1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxyribose-5-phosphate aldolase
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
molecule tags Structural genomics, lyase
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
1KV8A 1EEPA 4AHOA 3P5ZA 4JTFA 2D73A 4MY9A 3EKZA 1X8FA 2V0TA 3O1NA 4GNJA 3S5OA 3W84A 2PRLA 3NQDA 4JTSA 4WY0F 3NVTA 3L5AA 1QPNA 2QUTA 4N9BA 5D2XA 4AHPA 1LRQA 4LU0A 3NQ8A 1TV5A 1PHWA 2R91A 3TR2A 3TIMA 1L6YA 2AGKA 2H90A 4UCGA 3A24A 4NJKA 4NNAA 4O13A 4W9TA 4JX4A 1GTEA 2QCDA 1O94A 5A5WA 4JYDA 5AC6A 3P8IA 1I2NA 4MIMA 3PSWA 3LLFA 2ZYFA 3Q94A 3U2OA 1YXYA 2Y85A 1DKWA 3O6CA 3W7EA 3DFSA 4Y96A 2PRMA 3NYZA 3WJWA 3QJAA 3W1RA 1THFD 3DGRA 3LERA 1G4TA 1WXJA 5IBXC 1Y0EA 3G1HA 1AMKA 3FOKA 3LTPA 3NL6A 4RZ4A 3ATZA 1SW3A 2H8XA 2V2HA 4TMCA 4A2RA 1FDZA 1SO4A 2BWGA 2CLHA 4XKYA 3P62A 1JCNA 4LS0A 1NSJA 5EMUA 1XC4A 3TUUA 1C29A 2EPHA 2NLIA 4Z1AA 3Q58A 5FF2A 3MHUA 3WJYA 1TMHA 4UTKA 2OT0A 4UC5A 1W5NA 1H7PA 4IOTA 3W7CA 5BOOA 3QFEA 2A5HA 4WJEA 3EKLA 3PSVA 4JD4A 3HJZA 2WNZA 3IGXA 2QCDB 1IIGA 5HR7A 3SFKA 2A1YA 4OBTA 4FX7A 5CKSA 4HPJA 1DJNA 3QPYA 4A3UA 3C2VA 2ISWA 4ICNA 4AEOA 1ML1A 1VHNA 4K8EA 1FDJA 2ZA1A 4UR8A 5SWUA 2PC4A 5HINA 3EWZA 4UTMA 4K38A 1GT8A 1MEHA 2Y89A 3O07A 3TU9A 2X30A 3B04A 1HUVA 4ADTA 4O10A 3MI6A 3GDLA 4Z1BA 3L0GA 4XZ9A 5K9DA 3HG2A 5AFDA 4H3DA 1H62A 4JICA 3N3MA 1F74A 3KX6A 4OV9A 1N7KA 1QO5A 3CEPA 2CLFA 1H5YA 2X1RA 2WNQA 1O5KA 4K37A 4PA8A 1A50A 3G3DA 4D2JA 1FXQA 3M7WA 1GG0A 1JCMP 1LP6A 5C5YA 3C8FA 4M6QA 1G4EA 2DZPA 3T78A 4E0CA 3TC6A 4U28A 4UFIA 4NNBA 5DELA 3OG3A 1LROA 2I14A 5U4NA 2X1SA 3RK8A 1GVOA 4LVDA 4FIQA 2QCEA 1K03A 1FWRA 1TRIA 2YX0A 1JUEA 3LOTA 3GAKA 3TAOA 3HGOA 1JVNA 1RQBA 1YDOA 1TQJA 1H61A 1J5TA 1Z48A 1OX6A 3IVSA 3T7VA 3QSTA 1YPFA 1J2WA 2YR1A 1K8ZA 3PUDA 4HNTA 1RV8A 4M7SA 4O4VA 4EOUA 2GPTA 4HNVA 1S3HA 3VCRA 2C19A 4GBUA 3L2IA 4Q4KA 2V81A 1UBSA 3S5NA 4NX5A 4MJMA 1NF7A 4CQ9A 2ATSA 3W2UA 4ADUA 3L9CA 3GKFA 3WK3A 3W22A 3W70A 3UWWA 3W7RA 4O18A 4KFNA 1G67A 2Y70A 4UFLA 3NAVA 2A2IA 3AJXA 1QPOA 1YPIA 1YDVA 3CU2A 4M6VA 1Z42A 1KM0A 4KWWA 3TXZA 3STFA 3UWYA 1VRDA 4O1CA 2V9DA 2GQAA 2Y7DA 3W72A 3QQ0A 4N2YA 1IXOA 2V30A 4WOZA 3HQ1A 3GVGA 3CWOX 3TAKA 5AOUA 1JR1A 3FEMA 2ZZ7A 5HJLA 3UY7A 4M7TA 1BKSA 1QDSA 3HPXA 3MHGA 3M5XA 2KZHA 4Y9AA 4FNUA 5K4ZA 3PBWA 4DBEA 4B5NA 2NV2A 3C6CA 4FNTA 1AW5A 3MBFA 3PC0A 4R7JA 4OE7A 3PVFA 4TX9A 4Z0JA 1ICSA 3F1QA 5D2WA 4ML9A 2QDHA 1OFDA 4FF7A 1TPDA 3CIXA 2VEMA 4IXXA 3NM3A 3STCA 4QISA 4LW7A 3FYOA 1QAPA 1HFBA 3LHVA 3W71A 2W0UA 1XBXA 1ZAIA 2EGZA 1QWGA 1R47A 1TO3A 3W7IA 1KA9F 3WK0A 3EB2A 3LGEA 3NQEA 1O95A 3QQ1A 2C6QA 4YMZA 3USBA 1JULA 3ZWSA 1GJPA 1IIHA 2G96A 4I9AA 4UFHA 4JTKA 1P5BA 4JTTA 2WOQA 1I2QA 1VR6A 1EIXA 3B0UX 2WNNA 3CIWA 4EF9A 3HF3A 4N4PA 5D03A 4PCFA 1OFOA 2TRSA 4DEFA 4MLJA 4DBDA 5D05A 3O16A 3SGZA 1R2TA 2YCEA 5AB3A 4AH7A 2ZQ0A 2C1HA 2HS8A 3E12A 3M47A 2NX9A 1ZNNA 4RXGA 3B05A 3ELFA 2TPSA 4TIMA 3PG9A 3OVRA 2BXVA 4LV9A 4IGHA 1K02A 5FF0A 5K2ZA 1IGSA 3CC1A 1GG1A 4NJGA 3GYEA 2NUXA 3PB2A 3LCIA 3QF0A 3IIOA 2XN0A 5CZ0A 4ZQOA 5K4XA 3CB8A 4YLWA 1M6JA 3UQNA 3S1WA 4ZQPA 2DZTA 1FCBA 4O0ZA 1QOPA 1SFJA 4O54A 1R30A 4AWTA 1OYAA 2JBMA 3CHVA 4LTSA 3C2EA 1VGAA 2H3DA 3W75A 3L0NA 4MYAA 1MZHA 3TNOA 3FJ6A 2Y61A 3TW6A 2ZBTA 3C2RA 4EWND 3G0SA 3M0ZA 1MEWA 1H7OA 4UTWA 3BO9A 2FPTA 2HS6A 3TW7A 4HSNA 4JGDA 3EX6A 2DU2A 3W2JA 4CCEA 1SZNA 3QM3A 2GVLA 1RPXA 1VJIA 3KVKA 3LI0A 2ZZ3A 1XBYA 4OU1A 4JDYA 5FF3A 2X16A 1I2OA 3W6YA 2NUWA 1R46A 2Y7EA 3INPA 3DKJA 1KTNA 3NDOA 2P0OA 2DP3A 1LLWA 4NJJA 1IXPA 3LCHA 1B4EA 4JTJA 1W3NA 4WY0A 1WDWA 4FEZA 3KVMA 1M5WA 1TCDA 2RH9A 4ALDA 3O6DA 2V2DA 2WSQA 1QFEA 3THQA 1LOSA 5J5RA 2CW6A 1QOQA 