1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, lyase
molecule keywords 2-deoxyribose-5-phosphate aldolase
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
3QW4B 1L6WA 2F7FA 1KTCA 3QEZA 1GG0A 3SGZA 4MJZA 4DPQA 4O54A 4UMAA 3PUEA 4LT9A 2QCCA 5I3HA 3BLIA 1OYCA 3T7VA 1TJPA 4LUIA 4N9EA 3LCLA 1CW2A 1QPQA 1KA9F 2NUYA 2ZTKA 3TFXA 1PHWA 4DF0A 3W6YA 5EKYA 4NX5A 3MI6A 1XKYA 4JTKA 3QMSA 3G3DA 4H6KA 1G4TA 4FX6M 1P1XA 5D03A 3FIGA 4IMCA 1DQXA 1EEPA 4LTSA 5L9FA 2B4GA 4UUIA 1G69A 3L0KA 3O6DA 5AC6A 5CGQA 3C6CA 5DELA 2TRSA 3QMTA 3SGUA 5LKYA 5FI8A 1K7XA 4WZHA 3S42A 4Y90A 2ATMA 5AHNA 1ME9A 1TMHA 3R89A 3NQ2A 5F4XA 3CB8A 2E68A 1UCWA 2A7NA 3PBWA 3STEA 4JGDA 1G7UA 5K3VA 4PCFA 1LTDA 2VEKA 4LVGA 3IGSA 5LSMA 2R8WA 1YPFA 1VQTA 4O16A 4IPIA 3TAOA 1RD5A 3B8DA 1JQXA 2FPTA 2ISVA 3RU6A 4UIOA 4B5NA 5F2GA 3TDFA 3W7OA 4FNTA 1LM1A 3GLCA 4ZL1A 5K4XA 2ZRYA 2PC4A 2V5LA 4RJEA 5F1UA 3ABOA 5AHMA 3V1PA 1HTIA 1XFBA 6ALDA 1SPQA 4QJ1A 3TROA 5A8GA 3MO7A 3ZFHA 3W72A 3IEBA 1TCDA 1UJPA 5CZTA 2CWNA 1H7PA 1VCGA 4JD4A 5FF3A 1OABA 3HOJA 5AYZA 3SFKA 2ZZ2A 4GUFA 4M19A 3L0GA 1GVRA 1GVQA 1H63A 5FESA 4JDBA 3P67A 3ZWTA 5DY3A 4XKYB 5HWMA 3TSMA 2ZA3A 2QCGA 2A85A 1PHQA 3C61A 3P8JA 1OX4A 1LDCA 3TXVA 4QITA 2V81A 4LVDA 2PE4A 3W7RA 1LBFA 3CIXA 1BKSA 3CWNA 3W7PA 1BWKA 3PSVA 3P82A 4G1KA 4UCGA 3FS2A 4AXKA 1Z44A 4JTIA 1JUEA 3BO9A 4WUIA 3TAKA 1KFEA 4KWWA 1EWEA 3I7QA 2W0UA 2R94A 1KTNA 1R46A 1VCFA 1FUYA 3N73A 3H54A 2B7PA 3OIXA 4N6FA 1Q6QA 3PULA 4LW7A 1TPH1 3NQEA 1D9EA 1MZHA 3ELFA 5KZMA 5TIMA 3F4WA 4CNOA 1SZFA 2R91A 3KRSA 2I9EA 3PB2A 2J9ZA 4O19A 2A6NA 3LRKA 3LHUA 4Z1CA 5AC8A 1OX5A 4FNUA 5D30A 4IXXA 3MI3A 4IJBA 1VHCA 1UASA 3S1WA 4RLIA 3C2FA 3TMQA 2GPTA 3DH7A 1W5PA 3G0XA 1OK4A 1TTIA 2VFFA 4ZZ9A 4WY0F 3L2IA 1PV8A 3HGSA 1WDWA 3M16A 1OFRA 2OCZA 8TIMA 3ANYA 3NPVA 5AB3A 1ZY9A 2ZTJA 4HPJA 4O11A 4NZJA 2B0MA 3GR8A 3CEPA 5DXXA 3FA5A 4QNEA 2FB2A 3UYCA 1SFJA 3C56A 3GK0A 1ZAHA 4ORIA 3KAOA 4UFJA 1FBAA 4WOZA 2E5DA 5D37A 2VELA 3NQAA 1W0MA 4TIMA 1VYPX 4LV9A 3W2LA 1T96A 1PCWA 4QSHA 1AW2A 1OG0A 1LP6A 3W9ZA 1EUNA 4UTJA 3E49A 2C14A 2CLKA 2OZ0A 4JIPA 4MZYA 3NQGA 3G18A 1YLVA 1LOSA 2J24A 3CLMA 3DENA 5DCDA 4M5PA 4IX2A 1F76A 1VH7A 1FDZA 4ONVA 4OV4A 3HJZA 1M6JA 2AQWA 3PY2A 5FEZA 4NJGA 2QKFA 1IIHA 4UTTC 3KVMA 2WNZA 3KVLA 2FQIA 4AHOA 3W7QA 1ML1A 3P62A 5BRBA 4Z1BA 2YX0A 5HJLA 2Y7EA 3TJXA 4YCOA 2C16A 1BWLA 2ZYFA 2WV8A 3NXFA 3MYPA 2E5CA 2VEMA 4IUOA 4WOQA 1SW3A 3I68A 3MP5A 3FEMA 3MHFA 1GWJA 3I65A 4UTIA 3TR2A 2W79A 3HGOA 3QC3A 4WY0B 2TMDA 3R13A 4ZQNA 1S5VA 1KLYA 2QUVA 4KKXA 2BZNA 2GQ8A 3NL2A 4XKYA 3LDVA 1MEHA 1WBJA 1QR7A 4UXDA 3NQDA 3W84A 2X30A 1N8FA 2BSLA 2IQTA 5GVJA 2RH9A 1TPEA 1JCMP 1GVFA 4AAJA 4NU7A 5AYXA 1YXDA 4S1FA 4QM1A 3E02A 1RR2A 3JRKA 3NO5A 4EWND 3IVUA 4JDYA 3VCRA 1QOPA 1WV2A 4BI6A 3NGJA 1BEUA 3KVKA 4K8EA 3TE9A 3S5ZA 1ZALA 2Y6ZA 3NZ1A 3WFAA 4GNJA 2DORA 1JULA 2Y63A 1C29A 5MHBA 3HG3A 1M5WA 3C0JA 4FNPA 3VKJA 3BGGA 5AHFA 4AWUA 4NJJA 4E0CA 5AFDA 1PS9A 4Z0SA 5D2YA 4FF7A 1FWRA 1ZCOA 5C5YA 2FB3A 4AWTA 1EX5A 5IBXC 3MBDA 3CQ0A 4QQ3A 1LRQA 3EKLA 1KBJA 4GC4A 4OGZA 1F05A 2NUXA 1H7XA 4JTEA 2GUUA 3M7WA 4ZQRA 3BG9A 1Q6RA 1MO0A 2YDAA 2CZ5A 5EY5A 3PG9A 3LBCA 1R2RA 3CHVA 5G4EA 1RVGA 2C15A 3W1XA 2Y61A 3LCXA 3BV4A 3N2XA 3NQMA 3UNDA 3W70A 1KFKA 1K8ZA 3EWZA 2QR6A 2WSQA 2DZUA 2H8XA 4FNRA 4MY8A 4ADTA 4RZ4A 1XBZA 1AL8A 4HNUA 4X2RA 5I3JA 4XZ9A 2H8ZA 2R14A 1W56A 1J5TA 3OBKA 4LOCA 2NUWA 4HNTA 2H3DA 4HHPA 4HSNA 3F4NA 3W23A 3W7MA 3S5NA 5DLCA 1DOSA 1SO4A 2FPVA 3LM7A 4YMZA 2Q8LA 5KINA 3QRHA 5F4WA 3TU9A 3GKAA 3LHZA 4N4QA 1I2QA 4OBTA 3DBPA 3CIWA 3DU0A 4JTJA 2YFOA 1FWTA 3G1DA 2C19A 1W3NA 3O16A 4C1LA 1F6PA 4CCEA 2CLIA 3M43A 3ZS4A 2DZSA 3TNOA 2V8ZA 1QAPA 3G24A 5CKSA 1LRNA 4Q33A 3WJZA 5EMUA 3W1RA 3MHUA 2JGYA 1SFLA 1OFAA 4ADSA 3W7HA 1H50A 3MYOA 3W88A 3NM3A 4AB4A 4RKAA 3FKKA 3OA3A 3MI2A 4P2VA 3HPXA 1JCJA 4O1CA 5LGXA 1YYAA 1K8XA 2NV1A 1P4CA 3E96A 1VYRA 2QEZA 5H2ZA 2V0TA 4OQVA 4FX7A 3G0SA 4UFIA 2H6RA 1M7OA 3QW3A 1X1ZA 1OFDA 2Z0IA 3T40A 5EA9A 4O10A 4NJHA 4IMFA 3DXIA 5I3IA 1K7FA 3NA8A 4YCPA 1XM3A 1IF2A 3G1HA 1RPXA 2I1OA 3FJ6A 4A22A 3Q2DA 5F2IA 1W5NA 2CLLA 2Y89A 1VLWA 3FKRA 3HGJA 4JX5A 2G97A 3CPRA 4IOTA 2QCDA 3TUUA 4K7YA 2NWSA 3D0CA 1TYGA 1VZWA 1XDMA 3IIXA 1H1ZA 3PUOA 5G4WA 2RKXA 4QIUA 4CQ8A 2GQ9A 4KWVA 3HMJG 5EBUA 2C0AA 5D02A 1XBVA 1OX4B 2DZPA 3NPXA 1OJXA 3N9SA 5HUOA 2QUUA 1W5OA 4RK8A 1QO2A 3BG3A 3PWAA 4JYFA 3W1AA 3S5YA 2ABBA 5KMYA 2BXVA 4DELA 3W76A 3NDOA 2A2IA 1O94A 1FWWA 3QZEA 3BPWA 2O7QA 3G0UA 2VFIA 1W8SA 4O4VA 5LNWA 2WPBA 1OX6A 4MYXA 3SSJA 3UWUA 3EKZA 1NF7A 3AO0A 2PRLA 2VEIA 4FNQA 5AHEA 4GBUA 1X6UA 2GQAA 1LOLA 4FEZA 1JCXA 1TPDA 3S1XA 2GOUA 3L5AA 2PRMA 4JY8A 1W31A 1OFPA 4XBSA 1YDOA 3LB0A 3CTLA 2FTPA 4DQWA 3TIMA 3W87A 1JRCA 1HO1A 2X16A 2CFFA 4O0KA 5IBXA 2CLEA 2LLEA 4BI7A 1AW5A 3LGEA 3B03A 1SO6A 4LS0A 4JTGA 2XN0A 2HTMA 2ZA1A 3ATYA 5D05A 4JYEA 3IVTA 4FNSA 4R34A 1O5KA 3NQFA 4N2YA 3IIZA 1AMKA 2I14A 4Y8FA 4GXMA 5CPNA 5BMXA 5EYWA 3VE9A 3N14A 2YGYA 2UV8G 4NUWA 3W1UA 2ZRXA 1KV8A 1ICQA 3B06A 1VS1A 1TREA 3AJXA 1I8JA 4O18A 