1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
molecule tags Structural genomics, lyase
molecule keywords 2-deoxyribose-5-phosphate aldolase
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
3SGUA 3YPIA 3C0JA 5EL1A 2HSAA 1QPNA 3NL2A 5C55A 2NWSA 3S8HA 1O95A 4L4LA 2OMAA 1F6PA 2YXGA 4GFSA 3B0PA 4A29A 5HWJA 1YTEA 1HL2A 3F4NA 4E38A 4QISA 4TIMA 3S5OA 3RFAA 8TIMA 5CG7A 1VH7A 3W83A 3A5FA 1FWTA 1N7KA 3S1XA 3G1SA 3GDMA 3NQ6A 3W2KA 3LTPA 4FXRA 3R13A 2B7QA 1P1XA 1QPOA 3N73A 3DZ1A 5EYWA 4WUIA 5IBXC 3W73A 5D2WA 3PS7A 5D37A 3UNDA 3DFTA 3PY2A 2EKCA 5AHEA 2A4AA 3TX9A 1X1OA 5FI8A 1TQJA 2EGZA 5AC8A 4IMCA 1R46A 1KTBA 4JGDA 3ABRA 2FFCA 2F84A 1R2TA 5L6UA 1H50A 4RX0A 4RLIA 3GKAA 3RF9A 3KRSA 3PUDA 3CC1A 1PCWA 3A21A 5F2GA 1LTDA 3NM3A 4POCA 5FEZA 3KX6A 2V9DA 3U2OA 3C2FA 2E1DA 4MIMA 5KINA 3O6DA 2BWGA 1N55A 5I3JA 3Q58A 2QUVA 4AWUA 5F2LA 2BLEA 2D73A 4GNJA 2E6AA 1H1YA 3PBUA 4O13A 4JTKA 5LNVA 3CIWA 4Z1AA 3N9SA 4Y6GA 1QR7A 2W6RA 2VEPA 3SR7A 5SWUA 3EWZA 3GKFA 4Y96A 1WBHA 2FTPA 5FESA 5D2YA 2TRSA 4HNUA 1W31A 1TV7A 3W7GA 2E6YA 3LV5A 3LXCA 1XBZA 4QQ3A 3W84A 4HNNA 4X3ZA 3W6YA 3LV6A 1L6WA 3A23A 3T4CA 1A53A 1VCGA 2VFEA 4N2YA 2Y7FA 2VEIA 1KM5A 3L0GA 2A6LA 3W70A 2C0AA 1UUMA 3P7YA 1WA3A 2BXVA 1OX6A 4NJKA 4O12A 1FDJA 1Q6RA 1OK6A 2FB3A 1UBSA 4UTKA 3OA3A 1TJPA 1X8FA 4EIVA 3W1UA 1PHQA 2C3ZA 2WNNA 5DBUA 2YYTA 3LCIA 1ZAHA 1K7XA 4GUHA 2VFFA 3DFOA 3W7KA 2WSRA 2C6QA 4EF8A 1XXXA 4IXXA 4N9BA 4RV8A 3HB9A 4LOCA 1OFDA 2RH9A 4QNWA 3W1PA 3GIYA 4NNAA 2RFGA 2ZRUA 3BARA 3O07A 4LT9A 1TJRA 4NT0A 3D0CA 4EWND 3KFTA 1VHCA 2Y88A 3LCXA 1LM1A 3ZWTA 5F1VA 3PC0A 3NNTA 1GYNA 2A7NA 4JDBA 4B5NA 4IUOA 3LHTA 1TPH1 1ZAIA 4P2VA 1B4KA 1A50A 1M6JA 3EX4A 4JXCA 1LOSA 4O4VA 1OYCA 1EUAA 4RXFA 4UTWC 4LRSA 3UY7A 5DCDA 5CGQA 2DZPA 2ZTKA 3HOJA 2B4GA 4LS0A 1WOBA 3S1WA 3IEBA 5AOUA 1ZFJA 1JQXA 3NQAA 3L66A 2Y85A 3QW4B 3C2VA 4CCCA 4NJJA 3NYZA 3TCEA 3HF3A 3L5LA 3T78A 5J5RA 4UTMA 1THFD 1KFBA 1PL9A 3QMTA 3G22A 1TPWA 3B04A 3W7HA 5TBOA 5BMWA 4JNMA 4WY0F 3KVJA 2E6FA 1RQHA 4CNPA 3R89A 3S0CA 4MFDA 1X6UA 3LXBA 2VFIA 5HR6A 3UWWA 3PB0A 1FX6A 1TCDA 2QCGA 4YXGA 3WJSA 5DY3A 3SFKA 4IQLA 4UMAA 1SR9A 5GVJA 4K38A 4O53A 1BWLA 4O18A 4O1CA 4ADUA 4JTFA 3GZ3A 2CFFA 1OJXA 4NX0A 2H90A 2ZA1A 1Q6LA 2E5CA 1DL3A 1X1ZA 5D2VA 5G1TA 1YDOA 2ALDA 3I65A 3W72A 4LVAA 3W74A 1SFLA 2WSQA 4MYXA 3M5YA 4IMEA 3SI9A 1J5TA 5FF0A 4N02A 3W7NA 5BMXA 3NGJA 5CPMA 4DF1A 5AC7A 1H1ZA 3E12A 3TK7A 3G1DA 2Z2UA 4GUFA 1NEYA 3IVUA 3L9CA 3P5YA 2JKAA 5AHNA 4EF9A 3TQKA 2DZUA 3G0UA 1UASA 2ZTJA 5AHLA 1VRDA 2P10A 2RDUA 1O4UA 3HJZA 2A7PA 1YPFA 4O1AA 5E0KA 3EXRA 3P8IA 3QZEA 5HNRA 4EVZA 4PA8A 4K8HA 2EF9A 1GTHA 1FCQA 1W5MA 5I3IA 1KM1A 3OHIA 5AHFA 4JS3A 1FDYA 1P0KA 3EX2A 3BLFA 2G5WA 1TPEA 4ML9A 4O0KA 3KXQA 3MI2A 1DVJA 4H6KA 2GVLA 4BI5A 5F2MA 2RHGA 3GDRA 1KTCA 3LX9A 4H4IA 1ZENA 3MYPA 1B3OA 2H6RA 1TV8A 3M5XA 4LVBA 4PH6A 5HINA 5H91A 1SSDA 2CLLA 3KHJA 4I7WA 3WJXA 5D33A 3S1UA 1LORA 1FCUA 1SZNA 3W07A 2A5HA 4AEOA 2V82A 4H3DA 1H51A 5D03A 2YW4A 3BLIA 5F4SA 3LERA 3SGZA 3VE9A 3MMTA 4OWGA 3QQ1A 3IGSA 2X1SA 4YLWA 5DCBA 1IGSA 5KITA 4UFLA 3O05A 4JICA 4AH7A 1PE1A 3IIZA 1H7WA 3PG8A 1PIIA 4ONVA 3ABOA 4OGZA 1W56A 3IGXA 1F6KA 1G4TA 2WJZA 5AHIA 1M7OA 2PRLA 1GJPA 3MBDA 1TMHA 2Y7GA 3SZ8A 5C54A 1QOPA 4O14A 1A5AA 2NWRA 4UTWA 3V75A 2QF7A 3K30A 1TPFA 1RZMA 3NA8A 4ORMA 4PCFA 2YDAA 5D38A 5FF3A 2OT1A 1NF7A 3PF3A 1AG1O 4PC8A 2NV1A 5HWNA 1YTDA 4WJEA 3I6RA 3S6DA 5HR7A 1Q45A 3WK1A 3KOFA 3BK0A 5G2HA 2I14A 3RNDA 2CLIA 3P5ZA 3LLDA 2YZRA 3NQ2A 4JN6A 5IM51 3F1QA 4NJHA 4TU1A 3P8JA 5EY5A 3RK8A 5CZJA 2CZFA 3QC3A 1AW5A 4LVDA 3DENA 1VJIA 3BW2A 1FWNA 1YXCA 3C52A 4FX8A 2VFDA 1XL9A 4JTSA 1GG1A 3HPSA 1H7RA 1GG0A 3MP3A 1G4EA 2O7QA 4OV9A 3PWAA 3M0ZA 4WY0B 5EBUA 2E77A 3PBVA 1AMKA 1YTKA 2ZZ6A 4MVAA 3NQMA 3PM6A 1LOLA 1IXOA 4QAIA 5DLCA 3TE9A 3ZS4A 2QCMA 3ANYA 4IPJA 4K6AA 1WYIA 4CCDA 3FJ6A 1QO2A 4MY9A 3W2UA 2QUUA 3R2GA 1VYSX 1KTNA 3QRHA 4TMBA 3W1RA 3LTSA 4JTUA 4CNNA 2NXHA 3W7PA 3W3OA 7TIMA 3MO7A 3I7RA 4TX9A 4UR8A 2V2DA 3TA6A 1ONRA 4U28A 1TRDA 2O7SA 4FEZA 4LUJA 4LWWA 4UUIA 4O54A 2HTMA 4Q4KA 4NZJA 5FF4A 5HUOA 2YW3A 2ZRZA 4JR5A 3LTYA 3BPWA 4TO8A 2QDHA 2QCDA 2CW6A 2QAFA 2EPHA 2ZZ7A 1JULA 2G97A 2BZNA 2VKZG 2ZZ2A 1X7FA 1DV7A 1QPRA 1GVQA 2Z0IA 1SZEA 3TIMA 4ICNA 2J9YA 4MY1A 2PE4A 3LM7A 3BO9A 1SSGA 3DHFA 3B4UA 4JIPA 1JJKA 2YFOA 2HS6A 2A1YA 3LHVA 4UIOA 1JRBA 3INPA 3HG3A 2DP3A 4DEFA 3LCGA 1TRIA 3CWNA 3DI1A 3NPWA 3WK2A 3KVLA 3U8GA 5FEXA 1K8XA 5AYYA 4AHOA 1KLYA 1UUOA 1O94A 2H3BA 4UTTC 4N4QA 4O4WA 1QO5A 4N9EA 1SZGA 3NQ7A 3G1YA 4QJ1A 1NAL1 3NPVA 1F5ZA 3PB2A 1EB3A 3N9RA 3G24A 3NG3A 1ZHAA 3I68A 3NQFA 2Y7EA 1TTIA 2Y63A 3S1VA 4Z0JA 3H54A 1XUUA 3U6WA 4Z1BA 2ZZ3A 1TPB1 1YDVA 3C61A 3M5VA 3MW7A 4WY0A 5I3FA 4FNSA 1ML1A 1ZAJA 1I8JA 2FPYA 3SJ3A 3HGSA 3N2XA 4JTIA 4KKXA 1GQNA 3MBFA 3PULA 4OE7A 4X22A 4CQ8A 3O6YX 1SW0A 3HGRA 3JRKA 3IVSA 4WQ6A 1G69A 4O1DA 3EKZA 4ZZ9A 4LC6A 1LBLA 2YCEA 1OFBA 1A5SA 1OG0A 3IRDA 4M7TA 3TFXA 4UFHA 1G67A 5DXXA 2J27A 1YPIA 3BW4A 2ZDRA 2ZRYA 1KW1A 1Z44A 2V81A 3FA5A 4IX0A 5J5DA 4MPQA 4MOZA 4LV9A 