2CZDA 3NPUA 3EWXA 2JK2A 2YYUA 1H7RA 2E6AA 2X1UA 1RD5A 3N73A 2VFEA 3LDVA 3FLUA 3LTSA 3GXPA 1WQ5A 4G1KA 4ZMGA 1Z44A 3TV8A 1ZAJA 1GEQA 5HMSA 3A5FA 3MUXA 2EHHA 2CLOA 1Q6RA 3LX9A 3HPSA 1W56A 3MP5A 1FX6A 4R33A 6TIMA 2FJKA 1ZFJA 2FFCA 1VCFA 5K7JA 5CZJA 2H8ZA 4IXHA 5FEZA 4QITA 3LBCA 1KM1A 2QCMA 3M16A 1Q45A 5LSMA 3ZR4A 4LWWA 3G1DA 1FCQA 5LNRA 2W6RA 1YYAA 3DI0A 3EXSA 2E1DA 1VYSX 2QCHA 4L4LA 3RLVA 4RXFA 2VOMA 5L9FA 3W7PA 4JTLA 1LOLA 4RKAA 2Z0IA 1YLVA 1K7FA 4JDBA 5CZSA 3SIZA 2E6YA 3B06A 3BV4A 5EPDA 1FXPA 1ZHAA 3DKLA 4ZZ9A 4N4QA 1YTEA 4XWUA 3SW6A 1TPWA 3L68A 4JN6A 1I8JA 2Q3OA 1ADOA 1B3OA 1B4KA 3N19B 5C54A 2A7RA 1WYIA 1PCKA 2FTPA 4GUHA 1XBZA 5HULA 4KFOA 3I68A 3DBPA 4AAJA 3F4WA 3HMJG 4FNRA 4DQWA 3O15A 3W73A 4MZYA 3A5VA 3E96A 3KOFA 3P67A 1MEIA 5K3VA 4JS3A 1FWNA 3QEZA 5E93A 3TSMA 1DVJA 4DO5A 4QAIA 2VXNA 3W2MA 4NUWA 5FEPA 3TFCA 3DI1A 5G2HA 3W2NA 3VE7A 2ZZ5A 1TTPA 3PBUA 5AHLA 4EF8A 3LRKA 4O1DA 1FY6A 1LZOA 2E77A 2QF7A 1X6UA 2B7OA 1FUYA 1TPC1 4FXSA 1PHQA 5EBUA 3LV6A 4AXKA 4GUJA 4QJ1A 4MY8A 4R53A 3THAA 2WO5A 1WOBA 3BLIA 4UNLA 3NOEA 4S1FA 1T8XA 4WZHA 3L5MA 4IWWA 2I1OA 2GUUA 2FB3A 3TQ0A 4TR9A 3PUEA 3UWVA 3B8DA 2PURA 3ZFHA 4HHPA 4CQAA 4YCPA 1TPFA 1LBLA 3M5ZA 3V1PA 2WJZA 4P61A 1SFLA 5I3GA 3W1PA 2YGYA 3O06A 2Q8LA 3LCLA 1GVQA 4O14A 3LB0A 4YWIA 5KZDA 3W7JA 3FIGA 3MW7A 4QM1A 4XBKA 1WBJA 3MJYA 4JTGA 1TSIA 3IVTA 5HR6A 1EB3A 2YZRA 1SUXA 3G3MA 2QJHA 4LVAA 3S8HA 5D32A 1H7NA 1UASA 4YXGA 3CTLA 5F2IA 2QAPA 3W7GA 5DXYA 5HNRA 1YXDA 3QH2A 3L21A 4WX2A 2NX1A 3ABQA 3RNDA 4NXKA 3TK7A 3M43A 2DZWA 3CT7A 3I7RA 4Z1DA 4A22A 4LUJA 4ZQRA 1SSGA 3OA3A 5FF4A 4K7YA 3W1LA 1OABA 3U6WA 3W1XA 3I7QA 5F2MA 3EWYA 4AF0B 4X9SA 4ZQCA 3W7NA 4LUIA 5D2VA 3MHFA 1D3HA 3W1AA 4U4MA 3P82A 1AK5A 3LHZA 5DCEA 1TTQA 4DXVA 3W87A 4UR7A 3GX9A 1TPB1 1PE1A 3G1YA 1GZGA 3DFNA 3Q37A 2VEPA 1ICPA 1SW7A 4Z1CA 4JX6A 1MXSA 3VKJA 3NQ6A 3NPVA 3EX3A 4I7UA 1LLZA 2RKXA 3ZWTA 1DJQA 1KFEA 4MJZA 4XQ6A 1OFQA 1JCJA 5D2TA 2QDGA 2QJGA 1V7YA 5D02A 3W7HA 3S1UA 1GQNA 2RDUA 2CFFA 1IF2A 4MUZA 1LRNA 1TV8A 4PC8A 3TC7A 1ZY9A 1F7BA 4NJIA 2W79A 1TRDA 5HUPA 3T55A 5DN1A 4JEQA 2QUUA 3RF9A 4IMGA 1FWTA 3EXRA 4DELA 4UIOA 2OT1A 5EL1A 1G7VA 1OFAA 2PCQA 5DY3A 3QRHA 4LVBA 3SGUA 1ZCOA 1XFBA 1NEYA 1V5XA 4JYEA 3NO5A 4LV4A 3CEUA 5KTLA 1EWDA 2ISSA 3UZJA 4O19A 3HGRA 4NU7A 1UUOA 1U83A 1OJXA 4QQ3A 1S5TA 2XN1A 4ADSA 3QZEA 1PCWA 5LHEA 4JTHA 3NQGA 1WOAA 3IIZA 1JQXA 5AHEA 3NG3A 1JCLA 3BARA 3GDMA 3JR2A 1KFCA 4IPJA 1VCGA 4LS1A 5ABTA 2CZ5A 3T44A 2J9ZA 1H7XA 3PG8A 3IGUA 1F5ZA 3GR7A 4UMAA 2WV8A 3HG3A 2EAWA 1KLZA 2ABAA 2VFFA 4O16A 3GR8A 3MI2A 4XTIA 3WK2A 2TSYA 3STEA 3W76A 4PL1A 3UNDA 4JIPA 2RFGA 2R8WA 2FDSA 3K30A 3BVJA 3EXTA 3NQCA 2R14A 3FKRA 1L6SA 1K8XA 1Z41A 4O15A 1KM6A 1SO3A 2QCGA 1XDLA 4K7VA 2WSRA 5G4WA 2J88A 4UTJA 1FWSA 1AW2A 2J9XA 1XDMA 3H54A 4UTWC 3ABOA 3I7SA 3EX1A 2F84A 1PS9A 1O60A 5KZEA 3CLMA 1HO4A 4UTTA 1LDCA 1KBJA 3HGJA 2ZRYA 1QPRA 4CNPA 2ZZ2A 4UMBA 1H51A 1TJRA 5TIMA 3W2KA 2Q8ZA 4BFAA 2YPIA 2E68A 3LCXA 3WFAA 3QYQA 3DFOA 3QMSA 3P80A 2HMCA 3LXAA 2QCFA 2VENA 2H6RA 4YL2A 4BK9A 1WX0A 1EPXA 1Q3NA 2TMDA 1W1ZA 2QUVA 2BTMA 3GIYA 3D0CA 3OEXA 3GLCA 3NL5A 1RVGA 3G1XA 2HTMA 3DHDA 2ZRZA 3MBDA 4AMAA 2ATMA 3UPBA 4PODA 2V5BA 3DH7A 5BMXA 4MZ1A 3W7MA 2E6FA 3TKFA 4A29A 4Y8FA 3DAQA 1AW1A 4E2BA 1BWLA 1KFKA 4IPIA 5C55A 2YXGA 1VYPX 3KRZA 2DJLA 3W85A 4MZ8A 1KFLA 3G0UA 4LOCA 5D38A 4M5PA 3NQMA 4O50A 5G5IA 4HT3A 2VFGA 3SECA 2ZRUA 4A21A 2GQ9A 4JYFA 3G0XA 1ME8A 3UY8A 2B0MA 3PY2A 1XCFA 3EWWA 3TMQA 4O52A 5F4XA 3IIXA 1L9WA 3BGGA 4RX0A 4CQ8A 4LVGA 4N9DA 5DCBA 1X1ZA 3L67A 3HO8A 1NVMA 1ONRA 2JKEA 2J24A 1DBTA 4FX6M 4WD0A 3E9AA 3BG3A 3FFSA 3GAYA 2C15A 3G18A 3TCEA 