXA 3WK3A 4AB4A 1KLZA 3W72A 1XC4A 4FNRA 1OX4A 1FX6A 2E09A 2QAFA 1S5WA 3P7YA 4OGZA 4KKXA 1PCWA 3TNOA 2V5LA 3I68A 3G1YA 5I3KA 1AL8A 4RXGA 1QWGA 3FYPA 3WFAA 5CZTA 4N9DA 3H54A 1JRBA 4BF9A 2E1DA 3H53A 3F03K 2E5CA 1KTBA 3LLFA 1A53A 3A22A 1W3IA 2R14A 1RQHA 2A5HA 4LVAA 4K7VA 1OFBA 4B5NA 3CIWA 2YCEA 2E5BA 4GC4A 1ZNNA 1DHPA 2NX9A 4X2RA 3NQ6A 1H51A 3UQNA 4FNSA 1QO2A 3WJWA 5DXXA 2WSQA 5BW6A 3S0CA 2VFDA 2AAMA 3PSWA 3NGJA 2FPYA 2C0AA 5CG7A 5HNRA 3TIMA 3QQ1A 4HSNA 1KBIA 4HSOA 1LM1A 2V30A 4O15A 3W1MA 3LI1A 1OFDA 2QJIA 1F7BA 4Q32A 3VCRA 3TSDA 4JYFA 1OFAA 3LXBA 1WQ5A 3W85A 1JJKA 2FLIA 4QITA 4AF0B 1KM3A 4GWEA 5C54A 3UXDA 3LM7A 3CTLA 4JD4A 1T8XA 3W7MA 4OHQA 1RZMA 2C6QA 4O0KA 3TW6A 5I3GA 2NUYA 4LUJA 4MY8A 2Q8LA 3QJAA 4HNNA 5HINA 3HGOA 1TPEA 2X2GA 3EX3A 1ZHAA 4YL2A 5DLCA 2C1HA 1WXJA 5F4WA 4Y90A 1F6KA 1FDJA 4RCXA 2CLFA 3PC0A 4UFKA 1ZCOA 5D32A 1Q6OA 5K9XA 3G18A 5D2WA 4WX2A 4K39A 4O1DA 3W7GA 2W6RA 3F1QA 3QMRA 4UXDA 2OT1A 3TDFA 4AWTA 2V82A 1R46A 3MWAA 3W1PA 4Z1CA 4IMFA 3NPXA 1PS9A 3QQ0A 1MSSA 2YZRA 1E51A 3PBVA 2ATSA 5HQEA 1TPVA 3LHWA 3L21A 1ICQA 2R8WA 3PF3A 3N2MA 3W73A 5A5WA 5EYWA 4A2RA 2ZZ4A 2HSAA 3L67A 4IWWA 2BLEA 1YTKA 4YCPA 1VHNA 4DBDA 2A85A 1W5MA 4K36A 4ADUA 3KHJA 2CFFA 3A5VA 4IXHA 2YPIA 5D05A 1XXXA 4UFIA 4O8RA 3HO8A 5TQLA 3UWUA 3V75A 1TREA 1ZAIA 2VFHA 2X16A 5AHMA 1OYBA 1N8FA 4NU7A 1C29A 2GPTA 1NAL1 1SZFA 1H7OA 4JR5A 5FF7A 3LCFA 4RX0A 1I45A 1SSDA 2EAWA 2PRLA 2E77A 2YXGA 3TK7A 2DORA 3NDOA 3Q58A 4I7WA 3OG3A 3P5ZA 4QAIA 3IIVA 3P8JA 4UFHA 1EUAA 3G3DA 1FDYA 1RV8A 1VGAA 2OX1A 2QF7A 2VELA 1TJRA 3KAOA 4UTTC 2E6FA 5MHBA 1JULA 2ZRWA 5F1VA 1MEHA 3TC7A 1FCQA 3QF0A 1VRDA 4JTSA 5HR7A 1LRTA 2ZZ2A 4MJMA 2B7QA 3G1XA 1LP6A 1RQBA 4IQLA 3SGUA 5CSSA 3CU2A 1H7RA 4E38A 2V2DA 1XCFA 4PCFA 3RLUA 3VNDA 3GAYA 1H7NA 3IV3A 4MZYA 3P82A 2Y89A 4H6KA 2NLIA 4Q4KA 3AO0A 3C2FA 4CQAA 3C2RA 5U7SA 4Y96A 3NG3A 1GZGA 3LCIA 4FF7A 2WNZA 3NPVA 4NUWA 3MP5A 4DEFA 1IIGA 1QO5A 2NWSA 1G6CA 3WJSA 1KFJA 1CX9A 2EF9A 4N2YA 3LX9A 4KFPA 1QMLA 5DCBA 3CT7A 1A50A 3PB0A 2DZXA 4FO4A 1QNVA 3NM3A 2NX3A 4O14A 3WJZA 2JGQA 3B0UX 3UNDA 4IMGA 3SW6A 3CQ0A 1IXPA 2JBMA 2QUVA 2H6RA 3B0VC 4ZQPA 3RF9A 2VOMA 2BZNA 1VPXA 5K4XA 3EXSA 2PCQA 5D30A 3NPUA 1F6PA 1KTCA 3HGJA 1LOQA 5DBUA 1DKWA 4ZQCA 3TQKA 5D03A 2A2IA 1SUXA 1Z41A 2V81A 4JEQA 4YLWA 5H91A 4ADTA 3STEA 2QCEA 3TXVA 3EWBX 3LERA 3P80A 2TPSA 3HGRA 3P60A 3SJ3A 2WO5A 1YTEA 3M16A 2QCDB 4LC6A 3N9RA 3KRSA 3NPWA 4O28A 5F2LA 1Q3NA 3T78A 5J5RA 1K03A 4H3DA 1DBTA 1ZFJA 2Z6JA 1GWJA 1F5ZA 4UR8A 3N9SA 4JTLA 3W1RA 4I9AA 1EA0A 1Q45A 2G96A 3W2UA 4O4WA 4MOZA 1ME9A 4FIQA 5KINA 3IEBA 3GDMA 4A22A 1KM1A 3PM6A 3PUEA 1B9BA 1WAUA 1BWKA 1DQWA 4MPQA 5I3IA 3LHTA 4LW7A 3W1TA 4O1CA 4W9TA 3EX2A 1I2QA 2RKXA 3LHUA 1HO4A 3BW2A 3U2OA 3TE9A 3LBMA 3NNTA 4U28A 1ZAJA 4GUJA 1XL9A 3Q2DA 4WQ6A 5IBXC 1XUUA 3O8AA 4OU1A 3DFPA 4IOTA 2B4GA 2PRHA 3WK0A 1H60A 3KVKA 4OQVA 3FFSA 3PVFA 2A6NA 4MYAA 5D2XA 3VE7A 1A5AA 4I7VA 4JNMA 2BX7A 2WV8A 3LV6A 4QM1A 2J9XA 3O16A 4IGHA 1VZWA 1PHWA 3L68A 2F7FA 1ML1A 3OVRA 4ZQOA 1QPQA 5EMUA 3E49A 1XUZA 4UTKA 4JTJA 2RFGA 3LCGA 2QCCA 1KM5A 3R8RA 1SZNA 1VCVA 1BWLA 4QQ3A 3ATYA 2H3DA 3G24A 1WV2A 3NQCA 5IBXA 3N73A 1B3OA 4JTEA 5GVJA 4FXRA 3G0XA 5CSRA 1F05A 5LHEA 2Y70A 4MYXA 3T55A 4JY9A 5HWNA 3SY5A 3DH7A 2XFWA 2R91A 2ZA1A 3MHGA 3MJYA 2YW3A 5D2YA 1IF2A 2VEKA 1UBSA 3PAJA 4LRTA 2OMAA 3LCLA 4HN4A 4JICA 4NXKA 5I3HA 2B7PA 3NYZA 4NNCA 3NZRA 5I3JA 4DF1A 4NJIA 3ELFA 4LOCA 3QPYA 4MFEA 5C6MA 1NF0A 4N9CA 4DF0A 3DKJA 3TCEA 1JCNA 1QPNA 3NQ8A 4JYEA 3TA6A 4NXSA 3L0NA 2ZZ3A 4GJ1A 1BTMA 1TV7A 4IMCA 1SZEA 5HULA 5TBOA 3HG3A 3UZ5A 4KFNA 4FNPA 4NZJA 4EOUA 1GG1A 2FPVA 3UWVA 2D73A 3B03A 1WBJA 1S5VA 2Y61A 1I8JA 3R89A 1HL2A 1SW0A 4XTIA 1IXOA 1FCUA 1ZY9A 1W5QA 4Y9AA 1WBHA 3GVGA 1KLYA 5CZSA 5AYYA 3EX1A 4ORMA 3MO7A 2FTPA 5F4SA 3I6RA 2CLIA 3FJ6A 3G8RA 3SIZA 5G1YA 3W7RA 1AW1A 1SZGA 3IIXA 3I7SA 4JX6A 1OF8A 3MYOA 3BLFA 1S3HA 4M6VA 4C1KA 3KFTA 4HT3A 4JS3A 3HPZA 4ZVJA 2VXNA 1YDOA 3TH6A 4CNNA 4R34A 1LDCA 3GYEA 3L0KA 3BLEA 1TPWA 1FWSA 3W7PA 1GVFA 2CLHA 2C15A 5H2ZA 1VYRA 3LHVA 3W7IA 3CLMA 4O50A 4KWWA 2J9ZA 5AHEA 4A21A 3KVLA 3G0UA 3SSJA 2GJLA 3QSTA 5D38A 3DFSA 3CWOX 3R2GA 5DXYA 1M5WA 4N4QA 3S5OA 3IIZA 2NZLA 4FNUA 3PB2A 1DOSA 3PSVA 5IM51 3H55A 3TC6A 4YCOA 1GVSA 4RV8A 1KM0A 3TUUA 3E96A 1XI3A 1SU5A 1FUYA 4JTKA 3HF3A 4PTNA 2H8XA 1XM3A 4KWVA 4O57A 4WXYA 4PC8A 1DJQA 5C2XA 3W7HA 3MI3A 4M7SA 3S5NA 3S1XA 5E1QA 5BNKA 2Q8ZA 4PL1A 5U4NA 4UTIA 1D9EA 5L6UA 4ZMGA 1SO6A 3CM4A 3ANYA 3P74A 5D09A 1TYGA 2ZFAA 4MLRA 1UCWA 4G1KA 4LTSA 4UTJA 4A29A 5F2GA 2ZA3A 3LTYA 2VFEA 2ZRUA 2E6YA 3ZR4A 1LLZA 1OX4B 1R30A 1SO3A 3UPWA 2Y6ZA 4XWUA 4TMBA 3RU6A 3W2MA 4H4IA 5KSWA 2A7NA 3RLVA 1OX6A 3UPBA 3G1FA 1RD5A 2DU2A 4FXSA 6TIMA 1L6WA 3NQMA 4CCDA 3QYQA 4XKYA 4NX5A 3TKFA 2AQWA 1OYCA 3W2KA 5KTLA 2CZ5A 1SFJA 3W1QA 1ICPA 2VFGA 3T44A 5HMSA 3C2EA 3QMSA 4LS1A 3QRHA 3IGXA 1JCYA 1OK6A 3IVTA 3STGA 3KVMA 1H1ZA 