1M7PA 4DXVA 2P0OA 1WOAA 3W1PA 3A24A 1LORA 4LU0A 2WNQA 4PC8A 4OV9A 3TV8A 4GJ1A 1OVDA 1OFBA 3BVJA 4EF9A 2H90A 3GKFA 3NVTA 2Y70A 2DZXA 2WOQA 3LXAA 4Z08A 1I2RA 3EB2A 1JRBA 1R2TA 2CZDA 3SR7A 2EGZA 4XQ6A 1SW0A 2C18A 2KZHA 4I9AA 4ML9A 3KXQA 3UWVA 2ZA2A 3TMLA 4ZQOA 1SSDA 3LLFA 4KFNA 1XC4A 3L21A 4JTLA 3I7RA 3W22A 4AEOA 1TTJA 2V82A 2Z2UA 1KW1A 2CZEA 4IXHA 3VFLA 1XBXA 1RQHA 3G1XA 1H51A 3P84A 2P10A 4GUHA 4MKNA 1W3TA 5CSSA 2V9DA 2QCHA 2C6QA 5EPDA 4K8HA 1O95A 5DBTA 4MUZA 1EP1A 4M6PA 4DO6A 4LVAA 4DPPA 1IXPA 3W7IA 1F74A 3LTPA 5FEPA 1QO5A 2TYSA 4FB7A 4MY9A 3SZ8A 4O50A 1UB3A 5LGZA 4MJMA 3HB9A 5AYYA 1EA0A 5F2MA 1DHPA 2NXIA 4CNPA 2NX1A 3THQA 4UNKA 3TX9A 5K9CA 1KM0A 4O4WA 4KFPA 4UR8A 3TA6A 4JX6A 4PL2A 3GDMA 3P7YA 1YTDA 3GDKA 2JKPA 2JKEA 1ICPA 3GXPA 2Y88A 2DJLA 3KFTA 1L6SA 3VI2A 3P8IA 4RV8A 4O1DA 1W5MA 3ZWSA 4IMEA 5G2IA 4E2BA 1HL2A 3IVSA 3PBVA 1QDSA 3O07A 3GB6A 2DP3A 3ATZA 4UTWA 3LV5A 3H53A 1ME7A 2TPSA 1JJKA 1GQNA 2X1UA 2YPIA 3WK2A 1DV7A 3MJYA 3TKFA 1FDJA 1LLWA 3IGXA 5K7JA 5LNUA 1OYBA 2QUTA 4O12A 3S6DA 4LY8A 1JR1A 1U5JA 3IIOA 3WJYA 2E6YA 1IGSA 3MMTA 3STFA 3INPA 2A1YA 3QM3A 4PODA 1KFCA 2A7RA 3RMJA 5KZEA 3L66A 5DY2A 5C54A 1ZFJA 1YADA 5DN1A 3EX3A 1LLZA 2QCMA 4IMGA 3TW7A 5D2VA 2EKCA 2QDGA 5HULA 4NVTA 2QCNA 4DF2A 1SO5A 3UWYA 1XUUA 2YZRA 3EWYA 4LVFA 4ORMA 4O53A 1PE1A 2QCEA 3HG2A 1IXOA 4D2JA 4DO5A 3HPSA 1J2WA 3HIJA 4Y9AA 4RX0A 4TX9A 1GYNA 4WJEA 3NL6A 4LS2A 4Z1AA 3R8RA 4FIRA 4R33A 2E1DA 3QYQA 3NQVA 1QPOA 1SUXA 3TFCA 3S0CA 3LRLA 1WX0A 3A5VA 3IGUA 2ZRVA 2GJLA 3ABQA 3BLFA 3M6YA 3W3OA 4JR5A 2Z6IA 5HUPA 3LI1A 4Y96A 3DFQA 4MPQA 3QF0A 4H4IA 3FOKA 3CM4A 1HG3A 1WA3A 1QNVA 1OF6A 1KFBA 1PL9A 4OWGA 2E6AA 3W71A 3P5ZA 4JXCA 1K03A 4UFHA 3S1UA 1W1ZA 3PB0A 4RCXA 4JTUA 2J6XA 1XCFA 1F5ZA 2NLIA 3DI0A 1JUBA 2FJKA 3JS3A 1EUAA 3OVQA 4PTNA 1A53A 5HQEA 3CU2A 3UPBA 3W2UA 4FXSA 3S5OA 4N4PA 4Z0JA 1N55A 1TV7A 2A6LA 1O60A 2CLOA 3M9YA 5LHEA 3M5XA 1TB3A 3HO8A 2Z1BA 1SW7A 2EAWA 2B7NA 5KSWA 1TRDA 3UWWA 1EWDA 3G1VA 4PA8A 2QJIA 5CPMA 3E0IA 2CLHA 3UPWA 1MEIA 3LV6A 1T0OA 1XUZA 4DF1A 3G3MA 4FIQA 3GAKA 3NM1A 4A21A 2HMCA 1O4UA 2JKAA 4GWEA 1SZGA 4S2CA 3PC0A 3MP3A 2OX1A 3WJSA 1W54A 2RDUA 1XI3A 2G5WA 3T78A 3R2GA 4IWWA 2WSRA 5BW6A 2QCDB 5FF2A 4UFMA 4O15A 2VENA 3L9CA 5I3KA 4N02A 1ZENA 3L67A 3WJWA 3FYPA 3NR0A 3G8EA 1TJRA 5FEWA 1C9DA 3UZJA 4UFLA 1Q6OA 4OE7A 3THAA 3UY7A 1K3UA 3PG8A 3LCFA 4O1AA 1E51A 1VJIA 4JIQA 3BW4A 3EXSA 4K39A 1FXQA 4WXZA 1V7YA 1X7FA 1AL7A 1VCVA 4RXFA 2BWGA 1FCBA 2WQPA 4LC8A 1QPNA 5FF0A 2QAFA 5C55A 1W37A 2ZRUA 1Z42A 1LBLA 3V75A 3GIYA 4WXYA 2OT1A 4JY9A 1TRIA 2ZFAA 5G1TA 3T55A 3RK8A 2DU2A 3NG3A 3CC1A 1VHNA 4I7UA 4ADUA 2PRHA 1X1OA 3GX9A 1GEQA 4JEQA 3LBMA 1H7WA 1TO3A 4POCA 4TMCA 4MYAA 5K9DA 2J88A 4UMBA 1AW1A 1VR6A 1G4SA 2D73A 4IMDA 3TJLA 2E5BA 4AH7A 4Q32A 3QQ0A 6TIMA 1EPXA 5G2WA 1ZJIA 1Q3NA 5HR6A 1Z48A 3C2EA 2DJXA 5D2WA 3STCA 4DBDA 2A5HA 3MWAA 2RHGA 2QCLA 5U7SA 2FLIA 3WK1A 3TCEA 4AHPA 3QPZA 2FFCA 5LNRA 1C8VA 1YTKA 2ZBTA 3WJXA 1R2SA 2ZZ4A 3PVFA 5F2LA 1DJNA 1J4EA 2WJZA 2ZRZA 4ICNA 4MIMA 4N9DA 3T4CA 4HKPA 5HWNA 1TSIA 2E6FA 1ME8A 3QJAA 5TBOA 1L2UA 2ZZ7A 1G7VA 5A5WA 1GZGA 4O57A 3P61A 1VPXA 1FQ0A 3I6RA 4N6EA 4R7JA 1O5XA 3FYOA 1TPB1 3DGRA 4GUGA 2BX7A 4LNYA 4NXKA 1GT8A 4ZQPA 3C2OA 1RQEA 2VEPA 3I7SA 4O13A 1ONRA 3DFSA 3C2VA 5F1VA 4AF0A 1QFEA 4NNCA 3W83A 4AWSA 3W1LA 4UR7A 5IM51 4UTTA 1VLIA 1UBSA 1ICSA 1PIIA 4X22A 1K8YA 5E93A 3W7GA 1R30A 3NL5A 3CEUA 4O8RA 3BW3A 3LX9A 3A22A 2ZZ1A 3B0UX 2V30A 2ZQ0A 3SY5A 1NEYA 1I2OA 5H91A 5L6UA 3MBFA 2EHHA 3U2OA 5AN7A 1LBMA 3UWZA 2H3BA 4XTIA 2C1HA 1OYAA 3QMRA 3W1TA 4EIVA 5G2HA 1FX6A 4GRSA 4JICA 2VFEA 1ALDA 5G1YA 3CT7A 2YYTA 2HSAA 3M44A 4U4MA 4HNNA 3RF9A 4JX4A 3LRMA 2DZWA 3Q37A 1TQJA 4E2DA 2JBMA 1DL3A 1XDLA 4Y6GA 3E9AA 1SSGA 3NNTA 1ZAJA 2A21A 3B05A 4AMAA 2E09A 4K36A 5HNRA 3BG5A 2YFNA 4KFOA 1THFD 4LVBA 3U6WA 1I2PA 1I2NA 4J9JA 3HG5A 4IPJA 4JTTA 4MLJA 4O52A 2CZFA 1OFQA 3L68A 5K4ZA 2Q3RA 1Y0EA 3S1VA 4MFDA 3LCGA 3LHTA 2QF7A 4MZ1A 4XBKA 5SWUA 1L9WA 1QWGA 1K02A 4FX8A 3W1MA 1AG1O 4CQAA 1B4KA 4O28A 4NZFA 3A9IA 3QSTA 1YXCA 5T26A 3GDTA 2RDWA 2PURA 2ZZ6A 3M0ZA 3TC6A 2Q3OA 1MSSA 3NOEA 4GE8A 3EX1A 3TH6A 2ATSA 5CZJA 1GOXA 4BF9A 3S9YA 2QJHA 5AHLA 1KFJA 5CPLA 3QSRA 3LXCA 3EWWA 4FO4A 5FF7A 1B57A 2C13A 5ABTA 5C6MA 5I3FA 4JTFA 3TQ0A 3N9RA 2QAPA 3R5EA 1B3OA 3W2MA 3S8HA 3HF3A 1SQ7A 3SECA 3W2NA 1LCOA 4HT3A 3EXTA 2VFHA 5J5RA 5FEXA 5AHIA 3BGJA 4OT7A 3HPZA 1WYIA 4M6VA 4EF8A 3KX6A 5HINA 3UXDA 3W2KA 1I4NA 4L4LA 3Q58A 1F2JA 3NPUA 3W7NA 4BWLC 4PH6A 3EEGA 2OJPA 3QPYA 1Z41A 3LTSA 1RV8A 4NNAA 3CWOX 3TW6A 4BK9A 1H60A 4N9CA 3QFEA 2BLEA 1DVJA 2Y7FA 1MXSA 1JUKA 2HS6A 1L6YA 5KITA 1DQWA 4CNNA 1YPIA 1OF8A 3P74A 3NZRA 3LI0A 2Y62A 4HPXA 2ZZ5A 5K9XA 3DKLA 2XN1A 1JCNA 3L0NA 5D2XA 2YW4A 1PVNA 1S5TA 2JGQA 1A5AA 2V2CA 2O7SA 4A2RA 1UUMA 3SI9A 1TPWA 1TQXA 1EP3A 1KM6A 1X8FA 2NXGA 4M6QA 1T8XA 1B9BA 3B0PA 1TV5A 4Q4KA 3L5LA 3GXNA 4NJKA 5U4NA 5BNKA 2ZDRA 3UD6A 3WK0A 3GNNA 2GVGA 5F4SA 2QCFA 3PM6A 1ZHAA 5DBUA 4U28A 1A5SA 1JQVA 5CSRA 3W74A 2Y7GA 2WNNA 3YPIA 3GZ3A 5LNVA 4LS1A 3LXBA 