1YADA 1N8FA 4DO4A 5AHNA 1LOQA 2NXIA 4FXRA 3N2MA 5CSSA 5EY5A 1SSDA 1WV2A 2YFNA 3IVUA 4LVFA 5I3IA 1I45A 5FF7A 3TX9A 2C3ZA 4UFJA 1Q6LA 1H1ZA 3GZ3A 1EUAA 2Y7GA 1M7PA 1SZFA 1YTDA 3Q2DA 1MO0A 4AB4A 3U8GA 1QCWA 2XFWA 5AYYA 5D37A 5KITA 3F03K 5HWJA 1OYBA 3QMRA 1F6KA 1LCOA 1UJPA 1VZWA 2OJPA 2G5WA 1GVRA 2Y6ZA 3FJLA 3C0JA 3CQ0A 4Z0SA 1TREA 3NNTA 1FQ0A 4IMFA 4RJEA 3WJXA 3W7OA 4DO6A 2WSYA 1DQWA 2DZUA 5LNUA 1K7EA 4TU1A 3EX2A 1F6PA 3W88A 1LRTA 1TPUA 1VS1A 4PH6A 2P1FA 3LLDA 3LV5A 4O28A 5CPLA 3FYPA 4IQLA 5D30A 1ZJIA 4HIBA 2CLIA 4UTIA 2QJIA 4NT0A 1JUKA 2TYSA 5F2GA 2VFIA 3N34A 1DV7A 5DLCA 3M5YA 2ZA3A 3W1UA 3P5YA 3LRMA 4O1AA 1OF6A 2FB2A 3GK0A 4R34A 4ZL1A 1FCVA 4IMDA 3PULA 3BLFA 1W3IA 5HWMA 5AHFA 4IX0A 2GQ8A 3A9IA 2OCZA 3SI9A 1JRBA 4LS2A 2BZNA 1DL3A 2ABBA 4H6KA 1OK6A 1UUMA 3G8EA 4FIRA 1YTKA 1VLWA 5EKYA 3TA6A 3B03A 3H55A 4HSOA 3UZ5A 4LY8A 4MY1A 4N02A 3ANYA 1T96A 3NXFA 4WOQA 3LCWA 2Z6IA 3BGJA 3TSDA 4FNSA 4WQ6A 1SU5A 4MFEA 3BPWA 4JR5A 4JY9A 5CPNA 1AL7A 3A22A 3W23A 2YYTA 5HUOA 3DZ1A 4EIVA 3NQ2A 3ABRA 5BMWA 4UTHA 4NQ1A 1KBIA 3PM6A 4QNEA 4UTLA 3HB9A 1LM1A 3TQKA 2C14A 1OYCA 4X3ZA 5K9CA 1RR2A 1SR9A 4X22A 5DXXA 4PEKA 1T99A 5KINA 1W37A 3IRDA 3W1NA 5FEWA 3PS7A 1TYGA 1W0MA 3M9YA 3BK0A 3C61A 3DFQA 3S6DA 4NVTA 1L2UA 3N2XA 3L66A 1LBMA 4GFSA 4WXZA 4Q33A 1JQVA 3NL3A 1A53A 4K39A 3S42A 2GVJA 3UWUA 3MWAA 5HWNA 1WBHA 4OQVA 1XUUA 1GWJA 1LBFA 2RDTA 2QAFA 3IIVA 3CWNA 1CI1A 4NNCA 1ZAHA 3RFAA 2DJXA 1ALDA 4O53A 2ZZ6A 3HBLA 2NX3A 2OX1A 1SW0A 2Y88A 1KLYA 2QR6A 1SQ7A 5C6MA 4M19A 5LKYA 4YCOA 1TIMA 4I7VA 3O63A 3O8AA 3T4CA 3W2LA 1OHLA 1OFEA 4OWGA 1HG3A 4BWLC 5H91A 3DU0A 3PAJA 1X1OA 4RZ6A 1JRCA 4HPXA 2V5LA 3W86A 1J4EA 2V8ZA 4XUGA 2BX7A 2QCLA 3NPWA 5BW6A 3TJLA 3C3NA 1W3TA 1TB3A 5LNVA 3LRLA 1FCUA 3R89A 2E5BA 4DF1A 3PUOA 2YSWA 1BEUA 1I4NA 4RCXA 4N9EA 2HSAA 1C8VA 1QR7A 2NV1A 3V75A 1SZGA 2O7SA 4E38A 4O1BA 2J6XA 3RLUA 5EYWA 4MVAA 3WJSA 2WKJA 5D04C 2GVGA 5DCDA 4DF2A 3MP4A 4JY8A 4LRSA 5LHFA 4AF0A 2IQTA 2B7PA 3QW3A 3R5EA 3S1VA 3LXCA 1O4UA 5U7SA 5BRBA 2CWNA 3SJ3A 1LTDA 4ORIA 1TPVA 3DHFA 4LC8A 2B7QA 2QKFA 4HNUA 3GB6A 1EP2A 1D3GA 3HPZA 4POCA 4DPPA 1HTIA 1JCXA 2FPYA 1DOSA 3TJXA 5D33A 3R13A 3M41A 2GJLA 3IEBA 4PFMA 3W7QA 3DENA 1XL9A 4GC4A 4TO8A 3OVQA 4C1LA 2X2GA 1TJPA 3FA5A 2JKAA 3GXTA 4I7WA 3W83A 2I9EA 3M44A 3NA8A 3B0PA 3PBYA 2VFHA 3S9YA 3DFTA 4XTDA 2VEKA 3W07A 5C2XA 3UYCA 2V82A 4UTTC 4RR4A 5FEXA 4BF9A 1VC4A 3HGSA 4O12A 1H7WA 5I3FA 4O0KA 4N6FA 3SR7A 3QSRA 3NQFA 3P74A 5E1QA 2VEIA 3HIJA 3W1QA 2J27A 1OK4A 3ABSA 3NQ7A 3R12A 4X2RA 5A8GA 2ZZ1A 4JTIA 5G2WA 1G4PA 4MLRA 4GE8A 3LHUA 5G4EA 2YFOA 4O17A 3VFLA 1ME9A 2WPBA 5CG7A 4L4MA 3OBKA 1T0OA 3G1VA 3OIXA 3CPRA 2X1TA 1VQTA 3OVPA 3L0KA 1H1YA 1U5JA 4KWVA 2Y62A 4O11A 5KMYA 4UMCA 4E2DA 4RLIA 4NZFA 2ZFAA 2FIQA 5CGQA 1N55A 1MSSA 3QMTA 5LGXA 1W5MA 2JGYA 1QMLA 3EWBX 1GOXA 4IJBA 1KM2A 5E0KA 3A23A 4M6PA 2R94A 4BWLA 3NGJA 3KAOA 1C9DA 5AHIA 5IM51 3KHJA 1XXXA 3QC3A 3BG5A 1PIIA 1Q6OA 4PTNA 1LORA 1SO5A 3S5ZA 3IV3A 4MPQA 1TV7A 1JJKA 1F73A 4WXYA 4XKYB 4TMBA 1GTHA 3ZS4A 4BI5A 5L6UA 2ZRXA 1LYXA 2YW3A 4ONVA 1WAUA 1EP1A 2ZTKA 1F76A 2G97A 3N9SA 2C13A 2E09A 1YXCA 4RZ5A 1OFRA 3UWQA 5KSWA 4MYXA 4GUGA 2E5DA 1G7UA 2CZEA 5G1YA 3WJZA 2B7NA 1S5WA 2Y63A 1O5XA 3P60A 2JGQA 4O4WA 2ZRWA 1A5AA 3FKKA 3KRSA 2A7NA 1PL9A 1W8SA 4LNYA 2LLEA 3BG9A 2UV8G 1UCWA 5F2LA 3SSJA 2F7FA 1TPEA 3MYOA 3OHIA 3MI3A 3GKAA 4O57A 4NJHA 2ZCGA 1EA0A 1W5PA 4S2CA 3G1SA 2AQWA 3KRUA 1PV8A 5BNKA 3C2FA 4DPQA 4QSHA 4CNNA 3VE9A 3N14A 1EP3A 1UB3A 2GOUA 2QEZA 3UXAA 3DXIA 3PB0A 3R8RA 3VNDA 1XM3A 4AHQA 4Y6GA 4LC6A 3B0VC 2P10A 2ZZ4A 5F4SA 3LXBA 3E0IA 2CLMA 3NZ1A 1SO6A 2E5CA 4C1KA 1M7OA 2VFDA 4KKXA 4MKNA 