1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxyribose-5-phosphate aldolase
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
molecule tags Structural genomics, lyase
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
2QUUA 2CZEA 3HQ1A 3LDVA 1GWJA 4O0KA 3OIXA 1KM2A 4CCEA 1VYRA 2C14A 5HJLA 3UNDA 3NQEA 3I68A 1XUZA 2EPHA 4XQ6A 1QO5A 2WNNA 4KWWA 1ZNNA 3NQVA 1QMLA 4WD0A 3T55A 3P8JA 4IMFA 2JK2A 4O0ZA 4JTGA 2QJHA 3EX6A 3PC0A 4PEKA 2PCQA 1QNVA 1FWWA 4AAJA 3OA3A 1H5YA 3PUDA 4QNWA 3PUEA 1LBLA 1G4TA 1K3UA 2OMAA 4ALDA 4BWLA 2J27A 3GAYA 2YYUA 1OFAA 3W2KA 1KW1A 3PSVA 1WA3A 5D2XA 3S6DA 5EY5A 4CLMA 3UQNA 4HNVA 3OVRA 1BWLA 4DXVA 2Y63A 4CQ8A 3QQ0A 3EXSA 4FX7A 5LGZA 3G0UA 1D9EA 3R89A 2A85A 1LOLA 3L0NA 3GR7A 3F1QA 2EF9A 4ORMA 4OQVA 4QISA 3DHDA 5HNRA 1GVOA 3B0UX 4UTTC 1J2WA 1IXPA 3N14A 2E5DA 1VR6A 1SO4A 5CZTA 1GG0A 1W5PA 1M7OA 1EIXA 1KM5A 3SGUA 1SU5A 3UWVA 4YCPA 1QFEA 3IIPA 2VEMA 4A29A 4MOZA 5DN1A 3HG5A 2YXGA 3LCWA 2C19A 1DBTA 2RDWA 2GQ9A 1LP6A 3SJ3A 2NX9A 3NOEA 2WKJA 3BW4A 1N8FA 4O53A 5LHEA 5G2WA 3S42A 2X2GA 4XBKA 3P62A 3MHFA 5SWUA 3HO8A 5FF2A 5H91A 1EP2A 3DKLA 3TX9A 3NQFA 3TW6A 2VFDA 2EGZA 3U2OA 2A21A 5H2ZA 1THFD 3W9ZA 1ZALA 1SW0A 2CLFA 1P0NA 1W5OA 1SO5A 2GUUA 3QPYA 4IXHA 4OGZA 5F4WA 5HUOA 3W7JA 1RD5A 2CZFA 2PRMA 4HHPA 3FOKA 1H7PA 1W8SA 2GJNA 2Y61A 3SGZA 1OF6A 3ZR4A 4L4MA 1OF8A 5DBUA 4ZMGA 1ME9A 4AWUA 2FB2A 2XFWA 4OT7A 2PE4A 2GQAA 1G7UA 3UWQA 1OFEA 2I9EA 4ZQPA 4FO4A 3FA5A 3C3NA 4A21A 4GXMA 1XUUA 2NV2A 2JKAA 4ZQRA 2VOMA 1L6YA 3I65A 1Q3NA 5L9FA 3NQ8A 3N2XA 3BW2A 2C6QA 1W5MA 2NXIA 1X7FA 1I2QA 3PG8A 3W7OA 2NX1A 2WNZA 2QCLA 3STGA 4TX9A 5FEZA 4DF0A 3U8GA 3B8DA 3M44A 4S2CA 2FQIA 3I7QA 3QF0A 2PC4A 3T7VA 4PODA 3RFAA 3G1XA 4E2DA 1KM0A 3DZ1A 1M5WA 4LTSA 3W1UA 4HKPA 5AHEA 4CCCA 4JTKA 1GVRA 4JICA 5D04C 2V2DA 3M9YA 4X3ZA 3PF3A 1DOSA 5G4WA 1ICPA 1OABA 1XDMA 4I7WA 1KLYA 3N9RA 2C15A 4AF0A 4IUOA 1SW3A 2QCEA 2ZRZA 3MHUA 2R14A 4IMDA 4DELA 1G4EA 4OHQA 3BVJA 4OWGA 4TMCA 3MW7A 3KRSA 2H3DA 4FNTA 2ZYFA 2C3ZA 1H7XA 3G1AA 3EB2A 2GQ8A 1M6JA 4Z0JA 5L6UA 2DP3A 5AHLA 2C13A 3L21A 1G4SA 3IIZA 1PS9A 1CI1A 3KHJA 3LHYA 3MP4A 3W76A 3KVKA 3F03K 1KM4A 3R5EA 1TPWA 3NZ1A 4IWWA 1SZGA 2BXVA 2X1RA 1YPIA 4FIQA 2V9DA 4O13A 1KFKA 4NJGA 3TJXA 3NL2A 3SR7A 1SR9A 1XKYA 3CWOX 4QAIA 3EKLA 4JTFA 5E1QA 3W87A 3ABQA 2BLEA 1GOXA 3GK0A 2FPVA 3W1NA 4C1KA 1GVSA 1MXSA 4ADSA 3BGJA 3LCHA 2J9XA 3DFPA 3INPA 3HPXA 2GVLA 1RV8A 3MI3A 3B0PA 4QITA 3IEBA 2P10A 1YDNA 4ADUA 2DJXA 1W5QA 4LW7A 2X30A 4Z1DA 3S5OA 2DZXA 1S5VA 1Y0EA 1JR1A 3LV5A 1Z42A 3RLVA 1LOSA 4R53A 1VGAA 3M5VA 1W3TA 4OV9A 1I2RA 2CLOA 3LXAA 4IX0A 1O95A 3QMRA 1B4KA 3SECA 1OFRA 4YLWA 1WBHA 2DU2A 3W7NA 3SW6A 2Y6ZA 4A2SA 5AN7A 5I3FA 1PCKA 4K8HA 3P7YA 4FNSA 4KFNA 3UWWA 5C2XA 4LC6A 2ZBTA 5HMSA 3KVJA 4JD4A 3LOTA 1IIHA 3A21A 2VEKA 1W0MA 3T4CA 1JUEA 3QZEA 4JS3A 2A5HA 3IIOA 4IMEA 3GXTA 5J5DA 5CKSA 5IBXA 1K02A 3BO9A 4HN4A 1C8VA 2ZRVA 2TPSA 2IQTA 2WO5A 2TSYA 5AHFA 2OJPA 1VYPX 5C5YA 3FFSA 1KFLA 1PIIA 1PHQA 1H7RA 3PB0A 4NZJA 1YXYA 3M5YA 4UFKA 5FF0A 4GJ1A 1XFBA 2QCFA 3RK8A 2ZZ3A 3UYCA 2AQWA 4GUGA 3OVQA 4O4WA 1KFEA 4M7SA 1WQ5A 1F74A 2WQPA 4N9EA 3W07A 1FY6A 4FIRA 4BR1A 3TC6A 1ME7A 2E09A 1T99A 1QCWA 2Y70A 3LM7A 4O17A 4AH7A 3TQKA 1A5CA 3K30A 4AF0B 5LNRA 5MHBA 4MFEA 3ZS4A 5KITA 4ADTA 1EUAA 3S8HA 2FLIA 4PFMA 4RV8A 2QUVA 3RMJA 2C1HA 1EP3A 3G1FA 2X1TA 3ABOA 3KXQA 5EYWA 2YYTA 1VC4A 4AMAA 3SZ8A 1VCGA 4IX2A 2B7NA 1IGSA 1PVNA 2E6AA 5D05A 3H53A 3BGGA 3W7RA 4S2BA 3EWBX 2GJLA 3EWUA 3DKJA 4KFPA 3LCGA 1A50A 4P61A 1QOPA 1JUBA 3LXBA 1WOAA 3N2MA 1TPC1 3N3MA 3P80A 4UFIA 1TJRA 1Q6LA 3TMLA 3VCRA 2DZUA 5CSSA 3P5YA 3QSRA 1F73A 1R2RA 1AW2A 2ZRYA 1MZHA 2ZDRA 2CLKA 1VHNA 3LHUA 4MY8A 4RLIA 3W88A 1I2OA 1PV8A 3NXFA 3QEZA 4HT3A 5D02A 4BI5A 4N9DA 1LBMA 1NEYA 1DQXA 5DLCA 4Y6GA 3IGUA 1O5KA 3C2OA 1TSIA 4IMCA 3R13A 2YSWA 4UFLA 5EKYA 3RLUA 3UY7A 1FQ0A 4O57A 4DF2A 3CQ0A 5AC8A 1H7NA 1RZMA 5HWMA 3CT7A 1Q45A 1BTMA 3L67A 4JYFA 2EAWA 5KTLA 1X8FA 2DZSA 1O4UA 5BMWA 3DI0A 3TUUA 3LTPA 3C2RA 1SZEA 1TV7A 3TCEA 1GVQA 4FHAA 4UFHA 3W22A 1TTPA 1V7YA 2DJLA 5D2WA 3DXIA 4WXYA 4GWEA 4DBDA 1TB3A 3LI1A 2C18A 3SFKA 1ONRA 3FIGA 2ZZ5A 1P1XA 3HG4A 2CZDA 3W7IA 1DKWA 3M47A 1OX6A 4UXDA 3RF9A 3GZ3A 3TC7A 4JX4A 1S5TA 2XN1A 3VNDA 1YDVA 4Y9AA 3EXTA 4Z1BA 3WJWA 5LNWA 1MEIA 4LT9A 3TFCA 3NDOA 2QCNA 3TSMA 3FJLA 1P4CA 3D0CA 4UMAA 2C0AA 5AYXA 3GXPA 1WV2A 4OU1A 3P67A 5KZMA 2H90A 3M43A 1R47A 4DO5A 5K9CA 1WOBA 2AAMA 3DFTA 1FCVA 1JCLA 1FBAA 3Q37A 3NQCA 4UTTA 4JN6A 3SIZA 3LCFA 1YLVA 3GIYA 5EBUA 4PH6A 1Q6RA 1A5SA 1VJIA 3NZRA 3STEA 4LY8A 5AHNA 3LB0A 3P8IA 4NUWA 1KLZA 1H7OA 3G0SA 3W7QA 5E93A 4WX2A 1IXOA 2V2CA 4X9SA 1D3GA 5CPLA 1HO1A 1GG1A 4KFOA 1T8XA 4S1FA 4UMCA 3CPRA 4A3UA 4RZ4A 3I6RA 1YDOA 4LRTA 5D33A 1TPUA 1EP1A 1F2JA 3BARA 3DBPA 4OE7A 5KINA 2NUYA 3NYZA 3UWYA 1DJQA 1GQNA 5CPMA 2W79A 4UNLA 1TO3A 4RJEA 3W71A 3W7CA 5HR7A 2YFOA 2CLLA 3PG9A 4MYXA 4R33A 2ALDA 2RHGA 4UR7A 5CSRA 5D2VA 1YADA 4LV4A 3L0GA 2NWRA 5AYZA 1TTIA 1Q6OA 2GOUA 2ISVA 1KBIA 1GYLA 4UTLA 4LS2A 3GXNA 3W1QA 3N34A 3TSDA 1QPQA 3P5ZA 1WAUA 5KSWA 