1ICPA 2YR1A 5LKYA 3DU0A 3NXFA 1DBTA 4Y90A 5K4ZA 3A9IA 1I2RA 3OEXA 4OQVA 3LHUA 2QEZA 4OU1A 5LSMA 5D09A 3IIXA 2VEMA 3IGUA 5BOOA 3QMRA 4FX7A 1DQWA 5DELA 3CEPA 1OABA 3M7WA 4K37A 3TC6A 2FIQA 2DZVA 4HNTA 1KBJA 2PURA 1W8SA 4JY8A 1LP6A 1CX9A 4HHPA 1GVSA 3O15A 3BGJA 3PSWA 5G4WA 3B03A 4RK8A 4UCGA 1LRQA 3W2MA 3IV3A 4P61A 5K9XA 1KV5A 4E0CA 1T99A 3W7JA 1EPXA 4ZQNA 1W54A 5CPNA 2V5LA 4JX6A 4UTIA 1RV8A 4XTDA 4UFIA 1EEPA 4C1LA 4NZFA 4PFMA 5AYZA 1PHWA 4IMDA 5I3KA 1A5BA 2AGKA 4KFPA 2ATMA 4XTIA 4N6FA 1HO1A 1A5CA 3TAKA 3RLVA 3TFCA 3W88A 3NQDA 2CLOA 1LBFA 3L5MA 1W3TA 1WDWA 2ISWA 4WXYA 4MZYA 3EWWA 2ZZ5A 4AB4A 2ZQ0A 3FIGA 4W9TA 4RZ4A 1M5WA 2DJXA 4LV4A 4MYAA 2NX9A 3LCLA 3DGRA 3PUEA 3TSMA 1QOQA 1VC4A 1W3IA 4HNVA 5EA9A 1JRCA 1HTIA 4ADSA 1U83A 2B0MA 3ZWSA 2FQIA 3BGGA 3LI0A 3L65A 5G1YA 1CW2A 5U4NA 2W79A 3W75A 4ALDA 3KVKA 1JCMP 3UYCA 4BWLA 1FUYA 4K7VA 4I7UA 4UFJA 2NUWA 3THQA 1JUEA 2CLMA 3IIPA 1RR2A 4DPQA 4NNBA 3SIZA 1O5XA 1VLIA 1RQBA 2GOUA 3QW3A 2R91A 4RXGA 3MP5A 4UTTA 3TQVA 5LHFA 1TPVA 5LNSA 3IVTA 2GQAA 4ZQOA 1W1ZA 5AB3A 5CZ0A 3LDVA 1D9EA 3MHUA 4CQ9A 1OF8A 3G1HA 2J9ZA 2XN1A 4BK9A 3W1NA 2P1FA 3S5ZA 3TH6A 4X2RA 1F73A 3P82A 1O5KA 4YCOA 1VCFA 3LCHA 2JBMA 1LROA 4NNCA 1I2PA 4FXSA 2CZ5A 4MZ8A 4ADTA 1C8VA 4NX5A 2DZSA 3L68A 5T26A 1TSIA 1WAUA 3M44A 3TW6A 4OBTA 5F4WA 1YDNA 4NJIA 3N14A 1H60A 3VKJA 3QQ0A 1MEWA 3W1TA 3EX1A 3NEVA 4NXSA 4A3UA 5K3VA 2Q8LA 2PCQA 1OVDA 4R53A 2R14A 5C2XA 1IF2A 1VZWA 4DPPA 5F4XA 1GVRA 3TDFA 3TXZA 2R8WA 3LRKA 1G4SA 4FNQA 2C13A 2JK2A 3SW6A 3W7CA 4IXHA 3LHWA 4XKYA 5TIMA 3DFQA 1B57A 3TR2A 3VCRA 3LB0A 3G1AA 1TQXA 2PC4A 4MZ1A 3W87A 5LNRA 1FCVA 3GLCA 5U7SA 4CNOA 5D30A 2ATSA 4HN4A 2C15A 1LZOA 5HULA 1JUKA 4M19A 3BLEA 1XI3A 5G4EA 4M7SA 1KFLA 2DORA 5D05A 3B06A 3HBLA 3I7QA 4JDYA 2QUTA 1W37A 1W5QA 4NQ1A 3GNNA 4IMFA 4XBSA 1KFJA 3W7EA 4O28A 4OV4A 4A21A 4E2DA 3EWBX 4ZMGA 1WV2A 5AFDA 3UWQA 4IWWA 1SPQA 3IIOA 3M1ZA 1IIGA 5CKSA 1I2NA 5HJLA 2Y89A 4HSNA 1DJNA 5D04C 1AL7A 4JYDA 1HFBA 4LU0A 2VELA 1XCFA 4XWUA 3B0UX 1OK4A 4AAJA 3LXAA 5EMUA 3HQ1A 1OX5A 2QCNA 4LY8A 4FNRA 2YX0A 3RMJA 3T7VA 3GR8A 3DKLA 2VC6A 5EKYA 3W1AA 1DHPA 2Z1BA 3CT7A 4FX6M 1PCKA 1J2WA 2BSLA 1IXPA 4JTHA 3O63A 5EPDA 1XKYA 1V5XA 3B8DA 2Y62A 3BVJA 4QNEA 1B9BA 3F4WA 3ELFA 3Q2DA 1TTJA 3CLMA 4CLMA 2KZHA 2BTMA 4LS1A 3W7DA 1LRNA 2NUXA 4JX4A 3OG3A 3VI2A 2FLIA 4HKPA 2OX1A 3NDOA 1P4CA 1B4EA 3HMJG 3TW7A 4O17A 4E2BA 3NPUA 3JS3A 3NL6A 3QSTA 4J9JA 3EWYA 2ABBA 3F03K 2GVJA 5BNKA 3MWAA 4EOUA 1W5NA 5CPLA 4KWWA 5K9DA 2NZLA 2WQPA 2X2GA 1JVNA 1C9DA 1VCVA 4LUIA 1BKSA 3LBCA 1MSSA 1EP3A 4O19A 3TNOA 2NX1A 2GQ8A 3TU9A 2QCFA 1SO6A 5K4XA 3O8AA 4S2BA 1IIHA 3O1NA 3P80A 1LDCA 2F7FA 4WD0A 4LC8A 2AQWA 4YL2A 4UNLA 1GVOA 5AHMA 2FPTA 2A21A 3MJYA 1F05A 2OT0A 2QCDB 3CWOX 3W2JA 5FF2A 5G2WA 3GAYA 2VOMA 3CIXA 3WJWA 3N34A 2FPVA 2FB2A 4LS2A 1OHLA 3PBYA 1TIMA 3N19B 4PL1A 1XFBA 4MFEA 1MEHA 5I3HA 1I4NA 2NXIA 1LRTA 2JKEA 1TB3A 5E93A 5K9CA 3LCFA 1D3HA 1TREA 3PSVA 5DN1A 2I9EA 1SFJA 2R94A 4A2RA 1CI1A 1GT8A 2Y6ZA 1OFEA 2P0OA 3H55A 1O60A 3NL5A 4FHAA 3FS2A 1HO4A 1I2QA 3GXPA 1RD5A 4Y9AA 5HMSA 2YSWA 2AAMA 3TQ0A 3A22A 1R2RA 3W1MA 3M6YA 3W86A 3FOKA 4IGHA 4M6PA 3MHFA 5CSSA 1F2JA 1H5YA 3KRZA 2QCLA 3UY8A 1W5PA 3UXDA 4R34A 4C1KA 3W7IA 4UTHA 5KZEA 1KFCA 4RZ5A 3OIXA 3DKJA 3ZR4A 4PEKA 4UFMA 2GJNA 3CTLA 5E1QA 3GVGA 3P67A 3NM1A 1ZY9A 2Z6JA 1H62A 1ME8A 1SW7A 5C5YA 1SO3A 1QWGA 3EEGA 4A22A 4IOTA 4RR4A 2W0UA 1WBJA 2ZCGA 5L9FA 3FYPA 4PTNA 2ZA2A 3LBMA 1Q3NA 4BFAA 4LTSA 3KVMA 1VYRA 3QPYA 1ZJIA 2Y70A 4FO4A 3HO8A 3G3DA 3QPZA 1HG3A 2X1RA 4JX5A 3W7OA 2QDGA 4TMCA 5HWMA 2C18A 3JR2A 4GUGA 1PV8A 1SU5A 2GJLA 1YXYA 2ZZ1A 3THAA 4JIQA 2WKJA 4Z1CA 3EX3A 4UXDA 2QCCA 1U5JA 2ZFAA 3E49A 4DO5A 3FKKA 3QYQA 1OFQA 2QAPA 4Q32A 2X30A 2BX7A 1GPWA 4ZVJA 3OBKA 4GE8A 3TROA 1DQXA 4UTUA 2TPSA 2B7NA 3TV8A 5F1UA 4JYEA 1SW3A 3C2RA 3G8RA 4ZQCA 3WJZA 3QEZA 3C2OA 4O16A 2Q3RA 3STFA 1ZNNA 3DBPA 2XFWA 4AMAA 3NVTA 3G1XA 2A2IA 3TAOA 3GK0A 4ZQRA 5LHEA 3EB2A 1QPQA 1VS1A 3TJXA 1TPC1 4WOQA 3EKLA 3LRMA 1K7FA 1UJPA 1VGAA 5CZTA 4JD4A 3T40A 4RJEA 2QCHA 3NQVA 5CSRA 3G3MA 5LNUA 2DU2A 2PRMA 3HPZA 1Q6OA 2ZRWA 3FFSA 1J4EA 4IJBA 4BF9A 4NVTA 2CLFA 2I1OA 4MUZA 1BTMA 1XBYA 1YXDA 3FLUA 4HSOA 2VEKA 4N6EA 2H8XA 4O1BA 3FKRA 2G96A 2ISVA 1G7UA 1S5TA 4GBUA 3TJLA 1OX4A 4BI6A 3BV4A 4BR1A 3E0IA 1L9WA 2Q3OA 3W85A 4WX2A 5MHBA 2TYSA 3TSDA 3STEA 5KZDA 5I3GA 5KMYA 3W1LA 4PODA 4UMCA 3TMLA 2CLHA 3W9ZA 1G4PA 3CM4A 2V30A 4KWVA 1C29A 3EWXA 5FF7A 1ADOA 3MYOA 1KV8A 2JKPA 4MY8A 1QMLA 1EUNA 5KTLA 3L2IA 3GNDA 3B05A 3UPWA 2QCEA 4LVFA 1KBIA 1VR6A 3NL3A 5DY2A 3NQEA 1JUBA 4GC4A 1FBAA 1AW2A 4JTEA 1K02A 3GYEA 3M9YA 3WK0A 2H3DA 5HQEA 2RDWA 6ALDA 4JEQA 3DI0A 4M6VA 1MEIA 1OFAA 2GQ9A 3ATZA 5DXYA 3HGOA 3QF0A 3QSRA 2NLIA 4XUGA 5CPOA 2DZXA 5DBTA 4UMBA 5A5WA 2ZRVA 1I45A 5G5IA 1T0OA 1H61A 4JTGA 3RU6A 2QJGA 2RKXA 4A2SA 1LLWA 3UWZA 2QR6A 1TO3A 4N4PA 3CQ0A 3BG3A 3BW3A 2WSYA 3AO0A 3PUOA 3P84A 2C14A 1S5VA 1W3NA 1GOXA 2WNQA 3GX9A 5BRBA 1KA9F 2VXNA 3W7RA 4YWIA 1FQ0A 2YFNA 3CHVA 1JCLA 1RQEA 3LI1A 4FF7A 3KRUA 1BWKA 2NV2A 3QJAA 4KFOA 5IBXA 