4NXSA 3F1QA 2GVLA 4ALDA 2NV2A 3C4UA 3EX2A 2ZCGA 5I3GA 4O17A 2X2GA 1JVNA 5EL1A 4TO8A 1TPVA 2YR1A 4UTHA 1WBHA 3O6YX 4P61A 2E6DA 1SU5A 1HO4A 2VXNA 5D2TA 2WSYA 4X9SA 1TTQA 3MP4A 2W6RA 1GYLA 3DFOA 1P0NA 2WO5A 3B4UA 1KFLA 1TPFA 1YDNA 3EWXA 2QJGA 3W86A 1I45A 1A50A 4RZ5A 5KZDA 5HR7A 4LRSA 3EX6A 3ABSA 4XWUA 2VOMA 2TSYA 4X3ZA 1XXXA 3DKJA 1LZOA 3BK0A 1H61A 3GDRA 3RFAA 1UUOA 1SO3A 1GTEA 2CW6A 2DZTA 3G8RA 5CG7A 3QQ1A 5E0KA 3W75A 1V5XA 3NQ7A 4AHQA 4CCCA 3W07A 2NZLA 3HBLA 2DZVA 4WX2A 3M1ZA 3DI1A 3LTYA 2J9YA 3LHYA 4A2SA 4ZVJA 2A0NA 1YTEA 1DBTA 3BARA 3O1NA 1G4PA 1G6CA 1K7EA 2Y85A 2ZRWA 1TPC1 4DBEA 4GFSA 1EIXA 3MHGA 3FLUA 3W2JA 3DZ1A 3O6CA 3P5YA 2VC6A 3Q94A 3G1YA 1GPWA 3FFSA 2FPYA 2Z6JA 1EP2A 4QNWA 3M5ZA 3KRZA 2B7OA 5LNSA 3OEXA 3PF3A 4LRTA 1ADOA 1S3HA 2A4AA 1H1YA 3NQ8A 3C52A 2ALDA 1G67A 3TSDA 4QISA 1TPUA 1YXYA 4MZ8A 4PEKA 2OMAA 3W7CA 2NWRA 4UTMA 3NPWA 2ISSA 5CZSA 2OT0A 3PR2A 1XL9A 5G5IA 3OVRA 3UXAA 2A7PA 5AOUA 1W5QA 1OK6A 3SJ3A 3N2MA 5AC7A 3LCWA 1NSJA 4JTSA 2F84A 3G1AA 3W1QA 4FHAA 4ZQCA 2J27A 3C2RA 3GDLA 4BFAA 3IIPA 1G4EA 1QMLA 4JYDA 1FCUA 1LROA 1T99A 1OFEA 3F03K 3SIZA 2CU0A 4C1KA 1SZEA 3W7LA 1KM5A 4AF0B 4BWLA 3IRDA 2P1FA 4O1BA 4YLWA 5C2XA 5KTLA 2YW3A 4LWWA 4W9TA 1SR9A 3GVGA 1SZNA 3FJLA 4DEFA 3U8GA 3RLUA 4TR9A 3DFPA 3B04A 1NVMA 2NX3A 3TK7A 5DXYA 5TQLA 4JN6A 4Z1DA 2G95A 2ISWA 2YYUA 5D09A 3L65A 4LUJA 2Q8ZA 7TIMA 1FWSA 1FDYA 3DHDA 3W7KA 4JTHA 3GAYA 3DAQA 3KOFA 3EWUA 2XN2A 4CQ9A 1HFBA 2HS8A 1VRDA 1JCYA 3E12A 5HWJA 3NL3A 3PUDA 3DFNA 1VC4A 4XUGA 3OG3A 1KTBA 4CCDA 2YCEA 2V2HA 3PSWA 1YDVA 4YL2A 2AAMA 3UQNA 1WOBA 4NJIA 1LOQA 4H3DA 1KM2A 1KM4A 4XTDA 3TQVA 3HG4A 1F6KA 3LCIA 1Q45A 3G22A 4OHQA 3IIVA 4S2BA 3P80A 1IIGA 3IV3A 1LRTA 4TU1A 5J5DA 2RDTA 3EWBX 3W7DA 3W7JA 1KM1A 1QPRA 1D3GA 5BOOA 4ZMGA 5LHFA 3RNDA 1ZNNA 3G1FA 3C3NA 3EX4A 1RZMA 4RXGA 3BLEA 2E77A 4I7WA 4UTUA 1IXQA 1P0KA 1H62A 1A5CA 2V2DA 3A23A 4JS3A 3KHJA 3TQKA 4N9BA 1TV8A 4K37A 3GYEA 3OHIA 3JR2A 1H7NA 3UY8A 4A29A 4EVZA 4M7SA 5E1QA 1FXPA 2G96A 1PCKA 5LZLA 1VYSX 1MEWA 3TC7A 2WKJA 1Q6LA 5HMSA 1CI1A 3NAVA 4ZQMA 3P81A 4IGHA 4WQ6A 2EPHA 2X1TA 4YXGA 2BTMA 4O0ZA 3W85A 3SW6A 4PL1A 4E38A 1KM3A 2GJNA 1AK5A 2Y7DA 4NT0A 3HGRA 4TMBA 3VNDA 3GXTA 4UTKA 3A21A 4OU1A 3W1NA 1OFOA 2YXGA 2CLMA 3LERA 1WQ5A 1P5BA 2C3ZA 5DCEA 3W73A 1DKWA 3N19B 4L4MA 4UMCA 4LV4A 3BW2A 4O14A 1XBYA 3B0VC 4IX0A 4MFEA 1TTPA 1NF0A 2GVJA 1FY6A 4HIBA 4NX0A 3M47A 1WAUA 2NXHA 1A5BA 5D32A 3WK3A 4GUIA 3USBA 5D04C 5K2ZA 3P60A 1LYXA 2J9XA 3MW7A 3M41A 3TSBA 3LOTA 3LHWA 3M5VA 1KBIA 1NFBA 3NQ6A 1WXJA 4BR1A 3K30A 1OHLA 3O15A 1EB3A 4UFKA 2ZZ3A 4CLMA 1VGAA 3LCHA 1U83A 4UTLA 4BI5A 3PAJA 2CLFA 4K6AA 1DORA 3PBYA 1H5YA 4AVFA 4MLRA 1FCVA 2NX9A 3LLDA 4K38A 3NQCA 3TXZA 4I7VA 2V5BA 2FIQA 3W7EA 3GR7A 1FWNA 4WY0A 5CZ0A 3O63A 2VFGA 3HQ1A 3G1SA 2JK2A 3O8AA 1KV5A 3MUXA 3DFTA 4NQ1A 4R53A 3EXRA 1GJPA 1QCWA 3O06A 1CX9A 3N34A 2VKZG 1D3HA 3M5YA 2QDHA 3KRUA 4MVAA 1HUVA 3RLVA 1F73A 2XFWA 1GTHA 1F7BA 3KVJA 1FCQA 3NEVA 3OVPA 3N3MA 4HN4A 4DO4A 3LHVA 4IQLA 3NYZA 4HSOA 3PBUA 3ZR4A 4YWIA 1S5WA 4UTWC 3UWQA 5D38A 3PS7A 2B7QA 4LC6A 5FF4A 3UZ5A 4JNMA 4EOUA 5DCBA 1GVOA 1KLZA 1N7KA 2PCQA 4RR4A 5CPOA 4UC5A 1IXNA 5D33A 4A3UA 3VE7A 4PFMA 1RQBA 2ABAA 2AGKA 1NAL1 3GNDA 4UNLA 1BTMA 2YSWA 1H7OA 3L5MA 1JCLA 3A5FA 1TIMA 1ZAIA 3R12A 3O05A 1DJQA 3C8FA 4K7VA 1QOQA 3H55A 2X1RA 3DHFA 4GUJA 4MY1A 4QAIA 4MOZA 3ABRA 1GG1A 2FDSA 5BMWA 2RFGA 4FXRA 1W3IA 3QH2A 3T44A 1R47A 3STGA 2X1SA 1B4EA 1H7RA 4NNBA 4RZ6A 1GVSA 2VFDA 4M7TA 4WD0A 2EF9A 4HNVA
chains in the Genus database with same CATH superfamily
4ERIA 4MJZA 1WE5A 1XF0A 2FH8A 1M7XA 3QHMA 4UTFA 1OYCA 4N9EA 2CLPA 1CW2A 1B30A 2NUYA 3N9KA 3W6YA 1XKYA 3AI0A 1TZ7A 3CH0A 4JTKA 3G3DA 4R85A 1GKQA 1QBBA 1DQXA 3AIVA 4LTSA 2EBNA 5L9FA 1E6ZA 3L0KA 5AC6A 5DELA 3DFHA 3QMTA 1H0GA 1JD7A 2BV9A 3KBMA 2YBVA 3CB8A 1UCWA 2XZ9A 3PBWA 2PP0A 5IDZA 4HMNA 3AS2A 1BG9A 5CEWA 1G7UA 3ARUA 3BWWA 3UW6A 5HQMA 3EYPA 2OB3A 1W17A 3ARQA 4AVNA 1VQTA 4I9MA 1RLDA 3B8DA 3ONCA 1HX0A 1JDFA 1JQXA 3RU6A 1REQB 1XD0A 1MW1A 1T6MA 3IUHA 4UIOA 5A2CA 4MWAB 4JL2A 2ZRYA 2PC4A 1DXIA 1XFBA 2R1KA 2YDSA 1SPQA 6ALDA 4QJ1A 3EDFA 3TROA 2NQ9A 1E9YB 2WHJA 1JIBA 3W72A 1GJWA 3N2OA 4NZ1A 3DG7A 1OZMA 3KDNA 5CZTA 1TFVA 2PWVA 4RW3A 1BQCA 3KTSA 1NWRA 1M7JA 1WKDA 2CWNA 3IK4A 1CB2A 5A8PA 4JD4A 5FF3A 1OABA 3MZ2A 2DH3A 4JZ5A 1V3MA 5M3WA 4J3VA 3P67A 3REQB 3WX7A 1YRRA 4XKYB 5HWMA 3KTXA 3S2LA 4GNVA 2QCGA 2A85A 3RM9A 4QITA 2V81A 5TF0A 1XLFA 3OLDA 3RX2A 3KBVA 3F5KA 4HZMA 2MUCA 4D6CA 3W7PA 1BWKA 1Q65A 1XLEA 2D2GA 4DWSD 4HYWA 4WUIA 3TAKA 1EWEA 2WJEA 3I7QA 4ZCWA 2R94A 1KTNA 1R46A 1VCFA 1DE6A 1OCJA 2V6AA 2B7PA 1Q6QA 3TN6A 2PEVA 2QJMA 4G1NA 1VJZA 2X7WA 4CNOA 2R91A 3QOKA 4O19A 3W82A 1K9FA 3LHUA 2NVCA 2GJXB 4Z1CA 2QXWA 1EC7A 3OODA 3E0LA 1C8YA 2PWHA 1VHCA 2AGTA 3Q65A 1UASA 2XIIA 3PTKA 3C2FA 2Z1SA 1W5PA 2I5IA 3L2IA 1UD6A 1PV8A 3GQYA 4JTQA 1JYVA 3P0XA 3EMQA 3A47A 3FA3A 4DLFA 1GQJA 3ANYA 3VM5A 3NPVA 5HATA 1ZY9A 3G2GA 3N15A 1OZQA 3CBWA 4ACYA 1EXPA 2FB2A 3UYCA 3WQWA 2J6VA 3R7MA 1ZAHA 3RN6A 4WOZA 4UFJA 1FBAA 