3TV8A 3P8IA 3EWWA 5BOOA 4N4PA 3G8EA 2A7RA 4O1BA 1G4PA 1L6YA 4LUIA 3GR8A 5LNRA 2QKFA 3CPRA 4Q33A 1QCWA 3NQEA 5E0KA 4RZ6A 5AHLA 3W7CA 5AHIA 3K30A 4JYDA 3FOKA 3STFA 3M47A 4YWIA 1S5TA 3MBDA 1KTNA 3M1ZA 3GDLA 4WY0F 5LGXA 3GDTA 3N19B 4NJHA 2WOQA 4N02A 3GXTA 1DL3A 4O0ZA 3QH2A 4MJZA 3W7JA 2DP3A 4Z1BA 1W1ZA 4ZL1A 3DGRA 2ALDA 1TPH1 2I9EA 1PE1A 1KFCA 3ABOA 2ZQ0A 1LZOA 1LCOA 2ZZ1A 4GUFA 2HS6A 1N7KA 1W54A 4C1LA 1RQEA 5LNWA 3EX6A 4LC8A 2FDSA 3I7QA 3UY7A 3S42A 5HR6A 2E6AA 5KMYA 2QCLA 1KV8A 3OBKA 3P62A 1P0KA 1ALDA 1LRQA 1W0MA 1ZAHA 4LV9A 1W3NA 3GIYA 3G1VA 3MUXA 3KRZA 2JKEA 5LGZA 3PULA 3W6YA 3MP3A 3KRUA 4HNUA 3W22A 1FDZA 2VEPA 5EL1A 3IIOA 4AF0A 2C13A 3NQGA 4EWND 4YMZA 1TB3A 3DXIA 1RPXA 3E12A 4AWSA 3GLCA 3W2NA 4WY0B 3A5FA 3W1NA 2CWNA 5DN1A 3O15A 4Z08A 1ZJIA 1YTDA 1JR1A 2GVLA 2FJKA 1X1ZA 4EIVA 2GQAA 4Y6GA 5LNVA 4WD0A 3S5ZA 3E0IA 2J88A 3NQDA 4FNTA 2EHHA 1QR7A 1I2NA 1LBFA 2W0UA 3BGJA 3G3MA 3HOJA 3WJXA 5D37A 1GQNA 5CGQA 3IVSA 4UTWC 4XUGA 4IPJA 4DQWA 4O52A 4HNTA 2WJZA 2ZDRA 4HHPA 4WOZA 4GUGA 3PR2A 1Z48A 4P2VA 3C6CA 3FKKA 3LTPA 2ZZ6A 3RNDA 2EGZA 2G5WA 4K7YA 4LNYA 2Z6IA 2B7NA 3FIGA 4TO8A 3MP4A 3HB9A 1SSGA 2H3BA 5KZEA 4O16A 5BRBA 1J5TA 2C19A 1MO0A 3W71A 1O94A 2ZZ5A 3NL3A 4UC5A 3G0SA 1GYNA 1YADA 5G1TA 3W1XA 3MW7A 3LHYA 2WKJA 1SW7A 1YXYA 4P61A 2WNNA 3C8FA 4JXCA 4RZ5A 2F84A 1W5OA 5EA9A 5LKYA 1A5CA 2ABAA 3UD6A 5EBUA 4AVFA 5K7JA 3M44A 2TSYA 4UR7A 2DZTA 3ZFHA 3WK2A 3W70A 5F1UA 1VR6A 4IXXA 3A24A 1JUBA 2WPBA 4PEKA 1OF6A 4OBTA 1ZENA 4UTTA 3L2IA 4O12A 2FB3A 3M6YA 3O1NA 4NT0A 4WJEA 3B05A 4FX8A 4NJJA 2YDAA 2ZZ7A 3DFNA 5FF0A 1G4TA 2X1TA 4OV9A 4JGDA 3NQ7A 4LVDA 5L9FA 2QDHA 3PUDA 3INPA 3L5MA 4WUIA 4DO5A 3R12A 2NV2A 2I1OA 3LV5A 1P4CA 1RR2A 2NWRA 1B57A 3GB6A 3BG3A 4K8HA 2CU0A 2ISWA 3L5LA 1XFBA 3B06A 4RZ4A 3F4NA 4UTUA 4GFSA 1TIMA 4LWWA 5BMWA 3NXFA 3DHFA 2VEIA 2HS8A 3Q94A 1GVRA 3W87A 4MUZA 3AJXA 5HUPA 3OEXA 1F76A 4HIBA 4NQ1A 3BW3A 2CLLA 1X8FA 2Q3RA 2TYSA 4O18A 2ZYFA 1OJXA 1KM2A 4BR1A 1LTDA 5G2IA 3C56A 1VC4A 3L5AA 3VE9A 4POCA 4O10A 3ABSA 2V5BA 3EWXA 5LSMA 1RVGA 1VCGA 5DY3A 1TPC1 1TPB1 5KZMA 3Q37A 1WX0A 4TX9A 6ALDA 4XBKA 1NFBA 3GAKA 3C2OA 1L2UA 4O17A 1OX5A 5D2VA 4AAJA 3OVQA 3UZJA 3HQ1A 3W7EA 3GKAA 4EF8A 1YLVA 2Y62A 1QPRA 3W7NA 1TTIA 5FF2A 1J2WA 1G7UA 3TAOA 1TCDA 1K3UA 1IIHA 1P1XA 2QCDA 1FWTA 3CEPA 2TMDA 3IIPA 3GK0A 2G97A 3L9CA 3QM3A 2O7QA 2OT0A 3QEZA 4GXMA 4N9EA 4L4LA 3YPIA 4PL2A 3E02A 1UUOA 3W76A 1B4KA 4MVAA 2XN1A 4LVBA 2NV1A 3S5YA 2YYTA 2ZTJA 3W7QA 2ABBA 2Z1BA 3KXQA 5HWJA 1H5YA 3DKLA 1FQ0A 3BLIA 3GNDA 5LNSA 1WDWA 2C14A 2DZPA 1GTEA 1C8VA 2J9YA 1OFPA 2CZDA 4ONVA 1LYXA 4NZFA 1W31A 5G2HA 5CKSA 1AK5A 4BWLC 2NXIA 1W5NA 5AN7A 4MZ8A 1K7XA 1H61A 5FF4A 1OFEA 4MKNA 4IX0A 1PV8A 2Y7DA 3GX9A 5F4XA 1ME8A 3QZEA 4CQ8A 2J27A 5AC7A 2YW4A 2DZVA 3DFQA 3I7RA 4GUHA 3KVJA 4X9SA 1GJPA 1IXQA 2P0OA 3G1HA 4NNAA 3G22A 3C2VA 4X22A 1KW1A 4DO6A 4LVGA 4GUIA 2FPTA 3ZS4A 2ZBTA 3ZWTA 3KOFA 5AYZA 2C18A 5F2MA 5C55A 1EP3A 1QAPA 4BWLA 4CQ9A 2A0NA 4DPQA 2Y85A 4UNLA 4X3ZA 3RK8A 3W07A 4FHAA 1NSJA 4NVTA 2PE4A 4S2BA 2ISVA 3RFAA 1R47A 2NX1A 4Z0JA 3C4UA 5AFDA 2P10A 3O6YX 4JX5A 3M7WA 3PG8A 1FBAA 3UWYA 5HWMA 3LB0A 1OYAA 4E2BA 4I7UA 4NNBA 3W7DA 3DHDA 1O4UA 3BO9A 4QNEA 1H7WA 2DZSA 4NJKA 1YDNA 3IGUA 2CZFA 1A5BA 3HMJG 4LT9A 1UJPA 4LRSA 1YXCA 4IMDA 1OFOA 2QCGA 3DZ1A 3L66A 3JR2A 1EIXA 3LGEA 2ZCGA 4UUIA 5G5IA 2GQ9A 2VFFA 4UMAA 1LROA 4D2JA 1I4NA 1Q6LA 1ZALA 4FX7A 1IGSA 4GE8A 3TMLA 2VENA 4UTHA 1KFLA 1GG0A 3LI0A 1TPFA 3W7KA 1EX5A 1OHLA 1THFD 3NAVA 4K8EA 3B8DA 1GTHA 4RXFA 1ICSA 3GXPA 1VQTA 4UMBA 4M7TA 1R2TA 1EWDA 4O53A 2W79A 4AWUA 5I3FA 4KFOA 4BI5A 2RDUA 4UFLA 1FCVA 3MHUA 2XN0A 4JY8A 3EWUA 4CNOA 2ZA2A 2QJGA 1VJIA 4AHPA 2FFCA 1ADOA 3G1SA 1MEWA 2WNQA 3HG5A 4O13A 1SPQA 3M0ZA 3CC1A 3BG9A 3L0GA 5CPOA 1G67A 2QUUA 3FJLA 2QEZA 1KM6A 1FY6A 1TO3A 1FWRA 2ZRYA 2HMCA 1FXPA 1B4EA 4RR4A 4QSHA 4UIOA 3TX9A 4ADSA 2OZ0A 3N2XA 3DENA 3S6DA 2JGYA 3PWAA 1WOAA 3BW4A 1DJNA 4CCEA 4ZZ9A 1Q6RA 1O5XA 3BGGA 2V0TA 3EKLA 4JDYA 2X1UA 4XTDA 1FXQA 3W1UA 3FYOA 4JIPA 4RLIA 3T7VA 1GEQA 2QUTA 3SZ8A 5FEXA 4Y8FA 2RDWA 4TU1A 1KA9F 1VCFA 4FNQA 2FIQA 3U8GA 1D3HA 3EWZA 3TSMA 2YSWA 3S9YA 2QAPA 2GVJA 4PODA 2A6LA 3LRKA 1DV7A 3W23A 1LOLA 4MFDA 3PBYA 1ME7A 3T40A 3IRDA 4PA8A 1U83A 4PH6A 1EPXA 1CI1A 3HIJA 3NQFA 2V9DA 3MBFA 1TV8A 3QW3A 3QSRA 4IPIA 4R53A 4O4VA 2LLEA 3SGZA 1L6SA 3W84A 1MXSA 4UNKA 1JCXA 3W75A 1XKYA 1QDSA 4QJ1A 2X30A 3BVJA 3N3MA 3TU9A 5ABTA 4XZ9A 5FESA 4RK8A 3R13A 1OK4A 2A1YA 1X1OA 2XN2A 3LRMA 3FKRA 5TIMA 3TSBA 3O06A 1TTJA 3EEGA 3L65A 5F2IA 2H90A 2FB2A 1NF7A 1KV5A 3W88A 5EKYA 4IJBA 3DFOA 2E5DA 4JN6A 1FWNA 1P5BA 3IVUA 5CZJA 3SR7A 3C52A 5HJLA 2X1SA 4HPXA 3SECA 1OG0A 5K2ZA 3EB2A 3LTSA 3LXAA 4PFMA 3DBPA 1JCJA 4JTUA 4XQ6A 4UCGA 4N6FA 1JUEA 2ZRXA 3SFKA 3THQA 1YPIA 4MZ1A 1M7PA 1M6JA 4UTMA 3VKJA 1GOXA 1TJPA 4MY1A 4AEOA 5E93A 4E2DA 1N55A 1BEUA 3F4WA 3TFCA 2GUUA 4O1AA 4FIRA 1YYAA 1Z42A 3HJZA 4LS0A 2JKAA 