3G1FA 4Z1DA 1TTQA 3L67A 5AC6A 4K36A 4UNKA 1KM2A 3RLUA 3UPBA 3SSJA 4GJ1A 3NOEA 4I7VA 4G1KA 2RDTA 1EIXA 2FDSA 1K8YA 4IPIA 2ZBTA 4BI7A 4WZHA 3W2LA 3DFPA 1JCJA 3LHYA 3S9YA 1FDZA 1DJQA 1FWWA 1R47A 4LW7A 2Q8ZA 3O6CA 3DFSA 4UFKA 3GAKA 4AF0B 1WXJA 2WPBA 1EP2A 3N2MA 4R7JA 3STCA 1SO5A 3BG5A 4HIBA 2E5DA 4GWEA 2LLEA 4JTJA 3M43A 5FEPA 1V7YA 4MLRA 1KM0A 4S2CA 1QFEA 2VFGA 1EWDA 5TQLA 2EHHA 1YADA 4N9CA 4O50A 1SQ7A 2HMCA 5D2XA 2E5BA 3STGA 5BW6A 4OHQA 2ZRXA 1OYBA 1XDMA 1AL8A 5LGZA 3T44A 1LOQA 1Q6QA 3A24A 3P81A 1L6YA 3W2NA 1GVFA 3Q94A 1NFBA 3PG9A 4UTLA 4DO4A 4Z08A 1AK5A 3W1XA 3B0VC 1QNVA 1RPXA 3W23A 4K7YA 2V2CA 3DXIA 4LRTA 3N3MA 3WK3A 1XDLA 4LNYA 5K7JA 2WNZA 1R30A 2CU0A 3T55A 3C4UA 4ZQPA 3EXSA 5DCEA 1R2SA 1XC4A 1H7XA 1XBXA 4LVGA 2WO5A 4HT3A 3M41A 3SECA 3GDKA 3C6CA 6TIMA 1KFKA 3EWUA 3LRLA 4ZL1A 4NU7A 4BWLC 1M7PA 2Y7DA 4O57A 1ALDA 2J9XA 1OF6A 3VE7A 3MI6A 4DQWA 2ZZ4A 1OFOA 3QFEA 5H2ZA 3QM3A 1L2UA 1D3GA 4DELA 4AWSA 3FEMA 2Z6IA 1VYPX 3NZ1A 1P0NA 2J88A 3UZJA 3AJXA 1QDSA 3M5ZA 3QH2A 3P60A 4DBDA 1FWRA 3FJLA 1OYAA 1S3HA 1OX4B 2C1HA 3LGEA 3M16A 1EA0A 4TR9A 4FB7A 2J6XA 2QKFA 4K39A 2C16A 2FJKA 3KAOA 1K7EA 1AW1A 5FEWA 4MJMA 1XBVA 1XUZA 2OJPA 1YLVA 1Z42A 1XM3A 1K03A 4O52A 3S5NA 2V2HA 4Z0SA 1ZALA 1L6SA 4AVFA 2HS8A 3UD6A 1TPUA 4DF0A 3USBA 1N8FA 2V5BA 3G0SA 1UB3A 1T96A 4X9SA 1VPXA 2XN0A 1KFEA 5F2IA 1KM3A 1VLWA 1SUXA 3L0KA 3HG5A 1GTEA 3CPRA 3TUUA 1H7PA 2A85A 4O15A 4MKNA 3TSBA 1NVMA 1LLZA 1G6CA 1T8XA 2TSYA 4U4MA 1TTPA 2CLKA 3W7MA 1W0MA 2OZ0A 2NXGA 2QJHA 1FXPA 4FNUA 3BG9A 1W5OA 2X1UA 1GYLA 4XZ9A 3HG2A 2YPIA 4DO6A 1JCNA 4FIRA 3W7QA 1JQVA 3P74A 2TMDA 1K3UA 2ZYFA 1I2OA 3MUXA 2UV8G 4GXMA 1WOAA 4XBKA 3G18A 4JTLA 1ME7A 4ORIA 1TV5A 3CU2A 3HPXA 1PS9A 1RVGA 2V8ZA 3CB8A 4O8RA 3ATYA 3LLFA 4UTJA 5AYXA 4GRSA 4RZ6A 4AHPA 2X16A 3OVRA 4YMZA 3TKFA 1PVNA 2GUUA 4AHQA 4AWTA 3R8RA 4XQ6A 1WQ5A 2ISSA 1JCXA 2CLEA 4M6QA 2VENA 3W76A 1K8ZA 1IXNA 1QAPA 3VNDA 3EXTA 3NQ8A 4CQAA 1EWEA 2JGYA 3ABSA 4O11A 2WOQA 3L5AA 1LCOA 5ABTA 1QCWA 2C19A 3MHGA 1FY6A 3GR7A 3CEUA 5KSWA 3IIVA 1H7NA 1MZHA 4OT7A 3S42A 3G8EA 1MO0A 3O06A 3TC7A 1DKWA 3C2EA 2E09A 4S1FA 2YYUA 3TXVA 1KM4A 1OFRA 1FXQA 2VFHA 1ZCOA 1DOSA 2A6NA 3P61A 4QIUA 5C6MA 3W22A 4HPXA 1IXQA 3MP4A 4WXZA 4UC5A 3UXAA 2CZEA 4FIQA 3UQNA 2ZA3A 3GDTA 4MLJA 4UR7A 4JY9A 2EAWA 3PR2A 5D32A 5CZSA 4XKYB 2DZWA 1GZGA 1GEQA 3E02A 1LBMA 4GUJA 1UCWA 5D2TA 5KZMA 3GXNA 2V0TA 4AF0A 3R12A 3UWVA 3UZ5A 4NUWA 3QMSA 2E68A 4AXKA 3NAVA 4QITA 4L4MA 3OVQA 4FNTA 2CZDA 2E6DA 1TPDA 3C3NA 1LYXA 3O16A 1S5WA 4ZQMA 4QSHA 4RCXA 1BEUA 5AN7A 1F74A 4FNPA 4DBEA 1MXSA 3WFAA 1HUVA 2WV8A 3LHZA 5A8GA 3TMQA 2GVGA 3L0NA 1F7BA 1Z41A 3ZFHA 2A0NA 1YYAA 4IX2A 3LCWA 1Y0EA 4R33A 1F76A 1Z48A 3L21A 1NF0A 3GB6A 3DHDA 3DH7A 1ICQA 2A7RA 1JR1A 4QM1A 4YCPA 3W1QA 4Q33A 3FYOA 3PBWA 3VFLA 1OFPA 1H7OA 3OVPA 4JTTA 4KFNA 1FCBA 3E9AA 1VHNA 1SZFA 2B7PA 4WOZA 2J24A 4DXVA 1NSJA 3I7SA 3G1VA 4I9AA 3W71A 5LNWA 1DORA 4MJZA 2NUYA 4IMGA 4NXKA 1EP1A 1KM6A 4O0ZA 5D02A 1GWJA 3A5VA 3S5YA 2IQTA 3C8FA 2CWNA 2Y61A 1ICSA 3V1PA 3GDLA 5HUPA 3H53A 3G0XA 4RKAA 4M5PA 4O10A 3P62A 1JCYA 3HG4A 4JYFA 4CCEA 1ME9A 3E96A 2XN2A 3GXTA 2ABAA 4D2JA 2H8ZA 4HPJA 2OCZA 2QJIA 3WJYA 2DJLA 4GUIA 4K8EA 4PL2A 1TYGA 3PVFA 3HGJA 3DAQA 2NX3A 3MI3A 3NR0A 3C56A 5LZLA 5G2IA 1P5BA 3NQGA 2JGQA 3UWUA 3LOTA 1VQTA 2B7OA 2X1TA 2PRHA 3ABQA 1KLZA 3W7LA 3NQCA 1E51A 2DZTA 3UWYA 2GPTA 1EX5A 2YGYA 4DF2A 3NO5A 1SO4A 2G95A 3M47A 3R5EA 3NZRA 3PAJA 3Q37A 4N9DA 1WX0A 3SY5A 1FWSA 4NJGA 3HIJA 3EX6A 1H63A 3DFNA 5LGXA 4Y8FA 3NPXA 1G7VA 5K2ZA
chains in the Genus database with same CATH superfamily
1RAKA 4OJYA 2HSAA 3NL2A 4QDPA 1O5QA 5C55A 4RUBA 4F0SA 3CMGA 1VEOA 5HWJA 1PZ1A 2HROA 1HL2A 3F4NA 2GVYA 4QISA 4TIMA 1V7AA 3LGDA 1CXLA 3W83A 3A5FA 1FWTA 1XIMA 2OLAA 4C6MA 3AYTA 4L9ZA 3GC5A 5CC7A 3LTPA 4CKQA 5I3DA 1XH1A 2B7QA 4LBRA 4E6MA 1XIBA 4H8HA 3W73A 5D2WA 8XIAA 5IHSA 1IWBA 4UQDA 7A3HA 3GVWA 3WX7A 1TQJA 1EC9A 1EF3A 5AC8A 2V6AA 1R46A 3ZM8A 1CZ1A 5L6UA 4HPGA 8RUCA 3SCVA 1A5LC 4RLIA 3WQ5A 2JQXA 3PUDA 3MCOA 3A21A 1LTDA 3NM3A 5FEZA 4GY7A 5FJUA 1BQCA 2V9DA 3U2OA 3O6DA 2BWGA 3Q58A 4KGJA 4GNJA 4O13A 1S46A 4JTKA 5LNVA 3CIWA 4Y6GA 1QR7A 4EXAA 4JKMA 2VEPA 1PSCA 3VIJA 1MQQA 2J8GA 2ODOA 5FESA 2TRSA 1GGOA 1W31A 4NAFB 1P6BA 2DIJA 2GJXB 2BB0A 1PB0A 4NILA 1L6WA 3A23A 4DBSA 1B1YA 1PO9A 1KM5A 1M04A 3L0GA 3VMOA 3P7YA 4UCFA 4TTUA 1OX6A 4O12A 4B5UA 4MSSA 3CMFA 1FDJA 1V3KA 4UTKA 1TJPA 1X8FA 4EIVA 4QJ3B 1PHQA 3TYEA 1ZAHA 1XIGA 2YZ5A 3W7KA 2EPMX 4U2YA 2ZUNA 3H21A 2XPKA 3SQLA 4PSPA 4LOCA 1OFDA 1KRMA 1GZ1A 3W1PA 2GSJA 4BHYA 4HZ6A 2RFGA 3O07A 4HCLA 3VKCA 1JPIA 3ZWTA 3WG6A 5CAKA 2WWCA 3PC0A 3E2SA 2GDQA 4JDBA 3JZUA 3MVIA 2EXOA 3CAKA 3AYSA 2UY3A 3UBPC 4P2VA 2YXXA 5AC4A 1LOSA 2W66A 1EUAA 2WMIB 4GXPA 4UTWC 2WMIA 1PYFA 1VP5A 4LRSA 1AJ2A 2ZTKA 4LS0A 2ZUMA 3AFBA 1XS2A 4ACZB 5DMMA 2V3GA 1V6XA 1XLGA 1GK8A 9CGTA 4CNSA 4CCCA 4JBRA 4NJJA 3QC0A 3TCEA 1UD2A 4GINA 3HF3A 3CV7A 3T78A 5J5RA 2GGEA 5CGTA 2PCEA 1H49A 2BGSA 5F7UA 1E0UA 4JNMA 4WY0F 1VJZA 3GVQA 2E6FA 2FTWA 1XYAA 2RUSA 4I8YA 4TVDA 3LXBA 2GLKA 