3LCGA 5AHMA 5T26A 1H50A 1A5SA 4QIUA 1ME7A 4CCCA 3BW2A 4WUIA 5IBXA 1OFBA 5CPMA 1KM5A 2CU0A 4FNQA 1RQHA 1E51A 1QNVA 1RQEA 1B57A 5I3HA 4GUFA 4GUIA 1KM4A 1ZALA 4Q32A 5K9XA 1IXQA 3AO0A 8TIMA 2A21A 4QNWA 1ZENA 4MOZA 1GVFA 1TTJA 2BSLA 1W31A 3TH6A 1XUZA 2C0AA 2NWSA 3UWZA 3NPXA 2OZ0A 2Y7FA 3B4UA 3KVJA 2E6DA 4XBSA 3MO7A 5FESA 2DZVA 3S5YA 3M1ZA 5D09A 2YW4A 4JTUA 3VI2A 4HKPA 5AN7A 3PBVA 1OF8A 1XI3A 4IUOA 2ZRVA 3KFTA 3TROA 3HG4A 2FQIA 1FDYA 1W5QA 4FO4A 1HL2A 5CPOA 4EVZA 3TSBA 2A0NA 3I6RA 1PVNA 3NL2A 2NWRA 3S0CA 4AWUA 1OX4A 3NEVA 3E02A 1G4SA 1GYLA 1I2PA 1RZMA 7TIMA 2CZFA 4NX0A 4KFPA 3GXNA 1SZEA 1P0NA 5LGZA 5F1VA 4ZVJA 1GYNA 3BW3A 2Z1BA 1G69A 1FBAA 1CW2A 3G1AA 3NQVA 1D9EA 1KM3A 2NXHA 2A4AA 4Z08A 3S1XA 3C52A 3R2GA 5AC8A 4JNMA 3WK1A 6ALDA 1B9BA 3W7KA 3HG5A 5LNWA 3G24A 5LZLA 1AG1O 3C4UA 3C56A 1IXNA 2ISVA 1VH7A 2CLLA 3DFPA 4BI6A 3P84A 1L6WA 1OX5A 3P8JA 5AC7A 2EF9A 3BW4A 3TMLA 3T40A 2NZLA 1X7FA 2DORA 3G8RA 1GPWA 4BR1A 3P61A 4GXMA 5KZMA 3RU6A 3CM4A 4K36A 3GDTA 3G1FA 4O8RA 3ATYA 1W5OA 5G2IA 3W3OA 1DHPA 4NXSA 4UUIA 5MHBA 1OX4B 2VELA 5DY2A 3NR0A 2Z6JA 3G22A 2A85A 1P1XA 2EKCA 1WA3A 4FNPA 2PE4A 4CLMA 3HOJA 4JX5A 4S2BA 2BLEA 5G1TA 2NUYA 3QPZA 1NF0A 3UPWA 4AVFA 1G6CA 3LI1A 3GNNA 1VHCA 4UFMA 1TPH1 3KXQA 4RV8A 5CZTA 1KTCA 2H3BA 4ORMA 2VKZG 3TXVA 3TFXA 3W1MA 2ZTJA 2WQPA 5AYZA 1OFPA 1K8YA 1EWEA 3PF3A 1A5BA 2FPVA 3C2OA 3JS3A 4ZQNA 1Q6QA 3MP3A 3P7YA 1EX5A 1P0KA 1I2RA 5LNSA 4IMCA 2GJNA 3GDRA 3FS2A 4N6EA 2C16A 3YPIA 5HQEA 4JIQA 2ALDA 5J5DA 3M5VA 3W7DA 4UXDA 1FWWA 3M6YA 1P4CA 4GRSA 2CLEA 1H63A 2B4GA 1S5VA 4OGZA 4A2SA 2V2CA 4FX8A 3LHWA 3EEGA 4OV4A 4MFDA 3GDKA 2J9YA 4K8HA 4K6AA 1TQXA 4PL2A 1VPXA 2PRHA 3TE9A 4JXCA 3IIPA 4OHQA 1OVDA 2A7PA 4Y90A 4UNKA 4IMEA 5H2ZA 1W54A 4NZJA 4OT7A 1VYRA 3UD6A 1GVSA 1R2RA 4BI7A 1NFBA 3LHTA 3I65A 3GNDA 2VC6A 1KFJA 5D2YA 2A6LA 1K7XA 5TBOA 2RHGA 3P81A 1ICQA 1NAL1 1XKYA 5F1UA 4UTUA 3UXDA 1F2JA 4FB7A 3LM7A 3LHYA 2A6NA 1KTBA 3NM1A 1K3UA 3LTYA 3KVLA 1YDNA 4IX2A 3W74A 5EA9A 3TQVA 1R2SA 3PWAA 2DZSA 3O6YX 3W1TA 1QPQA 5I3JA 4AWSA 4J9JA 3H53A 3STGA 4DF0A 4HNNA 4N9CA 3TDFA 1KFBA 2YDAA 4RK8A 1AL8A 3LCFA 3W9ZA 5TQLA 2RDWA 1H60A 2ZDRA 3A21A 1SPQA 4ZQMA 3IGSA 2QCNA 1XBVA 4LT9A 1DQXA 5F4WA 3EWUA 2G95A 4GJ1A 4GWEA 1DORA 1KV5A 5AYXA 3E49A 2Z2UA 1F05A 3EX4A 3NZRA 3BLEA 4LRTA 4WY0B 5GVJA 2AAMA 4FHAA 1CX9A 1JUBA 1BWKA 2NXGA 3JRKA 5DBTA 3SZ8A 4UFKA 1OG0A 2O7QA 4JTEA 2XN2A 3N9RA 4CCDA 1BTMA 2QCCA 1JCYA 2FLIA 1KW1A 2JKPA 2C18A 3F4NA 4CNOA 3L65A 4HN4A 3MMTA 1TTIA 5DBUA 3L5LA 3LBMA 3PR2A 3NQAA 3RMJA 1VLIA 1A5CA 5FI8A 1QO2A 2OMAA 3W7LA 5I3KA 3QW4B 2ZA2A 2Q3RA 2CLKA 4H4IA 1VCVA 2DZXA 4P2VA 3SY5A 3MYPA 5CSRA 3O05A 1HO1A 1EUNA
chains in the Genus database with same CATH superfamily
3MU7A 4GG9A 4MY9A 3EKZA 1JGIA 1CENA 1LL6A 3NQDA 3PZMA 3ITYA 3TC3A 1QPNA 4KEZA 1GUVA 4HOXA 2QGHA 1LRQA 4O1FA 4JL1A 3VC5A 3CUXA 3LGDA 3SIMA 1PJ9A 3PP7A 2H90A 1Y5WA 4KESA 4NJKA 1WDPA 1GTEA 1MRQA 4JYDA 2BVTA 3RRAA 3NGFA 3VGEA 3TWAA 4PB5A 5A6KA 4W8LA 1Z9AA 2Y85A 4Y96A 3QJAA 3W1RA 2DUXA 1WXJA 1AMKA 1UP0A 1AQFA 3FOKA 1UH3A 1SW3A 4CKQA 2V2HA 3RILA 4TMCA 4C6KA 4H8UA 2CLHA 1JCNA 4LS0A 1NSJA 4ZENA 1C29A 3UVAA 4Z1AA 3ONCA 4UOZA 5FF2A 1BRLB 1QI2A 4IG2B 4L7ZA 1H7PA 4IOTA 5EMLA 2A5HA 3M4HA 4WJEA 1A5OC 1V08A 2EPNA 1HJWA 2VD9A 3VIFA 3HJZA 4E3TA 3WUBA 3UZWA 4IP7A 1QI3A 2A1YA 1UBPC 5FACA 4AU0A 4A3UA 3C2VA 2ISWA 5GJPA 1ML1A 1FDJA 2ZA1A 3ME3A 2XG9A 2P5NA 5SWUA 1OB0A 3CPUA 1TWIA 2HRWA 1GT8A 1MEHA 4I5XA 2VD8A 1ONWA 4ZE5A 1L6FA 1ODZA 4LEQA 2VGBA 4HB7A 3U57A 5K9DA 4GD0A 1CLXA 4PN2A 1RP8A 4JHOA 3KZPA 4PA8A 3EYPA 1A50A 2V3EA 3IJLA 2J47A 1M03A 3FDGA 1XLBA 3W53A 1C7SA 4Q7NA 6ENLA 1JCMP 1LP6A 