1ECEA 1J0YA 2A3CA 2ZDSA 5I78A 2J7FA 2VELA 2PLKA 1HKVA 1U5HA 4FLRA 4E3VA 3WNPA 4TIMA 2ICSA 4RW5A 4LV9A 4IFOA 3F2DA 3D6NA 1S38A 2CLKA 2GJPA 4JIPA 1REQA 2J24A 1WUFA 4HOZA 5DCDA 5CJNA 1F76A 1VH7A 1ZJAA 4ONVA 4AVOA 3PY2A 5FEZA 1EJTC 4UTTC 1CPUA 2NVAA 2WNZA 2YBUA 1L8NA 2BDQA 3DG3A 2XIOA 2FQIA 5BRBA 4Z1BA 3PJUA 4IIDA 4QLJA 2YX0A 3VKKA 5HJLA 4U33A 2Y7EA 2VJXA 2ZYFA 4C6MA 3NXFA 3MYPA 1R3YA 4J2MA 4WOQA 1W1YA 3D3AA 4UTIA 3TR2A 2VQUA 1XKJA 5EFDA 1OC5A 3HGOA 2QGYA 2QUVA 4QDMA 4QJ3B 3NL2A 4HYRA 4XKYA 3LDVA 2CBIA 1FWGC 4FR1A 5GNXA 1DTUA 1QR7A 3KLKA 3VD5A 3ZMRA 4C1NB 3RYSA 2G3JA 1N8FA 2BSLA 2IQTA 1XPGA 5LA0A 3E02A 1RR2A 4U31A 4QFUA 4JDYA 3VCRA 4L4PA 3NEHA 2ISFA 3U2CA 3QV7A 5DMYA 1AJ2A 1UD8A 3TE9A 4AZHA 4DAFA 1ZALA 2Y6ZA 2G50A 2W27A 4DO7A 4F0MA 2Y63A 1C29A 3WQCA 2YXXA 1J6PA 3ITTA 4RE4A 5AHFA 4NJJA 3D5HA 5BROA 1PTGA 4S3AA 2BGNE 2Y8KA 5D2YA 1YE4A 1OGBA 4HD5A 2FB3A 2YA0A 3GIPA 3VTRA 2HNEA 3F7JA 3GC5A 3CQ0A 2FVKA 3EKLA 4GINA 4QAWA 1U5VA 4OVXA 2AMGA 2NUXA 2GUUA 4G5DA 3M7WA 4YVPA 1V93A 2VURA 4DUXA 2Z26A 2CZ5A 2F6XA 3RR1A 4ZB0A 2F2HA 5CZKA 4QR6A 2GUYA 3PG9A 1V02A 3AIEA 3OIHA 4PMOA 1NP2A 3BV4A 3N2XA 3NQMA 1KFKA 4DJEA 3EWZA 2H8XA 2PTDA 4A3YA 4AIEA 2V68A 1SYTA 3R0UA 3U4FA 4HK6A 1NFPA 3FSUA 1XBZA 5E70A 1AL8A 1LL6A 1NOUA 4XIMA 1FA2A 4GK8A 3NTYA 3AWOA 3R0KA 3VD7A 2H3DA 3FAWA 1TUFA 3W7MA 5DLCA 1KC7A 2A3LA 3QRHA 1WDDA 3GKAA 3LHZA 1EJWC 2OOFA 3DBPA 4OBTA 1Z7AA 1ZJHA 3POCA 3O16A 4CCEA 3ZS4A 4XG1A 2FHCA 2Y8VA 2V8ZA 1QAPA 2VOTA 3KZSA 2WMGA 3NZGA 3MHUA 2O9PA 1SFLA 3FVDA 1WDSA 4ADSA 1JDDA 3HPFA 2XTKA 4ZO9A 1EBGA 3KHDA 4FK9A 3OA3A 4TX8A 2WMKA 5LGXA 2W3ZA 1VBHA 2VM8A 1P4CA 2ZUNA 1KWGA 1VYRA 2WCGA 4Q22A 4UBPC 2XFYA 4OQVA 5GPRA 3G0SA 5E0CA 4ERGA 1OFDA 3APGA 5EA9A 2ACRA 4PTWA 4CCZA 1DIEA 2FKPA 2FDMA 1K7FA 3NA8A 2E67A 1IF2A 2GVYA 1RPXA 3WENA 4RNFA 3LEPA 5AC5A 5KETA 4EK7A 1JNEA 1E4LA 4UQBA 2PDMA 2BOEX 3EB4A 3COTA 3CUJA 2HCVA 2YL8A 3CAKA 1JDCA 3TUUA 4WF7A 4K7YA 4DZ5A 2G8ZA 3TJ4A 4RPPA 1H1ZA 5FOOA 4UNIA 5HNNA 4KWVA 2H9AB 3FY1A 2C0AA 5JH1A 3S2CA 3NPXA 5GJMA 1OJXA 3M64A 2QUUA 3LS9A 4RK8A 2OU4A 2DEPA 1QO2A 4DJDD 1IWPA 3BG3A 2BHZA 4JYFA 2ABBA 2BXVA 2IPWA 2INZA 4MB3A 3W76A 4DELA 4PTVA 3NDOA 2ZUUA 4MSSA 4HMCA 1ZSXA 2VGFA 2VCAA 3BPWA 2ZKMX 4XUYA 1V3HA 7ENLA 5HANA 1NP0A 1XYAA 4IQJA 4GACA 2WPBA 4MYXA 2E8YA 4Y2WA 4XZLX 3AO0A 2PRLA 1F9CA 1LOLA 3WLKX 1BRLB 4FEZA 1V4YA 4GQQA 3GW0A 2GOUA 2WZTA 4JY8A 1YDOA 2CIPA 1UC4A 4NILA 2BHUA 3AMKA 2BVYA 4DQWA 2X16A 4UOJA 4RE2A 3BMWA 4JCMA 1AW5A 4QG9A 3B03A 3JZUA 2WMHA 4J7RA 2BVDA 4JTGA 4DRSA 2XN0A 3ATYA 1QNRA 5CH9A 3IVTA 5HNUA 4Y9OA 4AZGA 3NQFA 2F8QA 1AMKA 2I14A 1LWJA 1EJXC 2FTYA 3EDJA 6REQB 1YHTA 1XIDA 3OQEA 1A4LA 2GK1B 1CGTA 4NUWA 4HK5A 1ISVA 1ESWA 4ZOBA 1GPFA 1VS1A 2NQ5A 4NHVA 6XIAA 2X09A 4O18A 1EOKA 1HT6A 2P0OA 1WOAA 4LU0A 1XIJA 2WNQA 1UJQA 4I5RA 2XH0A 3ARZA 4OV9A 4DIAA 4J3SA 5GJPA 3LXAA 4ROPA 2GOKA 1Q6EA 2OPJA 4H8NA 1VIZA 5E9XA 2F6KA 3I3EA 3SR7A 1O5QA 4XQ6A 4ZTYA 4EXQA 2KZHA 2W63A 4KCWA 4PBFA 5C9ZA 2ZA2A 2EPMX 3HN3A 4F2TA 3HJEA 2VZOA 4JTLA 4BQ4A 2V82A 5D9OA 2Z2UA 1XICA 1IT7A 2CZEA 1UH2A 3ZT7A 1XBXA 2ZICA 4GUHA 3QBUA 3QY7A 3AUJA 3WYZA 3DYOA 1US2A 1RY8A 2HK1A 4DUWA 3WMLA 1K6WA 1EJUC 4L1GA 4ZSUA 2Z7GA 4LVAA 4DPPA 1IXPA 2WSPA 3MWCA 5HMDA 4DJFD 1W2PA 2YCKX 2WHLA 1C3FA 3VYLA 4C6FA 1AH3A 4HCHA 4R9OA 1TV3A 3ZJ7A 1VBRA 1MW0A 5CG0A 1EA0A 5F2MA 3R4IA 4YVVA 4CD4A 4C5YA 2Y5SA 4UNKA 3S4TA 1CIUA 5K9CA 2CPUA 3QKZA 4UR8A 1UD3A 4GD0A 2PS2A 1LG1A 3IJQA 2DJLA 1L6SA 4RV8A 4X0VA 4C6DA 1T40A 4BS0A 4FR6A 3WQDA 3IVSA 1O6IA 3H2NA 3BLOA 1F07A 3H53A 4H7ZA 1UR1A 9XIMA 3VZZA 3GDBA 2QIIA 2TPSA 3MC5A 3EDDA 3WD0A 4AYGA 1OYBA 2XIJA 2E9BA 1UQYA 1VRXA 2XGZA 1E9IA 2HVMA 4PMXA 4PUUA 3INPA 3F2CA 5CAKA 1DJWA 3SY1A 4QEEA 1X6LA 1OCBA 3SQSA 1AZ1A 3BMVA 5DY2A 3UEQA 2YB1A 3EX3A 1LLZA 2QCMA 3TW7A 5BOFA 6TAAA 2X0YA 4LUTA 1JGMA 4NVTA 3ZQ9A 2J75A 3HQNA 1Y7VA 2PLJA 1PE1A 3HG2A 4D2JA 3A3WA 3R10A 3RITA 4RX0A 4GCXA 5D4YA 4WJEA 4LS2A 2OO6A 4PUWA 4IM4A 1WX0A 4B3ZA 4ZGYA 2ZRVA 1FWIC 2GJLA 2PODA 3ABQA 3ORWA 4AG0A 2FYMA 2V69A 3U5YA 1WXZA 4JR5A 1UIOA 2VEGA 3G6MA 2Z6IA 1PZ3A 5HUPA 4GG9A 1E0UA 3DX5A 4H4IA 3VIGA 3ZIZA 1ENUA 3RILA 3PZOA 1PL9A 4OWGA 3ARVA 4GXPA 3RO8A 1K03A 2W4XA 4RCXA 4ZE4A 3UJ2A 3BCJA 3LM3A 3DI0A 1JUBA 5AKQA 3SUSA 3OVQA 1A53A 4OOUA 3OP2A 4C60A 3UPBA 1GOWA 1MRQA 2CC0A 2FZDA 4JQ1A 4N4PA 3WD4A 1O60A 5CXPA 2CLOA 4EPEC 5LHEA 3QQWA 1TB3A 4B91A 1PX4A 2EAWA 3BZJA 2PAJA 2B7NA 1M68A 1XHGA 2Z00A 2FMNA 3UWWA 1UP0A 1EWDA 4L7ZA 4PA8A 4CD6A 1W9UA 5CPMA 5LXXA 2VVSA 2NQHA 1MEIA 3T6CA 4XAGA 1XUZA 3ZLGA 4JFWA 2EO7A 4Q8WA 5FJUA 3HFYA 2JKAA 4GWEA 1Z8AA 1SZGA 3WLIA 1P48A 2OX1A 3PN8A 3WJSA 2A3AA 1XI3A 2G5WA 4IWWA 1IV8A 2OZTA 3QOMA 5FF2A 4UFMA 1CDGA 1EC9A 3F2BA 1NWUA 4AZCB 3DCPA 3V0TA 3NR0A 1TJRA 5FEWA 3B8IA 1C9DA 1O12A 3URAA 1Q6OA 3UY7A 3LCFA 4ASTA 1LF1A 4K39A 2WWCA 3UXIA 4ZOEA 1AL7A 1VCVA 3U48A 4PUJA 2C1IA 2BWGA 3LBOA 3L2LA 3ENLA 1Z42A 1U30A 1LBLA 3V75A 3GIYA 1DWFM 3T55A 2DU2A 1UD5A 4ADUA 3GX9A 4GFIA 1H7WA 3N13A 4MYAA 3CV2A 1G4SA 3GHTA 2D73A 3TTEA 2W62A 1JZ3A 6TIMA 2HE5A 