1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
molecule tags Structural genomics, lyase
molecule keywords 2-deoxyribose-5-phosphate aldolase
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
1R46A 2QCEA 4JDBA 2E5BA 5KITA 2Y85A 3GDTA 4AH7A 1W56A 3LV6A 4I7VA 1W5OA 5LHFA 4XTDA 3EWYA 4Z0SA 3SJ3A 4JTFA 1G4EA 3TKFA 3HGRA 4AHPA 4JYEA 3PB2A 2YX0A 3W7HA 1QPOA 3QEZA 1ADOA 3I7QA 2ZZ5A 3G0SA 3LX9A 4ZQOA 1W5PA 3TSMA 1MXSA 3W2NA 4LU0A 3TXVA 1YXDA 4PCFA 5HUOA 2RKXA 1TPEA 2J88A 3W7JA 2TMDA 3N19B 1ZAJA 1KFEA 2FDSA 2ISSA 1QPNA 3CC1A 3PUEA 4CQAA 2JGQA 2DJLA 3TMLA 5FI8A 3WJWA 2YXGA 3W83A 4UTWC 3TC7A 3M47A 4O18A 3VFLA 4NJHA 5AHNA 5BNKA 1BEUA 1TV8A 3HMJG 2A85A 4R34A 2VFDA 4JTEA 1UB3A 4Q33A 5FF0A 3TMQA 3NGJA 4NZJA 2QCDB 1QO2A 3P60A 3OVPA 2I1OA 3QC3A 3OIXA 3NPWA 3MHFA 2IQTA 4ONVA 1LP6A 4R33A 3GAYA 2ZZ3A 3W7RA 2OCZA 4LY8A 3GB6A 1PCKA 3F03K 3QPYA 4NU7A 1M5WA 4AF0B 3S8HA 2RFGA 3E49A 5J5RA 1TPC1 1V5XA 2CW6A 3GR7A 2B7PA 2VFIA 1YDVA 1AL8A 3QMTA 3NNTA 3MW7A 3VI2A 4EIVA 2Y89A 1I45A 3M7WA 1W1ZA 3ATYA 4YWIA 4AVFA 1U83A 2J9XA 4LVGA 3NXFA 1TPB1 1U5JA 3M41A 1OX5A 1LBMA 2Y63A 2QJGA 2R91A 1VPXA 3C2EA 4HNNA 4ADUA 2ZA2A 2CLHA 3PBUA 3GDMA 2ZZ2A 4C1LA 2ZTJA 4JXCA 3BLEA 5DY3A 1QPQA 5EA9A 1GVQA 3TUUA 1EA0A 5K4XA 3LCXA 4XBKA 3NA8A 3SW6A 1MO0A 1W31A 1I2RA 4LRSA 1H1ZA 3T44A 1FDZA 2E5CA 3I68A 2ABAA 4GUGA 4UFMA 2CZ5A 3BK0A 2CLMA 3WJZA 4MIMA 1VGAA 1RVGA 3C52A 1JQXA 1GTEA 3JS3A 4UTLA 5HWJA 1OFDA 4PL2A 4CCEA 4FF7A 4NX0A 3UY7A 1IXQA 3TQVA 1L6YA 3V1PA 1AMKA 1LTDA 2H6RA 3G8RA 4MYXA 5CSRA 5A5WA 2Q8LA 4DO5A 4LS1A 1Q6LA 3FEMA 4JTKA 4N6EA 2AAMA 3N34A 3LHYA 3C61A 1JVNA 3I65A 4FIQA 3W1LA 1QOQA 2ABBA 2QDGA 1VLIA 1W3TA 1WQ5A 3MUXA 3DHDA 2FB2A 3TSDA 1TPH1 2TRSA 4JDYA 3SR7A 2G95A 4IGHA 5LNRA 2ZTKA 1XXXA 2KZHA 3STEA 5IM51 4MY8A 1XUUA 4UTTA 1T8XA 3G3DA 3TSBA 3A23A 2F84A 3GNNA 3O6DA 3G0XA 4JTHA 1KM4A 1LOSA 3L65A 4UNLA 3FFSA 3O63A 1EX5A 3MO7A 1TIMA 3PY2A 3PC0A 5AC8A 3LBMA 4AXKA 5DXYA 4DF1A 2O7QA 1W54A 5BMWA 4IXXA 3OHIA 3GIYA 4IMEA 5FF4A 4JY9A 1TPVA 3QSRA 3O6YX 1HO1A 3ZR4A 1TB3A 3IIVA 5LSMA 3HF3A 1SO3A 3L67A 3ZWTA 3EWXA 3CWNA 5K7JA 3LXBA 3UWWA 3W2MA 5LKYA 4OQVA 5FESA 2E6FA 4CQ9A 3FS2A 4A22A 1UBSA 2B7OA 3NOEA 1TV7A 3VE9A 2V8ZA 5GVJA 1LCOA 4A29A 3NPVA 3W7IA 3M5YA 1KM3A 3NPXA 4LS2A 3MI3A 4H6KA 3W7EA 4JIPA 4FO4A 2DJXA 1PV8A 1H60A 2WJZA 4O19A 5D30A 2CU0A 4JTUA 2V5BA 4GFSA 5EL1A 4UXDA 4UTHA 3U2OA 5DBUA 3QMRA 3QFEA 5KZMA 3DENA 3TJXA 3PG8A 3Q58A 4K7VA 2WSYA 4HPJA 1CI1A 1KLZA 2ZZ1A 4NNAA 4O10A 3HB9A 5HWNA 3HOJA 5D09A 2GQ9A 3TROA 2DZTA 4AF0A 4WQ6A 1PHQA 3DXIA 1JUBA 3P5ZA 3TW7A 1F6PA 1QNVA 2F7FA 2ZA1A 1YTKA 4WOZA 1O5XA 4QIUA 2CLLA 4LRTA 1G4SA 3VNDA 5BMXA 2BLEA 3C2RA 3FYOA 1KV8A 5FF7A 3EXSA 3THQA 3NQ2A 1K02A 3NPUA 3TH6A 1EB3A 1YXYA 4N2YA 3I7SA 4BR1A 3KOFA 2CZEA 2TYSA 2O7SA 5EYWA 3WFAA 4GUFA 4YL2A 1RD5A 1VHNA 3GDLA 1RZMA 4XKYB 3EX2A 4K7YA 1WA3A 5AB3A 4CLMA 2JKAA 1HO4A 2CLOA 1JJKA 1WAUA 2C6QA 1W5MA 4K6AA 3O1NA 4GE8A 1GWJA 3SI9A 1VJIA 3PS7A 1A5BA 2NV2A 3BGJA 4RXGA 1WBHA 3GLCA 2C0AA 3SECA 3DFQA 1QOPA 1Z42A 3R89A 1LOLA 1UCWA 2JK2A 4HNTA 1TQXA 7TIMA 4QNEA 3RF9A 4N9DA 3CT7A 4QQ3A 5FEPA 1WYIA 2C16A 3VKJA 4UC5A 4O15A 3GKFA 3OG3A 2LLEA 1I2NA 2I9EA 1RQEA 3TJLA 4MJZA 4RCXA 4DO6A 3IVSA 4ZMGA 1VC4A 4UFIA 4GUIA 3HJZA 1QR7A 5CPOA 3IRDA 1CX9A 2YYTA 4XBSA 5G2HA 4OU1A 1OABA 3TFCA 1JCNA 5FEWA 4O54A 2YR1A 5AHIA 3A5VA 1JCMP 4FNQA 1P1XA 1JCLA 2C1HA 2E77A 3A5FA 4N4PA 5DELA 5LGXA 4JTTA 1VHCA 1LRTA 4O1AA 1BTMA 4AWUA 4AMAA 1B4EA 3NO5A 3W23A 1EUNA 3FKKA 4GC4A 4PODA 5L9FA 2DZUA 1ONRA 1SO5A 4Y8FA 1S5TA 2QR6A 3NR0A 4O4VA 4FXRA 3TC6A 2DZVA 2NWSA 1OG0A 3L5LA 1YTDA 3IGUA 2P1FA 3NG3A 2BXVA 3L0NA 1GVRA 1FCVA 1AK5A 2OMAA 4LOCA 3S9YA 5KSWA 4PEKA 1VRDA 2H90A 3DGRA 1ZJIA 2YW4A 4LC8A 1ZAIA 3C4UA 3IIZA 4NJIA 1K8YA 4OV9A 5KINA 4S2BA 3T78A 1VYSX 2ATMA 5FF3A 3DKJA 3EWZA 3STFA 3FKRA 1QDSA 1J5TA 1GEQA 1OF6A 3NYZA 2RDTA 4JN6A 3RK8A 1XBYA 3S42A 3T7VA 1R2SA 1W0MA 3PWAA 2VFGA 4MZ8A 3ZS4A 2A21A 3BPWA 3LTPA 1NSJA 3MYPA 1TPFA 1G4PA 1X7FA 2RH9A 2P0OA 1R47A 3L5AA 4M6PA 4PA8A 4Y96A 2X30A 1H63A 2J24A 2C15A 4WY0A 1F5ZA 4O4WA 1W3NA 3MI6A 3H53A 3HIJA 1G7UA 1DVJA 1WOAA 5KTLA 2V2HA 3LCGA 2ZFAA 4IPJA 3B03A 4UIOA 4PL1A 5T26A 4MPQA 1VH7A 1SZNA 1MEHA 3PF3A 4O1CA 3QW3A 1DOSA 1L6SA 1OHLA 3TQKA 2ZYFA 2FTPA 4LVBA 1IXNA 2ZRVA 2V5LA 3SIZA 4AWTA 3TCEA 3DFTA 4YCPA 4RLIA 4IJBA 1FWWA 3CQ0A 4LUIA 2EAWA 1DQXA 4QJ1A 3I7RA 3KRSA 3W3OA 5AN7A 3BW2A 4PH6A 3TXZA 4MFEA 3QQ1A 4LWWA 3EX4A 1A5AA 3L0KA 5FEXA 1VQTA 2ZCGA 3BG3A 2CZFA 1UUMA 4O52A 4DPQA 3B05A 3I6RA 2QJIA 4QSHA 5KMYA 3LB0A 3GK0A 1EWEA 2ISWA 3NQDA 2BX7A 3ABSA 5KZDA 2NUXA 4QITA 1BWKA 4K38A 1VCGA 3W75A 4GUJA 5LHEA 3HG2A 4JTGA 1QFEA 4HPXA 5HULA 2NX3A 1OVDA 1XC4A 1IGSA 4R7JA 4N02A 2P10A 4EOUA 1ZENA 3OVRA 3VCRA 4LUJA 3W2UA 1K7EA 1W3IA 1YYAA 1LBFA 1QMLA 4UFJA 5CZSA 3L9CA 5C2XA 5I3HA 1QO5A 3PB0A 2YYUA 4CNPA 5FEZA 1I4NA 1XBXA 2BWGA 4UUIA 4WJEA 4FHAA 3S1UA 5G4WA 4IPIA 1FDYA 2VFEA 4JIQA 1PVNA 1KBJA 3Q2DA 1UUOA 1XBZA 3NVTA 5D2YA 1WV2A 4HIBA 4WUIA 4HSNA 1RV8A 1XI3A 1I2OA 2J9YA 3DHFA 4Z0JA 3W7CA 