4PGLA 1PZ1A 1G4EA 2DZPA 5C9UA 1A4LA 1TWSA 1KGXA 4U28A 3TC6A 2G4JA 4NNBA 3OG3A 2I14A 3VX1A 3ALFA 4H6EA 2X1SA 4AD0A 4BEUA 5CBBA 1GVOA 4YTRA 1EXPA 4MGGA 4XK2A 1C91A 1XIBA 4FIQA 2DPEA 3QGVA 1ADSA 2DUAA 1JUEA 3GBEA 3TAOA 5MKGA 3HGOA 4U2YA 2OLAA 2XGZA 5AVHA 1YW1A 1CLVA 2Q71A 3WD4A 1Q4NX 3AXMA 3CZJA 2F9RA 3I4KA 1OX6A 2DT0A 3QSTA 1XC6A 1J2WA 2WVVA 4M80A 4EOUA 2GPTA 2CCRA 5JIPA 3S2MA 4GBUA 5A8NA 3VM5A 3S5NA 2OWCA 4NX5A 3NJ3A 4CQ9A 2AOSA 4DM1A 1J12A 3AAMA 4DAFA 4IIFA 3W22A 3UWWA 3W7RA 5I24A 1MUMA 4S3FA 5XIAA 1EYEA 4W7UA 1CXKA 1PSCA 4MNMA 4L65A 4B90A 1RVKA 4FXFA 4M6VA 1VIZA 1KM0A 1MW1A 1HQTA 3S2LA 3UWYA 4DYEA 1B54A 4URIA 2GGJA 2F6UA 4GIRA 2EO7A 3QQ0A 4ECLA 2V30A 1QASA 3NZQA 3HQ1A 1QT1A 1TMLA 1ZL1A 2ZUWA 4M7TA 4ZB2A 3HPXA 5IDIA 5C71A 4XV0A 1B2YA 5K4ZA 2HK1A 3PBWA 3OB8A 1QBBA 2EJ1A 4B5NA 3C6CA 3MBFA 1GOOA 4R7JA 4OE7A 4UCFA 1V6UA 2C79A 1WZLA 5HMDA 4D6IA 3WENA 2VUYA 1FP8A 2J7FA 3CLWA 4FF7A 1TPDA 3CIXA 2X0SA 4IZGA 5I09A 3U4FA 1VD6A 3PZVA 1TO3A 3LS9A 3W7IA 1MXGA 2FTYA 3WK0A 4CVUA 1O95A 3USBA 1TV2A 1NQKA 4J3WA 4UZUA 1W9PA 4I9AA 3RPTA 4WGXA 4F9DA 4JTKA 1ZP3A 4YS1A 3CIWA 3ABXA 3AHTA 1GW9A 2WMIB 2D2JA 3LM3A 4OBRA 5CGTA 5D03A 3V35A 1CGTA 3MMUA 4PCFA 1HL8A 1Q8JA 3P0WA 1GCYA 5D05A 2YLLA 3SGZA 2YCEA 1HN1A 3ZOAA 1JYNA 2ZQ0A 3N12A 5EMKA 2HS8A 2OZ3A 4G7EA 3M47A 2NX9A 4JHMA 3TLLA 3UZYA 2TPSA 3PG9A 5C0QA 4BQ5A 2BXVA 3OGSA 4C7FA 5BU6A 1TWDA 3QV8A 5FF0A 5K2ZA 1HP5A 2G0WA 1IWPA 1FWHC 3CC1A 1HKVA 5C2GA 2J62A 2HVMA 3IIOA 3Q4DA 1XRTA 2V38A 5K4XA 2NQ9A 3CB8A 3GTIA 3UQNA 3S1WA 4HN8A 4YTSA 5ABGA 2DZTA 4KRZA 1NP2A 2YDQA 3R8GA 1KXHA 2BVWA 3UP8A 3W75A 2OODA 4DUXA 2VJXA 3RO8A 4UTWA 4M29A 4A3HA 2RJGA 1QHZA 4CCEA 1SZNA 4YN5A 2PWFA 1NTHA 1RPXA 3HFTA 3LI0A 1TJ2A 3AHZA 1XYBA 1HVQA 3DFYA 2XFRA 3INPA 4XX6A 2ZADA 2VQUA 3SCRA 3KS5A 2MANA 1IXPA 3LCHA 2GSHA 1B4EA 4JTJA 3VD5A 1UMYA 4WY0A 5LIWX 3LD5A 4Q8OA 1TE6A 2XFYA 1M5WA 2RH9A 1IWBA 1YIXA 2OGYA 1PB0A 3CZGA 2CW6A 3GVRA 5BZAA 3C86A 1WO2A 2YYUA 1A0DA 2E6AA 2X1UA 1YPXA 1AFSA 4V33A 4DWSB 3AYRA 3LTSA 1WQ5A 3UZXA 1GEQA 2HE5A 3A5FA 3MUXA 1UHVA 2YA1A 2CXGA 1QHPA 4JTAA 3LBCA 1KM1A 4PMOA 3M16A 1Q45A 1Z6KA 3E2QA 3KBVA 3TTQA 4C6EA 3R0UA 2E1DA 3VDBA 4R9OA 5LXXA 2CYGA 1B5TA 1AQ0A 3RLVA 4DAIA 3GXMA 4LEFA 1ZCCA 1YLVA 3WLTA 2GL5A 4N4QA 1OY0A 3K4DA 3SW6A 1EJXC 2V3DA 2WLZA 1AA1B 3VA8A 1TVNA 5G1MA 2BXZA 3N19B 2WHLA 1A5LC 1HKKA 3QBUA 3EAUA 1PCKA 4LSBA 3BZGA 4GUHA 1WKFA 2FYMA 3BE7A 3E3HA 3PZUA 1QRQA 3GQYA 3VKAA 4KFOA 1B3ZA 3U9IA 3HMJG 1FHDA 3OGVA 3OBAA 5GJNA 2G3FA 3EMZA 3APGA 3AMDA 2O56A 1GOKA 3KEHA 4YTUA 1J0HA 3U2EA 1HL9A 2P8CA 3ZQ9A 1DVJA 1YDYA 4CNSA 3JVAA 5LIYX 3N2TA 1NM9A 1ONXA 1E9IA 1E6RA 1U1JA 1FY6A 3VOGA 4IG2A 2QF7A 2B7OA 2PTDA 1PHQA 1XLEA 3RJYA 4QJ1A 4MY8A 2WO5A 5XIMA 1Q5MA 3UJFA 4A8LA 4IWWA 4U2ZA 3U7BA 2I1OA 3TQ0A 4TR9A 3PUEA 3UWVA 1UR9A 2JQXA 4YCPA 1TPFA 3W6LA 4IL0A 1Z89A 3BQ5A 3V1PA 1E3ZA 3RLGA 1DXFA 2UY2A 3O06A 2Q8LA 3LY0A 1GVQA 2GJPA 3LB0A 4XZNX 5HXMA 1R0MA 1G1YA 2FGLA 1WBJA 4CNUA 1OIMA 5HR6A 2NQ5A 1IWAA 3S8HA 5D32A 1WE5A 1AQHA 1H7NA 3AMCA 5F2IA 3W7GA 1XJBA 4NZ1A 2CHOA 5HNRA 1I75A 2NX1A 4NXKA 4LB4A 4WKAA 3TK7A 8A3HA 3M43A 2DZWA 3KWXA 2PD5A 3CT7A 4Z1DA 2ZWZA 4W4QA 4ZQRA 5CGMA 2X42A 4CD4A 3H2FA 3K46A 1OABA 4AF0B 1W32A 1GVYA 2DQXA 3MHFA 3PFMA 4HPGA 4JQ2A 1F3EA 4RV3A 4AIEA 1BFNA 1H41A 5HJXA 1V02E 3VIJA 3FHQA 4NRSA 3NPVA 4F0LA 2RKXA 1KCLA 1V4YA 2F2HA 1ISZA 4XQ6A 1J6OA 3GFYA 1UD8A 2QDGA 2A3EA 5D2TA 1V7YA 3GHTA 1FWFC 1OEPA 2DSKA 1RHCA 1UR2A 4MUZA 4PCPA 2I5IA 1OIFA 4PC8A 1RY0A 3I6TA 2HEJA 2WMFA 3T55A 1F61A 1VFTA 2NW0A 3EXRA 4DELA 2QVNA 5EL1A 1REQA 5DY3A 3D46A 1ZCOA 4M51A 4HPHA 5KTLA 3CGTA 3UZJA 3APTA 1XIEA 2PGEA 4GO9A 1JXKA 