1EWEA 1SFLA 4BI6A 3JRKA 1DQXA 2V2HA 4GBUA 3OVPA 2YYUA 3RMJA 1PVNA 3QW4B 4LY8A 4UFJA 1UASA 2H8ZA 3LCHA 3LRLA 1X7FA 1TRIA 2R94A 3O63A 2YX0A 4OE7A 3NL6A 3W2LA 1JQVA 5AHNA 3GKFA 2NUXA 1EUNA 4FX6M 3NO5A 1NEYA 5BMXA 3W86A 3TXZA 1VYPX 1G7VA 4J9JA 2Z2UA 3PS7A 4FB7A 1XBVA 2J24A 3M5ZA 3IGSA 5DELA 1F74A 4WY0A 3PBWA 4CCCA 1K02A 2GQ8A 1SO5A 5FEPA 1A5SA 3NM1A 5KZDA 1AG1O 3GXNA 2CLOA 3P84A 1T0OA 3USBA 4ML9A 1HFBA 1KFBA 2VC6A 2DZUA 1TMHA 3FS2A 4ICNA 4DELA 2E68A 1TQXA 3OIXA 4N9BA 1KBJA 1P0NA 4S1FA 1Q6QA 1VYSX 5LHFA 3CIXA 4HNVA 2RHGA 3NL5A 3W9ZA 3W7OA 2ZTKA 1EEPA 4IUOA 3MI2A 4ZQNA 3A9IA 1OVDA 1H50A 2C3ZA 4UTWA 3N14A 1I2OA 4JTFA 1QOQA 3DI0A 3HPSA 3OHIA 3LHZA 1T96A 2CLMA 3DI1A 3W74A 4YXGA 5AHFA 3NA8A 3PUOA 3LCWA 1G4SA 1H7PA 1TQJA 3DU0A 4UMCA 3WJYA 1I2RA 4AMAA 3PY2A 1W3TA 1PCKA 3C0JA 4DF2A 3W83A 2BWGA 4OV4A 1SO4A 1TPDA 3NL2A 1EP1A 1AMKA 2C16A 3I65A 4GRSA 1JCMP 1VLWA 1F73A 3O6CA 2A21A 3EWYA 1O60A 4JTHA 5HUOA 3STCA 3FA5A 3UY8A 2G95A 4JDBA 1KM4A 2V8ZA 2A7PA 1J4EA 1FWWA 2NXGA 2PURA 2YFNA 5AB3A 3EXRA 1TTPA 3A21A 3PG9A 2GVGA 4MIMA 1W37A 1VLIA 3LBCA 2WQPA 4WZHA 2Y7EA 1V7YA 3TFXA 5EPDA 1QPOA 4ZQMA 3ATZA 3KX6A 3UXAA 5DY2A 1ONRA 3G1AA 1OFQA 3WK1A 3B4UA 4QIUA 1K7FA 5D02A 3W1AA 5KITA 1FCBA 3MHFA 5A8GA 3TQVA 3O07A 1OABA 2TRSA 4AXKA 1DVJA 4IMEA 2V2CA 4EVZA 2QCFA 1GPWA 2Z0IA 4R7JA 3GDRA 1TSIA 2CZEA 4HPJA 2DZWA 1VHCA 1F2JA 4JIQA 3HGSA 1W56A 2Y63A 3SI9A 5AC6A 1XDLA 4UFMA 3NQ2A 3V1PA 5K3VA 2DJLA 2I14A 1KFKA 3TJLA 3LLDA 5FEWA 2B7OA 3MI6A 3E9AA 4LS2A 3HPXA 4DXVA 1GT8A 3LXCA 3VFLA 3O6DA 1AW5A 1HO1A 2PRMA 3GDKA 4HKPA 2QCMA 1W5PA 5CPLA 4WXZA 4QISA 2GJNA 3B04A 3S8HA 4IX2A 1H63A 3BPWA 4K6AA 4M19A 5G4EA 3GNNA 4K38A 1K7EA 5DCDA 2Y88A 1W8SA 4NX0A 1UB3A 1I2PA 3S1VA 4N6EA 4TIMA 4NJGA 3GR7A 1LBLA 2ZRVA 1HG3A 5G4WA 5DBTA 3MYPA 1JRCA 5DCEA 4L4MA 2CLEA 5K9CA 7TIMA 3ABRA 3MMTA 1GVQA 3QPZA 5D33A 3C3NA 2A4AA 1SR9A 4O11A 1LRNA 3U6WA 3TMQA 4AHQA 1LLWA 1OFRA 4DO4A 1H1YA 1H7XA 1WA3A 3NEVA 4CNPA 3FEMA 4FEZA 3DFTA 2ATMA 1G4EA 1HTIA 1TPUA 1K8XA 3BK0A 2FQIA 3UWZA 4JTIA 1T99A 4S2CA 1WYIA 1NVMA 3ABQA 3PBUA 1K8ZA 3GZ3A 5AOUA 1GYLA 2HTMA 3M5VA 1SW3A 5FEZA 2J6XA 4DBEA 3VI2A 1IXNA 2Y7GA 1MZHA 2P1FA 1U5JA 4TMCA 5EY5A 4AH7A 3NVTA 1Y0EA 2QJHA 1H62A 3M9YA 3B0PA 4K37A 5AC8A 1YXDA 4EF9A 1Z44A 1QOPA 4ZQRA 1UUMA 3FLUA 4TR9A 3M5YA 2B0MA 3C61A 1TRDA 3QC3A 2DJXA 1R2RA 1V5XA 2JK2A 2BTMA 1K8YA 2OCZA 3BARA 2VFIA 1JUKA 1CW2A 2QR6A 4AHOA 4LV4A 3W7LA 1PIIA 2E6DA 4DPPA 1O95A 4M6QA 2IQTA 3NOEA 4M6PA 5FI8A 4OT7A 2O7SA 3R5EA 3NQAA 2NXHA 3W3OA 3N34A 2BSLA 3HG2A 4M5PA 4A2SA 1D3GA 3UWWA 3D0CA 1VS1A 3T4CA 2QCHA 3OA3A 2ISSA 2CLKA 5G2WA 2Y7FA 1WOBA 3LDVA
chains in the Genus database with same CATH superfamily
5BYWA 5A2BA 3UYCA 3TQ0A 5BOEA 3WF3A 4PCNA 4MNKA 3H26A 1J79A 3W00A 2X1RA 2KZHA 1L9WA 2ICSA 4RNIA 1AMYA 1PX8A 2YL6A 3O05A 4Q6XA 3WLPA 4O19A 3IJIA 4LVFA 2WXDM 1EP2A 1A5LC 3IV8A 5JH2A 4B5UA 4O1EA 3N2CA 3BAJA 1KB3A 1H5VA 1QJWA 3SCRA 1OIMA 2E9LA 3M64A 5K4ZA 2EKCA 2WM1A 2EO7A 2OEJA 3KBNA 1C9DA 1UR8A 3P67A 1CPUA 1TVNA 3S1WA 2YL8A 3R11A 1Z89A 2DH3A 1OT2A 3CEUA 3JS3A 4RW5A 1GONA 1MEIA 2YFOA 2YA2A 4ORIA 2RDTA 1VRXA 1HUVA 4MWAA 4RE2A 4WOQA 2XSBA 3CB8A 3MQTA 4IZGA 4OZOA 3BV4A 3CQJA 3OG2A 1YIXA 3EX4A 3IJ6A 2EPHA 2Y8UA 4PMOA 1UR4A 4J2PA 1XDJA 1XRVA 4JZ5A 5CZ0A 2XPKA 3NR0A 4PMNA 4RE3A 3THCA 1GVOA 1HKJA 4CLMA 4XKYB 2VM8A 4YTTA 1O5QA 1ITXA 2WJDA 3H2OA 4HHMA 3WL0A 4IGNA 1LORA 4R33A 5CBIA 1NDWA 5A6MA 5HBFA 1PHQA 3BURA 2X7WA 4GI4A 3WK3A 4FNRA 1EOMA 3WUFA 1M04A 1FX6A 3DC0A 1LF1A 2QPXA 1S5WA 1V4YA 1WDSA 1W8GA 2VZOA 2ACRA 2HEJA 3WF4A 3U5UA 4GZEA 1R9XA 2BOEX 3QR3A 1J11A 5CZTA 3DG3A 1JYVA 2J47A 1JRBA 4KQNA 4M3PA 3H53A 1MFVA 1QI2A 3VNMA 1KTBA 1PX3A 2R14A 4K7VA 1GZJA 3CIWA 4B9ZA 4MSSA 1TZ7A 4HA1A 3VXGA 1C90A 4FNSA 4WR3A 3HN3A 3H6OA 3CZEA 3URBA 3S0CA 2X42A 2VFDA 3NGJA 2FPYA 4HSNA 1AQFA 4H9XA 4HSOA 3SUSA 4AU0A 4O15A 3W25A 3W1MA 2QJIA 4Q32A 2PODA 3W85A 1JJKA 4QITA 1BD0A 1J93A 2CERA 1W3LA 4C7DA 4YPJA 3W7MA 4O0KA 5I3GA 2NUYA 2WC3A 4LUJA 3TYAA 3HGOA 1TPEA 3EX3A 4YL2A 3RYSA 4N0RA 3LMZA 1TVPA 2DVUA 1FDJA 1PZ3A 4UFKA 3II1A 3VKDA 3K4WA 4CN4A 3VOFA 4DZHA 4OUIA 2QMJA 1J18A 2W6RA 1ONXA 3QMRA 4WGHA 5LIKX 4UXDA 4TXEA 2EG6A 3LQLA 2C1IA 3M0IA 2YIHA 5C2GA 3PBMA 3W1PA 1EEXA 4E2VA 2C1GA 1TR1A 4LPCA 2CWXA 4PTMA 2CNCA 3RJYA 3S83A 3RM9A 1ODZA 3L21A 1AD4A 1E6SM 4DJED 5EYWA 2ZICA 4DO7A 4EXAA 2ZZ4A 2HBXA 3L67A 5DF0A 4D6CA 3MUZ1 4LUYA 1VHNA 4YCPA 2X8RA 1W5MA 1WO2A 2OGJA 3KHJA 4IXHA 3WD3A 1XXXA 5GJNA 4O8RA 1ZAIA 3CH9A 5AHMA 4JQ3A 1NAL1 3S1GA 1P7TA 1UKQA 4D9PA 1T5AA 1GW9A 2ESCA 1RBOB 4NYUA 3Q58A 4I7WA 3OG3A 1XFCA 3G3DA 1PTDA 4M6UA 2OODA 3UCQA 4PCSA 1D7FA 2VELA 3NGFA 1J01A 4UTTC 4YHGA 2E6FA 3AIRA 2DFAA 5MHBA 3BZGA 4CN1A 2PMQA 1VAHA 4MJMA 3G1XA 1OCJA 1AUSL 4PUEA 4WLCA 4IQLA 3JW7A 2G37A 5CSSA 2OWWA 4PCFA 3RLUA 3GNOA 3GAYA 1R3YA 4F0SA 1QBAA 1OZQA 2Y89A 2NLIA 4FK9A 1T8QA 2WC7A 3M6DA 3H2NA 2VHLA 4IFKB 