3N9SA 1FX6A 5CPNA 5F1UA 4N2YA 1W54A 3W2MA 3MJYA 1FDZA 1AK5A 4HIBA 5FESA 2YDAA 1QOQA 1LM1A 4XBSA 3LV6A 3MYOA 4BK9A 4LS1A 3LHTA 3UWUA 3PY2A 5G2IA 3W1AA 4O50A 5F4XA 1P0KA 5AHMA 3BLFA 3PUOA 4GBUA 1LRTA 4C1LA 2Z0IA 2VEIA 2QAPA 3EX3A 3PBVA 4U4MA 4LVBA 5I3KA 3T44A 1ADOA 1SW7A 3LTSA 1XBZA 4ZQMA 4ZVJA 4AB4A 2J9ZA 1T96A 1IXQA 4FNUA 3S1WA 3STFA 2HMCA 2ATMA 2WPBA 1G69A 4DEFA 1GTHA 2ATSA 1CX9A 3W85A 2Y85A 4GC4A 4K36A 2JGQA 3TROA 1TTQA 3L68A 5G4EA 3A9IA 1SO6A 3ATZA 2ABBA 3KRZA 1OVDA 3L9CA 3MP3A 3NNTA 5CZSA 2QUTA 4W9TA 4G1KA 3WFAA 1ICSA 1OG0A 1H1ZA 2D73A 3DI1A 4HSNA 3A23A 3GDTA 1PCWA 3QW4B 2CZ5A 3DFQA 4XUGA 3C2EA 4UMBA 2G95A 3BK0A 3NR0A 2PURA 5FF7A 3USBA 1DJNA 4R7JA 6TIMA 3TXZA 1M7PA 4MZYA 3PULA 3W7HA 3NM3A 4ML9A 5T26A 1ICQA 2ZCGA 1R2TA 2ABAA 2YFNA 1GTEA 3PBWA 3HGOA 1AL7A 1JCNA 1DL3A 3W1PA 1JQXA 3QFEA 4JYDA 5J5RA 4I9AA 2FB3A 3FS2A 3O1NA 4LV9A 4PL1A 5LNVA 1GVFA 5D32A 1OK6A 2AGKA 1VS1A 2ZA3A 3EWYA 2B4GA 5HWJA 1W31A 1H62A 2ZA2A 1HG3A 3JR2A 3NQAA 2OT0A 2VEPA 5TQLA 1SFJA 3IVSA 4JTIA 1P5BA 4NZFA 4NJHA 4LWWA 1XBXA 4UTWC 2R91A 3NGJA 4Z1CA 5K3VA 3LGEA 2RDTA 3M6YA 3P74A 4FXRA 2FDSA 5TIMA 3FJ6A 3P81A 2Y89A 4DPPA 1KTCA 1K7EA 1XBVA 2G97A 3L0KA 1GT8A 3WK1A 3B06A 2HS6A 4MKNA 4DBEA 4UUIA 4AHPA 4O10A 3DENA 1RVGA 1JCMP 4ZQOA 4MJMA 4MY1A 3CWNA 3G22A 3G1YA 5ABTA 5CPOA 4WXZA 3W2JA 5G1TA 3W2LA 1XXXA 2P0OA 4O8RA 1GEQA 4O12A 1F6PA 1VPXA 4LU0A 2YW4A 1WXJA 3G1DA 5A5WA 3HB9A 4WZHA 3W84A 2PRLA 2V82A 3ANYA 4YL2A 4RK8A 3MBFA 1AW5A 1ZAHA 1TREA 5F2LA 1TCDA 3FLUA 1K8XA 2E5BA 5KMYA 3BW3A 3I7SA 3VKJA 1NSJA 3M0ZA 3O16A 4PC8A 3LI0A 3NL6A 3TW7A 5FEWA 4UFMA 3W83A 1FWRA 4O15A 3V75A 3L65A 4MZ1A 3W3OA 2E5CA 3W72A 3OHIA 1JCJA 2V0TA 1OFBA 3JS3A 3LERA 4AVFA 5HWNA 2OCZA 1BEUA 3HIJA 1C29A 3HG3A 1X6UA 2A0NA 4TR9A 3G0XA 1TV5A 2HS8A 2YX0A 3W2NA 4BFAA 1I8JA 5LSMA 1NAL1 2Z1BA 3NPXA 4N9BA 2CLEA 2G96A 3IGSA 5I3GA 3TV8A 1FUYA 1H7WA 3GAKA 2HSAA 3KAOA 4IJBA 4JIQA 4MZ8A 4QQ3A 4NT0A 1RPXA 1KM6A 3N73A 3MMTA 1WYIA 3GX9A 1YXCA 3UPWA 5AOUA 1FCUA 3NPVA 3NQMA 1A5BA 3FYPA 1TIMA 1TPFA 3TIMA 5LZLA 2ZRWA 1VCFA 4LRSA 1WBJA 1G6CA 1LLZA 3DFSA 3LRKA 4WOZA 4EOUA 4LVFA 4IQLA 1PE1A 4U28A 3HGRA 2ZZ7A 2A2IA 3PAJA 3QSTA 3EEGA 3NQ7A 3S0CA 2VXNA 3GNDA 3S5NA 5G1YA 4HSOA 3AO0A 3O05A 1BKSA 1TYGA 5I3IA 3C6CA 4AHOA 5BMXA 4LVAA 4Y96A 1B4EA 3HG2A 4TU1A 1G7VA 1XM3A 2V2HA 1KV5A 2QAFA 1B3OA 1SO3A 1H51A 3TE9A 2QJGA 4HNTA 3Q58A 2ISWA 4DO4A 3HJZA 1WDWA 1QPRA 4JTLA 4Q4KA 3TDFA 1JCXA 3E0IA 2ZZ4A 5FI8A 5D03A 4O1DA 4FB7A 3G24A 4WOQA 3DFOA 1OX4A 1HFBA 1OYCA 2OX1A 3UXAA 4RXGA 4UTIA 3DAQA 4JTJA 1OJXA 4AEOA 1Z48A 1OFQA 2CLMA 1UCWA 3W70A 1TTJA 5K7JA 1XI3A 2C16A 3AJXA 4GUJA 2Z6IA 3KVLA 1O5XA 3CLMA 1JUKA 3F4NA 4NJIA 4NXSA 4QIUA 1GZGA 1YTEA 1N55A 2DZWA 5EA9A 3ABSA 4AWTA 4YWIA 3PR2A 4O1AA 1ZY9A 1EB3A 3P84A 3OBKA 4J9JA 3SY5A 2QEZA 3W1TA 2B7QA 3GDKA 4X22A 2NZLA 1FCQA 1FXPA 1EEPA 3KFTA 3TKFA 4AWSA 5HQEA 1TRDA 3LRMA 3NM1A 4QM1A 3EKZA 3LHZA 4LS0A 3CB8A 1NFBA 1YTDA 1ALDA 1HL2A 3KOFA 3CU2A 3P60A 3TU9A 5AFDA 4UC5A 3R8RA 1F7BA 1DV7A 2Y88A 1XBYA 1VZWA 1K7FA 1OX5A 1L6WA 2QCHA 3C4UA 5HULA 4M6VA 5K9XA 4JTUA 5C54A 1PL9A 3TAKA 4Q32A 3NL5A 1VCVA 1F6KA 2ZRUA 4JY9A 3C0JA 2BX7A 5BRBA 2H8XA 2WSYA 3WK2A 4B5NA 1ML1A 2LLEA 4N4PA 1KFJA 5F2MA 3GYEA 4UR8A 3TQVA 3L5LA 4K38A 1G67A 1HUVA 5CGQA 1EX5A 4EWND 1LLWA 2Q8ZA 1MEWA 3QW3A 3M16A 3O63A 1VLIA 3B04A 2DORA 5LNUA 3IV3A 4UCGA 1E51A 1LROA 4MPQA 1C9DA 3MI6A 5DBTA 2BSLA 4TIMA 4FXSA 3G8EA 4ONVA 2Q3OA 1TPVA 2NXHA 3IVTA 5LGXA 5D2YA 1J5TA 3LHWA 3C56A 2VKZG 2TMDA 2NUXA 5BW6A 2O7QA 4A22A 3ZWTA 3TMQA 3STCA 3BPWA 2E6DA 3CM4A 3ATYA 5BNKA 2YCEA 3NO5A 3QM3A 5HR6A 1U5JA 5AHIA 3UXDA 1K8YA 1QAPA 4K8EA 4PL2A 3LCLA 4MLRA 4RX0A 2J24A 4XTDA 1U83A 3QRHA 4BI6A 4FNPA 3QH2A 4FX6M 5K2ZA 1AG1O 1LORA 1KM1A 3O6CA 2A7PA 5TBOA 1UUOA 4EF8A 3WK3A 1TQXA 2FTPA 4JEQA 3JRKA 2BTMA 4IXXA 3LLDA 3TR2A 3LRLA 4TO8A 3G3DA 1MSSA 1JJKA 3KRUA 2FJKA 3Q94A 3S5ZA 3CIXA 1V5XA 3LXCA 4LUJA 4NXKA 1I2PA 4QJ1A 3NG3A 3W1LA 3VE7A 1LCOA 2OT1A 1XDLA 3BLIA 4Q33A 1VYSX 2Z6JA 4PTNA 1OX4B 4XWUA 4JX6A 4K37A 4POCA 4O54A 2F7FA 2V81A 3G1VA 1TPB1 1AMKA 3PBUA 3OEXA 3MUXA 2Q3RA 3W6YA 5D09A 2WSRA 4O28A 5G2HA 2CFFA 1YXDA 3ELFA 4O1CA 1LBFA 1VLWA 2Y7DA 3NEVA 3UD6A 4X2RA 1SZFA 1SQ7A 3A24A 2YPIA 2E1DA 2QCDA 3C8FA 3HOJA 3KVMA 2GVGA 3TXVA 3O6YX 4PA8A 4GUIA 3A5FA 1IXNA 1K03A 3IVUA 3QPZA 4M5PA 1K7XA 2A4AA 3W73A 4RKAA 2JBMA 3L5AA 7TIMA 1WX0A 2R8WA 4PCFA 5D38A 3TA6A 4QNEA 4WY0F 4RXFA 4AHQA 1J4EA 3W1MA 1LYXA 4HNUA 3W1XA 4O19A 1UB3A 1NF7A 4AXKA 4ZQCA 2QDHA 3CC1A 4UFJA 4LC8A 2V5LA 2F84A 1NVMA 3GB6A 1CW2A 3T78A 5EL1A 4EVZA 1UJPA 4WJEA 1R46A 3DFNA 3E12A 3W7KA 2H3BA 6ALDA 3YPIA 4EF9A 2ZZ2A 4CNOA 2G5WA 1IIGA 3TFXA 1TPEA 3PWAA 3UY8A 2E6YA 1EUNA 4MIMA 1AW1A 4YMZA 3PS7A 4FNQA 3GDRA 5DCBA 3IIVA 1L6SA 5DY3A 3QC3A 2QCCA 1UBSA 3H55A 3CHVA 1ZAJA 2E68A 5DXXA 3SSJA 3HMJG 3M5ZA 3W7PA 3BG9A 3EWXA 2VFEA 5D2TA 4YXGA 3G1HA 2DZPA 3DH7A 2B7OA 3EWZA 3TNOA 5U7SA 4NX0A 1EWEA 4H6KA 1ZCOA 5EPDA 3F4WA 2RFGA 3A5VA 4LVDA 3PSWA 4UTWA 4JTEA 2V30A 2WNQA 4N02A 4E38A 1PHWA 2CLHA 1QO2A 4L4LA 1TJPA 2VFFA 