3MKKA 4QXIA 1OJXA 5HBFA 3BJSA 2F6KA 1PCWA 4AD2A 4JTHA 3NQGA 1JQXA 3NG3A 3BAKA 1K4GA 2CZ5A 2XSBA 2J9ZA 1F5ZA 2XUCA 4CD8A 4UMAA 3BMWA 5FCZA 3GC2A 1KLZA 2PU0A 2ZC8A 4UB9A 3MI2A 1ZQ5A 1ZU8A 4GVHA 3WBAA 3NCOA 3UNDA 4JIPA 4KIRA 2R8WA 3BVJA 4Y2WA 4MB4A 3EXTA 1B90A 1L6SA 2OYMA 3QYSA 1K8XA 2DV0A 1FHUA 1Z41A 4P7RA 4C6NA 4DWSC 3UU0A 1XLJA 3WCZA 1PX3A 3LPGA 4HOWA 4RE0A 3AWNA 3ABOA 4PYSA 1M65A 2PP1A 1BG9A 3CLMA 4JTCA 3OLDA 4UQAA 3HGJA 2V69A 1JEZA 2WMIA 4J2MA 4WCJA 4BFAA 4DZHA 4ZXLA 2PBOA 3QYQA 3DFOA 2I7GA 1ITUA 4BK9A 4XSMA 3UG3A 3CUGA 2ZXAA 3GNOA 2BTMA 4OIFA 4E4UA 1FHVA 3MBDA 2WMGA 3CL8A 3NO3A 3UPBA 3DH7A 4IFKB 3IJIA 3DCPA 1KO0A 2E6FA 4A29A 4Y8FA 5JUVA 1QUMA 3ECQA 3PK7A 3SRFA 1NFPA 3AIRA 4J3XA 1T7LA 4GA8A 2YXGA 4GNVA 3W85A 3TZFA 1ZZMA 5D38A 3V1HA 3N4EA 4HT3A 2ZWYA 2VFGA 2HBVA 4HJWA 1YBQA 3UGVA 4ZCWA 4JYFA 3ZR5A 3UY8A 2B0MA 3AIEA 1VFOA 3EWWA 3TMQA 4O52A 5H6HA 3BGGA 1R7OA 3DBNA 3WLJA 1TKKA 1BVNP 3L67A 3BXWA 2JKEA 3E0FA 1IR2A 1RK5A 1DBTA 3T1GA 3BG3A 1CBGA 4Q4MA 3BLKA 4DO4A 5AHNA 1LOQA 2NXIA 1F9CA 4EWJA 2W61A 7ODCA 2VZVA 3NUKA 4LVFA 3MWCA 3WUFA 2C3ZA 4UFJA 4D6FA 2JIWA 4PMUA 2E3ZA 3U8GA 1PAMA 1QCWA 5AYYA 1BD0A 5E0CA 1C7TA 1OYBA 3QMRA 1F6KA 3T2PA 1LQAA 3TYAA 2MUCA 2Y6ZA 3V4BA 4I3GA 4IIGA 3OZOA 4PMNA 4L64A 3FXGA 1MQPA 2IPFA 1HGYA 5AZ0A 4R85A 3W7OA 1DQWA 1K7EA 3W88A 3TYEA 1LRTA 1M04A 1TPUA 4DWSA 3H2NA 4PH6A 3LLDA 5CPLA 4RDZA 1OD0A 2DGAA 2CLIA 4NT0A 2TYSA 1FFRA 5F2GA 1EOKA 1Q6CA 1XCXA 2VFIA 4LUTA 3M5YA 4DRSA 3P5YA 3B4YA 2HVNA 3T42A 1XPYA 2FB2A 2YL8A 3H23A 4QCEA 1ITCA 1R3QA 1FCVA 3PULA 2BY1A 4ZA0A 5AHFA 4IX0A 2GGGA 3SI9A 4J7RA 1JRBA 4HCHA 5AYBA 4H6KA 4NYUA 1CXFA 2WC4A 2ODOA 4LH8A 2EPMX 2X09A 3QPEA 4ROQA 2VT0A 2XIQA 4LB3A 3ITOA 3H55A 1TG7A 4P8XA 6REQB 4MY1A 3M0IA 4L5ZA 1XF0A 4WOQA 1UD5A 2Z6IA 4FNSA 4MFEA 1NIUA 1EC8A 5HUOA 1HNYA 4U5IA 5BMWA 1KBIA 2DSZA 3HB9A 3TQKA 1BXBA 4S3KA 2PLJA 3T81A 5DXXA 5KINA 3ITVA 1W1VA 1W0MA 2GQ3A 3BK0A 1GZJA 3C61A 1OT2A 3WNMA 3WLOA 1LWIA 3VIIA 4NF7A 3L66A 3VOIA 1J0JA 1LBMA 2NQZA 1JQVA 2GVJA 3UWUA 2IQDA 3UYIA 3QLDA 1GWJA 2RDTA 2QAFA 3IIVA 3CWNA 4NNCA 1ZAHA 4DZIA 1W9UA 1EC7A 3TOPA 2ZZ6A 3BLDA 3SQMA 2ALRA 3SCNA 3R4IA 1TUXA 3QZ6A 1FWEC 5E6ZA 1QW7A 1HVXA 2PDYA 4L6DA 5HA7A 5HANA 5DT7A 1EL3A 3O63A 3GVWA 2GDUA 4HPXA 3E0LA 5JBEA 4KWUA 4PMYA 4NSBA 4PCNA 4DY1A 2V8ZA 4HA3A 2PDBA 2J7CA 4F40A 4R7WA 2PWDA 1W3TA 1TB3A 3HQOA 5LNVA 4GZIA 3R89A 4GJIA 4LAZA 2XGIA 1E4LA 3URNA 3V75A 3AMGA 3WMSA 2J6XA 5JQ9A 5EYWA 4C7DA 5T9CE 1JXJA 4ZGYA 1XIJA 3MP4A 3D3FA 4AF0A 2B7PA 1F3XA 2CWNA 3SJ3A 4GI6A 2Q6ZA 1TPVA 3PTKA 4HNUA 2A3BA 3WD3A 4GGHA 3GFZA 4DPPA 1JCXA 1KKOA 1DOSA 4JCLA 5D33A 1JG9A 3AU2A 2D1ZA 2DZAA 3GXTA 3MSRA 5GQBA 1D8CA 1A3WA 3C0QA 1RJQA 5CSYA 3S9YA 1P6WA 3W07A 5C2XA 3R1ZA 4UTTC 3BCFA 1NDYA 4BF9A 1OZMA 1GVEA 3VZZA 4NZ3A 4M6UA 1J10A 3NQFA 4TVUA 4QG9A 3IJ8A 3HIJA 3W1QA 1AJZA 2GSJA 3K4WA 4KF1A 3UXKA 4X2RA 5IHRA 3EEZA 3WLKX 3SUTA 1UG6A 3XIMA 5G2WA 1BPLB 2YFOA 4AVNA 2VCAA 1DJYA 3UWEA 2BDQA 1T0OA 3G1VA 5TNVA 3H4XA 2O4QA 1BXCA 3L0KA 1U5JA 2OELA 4E2DA 1E6ZA 5CGQA 1DWAM 1MSSA 1RA5A 4S23A 4IIDA 2QW5A 1ISYA 1QMLA 5CBJA 3ES8A 4AG0A 1CGXA 4GMEA 4OJYA 1KM2A 2BMBA 1VF8A 3KCLA 2R94A 2YJQA 1C9DA 2G50A 4PTNA 5DMYA 2VC9A 4LALA 1W2VA 3PWIA 4QJ3B 4TX6A 3IV3A 4MPQA 1TV7A 1TE1A 1JJKA 1GTHA 1QK0A 3ZS4A 5L6UA 4AW7A 2ZX9A 2Y5EA 2YW3A 4CN4A 3CV6A 3ZSTA 3FAWA 1G01A 4RZ5A 1ECQA 3WH7A 5J04A 3ZLHA 4Y9OA 1E9ZB 2D24A 3WJZA 5DX7A 2PLKA 2WM0A 2Y63A 3P60A 5FJRA 2JGQA 3GUWA 4O4WA 5HPOA 3KRSA 3UG5A 4LNYA 5DANA 2UV8G 2CLPA 9CGTA 3AHXA 2NVAA 3KTSA 1MNSA 2NV9A 3G1SA 4MKVA 4MADA 3TN6A 3C2FA 3B8IA 3RM8A 5I06A 4HJFA 3N14A 1XYZA 5GNZA 3DXIA 4IP5A 4Y6GA 1FWAC 4I9MA 