1EPXA 1DJZA 1NFGA 3QLLA 4QS5A 1Z48A 4QDPA 1BYCA 1RSCA 2RAGA 2WB5A 1E43A 3MWAA 2RHGA 1ZBCA 5U7SA 2FLIA 1OC7A 1IR1A 4AHPA 3QPZA 2FFCA 4E2VA 5BRQA 5LNRA 5DT7A 3CMJA 1XGZA 5F2LA 1DJNA 4ICNA 4UQCA 1D7FA 2OWXA 3TYDA 1UUQA 3S9ZA 2P53A 2ZZ7A 4W8AA 2PGEA 1KKOA 1A5NC 1GZGA 1P6CA 4KW2A 1TWIA 1FQ0A 3J7HA 1NY1A 3GU9A 3BOFA 3UZWA 4G9PA 2X1IA 3DGRA 4GUGA 2RUSA 3C2OA 4FLOA 3CUHA 3BAJA 3LQLA 1Z69A 4B2DA 2FHFA 3DFSA 3BOLA 4AF0A 3ALGA 4AWSA 2XVLA 3W1LA 3M4HA 4LUSA 2XDFA 3K4WA 4UTTA 1VLIA 3GUWA 1PIIA 4TQTA 4X22A 5BYWA 3GXFA 1K8YA 5E93A 3W7GA 1M9HA 4I8YA 3CEUA 2J7CA 4O8RA 3SY5A 1NEYA 1J6OA 1KCLA 1H4PA 4A3HA 4GQ0A 4BJHA 2PI6A 4FI4A 3P14A 4LBRA 1LBMA 1XH0A 3N4EA 3S5SA 4W89A 2H3BA 4P8UA 2C1HA 3QMRA 3GE7A 5FJJA 3PANA 2GGJA 3MSGA 2VC9A 1Z89A 1GKPA 4QP0A 4DNHA 1UP3A 3USZA 1JF6A 3QY6A 4JX4A 1TQJA 4E2DA 1AMYA 1XDLA 3E9AA 1SSGA 4IJCA 3NNTA 4AWEA 1TMLA 2E09A 1EBHA 3B8SA 3BG5A 3OO2A 4KFOA 1OGGA 3N2TA 4LVBA 3I6TA 1ITCA 1I2NA 4J9JA 2MNRA 3MKVA 4JTTA 2WVVB 3ANUA 3UZXA 5AYBA 3S1VA 3LCGA 1E4MM 3LLXA 2QUNA 2ZX6A 2J74A 1K02A 2BB0A 4KEMA 1AG1O 2OKTA 4TUFA 3CLWA 4MWAD 4NZFA 4GBDA 3A9IA 3GBDA 4L61A 1MMFA 5A6AA 1V6YA 4KEUA 4ZO6A 2VP8A 3TC6A 4KCUA 4HMEA 3DUGA 4LX4A 3TH6A 2ATSA 4MNLA 4BF9A 2WAGA 1LUCB 3VOFA 4Q8VA 2X0HA 3UJSA 3WFZA 4W88A 2C13A 2OWCA 5I3FA 2Z1WA 1SMAA 3WMBA 5B7ZA 4H00A 4E8DA 3EXTA 3M46A 3GTHA 1CWYA 5AHIA 3BGJA 3HPZA 4M6VA 1ZJBA 1VFFA 1J9YA 2YA2A 4PTMA 4B90A 1YNYA 4NAEA 1EIBA 3SJNA 3QPYA 3CL8A 3OPSA 3TW6A 4IFKB 3QFEA 2YDRA 1DVJA 1JUKA 2HS6A 5KITA 4CNNA 3CJPA 1CXKA 1OF8A 2PD5A 4QE4A 3WLJA 2OYKA 1J5SA 3DKLA 1JCNA 2FJUB 3ZR5A 4A2RA 4PCSA 4I5UA 4PN2A 1KRBC 5DRIA 3B0PA 3W01A 3DHPA 3GXNA 4K68A 5U4NA 3WK0A 3SO7A 1ZHAA 2XINA 3FDKA 1OINA 5LIYX 4Q3MA 1JQVA 2W91A 1R6WA 1JZ4A 2WNNA 3YPIA 2YZ5A 2HJPA 3F1QA 3QN3A 4DX3A 2NV2A 3AXKA 3C4UA 2PDNA 3QFWA 1UR4A 2ZCGA 1AH4A 1IGWA 1CCWB 5I3GA 2GSHA 3QXBA 1GOOA 1JPHA 3PTDA 4TO8A 3MVIA 3VGHA 3MUCA 4JIIX 4P61A 1SU5A 2GZXA 2WSYA 4X9SA 1TTQA 3MP4A 2DVXA 1GYLA 1P0EA 1P0NA 3B4UA 5AECA 3KBSA 4PUNA 1EHNA 2V5DA 2VDGA 3UGRA 5GNZA 4H2CA 5KZDA 2HVNA 3VK5A 3CIVA 3ABSA 4XWUA 2VOMA 4AD0A 1XXXA 3DKJA 4GLEA 3BK0A 1LJYA 1GTEA 1WZMA 2HPMA 1K9EA 3QQ1A 1QNQA 1G94A 3VGEA 2HK0A 3DC0A 4AD5A 2PDQA 3LHYA 4A2SA 3GH7A 3SCVA 1A3HA 2A0NA 3O1NA 3SRHA 4JKKA 5HPOA 1F8IA 5GNYA 1RCOB 2VRQA 3FLUA 3S83A 3DZ1A 2VC6A 1XWYA 2J8GA 3FFSA 3VXGA 4BZYA 4TTGA 1O1HA 1UKSA 1A4MA 4LCQA 1ELSA 3NIYA 3QZAA 3CZEA 3PF3A 3IACA 1H1YA 3NQ8A 3TSDA 4QISA 3E1F1 2PDXA 3PJXA 4PEKA 1F4AA 4G56A 2NWRA 3W7CA 5CZSA 3SQMA 1JZ8A 1XL9A 1OC6A 5G5IA 4REQB 2A7PA 1AQ0A 2PC8A 3SJ3A 3LSBA 5AC7A 4F40A 1RY0A 4JTSA 2F84A 1BXBA 1E4IA 1KCKA 1KCZA 3S2JA 4BFAA 4R9XA 1QMLA 5BZAA 4P8VA 3GVRA 1W91A 1LWHA 4RUBA 3RCYA 3CK5A 4RDWA 1KM5A 5C2XA 3TQPA 4XK2A 5KTLA 1VFHA 2XVKA 2YW3A 5ECUA 4H41A 1RA0A 1Q6CA 1O5RA 1XSJA 1DXEA 4B5SA 3P2VA 5D9NA 4UWMA 3WLPA 3TK7A 1C90A 1WZLA 3DYMA 2OFJA 3CQKA 8RUCA 3WCZA 5H6HA 2G95A 2YYUA 3PK7A 3DHDA 3N6HA 3W7KA 4O0QA 3KOFA 2FZMA 2PDGA 1EQPA 2WJDA 4CQ9A 3WH8A 5C70A 2QPUA 4JFTA 3NJ3A 3FXYA 5HWJA 1ZS2A 3NL3A 1VC4A 2CBUA 1AJ0A 2YCEA 3UQNA 2AAMA 2ZUTA 4H3DA 3VNIA 1KM4A 4ATLA 1XD1A 1B1YA 1F6KA 2QS8A 3IIVA 1IIGA 1V8EA 3IV3A 4KIEA 2WMIB 5HJXA 3WNMA 3U2EA 2RDXA 5C2CA 3MPGA 4LEFA 4B15A 1QPRA 5BOOA 5TAOA 4JQ4A 4GIEA 1J79A 3R1ZA 5D9PA 3C3NA 1RZMA 4IP4A 9RUBA 2GL5A 8XIMA 3VDHA 4UTUA 1E5NA 2V2DA 3V5FA 4H9YA 1S2VA 4JS3A 5J04A 4LH8A 2Q8XA 4GVGA 4K37A 3UY8A 3JR2A 1C91A 1VYSX 2WKJA 1Q6LA 5HMSA 3NAVA 3P81A 1W32A 4WQ6A 4F3HA 2X1TA 3STPA 3C0QA 2BTMA 1C8QA 3H2OA 2WZEA 4FP1A 4PL1A 3VNDA 1TUXA 4UTKA 3VOGA 1P5BA 4OFCA 5DCEA 4GPNA 3AIRA 4LV4A 3WLOA 3B0VC 1H49A 4Q4SA 3TCSA 1NF0A 1PEZA 4DZHA 2GUBA 1V0LA 3M47A 1KRCC 4EX4A 1A5BA 5D32A 5K2ZA 1PPIA 3P60A 3M5VA 1KBIA 1HQTA 1NFBA 3FAXA 3NQ6A 3K30A 1EB3A 2IUZA 4UFKA 4CN1A 4UOQA 3PZMA 4L4OA 4BI5A 5C9WA 4OUIA 5FAGA 4MLRA 1FCVA 3LLDA 5TNVA 4KWSA 2D2JA 4I7VA 4LF1A 2V5BA 4DBUA 5JUVA 3W7EA 2WC4A 3GR7A 5CZ0A 2OSWA 4GX8A 1CXLA 1CGUA 3O8AA 1KV5A 4R53A 1UR3M 1UZ4A 2OYMA 1GJPA 1CX9A 2HWGA 1AA1B 2QDHA 2PBOA 1KD0A 3UR8A 4RV3A 1SVDA 3VNLA 3AIUA 3N3MA 4HN4A 3UVAA 4DO4A 2PCEA 3NYZA 1S5WA 3L2MA 5DEZA 4IIEA 5D38A 1JDAA 4JNMA 4W5ZA 4IQEA 3VCCA 1GVOA 4S3JA 4WDWA 3LPPA 5CPOA 1IXNA 3RCMA 1JPDX 4PGLA 2W67A 2AGKA 3VUSA 3T1GA 4AY1A 1BTMA 1JPIA 2BP1A 1VEMA 1XYCA 4WJXA 1ZAIA 1DJQA 3THDA 4K7VA 3WF2A 1RBOB 3DHFA 2ZUSA 3DN5A 1R3QA 4F2UA 4QAIA 3W00A 1WCGA 3LUTA 4L5ZA 2Y5EA 5A6MA 2RFGA 4FXRA 1K4HA 2WLYA 2WSKA 3QH2A 4MWAE 2VFDA 3BICA 3GG0A 1M03A 1I6NA 4Z2KA 3BUVA 1KTCA 1HGYA 5FAJA 4ZB5A 3SGZA 3VDCA 2XGBA 3S47A 3MZNA 1BWVA 4L56A 4UMAA 1XPYA 3PUEA 1QU4A 1RD6A 4HGXA 4QSFA 4LUIA 1ZTVA 1QPQA 1KA9F 3N4FA 1PHWA 3CHDA 4JTRA 4NX5A 2G41A 4YPJA 3T07A 4H6KA 4FX6M 1H11A 1UIPA 2KAUC 5C7HA 3SCWA 1XIMA 2B4GA 1E6RA 2WZHA 3C6CA 4R27A 3EA3A 2GDVA 3SGUA 5FI8A 1K7XA 3S42A 2ATMA 1TMHA 2O9TA 1EF2A 3B3DA 5F4XA 5XINA 1RALA 2E68A 3N3TA 1EA9C 3ZYZA 3MS8A 1M41A 2PDYA 2BY1A 3NSMA 1RP9A 1LTDA 4PCFA 2OYLA 2WHKA 2O9OA 3FGCB 3IGSA 1W9XA 1XSIA 2R8WA 3VIJA 1ISXA 1R5YA 1TX2A 3GW3A 1RD5A 1J96A 1FP9A 