1NF0A 4NNBA 3MI2A 3NQ6A 3IGXA 1VHCA 3S1UA 3BG3A 3MYPA 3E49A 3W75A 5F1VA 1W3NA 5DELA 4IOTA 1H63A 3H54A 1UUMA 3RU6A 1JULA 2ISSA 1EWDA 2Z2UA 1OYBA 4O4VA 3MWAA 2V5BA 5HINA 4BWLC 4XZ9A 2ZRXA 1X1ZA 2QDGA 1H60A 2BWGA 2DZVA 5D30A 2VFGA 4M7TA 4BI7A 3FEMA 5C55A 3QJAA 3MBDA 1TV8A 4Y90A 5CZ0A 4RCXA 3WJYA 3DU0A 5AC6A 3E9AA 3EX2A 4MLJA 3UWZA 1QR7A 1VQTA 3EX1A 3W2UA 2QCDB 4ORIA 4IPJA 3TSBA 2B0MA 3W7DA 1T0OA 4O52A 4MVAA 1EPXA 3W7LA 2OZ0A 3S5YA 3W86A 3EX4A 4O14A 2E6FA 5FEXA 4JTTA 3R2GA 1H50A 1TPH1 3CEUA 4M6PA 3W7GA 3IIXA 3M5XA 1RQBA 2CU0A 1DHPA 2W0UA 3THQA 1HTIA 2YR1A 2ZZ6A 5EMUA 4YCOA 4GE8A 1G4PA 4MYAA 1OFPA 1SPQA 1ZJIA 3A22A 3HGSA 4WQ6A 3B0VC 5BOOA 1OFOA 5AC7A 1YTKA 2Y7EA 1XCFA 5LNSA 3VFLA 3GR8A 1SUXA 4OBTA 1SSDA 2Q8LA 2A7NA 1FCBA 2E77A 1JRBA 3M41A 4UTJA 5DY2A 2DZTA 4K7YA 4XTIA 3SI9A 5KZEA 2CLIA 3PB2A 1L2UA 5LKYA 3E02A 4Y8FA 3EWWA 2FIQA 2FPYA 3QQ1A 4RZ6A 2NXGA 3L5MA 4NNAA 5E0KA 3L2IA 4JX5A 4R34A 4NU7A 3TQ0A 1IF2A 1F5ZA 2QJIA 3GKFA 3N19B 3U6WA 3WJZA 4JDYA 4GFSA 1OK4A 4IMGA 2P1FA 3O06A 1UASA 1FXQA 1W56A 4NNCA 1W37A 4CQ9A 3GLCA 4DQWA 2FFCA 2ZTKA 3OG3A 1YPFA 1YYAA 3LHVA 4GUHA 4RZ5A 3DHFA 5CG7A 2XN0A 3FKRA 2Y7GA 4MJZA 4QSHA 4MUZA 1H61A 4JXCA 3LCXA 1FDYA 5I3JA 1JCYA 3C2FA 3C52A 2GPTA 3PVFA 3GVGA 4EIVA 1A5AA 4LOCA 2H6RA 3NL3A 4Z1AA 3Q2DA 3WJXA 4IPIA 4N6FA 1D3HA 4LVGA 5IM51 2WOQA 4K7VA 2WV8A 3HPSA 4CCDA 3W23A 4JNMA 2O7SA 1O60A 2JGYA 3HF3A 4GUFA 4NX5A 1ZAIA 3B05A 3PBYA 3BV4A 2B7PA 4XKYA 3O07A 5DXYA 2VELA 3TJLA 4N6EA 4UTUA 2A1YA 1QPOA 2RDUA 1ZFJA 4UIOA 1OYAA 3T40A 1LRQA 2QCGA 2ZZ1A 1F05A 4JYEA 4NJKA 3UZ5A 1KTNA 4H4IA 2H8ZA 3LCIA 1BWKA 1JRCA 1LRNA 5C6MA 3NAVA 2QKFA 4M19A 5LHFA 1S3HA 2TYSA 5GVJA 2RKXA 1ZENA 3BLEA 2I1OA 2CW6A 2YZRA 2QF7A 3LX9A 3IRDA 3LLFA 4MY9A 2TRSA 4FNRA 3O8AA 2X16A 1TPDA 1X1OA 3ABRA 4K6AA 2NX3A 3B03A 4N4QA 4RR4A 5CZJA 5AYYA 1KBJA 2JKPA 4H3DA 2JKEA 4JDBA 4O11A 4Z0SA 4KKXA 2QR6A 5HUPA 3NQDA 3S1VA 3S1XA 3LBMA 3G8RA 5KZDA 5K4ZA 4JY8A 3TK7A 3TH6A 2UV8G 2Y7FA 4LNYA 3UPBA 4D2JA 5FEPA 3WJSA 3CIWA 4CNNA 4DO6A 4NQ1A 2ZA1A 3C2VA 1GJPA 2XN2A 3QMTA 1I45A 2J6XA 3DGRA 1FWTA 1DQWA 1KFBA 4O18A 1JQVA 4NVTA 4ZQNA 1SZNA 1EA0A 3I7RA 4WY0A 3G3MA 2VENA 2VC6A 4GRSA 1B9BA 4FEZA 4DPQA 1RQHA 1TQJA 4K39A 1DORA 4WUIA 4GNJA 3S9YA 1S5WA 1I4NA 1MEHA 2YGYA 3M7WA 1FWSA 1JVNA 3MO7A 5FF3A 2ZFAA 1XL9A 2J9YA 2KZHA 4Z08A 4LUIA 3GDMA 1SSGA 5FF4A 3G18A 3FYOA 1LZOA 3FKKA 1KTBA 3B4UA 4JR5A 2V8ZA 5I3HA 4N9CA 2I14A 1B57A 4UNKA 3W1RA 1LTDA 2J88A 3KX6A 3M1ZA 1GPWA 2WSQA 3HPZA 3P82A 2A6LA 4JIPA 5D37A 1N7KA 1KV8A 4FF7A 1MO0A 2FPTA 1VRDA 3NQ2A 1OFDA 3GDLA 5F2GA 3HGJA 1FDJA 4KWVA 4HPJA 4JTHA 1LDCA 5IBXC 2HTMA 1GYNA 3G1SA 4E0CA 2BZNA 1FWNA 4CQAA 3O6DA 5U4NA 4HNNA 1RQEA 2GVJA 4HPXA 1KM3A 3BG5A 1HO4A 3NPWA 3R12A 3P61A 5A8GA 1I2NA 1KA9F 2NUWA 4P2VA 1O94A 4A2RA 2A6NA 1KFCA 4DF1A 1QDSA 2WJZA 2Y62A 3NPUA 2VFIA 1SFLA 3PM6A 3RNDA 4XKYB 1XC4A 1R2SA 2X1UA 4CNPA 3L66A 1K8ZA 2PRHA 2EKCA 3O15A 4O1BA 3LBCA 4O16A 2YW3A 2RH9A 3W74A 3W7MA 3WK0A 1TMHA 4UTHA 1AL8A 2ZQ0A 5AB3A 3CEPA 3VE9A 3UZJA 1QWGA 5K9DA 4ZL1A 4TMBA 2W6RA 3ZFHA 1W5NA 3VI2A 5DCDA 4ICNA 3TAOA 1TRIA 4NJJA 1ZHAA 3CTLA 3QMSA 4I7UA 3C61A 3LTYA 3NA8A 1ME8A 3W7EA 2NV1A 4IGHA 3EXRA 1QPNA 1VH7A 1LOQA 5K4XA 3QYQA 3GNNA 2QCMA 4FX8A 1R30A 8TIMA 2VFHA 1OHLA 5F4SA 1Z41A 3THAA 4BF9A 1W1ZA 2R94A 3NVTA 2NLIA 4E2BA 5F2IA 2EHHA 3GKAA 3MHGA 2NWSA 1A53A 1RR2A 4ZZ9A 4I7VA 4UTKA 1Q6QA 4JGDA 1W3IA 4MFDA 2CWNA 3HBLA 3E96A 1F76A 1Z44A 4WY0B 5G5IA 4OV4A 3ZWSA 3NQGA 3MP5A 1L9WA 2A7RA 4M6QA 4JTSA 1H1YA 3V1PA 2X1SA 3OVPA 4UTMA 2ZTJA 1DVJA 5DCEA
chains in the Genus database with same CATH superfamily
2QUUA 2CZEA 3HQ1A 4O0KA 1VYRA 4QP0A 2BG5A 3I68A 2VR4A 4TX8A 1W3KA 3NQVA 1QMLA 4WD0A 1V0LA 4IMFA 2JK2A 4A3QA 2GJPA 5FJIA 4DBSA 1GVYA 4S3KA 3EX6A 4PEKA 1LT8A 2PDWA 4IIFA 1QNVA 1FWWA 4AAJA 2BHUA 4GIAA 3VUPA 4AXNA 1EDQA 5LIWX 1IT0A 3GAYA 1IR1A 1EO7A 1CDGA 2PLMA 1M9HA 1FH8A 3HURA 3UFYA 2Q8XA 3OVRA 2BY3A 4HCLA 2DGAA 1J10A 5CJNA 4FPSA 1TV2A 2WMHA 2XUCA 2Y2WA 1LOLA 3MSRA 3GR7A 5AC5A 2EF9A 3DHDA 5HNRA 1FHVA 1CTNA 1T8QA 3Q67A 1BGGA 2E28A 4P7NA 3BICA 2WM0A 4DWSB 3N14A 3AI0A 3ICJA 4LYKA 3N17A 1VR6A 5C9ZA 5CZTA 2OZ8A 1W5PA 3PHAA 1OADA 1QXLA 2R1LA 3SGUA 1QFEA 1LUCB 1VKFA 2BY0A 4L9XA 1CXHA 3IAQA 4MOZA 4AG0A 1WE5A 2QJNA 4AEFA 4A4AA 5TNVA 1IZKA 4J4KA 5JU6A 4DX3A 1FWJC 5LHEA 1GPFA 3S42A 1PZ2A 4XBKA 4EKJA 4FR1A 1U5HA 4C7FA 1MVYA 4MWAD 3GG7A 3UZZA 1POJA 4C1NA 1KO0A 4NZ1A 5H91A 3DKLA 1DJWA 3U4FA 3TW6A 2EGZA 2A21A 3EDDA 3W7JA 1Y5WA 4HHPA 4DZAA 1J0YA 3FOKA 4GX9A 2R6OA 3VNJA 4L4MA 3UZWA 1JDCA 4ZMGA 4AWUA 3I3EA 3KCLA 1M01A 3UPMA 3XISA 3UXLA 4C5ZA 1OFEA 3VOIA 4ZQPA 5HDRA 3LGGA 4IP5A 4A21A 1QNSA 2VOMA 4B4FA 3I65A 1Q3NA 3N2XA 2VJXA 2C6QA 3T4WA 3H7RA 1FWDC 1X7FA 3PG8A 3TYUA 4PUJA 5FEZA 1UG6A 2I17A 1HT6A 2F6KA 4PODA 3WELA 3RFAA 3G1XA 1PTAA 1I75A 1XRTA 1AUSL 1BVNP 1QNRA 4C6JA 4CCCA 1GVRA 3WNPA 3NSMA 4X3ZA 2GLKA 1G01A 1YW1A 1OCBA 1DOSA 1W6TA 2I5GA 3UG8A 3H22A 2HROA 2B31A 3SRDA 3M0YA 3TLQA 1WXYA 3KZPA 4L80A 1KLYA 4AF0A 4L65A 3RHGA 2ZRZA 4C6EA 3M0IA 2VGIA 3TOPA 1YHTA 4FNTA 