3N2XA 3IIXA 1ZFJA 3NL5A 2I14A 5E93A 1YDOA 3QSTA 1KV5A 4YCOA 1RR2A 5CPNA 3MP5A 3BV4A 5AYYA 1K8ZA 3WJXA 4ADSA 1ME9A 5D2XA 4WXZA 3SGUA 1QCWA 4MZYA 4K39A 2QDHA 2GUUA 2WSQA 3TDFA 4OGZA 2Q3OA 2YW3A 1H7WA 3GKAA 4O0ZA 3TW6A 1YDNA 2GVJA 1J2WA 2WV8A 3N3MA 4FNSA 4QAIA 3QF0A 3S5NA 2J9ZA 4TIMA 3W2LA 5A8GA 3UWUA 1DL3A 4OHQA 4Y9AA 3U6WA 1M6JA 5K9DA 2ZRWA 2GQAA 3IIOA 3LCFA 1H1YA 5D04C 4UR8A 3N73A 1B4KA 3HGSA 1XM3A 2YCEA 3C0JA 5D33A 3WJSA 1GG1A 3LHTA 2ZRYA 3E12A 1IIHA 5DBTA 3G1VA 1G69A 5EKYA 4ALDA 3MYOA 1SZEA 3PBWA 2FPYA 3W6YA 2QCFA 2QUVA 3UY8A 3HO8A 2JGYA 3EEGA 5TBOA 1OJXA 3R5EA 5LGZA 1KTNA 3BLIA 1G7VA 1XCFA 3LV5A 3MP4A 1OFBA 3EWUA 3EX1A 1GVFA 3UWVA 1F6KA 1DORA 4GNJA 1K03A 3DU0A 3PAJA 1P4CA 3LXCA 8TIMA 3G1AA 4TO8A 6TIMA 4JEQA 5K9XA 3GZ3A 2VC6A 1M7OA 3L21A 3MWAA 5LNUA 1GTHA 1LYXA 3S5YA 1PHWA 1A50A 1XL9A 3MMTA 3QZEA 1L2UA 5H91A 2ATSA 5F2IA 3GDKA 3PR2A 3G1FA 4YMZA 1X8FA 4N4QA 4O1DA 3RLVA 4UTJA 4X9SA 4E0CA 5K3VA 3NQAA 3WK3A 3PULA 3WK1A 1ZALA 1RQHA 3CPRA 2WSRA 3W7MA 1JCJA 1I8JA 1KFKA 1YPFA 2XN2A 3IEBA 3E0IA 1TRDA 3UYCA 3W72A 2HS6A 1K3UA 3C3NA 2OX1A 4RX0A 4DBDA 3L66A 1TRIA 3F4NA 2QF7A 1GQNA 1OX4A 5D32A 3L0GA 3T40A 5HR6A 4NXKA 3ABQA 4LW7A 2HMCA 2ISVA 1W37A 3CB8A 2D73A 1OFAA 2Y88A 2X1SA 3OVQA 4FX6M 4UMBA 6ALDA 1B3OA 1JR1A 5BOOA 5K9CA 5D05A 5D2WA 2XN1A 1K7XA 5L6UA 4DQWA 2WOQA 1H7OA 1KM0A 3TA6A 4ORIA 1FX6A 3D0CA 4FNTA 3W76A 3NQVA 2DP3A 4N9EA 3GXNA 2R8WA 3QRHA 3S5OA 2PRLA 4FNRA 1PE1A 3IV3A 4Z08A 3T55A 2JBMA 4ML9A 3BG5A 1FWTA 4QISA 3ZFHA 4FIRA 2ZZ4A 1GJPA 2Y62A 4WZHA 5DN1A 3LDVA 1GPWA 1ME8A 2EF9A 5LNWA 4BI5A 4LVDA 5HWMA 2V0TA 3NQMA 1O5KA 5BW6A 3HPXA 3KVKA 5AYXA 1R30A 5BRBA 1T99A 3UPWA 4D2JA 3NQ7A 1F7BA 3LHZA 2RDWA 1OX6A 3SSJA 4YLWA 1R2RA 3HG3A 3QJAA 2G96A 4JNMA 4X3ZA 3SFKA 3BLFA 4UFKA 2QAPA 4GXMA 1OX4B 3NQ8A 1Q45A 1FY6A 1LLWA 3FYPA 2EGZA 5CGQA 1J4EA 1W5NA 4RJEA 3U8GA 2YSWA 3R13A 1P5BA 3RNDA 2NV1A 2QKFA 1PS9A 4ADTA 3UXAA 1KM6A 3N14A 1SU5A 3G22A 4IUOA 5KZEA 5DCEA 2B7NA 2ZBTA 3VE7A 1DKWA 2NX1A 1EIXA 4MY1A 1H51A 3NEVA 4DXVA 2A2IA 5D38A 3W9ZA 1BKSA 1MZHA 4EF8A 5CG7A 4MFDA 4FB7A 1M7PA 2GOUA 3CHVA 3W1TA 1Y0EA 3BW3A 1TTJA 3CEPA 1G6CA 3W71A 5DLCA 3QPZA 3W1PA 4UFHA 5HUPA 4LV4A 4Q32A 3FJ6A 1AW1A 4IXHA 4J9JA 1WXJA 3WK0A 4ZQNA 2QAFA 1LDCA 5HINA 4HSOA 3INPA 5LNSA 4JYFA 2A4AA 1JUKA 4OT7A 5CKSA 1EPXA 3TAKA 3UQNA 4AAJA 4GRSA 4BI6A 2A7PA 5SWUA 3W73A 3EB2A 4AB4A 2WNQA 1BWLA 2Z6IA 1GVOA 1FCBA 4XUGA 2YDAA 3UD6A 5LZLA 4UTWA 4MVAA 1B57A 5CSSA 4Z1BA 5E1QA 1XDLA 1TYGA 5DCBA 5F4XA 3GXTA 3LCIA 2A6LA 1SW0A 1KBIA 4EF9A 4O0KA 1SO4A 3TQ0A 4FX8A 3SZ8A 3DAQA 2PURA 2BZNA 1F76A 2GPTA 1FWRA 1RQBA 2CLKA 5U7SA 1SFJA 3A9IA 3W1RA 2VEPA 3R12A 3W7QA 3DFPA 1F74A 1VYRA 3W70A 1ZHAA 1UASA 2YFOA 3F4WA 3DI0A 4XQ6A 4PC8A 3LI0A 3LHVA 4NT0A 1FDJA 1PIIA 1W8SA 4X22A 5AC6A 1B9BA 1SO6A 4MOZA 3MI2A 4IMGA 4JR5A 4UTTC 2VFHA 4JICA 2QEZA 4A3UA 4WY0F 3OA3A 3PM6A 3FLUA 4A2RA 4FNUA 1C9DA 1EP1A 2VOMA 1QWGA 2Z2UA 3O16A 4CNOA 3C56A 1JCYA 3EWWA 5AHMA 3W7DA 1QPRA 4TMCA 2E09A 1L6WA 3IIPA 4C1KA 3HPSA 4NUWA 3ELFA 1V7YA 3FOKA 3G0UA 1SSGA 5HR7A 3M5XA 4I9AA 4JX5A 5F2MA 3B4UA 3P81A 1PCWA 3BG9A 1N8FA 1THFD 2C13A 4MKNA 3M16A 3M43A 4AHOA 2C3ZA 4S1FA 2QCNA 1KFLA 3GYEA 1TPUA 1DJQA 2V2DA 3QW4B 4CCDA 4EVZA 4E38A 4DEFA 4K37A 3EX3A 1XBVA 2PRMA 5CPLA 4K36A 2C18A 4KFPA 5CZJA 5DY2A 4UCGA 2CWNA 2CFFA 2X1UA 1TTPA 3DKLA 2GQ8A 1FCUA 4AHQA 3TAOA 4PFMA 3EXRA 4TMBA 1E51A 4N9CA 2V9DA 1ZCOA 3GXPA 3LERA 3HBLA 3LCLA 3W22A 2Y70A 4U4MA 3TIMA 4ZQPA 3G1XA 2CLEA 3Q37A 3LCWA 3E9AA 2V82A 1JUEA 4DBEA 3NL3A 3LOTA 3CWOX 1D3HA 3O8AA 3PVFA 4XKYA 3DFSA 3YPIA 1LORA 4O17A 4Z1DA 2OT0A 2QCGA 4JTIA 5D2VA 2VENA 3G1DA 1GZGA 3FIGA 1CW2A 1S5WA 3EXTA 3STGA 2XFWA 4PTNA 5K2ZA 3KVJA 1HG3A 4EWND 1FXPA 3P5YA 3W1XA 3HQ1A 1TCDA 1KA9F 1TPDA 4MLJA 3S6DA 5I3IA 1IXPA 1H62A 3C2OA 4BWLC 2HTMA 4MYAA 2A7RA 2GJNA 1OK4A 1GOXA 1JQVA 2JKPA 2NUYA 3M9YA 4O16A 2R14A 1DV7A 4WXYA 1NF7A 4RZ5A 2AQWA 4IOTA 1O4UA 1C29A 5C54A 4I7UA 4KFNA 2Y7FA 1FWSA 4RK8A 4H3DA 3MHGA 2G97A 5E0KA 3W86A 1TJRA 3A24A 1I2PA 2E6YA 2Z6JA 1LLZA 3FA5A 4HNUA 3UZ5A 1Q6RA 3W07A 1ZNNA 2X1RA 1T96A 1OFRA 2RDUA 5F2LA 3S0CA 2DZPA 2YPIA 3BARA 1VYPX 2H3BA 2E6AA 1S3HA 4IMDA 1Z48A 3LTYA 5HQEA 1S5VA 5EBUA 1KM2A 2DORA 2B7QA 4JTSA 3HPZA 3W7KA 4DF2A 4MZ1A 1JRCA 3TR2A 3S5ZA 3PUOA 3EWBX 3HGJA 3LRKA 2WNZA 1SUXA 1XDMA 2ZZ6A 3R8RA 4OWGA 4BI7A 1DHPA 1K7FA 4KWWA 4QM1A 4UTMA 1XKYA 5G5IA 2DZWA 2NXIA 2Z1BA 2Q8ZA 4O57A 4R53A 1W5QA 3E96A 1X1OA 4JY8A 1D3GA 1JCXA 3BW4A 1H7PA 2Y7GA 4X2RA 2C14A 3NQEA 1YTEA 3H54A 2ZA3A 3ANYA 4O12A 4CCCA 5G2IA 3PUDA 3M5ZA 4ZQCA 3UXDA 1LRQA 1SPQA 3H55A 2GJLA 4LS0A 4NVTA 3AJXA 3IVUA 3DFOA 2Z0IA 3B0VC 4MUZA 3W7LA 2WNNA 4K8EA 4U28A 1SQ7A 2FIQA 1FQ0A 2QCHA 1KFCA 2XN0A 3DZ1A 2C19A 1A5SA 2HSAA 3O06A 1WOBA 1H7XA 3IVTA 1AW2A 3LHWA 3A22A 2CZDA 3GDRA 4FNPA 5C6MA 4UTUA 4XWUA 4K8HA 2WO5A 2EKCA 3W88A 2FB3A 1OFPA 3W84A 2ZQ0A 1TQJA 4TR9A 1DBTA 3JRKA 1LZOA 2X16A 4FXSA 3O6CA 3N2MA 2CLFA 4BF9A 4LV9A 2NX9A 5DXXA 2V81A 4NZFA 1GVSA 2RHGA 3O15A 3P7YA 4O50A 3W1UA 3QQ0A 3G1HA 3V75A 3KFTA 4CQ8A 1H7RA 5CPMA 1HTIA 