3TN3A 1FKWA 4Y96A 2YCLB 2IXVA 5CJNA 1RP8A 3NPVA 1F4AA 1Q6GA 3NJ3A 1ECEA 1QO5A 2NWSA 3ZLHA 3SUWA 3LENA 1KFJA 3TOPA 1XIDA 3OQEA 5DCBA 4FO4A 1QNVA 2NX3A 5C7HA 2VGBA 3WJZA 1KQZA 3W82A 4FR1A 1IXPA 1QNPA 4ECLA 2QUVA 4WVXA 3AAMA 3TYZA 1OINA 2VOMA 5D30A 3NPUA 1KTCA 3GU2A 2A2IA 3VCNA 3H4GA 4JEQA 5ECUA 1D7KA 4PTWA 5H91A 4ADTA 3STEA 3OGRA 3TXVA 2WHKA 5EMJA 4QS6A 2Y5EA 3EWBX 1AJZA 2TPSA 2ZX8A 1UD2A 3SJ3A 2WO5A 4ZB2A 4ZTYA 2QCDB 2AMGA 1JDCA 3T78A 3PPFA 1K03A 5CH9A 1JDEA 4Z2IA 3BCDA 1T7LA 4HOZA 4UR8A 1S46A 3V5OA 3KP0A 3UETA 1REQA 2G96A 3F2BA 1ME9A 2P8BA 4J3ZA 3DYOA 3RPTA 1JZ6A 3AZRA 2GK1B 3UZWA 1FWCC 3H7VA 4LW7A 4O1CA 1UKTA 3BSGA 1I2QA 2RKXA 1HO4A 3E38A 4ML4A 4TVCA 3NNTA 1SR0A 4GUJA 3Q2DA 3L12A 5IBXC 3RRXA 1OGGA 1XUUA 3O8AA 3UVIA 3WQOA 2R6OA 3WK0A 2CBUA 3UA3A 2WZHA 4XZIA 1UHVA 2UY3A 3PVFA 2D0GA 4JNMA 2WV8A 3AALA 4QM1A 2BGNE 4IGHA 1PHWA 4OTKA 4DN1A 2BHUA 2WBGA 1ML1A 4RPQA 2FMNA 2OFJA 3E49A 1V08A 2X0SA 4UTKA 4Q8PA 4JTJA 2RFGA 1GK8A 1VCVA 4W8AA 4PMDA 3G24A 4RDVA 1A0EA 1B3OA 1PJ9A 1R3VA 2NQ9A 3PZGA 1DIKA 4JIHA 2D1ZA 3DH7A 5DMNA 3R8HA 2R91A 2YW3A 5D2YA 4RNJA 2VEKA 3PAJA 1TCMA 3KP1A 1PIFA 3LSBA 1DJWA 4I9JA 3EPNA 4QE4A 4IISA 4KCVA 1TKKA 3SQLA 3PNUA 4DXKA 4MFEA 5C6MA 3ZLFA 4DWSA 3TCEA 1QPNA 4JYEA 2ZZ3A 4H8HA 6CGTA 1XF0A 3FA3A 2FPVA 2OEKA 1WBJA 1S5VA 2Y61A 1RSCA 4DUVA 2XM1A 3SCPA 4Y9PA 1IXOA 5CC3A 1E6PA 4AZBA 4Y9AA 3QTGA 3GVGA 1KLYA 5CZSA 1SVDA 4V33A 2GSEA 4EANA 1JXKA 3B8UA 1ESWA 3WLHA 3I6RA 1CXKA 3FJ6A 1LG2A 2PDWA 3BLFA 1HT6A 5H8MA 2YZ5A 9XIMA 2DUAA 2PDXA 1XLDA 3TH6A 1LDCA 3HFYA 2O4MA 1FWSA 2AQVA 3OU8A 3VX0A 3SCSA 2C15A 2OEMA 2Q71A 1KCLA 3CLMA 4XZBA 1IWPA 1LWIA 3SUTA 8CGTA 2GJPA 3UNTA 4KS0A 1XIMA 3SSJA 3QSTA 3WDPP 3R2GA 2UY5A 1BYDA 2WCAA 2NZLA 2QHAA 4R3UA 2HE8A 4B2DA 1E15A 1C7TA 3PSVA 1POKA 2C71A 4LAMA 4YCOA 1GVSA 3IJ7A 3E96A 2PLJA 3OGVA 2OVLA 4JTKA 3N2BA 4RDWA 4PTNA 1HQTA 1XM3A 3VPLA 5E0CA 1MMFA 1PO9A 3CV7A 3H70A 4FPSA 4M7SA 3GHSA 1O12A 3DECA 4TV5A 5E1QA 5EGRA 2Q8ZA 3TYUA 5L6UA 1SO6A 3CM4A 4HQVA 2PTZA 4MLRA 1SJAA 1UCWA 2VGFA 4UTJA 5F2GA 3LTYA 2VFEA 5C2CA 2G3NA 1SGJA 3RLGA 1LLZA 1ZU8A 1SO3A 3EKGA 3NTYA 3QGVA 2WNWA 4J28A 4KRTA 4EK7A 1HKVA 3GO2A 5KSWA 2FFIA 4H4IA 5CZKA 5JBEA 3KBVA 3W02A 3G1FA 4FXSA 4H9VA 4Q8TA 5FJTA 2HZGA 1L6WA 4C6LA 4KWSA 4GVIA 4XKYA 3W2KA 1VPQA 5XIMA 3UERA 3I3BA 2VFGA 3T44A 4D72A 2PEVA 3H2MA 2PDPA 3CZKA 3H2EA 1ADDA 3AHYA 2REQB 1H1ZA 3EWWA 5BOOA 1S38A 2OZ3A 3G8EA 2A7RA 2XH7A 3KOZA 1CLXA 4O1BA 1G4PA 3GR8A 3VGHA 1GOQA 3UG5A 1QCWA 4QDMA 5E0KA 4RZ6A 3V18A 4G7EB 2GL5A 1CENA 1UD3A 4JCMA 1AH3A 4ZB5A 1UOZA 3BICA 1S5TA 3MBDA 1KTNA 2W66A 3GDLA 4WY0F 1QBBA 3BMXA 1MW3A 1CBGA 1C93A 2VT0A 3O0KA 5ECVA 1DL3A 2DIJA 3QH2A 4MB5A 3UJRA 3W7JA 2DP3A 4JFWA 4Z1BA 2P5NA 1UR2A 2E1WA 1TPH1 2I9EA 3SAZA 3NDYA 3ABOA 1V8EA 2ZZ1A 2HS6A 4XK2A 2PTXA 8XIMA 4O8AA 3N3TA 5LNWA 3I7QA 5T91A 4D6IA 2XDFA 1F3EA 4PUDA 2DY3A 3TTEA 1P0KA 1MZRA 3DFHA 4DUOA 2FGBA 1W0MA 3ZSTA 3B40A 3GIYA 2QV5A 4H8UA 1B1YA 4L64A 3GR4A 3W22A 1FDZA 3QKEA 3BXWA 5EL1A 3IIOA 1QI3A 1UP3A 4YMZA 2VZVA 3DXIA 1DP0A 3E12A 1QI5A 3KBWA 1UKSA 3MY9A 1PB0A 1TZ9A 3VGGA 3IJ9A 4Z08A 1X1NA 4GVHA 2FJKA 1X1ZA 4EIVA 3QV7A 2GQAA 4I8YA 4KESA 4WD0A 1B90A 3VNIA 3RAOA 4JQ1A 4FXJA 1X6NA 5T9CE 3HOJA 4H6RA 1Q5MA 5CJMA 1P6BA 5CPSA 3MCNA 1XYZA 1DWIM 4L1XA 4UTWC 4XUGA 4IPJA 4DQWA 4O52A 3VNYA 4NKCA 4HHPA 4WOZA 4D6GA 1YX1A 1V0MA 3URQA 2ZZ6A 4IFRA 3R1ZA 2B7NA 1SSGA 5E09A 3PFMA 2R1NA 1TV4A 3S2NA 1ELSA 2V5CA 1YADA 2WKLA 4LH8A 4JL1A 3C8FA 2QJJA 3LPPA 1ISXA 4JXCA 3WDJA 4QXIA 1NOFA 1A5CA 4JL2A 3SRFA 3F5KA 4JFVA 5K7JA 3M44A 1M9HA 1XH2A 3PJUA 3NZPA 3MVTA 3ZFHA 5F1UA 4CD7A 3A24A 7ODCA 4Q4QA 4O12A 2FB3A 3M6YA 3B05A 2FZBA 5H8PA 1Q7MA 1G4TA 4F2TA 1UWSA 3QHMA 1TWIA 1UD4A 4LVDA 5L9FA 4L5ZA 2QDHA 4C6FA 3L5MA 2MANA 2NV9A 3WNPA 1P4CA 3S46A 4BQ2A 2ISWA 3L5LA 4IFKA 3F4DA 4K1WA 2YCLA 4GFSA 2MNRA 4LWWA 2INEA 4W87A 3Q94A 4H19A 4V27A 5EMMA 4AWEA 2DV0A 5AVHA 3IARA 3BW3A 1X8FA 1A5MC 4ROQA 2OU4A 4GGBA 1IR1A 2QPUA 3AROA 4O18A 4BR1A 3C56A 3IRSA 1JAEA 1VC4A 2VZUA 4O10A 4POCA 5BWFA 2V5BA 2Y5SA 5LSMA 2PCEA 4KGLA 4DJEC 1TPB1 5FCZA 1O68A 1WX0A 4TX9A 4BA0A 2EKGA 4YIWA 1V0LA 2J77A 1L2UA 1OX5A 2D2HA 3OVQA 3B0XA 3GBEA 3W7EA 4M1RA 3FY1A 1YLVA 4D1IA 1EPVA 2F6UA 1UC5A 1G7UA 3TAOA 1C8QA 1TCDA 2QCDA 3CEPA 1EJTC 3AIBA 3HQOA 1BHGA 1LQAA 3WLTA 2G97A 1JZ5A 2ZE0A 2PP0A 5M17A 4R27A 4Q3MA 3YPIA 3AWNA 5IDZA 4P7LA 1GVEA 4QR6A 4Q8NA 4E8CA 4NSBA 3PK7A 4LQ1A 2E7FA 4LVBA 3UZXA 4DUWA 1YMYA 2OKTA 8A3HA 3W7QA 1FFRA 2GLKA 1V51A 2Z1BA 3KXQA 5HWJA 2WANA 3IJLA 1TE1A 3NWRA 2VCAA 2C14A 2DZPA 3FSUA 1C8VA 2J9YA 2G41A 4NZFA 4UWMA 3S2CA 4BWLC 2NXIA 2FDMA 1W5NA 4PMVA 5FF4A 1OFEA 4MKNA 1MNSA 3I6EA 2A3AA 2YW4A 2DZVA 4E3VA 4GUHA 3T2PA 1FWDC 1FHLA 1S2WA 2W61A 2OQLA 4X22A 1QNRA 4J7RA 1IYXA 1FH8A 1U5HA 1ONEA 1NDYA 4DO6A 4I9MA 4GUIA 3AWOA 3CXOA 3KOFA 1Q4WA 1FVPA 1KD0A 2C18A 2PPGA 1ZJBA 2E67A 1QAPA 1VD6A 4CQ9A 1BVZA 4DPQA 4X3ZA 3RK8A 