3B0VC 4Q8WA 2ZZ4A 3LXBA 3NZ1A 1JGMA 3WDPP 2VFDA 4KKXA 3RCNA 4B9YA 4I9TA 4WUIA 5IBXA 3AZRA 3GHSA 4L56A 5M1TA 1CLKA 2E9MA 2FFIA 4FA3A 1B57A 4QCFA 5K9XA 1VFLA 4MOZA 2Q8XA 2VC7A 1OGBA 5HATA 4O1EA 1TTJA 3REQB 4RPQA 4GKTA 2NWSA 3WLIA 3C0LA 5C7VA 2Y7FA 3B4UA 1CPUA 3QR3A 4CEXC 4F66A 4XBSA 5FESA 3M1ZA 2FZNA 2YW4A 4JTUA 3VNZA 1UKPA 2PI6A 2ZRVA 1PKNA 3KFTA 3TROA 3CZ8A 2GUYA 3G1RA 3PBGA 1HIZA 3LYEA 1BF2A 5CPOA 4G8TA 4PUWA 3LEPA 3I6RA 3NL2A 2NWRA 4D71A 4DO7A 3EMQA 3S0CA 3GC4A 4AWUA 1OX4A 2CZFA 4HTBA 3GXNA 4MM1A 4ZTYA 3OBEA 4JFUA 4XBJA 5ECUA 2HDJA 1J18A 2NXHA 1SM9A 2C7FA 3WK1A 6ALDA 1B9BA 4ATDA 1J0ZA 2OTDA 1ZJHA 1UWUA 3C56A 3OJGA 3CT2A 1Q6DA 2IW0A 2CLLA 4AC7C 3DFPA 4BI6A 3WSUA 4AD4A 1OX5A 3P8JA 4H41A 5AC7A 2AMXA 2P76A 1AODA 1J96A 3TMLA 4LANA 1MXDA 3ZIZA 1UZHA 5C9RA 3F7JA 5KZMA 3BCJA 4K36A 1RBAA 1I0DA 4KBXA 4NXSA 4C6BA 5MHBA 2HK0A 2DDXA 5DY2A 3GHUA 4QR6A 4UQDA 1AUSL 1E0VA 3G22A 2A85A 3CH9A 4G2DA 4EAYA 6REQA 4UWMA 4EE9A 2NSXA 4ZE4A 1EDGA 1NDWA 3RCMA 2OOFA 4ASTA 3KW3A 3KXQA 2H3BA 4Z2IA 3TOYA 2WHKA 3ANVA 2QIWA 3SDOA 1E1FA 3E38A 5DRIA 1OFPA 1PPIA 4YVPA 2CEQA 3C2OA 3EDKA 3UEQA 1JZ5A 3B9EA 1Q6QA 4FOJA 2TAAA 1KBBA 2WCGA 2XDFA 4N6EA 1ADDA 5FA5A 1CIUA 3W7DA 1S2AA 2PCEA 3M6YA 5C9ZA 1P4CA 1H63A 4EXBA 5FL0A 3RPDA 1LUCA 4FX8A 1K9EA 4QG8A 4HCLA 4NP7A 1V3LA 2BODX 3GDKA 5A6BA 4K8HA 4K6AA 3HV9A 4JFVA 1WZMA 1TUFA 4PL2A 1VPXA 3TE9A 3IIPA 4JQ3A 1OVDA 4Y90A 2GDVA 4IMEA 1W54A 2NQLA 4NZJA 1VYRA 5JVLA 1R2RA 2D2HA 4BI7A 3I65A 1WNOA 3CUJA 1A0CA 3L12A 2VC6A 1KFJA 5FJJA 5CJMA 3AS0A 4Q8TA 3P81A 1ICQA 1XKYA 4UTUA 4OOZA 3QHOA 2BHZA 3NM1A 1KTBA 3RJXA 3WH8A 1F8IA 1BWVA 1K9FA 4OECA 1DJIA 1SGJA 1D3CA 3TQVA 3O6YX 1N8IA 1QPQA 3H7VA 2WK2A 4J9JA 2MNRA 4Y9NA 3LZ3A 4N9CA 1WCGA 2RGMA 2YDAA 5FIPA 2RDWA 1T8QA 1SPQA 4AY8A 1XBVA 1DQXA 5EMJA 3EWUA 3HMCA 1DIEA 3IANA 3FJNA 3NZRA 3BLEA 2QYGA 4XD6A 3A4XA 4NI8A 5DBTA 4WDWA 2HROA 1DE6A 3VMNA 2G37A 4DIAA 1JCYA 2FLIA 3VX0A 2DW7A 4CNOA 4AY7A 4GNKB 2PWVA 3MMTA 5DBUA 1AH0A 3GH4A 3LBMA 1F8MA 3RMJA 3L4YA 1OSEA 4HMNA 2OMAA 3W7LA 2DZXA 3TYDA 3VMPA 1WAWA 2Q09A 1EZ2A 1EUNA 1A49A 4JTFA 1VB9A 2J8FA 3O1NA 4GJJA 4GNJA 3WLMA 4WGHA 4MNJA 1JFHA 2OGJA 3L5AA 2GUBA 1TA3B 1XW8A 4IHCA 5D2XA 4UNIA 4AHPA 1UD3A 4DNHA 4AX6A 2D0HA 1TV5A 1PHWA 3WQFA 2R91A 3A24A 4NNAA 1W9VA 3KBJA 4B4FA 1O94A 3VTRA 2GJRA 2OZ8A 3GNPA 4MIMA 3PSWA 3PPCA 2HWGA 2ZYFA 3QOKA 1SJCA 3Q94A 3U2OA 1XIIA 1YXYA 4JKMA 1DKWA 3MS8A 3H4WA 1E6QM 2PP3A 4FAMA 9XIAA 1UPPA 2VX6A 1IEXA 3NYZA 3T2OA 3ZT6A 4GY0A 1THFD 3ARPA 3R10A 4KEUA 1G4TA 1S2VA 3DG7A 4NRRA 3G1HA 4J3SA 3KDOA 2GYIA 3BMXA 4Q8QA 4RZBA 3ATZA 4A2RA 4DJEC 1OC7A 1Q63A 4LUYA 3VIGA 2Y5JA 2NLIA 2I56A 3Q58A 3WJYA 3A47A 4UC5A 3BOFA 1W5NA 2VRQA 5I23A 3RX2A 5BOOA 1AZ2A 2W63A 4AXNA 4YNGA 1ONEA 1DYSA 3IJQA 2QCDB 3SFKA 4HPJA 1DJNA 3GXIA 1X97A 3EA2A 1VHNA 2I9UA 3LK6A 4AD3A 2VL4A 2QZRA 3CHCA 5HINA 2VZOA 3W37A 3GUGA 1U1HA 4R5EA 1IZJA 4O8AA 3TU9A 1R7AA 4O10A 3VU2A 3MI6A 2CETA 4Z42C 1KWGA 4GH1A 1IR1A 1VFSA 3AQUA 5FSEC 3S2CA 4PR4A 3HG2A 1H62A 2Z24A 4A8RA 1F74A 2XVNA 1UKOA 2XIIA 3KX6A 4OV9A 2VR2A 4ACZB 3M0YA 3CEPA 1X39A 1WKEA 2X1RA 3BJFA 5EFFA 3WF2A 1GQLA 3LSBA 4K37A 2J7BA 3KP0A 2DY3A 4LFYA 3WEZA 2X1IA 4NAEB 3M7WA 3D3AA 3KL0A 1DHKA 1M68A 4E0CA 4UFIA 3OIHA 4OKDA 1TZ7A 5DELA 3BSGA 5BOEA 1CXLA 1S3TC 2BASA 1BQCA 3AZTA 1TIWA 1JDDA 4GCXA 1GZ1A 4M0XA 4LVDA 2QCEA 2ACQA 2PDFA 4F79A 1TRIA 1L6GA 1E55A 2YX0A 4HNOA 3SAZA 3LOTA 1VP5A 4GYPC 3N3TA 1JDCA 3QFWA 1YDOA 1TQJA 1H61A 3IJDA 2OB3A 2XVKA 2DH3A 3IJ9A 3IVSA 4NZ4A 1JYWA 2R1LA 3DG6A 1PZ2A 1UPMB 2C0HA 1RV8A 4O4VA 2Y8UA 4PTVA 1S3HA 3VCRA 3L2IA 1NF7A 2FHCA 4Q8PA 1HKJA 3GKFA 3WK3A 1MNZA 3RX3A 3OU8A 2Z29A 1R9YA 3NAVA 