2VKZG 3NQ6A 2UV8G 2OT1A 1P0KA 2FFCA 5HJLA 3CM4A 3MBFA 1FBAA 4P2VA 3LM7A 5AHEA 4GBUA 5AYZA 3HG5A 2EHHA 4WX2A 4RZ6A 3ABOA 3G3MA 3G8EA 4NNBA 4M6QA 5H2ZA 3UPBA 1EUAA 4HHPA 1FUYA 4DO4A 3UNDA 3LHUA 1G4TA 3M44A 3PBVA 4NXSA 1OFOA 4JS3A 2E68A 1SFLA 2GVLA 4Y90A 2YFNA 5I3FA 2WKJA 5IBXC 4FX7A 5F1UA 3M0ZA 4E2BA 1GYNA 2Y7EA 1HUVA 2B0MA 1A53A 2ZDRA 4M5PA 4HN4A 3W2KA 4UTIA 5G1YA 4H4IA 4Z1CA 4KFOA 4DELA 4UR7A 3HGOA 3F1QA 2QUUA 1UJPA 3G24A 1GYLA 1P0NA 3GVGA 3DFNA 3B0UX 3NL6A 1OYBA 3BO9A 5AHLA 4LC6A 5J5DA 4ZQRA 2A6NA 5I3JA 3N9RA 1JRBA 4UMCA 2H3DA 1FXQA 3SY5A 2R94A 1F05A 3CIWA 3LGEA 2VEKA 4MLRA 1TMHA 4JD4A 5F4SA 4A2SA 4LVAA 4OBTA 4LNYA 1L9WA 1SW3A 4AWSA 1SSDA 5AC7A 1FCQA 1VLWA 4GWEA 2V2CA 5IBXA 3RU6A 3BVJA 2OJPA 4M6VA 1AW5A 2W0UA 2YGYA 3NZ1A 5AOUA 2A1YA 2CLIA 3NQGA 3SGZA 1XFBA 3TFXA 3W74A 2BSLA 3S1VA 3C8FA 1TTQA 3USBA 1ICSA 3P84A 5D02A 4BK9A 3WK2A 2FQIA 2NXGA 3B0PA 1AG1O 4MJMA 3KRUA 1GT8A 1R2TA 3UWYA 3HG4A 1YLVA 3PBYA 1KTCA 4LTSA 2E5DA 4QNWA 3TV8A 4W9TA 3RMJA 1DJNA 4NJJA 4ICNA 2A0NA 3LBCA 4AEOA 4JTLA 2NLIA 3C2VA 3MHUA 2NXHA 2QUTA 3TU9A 4BWLA 3IGXA 4A21A 3GAKA 2ZRXA 4DF0A 1H61A 2E6DA 4CNNA 1YXCA 2QCMA 3R2GA 4B5NA 3G18A 1OYAA 2DU2A 4ZZ9A 4TX9A 2W6RA 2QCDA 2Y61A 3OEXA 4UTKA 1EWDA 5AFDA 5AHFA 3W7GA 4O11A 3B04A 2VELA 1OF8A 3QYQA 4IMFA 1HL2A 3L5MA 4JGDA 3LRMA 3ZWSA 1TV5A 3E02A 1GG0A 2NUWA 3M5VA 2FLIA 3EX6A 3G1YA 2VEIA 4XZ9A 5ABTA 3KVLA 2PE4A 5EY5A 4O8RA 3JR2A 3STCA 5I3GA 3QM3A 5C55A 3TK7A 3NDOA 2FPVA 3Q94A 3QMSA 3PSVA 1SZFA 3NL2A 2X2GA 4NQ1A 4NX5A 1KFJA 3FJLA 1KM1A 3W7NA 4HNVA 2H8ZA 2HS8A 4G1KA 1C8VA 2VFFA 1ZAHA 5FF2A 3KVMA 1HFBA 1O94A 2DZSA 4KWVA 1N55A 1IXOA 1MSSA 4FEZA 1MEIA 1TO3A 3O05A 4UFLA 3P74A 2GVGA 2G5WA 5F1VA 4NJGA 3A21A 4WD0A 1KW1A 5C5YA 5TIMA 1NEYA 3LLDA 3GX9A 4OV4A 4Z1AA 4TU1A 3CLMA 1EEPA 4UNKA 2VXNA 2ZRUA 4KKXA 3LXAA 3W2JA 3EKLA 3L2IA 5F4WA 5TQLA 3W1AA 4M7TA 1NVMA 4ZVJA 4Q4KA 1TTIA 5DCDA 1OYCA 5G2WA 4POCA 2A7NA 1Q6OA 3P82A 3RFAA 3W7OA 5D2TA 4P61A 4ORMA 3IGSA 2TSYA 3NM1A 1WDWA 2PRHA 1VR6A 4M19A 3M1ZA 1O95A 4WOQA 1ML1A 3P61A 1QAPA 3P67A 3NQFA 3S1XA 2V30A 5D03A 3UZJA 4JX4A 1H7NA 4RKAA 3KX6A 4JX6A 2WPBA 1I2QA 1SW7A 4M7SA 4IQLA 1TREA 3RLUA 1TPWA 4ZL1A 4Y6GA 1D9EA 2QCCA 1LOQA 3P62A 5LNVA 4OE7A 4DPPA 3C2FA 3S1WA 1N7KA 4RZ4A 4O14A 4IWWA 3TX9A 5G4EA 1KFBA 1PL9A 1OK6A 1OFQA 3KXQA 2H8XA 4N6FA 3AO0A 4WY0B 2WQPA 3W1QA 3GNDA 4HT3A 4IX0A 3CIXA 3EKZA 1VS1A 1IIGA 4IX2A 4N9BA 1LBLA 3LI1A 2AGKA 4GUHA 3P80A 1X1ZA 4L4MA 3M6YA 1ICPA 1H50A 1F73A 3MJYA 3DH7A 3G1SA 3QH2A 4O1BA 1Z41A 1KLYA 1OFEA 1Q3NA 1EP3A 3MBDA 2PCQA 5G1TA 2X1TA 1SZGA 2NWRA 2YZRA 1RPXA 1A5CA 4NJKA 3NQCA 1MEWA 3L68A 4O53A 3DI1A 3W1NA 1G67A 3W7PA 2J6XA 3KHJA 2PC4A 3WJYA 4NNCA 5D37A 1EP2A 1DQWA 1F2JA 3UWQA 3K30A 2BTMA 5CZTA 1VZWA 2ZRZA 1WBJA 5U4NA 2VEMA 4XTIA 2Q3RA 3C6CA 3TNOA 1K8XA 4RR4A 4O13A 3B06A 3OBKA 3GR8A 1AL7A 1JULA 1O60A 3LLFA 4HKPA 2W79A 4O28A 3THAA 4JTJA 5HNRA 3PG9A 4UMAA 3W85A 2FJKA 3LTSA 2DZXA 3NM3A 1IF2A 3W87A 5CZ0A 2TPSA 1ZY9A 2A5HA 4L4LA 3P8IA 3W1MA 3TE9A 4RV8A 3CTLA 1XUZA 1NFBA 1ME7A 2JKEA 1H5YA 2QCLA 3PSWA 4YXGA 3LRLA 2ZZ7A 3B8DA 3UWZA 1ALDA 4E2DA 3CEUA 1VCVA 3N9SA 4ZQMA 5EPDA 5I3KA 4GJ1A 4I7WA 1YADA 1Z44A 5K4ZA 4S2CA 2J27A 3MP3A 4JYDA 1TSIA 1X6UA 2QJHA 2B4GA 2Y6ZA 3ABRA 2E1DA 1YPIA 3P8JA 3NZRA 2NZLA 5HMSA 1VCFA 1TJPA 1T0OA 3CU2A 3ATZA 1WX0A 5MHBA 1Q6QA 1KTBA 3O07A 4BFAA 2ALDA 4IMCA 3T4CA 3KAOA 5EMUA 1LROA 3KRZA 1NF0A 4LVFA 3DBPA 2OZ0A 1LRNA 3BGGA 2EPHA 1NAL1 3LCHA 3NAVA 1FWNA 1SR9A 2Y7DA 1LM1A 4LT9A 5F2GA 4MY9A 4RXFA 1KM5A 2FPTA 1ICQA
chains in the Genus database with same CATH superfamily
3GDTA 4F3HA 4J1OA 3SRFA 1UD8A 3SJ3A 3BMVA 3NZPA 5AECA 1XYLA 1G4EA 3GTXA 3HGRA 4AHPA 2GDUA 1QPOA 3QEZA 1K6AA 2YBVA 2XWDA 5IOBA 3TSMA 1M68A 4ICMA 4LU0A 1E4MM 2CEQA 4ENLA 4D9PA 5BXPA 2RKXA 1ZU8A 3UJ2A 3CZ8A 3SUSA 2J79A 3STPA 3S83A 2DIEA 4S3AA 1C7SA 4UTWC 6REQB 3M47A 1HF6A 3T09A 2A3AA 1OQFA 5GNZA 1BEUA 1TV8A 3REQB 8CGTA 1AH0A 4XD4A 1W9DM 1UR3M 1UMLA 4NI3A 1Z9AA 1IR1A 3WENA 3OIXA 2WMIB 5DRIA 4J3TA 1LP6A 4DJDA 1S2WA 5CCZA 4N7QA 2PB1A 2DZAA 3FSUA 4UZSA 1V5XA 4B5UA 3V5OA 4AY7A 1KCKA 2E9MA 1DXFA 3NNTA 2JF6A 5DT7A 4YWIA 3HMCA 1PIGA 2VC9A 4NAFA 4DBSA 2XFYA 4FR6A 5DRCA 1E55A 2OEKA 1VPXA 1UYQA 3MA8A 3OLGA 3PBUA 3QFWA 3TR9A 1LF1A 3GDMA 3CK5A 2OYKA 4HZMA 3WF0A 2ZTJA 2HZGA 3R1ZA 2QF8A 2DW7A 4CKQA 1CENA 1GZJA 3KZPA 1KCLA 1W31A 3M0LA 4XSLA 1FDZA 4QHRA 4JTAA 4DWDA 4MG4A 4L5ZA 1YRRA 1TWZA 2CLMA 4B2DD 1JQXA 2F6UA 5HWJA 4ZO9A 5BWFA 1XYMA 4NX0A 2DEPA 1EZ2A 1LTDA 2H6RA 3G8RA 2X8RA 3ISIX 2Q8LA 4DO5A 4JTKA 3N34A 3QGVA 1OEPA 2QHAA 1JVNA 4FIQA 1QOQA 1ZSXA 3GU9A 3WBEA 3H7RA 1UKQA 2FB2A 4GZJA 4RUBA 4AWEA 3ZJ8A 5LNRA 2KZHA 3OTRA 3SCPA 1T8XA 1E5NA 4HU0A 4C7GA 1JYWA 3SCUA 2I17A 3O6DA 2VD9A 3NIYA 3ZT5A 2CETA 3PC0A 4AXKA 5DXYA 1IEWA 1W54A 3GTFA 4RZBA 4IXXA 3OHIA 5HDRA 5FF4A 4GKLA 1KBKA 3C0LA 3O6YX 1VF8A 4NRRA 3IIVA 1XPYA 2WM1A 5A6BA 3RYSA 4GH1A 7REQB 1P0BA 1QK0A 4S39A 1IZKA 3L67A 1V77A 2VR4A 1CB2A 3CWNA 3EWXA 5I07A 3RILA 3UWWA 3W2MA 5BRQA 4I6KA 2E6FA 5XINA 2OSWA 2W5FA 1QTWA 3U4FA 2J8TA 1JDCA 