2C3ZA 4KMQA 3V16A 5AHLA 4QHRA 1G4SA 2KAUC 2QT3A 1PS9A 3QHMA 3LHYA 1B3XA 3GR4A 4R3UA 4W7WA 3GG0A 3COTA 5JIPA 4IMAA 4IWWA 5DMLA 1SZGA 2X1RA 3VKDA 4QROA 4O13A 2E67A 3RXZA 3OIHA 3SR7A 4UBPC 3KDNA 2OLAA 4JTFA 5E1QA 2I9UA 4L7ZA 3ABQA 3UGVA 1KGWA 1OC6A 4C1KA 4PMOA 1PTDA 3AROA 2J9XA 5FD0A 2GVLA 4FALA 3B0PA 1R3WA 3GFYA 1IGWA 3CH0A 1YDNA 4ADUA 4WKFA 2X30A 3WNNA 4EP8C 4JZ5A 2OU4A 4L6DA 1XDJA 3IUHA 2OGJA 5I07A 2E1WA 2CNCA 1BPLB 2BOFX 3QMRA 2D3NA 2CESA 4BQ2A 1K4HA 1JZ3A 4F0RA 5AN7A 1PCKA 3B8IA 4Q4SA 4JD4A 4AZ5A 3GBEA 3EB3A 2VEKA 1W0MA 4IIEA 4YTSA 1GOMA 4OOZA 3QR1A 3IIOA 3GXTA 5J5DA 5CKSA 1UWTA 3QHOA 1DYSA 1I60A 2AL2B 2PLJA 3ITVA 2IQTA 2WO5A 2TSYA 3VKKA 4WDWA 4RNIA 4UFKA 4K8GA 2R9RA 3RUBL 3WQWA 2BGSA 1FFRA 1LJYA 3DG7A 5IDZA 1KBBA 3LUTA 3UYCA 4J3XA 1V3LA 2AQWA 4M7SA 4FS9A 1F74A 1G1YA 3W07A 1V6WA 3DHUA 1KQYA 4BR1A 3TC6A 1QCWA 5LIKX 3LM7A 2ZX8A 3K30A 1PWLA 5LNRA 3ZS4A 2WHKA 4ADTA 2EG6A 3JW7A 1W91A 2OEJA 4AWEA 2VR2A 1UJQA 4BQ4A 2BMBA 3OPSA 3ABOA 3KXQA 2BV9A 2VX4A 1IZJA 1OT2A 1VC4A 4AMAA 4IX2A 2B7NA 4F8XA 2E6AA 1E5JA 1XH1A 3F4DA 1EYEA 2QS8A 3LCGA 5BXPA 1JUBA 5HK4A 1P6BA 1WOAA 3N2MA 2J47A 4UFIA 1E4MM 1Q6LA 3W24A 3QSRA 3L2LA 3FDGA 2ZRYA 3UVAA 2ZDRA 2CLKA 1NM9A 2J25A 1VHNA 3LHUA 3U7BA 3HJEA 1G0CA 4ZOBA 1XIJA 1NEYA 1R6WA 3GU2A 5DLCA 1QASA 1O7AA 2QW5A 3UY7A 1FQ0A 3CQ0A 5LIUX 1WCGA 1XLFA 2OEMA 3L4XA 4ZXOA 4DBWA 1NP2A 3RM4A 4PCSA 3T05A 2NQHA 4UFHA 1TTPA 3LS9A 1V6VA 1VEOA 5GJPA 3APYA 1C91A 2VX7A 3FIGA 1Q5MA 2ZZ5A 4P7OA 4G8TA 3MPGA 1P1XA 3HG4A 2CZDA 4WHBA 1DKWA 2VTFA 3R79A 2ZXDA 3A64A 4UXDA 1GOKA 2W3ZA 1HKJA 3WUGA 2Y8VA 2Q09A 1FFQA 3RF9A 3TC7A 1S5TA 3LPFA 1V6UA 2XN1A 3VNDA 2WKLA 4CU6A 4YU1A 1MEIA 1NARA 4MAZA 4GX8A 3AIVA 2QYGA 3A4WA 2CPUA 1WV2A 3FY1A 3P67A 2H90A 4S3FA 3NO3A 1TJ2A 4NG3A 2CC0A 1FBAA 3GIYA 3BCDA 4PH6A 1Q6RA 3STEA 1CENA 2J7BA 5FL1A 5AHNA 3P8IA 1KLZA 2E8ZA 3TOYA 4D71A 4GY7A 1HP4A 4E4FA 2PDBA 4B5VA 1TFVA 2PFHA 3JZEA 5ABEA 3WLKX 1W1VA 4A3UA 4PYSA 1GK8A 5D33A 1EP1A 5BRPA 3WNKA 5KINA 1ITCA 1GQNA 3WLHA 1QUMA 4MYXA 4R33A 2RHGA 4B91A 4BS0A 5M17A 5AYZA 2GOUA 1GYLA 4LS2A 3CS2A 1QPQA 3P5ZA 4AVNA 3WCZA 3M07A 1QWKA 3NWRA 1POKA 2RJGA 3W2MA 2DT1A 1FDZA 1RCXB 4HIBA 5FESA 1QOQA 3OHMB 4LS1A 2CYGA 3ZJ8A 3W1AA 4QCEA 3E2RA 2WC3A 5F4XA 4GBUA 3PBVA 4U4MA 2E9MA 4ZCWA 3T44A 3CHCA 3UR8A 4BKNA 1QW8A 3S1WA 2VCCA 2HMCA 2WPBA 4ZO9A 4DEFA 4GC4A 3SCOA 1TTQA 1QK2A 2UY4A 3ATZA 1OVDA 3BAYA 1RUSA 3OLEA 3MKKA 5CZSA 3A6OA 3IANA 4W9TA 2OZTA 1OG0A 4HSNA 1D2KA 3A23A 7REQB 1PCWA 2QXWA 3GTFA 4PSPA 4FF5A 4S3GA 3BQ5A 2Y8UA 4GC3A 4HOXA 4DM2A 3OZPA 3KOZA 4W87A 3LD5A 1ZLPA 2PTXA 4QLKA 2GGGA 1AZ1A 2ZCGA 2WWDA 4BZYA 2YFNA 1GTEA 3PBWA 1AL7A 1JCNA 1M03A 4H2CA 3GE7A 3B9DA 3CBWA 4M56A 4JYDA 3NZGA 3WUFA 2OKOA 5D32A 3URQA 1NDZA 1VS1A 1TJ0A 4TVUA 4JPGA 1UD8A 1HG3A 3B9NA 1OGSA 4W88A 4F0KA 1WAWA 4HN8A 2NSXA 3IVSA 4JTIA 5CPSA 2P8BA 1XBXA 1WZKA 4LFYA 1K8CA 5K3VA 1UH2A 1UD6A 1WZAA 5FACA 2PF8A 2PI6A 1EBGA 1BKHA 4DPPA 3TONA 5I09A 1UA3A 2YXXA 3T8LA 4ZTXA 1HZYA 4JOMA 1JCMP 1E6XM 3I3DA 4HYWA 1V02E 3G1YA 3ZM8A 4EE9A 3SDOA 3CB3A 4PFHA 1EF2A 4JQ3A 3W2JA 5G1TA 3W2LA 4J35A 3KCJA 1GEQA 4O12A 5I03A 1DXFA 2J66A 3HB9A 1UP3A 2V82A 1NJJA 1AW5A 2VZUA 1K8XA 4Q3MA 3I7SA 1E5NA 1M7JA 1DHKA 3O16A 3FDKA 2ZX5A 3BAJA 3TW7A 1A0DA 3W83A 2YXOA 4Z17A 4MZ1A 2WZTA 3PZTA 4D1JA 5CC6A 2V0TA 1C9WA 2OCZA 5DRIA 4TR9A 2PB1A 3W2NA 1MDRA 2Z1BA 4N9BA 2PGEA 3UU0A 2G96A 4DB7A 1FUYA 4QQ3A 2Z1VA 3F5KA 3FJNA 4IJBA 4JIQA 3GXFA 5B7ZA 3U9IA 4NILA 3OP2A 3WENA 3UPWA 5AOUA 3NPVA 3FYPA 1TIMA 2ZRWA 3IPWA 3TN6A 1AA1B 1LL7A 2XSXA 3PPCA 1HX0A 3LRKA 4WOZA 3KBVA 4DI8A 4C90A 4LVFA 5BWAA 4PGLA 2ZZ7A 4KETA 4JHZA 2GYIA 1EJSC 1VPYA 3EEGA 3S0CA 3IJLA 3AO0A 1MRAA 3C6CA 4LVAA 4V27A 1QBBA 4TU1A 1G7VA 4JTAA 1B3OA 1O5QA 1K77A 3FAXA 3Q58A 3GZAA 3BSHA 1WDWA 4ILSA 4UQAA 2W62A 3A3WA 1DE5A 3C8NA 5EB8A 4E8DA 3CZLA 5FI8A 3QYSA 4H41A 4ZOEA 1J6OA 5REQB 3U5UA 4JTJA 4RE2A 3EOUA 3AIUA 3C86A 3RJYA 1XI3A 3EMQA 4GUJA 4WGHA 3CLMA 2HVNA 3F4NA 3WLRA 1EBHA 2YB4A 1SR0A 3QKZA 4OBSA 1YTEA 4GABA 2XFFA 5EA9A 4MB5A 3PR2A 1K4GA 3PZGA 1ZY9A 3GWQA 3UA4A 1EB3A 3WF1A 5CH9A 3GDKA 3ZZ1A 3KFTA 3CWHA 4AWSA 2VURA 2SFPA 4ZOAA 3NM1A 1RBAA 5I3DA 4INFA 4LPCA 5I79A 3RX4A 3KOFA 3CU2A 1S3TC 4JN7A 3HQNA 3W27A 4GOAA 4AX7A 1VBJA 2XVKA 1OX5A 1L6WA 3WQFA 1Q6FA 1R3QA 1TZZA 4CN4A 4JTUA 3NL5A 4U10A 5HJYA 1F6KA 2OELA 3EDKA 3SCWA 3E38A 1U1HA 1ZJHA 2BX7A 3DYMA 1TR9A 5DMYA 1V6XA 3GS6A 1R38A 1G67A 1L8NA 4MNLA 3TWAA 4GO9A 1HL9A 3QW3A 3M16A 3M4HA 3N6JA 3T2QA 1CXKA 1VLIA 3DYOA 2DORA 3IV3A 2VWTA 4I6VA 2HQAA 5DBTA 1B3ZA 2BSLA 1HKIA 3IUIA 3G8EA 3CT2A 4ONVA 4XAPA 1TPVA 3IVTA 1VPQA 1J5TA 1PZ3A 4X2PA 2Q01A 2RUSA 1DWJM 4MDOA 3C56A 2VKZG 3WLLA 4US5A 1PX8A 5IFPA 4LF1A 1PSCA 4Q8WA 1YBQB 3EWDA 1E4IA 2E6DA 5BNKA 4C6OA 3T07A 3NO5A 3H70A 3LU2A 2WNWA 3B97A 2XIJA 1U5JA 5LA1A 2GJXA 3UWEA 1QAPA 4K8EA 3L4WA 1XYLA 3S9IA 3LCLA 4MLRA 3RO8A 4RX0A 4XTDA 4DRSA 3CNYA 4GZJA 4QE1A 2Z29A 1UD2A 4AIEA 3O6CA 1BAGA 1VIWA 3FHAA 4QG8A 3IACA 1YNQA 3JRKA 1BGAA 2BTMA 4QCFA 3TR2A 1EQPA 3KW3A 2A3CA 2FJKA 4NKCA 1MRQA 3LXCA 1I2PA 