2FPTA 2ZOXA 1FTXA 4XVDA 4B5NA 4FNTA 1TE1A 2WVTA 4ZL1A 5K4XA 4BF7A 2V5LA 5AHMA 1ISWA 1RP8A 1HTIA 1QW7A 1BVNP 1S5MA 4MUPA 1MFVA 1OEPA 5EMMA 3ZFHA 2YDQA 2OSYA 1K8CA 4IL0A 1UJPA 4L65A 4G7EA 3VAVA 1H7PA 5REQA 8A3HA 1K77A 4IG2B 4PMYA 2OR2A 2ZZ2A 3GVQA 3QGKC 3TONA 3L0GA 1H63A 3EDKA 4IIHA 4C91A 3LPOA 4JDBA 4D8AA 3GG1A 2WKLA 1PHQA 3IK2A 3TXVA 3O3RA 4JOMA 3KRBA 2E7FA 2PE4A 4XZBA 3BAIA 5JBDA 3CTTA 1X7IA 4MNJA 1AQFA 1Q8AA 3ZVHA 3CV1A 3OZOA 1JUEA 1XYMA 2VWSA 4Q4PA 1JZ5A 2BVTA 4KWWA 1AD1A 3TYUA 3H54A 3RXZA 1OD8A 3OIXA 4N6FA 4CD5A 4LCRA 4LW7A 1TPH1 3NQEA 3MMUA 3ELFA 1IZKA 5KZMA 3QY8A 5TIMA 1XQKA 1IEWA 3F4WA 1GQLA 3KRSA 2J9ZA 2QF8A 3LRKA 1HZYA 3ARXA 1OX5A 4FNUA 5D30A 3IWPA 1BFNA 1QTWA 3MI3A 4IJBA 2UY2A 1SFTA 4IP7A 4D6DA 4RLIA 3UCCA 3TLQA 2VDIA 3G0XA 1OK4A 1TTIA 2UZ9A 3TWAA 2V5JA 3LENA 2OOGA 5TD4A 3HGSA 1WDWA 3NZPA 2YBTA 3VOJA 1DJYA 2OCZA 8TIMA 5BOEA 1QHOA 5AB3A 4EPDC 1M3UA 2C71A 5IFPA 4O11A 4NZJA 1Q66A 2Y2WA 3WF3A 4ZODA 3GR8A 4L9YA 3QTGA 3U57A 1SFJA 1YE6A 2E5DA 3CNYA 4MDOA 1ECQA 4KS0A 1KXTA 5D37A 3NQAA 3GFZA 1W0MA 3RDKA 3UA3A 1NIUA 1WUEA 3E49A 3S1GA 3KCLA 4MZYA 3NQGA 3G18A 3DENA 2X0SA 1KBBA 4IHCA 1HKJA 2R24A 1CBGA 2AL2A 3HM7A 3FYYA 1E56A 1UH4A 4DYKA 1IIHA 4LUYA 3KVLA 3HA1A 3R25A 1ML1A 4U2YA 4AZ5A 3AYTA 1QT1A 1ZLPA 1IEXA 3L4WA 3UCQA 4YCOA 2C16A 1BWLA 3A3HA 4TX6A 3MP5A 3MHFA 2GWGA 4IG2A 1CLXA 1A0EA 4GVFA 4M24A 4LBUA 1H3GA 4GZJA 2GQ8A 4UR9A 2FTWA 3T0AA 1P43A 1T5AA 1MEHA 2AOSA 4FAMA 4UXDA 1CEOA 3BMXA 3UG8A 3CZ8A 2OLAA 4F9JA 1JCMP 4Q4OA 4JAWA 2BY0A 5AYXA 4AAJA 4Q7NA 4QM1A 5D8ZA 4EWND 1QOPA 1XW8A 3R8GA 3UR5A 4K8EA 1S1RA 4CVUA 4X61A 4G8TA 3H26A 3EOUA 4GNJA 4WGHA 1L6GA 4EXBA 4FNPA 3VKJA 1RLCL 4AWUA 3AMGA 5FL0A 4E0CA 5AFDA 1SJAA 3IJDA 4FF7A 4HTBA 1D7KA 2GGIA 3LGGA 4NP7A 1JFXA 2FZBA 1B3YA 4OGZA 1KBJA 1VBJA 1KO0A 3A9BA 1H7XA 2D20A 4JTEA 2DZAA 1J2BA 4H7VA 1I0BA 1TR9A 1Q6RA 2WVSA 4BCEA 4W85A 1R2RA 1UR9A 3W1XA 4WVXA 4WSKA 1K8ZA 1JEZA 2BS9A 1PTAA 3H22A 3AS3A 4ADTA 1PO9A 4X2RA 2R14A 1W56A 1US3A 1GYMA 2XUCA 3OBKA 4LOCA 3OBEA 4HHPA 3WG6A 5HOSA 1QATA 4UOZA 4MAVA 1DOSA 3U9IA 5C8BB 4YMZA 2WCSA 5F4WA 1GW9A 4H83A 3TU9A 3VIHA 3TOYA 2ZWYA 1XSKA 1I2QA 3TYBA 3QKEA 1FWTA 2YCLB 1W3NA 1F6PA 1CYGA 5JU6A 3DBNA 1HP4A 2E8ZA 4LEQA 4C7DA 5LA1A 1OFAA 1UKOA 3MYOA 3NM3A 2J25A 4Z2LA 1F3WA 3XINA 2OVLA 4Q8QA 3KOXA 4DXXA 3VFCA 2D0GA 1JCJA 2O55A 1K8XA 3B9AA 1BYDA 4FX7A 4LALA 5I0DA 1OWQA 3QW3A 4C5ZA 4O10A 5I23A 1BQGA 3DIPA 2VRKA 3DXIA 4GISA 4YCPA 3SCOA 3BLKA 3IUIA 2QIWA 3HV9A 2EPNA 3TYAA 4I6VA 4O1FA 2Y89A 1VLWA 5BXSA 3HGJA 2G97A 3CPRA 3N4AA 4BQ3A 1NQ6A 1P0DA 2PP3A 4AX6A 2EJAA 3IIXA 3SRFA 6ENLA 4TV6A 3PUOA 4WKHA 2RKXA 1XISA 4R3UA 2ZE3A 3WQVA 2GQ9A 1QW9A 2OQYA 1TVPA 5HPCA 5D02A 5IXEA 2R1NA 4H9TA 1OX4B 3NWRA 2WHMA 4IQDA 3N9SA 4MAZA 1W5OA 2JE8A 4RDYA 2W9MA 2ZUMA 3VIMA 3W1AA 3S5YA 3RO6A 5KMYA 2IPFA 3ICJA 3SGGA 3WUBA 5HK4A 2P76A 1FWWA 3QZEA 5DMNA 3BC9A 3L4YA 1KKRA 4R5EA 1OX6A 3SSJA 3EKZA 1NDWA 3WH9A 3IJ6A 5FIPA 3S1XA 4J4KA 3L5AA 3CHFA 1OFPA 3ZO9A 3OYXA 3LB0A 1SJCA 4EAYA 1KFWA 1JRCA 2F38A 2CFFA 5IBXA 2CLEA 2LLEA 4BI7A 4FPSA 4HHMA 4P5UA 4NAFB 2ZA1A 4JYEA 3MDWA 4R34A 3LN3A 1YPXA 4N2YA 3IIZA 2GDUA 3ECQA 4Y8FA 5CPNA 7CGTA 3ES8A 5EYWA 3N14A 3SUVA 4NY2A 1V6VA 3W1UA 4E2OA 1AQHA 3BV7A 4XZNX 1M7PA 1JZ7A 3LNPA 3A24A 1R3SA 1BSIA 4H6EA 2YLLA 4PC8A 3VIFA 4HK7A 3TV8A 4GJ1A 4QGCA 1OVDA 1OFBA 5ABFA 4I9JA 3BVJA 4JHMA 3GKFA 2Y70A 2DZXA 4Z08A 4A8LA 1XYBA 1R2TA 3V5OA 2EGZA 1SW0A 2BY3A 2ZVRA 4IMAA 4ML9A 3TMLA 4HTYA 4ZQOA 3ZSTA 1Q6GA 3LLFA 1XLIA 4KFNA 4AEOA 2VT0A 4X63A 1GNXA 5EMJA 1RQHA 1Y5VA 4A8RA 4MKNA 1W3TA 2V5CA 5CSSA 2V9DA 4LNCA 1PKNA 5EPDA 1O95A 5DBTA 3FA4A 4WJ8A 2FGZA 4NYYA 1XS2A 2PGRA 2XH7A 4CD8A 4DY1A 4DO6A 1SMDA 3WY1A 2Z7KA 3LTPA 2YL6A 4XV0A 4W86A 3A64A 4YU1A 4ZR8A 4BHYA 3GNPA 3SUUA 3E2RA 5LGZA 4MJMA 2XM1A 3GC2A 3UG4A 2J13A 3GHSA 1HJUA 1UMYA 4F0LA 1V51A 3D3FA 3E5BA 4D72A 4JX6A 3AAMA 4PL2A 1B54A 4IP5A 3P7YA 4HNOA 2JKPA 2ISDA 1ICPA 4H2HA 2BOFX 3U4AA 3ZWSA 4F2BA 1E0TA 2HNHA 2QLYA 5G2IA 4E2BA 3UGVA 5A6BD 1HL2A 3AIQA 4HCLA 4N0RA 1QDSA 4JQAA 5H1WA 2XG9A 4HYVA 3K8LA 3GXIA 1ITUA 3UF9A 1WZAA 4N42A 1GQNA 1WDPA 2X1UA 2V67A 2QYGA 2REQA 3WK2A 2VZVA 3MJYA 3K1GA 2VC7A 3POHA 1SGJA 4UQDA 1R3RA 3S6DA 1U5JA 3AC0A 2E6YA 1IGSA 1CXFA 3STFA 1FWFC 1GORA 4GABA 1H2JA 2A1YA 1US0A 3QM3A 1KFCA 4JN7A 1H41A 5KZEA 3OHMB 5C54A 2Q71A 5DN1A 2FVLA 1E55A 2EKCA 1M04A 5HULA 3B40A 1XUUA 4JNYA 1V7AA 4ZSTA 2YZRA 4LVFA 3ISIX 5I03A 4KCVA 4LAMA 3HIJA 4MGGA 4TX9A 1GYNA 3W37A 4KCTA 2XH4A 4Z1AA 1HNYA 3GHRA 1QPOA 1SUXA 3TFCA 3NO3A 3LRLA 3S0CA 2YB4A 2P3ZA 3A5VA 4E8CA 4L80A 2PLCA 3ZXWA 3LI1A 4MPQA 3URNA 3QF0A 4LCSA 3CM4A 1XG3A 2DDXA 4ML4A 4DN1A 3H21A 1A5KC 1PYFA 3TYZA 3FX4A 2YCIX 1OF6A 1KFBA 1W2VA 4UFHA 4Z2JA 2HVOA 2GLKA 3RUBL 4D71A 1F5ZA 4ZXOA 2NLIA 2A3HA 5LIXX 3JS3A 1V6XA 1E72M 2POZA 3CU2A 3ITXA 2PD9A 3W2UA 1N2VA 4PSRA 3O9NA 4Z0JA 4GZIA 4QRNA 4ZXLA 2DUAA 3C8NA 4S23A 1EJ7L 5DANA 3M5XA 4ERAA 4J28A 3HO8A 4Q8NA 1FOBA 4G7FA 2VUNA 3AWNA 2DVUA 2Y5JA 1TRDA 3E6EA 1Y5XA 2CKRA 2QJIA 1R9XA 3FW6A 3UPWA 5IDIA 4DF1A 1UYQA 