3TLLA 4V15A 1BGAA 4MPKA 3VMOA 2ZVRA 1G9HA 2FHBA 4P8VA 4NVTA 3VD4A 3RFAA 2NX1A 3BLKA 3C4UA 5AFDA 3QV6A 1GOOA 3VA8A 4JX5A 2WZTA 4ES4A 7CGTA 2WMGA 1RJQA 4REQB 5HWMA 3VIKA 1OYAA 4JOMA 4ILSA 1DIDA 5D9MA 3M46A 4KRUA 3USZA 4GPNA 3U2EA 3E2SA 3DHDA 4ZXOA 3BO9A 2J7GA 3IGUA 2CZFA 1A5BA 1BF6A 2OG9A 2V68A 3OP2A 4LT9A 4LRSA 1SJCA 1XD1A 3UVAA 4KMQA 3DZ1A 3L66A 3JR2A 1J8VA 4IH3A 3LGEA 3AMKA 2ZCGA 3CPGA 1W17A 4UUIA 3CQHA 5I23A 1GCYA 1LLOA 1A4MA 1C8XA 4FX7A 4GE8A 2E25A 4KEUA 3LQGA 2VENA 1GW1A 1DJYA 1UR1A 1GG0A 3W7KA 3NAVA 1VFFA 3SQMA 4AX6A 2W63A 1ICSA 4UMBA 3QZ6A 4JNYA 4L80A 3V0TA 2J7EA 2PWGA 3OJGA 3B97A 3PZTA 4KFOA 4UFLA 4ZE4A 1FCVA 4MWAC 1QATA 3QR0A 2BGSA 4AHPA 1Q85A 3RM8A 4DYEA 4L56A 1RLCL 1G67A 4JFSA 4ZO6A 1NWTA 2DPEA 3BOXA 4AMCA 3CYJA 4UZUA 4EP8C 4RR4A 1NM9A 4QSHA 2QGYA 5IHSA 1TWDA 2GDUA 3MMUA 3UJ2A 2JGYA 1WOAA 3BJFA 3GS6A 3VDHA 4JDYA 2X1UA 4XTDA 4EXBA 4TX8A 2PS2A 1TELA 4JIPA 1E0TA 4XKMA 3SZ8A 4DHGA 1AFSA 4Z2GA 4ATDA 3ZIZA 1W2PA 1D3HA 2QYGA 3EWZA 3S9YA 3AYRA 3SRHA 2GVJA 3NSMA 4PODA 3XISA 3PBYA 1ME7A 4GOAA 1J6PA 4KH2A 1U83A 4PH6A 4GCXA 3PZOA 3AUOA 3HTWA 3NQFA 3MBFA 1ZBCA 3QW3A 3DX5A 4XBJA 1Q8AA 1WZAA 3DERA 1JCXA 1XKYA 1DIEA 3BVJA 3HA1A 2AOSA 4XZ9A 1PIGA 4TVDA 1QK0A 1KXQA 4PCTA 4GIAA 1X1OA 4AD4A 3LRMA 4AVNA 1VEPA 4F66A 1TTJA 3ZVHA 4HTBA 3K13A 4NI8A 1EDQA 3L65A 1TWWA 2H90A 2O9RA 2BOFX 4S3FA 3WNLA 2REQA 3NEHA 4OJYA 4IJBA 4PTXA 8XIAA 1JF6A 2QJMA 4HPHA 3SR7A 3C52A 2ONEA 4G7EA 1JFXA 3EB2A 1M01A 4QDWA 1HL9A 4XQ6A 1OCQA 2OB3A 1H4PA 1VKFA 4MZ1A 1TJ0A 5BXTA 4W86A 4L4PA 1GOXA 4AEOA 3UCDA 2XH0A 5E93A 4E2DA 7TAAA 3F4WA 4O1AA 4XAPA 4QEEA 1PPIA 4FP1A 4AISA 1E55A 3WUEA 3KDOA 4BI6A 3JRKA 4GBUA 4MJ4A 1PVNA 4UFJA 4YYCA 1UASA 2WJFA 2GVYA 3LRLA 1TRIA 2YX0A 2PLMA 3DN5A 3WD0A 1UA3A 5C9RA 1G01A 5DT7A 4FX6M 3WZ0E 1NEYA 3P14A 3W86A 3TXZA 1VYPX 4GQQA 4LCSA 2WMJA 1BGGA 2Z2UA 5FSEC 5IOBA 1W6TA 1AD1A 1F3WA 3M5ZA 2YB1A 5DELA 4RW3A 5FEPA 1WDRA 4Y9NA 1D8CA 2CBVA 3VKCA 2D69A 3TCSA 4IGMA 1HFBA 1KFBA 2VC6A 4LUSB 4R9XA 3U4AA 2JEQA 3F5LA 1N82A 4GIRA 5I07A 4YNGA 4KCTA 1P0NA 3UWEA 4S1FA 1PTGA 1VYSX 3CIXA 4HNVA 3NL5A 1EEPA 4IHCA 4IUOA 3WL1A 3VDBA 4M82A 3HV9A 3A9IA 1OVDA 2P0IA 3TR9A 1I2OA 5LA1A 3Q45A 1B3VA 3DI0A 1EJUC 2PWEA 3NA8A 3PUOA 4GO8A 2Y5JA 1TQJA 1H7PA 1EC9A 2HWGA 3PY2A 4C6EA 4HMEA 1EJVC 3W83A 4FXFA 2J79A 2NVDA 3VDAA 3GNPA 1TPDA 3NL2A 3GH4A 5A6LA 1MW2A 4N42A 3I65A 1JCMP 3MZNA 1R7OA 1IZJA 1WUFA 4XZNX 3O6CA 5HQLA 4JTHA 3BAKA 3WDIA 4C6NA 2J62A 3D3FA 1KM4A 4TQTA 3PHAA 3ITTA 4S3CA 1J4EA 1FWWA 2B31A 3CH0A 4PMJA 3B9OA 2PWVA 5AB3A 3EDJA 2GVGA 3QPEA 1W37A 2CZVA 3EWDA 4WZHA 4Q8WA 4DWDA 1V7YA 3ARUA 1K77A 4NILA 1X38A 4I6VA 1QPOA 2WAGA 1HJWA 1W1PA 1OFQA 4US5A 1E72M 2J78A 3HQNA 3MHFA 1NOWA 1Q6DA 2ZC1A 4AY7A 1OABA 4QG9A 3ALFA 2RGMA 2TRSA 5AKQA 2IQ0A 2QCFA 4H9TA 4NAFB 1IEWA 4GYPA 4JIQA 4HU4A 2Y63A 1DWHM 1Y8BA 3V5CA 4KRZA 3N6QA 2PP1A 1U33A 4UFMA 4IIDA 2AMXA 1ZCCA 1T40A 1B54A 3APTA 5E9XA 4UCFA 3N6JA 3F2DA 4AEEA 5FEWA 4L6OA 2IPWA 5GNYA 3MI6A 4QROA 1GHSA 4QQUA 5B7YA 3CV1A 1JGIA 2DVXA 2XHYA 3WLNA 5LYRA 1W5PA 4B5XA 4DNMA 1OGBA 4H8NA 5CAHA 5BU6A 2GJNA 1LWHA 1BSLA 1UD8A 1Q4NX 1FH9A 4HJFA 4P5UA 1K7EA 5CQ1A 4JCLA 1DE5A 2WSPA 3VIMA 4WKFA 4PGLA 4N6EA 1V7AA 5TNVA 1LBLA 4DB7A 3L7RA 1WKEA 4KIRA 1EA9C 3MYPA 1GJUA 3WYZA 1QOXA 1M3UA 3GTHA 4S3EA 1S39A 1BVNP 2R1MA 3U6WA 2OLAA 4W84A 4F4RA 4NL1A 2PLCA 5C70A 4I5RA 2HVNA 4PSRA 4CNPA 3NO3A 2WPGA 2ATMA 3BWWA 4OUEA 1E43A 4DWSC 5FOOA 4U10A 3WBWA 2VQTA 1D2KA 1K8ZA 4MNJA 3GZ3A 1XH0A 5AOUA 1GYLA 1M7XA 1SW3A 1EDGA 3VI2A 4QGCA 2P1FA 1U5JA 2PI6A 1J10A 4K37A 2QJHA 1V6XA 3M9YA 5AC8A 4NG3A 1O1HA 4EF9A 4AFYA 5A1AA 2V3FA 1QOPA 4J4KA 3RXZA 4FLOA 3FLUA 3HV8A 1ZP4A 3QV8A 2B0MA 3GBDA 1TRDA 2DJXA 1R2RA 4EPKA 4EAYA 3WQFA 5AECA 4RV3A 2D3NA 1XLJA 2GYIA 1JUKA 4IG2B 3B8VA 1CW2A 4R7WA 5CPTA 1PIIA 2E6DA 4DPPA 1XD0A 4X60A 3NOEA 1KCXA 5FI8A 3RX3A 1NP2A 3R5EA 2BASA 3WD4A 3CMFA 2FMOA 3HG2A 3FW6A 1Z69A 1VS1A 3GVRA 3T4CA 1M65A 1FWHC 7PTDA 3A3WA 3TR2A 4XBSA 3QV9A 4HK5A 4REQA 2WK2A 2YLLA 4GQ0A 1TTQA 4ALDA 3ITXA 3ZT7A 3G6LA 3TJXA 3UWQA 2J8GA 2A3EA 4JTGA 3TROA 2ON3A 1JDAA 2NQJA 1HKWA 4TUFA 3S1UA 2ALRA 1JD7A 3LCXA 1R2SA 3VGDA 3G1RA 2I16A 4JTTA 3NCOA 3M0HA 4DBSA 1QPKA 1FP8A 2VX4A 3G5EA 1W2VA 3FNDA 5CPMA 1RCOB 1W1YA 4F0MA 2Z00A 4RKAA 1AL7A 2I17A 3G1DA 4Z0SA 1HKKA 2PC4A 3P61A 4MHBA 1DORA 4E0CA 3SO7A 2XGBA 4Y8EA 4H6QA 1YQ2A 3ECQA 3BCJA 2CHOA 4AZHA 2WSYA 1OC5A 3EKZA 4D8AA 1W3KA 2VZTA 4GHRA 4LALA 3EXTA 1S3TC 1CEOA 3L2LA 1UKPA 5EBAA 2YCKX 3P5YA 2DEPA 4LU0A 1C7SA 4Z1AA 1Q2RA 1UMLA 3WUBA 1GQJA 3W1LA 3QHNA 5CEWA 3K5XA 3CHVA 2OJPA 5AYXA 4HZMA 3NZ1A 2XWEA 1E40A 4AIEA 5TAOA 3M41A 2KX9A 3MA8A 4D6HA 2O4QA 2CIPA 3FVDA 4GNJA 4PBEA 3W4RA 1PL9A 2BXVA 1XWYA 3ZWSA 4MLJA 5JMUA 1AJ2A 2HE5A 3DYMA 4OWGA 1Y65A 9RUBA 5J5DA 1CTNA 3UJFA 6ENLA 2OSXA 3HPAA 2OSYA 4GY7A 2OYLA 1AW2A 2AGKA 4AB4A 1XC4A 4P8UA 2WC4A 3GYCA 1DWJM 3P7YA 4KWOA 4KKXA 1PCWA 3I68A 1FP9A 