4FLOA 2G3FA 1UH3A 1LCOA 3NPVA 2FKPA 3AQUA 3M5YA 1CWYA 3EBVA 1OC6A 5TAOA 1XIJA 5I77A 4J2PA 2CU0A 4L56A 4GFSA 4UTHA 4MADA 4V27A 3QMRA 5LIYX 4AZIA 3QFEA 2V6AA 3WUBA 5KZMA 3QLLA 4E4PA 2R1NA 3NO1A 4GPNA 4O10A 4ZTXA 4ACZA 1Z8AA 5HWNA 3TROA 2QUNA 4DO7A 3S6OA 2QIIA 3OYZA 3TW7A 1EC9A 2ZA1A 4JIIX 1YTKA 4WOZA 5HOSA 1O5XA 4LRTA 5CQ1A 4CD5A 1CNVA 1EO7A 4BQ3A 3EXSA 3FAWA 3THQA 1ZJAA 4PTVA 1ISXA 1J6PA 4U5KA 3ARTA 1BKHA 3KOFA 3M6DA 2TYSA 2VQUA 1CB7B 2OLSA 3PZTA 4XKYB 1U5HA 5T8GA 4AX7A 2JKAA 3WNNA 3BSMA 5XIAA 3WBWA 4I90A 4H04A 1WAUA 2C6QA 4K6AA 3O1NA 1FWFC 4DZ5A 1A5BA 3BGJA 5DF0A 1V4YA 4GQGA 3IUIA 1IEQA 2C0AA 1VFOA 3DFQA 1QOPA 1Z42A 2X7VA 3OBEA 3R89A 2WSKA 1LOLA 1TWWA 1CGXA 2WBGA 1SJDA 3WMBA 1XYAA 3RF9A 4QQ3A 3GC5A 3LMYA 4PB3A 4NZCA 3N6QA 4UCFA 3SUWA 2H9AB 3QOKA 2E7FA 4IPNB 4UC5A 4NY2A 1TV4A 3WQCA 4PUJA 3TJLA 4DO6A 1VC4A 4M24A 4CNUA 4XSMA 1XH0A 1A3HA 1CX9A 3T2PA 2YYTA 4HJFA 4A6GA 3UJRA 1XD0A 3FSTA 1GQKA 4KRZA 2NQZA 3HPAA 5AHIA 1JCMP 1JCLA 2AAAA 4RDZA 5LGXA 5EMKA 3ZVIA 2WPGA 2QV5A 4IJCA 4PMJA 3LU2A 1JAKA 1LRTA 4B5TA 3TN6A 4O1AA 1BTMA 2OPJA 1IQ8A 3OYXA 4CU6A 4WDUA 4EKJA 4CVWA 2PTDA 4J4KA 3B40A 4L6HA 3L2LA 4R5EA 3DCPA 2RUSA 4G7EA 5E0CA 3AYRA 1OG0A 4LX4A 3D6NA 3L5LA 1JF5A 1FCVA 1PX4A 2ZICA 4KT2A 3FAXA 4PEKA 1HGYA 2H90A 3G2GA 2JE8A 1ZJIA 4KF1A 4FAMA 2PTZA 1JFXA 5KINA 1VYSX 3EWZA 3STFA 1GEQA 3B8UA 1V8EA 4JN6A 2WJEA 2DT1A 3PWAA 3NQBA 2A21A 3CZGA 1IT8A 3D46A 1G4PA 2QMKA 1R47A 4PA8A 5DEZA 2J24A 4L1WA 1W3KA 2C15A 1BLIA 1HX0A 4C6KA 1DVJA 1WOAA 2CLPA 1QI5A 4EX4A 3V35A 5GQBA 1VH7A 3ZJKA 1VP5A 2J78A 3TQKA 3ZSTA 2I9UA 2ZYFA 2FTPA 4LVBA 3AISA 2V5LA 5BU9A 3DFTA 4YCPA 3LQLA 4RLIA 4IJBA 4JFTA 4J3XA 3CQ0A 4I9JA 4QJ1A 3I7RA 4PH6A 5D8WA 3TXZA 2ZUTA 4UZUA 3EX4A 1XPGA 2ZCGA 4TOQA 3TWAA 4DPQA 2ZUVA 2ISWA 3NQDA 2BX7A 3BCDA 1WDRA 3P14A 2TAAA 4WSKA 3BXWA 1FTXA 2ASHA 1AQ0A 1VCGA 1UUQA 5LHEA 1TV2A 1KR0A 3V18A 1J0ZA 3AFBA 3T2OA 4EE9A 1EHNA 1OZMA 1XYBA 1R87A 1OVDA 1XG4A 3OVRA 3VCRA 4LUJA 1W3IA 1YYAA 5D9OA 1QMLA 4UFJA 4C6PA 1VEOA 5C2XA 5I3HA 1ZBVA 4M80A 3W01A 2PI6A 3ARQA 1M3UA 1C9WA 1TWIA 1XBXA 2BWGA 2X0YA 3CQKA 4L1XA 4WJEA 3N2BA 1M65A 1FDYA 4JIQA 4MMWA 4GHRA 3Q2DA 1UUOA 5IFTA 4Q7IA 3NVTA 1WV2A 4HSNA 3U48A 3HZ3A 2JIEA 4A8IA 1K9EA 3N2XA 1QOXA 2OTDA 2JALA 1YDOA 5JH1A 1TA3A 1W9XA 3BOXA 2JQXA 1BPLB 4NASA 2HNHA 1TIWA 1K8ZA 3WJXA 4WXZA 1HKJA 3AZRA 3SGUA 2G3NA 4ASTA 4K39A 4MAZA 2GUUA 2WSQA 4FR1A 1GEHA 1UR8A 1PZ1A 3DFYA 4Z2HA 5MKGA 4J2MA 1J2WA 3D3FA 3N3MA 3B9OA 1B9ZA 3KCLA 5K9DA 3IIOA 4FSAA 1X96A 1DE5A 5D04C 3P0XA 3HGSA 3C0JA 4GQQA 2GGHA 1GG1A 4QJ5B 1IIHA 3H4GA 5DBTA 4KEMA 4XK2A 4HMEA 1XLBA 3GDBA 4R9XA 3VD4A 5A6KA 1UD4A 2PDPA 2QUVA 1D7KA 3GTHA 1I0DA 3EEGA 1OJXA 1ITQA 3BLIA 2I7GA 1E3ZA 2ZC8A 3PFRA 1ITXA 1GVFA 1I75A 4EWJA 1DORA 3PAJA 3MDWA 2ZX9A 2VDIA 4O1EA 3SCRA 1HJVA 1QU4A 5K9XA 3BWWA 4HP5A 3MWAA 5LNUA 2EPKX 1KXVA 2VUNA 1E6RA 3DG3A 1Z3NA 5EFFA 1GVEA 4QBXA 3G1FA 4YMZA 1X8FA 1KRAC 4E0CA 5K3VA 4B91A 1RK6A 4RPQA 1RQHA 1I8JA 2XN2A 3MV01 2QZRA 3WQGA 1PYMA 3W72A 4AISA 1JNDA 1GKPA 2AKZA 4DBDA 4F79A 3UXIA 3F4NA 5E0FA 2WK2A 1JNEA 2PDNA 5D32A 4RNHA 2PU1A 4JZ5A 4QSFA 5HR6A 4N42A 3VNMA 2J77A 9XIAA 4LW7A 1W37A 1V3MA 2GDQA 2PTYA 3FEQA 3OVQA 2I57A 4LUSA 5EB8A 5BOOA 1BYAA 4FA3A 2EQDA 1PTAA 1QW9A 4ACZB 1FKWA 2XTKA 4PMXA 1E6XM 3GFZA 3PANA 5FSEC 1RALA 1CBGA 1WAWA 1SR0A 4IP4A 4S3CA 3QRHA 3S5OA 1A5NC 3U5YA 1V6XA 3WUGA 1WUEA 3IV3A 1XLIA 4ML9A 3MUAA 3B8WA 4LAKA 5E70A 5I3DA 3LDVA 1GPWA 3MS8A 4QS6A 2DDXA 1VFFA 4LVDA 3LZ5A 4KRUA 5HWMA 3QOMA 3KVKA 2VURA 4D2JA 4L61A 3GZAA 3HU7A 2P0IA 3WKZA 4AG0A 1JZ4A 3NVDA 1OX6A 1QASA 2FVLA 3M0IA 3QJAA 2G96A 4JNMA 5CC5A 4GY7A 3SFKA 4HMNA 2IMRA 4GXMA 1KO0A 3FYPA 3T0AA 7TAAA 4RL3A 3VOHA 2O9OA 2Q8XA 4B2DA 2HISA 4ZFMA 1K9DA 2YJQA 5CC3A 3R13A 3RNDA 3SCOA 2PBGA 4PRRA 2B7NA 4PMQA 2ZBTA 3K5XA 1DKWA 3VILA 2CHOA 1PTDA 4HHHA 3LG3A 1MZHA 5CG7A 4MFDA 4FB7A 5CC6A 2AMGA 3CEPA 5HNUA 3W71A 3QPZA 3LENA 4LV4A 3FJ6A 2WC7A 4IXHA 3WK0A 4P8XA 4RDWA 1TV3A 2QAFA 1JFHA 2D0FA 3INPA 4HSOA 2VEGA 1I60A 4W4QA 5I5RA 3WF1A 4MGGA 4OT7A 3UXLA 5JQ9A 3TAKA 2VR2A 4AAJA 4GRSA 3CUHA 4US5A 1JPMA 5SWUA 5JVLA 2GQ3A 4P7LA 4XUGA 4ZXOA 4MVAA 4Z1BA 3QXBA 4RE4A 5E1QA 1XDLA 3GXTA 3VIJA 1BVNP 1XP3A 2A6LA 1M04A 3V5CA 1NWSA 1H4PA 1C7TA 4H01A 1GONA 3TQ0A 4NRSA 1CXKA 2PP3A 2FZ9A 4LUSB 1OIMA 3GNXA 2RAGA 1RQBA 1GW1A 1TMLA 3ARZA 3G6LA 5U7SA 5A94A 5C7HA 1XLGA 4REQB 3W7QA 2EPMX 3R0KA 1F74A 2OGJA 2YFOA 2CERA 3E2RA 4XQ6A 3TW9A 5I06A 4PC8A 4NT0A 4IFOA 3MC5A 1Y5VA 1S1RA 3MI2A 4IMGA 2XHYA 4ZO6A 5LIXX 4C1NB 2VFHA 4JICA 1G5AA 1V02E 4WY0F 3UT0A 1PAMA 2Y1HA 3AXXA 3FLUA 4L4OA 4A2RA 4FNUA 3KBWA 1UQZA 4ML4A 2VOMA 1DHKA 7PTDA 2Z1KA 3XISA 2Z2UA 3TLQA 5DX7A 2W4XA 3H4XA 3VFCA 2BXZA 4BQ5A 3KBJA 2P3ZA 2E09A 1L6WA 1AQHA 1SSGA 4R7WA 5HR7A 1X6LA 5KETA 2Y5JA 2WMGA 3B4UA 3P81A 1QI2A 3BG9A 1E9IA 4P7RA 2C13A 3M0KA 3CJPA 4MKNA 5REQA 4AHOA 3KRBA 4XAGA 2E25A 4JFUA 3QW4B 4EVZA 4GNKB 4DEFA 2C1IA 5CPLA 2OOFA 2C18A 2ZX5A 4KESA 3WLLA 4FOKA 3OGSA 2X1UA 1TTPA 1HVQA 2NVDA 3HQPA 3AICA 1AA1B 3TAOA 1VFUA 4PFMA 3EXRA 1E51A 1W3JA 3EB3A 