3N4EA 4US6A 4RE3A 5CPTA 3VE7A 1ZS2A 3OW1A 4AZCB 1XCWA 3DECA 1YX1A 2Z6JA 1ZRQA 4JAWA 2V81A 4B90A 1TPB1 2JIWA 4AD4A 2WSRA 3KUMA 4O28A 5G2HA 1H0IA 3V5CA 2YZ5A 2PP0A 3QXBA 1F9CA 1VLWA 2XFYA 3AICA 4RNJA 1U2YA 1A80A 1JZ8A 2QIWA 2GVGA 3TXVA 3O6YX 4PA8A 2WMJA 2EPKX 2PDXA 3IVUA 1IXNA 1K03A 3QPZA 1GNXA 1K7XA 2A4AA 3WQOA 4GKLA 2HVOA 4RKAA 2JBMA 4PTWA 4XK2A 2PF0A 3LK6A 3WBXA 2GGEA 2OG9A 1CB7B 5D38A 2O9RA 4W4QA 2J75A 4AHQA 3LPPA 3WF0A 4KRTA 1DTNA 3BLLA 1MUCA 1MUMA 4P7LA 4UFJA 4NF7A 3DC0A 2YBUA 4O1FA 3T78A 1XLHA 4PB4A 2P3EA 1R46A 2XVLA 3MUIA 4MB3A 1OCQA 4YJ5A 2Q6ZA 3CUZA 4DAIA 2ZZ2A 3QZAA 3TFXA 4IQDA 4BQ3A 3UY8A 5DFAA 1NU5A 3IJIA 3OBEA 4YMZA 1UYQA 1UZHA 1XYFA 1FWIC 3GDRA 2IQDA 3WLSA 1K9FA 4B4HA 2QCCA 4O8AA 3N4AA 1UBSA 2X7WA 1YNYA 3H2AA 2IPWA 3BLDA 1X96A 1XLLA 2XIOA 5DXXA 3SSJA 3W7PA 2Z4GA 3O0KA 2QULA 3BG9A 5D2TA 2YA0A 1ZCOA 2CHNA 3BZGA 1BYCA 1GZ1A 4E4UA 1FKXA 3CAQA 2EG8A 4N02A 4L61A 2IPFA 3D3FA 4L4PA 5A3HA 1C90A 4CGTA 3ARVA 3E49A 5A6TC 3H54A 4IF2A 5DMMA 3UG3A 1JULA 2ZUVA 4BQ5A 3MWAA 2VWSA 4BWLC 4XZ9A 3ZLFA 5HNTA 2DZVA 4LGXA 4M7TA 4Q8MA 3CTTA 3RCMA 3BJTA 1EJVC 4ROQA 4CD6A 3QJAA 3SCVA 5CSUA 4EPEC 1PPIA 5AC6A 4MDPA 5D8ZA 3E9AA 3EX1A 1BSIA 4S3AA 3TSBA 3N2BA 2XSAA 4Z42C 3W7DA 2WCSA 1FWCC 1EPXA 3APGA 2FYMA 4EXBA 3URAA 2E6FA 4JTTA 2CZVA 4Q8VA 2VMFA 3M5XA 4HU0A 3SADA 2W0UA 1WZLA 3THQA 1HTIA 3APTA 5EMUA 5FAGA 4AZBA 4YCOA 4ZO6A 1LQ2A 4KEVA 3A22A 3B0VC 1B3VA 4KBXA 3T0TA 1OFOA 4HMCA 1YTKA 3EOSA 1XCFA 4DNMA 4HNLA 1FCBA 4UTJA 1PYMA 2CHOA 3NXLA 4E3VA 5LKYA 3E02A 3C0QA 2V6AA 3ZYZA 2FPYA 2DH3A 4RZ6A 2NXGA 4DYKA 2GSJA 5CLTA 3SEPA 5GNYA 3ONBA 4JX5A 3CAWA 2D0FA 3N19B 3WJZA 1NIUA 4ERGA 1OK4A 4NIRA 2P1FA 3O06A 2UZ9A 2IMRA 1U33A 3SCQA 3W29A 4AVOA 3OG3A 3V1HA 4PCTA 8XIMA 1XIHA 2XWEA 1PAMA 4JFTA 4HU4A 3EA2A 4WEVX 2Z2AA 3U2ZA 4ES4A 1E9ZB 3C2FA 2GPTA 4KF1A 3GVVA 5D9NA 3GY1A 1V3IA 3NURA 4TTGA 4Z1AA 1NWTA 1R5YA 2D0GA 1R7OA 1XYMA 1DWAM 2F38A 3WF3A 3KE0A 2WOQA 4K7VA 2WV8A 1SM9A 1RBLA 1L6FA 4J3VA 1O60A 2IPGA 1R85A 4ZGYA 4UCFA 3B05A 1J0ZA 3PBYA 1LL6A 1NTHA 1VFUA 4EACA 4UTUA 2HXTA 2A1YA 2WBKA 4PMNA 1ZFJA 1V77A 2ZZ1A 4JYEA 3UZ5A 3AMKA 1LRNA 3LCIA 5JBFA 5GQBA 5A6KA 3OVGA 5LHFA 2PDFA 3BTNA 3TN4A 2EKGA 4YYFA 2FKPA 4WJ8A 3VGBA 2V69A 2YZRA 2QF7A 2ZOXA 4NAFA 1OQFA 2TRSA 3VGEA 3N6QA 4RUBA 3WEOA 3SJNA 2PLCA 3B03A 4RR4A 4DBUA 4GINA 3FSUA 4H3DA 2JKEA 1KNWA 4D1IA 4O11A 4KKXA 1ZBWA 3PTMA 5HUPA 4QG9A 4LEFA 1DP0A 1P48A 1XLKA 3GNXA 2VVSA 3S1VA 3EOEA 3HM7A 3LBMA 5K4ZA 3LLXA 3S2LA 4CU8A 2BVDA 5FEPA 3WJSA 3WQEA 4CNNA 2OKTA 1EDGA 2ZA1A 2XIBA 5PTDA 4F0HA 3K4WA 3DGRA 3S2JA 4GIYA 4NVTA 2YL8A 2G4JA 5JQ9A 3HMCA 2WBGA 3HTWA 1TQJA 1EHAA 4Q4QA 4GNJA 3VA8A 3BANA 3MO7A 1ITQA 1DQUA 2BGNE 3ITTA 3PANA 2KZHA 1DXIA 4LUIA 1TVLA 5JXQA 1SSGA 5FF4A 3G18A 3WD1A 2J88A 3QY8A 2HBXA 2WSQA 3HPZA 1QJWA 3ITYA 4D6EA 1MO0A 1VRDA 5F2GA 3K8MA 5IFTA 4XZMX 4FAMA 3TA9A 4KWVA 4HA3A 1LDCA 2J8TA 2XH4A 4H00A 2G3NA 1Q7ZA 2BZNA 4CQAA 5U4NA 1RQEA 3Q45A 1U30A 2YDQA 1UZ1A 5E0CA 1KFCA 1WXZA 3AS3A 2CLPA 2WJZA 1BQGA 3VGHA 2Y62A 3NPUA 2PDGA 4XKYB 3AU6A 3KS6A 3JVAA 1XH2A 4GIRA 1C7SA 4IICA 4GQGA 4PULA 3RCYA 1Z32X 5KEZA 3WK0A 1TMHA 2ZQ0A 5ENLA 3RAOA 3W00A 3UZJA 1QWGA 4ZL1A 4XAYA 2W6RA 3H26A 3ZFHA 1W5NA 3OODA 3VI2A 3QGVA 4ICNA 1X97A 3TAOA 3UXIA 1TRIA 2AAAA 2ZUNA 3C61A 3LM3A 1GONA 3ERPA 1E55A 1ZBCA 1MW3A 4RV3A 1QPNA 5K4XA 2OWXA 4FX8A 2NT1A 2VFHA 4IFKB 5F4SA 4BF9A 2R94A 3GRIA 2NLIA 2HV5A 1F3XA 3GKAA 1JYNA 3ID7A 3GM8A 3MHGA 5CXPA 1J0IA 4F9JA 3G2GA 1E0XA 5CQ1A 4GK8A 4MFDA 4DXKA 1VF8A 3HBLA 1O66A 3NSXA 3E96A 1F76A 5CJ5A 4GO8A 2PZ0A 5G5IA 3QKEA 3NQGA 4GJJA 2X0SA 1YE6A 4YTTA 3RJXA 1QVBA 4DWSD 4W85A 1AQ0A 1WO2A 4GG9A 3GC5A 1D8CA 1J0KA 2QVHA 4XZLX 4IPPA 3MMDA 2XZ7A 2PTYA 4IG2B 2EPHA 2WNNA 4KWWA 4L1WA 4KW2A 1X8CA 1KWKA 4G7EA 2NVDA 2QJHA 1MW0A 4TUFA 3PC0A 9XIMA 1XS2A 2PCQA 5H8PA 2JEQA 3AIWA 3OA3A 4H9ZA 3EYPA 1E4LA 1H5YA 4QNWA 1LBLA 2QJJA 2PDQA 4CUCA 4BWLA 4DZHA 4Q8QA 4FLRA 3QQWA 2YYUA 1OFAA 1KW1A 4A8NA 4CLMA 5HBFA 4HNVA 3UQNA 4DXVA 2X42A 2Y63A 6ENLA 1Y65A 2A3LA 3EXSA 3OA5A 3HPFA 3G0UA 1D9EA 4TVDA 2DIEA 1R8LA 2EEXA 2WMGA 2PLKA 1RXOB 4ORMA 4JFVA 4OQVA 4QISA 1HNYA 4PMQA 3AHVA 5FJJA 4IFOA 5XINA 2CXGA 2E5DA 1PDYA 1LWJA 3R6IA 3H6OA 3QTPA 3WFLA 3FNDA 1Q8AA 5MF5A 1SU5A 3UWVA 3IIPA 2Z1SA 1BF2A 3CQIA 3CLWA 2H9AB 4XSLA 3H4XA 1DBTA 3C3UA 6XIAA 1J8VA 2GQ9A 3ARRA 3ZVIA 3BW4A 2R1NA 5EFFA 3VYLA 3P62A 3BE7A 5SWUA 2E9BA 2V68A 3CMFA 4LAOA 3U3HA 4HNOA 3NQFA 3BCJA 3BL3A 2VFDA 3CAKA 3O0FA 3W9ZA 1ZALA 4Q6JA 4IHCA 2O55A 2PBGA 1SO5A 2GUUA 3QPYA 3UJRA 2OWCA 4IL2A 1DXEA 1NWRA 5KETA 3L12A 2GJNA 4J40A 1HP5A 5CC7A 1OD8A 5E09A 1OF6A 1OF8A 5DBUA 4PMYA 1MZRA 4OT7A 4F0MA 3VIMA 3AHTA 1GOIA 1XRVA 3SSZA 1DWGM 1L8PA 2X05A 2WCGA 4M81A 1TA3A 1CXFA 4C6FA 4KCUA 3NQ8A 1T7LA 3QZ6A 3MUY1 1W5MA 3I4EA 3VZZA 3SN0A 3CUGA 2NX1A 4TX9A 4DF0A 3U8GA 3M44A 3RRAA 3T7VA 1MI3A 5HMDA 3DZ1A 4UB9A 1BVZA 2HK0A 1SYTA 5D04C 1UMYA 2V2DA 3ARQA 3AYVA 1YE4A 3RPMA 1GEHA 2OQHA 4XD4A 2PDCA 1PO9A 3FV9A 4JIEA 1OABA 1MNZA 2DZAA 2A3AA 3SB0A 2DH2A 3ZR5A 1XISA 2Z1WA 1UR1A 1KBLA 1W1TA 3WQPA 3VNLA 