4F0HA 1AL8A 4ZCWA 2X40A 2ZXBA 3WFAA 3PANA 4NAEB 4J5NA 3UZZA 1XP3A 4JTCA 4C1NA 3QHOA 1OEPA 1X39A 3RDKA 1QHZA 1MWOA 3ABXA 1W3IA 2XZ7A 4B5NA 1CGTA 4CD8A 1V3LA 2NX9A 3DIPA 1AZ1A 1EOKA 2I7GA 2R24A 3OOQA 3PZIA 4BJHA 5BW6A 4LYPA 1JL8A 1HL8A 1EBGA 3LSCA 2AAMA 1VENA 3PSWA 5CG7A 5HNRA 3TIMA 3TYDA 5FL0A 1LM1A 3E5BA 1PDYA 4AD0A 1H41A 2Z1KA 1OFDA 3LI1A 1F7BA 3OZPA 4JYFA 1OFAA 1V6VA 1KR0A 3F5JA 4AF0B 1KM3A 1BLIA 3S2JA 2G8ZA 5FL1A 3NSXA 4OKDA 3R7MA 3CTLA 3PP7A 1RZMA 2C6QA 3IWPA 4H01A 2Q8LA 2BNJA 3QJAA 4HNNA 3SDOA 1WXJA 5F4WA 1V77A 4GZ7A 4M80A 3PZNA 3MCOA 4H04A 2EXOA 4BQ3A 1Q6OA 1B9ZA 2W3ZA 5D2WA 2I56A 3ARWA 4DJDA 3W7GA 2PD5A 3F1QA 2OELA 3R58A 3TDFA 1XQLA 2AAAA 1UYQA 1R3RA 2GGJA 1R46A 2XIIA 3M7SA 3NPXA 2JF7A 1I1XA 2FHFA 1RJPA 1E51A 3PBVA 3R0KA 2P50A 2VX6A 5A8MA 5HQEA 1ICQA 1QTWA 3N2MA 2SFPA 3IK4A 3W73A 4A2RA 2CYGA 4IWWA 2BLEA 5MKGB 1YTKA 4HHLA 2O0TA 4DBDA 4K36A 1E9YB 3TW9A 5D05A 3V75A 4J2MA 1N8FA 3FK4A 3CO4A 4YVVA 3LCFA 3LGGA 1SSDA 2W5FA 3FN9A 2YXGA 1KWGA 1HJQA 2DORA 4QAIA 3IIVA 5J04A 3P8JA 1H3GA 4UFHA 1ITCA 1RV8A 3KCOA 4LUSA 3N4FA 1JULA 3TC7A 5PTDA 3QF0A 1VRDA 1LP6A 3LN3A 3URNA 1GJWA 2DSZA 2QZRA 4Y7EA 2VI0A 3UZYA 4BHYA 1FWIC 1H7NA 2OOGA 3GTNA 4IGSA 4PB4A 4GO9A 4CQAA 3FSTA 2VDIA 4IMAA 4J3VA 3VOJA 3IJQA 3B8SA 2EBNA 3LCIA 1YKWA 1I0DA 2WMHA 4GXPA 4DEFA 4Z2HA 1G6CA 3WJSA 5D9PA 1EHAA 4UB9A 4KFPA 2QDDA 4DZ5A 1QMLA 3NM3A 4O14A 3UNDA 5BU9A 5HNUA 3SW6A 3CQ0A 3MSGA 5H1WA 4ZQPA 2BVDA 5K4XA 3EXSA 2PCQA 1F6PA 1DJXA 4ZQCA 3DDMA 3TQKA 5D03A 3KCLA 1Z41A 4X0VA 2KAUC 2QCEA 3WF1A 4DI9A 2RJHA 1BRLB 4KETA 4A3QA 3KDNA 1J96A 2VUYA 3MZ2A 3DOPA 4GLEA 3N9RA 3NPWA 1WE5A 5J5RA 2AGTA 4LYQA 1ZFJA 4NAFA 4F0KA 2OQYA 1DXEA 2Z6JA 1GWJA 3N9SA 4Q7NA 3W1RA 4I9AA 1EGZA 4PUKA 3H7RA 2WHLA 4A22A 4WJXA 3PUEA 2VL4A 1JZ8A 1WAUA 2O9PA 3UPMA 1B3YA 3CBWA 4W9TA 2YL9A 3EX2A 4PUJA 3BW2A 3TE9A 3LBMA 3MDUA 4TX6A 4U28A 3E0WA 3WFZA 3E6EA 2ADAA 4WHBA 3W28A 1OC6A 3DFPA 4OU1A 1EC7A 2B4GA 3KVKA 3BE7A 1M53A 4S3AA 5A6KA 3AFBA 4PBGA 4MYAA 3PAOA 3CV2A 2OXNA 2JALA 3LV6A 3WH9A 1VZWA 4AC1X 3V7PA 3OGSA 2CC0A 2X05A 4ZQOA 1QPQA 1IQ8A 2OQHA 4QQ3A 3GW0A 2WMKA 3EOSA 3NQCA 5IBXA 3WF0A 4JTEA 4W93A 3TYEA 3ONBA 3TTQA 2YL5A 4JY9A 5HWNA 4NYYA 1IT7A 5CSYA 3WQGA 2VEFA 1UBSA 1M1BA 3GG7A 4HN4A 5ABEA 4LFYA 2ZIDA 2GZXA 2B7PA 3NYZA 1L6FA 4NNCA 4XVDA 3MKVA 3MB9A 2GJRA 4NJIA 3ELFA 3QPYA 3AHTA 4FSAA 5JQ9A 1O7AA 2J7HA 1JCNA 3EAUA 3TA6A 5A2AA 3PZMA 1TV7A 3WNNA 5A94A 5AY7A 1A49A 1BWVA 4YYFA 3HZ3A 4HK6A 3C8NA 2PDBA 4FNPA 4NZJA 1JZ4A 1NDZA 1GG1A 5A6BA 1HL2A 1E6NA 5I78A 1AODA 2VRKA 5KEZA 1GUVA 1Q7ZA 4F2UA 1O66A 1DJZA 3UF9A 1CT5A 2V6AA 3UXLA 3MO7A 2W91A 4C6DA 5G1YA 1AW1A 3I7SA 1CB2A 3TEVA 1OF8A 2ZC8A 4H9ZA 3KFTA 3GIPA 4ZVJA 1JNDA 3LNMA 2JF6A 1TPWA 2Z7KA 1I6NA 3W7PA 2CLHA 4MNMA 1XCWA 4C6MA 4DIAA 4NZ5A 5E6YA 4O50A 1ISZA 2Y4SA 4KWWA 1SYTA 2J9ZA 5AHEA 2XINA 5EMKA 4P7OA 3TYCA 1E4MM 2GJLA 3DFSA 3CWOX 5DXYA 1M5WA 4N4QA 4FNUA 4MNLA 4H83A 2DT0A 5D8WA 2DT3A 3GHUA 4GINA 3PJWA 4FI4A 3Q65A 3GY1A 1QK2A 4C60A 4MWAB 1XI3A 3VGEA 4JPGA 4LSBA 4KWVA 4Q7BA 4WXYA 4PC8A 5IRPA 1DJQA 5C2XA 3EOEA 3W7HA 1XH1A 4Z42C 2GJXB 3WD2A 1E6QM 1EGVA 3BQ6A 3BMVA 1Q13A 4JFUA 5GPRA 4A29A 5I5RA 3BJTA 1XLCA 2ZRUA 5JBFA 1PYFA 2VMFA 1R30A 4ACYA 3LNPA 3UPWA 3W53A 1JXJA 4XWUA 2J74A 3W2MA 1LUCB 1FWJC 3UW6A 3DG6A 3U4FA 2DU2A 4GISA 2J7BA 1ZS2A 1C3FA 2Q01A 2WKGA 3V4BA 4LCRA 5JU6A 1ECQA 2AQWA 1OYCA 2QDEA 5HXMA 5KTLA 1SFJA 1HJSA 3CZJA 3W1QA 4KEMA 5HMSA 4D71A 4LS1A 2DZAA 3IVTA 1OK6A 4F2BA 3TV8A 3CZ8A 5LXEA 3CGTA 4JQ4A 3MC5A 2VGGA 5LNRA 1UIOA 3S9ZA 3N1AA 3E0LA 4NIRA 3K30A 1ONWA 4IPPA 1UR9A 2EPNA 3VM7A 1XCXA 4N02A 4EWJA 3GXTA 1IT0A 2EG8A 5CLTA 2RDXA 3CUJA 4J35A 4MJZA 2NSOA 2GWGA 2O56A 5C9UA 4ZL1A 4E4FA 1R85A 3AMLA 4UQ9A 1ZLPA 2YCIX 2ZQ0A 1LCOA 4GUFA 3WMCA 2VDGA 4C1LA 2J7CA 4LC8A 3KTSA 3UY7A 3S42A 3WO8A 3V5FA 2QCLA 1KV8A 3P62A 4XVEA 5I00A 3KEHA 1LRQA 1NU5A 1ZAHA 4J3WA 3G1VA 2HBVA 4Y9MA 4GKTA 2VEPA 5LIUX 4Y9OA 4L9YA 3MU7A 4AF0A 4IP5A 2C13A 2A79A 5JUVA 2Z1SA 3GLCA 3H21A 1S2AA 4WY0B 4IIGA 2UY2A 3SIMA 3O0FA 3ARXA 1Q63A 5I3DA 3C0LA 1RK6A 4OBSA 1GVYA 3QOKA 1TVLA 4PBFA 2EQDA 1YTDA 2DDXA 1EH9A 1JR1A 2GVLA 4GBDA 4GX9A 4AXNA 4I6KA 1YHTA 4I90A 1G5AA 3VDCA 1XICA 3VILA 4B92A 3NQDA 3VIFA 4X61A 4DLFA 7XIMA 1I2NA 2W0UA 3BGJA 3VC5A 1P7TB 5D37A 2TAAA 2CBJA 5CGQA 4MB1A 1VB9A 1BPLB 4TTUA 3D5HA 1ZPTA 2ZDRA 3EA2A 3A13A 1NIUA 4NY2A 3KL0A 3FKKA 1PBGA 3LTPA 2EGZA 2G5WA 5HANA 4LNYA 1LT8A 1RALA 4P7NA 3FIGA 3HB9A 1MVYA 2H3BA 5KZEA 1OC7A 1EIBA 2C19A 4GH1A 2CESA 2BOGX 3CWHA 5GJPA 3G0SA 1GYNA 1JYNA 1UPPA 3PWGA 4R9OA 1YXYA 1VFHA 3B8WA 2QV4A 2E8ZA 5LKYA 2ABAA 3UD6A 2WSKA 3A4XA 1JI1A 2TSYA 1HX0A 3WK2A 2AKZA 1VFSA 1VR6A 4UOJA 1UWUA 1OF6A 1KBBA 4WKAA 1Z32X 2P53A 2HRWA 4NT0A 3OQ8A 4Q4OA 4WJEA 4FX8A 4NJJA 1HW6A 5D9NA 5FF0A 2X1TA 4DJFD 4CEUC 3NQ7A 3WQ6A 3XIMA 4RPPA 3PUDA 4XO6A 4WUIA 1QW9A 2I1OA 2QUMA 2IPFA 3LV5A 1PWLA 1RR2A 2NWRA 4GYPC 1ZSXA 4RNHA 