3WX7A 3GTIA 2E28A 4BF5A 2A3CA 5A6BD 1GOOA 3TP4A 3AUJA 2P8BA 1TJ1A 1ITUA 2C71A 2HE5A 1CPUA 1BF2A 3HFTA 2PGRA 4PFHA 3YPIA 3B9AA 1EJXC 3POCA 1PWMA 2IW0A 1RCXB 1OD0A 4PTNA 2PLCA 1AQMA 3KVJA 1HG3A 3PUGA 1UD6A 1FXPA 3P5YA 3UF9A 3WSUA 4MNJA 4MLJA 2J25A 1ZCCA 1AZ1A 3PAOA 4PMNA 2A7RA 3TZFA 2FHBA 1GOXA 1JI1A 1JQVA 4O16A 2ZE0A 3K4AA 1DV7A 4WXYA 3LNMA 4IOTA 2CIPA 4KH2A 4FI4A 3BCFA 4MDPA 4JTRA 3V16A 2VR5A 2Y7FA 1FWSA 1VIWA 1TJRA 2E6YA 3UZ5A 4S3JA 3A4XA 3WELA 1ZNNA 2OODA 2X1RA 1PB0A 2RDUA 2YLLA 5F2LA 5BU6A 4C60A 3SRDA 5PTDA 1GOWA 1S3HA 2VCBA 1Z48A 5EBUA 4YHGA 6ENLA 3HPZA 5TF0A 3VD3A 4DF2A 4Q6JA 4MZ1A 3TR2A 3C2YA 3HGJA 3LRKA 1F8IA 1OGGA 2PA6A 5LXEA 3ITGA 3R8RA 1QXLA 2XIJA 3QZAA 4OWGA 4GYFA 1DHPA 1HQTA 1JZ6A 4PBGA 2NXIA 1G01A 4Q7NA 5BRPA 3OGVA 1VBHA 1JCXA 4B5WA 2BVTA 3BW4A 3GO2A 2D2OA 2C14A 1YTEA 3NQEA 1XSKA 3WQPA 5G2IA 3M5ZA 3UXDA 2D2HA 1PZ2A 3EOOA 1X97A 3ECQA 4IIHA 3LA4A 3KOXA 2Z0IA 2FIQA 3CAKA 1FQ0A 1KFCA 3WNLA 2XN0A 3DZ1A 1J12A 5E6YA 1SM9A 3AROA 3LHWA 3GU1A 3TYBA 3GDRA 4Z2IA 5C6MA 4UTUA 4YPJA 4K8HA 2J7CA 2KX9A 1C91A 4JTQA 4TR9A 5ABHA 4HK7A 5D9MA 4G2DA 3U3HA 4U33A 4NL1A 3N2MA 2CLFA 3PNZA 3J7HA 4TV6A 2CITA 2GZXA 1KNWA 3VOCA 1GVSA 3JZUA 2RHGA 3O15A 3SM0A 3MKCA 1E6QM 4YYFA 1E0WA 2YB1A 3WDQA 5MKGB 4DWSA 1W3HA 4CNSA 2YL9A 4Q6XA 5CPMA 1TWSA 1KFWA 1HTIA 2EPNA 3CM4A 3MBFA 2VP8A 2EBNA 3OIHA 1PKMA 1SMDA 1Q7MA 5AYZA 2PGFA 4W86A 1RPKA 3G8EA 3QQWA 4NNBA 3UPBA 1MW0A 3UGVA 4X2PA 1FUYA 3BV7A 3CB3A 1RK5A 3LHUA 1W9PA 2DT3A 1FH9A 3WDRA 4HJWA 4PTMA 1OFOA 2GVLA 2YFNA 5I3FA 1FWIC 5IBXC 1MUMA 4FX7A 3GD6A 3M0ZA 1UR2A 5CBIA 4HBKA 1IV8A 1Y5WA 2VX7A 2Y7EA 2B0MA 5B80A 3ME3A 4IP5A 4H4IA 2INZA 2DQWA 2E8ZA 1S2TA 4I8YA 1CGTA 1ZB5A 1F8MA 3BJTA 3G24A 3S2LA 3QYSA 4A05A 3GVGA 3DFNA 2A6NA 2NQ9A 3N9RA 1FXQA 4Y7EA 3LGEA 2VEKA 2WNWA 4B9ZA 9CGTA 2XZ7A 5F4SA 5C9RA 1E1EA 3VMOA 2BV9A 4AWSA 5AC7A 1J01A 2GWNA 4V28A 3RU6A 4M6VA 2X2YA 2W0UA 1TR9A 2CLIA 4RDVA 3AS0A 3EA1A 4HZ7A 2BSLA 3C8FA 4GH3A 1KBLA 1T7LA 4BK9A 2QJJA 1UZHA 3WK2A 4E4UA 2NXGA 1DWIM 4M81A 3B0PA 4W84A 1TG7A 3B0XA 3FK4A 3HG4A 3PBYA 4Q8VA 1TE6A 3HURA 3UPMA 2H9AA 1MUCA 3TV8A 4HK5A 5EMJA 3CAVA 4NKCA 3N4AA 1EHAA 3MHUA 4H1ZA 1VFTA 4DVOA 3POHA 2ZRXA 4Z2LA 2JF7A 3F5JA 4IF2A 1H61A 4JQAA 4LBSA 1AJ0A 1OYAA 1W8GA 5AKQA 3ZJ7A 1S2AA 2DU2A 4UTKA 4HA3A 4V1YA 1J96A 4O11A 3B04A 3QYQA 1ZTVA 2DVTA 4ZGYA 4JGDA 3E02A 2XIOA 3VZZA 3WDHA 6XIAA 2QV4A 2R1KA 2PE4A 2GK1A 5EY5A 3MMUA 3N29A 2DH3A 3W24A 4H8UA 5KEZA 3CUZA 3Q94A 1Q6EA 1JYVA 3SRKA 3Q67A 1B3XA 2CYGA 4AIEA 2OEJA 2HS8A 2V3GA 1PSCA 3DGBA 4DZIA 4KWVA 1MEIA 4OJYA 2DSUA 4AMCA 1ISYA 1AJ2A 4UFLA 5A6MA 2GVGA 2G5WA 5F1VA 4L80A 1XIBA 3LYEA 5C5YA 3A21A 2VUYA 2PWDA 4LYKA 1FWCC 3GW0A 4TU1A 1UWRA 4UNKA 1Z89A 2A3LA 5BOFA 5F4WA 2WVVA 1J0HA 5TQLA 3WDPP 7CGTA 3WLRA 3MTWA 3URAA 4V2XA 5G2WA 1OD8A 2A7NA 3GH4A 3P82A 2CC0A 8A3HA 1AVAA 1EJ7L 4ORMA 3KLKA 2TSYA 1PIFA 3NM1A 2PRHA 4HYVA 4WOQA 1JG9A 1QHPA 4PUDA 4QJ4B 3GVRA 5D03A 4JX4A 4RKAA 4HN8A 2D0HA 3IAQA 2X1IA 4MJ4A 3VKCA 1I2QA 4M7SA 4B5SA 3VUPA 2W92A 3WD4A 1LOQA 1E40A 4OE7A 4DPPA 3C2FA 1YKWA 3FA4A 1PL9A 1OFQA 3KXQA 4B3KA 2EJ1A 3VM7A 1E15A 3R94A 4BEQA 2EG6A 4L1GA 3AMCA 5LIKX 3HA1A 4L4MA 3UW6A 4GINA 4YVVA 1F73A 2A3BA 1IEXA 3VPLA 2DV0A 3S2MA 3AHZA 3IJQA 4TUFA 4O1BA 1V3IA 1Q3NA 4DAFA 3K4DA 4LYRA 2PCQA 3V5FA 2X1TA 2NWRA 3GRIA 2POTA 4UTFA 1RPXA 1A5CA 2QNEA 1MEWA 1GQJA 3ZLHA 3W7PA 5GNXA 4X0VA 1EP2A 3L4TA 3EWDA 2V5CA 4KCTA 3ZVHA 2IKGA 3C6CA 3TNOA 1SGJA 3TZNA 1O1ZA 3TYDA 3LBOA 3B06A 1V0LA 5E6ZA 1JULA 3LLFA 4IH3A 2W79A 3WBYA 4ZFCA 3JU2A 4UMAA 3AMDA 4HU8A 2FJKA 5DO8A 3LTSA 4ZODA 2TPSA 3WF2A 3ZVHB 1RH9A 3NCOA 3W1MA 3UVIA 4GQ0A 4L4PA 1ME7A 2JKEA 4YXGA 2C0HA 3WLOA 3LRLA 4C6EA 5D9NA 1VB9A 2BXYA 2X7WA 1US0A 5H8UA 4GOAA 3N9SA 4HQVA 5EPDA 1JXJA 2Z2BA 1ECEA 1Z44A 5K4ZA 2J27A 1XD1A 1X6UA 3ABRA 1F3TA 1K6WA 5HATA 1U1UA 2VMFA 3N2OA 3CU2A 4GBDA 3COTA 4N0RA 2FZNA 4J3WA 3T0BA 4C6MA 3F5KA 3O07A 1EC8A 2ALDA 4IMCA 1B0IA 3CZLA 1LQ2A 4QTGA 4LVFA 2WSPA 1FWEC 1NAL1 4HPHA 1AJZA 1FFRA 3LCHA 3KCOA 3BOFA 4X9YA 1SZRA 4LT9A 1GHRA 1PDYA 4MY9A 4RXFA 2ALRA 4HNLA 3EDDA 1R46A 4JDBA 1UD3A 5LHFA 3EWYA 2PWVA 2HVMA 4JYEA 3U4AA 4P8UA 2E1WA 2VL4A 1AFSA 1KC7A 4H8VA 1G0CA 3IV8A 4ZQOA 1UPMB 1EJRC 3TXVA 3SO7A 1YXDA 1XLEA 1YNQA 1IWPA 2J88A 2TMDA 3N19B 2HV5A 1QBAA 5BXTA 1QPNA 4AD0A 3D3AA 3EMZA 4CQAA 1IT0A 2FZ8A 1JZ2A 1GPFA 3M07A 4C5ZA 3ZJ6A 4AU0A 1EQPA 1M1BA 3QHOA 4R34A 1W1PA 4WRHA 2X05A 2VFDA 4H8NA 4Q33A 2PDXA 1GHSA 2QCDB 5DANA 3OQEA 4CNTA 2ACRA 2WVVB 1EL3A 4H41A 3RPMA 1O5RA 1E70M 1U30A 3GAYA 2ZZ3A 3EEZA 2OCZA 4NHVA 2DH2A 3QPYA 1M5WA 2IPWA 2GK1B 3E49A 1TPC1 2Z26A 2WHLA 3GR7A 3ITOA 4WR3A 2VFIA 4HYRA 3ARWA 1V79A 1R0MA 4IIEA 1I0BA 3M7WA 3ATYA 2XSBA 2BHUA 2XINA 3BDKA 2J9XA 5EU9A 1LLOA 3EOEA 3CUJA 1TPB1 1U5JA 3M41A 3L4UA 2YLAA 2R91A 3C2EA 4HNNA 3UCQA 2CLHA 4PTDA 2ZZ2A 1K8CA 1XLAA 1W1TA 4C1LA 5DY3A 4MB5A 1QPQA 1R8LA 2E4TA 3TUUA 1YPXA 2O56A 3DHUA 4XBKA 3UG8A 4CQCA 4W8AA 3H7VA 1NDYA 2E5CA 1NFPA 2E67A 3GBEA 3BK0A 3L23A 2YOCA 4MIMA 3UZYA 1VGAA 2DIKA 2Z7GA 1GTEA 4ZOCA 1US2A 3H2NA 6REQA 1VEMA 