2VFIA 1SFSA 3MKCA 4CD8A 1OIMA 4YXGA 1CXIA 2ZX8A 4B91A 3CJPA 4IQLA 1UP2A 5EMKA 4O53A 1BWLA 1SMAA 3E2VA 1B3YA 4KWOA 4JTFA 1JGMA 4FS9A 2H90A 3EMCA 1Q6LA 3W0KA 3V7PA 3VNZA 5G1TA 3W72A 3G6LA 4HYVA 2DW7A 3W74A 4F4RA 4RDVA 5AY7A 4C6LA 1GJWA 2WSQA 3GO2A 4MYXA 3M5YA 2EPKX 3GG1A 5H8PA 3B8WA 5FJJA 4N02A 1OCQA 1BGGA 3NDZA 3NGJA 3AWNA 5C9RA 2WB5A 3RILA 1E9ZB 1ISZA 2PTXA 3NO3A 1JYXA 4K68A 2GJRA 3AI0A 4GUFA 2WMFA 4XZMX 3P5YA 3OVGA 1ZUAX 4EF9A 4XIMA 4HMCA 4JOMA 5LA0A 1JPKA 3HFYA 2P10A 2RDUA 2DEPA 5AVNA 3EXRA 3P8IA 4EVZA 3HQOA 3RU8X 4WEVX 4GO9A 3BJFA 3EDEA 4L9XA 1GTHA 1FCQA 1DTNA 1KM1A 5FJRA 4ML4A 2PGRA 3KBJA 2HV5A 4J7RA 1DIOA 4FLRA 4ML9A 2RGMA 4H1ZA 3KXQA 4PSRA 1XLBA 3BAXA 3BAWA 4IIEA 4UZSA 1DVJA 4DHGA 3WMLA 2RHGA 4IH3A 2HNHA 2AKMA 3OODA 5H6HA 4GMEA 2F8QA 3M5XA 3OGRA 1PKMA 2OWXA 1SSDA 1QATA 1UWUA 2HDJA 4HNCA 2WVSA 1FHVA 1ISVA 5D33A 4IP4A 2A5HA 2W63A 2V82A 4H3DA 4S3CA 4AISA 5FOOA 3BLIA 5F4SA 3VE9A 1JDDA 4OWGA 3IGSA 4YLWA 1V3JA 4HOXA 5E0CA 2NVCA 5KITA 4UFLA 4JICA 1UZDA 3IIZA 1H7WA 3D47A 5GJPA 1PIIA 3PHAA 4ONVA 4OGZA 4ZB2A 4L80A 3NSXA 1W56A 3WUGA 1HVXA 1F6KA 4J3XA 1M7OA 3MS8A 4YPJA 2ESCA 4ZSTA 1GJPA 1ZBCA 2OU4A 1NQKA 2FH8A 4J28A 1CB2A 2WC4A 4AZGA 3AMDA 1OCBA 3RUBL 4O14A 1A5AA 3V75A 2QF7A 1KFWA 1TPFA 5LXXA 3U3HA 1KQYA 1Q8AA 1R8LA 1VFUA 1TUFA 1NF7A 1E9IA 4S3FA 4HYWA 5HWNA 3L4UA 4WJEA 3S6DA 5HR7A 3T8QA 2DY3A 3VD7A 3BK0A 3VD5A 4UNIA 1EO7A 1L8NA 2V67A 3ARTA 3T0AA 3V35A 3W00A 2Z27A 2IS7A 3W6MA 5IM51 3F1QA 4NASA 4NJHA 1JG9A 3STPA 5EY5A 3SURA 1AW5A 3DENA 3GSMA 1XL9A 1XRFA 3PPGA 5REQA 4OV9A 2J7CA 2E77A 2OQLA 1QJWA 4BZYA 2ZZ6A 3NQMA 1JZ5A 5E0FA 2QCMA 3S4TA 1DEDA 4CCDA 3AWOA 2X09A 3W2UA 3NYDA 2QUUA 2DSWA 3SBFA 4GFIA 2NXHA 2FGBA 4IFRA 1XLFA 4U28A 4IIGA 1T8QA 2MANA 1ZP3A 4J3VA 4LUJA 2OSXA 1R9ZA 4UUIA 4QS5A 4HA0A 4NZJA 1FWEC 5FF4A 2YW3A 5HUOA 3LTYA 3BPWA 2QDHA 2QCDA 1EF2A 4U33A 2XVKA 2ACRA 2JF7A 2VOTA 3VCCA 1DV7A 2Z0IA 4B5SA 4ICNA 4MY1A 3VZZA 2PE4A 3PPCA 4DJFD 4CN1A 1RCQA 1SSGA 3MDUA 2VWSA 1GOWA 1LG1A 4QBXA 2HVNA 4XSMA 4IPLA 4DEFA 1BLIA 1DQUA 3CWNA 3DI1A 3NPWA 4QCEA 1KCXA 5LYRA 3L4YA 3U8GA 3L7RA 1KLYA 1O94A 2H3BA 1TWIA 4W8LA 4R9OA 3DECA 1BRLA 2FHBA 1UWIA 3BDKA 1O66A 2XWDA 2FZ9A 4J40A 2DSZA 5ABEA 3ITYA 3C61A 3M5VA 4FNSA 1UA3A 2REQB 1ZAJA 5EMMA 4DJEA 2J47A 1I8JA 2FPYA 3AXHA 1QNOA 3PJTA 2YLAA 4KKXA 1GQNA 3DYOA 4CQ8A 3SN4A 3TTSA 1EDTA 3ZMRA 3H2CA 3ZIZA 4W88A 1JI1A 4IIDA 5LXEA 3N11A 4X61A 2YCEA 4D71A 3IRDA 4CU8A 2Z7GA 3TFXA 1UKPA 1NP0A 1YPIA 3FYYA 4IX0A 4MPQA 1H0IA 1ICPA 2YR1A 5LKYA 3DU0A 4C1NA 1VPQA 1YIXA 3OEXA 4OQVA 3LHUA 5LSMA 2GWGA 1X6LA 1A3XA 4ZFCA 3ZJ8A 4H9UA 1SJDA 5BOOA 2Q71A 1V3MA 1OABA 4ZOAA 2QYGA 3TC6A 2FIQA 2DZVA 1AVAA 4MJ2A 3WN6A 4JTQA 2PURA 3MY9A 1W8SA 4JY8A 4D6HA 1CX9A 2Q8XA 1XIDA 6CGTA 4HHPA 1GVSA 1SFTA 4QQUA 4RK8A 4F0MA 1MZRA 1KV5A 2CITA 1TCMA 2GWNA 2EQDA 3BANA 1S5MA 1W54A 5CPNA 2V5LA 4JX6A 4DB7A 1RV8A 4KWSA 4MDOA 1GQJA 2PUZA 1BF6A 1W9BM 4NZFA 4QRNA 4X0NA 4KRTA 5I3KA 3QOMA 2A3LA 1GKRA 2DT2A 2I56A 1HNYA 1J0IA 5A8NA 3NOYA 4UOZA 2CLOA 4R9XA 1LBFA 2ANUA 1R6WA 4DUWA 2KAUC 1E1CB 3DCPA 4MZYA 3UP8A 1FWHC 3NDYA 1K9EA 1ZPTA 4W9TA 4MYAA 5LIUX 5BXTA 1TWZA 3URNA 4PMZA 1QOQA 4AMCA 5EA9A 5T91A 1C92A 1JRCA 3B8VA 3FGCA 3E74A 3FSTA 5HAOA 3Q4DA 3BGGA 1UKTA 3S3GA 1UR8A 2PDYA 3W75A 3BMWA 3GWQA 2XGIA 1BFNA 3VOGA 1WDDA 3UPMA 4GZIA 3UYCA 1FUYA 4K7VA 1Q8JA 4IG2A 2NUWA 1QUMA 2CLMA 3WLNA 3THDA 3SIZA 5CC5A 1VLIA 2GOUA 4XO7A 1W1PA 1UIPA 4D8AA 3CO8A 4M1RA 5BOFA 1A4LA 4I5XA 5LHFA 1TPVA 1YEYA 5LNSA 3IJIA 1EC8A 3LDVA 1D9EA 2J9ZA 5LIWX 2XN1A 3L4WA 4JNYA 4BK9A 1OC7A 4E5TA 4OKDA 4KCWA 2Y8UA 3CT2A 3FJ4A 3P14A 3TH6A 3VILA 1BVNP 1RVKA 3H7RA 5CPQA 1OCNA 1UH2A 4NNCA 3VGDA 1AQ0A 3VIHA 2PLMA 1PIGA 1C8VA 2DZSA 5T26A 3KOXA 1WAUA 3M44A 3CHFA 4NJIA 2I5GA 1Y5WA 1TA3A 1MEWA 3NEVA 3QLLA 4KRUA 2WWDA 2Q8LA 1ZLPA 3ERPA 1PJ9A 1OVDA 4R53A 2VGGA 3VX1A 3MKKA 5F4XA 3TDFA 2R8WA 3LRKA 3K4DA 4FNQA 1OWQA 4XKMA 3TP4A 5LIKX 3VNMA 4IL0A 1E72M 4V1XA 1LT7A 4OUEA 5TIMA 4HOZA 1ITXA 2VZSA 3DFQA 2GGHA 1UD8A 2YOCA 2WZIA 1TQXA 4MZ1A 2AMXA 1FH8A 5U7SA 5D30A 3KTCA 4E3TA 2PDKA 1LZOA 3TQPA 4KW2A 1M41A 3CQJA 3BLEA 1XI3A 1V03A 1KFLA 2Y8KA 3M0MA 4TV5A 3I7QA 2QUTA 1KGUA 4G8TA 4NQ1A 1HN1A 3B3DA 2OYMA 4XBSA 1KFJA 2AQOA 4OV4A 4A21A 2X1IA 1WV2A 4BY3A 5AFDA 2V3FA 1CENA 1XV8A 4FOKA 1Z7AA 5HJLA 5D04C 5JQ9A 1XWYA 5C8BB 2IKJA 1HFBA 4KETA 7REQB 4XWUA 4YU1A 4XZWA 3HQ1A 3CHEA 3KUMA 4LY8A 3GR8A 1E43A 2D23A 3ONBA 3DKLA 2QPSA 3W1AA 2Z1BA 4GK8A 1OGBA 2BSLA 3WMBA 3WELA 5E9XA 4B2DD 1RA5A 4JKKA 4J2MA 1B9BA 3RIKA 4AX7A 2PTYA 3EGJA 3AU6A 3VOIA 2J74A 3K1DA 2PDUA 1KC7A 1FFRA 2YBUA 2ZOXA 4DI8A 3W24A 2I17A 4O17A 3NPUA 3QSTA 3IWPA 2GVJA 1HZYA 2QIIA 4E4PA 3MWAA 1EJXC 5CPLA 3S1GA 5K9DA 3OQEA 3CUZA 3WLIA 1FOBA 1VCVA 1PTDA 1Q7ZA 5A95A 1PWMA 3DG6A 3KOZA 4XK2A 4PTWA 3KRBA 1EP3A 3TNOA 2QCFA 2IXVA 5K4XA 1AQMA 1C9WA 1GOKA 2QJJA 4MF4A 3OB8A 3GDBA 2FZNA 2A21A 3ZYZA 1F05A 3MSYA 5TF0A 3CWOX 2PB1A 1FH7A 1KGXA 5G2WA 4C6BA 5H8UA 1O7AA 1VD6A 3OZMA 3N34A 3WQPA 2FZBA 4XUYA 3W4RA 4PN2A 2D1ZA 4A3HA 4CQBA 1TIMA 4PL1A 1NDZA 2CHRA 4MFEA 