1SW3A 4WK9A 3PFMA 3W25A 4IMDA 1G4EA 3MW7A 3KRSA 3ZSTA 4QS5A 1XRFA 3EB2A 2GQ8A 4QDMA 5I06A 5L6UA 2NQ5A 4G5DA 2C13A 3L21A 1NOFA 1DIEA 3IIZA 3WF4A 1UQYA 2WHLA 1BVWA 5DRCA 2X7VA 6A3HA 2AKMA 2HWGA 1A0EA 2DIJA 4JCMA 4HSHA 1XH0A 1MNSA 2DSKA 3TJXA 4B9ZA 1CGYA 2YL9A 3NZPA 4MUPA 1M65A 4QAIA 3GUGA 2DVXA 3EKLA 2VUYA 1E6RA 3QGAC 2BLEA 4W8LA 2OLSA 2GUBA 2XH7A 4CNTA 3W1NA 4ADSA 1MXSA 1Q66A 4C1NB 1F3EA 3DFPA 3WDJA 1E0VA 3W6MA 3MI3A 1B54A 4AZHA 5BCAA 1IYXA 3ANVA 1BRLA 1W5QA 3WLIA 1NWUA 3S5OA 1Y0EA 1Z42A 1JZ4A 1R3SA 4R53A 1VGAA 4OV9A 2J78A 3LXAA 3KDOA 4IX0A 4ZOCA 3PZUA 2DV0A 1OFRA 3LZ5A 2RGMA 1WBHA 4A2SA 2WZEA 4CQCA 4K8HA 1J0HA 5E9AA 3P7YA 1NQ6A 4C60A 1IIHA 1QT1A 3A21A 2JE8A 4X9YA 3T4CA 1A5MC 4JS3A 3WMBA 1AQMA 2FTYA 3VD3A 2A5HA 4QXIA 4IMEA 4Y8EA 3KOXA 3MV11 1DWFM 3QPEA 1C8VA 1UWRA 3WEZA 2OYKA 4PRWA 5AHFA 1AQFA 1QI5A 3FFSA 4H19A 1PIIA 4JNYA 3GFXA 4ZODA 2FZ9A 2WANA 2ZX9A 4Z2JA 3ZXWA 4C6CA 4QJ3B 1XP3A 2NVAA 3SUVA 1QI4A 4H6EA 3BH4A 4NL1A 3OVQA 4O4WA 1KFEA 1UBPC 2XFRA 3MSYA 4B2DD 2UBPC 3HN3A 2P88A 4FIRA 3RR4A 1JNEA 5CC3A 2Y70A 4O17A 1E6NA 4GNVA 4C65A 4AF0B 3U2CA 4MFEA 4CVWA 1W1A1 4E3TA 5T8GA 3AMLA 4J2MA 4XZIA 1GCYA 1R7AA 4YS1A 4RV8A 3RMJA 3VUSA 1XR2A 3G1FA 2X1TA 5EYWA 2QGYA 3AMDA 5FKYA 1K1DA 5ECVA 3H53A 4XVDA 4S2BA 1EZWA 3A9BA 2OQLA 3EWUA 3FYYA 2PWUA 3RM9A 3VMPA 4GYFA 3FVMA 2DT0A 1TJRA 3CHEA 1VEMA 2DZUA 1E0TA 1FRBA 1R2RA 1AW2A 1KCKA 2NQJA 1PV8A 1KXTA 3G1RA 4UWMA 5D02A 2VCBA 1GOWA 2GGHA 4M24A 1LBMA 1DQXA 1F61A 2DPEA 3TEVA 3A4XA 1DE6A 4U3AA 3C2OA 2DVUA 1PKLA 3PBGA 2YSWA 3R13A 3RLUA 1JG9A 2YBVA 5AC8A 5HWMA 3CT7A 4MB1A 3L67A 3T1GA 3TYZA 4JYFA 2EAWA 4NRSA 1X8FA 5KTLA 3S4TA 3TR9A 2DZSA 3TUUA 3LTPA 2XH2A 1IV8A 1GVQA 3PFRA 2VRKA 1V7YA 1J79A 3QFWA 2C18A 1A5LC 1XIBA 3BAWA 2B81A 3SCNA 3DCPA 3W7IA 2PTWA 1Q13A 4L6OA 4GISA 3AUOA 4F40A 3Q65A 1K9EA 4RPPA 3NZQA 3CIVA 4HHMA 3GZ3A 2WVUA 4JX4A 4UOJA 1YDVA 4U31A 1YNPA 4Z1BA 4LBUA 4S38A 3TFCA 2QCNA 1SJDA 1WKFA 3WNOA 4HA4A 3SCRA 3OGSA 3D0CA 3GXPA 3UJ2A 3FW6A 1R47A 4EPDC 1CLVA 1WOBA 3F2CA 1J93A 3DFTA 1KXHA 1QNOA 2A3BA 1FCVA 1Q2RA 2XZ9A 4JN6A 3SIZA 4DO7A 4LXFA 5EBUA 1A5SA 1PTGA 5J8LA 4PBGA 5E93A 4W84A 4WX2A 2V2CA 4X9SA 4IL0A 5CPLA 1HO1A 2PC8A 4LUYA 1Z6KA 4Z2KA 4A3HA 4S1FA 5I78A 4UMCA 3N2OA 3W6LA 3CPRA 2Y5JA 1YDOA 4LRTA 1TPUA 1F2JA 4PBEA 3CZKA 1NFGA 5CEWA 4ATWA 5FSDC 2I57A 2OX4A 1WUFA 4PMZA 1TO3A 1JAKA 4RJEA 5HR7A 3R11A 2WZIA 2CBJA 3PG9A 2HK1A 2VGFA 3UBPC 4UR7A 3OG2A 1UD3A 5CSRA 3L0GA 1BFNA 2RGLA 3AU2A 1Q6OA 2X09A 4OZOA 2X2YA 3IUDA 2XGBA 4UTLA 1ZP3A 3W1QA 3WSUA 3ECQA 5F1UA 3D47A 2V5DA 1U1UA 4Z2HA 1BTCA 3MJYA 1AK5A 5DANA 1LLOA 3W82A 3JZUA 1UR2A 3UWUA 1MFUA 1Q4NX 4O50A 4A35A 3EDEA 3T6CA 2QAPA 2OWWA 3REQA 4LVBA 4PUNA 5I3KA 1ADOA 4J3WA 2W27A 1EXBA 1V6TA 2IW0A 3PZMA 1BSLA 1AD1A 4FNUA 5EBAA 5HPCA 3MCMA 1G69A 1JYXA 2J7GA 1UP2A 4K36A 1JDAA 4EXAA 4XAGA 4Q7BA 5G4EA 3A3HA 1DJHA 2TODA 2V5CA 2XGZA 2GSEA 4Y7EA 1UWSA 3MP3A 3NNTA 4BJHA 4UZUA 3RLHA 4G1KA 3II1A 4PZVA 3WFAA 4V28A 1GOQA 1I0DA 2PD9A 2DSVA 3DFQA 4F0SA 2ONEA 3VDHA 1XICA 4QE4A 5C9UA 2IKHA 3NR0A 3USBA 3TTQA 1F6YA 1C8YA 1R3TA 3L7RA 3ZT7A 3IGHX 1M7PA 1TWWA 3W7HA 2Q02A 1ICQA 3CL6A 1A5OC 3MUCA 5CAHA 2J8GA 5C9XA 4KEZA 5J5RA 2FB3A 3B8UA 3O1NA 3TQPA 4LV9A 1GVFA 3PZVA 4ECLA 4V1YA 1RPKA 5ABGA 4AIBA 2X1IA 4MSSA 2HVMA 1C3FA 5JBDA 1TWDA 4NZFA 1P5BA 3D46A 4H01A 4LWWA 3LA4A 4RE0A 4UTWC 3T42A 4Z1CA 3P0XA 3NYDA 2V5JA 2O92A 4H2HA 2ZUTA 2G3MA 3P74A 1XGZA 2FDSA 5TIMA 2Y89A 4DN1A 1UZ4A 3L0KA 3WK1A 2E0PA 2HS6A 4ZXLA 4JL1A 4AHPA 4O10A 1RVGA 4I90A 4ZQOA 1MQQA 1P6WA 3G22A 4Q22A 1HKKA 2QZRA 3R4IA 1ZB5A 3UCQA 1VPXA 1PZ0A 4G7FA 5C0QA 1PKYA 3B40A 3MSGA 5A5WA 4WZHA 3ANYA 5BROA 2CERA 2XU2A 1C8XA 3B9EA 3AIRA 1C92A 4LYRA 3TTSA 2OZ3A 5KMYA 4TXEA 2XDFA 3M0ZA 4PC8A 3ZVHA 4UFMA 1Q8JA 3AMGA 3PNZA 1FWRA 3P14A 4O15A 3V75A 4AC7C 4E2VA 2D3LA 2E5CA 1AD4A 4GY0A 3AC0A 4B5TA 1HJVA 1BEUA 1FWAC 2WVTA 1X6UA 1GVEA 3G0XA 1Q7MA 2EBNA 1TV5A 2HS8A 1XKJA 1CGTA 4BFAA 2QPXA 3KBNA 3AOFA 3U0HA 2CLEA 4DYEA 3IGSA 3WH7A 2G8ZA 2OGYA 3TV8A 4MZ8A 3G6LA 3PZNA 1KM6A 3W81A 4GVHA 2ACSA 3MMTA 3OQEA 6REQA 4XSMA 3QOMA 3NQMA 1OBAA 4Z2IA 1TPFA 2CCRA 4S3BA 3GHUA 2Z1XA 3UA3A 3ITOA 2VGBA 2ZVRA 1CLXA 3VD5A 1UD5A 2G0WA 1X6LA 4NRRA 4U28A 4OBRA 3W0KA 2DW7A 4JEJA 1QHOA 4GIEA 5E5CA 3P93A 1JZ7A 2REQB 5IHSA 3GH5A 3FEQA 3WD0A 1DIDA 4Y96A 3HG2A 3LMYA 2W4XA 4L9YA 4QJ4B 1KV5A 3TE9A 2ISWA 3V35A 3WBYA 2PP1A 3HJZA 1OZQA 4EAMA 4JTLA 4F2TA 5HMFA 3GTXA 5D03A 4O1DA 1SFSA 3G24A 2VEGA 1H5VA 3DFOA 1E43A 2OX1A 3L4VA 3UXAA 4UTIA 3SUTA 4AEOA 1Z48A 3GXDA 1UCWA 2AMGA 3W70A 1TTJA 1CGUA 2I5QA 2C16A 3AJXA 2Z6IA 1BXBA 3ARWA 3KVLA 1O5XA 2VX6A 3BLKA 1KGXA 1XWYA 4P7QA 4W5ZA 4QIUA 2XM2A 4B5UA 3OU8A 1GZGA 2DZWA 2QDEA 3ABSA 1ISZA 2WKGA 2FZDA 1VFMA 3SY5A 2VI0A 3W1TA 3WQDA 2YDSA 3RRXA 1FCQA 3TZNA 1EJXC 4QM1A 1VB9A 1EXPA 3LHZA 3CB8A 3DEQA 1NFBA 1ALDA 1XIEA 1HL2A 4RDZA 2PAJA 5FIPA 3WQ4A 1OCNA 3AIQA 1F7BA 3D6NA 2Y88A 4PMVA 5IDIA 2D2GA 1XYCA 2Z27A 5LA0A 5K9XA 3LQLA 1UUQA 2INEA 1PL9A 3TAKA 2GZXA 2PD5A 5DT5A 3AUJA 4B15A 1E1CA 3F4CA 3C0JA 3LNMA 4UOZA 2LLEA 5F2MA 3GYEA 