5A6SA 3FHAA 1N2VA 4GCXA 2OB3A 3KEHA 3AYTA 5A5WA 2DVUA 4ZTYA 4LS1A 3FEMA 4YTRA 3C61A 3ZLGA 4DYEA 4E6MA 2I5IA 2I56A 2ABBA 2QDGA 1P1MA 4D1IA 3VVGA 3MUXA 3RUBL 7XIMA 4PMOA 3DHDA 4IFKB 1TPH1 3DIPA 2G95A 2ZTKA 1XXXA 3STEA 2KAUC 4UTTA 4K68A 3A9BA 3TSBA 5BXSA 4UQDA 3A23A 1P6WA 1W1IE 1KM4A 3HQNA 3L65A 4UNLA 2OKOA 3O63A 4GYJA 4S3GA 4Z2GA 3MO7A 3PY2A 5T91A 2O7QA 4HK6A 4CUCA 3QV8A 1FH8A 4JY9A 2W27A 3SUVA 4KCUA 1W9BM 4AC7C 5LSMA 5CJ5A 3HF3A 1XIEA 4XZMX 1HP5A 3FJNA 4C6JA 1TKKA 3ZWTA 2GJPA 3WEZA 4F66A 5H6HA 2VVNA 3B9DA 9RUBA 4OQVA 1LT8A 2DT2A 5FESA 1UBSA 1JYNA 2OZTA 4DLFA 4L9YA 4Y9PA 3VE9A 3IJLA 4DUVA 1JEZA 1KM3A 1M7XA 1M53A 4V1XA 4A3QA 4H6KA 4LB3A 1UWAA 3W7EA 1K9TA 1H60A 4O19A 3MMDA 4KRTA 4DUWA 3VGDA 1M01A 1WO2A 1OCBA 5AYIA 4MKVA 4KIEA 2PDGA 1LWIA 2WHJA 3R6IA 3IUDA 1CDGA 2V68A 1XINA 3FXGA 3PG8A 4DX3A 4IPLA 1POKA 3GNRA 5HQLA 2WSYA 3BURA 3UBPC 3VKDA 3HB9A 1A5MC 3HOJA 3HJEA 3VNIA 5D09A 3PZMA 5C9ZA 2DZTA 4WQ6A 1JUBA 2PAJA 3P5ZA 2F7FA 1QNVA 3VIGA 1FOBA 2V38A 4QIUA 2CLLA 5C2GA 4ERGA 1PEZA 3FYOA 2PD9A 4DLMA 4XZHA 1AQFA 3PZOA 1P7TA 3AXMA 3GQYA 1DQUA 1BXCA 3NPUA 5ECVA 1EB3A 1HJQA 4JEJA 1DJIA 4IFKA 6XIMA 3WFAA 1M7JA 1VHNA 3AHYA 1V08A 3EX2A 1Q85A 4K7YA 3LZ3A 1WA3A 2WC4A 1RSCA 1HO4A 3SCWA 3KDOA 1JJKA 2Q71A 4GE8A 3SI9A 1VJIA 3TN5A 2NV2A 4RXGA 3IACA 1WBHA 4YWSA 3I6TA 2NLYA 2QPSA 2YDSA 1BAGA 2XPKA 1XC6A 2WZTA 1TQXA 1BG4A 7TIMA 3BLOA 4QNEA 3TCSA 2OELA 2JFEX 3VKJA 4B92A 2RGMA 1EXPA 5FA5A 2J66A 3PTKA 4O15A 1OCNA 3OG3A 1WXZA 1I2NA 2I9EA 4MJZA 1FH7A 3IVSA 4F8XA 1EH9A 1ODUA 2XYLA 1PTGA 4GUIA 2Z25A 3HJZA 3IRDA 1DEDA 4EPBC 2XG9A 5G2HA 4OU1A 3F4CA 4I6VA 1OABA 3KTCA 4Z2JA 1W6TA 3VIPA 2DUXA 2YR1A 1J0JA 4YTUA 1R3TA 3CUIA 4N4PA 3A5FA 4DM1A 3A64A 1ZPTA 1R3SA 1XWYA 3VMNA 1E0VA 2WMFA 1HW6A 4AMAA 4B5VA 3NO5A 3WL0A 3MCOA 4CD8A 4GC4A 2V5JA 3VIHA 5L9FA 2J7GA 1ONRA 1SO5A 1VBUA 2QR6A 4BF7A 2X42A 3R7MA 3QR1A 5GJNA 3TONA 4QP0A 1YTDA 2P1FA 3VD9A 3NG3A 2BXVA 1UH2A 4LOCA 4LBRA 3EPOA 4PBEA 4Q4OA 3V3WA 5KSWA 3S9YA 1XIIA 4GNVA 3OG2A 1VRDA 5JIPA 5FAGA 1FA2A 3DGRA 5M5DA 1KRCC 3F2DA 4XB3A 3H24A 3M0VA 5T9BG 1YW1A 3DKJA 3WQWA 1L2QA 1WZMA 3S42A 2PZNA 2VRQA 2PUZA 4NI8A 4QE4A 1QVBA 4GY0A 4MZ8A 3LTPA 1NSJA 4G5DA 3MYPA 1X7FA 2P0OA 3RO8A 4M6PA 4NAEA 2Z28A 3FA3A 1FKXA 4WY0A 3A3XA 4O4WA 1W3NA 3MI6A 1QNOA 3H53A 3HIJA 3UJEA 1ISZA 3VDHA 3GIPA 4HU4A 2E9BA 1XYFA 2YZ5A 4B90A 4AZGA 4O1CA 2WMKA 1DOSA 1L6SA 4D6FA 1OHLA 2YCKX 3BLLA 2ZRVA 1FFQA 4AWTA 4ROPA 3TCEA 1ZUAX 2EAWA 1DQXA 2PCEA 1Q4NX 3KRSA 3KUMA 5AN7A 1WZAA 2HE8A 4LQ1A 4LWWA 3EB4A 1UA7A 1A5KC 1VQTA 2CZFA 3BAJA 2OO6A 3KCJA 4C6IA 1FVPA 1MQQA 4B4FA 1NDWA 2QJIA 3D5HA 4QSHA 5KMYA 4FOUA 3GK0A 4HPNA 5KZDA 4DBUA 2NUXA 3WQ4A 3MUY1 2Y8UA 4QITA 4NYYA 3IK4A 3QR3A 4S3KA 4K38A 1US3A 3W75A 4GUJA 3HG2A 2PBOA 4JTGA 2FFIA 4GXPA 1J10A 3WH7A 1QFEA 1BG9A 1DJYA 2DUAA 4HU3A 2OWXA 2NX3A 2WW5A 4R7JA 4F0LA 1K7EA 3ARXA 1LBFA 5CZSA 4H6RA 5JXQA 2UY2A 4IIDA 3GM8A 2YYUA 5FEZA 1I4NA 4UUIA 4FHAA 3S1UA 3SBFA 4LF1A 4RNFA 2XVLA 1F4HA 1TVLA 2VRJA 5LIWX 5D2YA 2AQVA 3K8KA 2BASA 5DFAA 4Z0JA 3LPOA 3AHTA 2E40A 1CZ1A 5LA0A 4AIOA 3WNOA 2I14A 2PF8A 5E93A 1EA9C 3PTDA 4MB1A 1DP0A 3SAZA 3GXDA 2D24A 1KV5A 4YCOA 1OBAA 1RR2A 5JU6A 1UR4A 1ZRQA 3GE7A 3LQGA 4ADSA 1OINA 2O92A 1C3FA 4BQ4A 5D2XA 3H4WA 2D22A 4QQUA 2QDHA 1RUSA 3VK5A 3GKAA 4O0ZA 2GVJA 4UBPC 5A1AA 1GOQA 3QF0A 2J9ZA 5A8GA 1P7TB 3U6WA 1M6JA 2INEA 3MUCA 4DY1A 2XJ7A 4ZA0A 3VOJA 4LNCA 1B4KA 1FWJC 3VU2A 3B8SA 3WJSA 4PUNA 4FXFA 3G1VA 2VGBA 5EKYA 3MYOA 1EC7A 4HCLA 1DWAM 3MU7A 1AZ2A 5H8PA 3PP7A 4NF7A 2QCFA 2JGYA 3MT1A 4R9OA 2ACQA 3QHNA 3CUFA 3AJ7A 1G7VA 1KRMA 2AQOA 3GG8A 3UR5A 4IUGA 3NXLA 3EWUA 1GOIA 4W87A 4Z1YA 3WD2A 1K03A 3GFXA 3IJIA 3PZGA 2JEPA 3BQ5A 2YA1A 1GJWA 3G1AA 5ABFB 1V6YA 3L21A 4AQLA 1GTHA 3S5YA 4GI9A 4KEUA 1A50A 1EDQA 1XL9A 4D6DA 1WKDA 2FGZA 4GO9A 3C5QA 4HTYA 3H2FA 3NQAA 3RX2A 4XZNX 2B81A 5C7VA 1ZALA 2WSRA 1VFSA 3W7MA 1YPFA 1D8CA 4ES4A 1AUSL 1J5SA 3C3NA 3WLPA 1EGMA 2VGFA 4V33A 3N04A 1T41A 2OSXA 3VAVA 1FWBC 3L66A 1TRIA 2QF7A 1YHTA 3AIUA 4GD0A 1GQNA 2V5DA 3AMKA 1OX4A 4RW5A 3W28A 3L0GA 4PEEA 3C0QA 1Q6FA 1KD0A 1GOKA 1MNZA 4IHCA 4DXXA 3RRAA 3CB8A 4DWSD 2D73A 2Y88A 2X1SA 4B15A 1XJBA 1JR1A 1TZ9A 5LIUX 3KBSA 4S3BA 1EOKA 4H6QA 3HPFA 3IRSA 3NQVA 4WK9A 4N9EA 3QC0A 3GXNA 2QT3A 2GJRA 2DGAA 3BGAA 4Z08A 1O5QA 4LEFA 1R38A 1UG6A 3WQVA 3GBDA 2GVYA 4IISA 2WZIA 3ZFHA 1GJPA 2Y62A 1ME8A 1BFNA 5LNWA 1H2JA 1ZS2A 2V0TA 1UR0A 3N9KA 5BW6A 3VKAA 4F2UA 1H0GA 5AYXA 2FZMA 1XLFA 1UZDA 4H9VA 3B3DA 4JTDA 3WY1A 3OLEA 2RDWA 3SSJA 2BB0A 1WB0A 4YLWA 3HG3A 3W27A 1QPKA 3OZOA 1Q2SA 4X3ZA 4XO6A 1Q45A 1FY6A 1WZKA 1KXTA 3VDGA 2CESA 3U2CA 1E0XA 1L0PA 6CGTA 2YSWA 5A8OA 1P5BA 1EOMA 2NV1A 4A8RA 4ADTA 1S5NA 1KM6A 1SU5A 3VDBA 1RJRA 4CD4A 5CAHA 3VE7A 3A12A 3PWIA 4WHBA 1EDGA 2SFPA 1EIXA 1ZL1A 1MUWA 4TQTA 3I10A 4H83A 3ES8A 3K1GA 1WDQA 2R6OA 2OO0A 1M7PA 1YX1A 3BSHA 3CHVA 1Y0EA 1TTJA 1FRBA 3WH9A 3UJFA 1EDTA 3GW3A 4R88A 3SCQA 1H5VA 2E3ZA 1SMAA 3KOWA 1V3KA 4EAYA 1LDCA 5LNSA 4JYFA 4MB4A 2A4AA 4M8UA 1EGVA 5CKSA 3FVDA 1UA3A 1MDRA 3WFZA 5FJOA 1XLKA 3W73A 1REQB 