2JE8A 2PDPA 2JKEA 3PTMA 3B40A 1TREA 3PSVA 2R94A 3CHDA 1C8YA 4G7FA 3IS4A 2J7BA 1XLHA 4JQ2A 2Y6ZA 3WDRA 3KL5A 3L4TA 4HD5A 1O60A 4FHAA 2J75A 1EA9C 1IHIA 4LUYA 4L7ZA 4ZA0A 3POHA 1PKYA 3AC0A 5A6TC 2GK1A 4IGHA 3AXMA 1MW0A 4R34A 3W7IA 4UTHA 1KFCA 4RZ5A 5KZ6A 3WLOA 3DKJA 4DYKA 3ZR4A 1R0MA 4AY8A 1GOQA 1E5NA 5E1QA 2PMQA 1R38A 4QDMA 4DM1A 2Z6JA 1YE6A 1QWGA 3B8IA 4IOTA 4RR4A 1GVIA 2Z29A 3FW6A 3NZQA 3UEQA 1VFOA 3FYPA 1S2WA 1E6NA 4PTNA 3LBMA 4BFAA 2GZXA 1VYRA 2H9AA 5REQB 2Y70A 4MNKA 2Y2WA 4TOQA 3G3DA 3FXYA 3SSZA 1K6WA 1NWTA 5H1WA 1X96A 3SCNA 2QDGA 1LJYA 1J9YA 1OGSA 2ZZ1A 4LNCA 1UR0A 2PZNA 3EX3A 5CPTA 4LUTA 3NUKA 2XFYA 4DO5A 3FKKA 4F2BA 1LWIA 1MW3A 1V6WA 5A94A 2BX7A 3BOFA 4ZOEA 4GE8A 1PYMA 1VBUA 2VRKA 3FAWA 2B7NA 3TLLA 3TV8A 1UKQA 4Y2WA 3C2RA 3G8RA 2A3BA 5HOSA 3GW3A 3T0TA 1J12A 1ZNNA 5JIWA 2XFWA 4F48A 2A2IA 4UTFA 2E25A 3EB2A 1QPQA 1VS1A 2BOFX 1MXGA 3SDOA 1TE1A 1RPKA 1UJPA 3PPFA 3GY1A 4RJEA 3SN0A 3T42A 3S2LA 2PRMA 2INFA 2P53A 1Q6OA 2ZRWA 3FNDA 1J4EA 2P5NA 2OWCA 4NVTA 3WQ8A 5I0DA 5HBFA 4DVOA 3CUGA 3LNPA 2J79A 2XFFA 5EGRA 4A35A 1RHCA 3UCCA 4O1BA 3FKRA 3UZZA 2R24A 4H9ZA 2HPIA 1HW6A 2ISVA 1G7UA 3TJLA 1VBHA 3UESA 3CZEA 3MUY1 3BV4A 1P6CA 3QZ6A 1YX1A 2OFJA 5KZDA 3W1LA 3TMLA 1OZQA 3WLPA 3GU2A 2G3FA 3BLOA 3MYOA 3S5SA 1EUNA 1QMLA 3R0KA 4LVFA 4DZ5A 4TTGA 3ANVA 5DY2A 1VFLA 1FKWA 4ACYA 1GVYA 2TAAA 1FBAA 1AW2A 3WK0A 2QHAA 2CPUA 2IUZA 3O9NA 6ALDA 1UJQA 1K6AA 3BLDA 2GQ9A 4AG0A 1E9YB 1C8QA 3QSRA 2IKHA 1UWTA 3GD6A 5MKGA 3H6OA 1JDFA 4UMBA 1I45A 1LLWA 1XLKA 3WH5A 4R7OA 1WO2A 1TO3A 4JIRA 5I78A 3CQ0A 3NIYA 5ECUA 3CB3A 1J01A 3AO0A 4K2SA 1CGVA 2X41A 2XJ7A 4BQ4A 1W3NA 3CUJA 1HGYA 4GO8A 1W1VA 3W7RA 2OZ3A 3EDDA 3UW6A 1RQEA 3KRUA 2NQZA 1BWKA 2QW5A 4LAMA 4UNKA 2WK2A 3SSJA 5CPSA 3L4ZA 1BD0A 4GJ1A 1XCXA 3NOEA 4I7VA 1SM9A 3DFHA 4XV0A 2ZBTA 3DFPA 3VINA 3LHYA 1T40A 3CV2A 1MQPA 3DFSA 2R1MA 1VENA 3UR2A 4UFKA 1R3QA 4AF0B 4MAVA 1Q2RA 4H7ZA 1ZZMA 3BG5A 1KCLA 3VM5A 2VJXA 4NZCA 4PUDA 4AVNA 3M43A 4HZ7A 3SCOA 1FWDC 3IJLA 1EWDA 3ARSA 2ON3A 1YADA 4N9CA 4O50A 4F9JA 2XIQA 3STGA 4OHQA 2X05A 2ADAA 2DW6A 3UA4A 1LOQA 5CQ1A 3EBVA 1B2YA 1XJBA 2GUBA 1JZ6A 1GVFA 1NFBA 2IKIA 1UR9A 4K7YA 5FKYA 4FSAA 3WK3A 4LUTB 1HIZA 3B8UA 3BXWA 3T55A 1UP0A 2X7WA 4ZQPA 5E09A 4ZXLA 4AC7C 1X8CA 3KBVA 3SECA 1B0IA 4EE9A 3C6CA 1KFKA 3GH5A 3EWUA 4Z2LA 4BWLC 2BDQA 3R79A 4D8ZA 3H2AA 4Y9OA 2YLLA 1E6RA 4O57A 1TVNA 3AIQA 3SUWA 3TOPA 1CGXA 3PFMA 2QJNA 3B9EA 2XSBA 1ESWA 4C5YA 1Y7VA 1CLVA 2OGYA 1P0NA 1I75A 2J88A 1TZ9A 1T7LA 3CUHA 2WMHA 1DWAM 5JH2A 1OX4B 2BS9A 4DLFA 2C1HA 3ZLGA 4FB7A 4HQVA 2YA2A 4L6DA 4MJMA 1XBVA 1XUZA 1YLVA 4JTCA 4Z42C 1K03A 4PMUA 1FVPA 3MCMA 1L6FA 1L6SA 1XLAA 4AVFA 1LUCB 7PTDA 4K3ZA 2DH2A 2XVGA 4JIIX 1CXHA 2O4MA 2V3DA 4NRSA 1KM3A 3WDIA 2OKTA 4QFUA 4MNLA 2ZDSA 3CPRA 4MKNA 2CLKA 3W7MA 1XD1A 2AAAA 3ENLA 1CWYA 3IK2A 1FXPA 4FNUA 3GC4A 1A5NC 2GGJA 4G9PA 2X1UA 3ZJ7A 1JQVA 3PK7A 1K3UA 5HMDA 3MUXA 3EOOA 1J93A 2Z1KA 1BVZA 4X9YA 1AH3A 2A3AA 1OC5A 1RVGA 3WIJA 2D3LA 5C9UA 3CB8A 2IQ0A 3ICJA 4HSHA 4GRSA 5AYIA 4RZ6A 3LMYA 1CT5A 3OGSA 2PBGA 4PBFA 4JCMA 4H41A 3BZJA 2X16A 4LAZA 3WLTA 1PVNA 2VX4A 4Z2GA 4AWTA 1RUSA 4XQ6A 4QXIA 3N4FA 5D8ZA 2ISSA 4Z17A 3VGEA 1W1YA 2X40A 4M6QA 1NP2A 4ATLA 3W76A 1IXNA 3EXTA 1G9HA 3NQ8A 1B3XA 3SUVA 4O11A 3L5AA 3FDGA 4BEUA 4V1YA 2C19A 1IEQA 4EPDC 3GR7A 1UBPC 3CEUA 5J04A 4OT7A 2HVMA 1PZ2A 1DKWA 3C2EA 2E09A 4S1FA 5IDIA 2YYUA 3W26A 4QR6A 4P7OA 2VC7A 4J3ZA 3GYCA 4ZO9A 5C6MA 1M65A 4HPXA 1IXQA 3MP4A 2CZEA 4MLJA 4UR7A 2BVYA 3SRHA 2DZWA 3PZGA 3M0JA 1LBMA 5D2TA 2V0TA 2EO7A 4NUWA 4AXKA 4Q4QA 4FNTA 3KBWA 2CZDA 2E6DA 2YCKX 3VIKA 2YCJA 4B3ZA 4LXFA 1BEUA 3W82A 3OLEA 5I24A 1NWUA 1YE4A 4DBEA 3WFAA 4MB5A 1HUVA 5A8GA 2GVGA 6ENLA 4HPNA 1F8IA 2NSXA 1P7TB 3FN9A 4DJDD 4YHEA 1E71M 3F5JA 3EWCA 4QM1A 2C1IA 1E0XA 3W1QA 1XH2A 3FYOA 4IF2A 4GVIA 1H7OA 3OVPA 2Z24A 4KFNA 1M7JA 5GJMA 2E9LA 2B7PA 4GQ0A 3PWIA 4DRSA 4WOZA 5LNWA 3W71A 2NUYA 2XIJA 5CBIA 3H4XA 1E1FA 5AZ0A 1HL8A 3G2GA 2IQTA 3C8FA 1EQPA 3H53A 4O10A 4LYPA 2WCSA 3GXTA 4D2JA 5A6SA 2AGTA 2EPLX 1LWJA 4NI8A 1TYGA 5JH1A 2NX3A 2F38A 1BWVA 3EA2A 3MI3A 5LZLA 2JGQA 3SJNA 3PANA 4JQ4A 4FXJA 3BMVA 4IIBA 1KLZA 5C9ZA 1EX5A 2YGYA 4C7DA 2Z1VA 3A4XA 3M47A 4NG3A 3LN3A 4YJ5A 3EX6A 3LY0A 4AZIA 1H63A 5LGXA 4D6GA 2R1PA 1G7VA 1HX0A 5EL1A 3QHMA 1QPNA 1NDWA 2NWSA 3A6OA 5CBBA 5EBAA 1CYGA 1F6PA 4ROQA 3DG7A 3EDFA 4YTTA 4NAEB 1YTEA 3H2EA 4BF7A 4YHGA 2OSWA 3BCJA 2QUMA 2WVTA 3KHDA 5A3HA 1N7KA 3H4GA 3VFCA 3G1SA 3GDMA 3K2GA 3NQ6A 1JFHA 4D8LA 3R13A 5I07A 1DJIA 1QVBA 1P1XA 3N73A 4FK9A 5EYWA 1R9YA 1R9XA 1AD1A 1QI3A 1QNSA 3PS7A 1AFSA 3EB3A 3FX4A 2INEA 5FI8A 2ZX6A 2HK0A 4IMCA 3ABRA 4YTRA 2F84A 1R2TA 3MCNA 4RX0A 2WZTA 3RF9A 4ECLA 1UR4A 3AIUA 2VYOA 5F2GA 3NO1A 2Y0FA 3QVQA 3C2FA 2E1DA 4MIMA 4ZFMA 1FWAC 2QMKA 3URAA 1N55A 3APGA 2D73A 3PBUA 4IFOA 3N9SA 3ZT5A 5DMNA 5SWUA 3EWZA 3GKFA 1DJGA 3GFXA 1WBHA 3AS2A 5E5CA 1TV7A 3W02A 3R43A 3LXCA 1UD3A 1XBZA 4Q8MA 3W84A 2YB4A 1ADDA 2Q09A 3AQUA 4X3ZA 3W6YA 3WQ4A 5I79A 1H11A 2OZTA 3S6TA 5BCAA 3U4FA 1O6IA 4EK7A 4DO7A 4DWSD 4J27A 3NQBA 2DT0A 2A6LA 