3TQVA 3T9PA 1HUVA 1EX5A 1RP9A 2Y24A 3GD6A 1P43A 3KWXA 2QMKA 4UCGA 2Z26A 2F61A 3GG8A 3SCPA 4IIBA 4TIMA 4U2ZA 5CJMA 2NXHA 5LGXA 3ZO9A 3BAIA 1WKDA 2WB5A 2TMDA 4IP4A 4AZ6A 3STCA 1DEDA 4M6UA 5H8UA 1EF3A 2ZUWA 3VMOA 2POTA 1Q65A 3UXDA 1KQZA 2ACUA 3CASA 4PMUA 1AG1O 1N8IA 2A7PA 1A47A 3GUWA 2QF8A 1TQXA 5MKGA 2FTPA 5DT7A 4HU3A 2VC5A 4YTRA 3LLDA 3LRLA 1JJKA 4K2SA 4MF4A 2PS2A 1TZ9A 2X41A 4GD0A 2VC9A 3Q94A 3CHFA 3S5ZA 3CIXA 2ZICA 5CAKA 1KRCC 3PPHA 4UZSA 3W1LA 3VZYA 1VFHA 2OT1A 3TW9A 3T8QA 4Q33A 1US3A 3ENLA 3VVGA 3WIJA 1NOUA 4K37A 4POCA 2F7FA 3ME3A 1JYWA 3PBUA 3W6YA 5D09A 4ZB2A 4DZIA 2CFFA 3WLMA 4KWSA 1IEIA 1SZFA 1HJXA 4RPQA 2YPIA 3TP4A 1TELA 3NDYA 3KVMA 4W89A 3KL0A 2VRQA 1OSEA 2WMIA 3A5FA 3GSMA 1EGZA 1EYWA 3W73A 1JDFA 5T9CE 3OQ8A 6TAAA 7TIMA 1WX0A 3ARXA 3M0MA 2ISFA 4RW3A 3TA6A 4OVXA 4QNEA 4ENLA 1P0DA 1V3MA 1LYXA 4YTUA 4HNUA 2W66A 4REQA 1BG4A 5TD4A 4H9TA 3H4WA 3EMZA 3MMWA 1F3TA 4ZENA 5A6AA 4JQ2A 4ZQCA 3CC1A 3C0LA 1M1BA 4DJEA 3CPUA 1HKVA 4DNHA 5LIXX 4FOKA 1AVAA 3YPIA 5C2GA 3AAMA 5E9XA 1RCQA 4MHBA 4CNOA 2G5WA 1M68A 3CH9A 3PWAA 4DUVA 2RAGA 1RA5A 1EUNA 1AW1A 1UH4A 3IIVA 3GO2A 1L6SA 4C6PA 3CHVA 5XIAA 1ZAJA 2GWNA 2DQXA 4BA0A 3GNPA 1J9YA 4RE4A 3MU7A 3KBMA 3HMJG 1CNVA 3BOXA 4UQ9A 3M5ZA 4JN8A 3P3BA 4YXGA 3H23A 2B7OA 2J4GA 3EWZA 4Y9PA 3TNOA 1KWGA 3EDJA 2GJXB 1OM0A 4H6KA 2Y0FA 3F4WA 3N13A 1XSKA 3QLLA 1OY0A 2R1KA 4UTWA 2BVYA 4JTEA 2V30A 2P53A 2WNQA 1O68A 1PHWA 1R0MA 4MWAC 1XX1A 1DJYA 1TJPA 4ACYA 2VFFA 4NNBA 2VZOA 3NQ6A 1JXJA 2UY5A 4PTXA 1VAHA 1LWHA 2ZE3A 5F1VA 2OEKA 4UOQA 4B5XA 3RU6A 2GDUA 2ISSA 2WLYA 3ITCA 3RCNA 2V5BA 5HINA 2ZUMA 4QX4A 3CXOA 1X1ZA 2Y5SA 7XIMA 3FEMA 2PDIA 3DBNA 5C55A 4OKDA 1TV8A 1UD4A 2AGTA 3MWCA 4Y90A 2XG9A 4C6IA 2OFJA 4H8UA 1GQLA 1ZJBA 2POZA 1W32A 3V3WA 5AZ0A 4IPJA 4LB3A 7CGTA 1T0OA 2ICSA 4MVAA 5C7HA 3N11A 2OZ0A 3W86A 1ODUA 3NSNA 3R2GA 5JIWA 1H50A 1TPH1 3CEUA 1FOBA 2NSOA 3ABZA 3L4UA 3IIXA 1DJIA 2NT0A 3KZSA 3HFTA 1RQBA 2CU0A 4DJFC 3GH7A 3CUJA 2YR1A 1LG1A 4GE8A 2EXOA 1A4MA 5H8MA 1OFPA 1SPQA 5FJRA 2FVKA 2Y7EA 3DFYA 4EPBC 1Q6DA 3GR8A 1SUXA 4OBTA 1Y8BA 2Q8LA 3DX5A 5A1AA 4DJDD 1WDQA 5KZEA 2CLIA 3PB2A 1L2UA 3EWWA 4GY1A 3PBMA 3WD2A 1YMYA 4GI6A 3L2IA 3WUEA 5BYWA 4ATDA 2FHFA 4C6NA 2NVCA 4JDYA 3URNA 4GFSA 3RX3A 4GGHA 3R10A 1RD6A 2IXUA 1FXQA 1CEOA 3M0KA 4NNCA 1UIOA 3UXKA 1ECEA 4XIMA 1WNOA 2IUZA 4DQWA 2FFCA 1YPFA 4JFSA 2Y7GA 4QSHA 4YHGA 2JQXA 4JXCA 1FHDA 1FDYA 1JCYA 4S3EA 3GVGA 4EIVA 5JUVA 1A3WA 1E0UA 1KXVA 3Q2DA 3UYIA 4IPIA 4N6FA 4GH3A 4LVGA 4HK5A 3VIFA 1E0WA 1TCMA 1I0BA 3VIIA 4I6KA 1DJGA 4GLEA 1ZAIA 2V5KA 5GPRA 3BV4A 2B7PA 3O07A 5DXYA 3K13A 2VELA 3TJLA 3P6LA 1HJWA 1QPOA 3EMCA 3VGDA 4B5SA 4UIOA 5C70A 4J28A 3T40A 1XD1A 2QCGA 4AB4A 1EX1A 1P0BA 1JRCA 3HU7A 5C6MA 2QKFA 4M19A 1S3HA 2TYSA 1EPVA 5A6BD 1EDTA 1RLCL 3TN3A 4GBDA 2RKXA 1NY1A 1AMYA 3UR7A 3CV7A 2CW6A 1JPKA 4ERIA 3IRDA 3LLFA 4MY9A 3O8AA 1SJBA 4JKKA 1X1OA 3CV2A 1UQZA 3ABRA 4K6AA 1W1IE 2NX3A 5CZJA 3VKAA 1KBJA 2JKPA 3VIHA 2FMNA 4PUMA 4YN5A 4Z0SA 5HA7A 5C8BB 2ZVIA 3VD9A 3S1XA 2VO5A 3OB8A 3TK7A 4KCVA 3TH6A 1IEXA 4QDPA 4LJ3A 3KLKA 4D2JA 3WDIA 4NQ1A 1T5AA 3LNPA 1XF0A 2W92A 3VKBA 3QMTA 3AZTA 3BQ6A 1JQVA 1SZNA 5HQLA 2BOGX 1EA0A 1X6NA 1EGMA 4GRSA 4KRUA 4FEZA 2XVPA 1CGWA 4R88A 3KCOA 2FGLA 5HXMA 1V0MA 4XD6A 4IGMA 1DORA 4WUIA 4K3ZA 3HQOA 4X0NA 1FTXA 1V03A 1TWIA 1MEHA 2OYLA 1JVNA 2R24A 2BBFA 2ZFAA 4X63A 2X40A 2BXZA 4I8DA 1Q6GA 2KX9A 3R7MA 4EAYA 2V8ZA 3L23A 3VPLA 2J13A 4N9CA 2I14A 3W1RA 4WDXA 3VOFA 3KX6A 4JL2A 4HYVA 5D37A 8A3HA 2FPTA 2EPLX 1RJQA 3HGJA 5ABFB 3GC2A 3IJDA 4PMRA 4HPJA 1ZQ5A 5IBXC 3B3DA 4XO7A 1KB3A 3G1SA 1PEZA 4H8HA 3THCA 3SURA 1CGVA 4F2BA 3BG5A 3RN6A 3WG6A 3NPWA 3R12A 2CITA 1WZMA 1V08A 3P61A 4N42A 5B80A 1IEQA 5A8GA 4P2VA 2A6NA 4AX6A 2EJAA 1FHUA 3IAPA 4IUGA 1SFLA 3PM6A 3RNDA 1XC4A 3E6EA 4CNPA 2PRHA 4CN6A 2GUYA 3AWOA 1CCWB 1VFOA 2DDXA 4S3DA 4A3YA 2YCJA 2BB0A 1QBAA 1EIBA 3NUKA 4UTHA 4XZWA 1AL8A 2Y1HA 5AB3A 1AJ0A 1GW1A 3VE9A 4NAFB 1GZJA 2GK1A 2F8QA 5K9DA 4I9MA 4IH3A 5LA2A 4TMBA 1REQA 4NY2A 5DCDA 1TG7A 2YB1A 3VFCA 1A5KC 1ME8A 2G50A 3URBA 3WFZA 4AIOA 2WZMA 4CN1A 2ZIDA 1UPPA 3A4AA 2CIPA 3QYQA 3UCDA 2ZX6A 1XSJA 8TIMA 5BZAA 3OLIA 3BMVA 2EPNA 3I3BA 1Z41A 3IWPA 3BC9A 3NVTA 4NAEA 4JIHA 5F2IA 3BXWA 5A6MA 1A53A 4WSJA 2Z25A 3VOCA 3OZYA 3H2FA 3VC6A 4JGDA 3GW3A 3W01A 4XISA 2CWNA 2CWXA 4XBJA 1WDRA 2BOEX 3UZYA 1MQPA 3MP5A 1X1NA 2CBVA 1L9WA 2FZMA 2W61A 3BCFA 1H1YA 3V1PA 1MDLA 3Q4DA 3GU1A 1DVJA 3LDVA 4CCEA 3C0SA 4AISA 4YIWA 3V0UA 3NQEA 4MWAA 3V7PA 2BHYA 3EPOA 5CSYA 3WLNA 3P8JA 1G5AA 1GKQA 4LUTA 4O0ZA 4FOUA 4HPNA 3KOWA 3VMNA 1E40A 1M53A 1R87A 1G4TA 1K3UA 1MXGA 3V18A 2O0TA 4GH1A 3W2KA 3PSVA 4L1XA 5HNUA 3S6DA 1HVQA 4LF2A 2I56A 2XH0A 3LYEA 3QQ0A 4GZ7A 3OYZA 1SJAA 4FX7A 5LGZA 1FP8A 4GI4A 5BWFA 3GIQA 5E0FA 4FSAA 2PPGA 1GVOA 3I6TA 1DTUA 1EOMA 1JNDA 4M82A 4FK9A 2GGJA 1PZ1A 1J2WA 1IXPA 3PTDA 1V51A 1GG0A 1M7OA 2VGGA 1EIXA 4GI9A 1B90A 4LYPA 4YCPA 4ASTA 2VEMA 3GIPA 1K6WA 4MB4A 1L0PA 5DN1A 3HG5A 3SM0A 2C19A 2DIKA 5T91A 4DJFA 2RDWA 1ONXA 4MMWA 3SJ3A 3W28A 2D2JA 2WKJA 1GKPA 3N2CA 2D2OA 4PUUA 