3OB8A 1BWLA 3G5EA 1CLVA 2YDAA 5LZLA 5CSSA 4MPKA 1TYGA 5DCBA 4O0KA 1SO4A 5HQMA 1Z69A 3MSYA 4W89A 3HQOA 3E0WA 5A3HA 3ZM8A 3DAQA 4Q4SA 2NT1A 2ZUUA 3TTQA 2ZXDA 3DN5A 1DJHA 3DFPA 1AH4A 3W70A 1ZHAA 3F4WA 1DPMA 1W8SA 1UC4A 4X22A 4R3UA 4WJ8A 4MOZA 3PPFA 4UTTC 1MDLA 1O12A 7A3HA 2ZWYA 2V67A 2GDVA 3N12A 5BZAA 3CXOA 1QWGA 1JZ3A 3QY7A 3C56A 2Q02A 1K77A 3EWWA 3W7DA 2CPUA 4TMCA 3ZR6A 3IIPA 1E1CB 1E56A 4KERA 3RCMA 3G0UA 3SGGA 3SUTA 2FGLA 4FMVA 3M43A 4DIAA 3BC9A 3GYEA 1EPVA 3AWNA 1A4LA 2V2DA 2PDHA 1HT6A 4CCDA 4K37A 3V36A 5C71A 3GS6A 2FTWA 3XIMA 2PRMA 3MV11 4CQBA 5DY2A 2CFFA 2P5NA 4KWSA 2GQ8A 2C91A 1W1A1 4AHQA 3EMCA 4QROA 1YBQB 3HBLA 4HOZA 3LCLA 4U4MA 2QGYA 4F0RA 3G1XA 5ABFA 2CLEA 3LCWA 2OZ3A 3E9AA 2V82A 3KTXA 3CWOX 3GUGA 3UG5A 1LORA 3ENLA 4O17A 2QCGA 5D2VA 2VENA 1S5WA 3EXTA 2EXOA 1CXEA 5K2ZA 2PPGA 2F61A 4CVUA 3UNTA 3RX4A 1EYEA 1OK4A 1KCXA 4NZ3A 3E0LA 1PXGA 2JKPA 1SFTA 2ZC1A 3T2QA 4Q3MA 2R14A 1V3HA 3N4FA 4RZ5A 4H8HA 3E5PA 3FVMA 3MANA 1O4UA 2IKJA 4I7UA 5JBDA 4KWUA 3VDAA 3MHGA 3VD7A 2G97A 4HNUA 1J2BA 1Q6RA 3W07A 1R7OA 3S0CA 1GUVA 2DZPA 2YPIA 1S5VA 3BICA 2DORA 1XLLA 4JTSA 3RJXA 1JRCA 3PUOA 3EWBX 4D6GA 1SUXA 3HFYA 1XDMA 2XM2A 4D8LA 1QBBA 3EOLA 3TYEA 4RE2A 2PWUA 3KS5A 3GIQA 1K7FA 2PU0A 3TVAA 4G6CA 3N6HA 2Z1BA 2OQYA 1XRTA 4PRWA 1W5QA 2D3LA 1GNXA 5C9XA 1D3GA 3UWEA 3OP2A 2PDCA 1LWJA 3WLHA 1T8QA 2Y7GA 2GGEA 2ZA3A 3T0CA 2ZWZA 3ANYA 4MWAD 4ZQCA 3BUVA 1SPQA 4NVTA 1Q6GA 4MUZA 4U28A 4IP7A 4C6NA 4YHEA 3ONCA 3T42A 4BKNA 2VX5A 3A3WA 4C6QA 2HSAA 5CPTA 4LCSA 1WOBA 4AEFA 1AW2A 2CZDA 4FNPA 1Q6CA 1EEXA 4GISA 3ZYZA 2WO5A 2PDYA 3W88A 2FB3A 1OFPA 3W84A 1CXFA 2J8FA 1DBTA 4XZBA 5J8LA 1LZOA 2X16A 2WZHA 3ZOAA 4BF9A 3DYMA 4LV9A 2NX9A 4HOXA 2VHLA 4NZFA 1S3TC 2XFRA 1UW9A 3P7YA 4O50A 5HK4A 4W7UA 5BROA 2PDBA 3BOLA 1IEIA 5JUVA 1IWBA 3ID7A 1HKKA 3OZYA 2OT1A 3VMPA 4FXJA 1P0KA 2FFCA 3MCMA 1IZJA 4KS0A 1E1CA 1KB3A 3VCCA 1W1B1 3FN9A 3HG5A 3WBAA 1VEPA 4RZ6A 3ABOA 4DJEA 4IG2A 5H2ZA 1UKPA 3KWSA 1C90A 3UXKA 3UNDA 1G4TA 4FF5A 3MKVA 3SQSA 4HOWA 3ZR5A 4WSHA 3VX1A 2XGZA 2OVLA 3LGGA 4E2BA 4DWSC 1JCTA 3UEQA 2UY4A 4IL0A 3S5SA 1A53A 2GL5A 3I4EA 4HN4A 5G1YA 4UR7A 4AD3A 1W17A 5I02A 2UBPC 3U0HA 2QUUA 1UKTA 4Q8MA 1P0NA 3KBNA 3B0UX 3MQTA 4IICA 2GSHA 1WXYA 4ZENA 1JRBA 2PTWA 2R94A 4OFCA 3RM8A 4MLRA 1E72M 1LL4A 4JD4A 2XVNA 4A2SA 2IPJA 3IANA 4LNYA 1W9UA 2HK0A 2CHRA 2R1LA 1VLWA 5IBXA 2OJPA 1MRQA 1UPPA 3WFLA 5AOUA 2WHKA 5T9CE 4OUIA 3W74A 3S1VA 3EPNA 1ZLPA 3I3DA 3USBA 4EK7A 3E3HA 3P84A 2FQIA 1J6OA 4GXWA 3ONBA 1UD2A 3E0VA 2BODX 4MF4A 1OWQA 1H49A 3UWYA 1QRQA 1YLVA 4PN2A 3AZSA 3P3BA 4QNWA 1HKMA 4Y9MA 3VKKA 1JXKA 1DJNA 2WCAA 2A0NA 1XFCA 4QXIA 3C2VA 2QUTA 4LEQA 3TU9A 4ZXLA 5A69A 3E1F1 1UP0A 4D8AA 2BMBA 5I09A 3RM9A 4CN4A 2F6XA 4M29A 3ITLA 1A47A 1YXCA 1HGWA 3G18A 2XH7A 1GOMA 4HZ8A 4TX9A 2W6RA 3OEXA 2Y61A 4ERIA 2OWCA 1EWDA 3U2ZA 2XM1A 2VELA 4IMFA 1SJBA 1HL2A 3L5MA 1E71M 2YDRA 1XCXA 3DHPA 3ZWSA 1GG0A 4FLSA 3EX6A 2PP1A 4PZVA 3KOZA 4OZOA 1EXBA 4TX6A 2GGJA 4Q22A 4GVHA 5C55A 3NDOA 3N25A 2FPVA 1J93A 2POZA 3PSVA 3NL2A 4NX5A 1S5MA 2HWGA 3FJLA 1KM1A 3DG7A 3VCNA 4LFYA 4G1KA 2NSOA 1C8VA 4R7OA 5FF2A 4L6DA 1ZAHA 2VFFA 1RY0A 3KVMA 4JIEA 1OT2A 2F9RA 2FMOA 3OBAA 5E9XA 1IXOA 3KWXA 3VNJA 2W9MA 3P74A 1ISWA 4WD0A 1KW1A 2ZUNA 4Z1AA 1Y8BA 4KKXA 4M3PA 3ITVA 1V51A 4Q4PA 4KW2A 1TTIA 5DCDA 3U9IA 2IKIA 4F9JA 2WLYA 3FXYA 1NWTA 3UG3A 1U33A 1XGEA 4NZ1A 4IL2A 3P61A 3P67A 1WCGA 1E3XA 3A6OA 4XAPA 5BWAA 3ITCA 3KX6A 3M4HA 1JGMA 1C8QA 4MKSA 4YVPA 3RLUA 1TPWA 4GQBA 1D9EA 1IYXA 2OLAA 3UJSA 5LNVA 1UZ1A 4IWWA 1GORA 3TX9A 1XQKA 3F2CA 4WY0B 4X63A 2WXDM 4DXKA 3MSRA 3CIXA 3EKZA 3WQ8A 4N9BA 3GH7A 4HB7A 3LI1A 2AGKA 4E2VA 4NIRA 1MW1A 1X1ZA 1PPIA 4XD6A 3MJYA 3DH7A 3DC0A 2Q6ZA 3GHUA 3IJDA 2WANA 3VC5A 5G1TA 3W02A 1SZGA 5HBFA 1A0CA 3WL1A 4KMQA 4O53A 1N8IA 3DI1A 4QJ3B 3W1NA 1G67A 3W26A 2J6XA 1JL8A 2PC4A 1EJTC 1DQWA 4WDXA 3OHMB 3K30A 2ODOA 3BAXA 5CZTA 4AY1A 3THUA 2X0HA 1VZWA 4L65A 4C5YA 1W9VA 1TFVA 2O9TA 3APTA 2REQA 4O13A 1DTUA 1AL7A 1O60A 4O28A 4MNKA 3THAA 2FYMA 4JTJA 3PG9A 2DZXA 1IF2A 2A5HA 3CZKA 4L4LA 2UY3A 1KWKA 1VBRA 4E8GA 1Q8AA 4U5IA 2QCLA 3GNPA 1B90A 2ZZ7A 3B8DA 1QW7A 3PZIA 3GG7A 3IPWA 5FL1A 2Z1WA 1P48A 3ZT6A 3CEUA 1B30A 4ZCWA 1VCVA 4GJ1A 1FWDC 4O8AA 4JYDA 2QJHA 2B4GA 2WVUA 2Y6ZA 4DB7A 1YPIA 1ESWA 2CNCA 3P8JA 5HMSA 1VCFA 1OC5A 3CHCA 2PLJA 4Q4MA 1Q6QA 1DWFM 4JQ4A 3BE7A 5A2BA 3IJ8A 3NDYA 1LROA 3OJGA 1N82A 3KRZA 1NF0A 3URQA 1EJWC 2UWFA 3DBPA 5EBAA 2A3HA 4GKTA 2Y7DA 3WQDA 1VD6A 4GO8A 1LM1A 1KM5A 2FPTA 1I6NA 1ICQA 2QCEA 2E5BA 5KITA 2Y85A 4AH7A 2J7DA 5IHSA 1W56A 4I7VA 4XTDA 2QVNA 4QLKA 2YA0A 4W7WA 2YX0A 4DUXA 4YNGA 3I4KA 4D6IA 1ADOA 4PGLA 3I7QA 2ZZ5A 3WH6A 3S2NA 3G0SA 2FJUB 3LX9A 1XYCA 1W5PA 2OQHA 2PDKA 2BGQA 4RNIA 5AY7A 2YL8A 5HUOA 4A3RA 1E0UA 3LPGA 3RMEA 4HSHA 1I1WA 2NQ5A 3WUEA 5HNTA 1KFEA 2FDSA 2ISSA 3CC1A 3WQ6A 2DJLA 3TMLA 3PTMA 5RUBA 1RBAA 5CLWA 2YXGA 4CU7A 3PJUA 4LCQA 3TC7A 4O18A 3K13A 3VFLA 1CLKA 4NJHA 5AHNA 4JFVA 5HMFA 4KQNA 5HMDA 1UB3A 1HL9A 3NGJA 1QO2A 1U5VA 3P60A 3OVPA 2I1OA 1S46A 1NFGA 3MKKA 3MUIA 3MHFA 3CQJA 2IQTA 