1B57A 3GB6A 1E0WA 4K8HA 3B8TA 1XFBA 2E3ZA 4DUXA 1J0IA 1TIMA 3AYVA 3DHFA 2HS8A 4G6CA 5HUPA 3IUIA 4NQ1A 3ZVIA 4QS5A 4WDUA 1KM2A 1LTDA 3AMDA 3L5AA 3VE9A 1E1CA 2J7DA 4PYSA 5DY3A 1X8CA 5KZMA 1FWEC 2PDCA 6ALDA 3OYZA 4XBKA 5I77A 2XVNA 1OZMA 5AZ0A 4EPDC 2QVHA 3FXYA 3UZJA 3HQ1A 5CGTA 3L4TA 1BRLA 3GKAA 4EF8A 1U1HA 3CO8A 1CCWB 2DT2A 3M0VA 4M1BA 2RGLA 1TTIA 2R9RA 5FF2A 4A3YA 4HU3A 3M0YA 1U5VA 1EXPA 1K3UA 1IIHA 2O9TA 1P1XA 4HTYA 5BXPA 3VOIA 3VK5A 3P6LA 1A0DA 3W29A 2J8TA 3GK0A 5GNXA 3DUGA 4DJEA 3L9CA 4MJ2A 2Y2WA 4RL3A 3E02A 1UUOA 4GGHA 3W76A 1B4KA 5DEZA 3M0LA 5DANA 2NV1A 4JTQA 3T0CA 3PZ9A 2D23A 1JPKA 4B90A 1KBKA 3TYBA 3GNDA 4IICA 5LNSA 3QFWA 1XINA 3GTFA 2CZDA 4ONVA 4QJ3B 5E5CA 3WNOA 2Q09A 1BYAA 4ZGYA 2VR2A 2Y7DA 4MB4A 5F4XA 1XLBA 1US2A 3KWSA 3QZEA 2J27A 2FGLA 1X98A 3KVJA 4X9SA 4NNAA 2PBGA 1A5NC 3C2VA 4BQ5A 3KBSA 2OLSA 3MV11 3NQBA 2D2OA 2Y1HA 4EX4A 2FPTA 4IPLA 2ZBTA 3URAA 2FZMA 5CJ5A 5DT5A 4D1JA 4L4OA 4WCJA 4BWLA 1PKNA 3B9EA 5CAKA 2F2KA 4PB5A 4HYVA 3KOXA 3WLQA 1Q65A 1GGOA 5A8OA 5RUBA 2X2YA 3UR7A 1QXLA 3QQWA 3H4XA 1TV2A 3A64A 2PDIA 3M7WA 3PG8A 3KE0A 1FBAA 2J66A 4C5YA 4Q4MA 2GUYA 4M0XA 3MUY1 1H7WA 2OZTA 4G9PA 3UYIA 5FJOA 2BY3A 3R4IA 1OFOA 4ZOAA 1UA7A 3GVVA 1Q6EA 4Z2LA 3HURA 1W1VA 2OWXA 2GQ9A 4H6EA 4QG6A 1I4NA 4Q6JA 1Z9AA 1D3CA 4YHEA 1L8PA 4R85A 1KFLA 2HROA 1A80A 1OHLA 4K8EA 2JIWA 1KXHA 1EWDA 1AQ0A 3SY1A 3UR8A 3FAXA 5I3FA 2Z4GA 5FKYA 2IS7A 1W9DM 2GDQA 2ZUMA 3EWUA 4CNOA 1XRSA 2OOFA 2HVOA 4MADA 3KZSA 3E0FA 1PKMA 5FJIA 3KCJA 1VPYA 2FFCA 4AZCA 2WNQA 3HG5A 1SPQA 1TR9A 3CC1A 3BG9A 3L0GA 5C8BB 1NOUA 2YDQA 2QUUA 2QEZA 1KM6A 1TO3A 2ZRYA 3KL3A 3AMCA 1VF8A 3COTA 1IR2A 3MPGA 3N2XA 5HMFA 3DENA 4PMQA 4CQCA 3PWAA 3L4VA 1M41A 1W1A1 1DJNA 3SCQA 1X97A 4CCEA 4U31A 4ZZ9A 1Q6RA 1O5XA 2V0TA 4E3TA 3W1UA 2ASHA 3MV01 3FYOA 4RLIA 2QUTA 5FEXA 1CXEA 2FIQA 2GJXA 3U8GA 4W5ZA 3TSMA 4KGJA 5XINA 3LRKA 3C2YA 4A3RA 1LOLA 1QT1A 3T40A 4DYJA 1BQCA 1XSIA 1W9UA 1VBUA 4PA8A 1B2YA 1E4IA 1EPXA 1QHOA 4AY8A 3HIJA 4ACZB 4O4VA 4ZR8A 1LUCA 3W75A 2FTWA 4HGXA 1QDSA 4QJ1A 3GG8A 3RU8X 5ABTA 1F8MA 3QGKC 2CCRA 3R13A 4HZ6A 3SN4A 4HNLA 2A1YA 2XN2A 4XAZA 2JFEX 3TSBA 5IXEA 2OYKA 1XIHA 4HHHA 3T0BA 3W88A 1W1IE 5EKYA 3R8GA 4CNTA 2PZ0A 3DFOA 1FWNA 2NQ5A 2BMBA 3SM0A 1EZ2A 3C3UA 2NQLA 4GI6A 1CGVA 3LXAA 4PFMA 3DBPA 1JZ2A 3ZR5A 5DO8A 3JZEA 1JUEA 1VEOA 3N4EA 1MUMA 3S6OA 1GOMA 2WVSA 1M7PA 1M6JA 4DJDC 5DFAA 1XLHA 1TJPA 3UR5A 1EO5A 5CC5A 1UP0A 3EOUA 1HGYA 3LY0A 2CHNA 3TFCA 2PGRA 4FIRA 4YVXA 3UG3A 2ZUVA 3VMNA 2C91A 2DQXA 1UR3M 2XIMA 4P8WA 3C0SA 1SFLA 4GNVA 3MDWA 3OVPA 4AG0A 2R94A 4MAVA 1NWSA 3AIEA 4PULA 3WLJA 4ZOCA 2DIKA 5HNTA 1XIBA 3GKFA 1VBJA 1EUNA 4NZCA 3T08A 3RCYA 4DBWA 3ITGA 2XISA 1IGWA 2NVAA 3WKZA 4GQGA 4FB7A 5CCZA 1F74A 4WY0A 5KZ6A 3PBWA 1YDYA 2GQ8A 3AZSA 4F8XA 2XUCA 2CLOA 3BANA 4R5EA 1F6YA 4MGGA 1K9EA 4S3KA 3TTOA 4LBSA 4D6JA 4IJCA 4ICNA 4DELA 2YA1A 4LF2A 3M0JA 1ZBVA 1KBJA 2HPIA 2JEPA 1LQ2A 3W9ZA 5DMMA 2ZTKA 4ZQNA 3ANVA 4CD6A 3WEMA 1GKRA 2BHZA 3U0HA 1QOQA 3OHIA 5CG0A 2XIOA 3CV6A 2CLMA 3LHZA 2CBIA 4IIFA 3FHAA 4FR6A 4AMAA 1WDDA 2VDHA 3IUDA 3SRDA 3RO6A 1MRQA 1LG1A 1AMKA 3KS6A 2EEXA 4GRSA 3EA3A 3FJ4A 2VR4A 5JIPA 1R9YA 1VLWA 3SN0A 2CHRA 5BROA 5T9BG 1O60A 2WZIA 3STCA 3FA5A 2G95A 4JDBA 2V8ZA 4B9YA 4C6JA 4C6OA 1BYCA 2NXGA 2PURA 2FZ9A 3PG9A 2PAJA 3A21A 3UXKA 3PZQA 4MIMA 4YTRA 1AQHA 3LBCA 2C8NA 1IZKA 2Y7EA 3TFXA 4OBRA 2A3HA 2DW6A 3DYPA 3WH6A 2XZ9A 3RITA 3UXAA 5DY2A 3G1AA 4L9XA 2RUSA 3B4UA 5G1MA 1Z7AA 2P88A 1FCBA 5A8GA 3TQVA 1P0EA 1IWAA 3WBXA 4AXKA 3VCCA 1DVJA 1MDLA 1NTHA 3LGDA 4CVUA 4HPJA 2CZEA 5ABHA 1ZRQA 1VHCA 1F2JA 2Z25A 3VIPA 2J25A 3SI9A 4HJWA 5AC6A 4KEVA 3OLGA 4JHOA 1KXTA 4K1GA 3NQ2A 3V1PA 2DJLA 3VNLA 2I14A 1QI0A 1W32A 3BTNA 4MMWA 3DGBA 3TJLA 3N11A 1RBLA 2B7OA 3E9AA 4HYWA 4GY1A 4LS2A 4DY1A 3HPXA 5FA5A 2VWTA 1WXZA 4D8ZA 3VFLA 4W88A 3O6DA 4GCAA 1HO1A 2PRMA 1FWBC 1GKQA 2QCMA 3I3DA 3ERPA 4MB3A 1J6OA 1HZYA 3GUGA 3RUBL 3QLLA 1W91A 2GVEA 4JKLA 4K38A 5HPCA 5FJJA 5DCDA 3AUJA 4WK9A 4NX0A 1UB3A 3ONCA 1I2PA 3S2MA 3GU1A 4Q8UA 4TIMA 1X6LA 2ZRVA 1NARA 1JRCA 1U30A 4L4MA 2CLEA 5K9CA 3LYEA 3L4XA 3SUVA 7TIMA 3ABRA 3QPZA 5D33A 3C3NA 3ARPA 3BAXA 1OFRA 3BGAA 5A6JA 1E73M 3ISIX 3GWQA 5T8GA 3BK0A 1K8XA 2FQIA 1T99A 3GVWA 1WYIA 3PBUA 5FJRA 4KT2A 1YBQA 3WDHA 2HTMA 3SFWA 5FEZA 2J6XA 2Y7GA 4PTDA 1DXIA 1E6XM 4C6IA 1JPIA 3NVTA 2G3JA 3NSNA 1UH4A 3ITLA 4TR9A 5CLWA 3C61A 1UWTA 4CNUA 5M1TA 2JK2A 2BTMA 1K8YA 4QX4A 4RE4A 3VOHA 1V02E 2PWDA 2OYMA 2NVCA 3CL8A 4AHOA 1HVXA 4CQDA 3D6NA 1O95A 1WDPA 2VVNA 1XHGA 2D2JA 4OT7A 4D6FA 4NP7A 3BAIA 4W89A 1ZGDA 4M5PA 5FAJA 3FYYA 3D0CA 4HZ8A 2ISSA 3CZGA 2CLKA 3ZT5A 1FKXA 4AD1A 1UWIA 3G77A 4PUMA 5LNUA 1EHNA 1M7OA 1TV5A 1O5KA 4C90A 4PUUA 2Q02A 1FA2A 1YE4A 2QCNA 1LOSA 2GOUA 3THAA 5SWUA 3B9AA 3HBLA 2RH9A 1PSCA 5K9DA 3MUCA 4BK9A 3BC9A 1P1MA 2CW6A 3VYLA 5D04C 3WMBA 2AL1A 1WB0A 5D2TA 3S2LA 4U4MA 3ABZA 3RLHA 2YGYA 3TOYA 1EF2A 3DAQA 5B80A 4LAUA 2IPGA 