5CPQA 3WH9A 3HO8A 5FF2A 3TX9A 4DJED 1E6SM 3VILA 2DT3A 3R8GA 3U2OA 5H2ZA 3BOFA 1THFD 5KZ6A 4PEEA 2PP3A 2CLFA 2GL5A 1W5OA 2D23A 5HUOA 3CV6A 2XINA 1NWSA 2Y61A 4AW7A 3MSDA 2OTDA 2G41A 5FJPA 2XFWA 5G1MA 4X0VA 2PE4A 2GQAA 1G7UA 3WDPP 2I9EA 2ZE0A 4FO4A 3WX7A 3FA5A 3CZ8A 1AJZA 3VDCA 1SZRA 1XUUA 2NV2A 1OT1A 2JKAA 3WL0A 4ZQRA 3CHDA 5L9FA 5DEZA 4FA3A 3ALFA 1EZ2A 4H83A 1TVPA 2GWGA 3U5YA 3SCTA 2INZA 4TOQA 3WL1A 3M0JA 4Q8PA 1M41A 2QCLA 1E6QM 4KWOA 4RNHA 1GQIA 4C7DA 3B8DA 4AZIA 5A6SA 3A47A 1XLIA 4S2CA 3I7QA 3QF0A 2PC4A 4E2DA 1E9LA 2G3IA 4GKTA 1KM0A 3CQJA 3WLPA 4G7EB 1M5WA 1RK6A 4HKPA 4Q7IA 4A05A 4JTKA 3S5SA 4JICA 2GFTA 3RITA 2PZNA 3MQTA 3PF3A 3VM7A 5G4WA 3KL5A 1XDMA 1CLKA 4I7WA 3ORWA 3G5EA 1JPIA 4ATLA 3E2QA 2P3ZA 3MHUA 4DIAA 2R14A 3R0KA 2R1PA 3IARA 1HJSA 4WCJA 4DELA 2X0YA 3BVJA 4OWGA 2OSYA 4TMCA 2AMXA 4MKVA 2G3FA 2Z7GA 1QI2A 4Z0JA 3TLLA 2D0HA 2PGWA 2DP3A 3NO1A 4NYYA 4HA1A 4AZ7A 3ITLA 4D6JA 1LQ0A 3R94A 3MC5A 3SIMA 4KEMA 3KHJA 4XAZA 2WSKA 1ZCCA 3KVKA 1KM4A 3R5EA 2XIIA 5CG0A 1TPWA 3NZ1A 3OLGA 2BXVA 1AH3A 4FIQA 2ZADA 3KBSA 3U48A 2WMKA 3NL2A 3F2DA 4GPNA 5I6SA 1XKYA 5GJMA 1KRBC 3FA3A 3AXIA 4JTQA 1E9YB 3W87A 4PRRA 1NFPA 3GK0A 2P5NA 1Y5VA 3V5FA 3BGJA 3GTHA 3INPA 3MO4A 3PJTA 4OECA 1E6PA 4ZE5A 3ZLHA 4QITA 2FGZA 3IEBA 2P10A 5DX7A 3F7JA 4LW7A 2DZXA 1S5VA 4IIGA 1JR1A 1IQ8A 4ZFMA 3RLVA 3DHPA 1Y7VA 1V79A 1W3TA 3HV9A 3IJ6A 4ZR8A 1I2RA 5IHRA 2CLOA 3NJ3A 1O95A 1B4KA 1RVKA 3SO7A 3SY8A 4XIAA 4HNCA 4YLWA 2DU2A 3SW6A 1XIGA 2Y6ZA 2J79A 4L64A 4GGBA 5HQMA 3VU2A 4FNSA 4KFNA 3UWWA 4LC6A 3SRKA 3B0XA 2ZBTA 5HMSA 4CEUC 3KVJA 1WB0A 3MT1A 3LOTA 1TA3B 2NW0A 3QZEA 3EBVA 1Z89A 1HW6A 1BLIA 5IBXA 1K02A 1EKOA 3TWBA 1RLDA 2WVSA 1VYPX 3G77A 2VUNA 1KFLA 4HVXA 3VOHA 2NQ9A 4HJWA 3BGAA 5G4HC 2YCLA 4JKMA 1PHQA 1H7RA 3UT0A 3SBFA 3PB0A 4NZJA 4Q8UA 3WD3A 1X38A 1YXYA 1LWIA 2FDMA 1HN1A 3PZIA 5FF0A 4GJ1A 3N2TA 1XFBA 2QCFA 3RK8A 2ZZ3A 3KL3A 9XIAA 4DHGA 2FVMA 5HOSA 4GUGA 3TC3A 2W91A 2P50A 3FHQA 4I3GA 1I1XA 4Q8TA 4P8WA 2YBTA 4HOWA 4PB5A 1KCXA 2FZBA 1T99A 4W5UA 4AH7A 1A5CA 3V36A 2DEPA 5FJOA 1ONEA 4FP1A 1B5TA 3TCSA 3ARUA 4GVGA 2CKRA 1EUAA 7PTDA 3PPGA 2C1HA 4OFCA 2WC4A 3PJUA 4F9DA 3C2YA 4LUSA 3ZLGA 2YYTA 3L4TA 3S83A 1RCOB 3SZ8A 3ITGA 1IGSA 1PVNA 5D05A 3FAWA 3W7RA 4AQLA 3EWBX 3QV6A 2F6XA 1FA2A 2CBIA 4FLQA 4LCSA 2GJLA 3DKJA 1A50A 4P61A 1QOPA 4LH8A 3LQGA 4J5NA 1A3HA 2PUZA 4GFIA 3KP0A 3P80A 1G9HA 1TPC1 4QBXA 3TMLA 3VCRA 2ON3A 4X60A 2WK2A 1F73A 2XM1A 1MZHA 1W9UA 2VC7A 4ACZA 4GCXA 3RO6A 1K9DA 3POHA 5A95A 3MKVA 4Y6GA 4P8UA 3IGUA 2XWDA 1TSIA 4UFLA 2YLAA 1BRLB 1HL8A 3UNTA 4O57A 3VX1A 4DF2A 1Q45A 1BTMA 1XLEA 1CWYA 2PDNA 3B4YA 1O4UA 3VIGA 5BMWA 3DI0A 4D6HA 1TV7A 2A3HA 3TCEA 2E8YA 4GCAA 2DJLA 5D2WA 1KFWA 3DXIA 4MG4A 4ZB0A 3ZIZA 1TB3A 3LI1A 3SFKA 1ONRA 4LY4A 4TX6A 1H41A 1QATA 1WDDA 1JYVA 2ADAA 3RG6A 1EJUC 5CGMA 3WLQA 1OX6A 4PMXA 2F9RA 4QFUA 4IP7A 4FXJA 3TYEA 4H7CA 4Y9AA 3EXTA 2O4QA 5EMMA 4XD5A 2ACQA 2PU1A 4DM1A 3TSMA 4H9XA 1ISYA 1P4CA 4UMAA 4AFYA 3MVIA 2I5IA 1US0A 5KZMA 3MS8A 1PXGA 3M43A 4DO5A 1Q7QA 5K9CA 3HA1A 2C91A 4CD8A 3ISIX 4OOUA 2ODOA 3NQCA 5JH2A 4MGGA 1OGBA 1JDDA 3LCFA 1VJIA 3NZRA 4LY8A 1J6PA 3N4FA 1KKRA 1HF6A 1FVPA 3GTIA 3ITXA 2OLHA 1IXOA 4IJCA 1D3GA 5FJUA 3RR1A 2RJHA 1GG1A 1T8XA 2WJDA 2WQDA 2ZX7A 3AALA 3R58A 3W4RA 3DBPA 2NUYA 3M0LA 1AZ2A 3UWYA 1Z3NA 5I7GA 3ARZA 2W79A 4UNLA 3W71A 2YFOA 3FCPA 3QN3A 3M0HA 2ALDA 4K68A 1UWAA 5D2VA 3EGJA 1TTIA 2VZTA 1IHIA 2ISVA 3MDWA 4WVXA 4AD0A 3N34A 7A3HA 1W9VA 3U7VA 3N9SA 1FX6A 3AXKA 3LSCA 4BEQA 2WC7A 1W3HA 2YDAA 1LM1A 3LV6A 1D3CA 3LHTA 5G2IA 1QW9A 1P0KA 5AHMA 3PUOA 1LRTA 1EFZA 2VEIA 2WAGA 4BF7A 4YYCA 2DT2A 4QR6A 1SW7A 3LTSA 4BEUA 4ZQMA 1GJUA 5A69A 4P7RA 3N15A 2OO0A 1IXQA 1B3WA 4W8BA 2IKIA 3BSGA 3NCOA 2O9TA 3UR5A 2ATMA 5JVLA 2WHMA 2Y85A 4TVCA 1XD0A 2JGQA 3L68A 1QNPA 2FHCA 1SO6A 3KRZA 4P5UA 3R0UA 3HV8A 3ZQ9A 4QQUA 3CZJA 4IIDA 4J3ZA 2QUTA 1NELA 1ICSA 1H1ZA 3VCNA 2BNJA 2D73A 3DI1A 3WLJA 3GDTA 3QW4B 3BDKA 1YQ2A 4FLOA 4XUGA 4A8LA 4UMBA 2PDLA 3OYXA 3BK0A 5FF7A 1PDZA 1DJNA 2PWFA 4R7JA 1TIWA 4MZYA 3CGTA 1TJ1A 4NASA 2FZNA 1BF6A 1TKKA 3WQ5A 3FVDA 3W1PA 1JQXA 2IPJA 3XIMA 1PB0A 4PL1A 3XINA 1JZ2A 1OK6A 2AGKA 4N0RA 2PCEA 2ZA3A 2JF6A 1H62A 2ZA2A 2PDJA 4HMNA 1XIFA 2OT0A 3T08A 1QNQA 5TQLA 1SFJA 1VFSA 2FH8A 3T2PA 2R91A 1UZDA 1UKPA 3LGEA 2RDTA 4OIFA 4FXRA 3FJ6A 4DJFD 1KTCA 5HATA 2G97A 3AS0A 1TV3A 3TJIA 4YVPA 1ZTVA 1E70M 4UUIA 2YIHA 3QY6A 1DIOA 1AQHA 4HK7A 2DUXA 2EJ1A 3LSBA 3RGTA 1V3HA 5LXEA 4MJMA 4MY1A 3CWNA 4BHYA 4PTVA 3LZ3A 5CPOA 4CQDA 4C6QA 4WXZA 3FSTA 1LF1A 2ANUA 1V4YA 1XXXA 2P0OA 4O8RA 1P1MA 2EQDA 3G1DA 4WR3A 3W84A 2PRLA 1OC7A 2QNEA 2X8RA 3MBFA 4XD3A 1F3WA 1ZAHA 5A2AA 2E5BA 3OJGA 1GORA 3BW3A 1NSJA 3LI0A 1CXLA 3MZ2A 3NL6A 5FEWA 3K1DA 2OB3A 3H2MA 4Q8OA 2E4TA 3W3OA 3REQB 3W72A 1JCJA 4H1ZA 3VIOA 1W17A 1BWVA 3JS3A 4J3SA 5HWNA 2O9OA 3HIJA 3HG3A 2A0NA 2YOCA 2YX0A 1XRSA 2OSWA 5LSMA 1NAL1 1OC5A 4ZB5A 3T81A 5I3GA 5ABHA 2ZXAA 2HSAA 1UR8A 3CUFA 3ZT6A 4NT0A 1RPXA 2ALRA 1F4HA 1H11A 3N73A 3T2OA 1WYIA 3AXHA 1YXCA 1MUWA 1P7TA 1FCUA 5IRPA 1HJUA 3TIMA 5LZLA 4LRSA 1WBJA