1CT5A 3G3MA 4FIQA 4P7LA 1XLKA 3RPMA 4GZEA 3PC0A 1XLCA 3MP3A 1BYAA 1W54A 3T78A 3R2GA 2CKSA 1JXKA 1B2YA 5BW6A 2QCDB 2AKMA 5I3KA 3L9CA 4K1WA 4N02A 4WDUA 3L67A 3WJWA 3FYPA 1TVLA 2ZX5A 4YHGA 3UZJA 4UFLA 5D8WA 1PYMA 4L9XA 3E3HA 2I56A 3PG8A 4MHBA 3QC0A 3T42A 1VJIA 3EOLA 4F66A 3VDAA 2CWXA 1F3XA 4WXZA 4KBXA 2WNWA 2J66A 1V7YA 3PZUA 4DJFA 2BOGX 7A3HA 1FCBA 3VD4A 2WQPA 4NIRA 3BANA 5FF0A 1K6AA 2PWFA 4XO6A 4WXYA 5CLWA 3UZYA 1DQUA 5G1TA 3NG3A 4UQAA 1VHNA 4H01A 3MSDA 4I7UA 1X1OA 2EXOA 3LBMA 3PBMA 3LMYA 1BXNA 1KGWA 2PUZA 3QGAC 3F4CA 3BAKA 4AH7A 3QTPA 4NRRA 1W8GA 1ZJIA 3D47A 1CLVA 1Q3NA 2CNCA 5HR6A 3KL0A 1TKKA 3C2EA 3NCOA 3WBYA 2PWUA 1A3XA 3TZNA 2Q09A 3OBAA 5KEZA 1VFUA 2PPGA 4XD6A 3DOPA 3WL0A 3DYPA 4HPGA 4US5A 4HQVA 1JAKA 4Z2IA 3BAYA 2ZZ4A 2NV9A 2ZRZA 1LQ0A 4N9DA 3EMZA 4HKPA 3AXHA 1TSIA 3EPOA 1ME8A 1Y8BA 3QJAA 1L2UA 7XIMA 5LA2A 4PMDA 1VPXA 1GONA 2WBGA 4N6EA 2PTZA 4R7JA 3FYOA 3W81A 1CGYA 2BX7A 4NXKA 1QI3A 1GT8A 4B16A 3ZJ6A 1RQEA 3DHUA 4H9UA 3VIPA 4AFYA 1F4HA 3M0JA 5HDRA 3FNDA 4AIOA 3QV9A 1Q6FA 3SN1A 3C2VA 5F1VA 1XRTA 4JIHA 1G01A 3FDGA 1Q2RA 3VKDA 1C7SA 4UR7A 1IWBA 2OTDA 3ID7A 5IM51 1U2YA 1QK0A 1K9DA 4WEVX 2QPSA 3L4ZA 2E9MA 1R30A 2FHBA 5AVHA 4GVHA 1P1MA 2C91A 3AYVA 3MB9A 3B0UX 2ZZ1A 2WMJA 1I2OA 1VP5A 4HU3A 4KMQA 2Z1KA 1E73M 4K8GA 2Y24A 3P3BA 3PZIA 3U2OA 1UW9A 1CLKA 1J01A 4ZO8A 1K9TA 3IGHX 3IPWA 4XTIA 3DECA 4GKLA 3AIBA 3FN9A 3AIWA 3R11A 4B3KA 3PZNA 2Q02A 1U1UA 3ITVA 1FX6A 2CZVA 4GRSA 4JICA 2VFEA 4I3GA 1UH3A 3WUGA 2YYTA 2Y8UA 3TLLA 3GTIA 4JTDA 3IAPA 3Q37A 1DJIA 2JBMA 4L1XA 4ZA0A 2J7GA 3MY9A 3ONBA 1XLHA 2QULA 4ATWA 1J11A 3WDJA 2A21A 4AMAA 4Q8MA 5M2FX 1Q4WA 3W27A 2QW5A 1THFD 2X8RA 3ABXA 3U6WA 4EKJA 3OLEA 1IZJA 1ONWA 1XRSA 3HG5A 2J8FA 4MLJA 4O52A 1OFQA 2Q3RA 1Y0EA 2WJFA 4MFDA 4FOJA 4MZ1A 4YTQA 3PJWA 4HB7A 3W1MA 4QCEA 4A3QA 2QZRA 1B4KA 3MMWA 4O28A 1UKQA 2PDBA 3AHYA 3EA2A 3RG6A 1H0IA 1YXCA 2DIJA 5T26A 3M0ZA 2Q3OA 1MSSA 4QJ4B 1WZKA 5CZJA 1GOXA 4H8HA 5E6YA 3SCRA 2QJHA 5AHLA 1KFJA 2ZE0A 4MPKA 5EGRA 1E1CB 4FO4A 5ABTA 3TQ0A 3RAOA 4UQEA 3R5EA 1IZCA 3SECA 1SQ7A 2R9RA 3W2NA 4XSMA 2G3FA 2VFHA 4M51A 1K4GA 1ZRQA 1A0CA 2O0TA 5HINA 5C2GA 3PPHA 2MANA 1S1PA 1I4NA 3N6JA 3NZQA 4L4LA 1F2JA 4PH6A 4AZBA 2VX5A 3EEGA 3CWOX 4BK9A 4N9CA 4ACZA 3N2CA 1BXCA 1BGAA 3QLDA 2WC7A 1XV8A 2PDWA 2TODA 2V63A 5GJNA 3P74A 3NZRA 4GY1A 2Y62A 4Q8TA 3RRAA 3TYEA 1QHPA 2XN1A 1HL9A 3GYCA 4XBJA 4A8NA 1TIWA 1A5AA 2YL9A 2BG5A 2Z2AA 1JL8A 3SI9A 1X8FA 1EP3A 4M6QA 1O7AA 2BY2A 2NXGA 1T8XA 1RVKA 4AU0A 1TV5A 4CU8A 1OB0A 2ZDRA 3GNNA 2GVGA 3VNZA 4S3BA 4JQ2A 3K8KA 1A5SA 2OEJA 2JF6A 2Y7GA 3CQHA 5BXRA 3B9OA 4LS1A 3W26A 3WLMA 3T9PA 3WQ5A 4LYPA 1E15A 4GYJA 4O17A 2EF9A 1J0HA 2FZ9A 1CZ1A 1JVNA 3AXMA 3H2AA 3M0MA 4UTHA 1I9CB 2VR5A 1TV4A 3K13A 3BTNA 4B3LA 1KQZA 3QGVA 3GUGA 1RA5A 3DFOA 1DWGM 1TPFA 3A3XA 3EWXA 1I45A 3AZRA 4MKSA 3UBPC 4LRSA 4Z42C 1I1XA 4BQ5A 2TSYA 4NI8A 4U2ZA 3WDHA 4M1BA 2DZTA 2I7GA 3G8RA 2IW0A 4GYPC 5G4HC 5E0KA 3NQ7A 4Q8PA 4CCCA 3HBLA 3KWXA 3ANVA 4HHHA 4WX2A 1A80A 2NSOA 3LTYA 2J9YA 4PSPA 4JFUA 4L6DA 4B5VA 4ZVJA 3SQLA 1DBTA 3BARA 1G6CA 1LT8A 3PZ9A 2Y85A 2ZRWA 4J1OA 1M65A 1EIXA 1EH9A 3W2JA 4DWSB 4BKNA 3Q94A 3EBVA 2FPYA 3BH4A 1EP2A 4H19A 4YHEA 3C86A 4QBXA 1W9PA 1EDTA 2DSUA 4CKQA 2B7OA 5LNSA 3OEXA 4INFA 4LRTA 1ADOA 1RUSA 1S3HA 2CHNA 3CZGA 1VJSA 2ALDA 1TPUA 3B0XA 3W29A 5H8MA 4MZ8A 3NPWA 3VCNA 3WF1A 2OT0A 4ICMA 3K2GA 1V3KA 2CETA 1I0DA 5EMKA 3FJ4A 3CGTA 3E2VA 4MWAA 4FHAA 3VX1A 3C2RA 5T9CE 2V3GA 1S2CA 3BJSA 3WBAA 1G4EA 1G9HA 1B3ZA 4C1KA 5CC6A 3RM4A 1UHVA 1F3EA 4BWLA 3IRDA 4YLWA 3WLQA 4W9TA 4H6RA 4YTUA 2E9LA 3H2MA 2ANUA 2FVMA 1R3VA 2DSWA 3OW1A 3RLUA 1UWUA 2X05A 3DFPA 2NX3A 2PU1A 3OLIA 1GZJA 5D09A 3WN6A 3HZ3A 3REQA 1FDYA 4DM1A 1DE5A 3QYSA 2D24A 3DAQA 3B8UA 4OBSA 3EWUA 2XN2A 4WGXA 1X39A 3AXIA 4V1YA 2HS8A 1VRDA 3WD2A 4H9XA 2XYLA 1HW6A 2QGHA 3KBJA 4OIFA 4QROA 2DQWA 3OG3A 1NDYA 3VKCA 2V2HA 4B9YA 4TVDA 1WOBA 5AY7A 3TQVA 3BQ5A 3MUAA 2QJNA 4TU1A 4TOQA 5J5DA 1BSLA 2RDTA 4U5IA 1E1EA 4KH2A 4NKCA 2AAAA 1D3GA 1OCQA 2OGJA 2ALRA 4ZMGA 5LHFA 1ZNNA 4HA1A 3M0LA 2GJXA 4RXGA 2E77A 2VYOA 1H62A 3MU7A 4UZSA 1PKMA 3A23A 1KCXA 3TQKA 3UYIA 3HV8A 3WNNA 4Q8UA 3GYEA 4A29A 4EVZA 5HQLA 1W9DM 3OZPA 1KRAC 1FXPA 1U22A 5JH2A 1NM9A 2QVHA 3MDUA 5FJIA 2HBVA 1UWIA 1JYNA 1CENA 4IGHA 3UJFA 2EPHA 4YXGA 4O0ZA 1XIFA 1GJUA 3SW6A 1IT8A 1PAMA 4EE9A 1KM3A 2GJNA 2Y7DA 3HGRA 7TAAA 3GXTA 5JMUA 4XD3A 4OU1A 2CLMA 1WQ5A 3CUGA 4HA3A 4KGJA 1X97A 3H4GA 4O14A 2ASHA 3VDGA 1GVEA 3ITOA 3WNLA 2F2KA 1FY6A 4HIBA 4KERA 3AMCA 1QI0A 3ALFA 5I77A 5EU9A 3LOTA 1EYWA 2PTWA 4NSBA 2JIEA 1OHLA 3G77A 1CGWA 2NQZA 2OELA 1GHSA 4UTLA 2CLFA 1DORA 1D8CA 2YL5A 2G3NA 4K38A 3NQCA 3TXZA 4AD2A 2FZ8A 4YWSA 1W3KA 7ODCA 4Q6XA 2VFGA 3G1SA 2JK2A 3MUXA 1J0KA 4MNKA 1KR1A 1D3HA 4MVAA 4C1NA 5MKGB 1HUVA 3S46A 2XFWA 1F7BA 3GZAA 5E09A 4HOXA 1MXGA 2PZ0A 4B5UA 3WUEA 4IQLA 3PBUA 1X1NA 1TA3B 3PS7A 5IHSA 5PTDA 1IWAA 2NQJA 2PCQA 3ARTA 4ZFCA 5D33A 9CGTA 2D23A 1RQBA 4XZIA 2ABAA 4C7GA 1Z9AA 1V77A 4Z2HA 1H7OA 3GXDA 3A5FA 4H7CA 1PX3A 1W1VA 3H70A 3R12A 3O05A 4R88A 2PMQA 1V0MA 3C8FA 