2QPUA 1BYDA 3REQA 1DJHA 2BXVA 4NJKA 3B9NA 4C7FA 2O0TA 4GOAA 4YTUA 2WNNA 5DBUA 2YYTA 4W4QA 3LCIA 2VFFA 1B31A 2W9MA 3WEZA 2J7EA 1W2PA 4PUJA 4EF8A 4RPPA 4RV8A 3HB9A 2D24A 2PWUA 1HJXA 2RH9A 4QNWA 2PODA 3VKAA 4LT9A 1TJRA 4PTMA 3C5QA 1OM0A 3D0CA 4EWND 1PEZA 1XX1A 2Z7KA 1IR2A 3E0LA 1LM1A 4DJDC 3DEQA 3LHTA 2ZIDA 3GHRA 3WL1A 3U48A 1A50A 3OJGA 4ZSUA 3EX4A 3OYZA 1UIOA 1ODUA 1OYCA 5HJXA 1XYBA 5DCDA 1QK0A 2ZWYA 5CGQA 2DZPA 2WMKA 3WD1A 1L8PA 3CPGA 2B4GA 2J8FA 4QX4A 1OY0A 1WOBA 3IEBA 1ZFJA 4I6VA 1Q6EA 3I6EA 2ZC8A 3ES8A 3L66A 1TZZA 2BXZA 1S1PA 3M7SA 4JQ1A 3QW4B 3C2VA 3NYZA 4HCDA 3WZ0E 4NYYA 3N2BA 1MI3A 3MZ2A 3L5LA 3B0YA 3PZUA 1R3WA 3B04A 3AHXA 1J11A 1GCYA 5C7HA 2PDWA 3ZO9A 2VVNA 3KS5A 2YL8A 3M0VA 3R58A 3TYZA 2OEMA 2AL2A 2GGGA 1V6YA 7ODCA 3VNIA 2Z1WA 3R10A 4H6RA 3S0CA 3VD3A 3UWWA 1TELA 3AROA 1TCDA 3IGHX 3WJSA 2HJPA 4KRZA 5DY3A 3SFKA 3WD2A 5A1AA 4LALA 2G3NA 3CZLA 1SR9A 5GVJA 4ERIA 1GNXA 1X39A 3I3EA 4O18A 1OJXA 2NQJA 2QF8A 2PGFA 1DL3A 4DXXA 2ZUVA 1YDOA 3I65A 4LVAA 3OTRA 4B9YA 4IMEA 1VFFA 5FF0A 1QW8A 2PDMA 5BMXA 2FMOA 2Q02A 1WDSA 2EEXA 3O0KA 2WPGA 3S6OA 1MFVA 3E12A 4KMQA 3HU7A 3S2MA 1H5VA 1EDGA 2UY5A 1R86A 3ALGA 1ZB5A 3TC3A 4UWMA 1FWJC 3L9CA 3PBGA 3SCUA 3MQTA 2DZUA 4C6OA 4PUNA 3G0UA 4GGBA 1O4UA 3HJZA 1AMYA 4HTBA 8A3HA 1VF8A 1BPLB 1FHDA 2PDQA 3AIBA 3SUSA 4H8NA 3ZJKA 2DUXA 1W5MA 1ODZA 3UCQA 1KXTA 3OHIA 1FDYA 3EX2A 2G5WA 4WLCA 1RY8A 3MI2A 1ITCA 2VC9A 3NCOA 3TNBA 2WVVB 3VMNA 1K8CA 1B3OA 1U33A 2H6RA 1TV8A 4JCLA 5HINA 4PH6A 3OLDA 4EWJA 2E9BA 3KHJA 2X8RA 5JBDA 3EEZA 3W07A 3PFRA 4GX8A 3QQ1A 3PJWA 5DCBA 1VBRA 4B5TA 2YDQA 3FDKA 1IT0A 4AX6A 3NURA 4NZ3A 1O5RA 2XHYA 1G4TA 2WJZA 2W4XA 5AC5A 2J7DA 1G1YA 4MWAB 4WHBA 5C54A 5A6AA 1RBOB 1J79A 2WJFA 2ACSA 4IP5A 3GU9A 3H2NA 4R27A 5AVHA 4PB3A 3UG5A 2O55A 3NA8A 5D38A 1UUQA 3WQCA 3TCSA 3CS2A 2RDXA 2R9RA 3UETA 2NV1A 1VB9A 1XPGA 1M7XA 3I6RA 2QMJA 1Q45A 3DESA 3WK1A 9XIMA 3QY6A 3QXBA 2CLIA 4GVGA 1HP4A 5FJPA 1QBBA 4JN6A 3TYBA 4KCUA 1I9CB 3P8JA 2PI6A 2VZVA 1KXQA 1XG4A 2ZE0A 4IISA 3RK8A 3ITCA 4HBKA 3QC3A 4OECA 1CBGA 1CLKA 1FWNA 4Q7IA 1JCTA 1H7RA 3S2JA 2VEFA 3MP3A 2O7QA 3WQEA 5EBUA 1UZ4A 3LM3A 1AMKA 2YCLA 3ZOAA 2WCAA 4QAIA 2R6OA 3ZS4A 3ANYA 3ZQ9A 1XHGA 1DP0A 3LG3A 3FJ6A 5IOBA 2E8YA 4QAWA 2WJEA 3IJDA 4AIUA 4CD7A 2ONEA 3WEMA 4TMBA 3KDOA 3W1RA 3WLRA 3SADA 1ELSA 3LTSA 4JTUA 3VDBA 4CNNA 3WH7A 3V1HA 3W7PA 1PDYA 3M0LA 3MO7A 4GA8A 4UR8A 2V2DA 3VX0A 3TA6A 3R25A 1TRDA 2O7SA 1GHRA 4TV6A 5LA2A 3ZR5A 1NWSA 4LWWA 1YBQB 2QNEA 3H2FA 2XIMA 5LIXX 3LENA 4O54A 4Q4KA 4WDXA 3VOJA 4JR5A 1QWKA 4GGHA 1UKOA 1POJA 1QI5A 3KS6A 1IT8A 2ZZ7A 1JULA 1VEPA 2ZZ2A 3EPMA 4MJ4A 3OPSA 4XZHA 3TIMA 1C7SA 1JXJA 3CZ8A 3LM7A 5DRIA 3BO9A 4REQA 3ZT7A 4HB7A 2ZX9A 3B4UA 4Z1YA 2YFOA 4DIAA 3LHVA 4L1XA 5IFTA 4EP8C 4UIOA 1JRBA 3INPA 3HG3A 2DP3A 1U30A 5MF5A 3LCGA 1WDPA 4QE1A 3KVLA 3W6LA 4S3GA 1K9FA 5AYYA 4MB1A 3CZKA 4UTTC 1EJSC 4O4WA 4N4QA 1RJRA 4N9EA 1NAL1 2DZAA 1F5ZA 2D2GA 4XISA 3G24A 3G1RA 3I68A 3NQFA 4XZBA 3H54A 4AY7A 1J0ZA 4WY0A 5TNVA 3K1GA 5I3FA 3T08A 3HGSA 3N2XA 4QEEA 4UQBA 1ZSXA 3WD0A 5CZKA 3IVSA 4O1DA 2G3IA 3EKZA 5GJNA 4ZZ9A 1LBLA 3GUWA 3LQGA 1OG0A 4M7TA 4LH8A 1EBGA 3K8MA 2DUZA 2ZRYA 1Z44A 1A3WA 2BY0A 1W32A 3EDJA 3NXFA 3V16A 1BG9A 4GBDA 1JYWA 1I2RA 2QEZA 3A4WA 3LLXA 1XYCA 2YCIX 4IZGA 2VEMA 2FH6A 1DQWA 5DEZA 5DELA 4Q8QA 4W84A 5C71A 3HPFA 2C71A 4HNTA 4OVXA 3A3HA 4IICA 3T0DA 2QUNA 4HP5A 2XWEA 3SFWA 4ZXOA 1TR1A 1CNVA 2A3EA 3H22A 4UCGA 3W2MA 4GNVA 2C1GA 5CXPA 4E0CA 1XIFA 1T99A 2G37A 4UTIA 3GIPA 2GJPA 1VFMA 3GNXA 4HU4A 4PFMA 1PHWA 1TVLA 3BTNA 2QV5A 4U10A 1OGGA 1JNEA 4REQB 3H24A 2XIOA 1IEIA 1V3HA 3BAIA 2XVPA 4XO6A 3TFCA 3W88A 3NQDA 4WDWA 1W3TA 3VDCA 1WDWA 4HHLA 4WXYA 4XX6A 3EWWA 4CD5A 4AB4A 3WLLA 3WDPP 5DMYA 2VQTA 3VXGA 4F3HA 4PBEA 5HA7A 1EZ2A 1EJWC 1W3IA 3MMWA 3USZA 4HNVA 1HTIA 1OG6A 2VR4A 2FQIA 5G1YA 3VDGA 1CW2A 2W79A 4ALDA 3KVKA 1JCMP 1F6YA 1NDVA 1UPMB 1HKVA 4A6GA 4BWLA 4HK5A 1UH4A 1EKOA 2HQAA 3IIPA 1RR2A 4DJDA 5C7VA 1EYEA 5HMFA 2R91A 3UG4A 1ZJAA 3B9DA 3TQVA 4HHMA 4AFYA 4DJFC 3IVTA 1CB7B 1UG6A 3FHAA 4C60A 4ZQOA 1W1ZA 3ITLA 1E56A 4CQ9A 4R5EA 4PRTA 3ORWA 4PMDA 3RM8A 2QQ6A 2PWFA 2OX4A 4KWUA 1YW1A 1DWHM 1VCFA 3U7VA 1I2PA 1US0A 2GK1B 4HN8A 4MZ8A 3VVGA 3BV7A 3N15A 1I60A 3WQVA 3L68A 3NEHA 1MUWA 5F4WA 1FWBC 4F2UA 3N14A 3VKJA 3SY8A 5FA5A 1JF5A 1J6OA 3BL3A 4PZVA 4NXSA 4O0QA 5K3VA 1F4AA 3VA8A 2R14A 1GYMA 1B90A 1IF2A 4IGNA 3T9PA 4DX3A 4DPPA 2QULA 3UJFA 1XLDA 3TXZA 3PJXA 3JUGA 4FZIA 3T2PA 4DZHA 3SW6A 5IXEA 4HYRA 4IXHA 4JTRA 4XKYA 3GNOA 3MANA 1IZCA 2ASHA 3LBOA 2D20A 4F0RA 4NZ4A 3A64A 1QRQA 3VCRA 1Q7MA 3G1AA 4S3DA 1JD7A 4MTVA 4B5WA 2OG9A 2PC4A 3W87A 5LNRA 2BHYA 4HN4A 3KM8A 3KTXA 2WSKA 1LWHA 5H8MA 1XIJA 4WK9A 2DORA 3B06A 2C8NA 1QHPA 2CBIA 1W37A 1W5QA 3CAQA 3UERA 3W7EA 3LD5A 1XISA 5FCZA 3TN5A 1W1B1 2ALRA 1DIKA 3ITVA 4Q4PA 1U22A 4S3KA 3WMSA 3UWQA 1SPQA 3IAPA 1I1XA 2E9MA 4HSNA 1AL7A 5JMUA 3WQDA 1AQHA 3RO6A 4WR3A 4JYDA 4LU0A 2PFHA 3B0UX 1OX5A 1O68A 4QJ4B 3WO8A 1PX4A 3LSBA 4H7CA 3T7VA 5A6MA 4JL2A 2VC6A 5EKYA 1DHPA 3VGHA 4F79A 2FJUB 1IXPA 1ZCCA 3CXOA 1V5XA 