4ONVA 3GWQA 4IQJA 1MQRA 1QHZA 1X38A 3W7RA 4LY8A 1PCKA 2Z2AA 1XHGA 4NU7A 4BJHA 5A8QA 4AF0B 5J5RA 4L64A 3B9EA 1YDVA 1AL8A 3QMTA 3VGFA 3MW7A 4MWAB 1W1ZA 1YEYA 3CQHA 2OR2A 2DSKA 3R58A 5I2UA 1OX5A 1LBMA 3RRXA 2QJGA 3SY1A 4ADUA 2ZA2A 2WCGA 3K4WA 3TYCA 5M1TA 3QPEA 4JXCA 3NA8A 3NOYA 3WEOA 1I2RA 1H1ZA 3T44A 2PC8A 2XU2A 2ABAA 3CAQA 4OKDA 1OGBA 2DSVA 1JIBA 5A6AA 2CZ5A 4F40A 2Q01A 4GK8A 1RVGA 3C52A 3JS3A 1R3VA 3CMFA 4CCEA 4FF7A 3UY7A 1IXQA 3TQVA 2HRWA 1AMKA 4XVDA 4MYXA 1T6MA 1CIUA 2YXOA 1E0TA 1PZ3A 2BHZA 1BYDA 2FVMA 1B31A 1QI3A 3RX3A 4N6EA 4Q8PA 2AAMA 3MVIA 3ZLFA 1IEVA 1UJQA 3I65A 1CT5A 3WD3A 1VLIA 3VM5A 1JDDA 3KBMA 3KW3A 3OVGA 3TSDA 2TRSA 4JDYA 2VD8A 1E6SM 1HJXA 4YYCA 2IKHA 3BSGA 4IGHA 5IM51 1R9YA 4MY8A 2OOGA 2Y2WA 4GYKA 4H00A 1RLCL 4JTHA 1LOSA 4CD6A 3LBMA 5AC8A 2EO7A 3AS1A 1NP2A 3KOYA 4JN7A 4IG2B 1EJUC 2IUZA 3ZZ1A 1ELSA 1CXLA 3QSRA 1XF0A 1BHGA 4GJJA 4J28A 1SO3A 2ICSA 3O3RA 5I6SA 2CXGA 2G50A 5M3WA 5K7JA 3LXBA 2MANA 5LKYA 1IT7A 3FS2A 4HA0A 3NOEA 2B7OA 2WM0A 2E8YA 2V8ZA 4HYWA 4A29A 5FJJA 3FW6A 3W7IA 3WD1A 1JAEA 2IQDA 4PUKA 1LL6A 1VIZA 3NPXA 3VNYA 4NZ5A 3QV9A 4AZCB 4JIPA 4FO4A 1NQKA 3N11A 4G56A 2AL2A 2CZVA 2WJZA 1LWHA 5D30A 4JTUA 3FNDA 5EL1A 1E6ZA 3QVQA 1TELA 4C6CA 5DBUA 3VYLA 4WGHA 3SCSA 2G4JA 1WZLA 2BY0A 1RJPA 3DBNA 1TUXA 4AZ6A 2XH2A 3VGHA 4C7FA 2AL1A 5EFDA 1CI1A 1KLZA 2ZZ1A 3UA3A 2YCLB 4NNAA 2PTXA 1MI3A 1IZCA 4LJ3A 1TCMA 3SJNA 1OGSA 4AF0A 4DJED 1JF6A 1PHQA 3WLTA 1OSEA 4PYSA 3WYZA 3TJ4A 1W1YA 1G4SA 3VNDA 3AXKA 1UHVA 2P88A 3LS9A 4P8WA 5FF7A 1Q7QA 4BEUA 5C0QA 3VABA 1K02A 3TH6A 3CH0A 4BHYA 3AZTA 1YXYA 4BR1A 2CZEA 2WLZA 3UERA 5EYWA 2O7SA 4YL2A 2PWFA 3WLNA 1RZMA 4TXEA 1XIMA 4LALA 2ACSA 5C8BB 5AB3A 2EPOA 4UWMA 4ECLA 2HXUA 3EA2A 1GWJA 2C79A 4S3DA 3RG6A 4P5UA 4QE1A 1C93A 3NGFA 3MSDA 5HPCA 1CCWB 3GLCA 4QDPA 1R85A 2WZMA 3SECA 1XGDA 3MWCA 3T1GA 3TA9A 2JK2A 4N9DA 3MY9A 5FEPA 1TA3B 3MUZ1 2VZOA 3P2VA 2WC3A 3GKFA 5I0DA 4QE5A 2LLEA 2PFHA 1RQEA 4RCXA 4UFIA 4A3YA 5H8MA 4F2BA 5CPOA 3KS6A 1BVWA 2V3FA 4QG6A 4M56A 2PDQA 3A4AA 4ZEPA 1GKRA 3UG4A 3TFCA 1JCNA 4LUTA 4JQ2A 3FCPA 4D71A 2ZUMA 5CPSA 1JZ7A 3A5VA 4W88A 1P1XA 2C1HA 2E77A 1M03A 5DELA 4ACYA 1F61A 2V3EA 2VZTA 4RE0A 3CMGA 3UETA 4C1NA 2VGGA 5XIMA 4LY4A 4DZAA 1B4EA 4HZ6A 4LSBA 4Z42C 3W23A 1DIOA 1EUNA 4PODA 3EGJA 3GTNA 4Y8FA 2WB5A 3NR0A 3W00A 1UH4A 5D8ZA 1PWLA 2NWSA 3IGUA 3IJ7A 2OMAA 1S39A 1XDJA 1ZP3A 2X09A 4QAWA 4QLLA 4TVCA 3THCA 4J3ZA 4E3VA 3C4UA 2D20A 4YS1A 1K8YA 2ZOXA 4OV9A 1CEOA 4S2BA 3T78A 5FF3A 2ATMA 4D6EA 3FKRA 1QDSA 1OF6A 5A6TC 2RDTA 2GVEA 2BHYA 1XBYA 1R2SA 3RPDA 1W0MA 2XGBA 4CQDA 2VFGA 3VD5A 3ZS4A 1XKJA 3WDIA 1TPFA 3CHEA 2GUYA 1R9XA 1VPQA 4MWAC 1H63A 4PMDA 1F3EA 4ATLA 3PJXA 3BMXA 2V2HA 3VINA 3JZEA 1OY0A 4IPJA 2OQLA 4UIOA 3QGKC 4R85A 4PL1A 3UZXA 5T26A 3WLQA 4MPQA 2BNJA 3K46A 2JIWA 1MEHA 3C0SA 4FOJA 3LPPA 4PB5A 3GXIA 1PJ9A 3Q4DA 2I16A 1MZRA 4F0KA 1IXNA 4DI9A 4US6A 5BOEA 1DJXA 2FZBA 2Y0FA 3MJMA 1FWWA 4LUIA 1V93A 1VAHA 4GG9A 3TN3A 1A5LC 1EFZA 1WDSA 1XLCA 3QQ1A 3UESA 3L0KA 1QW8A 3M0YA 1UUMA 4MWAA 3B05A 3S2JA 3LB0A 4W5UA 4M1BA 3KE0A 3PTQA 2VC5A 1BWKA 2BOEX 3ITXA 3G6MA 3M7SA 4DAIA 4PUMA 1VJSA 1R7AA 1GQIA 5HULA 1HXJA 3H70A 2P10A 4GI8A 4EOUA 1H3GA 3SN0A 3W2UA 5AVNA 3L9CA 3GH5A 5REQB 3QV7A 3WO8A 1CGWA 4CNPA 1XS2A 3CAWA 4IPIA 1IGWA 3NSNA 3RCYA 1PVNA 2CWXA 3E2SA 2ZXBA 3ALGA 4EAMA 4BA0A 4GZEA 5I24A 3VGEA 1I2OA 2J9YA 5E5CA 4DNMA 2C1GA 1Q7ZA 4X0NA 1F3XA 4DWSB 3IIXA 2O4MA 1F9CA 5G1MA 3URBA 3NL5A 3ITTA 4ZR8A 3BLPX 1TJ0A 4IIBA 2XIBA 5CSYA 4J27A 4DYJA 1TUFA 1E4IA 5CPNA 1UC5A 3MP5A 4H9UA 3BV4A 1FWAC 1DWGM 2ZADA 4E8CA 1V7AA 1QCWA 2FVKA 3RJYA 4I5XA 3TDFA 2YW3A 1H7WA 4ILSA 2WV8A 3RCNA 2QVHA 3W2LA 3T6CA 3UWUA 4Y9AA 2ZRWA 3LCFA 2Z00A 4XISA 3N73A 4L9XA 2V5KA 3DYOA 1E9ZB 1K4GA 3L7RA 4MNMA 4H9ZA 1XM3A 2YCEA 5D33A 3VNLA 4B3ZA 4PSPA 3LHTA 2ZRYA 3T0TA 3W0KA 2XGIA 3KL3A 3T8LA 3O6AA 1QNRA 4J35A 1SZEA 1X98A 2FPYA 3T8QA 2J7FA 2WCSA 1VFMA 4AVOA 1F07A 1HNYA 4AW7A 1JPKA 4W85A 5TBOA 3VKBA 4RW3A 3R5EA 2ADAA 1NOFA 1KTNA 3DOPA 4JNZA 3VGGA 2OGYA 2X40A 3MP4A 1FHLA 4KCWA 1G1YA 4I9TA 2VZUA 4GCAA 3UWVA 1KRBC 1F6KA 1P4CA 1XLHA 3LXCA 8TIMA 2WKGA 4QCFA 6TIMA 1FP8A 2HDJA 4LPCA 1XQLA 2YBUA 2PLMA 5FD0A 1LYXA 1PHWA 1NDVA 1MXGA 2F2KA 4JQ1A 4AIUA 2E0PA 3TC3A 1L2UA 2J8GA 2J75A 3T05A 1BD0A 3D47A 2WAGA 4Z2KA 5F2IA 3GDKA 2GLKA 2GFTA 3BH4A 4O1DA 3RLVA 5AYBA 4GX8A 1EQCA 1YNPA 4DHGA 5TNVA 3PULA 2FTYA 3WK1A 2VZSA 3BJFA 3MO4A 3IEBA 3E0IA 1E43A 3AU6A 1K3UA 2NV9A 1JDAA 3M64A 2PP0A 2NT0A 4LAOA 1NWUA 1O68A 3ZSSA 1E1FA 4M82A 2PWGA 1MYRA 1RJQA 3BL3A 4OOZA 1NJJA 3PPHA 3ABQA 5A6LA 2ISVA 2YIHA 1L6GA 1OFAA 1LUCA 4FX6M 4AC1X 1C8XA 3QTPA 3V7PA 6ALDA 1B3OA 1PX8A 3ARVA 1Y65A 5D05A 2CKSA 5D2WA 2XN1A 1K7XA 2WOQA 1H7OA 4RPPA 1KM0A 3TA6A 4ORIA 1FX6A 3D0CA 4FNTA 3S46A 4WKFA 4H9MA 3W76A 1QNSA 1CGUA 3RIKA 5ABEA 4Y8EA 3ARSA 3AMLA 3JVAA 4ROQA 3UA4A 1BVZA 2PRLA 4FNRA 1PE1A 4F0MA 1NELA 3T55A 2JBMA 2A3EA 3BG5A 4FIRA 2ZZ4A 4WZHA 2EF9A 2XH4A 5FJPA 5ENLA 2BVDA 4BI5A 2XVPA 1Q66A 1NARA 6TAAA 1XLJA 1R30A 5BRBA 5CJMA 1T99A 4XAZA 3NQ7A 1DWHM 3CL6A 3LHZA 3AMGA