1QOQA 1TWZA 1ZU8A 3OZYA 4HP5A 4MY1A 5BMWA 3WKZA 1FVPA 3T44A 4NYUA 3ZZ1A 2POTA 4PMNA 4RZ6A 4M7TA 5XIAA 1Z6KA 7REQB 3QW4B 2F7FA 5I00A 3QEZA 4DPQA 4G6CA 2D3NA 2QCCA 5I3HA 3BLIA 4L1WA 3CPGA 2ZTKA 3LK6A 2P88A 2XSBA 5EKYA 2INFA 3MI6A 3EAUA 3QMSA 2BVWA 1G4TA 2OGYA 1OSEA 4IMCA 4DUOA 1J93A 5CGQA 3H7UA 2TRSA 1L6FA 3CS2A 4WZHA 3VM7A 1TX0A 4Y90A 1XIBA 5AHNA 3R89A 3EMCA 3VO0A 1DPMA 5CGTA 4LAKA 2A7NA 3BE7A 4JGDA 3VIIA 5HBFA 2PB1A 3DEQA 4LVGA 5LSMA 1FWAC 1YPFA 2GYIA 5BCAA 5FCZA 1VFLA 4IPIA 1DP0A 1WKFA 1KXHA 2ISVA 3E0WA 1B3XA 1DEDA 2XPKA 1FFQA 4J3UA 5F2GA 3TDFA 3AALA 1LM1A 1EGMA 3DG6A 5GQBA 4RJEA 3ABOA 4PCPA 1P7TB 3T0BA 3VILA 1MDRA 2OZ8A 3RGTA 3IEBA 4ATDA 1VCGA 3LYEA 1JFHA 2B81A 3SFKA 3GM8A 1QI2A 1UZ1A 1VKFA 4ES4A 4TVUA 1GVRA 1GVQA 1KWKA 4BF5A 2WM0A 5FESA 2H9AA 3HPAA 3TSMA 3C61A 2A79A 3MUY1 2D1ZA 3VGFA 4LVDA 2XVNA 1OIMA 1O1ZA 1MW3A 1TWDA 1LBFA 1JZ6A 1PXGA 3PSVA 3KW3A 3FS2A 4BY3A 4AXKA 2Y0FA 4JTIA 4RPQA 4XB3A 1KFEA 1HKKA 4PB5A 1FWCC 3MA8A 1FUYA 4US5D 2C1GA 2C8NA 4D6JA 4LFYA 1HJQA 3WF0A 3PULA 4LANA 4IZGA 2VNCA 1UG6A 1BRLA 3IJ9A 4XVEA 4MJ2A 2I9EA 3PB2A 1W9VA 4PBEA 2VC5A 5AC8A 3HMCA 3WLNA 4IXXA 3PFMA 5A6SA 3AFBA 2W92A 1QOXA 2GPTA 1CXHA 3DH7A 3VKBA 2VFFA 4WY0F 3BURA 4CN6A 3UR7A 1EGZA 2P0IA 1OFRA 2EPOA 2YA1A 6REQA 4AW7A 3FEQA 4FZIA 2GK1A 4AD3A 3XISA 2ZTJA 4HPJA 2PWDA 1Y65A 1OBAA 4GH3A 4EPKA 3CEPA 5DXXA 3HTWA 3C2YA 1EO5A 3L4VA 4QNEA 1HKWA 5CJ5A 3GK0A 1TWWA 3KAOA 4ORIA 3QHNA 3CV6A 4GI9A 1W6TA 1W3LA 1TG7A 1VYPX 3MKKA 3W2LA 4QSHA 1LP6A 1EUNA 2Z24A 2C14A 1WP6A 3UFYA 3OA5A 1LOSA 4M5PA 4IX2A 4X0NA 3PZGA 1FDZA 4OV4A 2AQWA 4XZWA 4NJGA 3G6LA 1JPKA 5A6JA 2CBVA 1JCTA 2ZUWA 3GTNA 3RLGA 1ISYA 4KPLA 3VD3A 2AQOA 4AHOA 5DX7A 3P62A 6XIMA 3E38A 3BJFA 4MADA 4B92A 2E5CA 2VEMA 4IUOA 1QNOA 3LMZA 4RNHA 2W79A 4WY0B 1RH9A 1FHVA 3R13A 5JIPA 3CUFA 2GSJA 4HU0A 2E40A 1PWMA 1UROA 3V18A 3V0UA 4DLMA 4FLQA 3NQDA 2X30A 4XAYA 1SJBA 1W1A1 5GVJA 4C6JA 2XWEA 1GVFA 1YXDA 4S1FA 3NDYA 4ZENA 4BA0A 3IVUA 4JIRA 2Z27A 4HNLA 1WV2A 1KBKA 3D46A 3KVKA 3WFAA 2OLHA 3TR9A 2ADAA 2DORA 1JULA 3OTRA 4C65A 5MHBA 1E6QM 1Q8JA 1TJ2A 3HG3A 1IEQA 3CUIA 3PPFA 2WCAA 4E5TA 1PS9A 4Q7BA 1FKWA 3NVDA 1R3TA 3WDPP 3PJTA 1FWRA 1ZCOA 5C5YA 1HGWA 2Y1HA 1MUCA 3KS5A 4AWTA 4L6HA 1EX5A 3GU1A 4YVXA 1GK8A 5I79A 4GC4A 4C6PA 1F05A 4C7FA 1K1DA 1AODA 5T91A 4QG8A 3ZLFA 4GIAA 5DO8A 4ZQRA 3BG9A 1UR2A 2YDAA 3VOIA 3WQ8A 1TZZA 2C0HA 5G4EA 2C15A 3LCXA 3UNDA 2QR6A 2WSQA 1UA3A 4FNRA 4XAFA 3WL1A 4JEJA 4RZ4A 4GOAA 2V3DA 2HPIA 4HNUA 2PZNA 5DMMA 4XZ9A 2H8ZA 2WK2A 1V0NA 2D22A 2WZMA 4MMWA 4PTXA 4QXIA 2V5KA 1OIFA 4HSNA 3F4NA 3S5NA 3CAQA 1HKMA 1DWHM 1SO4A 2FPVA 5KINA 1IYXA 4ENLA 2VDHA 3TTOA 4N4QA 3QZ6A 4Q4RA 8CGTA 3DU0A 3S9IA 2EG8A 3R0DA 2HZGA 4C1LA 2CLIA 3M43A 2GFTA 3ARSA 3TNBA 3FCPA 1T41A 4WKAA 4HBKA 3G24A 5CKSA 1KQYA 3WJZA 3WBWA 4TV5A 5EMUA 3W1RA 2JGYA 3C5QA 2QMJA 1GQIA 2PDJA 4M3PA 3W88A 3PZQA 1UWSA 3PWIA 1R86A 3MI2A 3RX4A 3HPXA 4W7UA 4O1CA 3HURA 4B9ZA 1ZP4A 3E96A 2QEZA 3WQOA 1EO7A 2OWWA 1M7OA 2Z0IA 1ZZMA 4NJHA 1K70A 3QR0A 1RHCA 4CQCA 3PHAA 4HN8A 1VBUA 3U5UA 5I5RA 1L0PA 2P5NA 3G1HA 4XD5A 1J0JA 1X38A 3FJ6A 4A22A 3Q2DA 4NF7A 1LQ2A 1W5NA 2CLLA 4WDXA 1ZP3A 3FKRA 4JX5A 2XIMA 1WAWA 4HZ8A 3D0CA 1TYGA 4W5UA 3O7UA 4AZCA 3V16A 2INEA 2HDJA 1TJ1A 1RBLA 5A69A 3HMJG 1XBVA 4OBRA 1PBGA 1YNPA 3NUKA 3N11A 3CB3A 4IT1A 3L4UA 5A94A 3UPMA 4HCDA 3PP7A 5HJYA 3K4DA 1O94A 3VNYA 5H8PA 3WQ6A 1XIEA 2DIKA 5EMYA 1Q7QA 2O7QA 3RIKA 4QEHA 1YMYA 4O4VA 1Q2SA 1NF7A 4FNQA 2VEIA 2G0WA 5AHEA 1X6UA 3N17A 2GQAA 4KESA 4NRSA 2JFEX 2HISA 2JEQA 1W31A 3ITGA 2YCJA 4XBSA 3SSZA 1EOMA 3GC4A 4C6NA 3CTLA 3MSYA 4NG3A 1UQZA 1B0IA 3TIMA 1HO1A 1PJ9A 2UY3A 3VOCA 3LGEA 4GNKB 4KRZA 3LGDA 2XIBA 2OQHA 4LS0A 4DI8A 4ECLA 2HTMA 5D05A 1QI5A 4IFRA 3PPGA 3RPTA 4E6MA 4L9ZA 1XJBA 4GXMA 4S3FA 4JIEA 5BMXA 3T2PA 1MWOA 1VFTA 2UV8G 2ZRXA 2OX4A 3F4VA 3B06A 3KOWA 1CB7B 2IKJA 5HXMA 3S2NA 4DXVA 1LORA 3R58A 3BLLA 1NH6A 6CGTA 3I10A 2DPEA 3KL3A 4D8LA 3NVTA 1EDQA 5EMLA 2WOQA 1VFSA 2VMFA 3EB2A 3VX0A 1JRBA 1DIKA 3AXXA 2CZDA 2E28A 4WKFA 4I9AA 4J40A 3UWVA 1SSDA 1EF3A 1XC4A 4Y8EA 3I7RA 3UXLA 4CVWA 1VIWA 1TTJA 1PSCA 2DZBA 1Z3NA 3GVWA 1KW1A 3G1XA 3P84A 2P10A 1MI3A 1E6PA 2QCHA 1OD0A 3EOSA 4K8HA 4LYQA 1Q63A 2C7FA 4M0XA 1XQLA 1EP1A 1Q7MA 2QV5A 3OQ8A 2VGGA 2VWTA 4OJYA 3UG5A 1QO5A 3VIOA 1XH2A 2TYSA 3LPFA 2DIEA 4MY9A 3SZ8A 1PTDA 3OVGA 2J7EA 3MCNA 3WLLA 2JALA 2NX1A 2ZC8A 3CXOA 1KM0A 4QHRA 4J35A 1QK2A 2QT3A 3E0VA 3GH4A 3TA6A 1GOMA 2Q01A 4WSHA 4GVIA 1YTDA 2JKEA 3VINA 3KFTA 3NO1A 3VI2A 4B5TA 3IV8A 1E40A 1VB9A 4PE8A 3ATZA 3LV5A 4MB5A 5E0FA 1JJKA 1R85A 5B80A 2YPIA 1AZ2A 1MDLA 1FDJA 1LLWA 2DQXA 4PULA 2NT1A 2QUTA 4FALA 4O12A 1JR1A 3IIOA 1UP2A 3WJYA 2WVVA 2XIQA 1VD6A 1XLGA 1YDYA 2E1WA 2P3EA 2DFAA 3XIMA 5HA7A 2XSAA 4KRUA 3ZOAA 1N8WA 1ZFJA 2BFGA 3CQIA 4IMGA 3B9NA 4GQRA 3T05A 5D2VA 1EJRC 2DSVA 2QCNA 4DF2A 3UWYA 3EWYA 1DIOA 3CPUA 2ZXBA 2QCEA 1IXOA 3SCUA 4IIGA 4DO5A 3HPSA 3QV6A 3BSMA 1J2WA 3CUZA 2VZSA 5FJOA 1LUCA 1E0WA 3NL6A 1H09A 2E1DA 4DBSA 1BVZA 3NQVA 3V7PA 2J62A 4ZE5A 3SADA 3WNOA 2QNEA 3N04A 3W3OA 1F8MA