4Q8NA 3KCLA 2Y62A 3LPOA 3J7HA 4QNEA 1FFQA 5FSEC 1E3ZA 4H6QA 1R7AA 1TWWA 4M80A 4CLMA 3WMCA 4LS1A 3W7DA 1EXBA 2NUXA 3ISIX 2OX1A 3FEQA 3HMJG 2W67A 3JS3A 3GTHA 4AIBA 5JBEA 1VKFA 1TMLA 3EWYA 3F03K 5CBJA 3DDMA 3IJ9A 3W37A 2D0HA 2BODX 2WBKA 3MB9A 4EOUA 6PTDA 4KWWA 1OZMA 4AUBA 3PZNA 2WQPA 3B4YA 2QT3A 1NTHA 4W7UA 1C9DA 1G5AA 3CUFA 3QV6A 1BKSA 3LBCA 5I09A 3ARYA 2VC5A 1E15A 1V4YA 2NX1A 2GQ8A 3THCA 2XTKA 3TU9A 4AIOA 3O8AA 5JXQA 1QOXA 4M29A 3O1NA 3P80A 1DIDA 4LC8A 2AQWA 2FVLA 3Q67A 4UNLA 4IQJA 2CC0A 5AHMA 2BGQA 3EAUA 2FPTA 4A8NA 3QKZA 3N4EA 2XDFA 2OT0A 3LQLA 4XSLA 5JU6A 2PBOA 3L2MA 3FHQA 4CQCA 2FPVA 1PZ3A 1EJ7L 3CGTA 3W01A 1QNRA 1XFBA 5I3HA 5B7YA 1I4NA 4U31A 1GQIA 4Q7BA 1LRTA 5D9OA 3LCFA 5BROA 4DXKA 1LL6A 4D9PA 5DN1A 2BOGX 3BURA 3UZYA 1B54A 1EJVC 4LEFA 3H55A 3NL5A 1XSKA 2XH2A 3TQ0A 3W1MA 4KT2A 3M6YA 1J10A 4YYCA 4WDTA 2UY4A 2OODA 3KRZA 1XLEA 4R7WA 4C1KA 4XAZA 1W9XA 2J6VA 2J78A 4Z2HA 1MW2A 2BXYA 3II1A 1Z6KA 4PEKA 4LCRA 3AU2A 3SAZA 4IIFA 2REQA 3CTLA 3GVGA 2J4GA 3AIWA 1ME8A 1SW7A 1QU4A 3WL0A 3EEGA 3PUGA 3T81A 2FVKA 3APTA 5CG0A 2VD9A 5L9FA 5DMLA 3VIPA 3ZXWA 3A3WA 4UOQA 3QPYA 3KOYA 1ZJIA 2FZDA 2X2YA 3LPGA 2X1RA 1K9DA 2PF0A 3JVAA 4KGLA 5HWMA 3JR2A 3M6DA 4H04A 2GJLA 1WCGA 2ZX7A 4JIQA 2WKJA 1A0CA 4UXDA 3GBDA 2QCCA 4I5UA 1U5JA 2ZFAA 4KPLA 4IL2A 5BU9A 3E49A 5D4YA 2OR2A 4MNJA 2QAPA 1PKLA 2BGNE 1UZHA 2X30A 1RSCA 1RCXB 2P3EA 1Q6GA 3OBKA 4XZIA 3NXLA 4B90A 1S2CA 2QV4A 1EC7A 1VFSA 4HVXA 5AZ1A 5F1UA 4JYEA 4QSFA 1SW3A 3GBEA 4ZQCA 3K5XA 4O16A 3QN3A 4E2OA 1F3TA 2QGYA 3SRKA 2Q3RA 2SFPA 4AMAA 5ABFB 3LK6A 1JDCA 3TAOA 3LRMA 2FYMA 1K7FA 4IIHA 4JD4A 3GTXA 3T40A 1WPCA 1KWKA 2WLZA 2QCHA 3HN3A 3NQVA 1WZLA 5LNUA 2DGAA 3W25A 4QEHA 3IJ6A 5A69A 2VX5A 1J8VA 4MUZA 1YXDA 5I03A 2W3ZA 2I7GA 1BKHA 4N6EA 2H8XA 3VDAA 7ENLA 3UF9A 4J2PA 3WBEA 1OINA 3VNLA 4BR1A 5D9NA 3R94A 1L9WA 2Q3OA 3W85A 1GJUA 5MHBA 2TYSA 3STEA 5I3GA 5KMYA 1BRLB 4PODA 2VEGA 5A8PA 4LQ1A 3EWXA 2JKPA 4GISA 3GTIA 4PCTA 5KTLA 4YNGA 3GNDA 2HCVA 3UJSA 3NQEA 2HRWA 4GC4A 3RCMA 2H3DA 3UJEA 3M46A 4ZE5A 3VO0A 3EZ4A 4GZ7A 4M6VA 1MEIA 2NVDA 4J4KA 4X63A 3HGOA 1LT8A 2OXNA 4XUGA 2OYLA 5MKGB 5A5WA 5G5IA 1T0OA 3D3AA 3E2QA 1XYFA 4N4PA 4C65A 4GC3A 4QG9A 4JAWA 1QW9A 2ZX5A 2C14A 2B81A 3U2ZA 4G7EA 1W3HA 3GX9A 2FHFA 4WGXA 2VXNA 1C8XA 4YWIA 1YBQA 1FQ0A 3BZGA 1JCLA 1EHAA 4FF7A 3VTRA 1QK2A 2NV2A 4KFOA 5IBXA 4Z1DA 4LFYA 3IV8A 3RLUA 4FLQA 1P48A 3UPBA 3AHZA 1RD6A 2OQYA 2RDTA 1EIXA 3HMCA 3KEHA 1H41A 4KEZA 1K8YA 2MNRA 4XZNX 2HK1A 4L61A 4GYPA 2DH3A 1FDZA 1DJQA 3S9YA 1KR0A 1R47A 4LW7A 2PDGA 4XZLX 3KBNA 1WKEA 1W1IE 2WPBA 3E6EA 4R7JA 1XH0A 4WKAA 3GTNA 2E5DA 1GONA 3O2LA 4I3GA 1V7YA 3H26A 2VFGA 2DQXA 5TQLA 2WHKA 1DJYA 4PTDA 1F61A 3CMJA 1IT7A 1UD4A 4YN5A 1XDMA 3GRIA 4Q22A 1PX3A 2QVHA 3A24A 3TYAA 1IEXA 1SJBA 3QGKC 1FWFC 4UTLA 4DO4A 4PMXA 2C0HA 3WQFA 3B0VC 3EB4A 1RPXA 3W23A 4LRTA 2V2CA 4P8WA 2NQ5A 3N3MA 4GI4A 1XDLA 3LMZA 4LNYA 5K7JA 5BXRA 3E0VA 1ZTVA 4EPKA 3P0WA 1R2SA 2OVLA 3PJUA 1J96A 1EPVA 4D72A 4HT3A 3GDKA 1R87A 3LRLA 4FPSA 3M0IA 1HKWA 4G5DA 3SCTA 2YBVA 3KZPA 1R3SA 3IANA 5H2ZA 5DT7A 4DELA 3B9OA 4J3TA 1FKXA 2Z6IA 1DTUA 2AL1A 3NZ1A 3AJXA 2AL2B 2PWDA 1BXBA 1QDSA 1M68A 3M5ZA 4WKHA 1CGUA 1KO0A 3GIQA 3MJMA 2J62A 3CIVA 1FWRA 1OYAA 1XIHA 2FFIA 3OA5A 2FTYA 3IK4A 3K46A 4TR9A 4XBJA 3PN8A 2FJKA 3KAOA 1AW1A 3GW0A 5C2GA 1Z42A 4H19A 3LGGA 4Z0SA 1JZ7A 3UD6A 4DF0A 3USBA 1N8FA 2PS2A 2PD5A 1T96A 4X9SA 1VPXA 5F2IA 3LSCA 1JAEA 1VLWA 1SUXA 4S23A 4Y9MA 5JIPA 1PBGA 1GTEA 4ERGA 3TSBA 1NVMA 6XIAA 2EBNA 3JU2A 2OB3A 2WHLA 2V5KA 3ARXA 2XUCA 5HXMA 2TSYA 1Y65A 1W0MA 3H7VA 3L12A 2NXGA 2QJHA 2OGJA 4LAKA 1O12A 1VRXA 3OW1A 1IV8A 2BFGA 1W5OA 4DO6A 2YPIA 3WH8A 1MDLA 4RE0A 5DFAA 3P74A 1I2OA 1WOAA 3AISA 4PR4A 4XBKA 3D3FA 3CBWA 4JTLA 3XIMA 1HP5A 1ME7A 3SQMA 1PXGA 1XICA 3OZYA 3K8KA 3AMCA 4A05A 1FP8A 1DE6A 9RUBA 1PS9A 1E0WA 4LF2A 4HZMA 3LLFA 1S2AA 3L23A 3ZJ6A 3OHMB 1Q4WA 4AHPA 3OVRA 2ZXQA 3TKFA 2GUUA 4DYJA 4AHQA 2EG7A 2BV9A 5GNZA 2VZOA 3BOLA 2VENA 1K8ZA 1A49A 1TWSA 1QAPA 3VNDA 3GM8A 1EWEA 4UQAA 2UBPC 2WOQA 1QCWA 1BTCA 3MHGA 4PUEA 2IPJA 5KSWA 1QW7A 3M0KA 5BRPA 4ATWA 1KM4A 4FOJA 4QIUA 4WXZA 3KTSA 3T2OA 1ZBWA 3GDTA 1MYRA 4JY9A 4PCNA 3F5KA 4L5ZA 1Q5MA 4S38A 5D32A 2OWWA 4AZCA 4LCQA 4L65A 4PMVA 3FV9A 3N6JA 3GXNA 4D6JA 4H9MA 3UWVA 3UZ5A 2BY2A 1TG7A 2X0HA 4QITA 4L4MA 3PBMA 1CEOA 1LYXA 3O16A 1S5WA 2PGEA 2CHOA 4TVUA 4RCXA 1UROA 4XAPA 1F74A 4F0HA 3UCDA 1MXSA 3IJQA 3GE7A 1A47A 1Z41A 1UR1A 2A0NA 3VUPA 3LCWA 3BSMA 3LU2A 3ARQA 1F76A 4R33A 3L21A 1NF0A 1NELA 3GB6A 2OEKA 3DHDA 4ZTYA 3C86A 3DH7A 5CSUA 3OZOA 4YCPA 3VFLA 3U2EA 4AQLA 3ARVA 1GHSA 2PLJA 2DSUA 4LBUA 2J24A 3I7SA 1YPXA 4I9AA 3U57A 4NXKA 1EP1A 3V18A 4NAFA 1KR1A 3A5VA 3TEVA 3S5YA 2Y61A 1ICSA 1B3WA 5HUPA 3G0XA 1V3LA 3P62A 1GKPA 1JCYA 2ZE3A 3RHGA 3E96A 5BXPA 4DWSA 4QLKA 4MDPA 1X6NA 2H8ZA 1K70A 4HPJA 3UG8A 1YMYA 2OCZA 4GUIA 4QJ5B 4B16A 3M4HA 3NR0A 3BOXA 5G2IA 3EPNA 1P5BA 3K8LA 3D5HA 2F61A 1KBBA 3BCDA 3VCNA 3OO2A 8XIMA 4JN8A 1WZMA 4BA0A 2B7OA 2X1TA 4EAYA 1E51A 6REQA 4DF2A 3MSRA 3NO5A 2XZ9A 3WQWA 4GQGA 1KWGA 3SUTA 1YRRA 