1X6UA 5I24A 2HJPA 1W3JA 5LZLA 4RJEA 3BG5A 4D6DA 3A47A 4UQAA 4UTLA 3O7UA 2Z29A 3MUAA 4Q8QA 4JX4A 3WBEA 3HG4A 4BI7A 1XBZA 3T6CA 2J4GA 3PWIA 2WSRA 4IP4A 1PWMA 8TIMA 1V93A 1GOIA 4ERAA 2VUNA 2IKIA 3LU2A 3RCMA 4YTSA 3CWNA 1YDVA 1XJBA 1IEXA 1JVNA 2JKPA 5CC6A 3LOTA 4QG8A 3NQVA 4BFAA 5FF3A 3QMTA 4AIOA 1G94A 1KLZA 1EKOA 2DSKA 5KETA 1OX4A 3QOMA 1WKYA 2QAFA 8RUCA 3WDQA 3WBAA 5AYIA 4LY4A 5I3KA 1ITUA 3RMEA 4RXGA 1F3TA 1ISWA 1QWGA 3CL7A 3R94A 3NO1A 3WEOA 3H54A 3ZVHB 3L23A 1GQIA 2ZXAA 2E1DA 3F03K 2X7VA 3LLFA 1A53A 3A22A 2XG9A 1E5JA 1OFBA 4GC4A 1LJYA 2E5BA 4ACZA 4BQ4A 2XFFA 4X2RA 2YLAA 2GSHA 3UQNA 2ODOA 5FSDC 3WJWA 5CSUA 4WSKA 3HU7A 2WVTA 2ZOXA 5DXXA 2WSQA 5HQMA 3OLDA 2C0AA 3QQ1A 3WH5A 1KBIA 3MMDA 3VX1A 4E6MA 2QMKA 3K4DA 4C6QA 3VCRA 3V1HA 3TSDA 3LXBA 1WQ5A 2FLIA 1WDQA 1GOWA 1IEVA 4CKQA 4R7OA 4JD4A 1T8XA 5HMDA 4OHQA 3GH7A 3GVQA 3TW6A 4O0QA 1S2UA 1XSJA 3RJXA 1HP4A 5DLCA 2C1HA 4Y90A 2HQAA 2YKKA 3AU2A 3T1GA 2CLFA 3PC0A 4Q8OA 3KTCA 1BTCA 1UW9A 5C9WA 4B91A 3G18A 3LPFA 3MSYA 4O1DA 2FKPA 5HOSA 1R0MA 1KGXA 4H41A 4ERIA 4E5TA 3VNZA 2PZNA 2V82A 4Z1CA 9CGTA 4F48A 2YZRA 3H4WA 3LHWA 2XGZA 3PF3A 3O6AA 1GQLA 1XLKA 5A5WA 3VTRA 2ZUUA 4G7FA 1XYMA 3BL3A 2HSAA 2PF0A 1EF3A 3VUSA 4ADUA 2CFFA 3A5VA 2AL2A 2YPIA 4XV0A 3HO8A 2VFHA 2X16A 2HK0A 4NU7A 3F2CA 1C29A 1SZFA 3PTKA 3M4HA 4JR5A 5FF7A 4RX0A 1I45A 2EAWA 2HPMA 2PRLA 1HNYA 2E77A 3FAWA 3O3RA 1K6WA 5J8LA 3SCNA 1LWJA 2WCGA 1XISA 2CLPA 3R10A 2Z24A 2DUXA 1FDYA 2RJGA 1VGAA 2OX1A 3GXMA 2QF7A 1TJRA 1QU4A 4IFOA 3KAOA 2XFRA 1UROA 1RP9A 3OA5A 1K8CA 1FCQA 3H2AA 1HP5A 3ZOAA 4JTSA 1LRTA 5BXRA 2B7QA 3I3EA 1C92A 4CUCA 1B3XA 3MTWA 3SGUA 1UD5A 1EJWC 1H7RA 4E38A 2V2DA 1V03A 3VNDA 1E0XA 4MZYA 2J13A 4Q4KA 3AO0A 5H8UA 2QGHA 4UTFA 1XLLA 4Z2KA 3C2RA 3PZUA 4QSFA 5U7SA 1QRQA 2OGYA 4XZLX 3EOOA 3NG3A 1GZGA 3LPOA 4FF7A 2WNZA 1C9WA 3D47A 1WZLA 4NUWA 2WYSA 1WKDA 3VNKA 1E5NA 1CX9A 1DWAM 2CEQA 2EF9A 2RAGA 3C5QA 4N2YA 3LX9A 1TG7A 2PB1A 5I09A 3CT7A 1C8YA 7REQB 3TN4A 4JAWA 3BAYA 3B0UX 3MANA 1R38A 4IMGA 3OYXA 4WSJA 4QE1A 2JBMA 3AOFA 2H6RA 2W62A 3CPUA 3B0VC 4PEEA 3UT0A 1V02A 1VPXA 3NDZA 3HGJA 1LOQA 1DKWA 3KOWA 1L6GA 1IWBA 4HCLA 2W9MA 2V81A 1N8IA 3OIHA 3ZMRA 1GOKA 4YLWA 1UC4A 4QLKA 3OBAA 9XIAA 1K4HA 1QNQA 4PE8A 3HGRA 1QHPA 3CUHA 3I10A 3HFTA 3RPMA 2ZX9A 1E4NA 1UH3A 3T0TA 4RDYA 3N4AA 4GA8A 2IKGA 1FWAC 4LF1A 4J3TA 1RPKA 3WH7A 3E2QA 3WUGA 4O28A 1A0CA 5F2LA 3N6HA 3MKCA 1Q3NA 1W9PA 3R43A 4AYSA 4DZIA 1K4GA 1GNXA 1F5ZA 4JTLA 3EA1A 2F6XA 2PLKA 1EA0A 3BSMA 4E8DA 1FHDA 1Q45A 4O4WA 4MOZA 2FH8A 1R3TA 2VCCA 3OLIA 2WMFA 4HCDA 2OO0A 2E28A 1J5SA 5JVLA 1KM1A 3PM6A 2XTKA 1B9BA 4W85A 3H23A 1F07A 1DQWA 3LHTA 4B16A 3W1TA 5M2FX 4GVGA 3LHUA 5BXSA 3U2OA 1ZAJA 2P3ZA 1XL9A 4US6A 3M0MA 4IOTA 2XU2A 1EFZA 3AXHA 2PRHA 4OQVA 3W27A 3FFSA 4K3ZA 2ZUSA 5FJPA 4U2YA 1MDRA 3O16A 4LBRA 3STPA 3FVMA 2F7FA 5EMUA 5DMLA 1XYCA 3UP8A 3ZR6A 1XUZA 4AZ5A 3S3GA 2QCCA 1KM5A 5AVNA 3GTXA 1BWLA 2H3DA 1WV2A 3WLRA 3N73A 4I9TA 4J3SA 4FXRA 3HMCA 5CSRA 1F05A 5LHEA 3VD5A 2Y70A 3EPMA 4MYXA 3T55A 3SY5A 3UA4A 3ZT6A 1EQPA 3QY8A 1XX1A 2GUBA 3VVGA 2ZA1A 3MJYA 4LBUA 1IF2A 3LCLA 1OSEA 4NXKA 1NJJA 5I3HA 3NZRA 5I3JA 4DF1A 2PWHA 3PTQA 4LOCA 2Z2BA 2WQDA 3VD7A 2YB4A 2XGIA 4XUYA 4NXSA 3L0NA 4GJ1A 2HV5A 1U22A 3GDBA 3KW3A 1SFTA 1SZEA 5TBOA 4N7QA 3HG3A 2FZ8A 3UWVA 2D73A 1G0CA 4I5UA 1SW0A 4HA3A 3ZZ1A 4XTIA 4C6BA 2WWCA 1FCUA 1ZY9A 2WVUA 5AYYA 1DXFA 3EX1A 2FTPA 3B4YA 1O6IA 3SIZA 2Z1XA 1SZGA 3IIXA 1TFVA 4GABA 1S3HA 4C65A 1NWUA 2VXNA 4TTGA 1YDOA 5A8QA 3LEPA 4CNNA 4R34A 5A2CA 3L0KA 3DC8A 2VD9A 1GVFA 3VFCA 1H09A 1EO7A 5H2ZA 1UD6A 2V3DA 3LHVA 4O1FA 2PU0A 3KVLA 3G0UA 1EQCA 3N12A 4NF7A 3QTPA 3U9IA 4EPEC 1DOSA 5IM51 4E4UA 3H2FA 2G50A 3WQ8A 5C71A 3TC6A 1H0GA 1W9BM 1SU5A 1YNPA 3OBEA 4GH3A 3N17A 4YU1A 1J0KA 4GYJA 4LEQA 1YE6A 3EMCA 4S39A 5CC7A 4B3KA 3S5NA 1MRAA 4NRSA 5BNKA 4PL1A 3VABA 4ZMGA 5D09A 1HJUA 5LA2A 1XLFA 2AKMA 3A3XA 2ZA3A 3BLLA 5M03A 1XLGA 3K8MA 3CL6A 3WX7A 2C0HA 1UIPA 4H7ZA 1LL4A 4G5DA 2A7NA 3LZ5A 3RLVA 1OX6A 2QQ6A 3VZZA 2O55A 3SCOA 1NWRA 3VINA 3JVAA 3ZYZA 3MVIA 4HN8A 4C1NB 2D20A 4GJIA 2WJEA 4CCDA 4FLRA 3WMSA 2INFA 2CZ5A 3E5PA 3VO0A 2PDGA 3IJDA 3LPGA 2HK1A 1PKLA 3ZLGA 2PBOA 3EBVA 3QMSA 4NASA 3QRHA 3IGXA 4U3CA 3P8IA 1DIOA 1E4LA 3VOCA 1RY8A 2QKFA 1Z3NA 2OZ8A 4Q33A 4F0RA 2XH4A 4PFHA 2J75A 5AHLA 1A47A 3W7CA 1JCTA 1JPDX 1HVQA 3E2RA 1ZTVA 4XO7A 2ACQA 4JYDA 3FOKA 4C6PA 3STFA 2F2HA 4YWIA 3SN1A 5HK4A 1XLEA 5A6TC 5LGXA 3V36A 3AHXA 3GDTA 1L8NA 4NJHA 2WOQA 1H2JA 1MUCA 4O0ZA 4A6GA 3H12A 3APYA 2VC7A 5LA0A 1W1ZA 3CASA 2QXWA 3WBYA 4H00A 1PE1A 5DQPA 1UMYA 1KFCA 3EPOA 1LZOA 3P2VA 1W54A 4ICCX 4HYRA 3WDRA 7A3HA 4C6KA 4QEHA 5DMYA 5HR6A 1OBAA 2E6AA 3OBKA 1OD0A 2DSVA 3ARSA 1ALDA 1PZ0A 4HB7A 4LV9A 1W3NA 3PULA 5CPQA 1QNOA 4NZ3A 4ZBCA 6XIAA 1TB3A 1RPXA 4W5UA 4HMDA 3A5FA 3R0DA 3CUIA 3SRKA 2VX5A 4GYFA 3W1NA 1VFTA 2G3MA 3O15A 5E9AA 4WDXA 1ZJIA 3L4UA 5CXPA 4FA3A 1EYWA 2IKJA 1ZBKA 4BZYA 1H11A