1R3YA 4RW5A 2OYKA 3VABA 1F3WA 4I6KA 4YTQA 2VCAA 1AA1B 3GG8A 1HJSA 4L4LA 2YXGA 4GFSA 4I9MA 5EFFA 4A29A 1QASA 3UR7A 3TONA 3S5OA 1V3IA 1QPKA 3ANUA 5EMYA 4HNLA 4GD0A 4ZGYA 3S1XA 3UGRA 2QLYA 1S5NA 1QPOA 4WUIA 1US3A 1FP9A 4Q6XA 3UNDA 4WGHA 3PY2A 3B9AA 2EKCA 1QHOA 3I4KA 3R0DA 2F2KA 2Z1XA 4JQ3A 1XYZA 1AD4A 3POCA 2EGZA 1KTBA 4JGDA 2FFCA 3XINA 2HXUA 1H50A 2WZMA 2EG8A 3H2OA 1PCWA 4POCA 5KINA 4W93A 1D3CA 5I3JA 3RAOA 4AWUA 2P8BA 2BLEA 2E6AA 1H1YA 2A3CA 4Z1AA 1J0JA 3W29A 2PDLA 2PDIA 1TJ2A 1TZ7A 5ENLA 4Y96A 2FTPA 5D2YA 4R3UA 2E6YA 4MMWA 1Z32X 2P50A 4QQ3A 1ZRQA 4HNNA 2AKZA 4Y7EA 4C6PA 1ONXA 4CN6A 1KXHA 3FVDA 3T4CA 1PTAA 3B8TA 1A53A 1HJWA 3WY1A 2VEIA 3PZMA 3CK5A 4YVPA 2C0AA 1UUMA 1HJQA 1QTWA 2J77A 1OK6A 3SQSA 3W1UA 1K7XA 3DFOA 1OB0A 3W81A 2C6QA 3GXFA 4N9BA 4IXXA 2VR5A 4GQRA 1FHLA 4NNAA 1R3VA 3BARA 2J25A 3ITXA 2R82A 1UMLA 3WYZA 1GORA 2Y24A 3AUJA 2Y88A 3LCXA 4E2VA 3WBXA 3QFWA 4C5ZA 4K1WA 3NNTA 4B5NA 2DV0A 1XSJA 1M6JA 5J8LA 2V5JA 3S2CA 2UY2A 2W27A 3GR4A 4RXFA 4B4FA 3C3UA 4FA3A 3UY7A 2BY1A 3KZSA 4LY4A 4X60A 3MO4A 3AALA 4RNFA 3QV9A 3TJ4A 3S1WA 1JQXA 4WIWA 5CH9A 3ME3A 3CPUA 3CYJA 3MWCA 2ZADA 3SEPA 3QQWA 1NJJA 4UTMA 4GZEA 1THFD 1KFBA 1PL9A 4RPQA 4AWEA 3G22A 4C6JA 2BHUA 2XVLA 3W7HA 2ZUSA 3OOQA 1XPYA 2QPXA 4CNPA 1F07A 1XP3A 2WYSA 4V28A 3PB0A 1ZGDA 2XSXA 2PAJA 4UMAA 4HA4A 4K38A 3V5CA 3HPAA 4TX8A 5HQMA 4IG2B 2JEQA 1JDEA 2ZA1A 4HJWA 3DOPA 2E5CA 5D2VA 4BKNA 2ALDA 1LQ0A 1XLJA 3H4WA 3O0FA 4US5D 4YIWA 1CXKA 1YNPA 4WVXA 5CPMA 1NDYA 1XFCA 4DF1A 5KEZA 1BSIA 1R85A 2Z2UA 1HKIA 2VCCA 3C0SA 4F2TA 5AHNA 5HANA 3TQKA 1ONWA 1G01A 1ZBKA 5AHLA 5I02A 3QTGA 4GPNA 2L5HA 4O1AA 4GYPC 3H8AA 4AD0A 3ZSSA 5HNRA 4L9YA 4K8HA 1RY0A 1NOFA 4PGLA 5I3IA 5AHFA 4JS3A 3F2CA 3BLFA 1TPEA 4OBSA 1T6MA 4KIRA 4OOUA 1OT2A 3RGTA 2HVOA 5ABHA 1GEHA 5F2MA 3GDRA 5E6YA 1KTCA 3ABZA 4H4IA 1ZENA 3KDNA 4NRRA 2WVVA 5D9PA 4NZ1A 2OOGA 4LVBA 3VMPA 1ADSA 5H91A 4WCJA 5D9MA 1XF0A 5HJYA 1FCUA 1D8CA 4L1WA 5D03A 1H51A 4DWDA 1KBLA 3LERA 3SGZA 4D6FA 3MMTA 1QT1A 4LYQA 4IQDA 2X1SA 1LLOA 2Q01A 4XD3A 3GH4A 4AH7A 3LUTA 3S9IA 3NSNA 4E8CA 3IJ8A 3OIHA 5AHIA 2JF6A 4HU0A 3MZNA 1US2A 4R88A 3BJSA 3MBDA 3CH0A 1QOPA 1JFXA 6A3HA 1GW1A 3TYUA 4FXFA 1EO5A 4Z2IA 2NWRA 4UTWA 2F9RA 4C6CA 3GH7A 1ZS2A 4Q4RA 1RZMA 5A6LA 1K4HA 3AICA 4H01A 3OBAA 4ORMA 2YDAA 5ABFA 2OT1A 2VZTA 3PF3A 3T2QA 1AG1O 1CXFA 2E3ZA 2BASA 1YTDA 5G1MA 1TA3B 2OKOA 5G2HA 4DJED 1XGEA 2YZRA 3NQ2A 3QR1A 5EMLA 4TU1A 2XVNA 1MW1A 2E8ZA 3GFZA 5CZJA 3N04A 1X1NA 3DG3A 1VJIA 4JEJA 2J66A 1YXCA 3C52A 4FX8A 2VFDA 2HWGA 2NVAA 1CCWB 3HPSA 4GIYA 5M1TA 3PWAA 3M0ZA 3T8LA 1UR2A 4Q3MA 1YTKA 4MVAA 3PM6A 1LOLA 1PUDA 4LUSA 2Z2BA 5DLCA 3TE9A 1TVPA 3GVRA 1QO2A 3C2YA 1Y8BA 4R85A 4BF5A 3QGAC 4CQDA 3R2GA 2AQVA 1VYSX 1KTNA 3QRHA 4M82A 4XAFA 3Q65A 1JI2A 3AYVA 2HISA 4GG9A 1DXIA 7TIMA 3TYCA 3I7RA 6REQB 3SCSA 1DWJM 3PZQA 1AZ1A 1XYMA 3R1ZA 4U2ZA 5FSDC 2DFAA 2HBVA 3TTYA 2CKSA 2RAGA 4MKVA 2WKGA 1R3TA 2ZRZA 4AZBA 4RNHA 4S39A 1UC4A 4TO8A 4ZENA 4Y9NA 2CW6A 2QAFA 4LGXA 3CO4A 2EPHA 2OZ8A 2G97A 2VKZG 1BYCA 1X7FA 1GVQA 1SZEA 1OD8A 2J7HA 2V69A 3R11A 4I5RA 3DHFA 2CETA 2WMGA 4JIPA 2HS6A 2A1YA 4WDUA 4F8XA 2OPJA 1TRIA 2Z00A 1K8XA 1E6ZA 1QO5A 4WRHA 2Z1SA 1SZGA 3G1YA 4QJ1A 1MRAA 3NPVA 2ZUTA 2Y5SA 3PB2A 1EB3A 3N9RA 4HMNA 3NG3A 1ZHAA 3WD3A 1TTIA 4DUXA 4Z0JA 1XUUA 3U6WA 4AEEA 3OQ8A 3PZ9A 3AMKA 2DSVA 4W7WA 2ZZ3A 4Z1BA 1TPB1 1YDVA 3KWXA 3SJ3A 3RN6A 1M9HA 5M03A 4GCAA 3MBFA 4OE7A 4WSKA 4X22A 3AS3A 3QHOA 1SW0A 2PDNA 4MADA 2YB1A 3UU0A 4WQ6A 1N82A 1G69A 5HDRA 2F6UA 5XIAA 4LC6A 1OFBA 4HTYA 1KQZA 2ZWZA 3QY8A 4RL3A 4UFHA 1G67A 5B7ZA 4QE4A 3BW4A 2NLYA 3PWGA 2V81A 3FA5A 5J5DA 4MOZA 1R7OA 4DN1A 1DBTA 1S2VA 5K4ZA 3EA3A 1MMFA 4PB4A 3KLKA 3U5YA 3GG0A 4GKTA 3KBSA 5FACA 1EYWA 4UR9A 7XIMA 3UA3A 3IIXA 1DWFM 3F7JA 1NU5A 3ID7A 4FX7A 3EOLA 5ECVA 1I6NA 4F40A 2Z28A 3CEPA 3M7WA 4K37A 1C93A 5A2CA 1LL7A 3SCPA 3T0CA 3VOCA 1LP6A 1UPPA 4NKCA 1XDJA 1TV3A 2OELA 5G4WA 3B03A 2YJQA 1U2YA 1DYSA 3GXIA 3IV3A 4P61A 5K9XA 2D3NA 3DN5A 4HHHA 1JD9A 2OEJA 3E0WA 3ITTA 3W7JA 1EPXA 4OUIA 4XTDA 2WMJA 3VNJA 1EEPA 3M0YA 3GUGA 4NZ5A 2E28A 3T6CA 1EOKA 5BOEA 1V6UA 1UR3M 1QHZA 2ATMA 3ARRA 2BBFA 4IJCA 4XTIA 3DHPA 4N6FA 1A5CA 4B3KA 4RE3A 3RLVA 4RW3A 3L5MA 4HZ8A 2ISWA 2CKRA 4DM2A 2G8ZA 4M6UA 3FIGA 2DJXA 2X0SA 1E3XA 2NX9A 3LCLA 1V02A 1TMQA 3CAWA 2WJDA 3DGRA 3TSMA 3D46A 1Q6CA 3MC5A 4PEEA 5FAGA 2QGHA 4H00A 4PUUA 4LF1A 1MVYA 2B0MA 2EKGA 3UFYA 3ZWSA 3VKBA 3O7UA 2CXEA 5A8QA 3L65A 3V0SA 5U4NA 2PWHA 4QLLA 5E70A 3RPTA 1J0KA 3H7UA 3EOSA 3O6AA 3KLLA 4UFJA 8CGTA 4FI4A 2IXUA 1OCJA 3QW3A 3OGVA 3FXGA 1MWOA 4RXGA 4B2DA 4AZ6A 1D7KA 1X38A 1Y5VA 4DUVA 3LPFA 2GQAA 4AZ7A 4C91A 2ZUUA 3K4AA 1OF8A 2CYGA 4PTVA 3IUDA 3AMGA 2VD8A 4EX4A 4KIEA 3T0BA 4B5XA 3W1NA 4GIEA 2VDHA 3MVTA 3S5ZA 1CLXA 1F73A 3P82A 1O5KA 3R4IA 3LCHA 4A8RA 2CZ5A 1OADA 5M2FX 1LL4A 5HNUA 1PIFA 2Y4SA 3A9BA 4OBTA 1YDNA 5JVLA 3QQ0A 1ISWA 4RV3A 3W1TA 4A3UA 2XYLA 4NY2A 3UXLA 1E0VA 5C2XA 2E1WA 1VZWA 2BMBA 1GVRA 1NY1A 1BXCA 2C13A 3DC8A 3WBWA 4AU0A 3RITA 5JUVA 1TE6A 1RCOB 5DF0A 1B57A 4LANA 1L6GA 3TR2A 2WQDA 4HU8A