3AJXA 3BDKA 3H12A 5AC4A 1YPIA 3CU2A 1V0LA 1Z42A 3VD3A 3STFA 1VRDA 4O1CA 2V9DA 3QTGA 2FHFA 3U5YA 3BL3A 3OLGA 1AJ0A 3GVGA 3CWOX 3TAKA 1JR1A 3FEMA 2ZZ7A 3ABZA 3UY7A 2XHYA 1BKSA 4L6HA 4Y9AA 3MKCA 4DBEA 1PKMA 1AW5A 4FNTA 3RGTA 4TX9A 4Z0JA 1JDAA 4IFRA 4J4KA 1OFDA 3QHNA 3LPPA 4IXXA 1X6LA 1Y65A 3STCA 3FY1A 3APYA 1HFBA 1QHOA 1C8XA 4RNIA 1XBXA 1CDGA 1ZAIA 4KT2A 1R47A 2NLYA 4NY2A 4JFTA 1V7AA 3RX4A 3GSMA 3KBWA 3QQ1A 4H9YA 4YMZA 3EOOA 4TV5A 3NSMA 1GJPA 5A8PA 3SN4A 3GY1A 1L8NA 3AIUA 1EA9C 3VNMA 1TV3A 4YTTA 3KOZA 1JL8A 4JTTA 2EG6A 2O9TA 4J3TA 1I2QA 4Q7BA 1EIXA 3CUZA 3S2JA 3MTWA 1BKHA 1P48A 3V5CA 4HK5A 4GQBA 2PDCA 3GG8A 3O16A 1R2TA 2WB5A 4MKSA 2WHJA 1GQJA 2XWEA 2C1HA 3IJ7A 1QVBA 4NILA 4LV9A 4XVEA 2PDHA 3VD7A 4GYPA 2P53A 4C91A 4YYCA 1GG1A 4NJGA 4NYYA 2QMKA 4M24A 2QUMA 3CASA 3LCIA 5CEWA 1RP9A 3ANUA 1S2UA 2XN0A 4PEEA 4ZQOA 1F6YA 2QHAA 5A1AA 4AIBA 7ENLA 4ZQPA 4O0ZA 1K77A 5TF0A 1SFJA 4PE8A 4AWTA 3WX7A 4LTSA 3C2EA 2H3DA 3M7SA 3L0NA 1MZHA 5HMFA 3FJ6A 3EDFA 4HVXA 5HJYA 4MWAA 3H2CA 4H9MA 2G3NA 3QV9A 1R5YA 3QM3A 2GVLA 1VJIA 4L80A 2PF8A 3C0SA 2ZZ3A 3CNYA 5FF3A 2X16A 1P6BA 2XH4A 1R46A 1VBRA 2Y7EA 3CL6A 3DKJA 1KTNA 4P8WA 1C93A 1LLWA 3PPHA 4JN8A 4GGBA 1A0EA 1EJSC 3VFCA 4MDOA 4PUEA 3VKKA 4FEZA 1SJAA 3BQ6A 1TCDA 4QEEA 1LOSA 1S46A 2OSYA 4GIAA 3TCSA 3WL0A 4XZBA 2CZDA 3NPUA 3EWXA 3PTMA 2ZXDA 5KZ6A 1B31A 3GG1A 4G1KA 3AZSA 5BROA 4DHGA 5HMSA 4GBDA 1Q6RA 1RAKA 3LX9A 2A3LA 3MP5A 3DC8A 2FJKA 1M41A 3EZ4A 1TV4A 2UY4A 5K7JA 2PFHA 3CV7A 2H8ZA 4ZSTA 5FEZA 4QITA 1RLDA 5E9XA 2QF8A 5M2FX 1QW9A 2Z4GA 2WMHA 4LWWA 4JFSA 1F3WA 1VYSX 4RXFA 2E67A 2VOMA 4FS9A 4QLJA 3VGDA 3OLIA 5CPSA 1K7FA 3SIZA 4CVWA 4C6FA 1FXPA 1ZHAA 3MQTA 1QOXA 3QXBA 3L68A 4CN6A 3CO4A 3UCQA 2WCSA 1B3OA 1UZ4A 4W89A 1IZKA 2A7RA 1WYIA 4GY1A 4AAJA 4JQAA 3ID7A 3T05A 4FNRA 3WBYA 4P7NA 4QE1A 1MDLA 4IPNB 1PX4A 3A5VA 3E96A 1IT7A 1O1HA 1WZKA 3R58A 5F7UA 3U5UA 4JS3A 2E25A 1J6PA 3PJWA 4V1XA 2OWXA 5HNTA 3TSMA 1XLIA 4Q4SA 4QAIA 4NUWA 5G2HA 4QS5A 3UETA 2ISDA 1LZOA 1AH4A 1G0CA 2E77A 3RIKA 1MDRA 1X6UA 4DBWA 3RU8X 4AXKA 2W62A 4R53A 3THAA 1WOBA 3BLIA 4UNLA 3NOEA 1KRCC 1T8XA 4WZHA 1W9DM 3L5MA 4QLLA 3M0MA 1OCNA 2VRKA 4C7GA 4XUYA 3W25A 1AQMA 3ZFHA 2RJHA 3ONBA 4MWAE 4V2XA 4CQAA 1ZSXA 4MJ2A 2Y8VA 2QLYA 4U3CA 3UR5A 1KGUA 1FWJC 4KRTA 2PEVA 4S3AA 3MJYA 1TSIA 3IVTA 3C5QA 1SUXA 3OQ8A 4ERGA 5H8MA 2QJHA 4K68A 1YQ2A 1P7TB 3N11A 2H9AB 3CTLA 1J79A 4ACZA 1XSIA 3N6QA 3KTCA 3NSNA 1Q6GA 1YXDA 1XS2A 3RNDA 4IL2A 1OZQA 2Z1SA 5A6LA 4A22A 1PZ3A 4LUJA 3AXIA 1SSGA 1WXZA 4NAEA 2HVOA 3OA3A 4K7YA 4ML4A 3W1LA 3W1XA 4R27A 3W7NA 1R38A 1ZS2A 4LUIA 4NAFB 4K8GA 4U4MA 4US5D 1HJUA 3LHZA 5T8GA 2D0FA 3T9PA 4RDWA 1YKWA 1WKDA 1TTQA 4UR7A 1TPB1 2Z00A 3F2DA 1DJGA 1GZGA 3CV1A 2X05A 4PTXA 1SW7A 1XD1A 2YDSA 3ITXA 5FJUA 4F9JA 1LLZA 3MCOA 2D22A 2HXUA 1KFEA 1VBHA 4ZOAA 1FH7A 1OFQA 1XGZA 2NSOA 3TTSA 1R8LA 1LQ2A 3W7HA 1GQNA 2RDUA 1DTNA 5DFAA 2X40A 2WQDA 2XFFA 4NJIA 2W79A 4H7VA 3W4RA 4D72A 2CIPA 4QGCA 2VDGA 2QUUA 1E40A 3N1AA 1ENUA 1FWTA 4UIOA 3N6JA 1G7VA 1OFAA 2PCQA 3QRHA 3BH4A 4LVBA 3FK4A 1XFBA 1YRRA 3RRXA 4C6JA 1IE7C 2IS7A 3CEUA 4B2DD 5HNUA 3HGRA 3P3BA 1GOQA 4B4HA 3RUBL 5CAHA 1OGGA 2PDPA 4QQ3A 1EXBA 6PTDA 4UQ9A 2O92A 3SCQA 1Z7AA 1CGUA 1CCWB 1GW1A 1RBOB 1TWZA 3GDMA 4OBSA 4PMQA 3ISIX 3GTHA 3JU2A 2ZVRA 2FGZA 3GR7A 2AKZA 4ZOCA 2PDIA 2PGRA 2ZC1A 2EAWA 2ABAA 4XD3A 3DESA 4O16A 3G2GA 3STEA 1FVPA 1V0MA 1B9ZA 4PL1A 4KMQA 3UNTA 4IPLA 2FDSA 3K30A 4DWDA 2CKRA 3GVVA 1RALA 2PA6A 3GU9A 2Z7KA 4O15A 1KM6A 1SO3A 1XDLA 1M7XA 4DYJA 4XVDA 3LBOA 4UTJA 5ABHA 1FWSA 1M1BA 3PJXA 3QY8A 1AW2A 3H54A 1BXNA 3I7SA 2CKSA 1GKRA 3EX1A 2F84A 1JAKA 3ZVHB 4D8LA 4AZBA 3ITGA 4R9XA 4GQ0A 1RCXB 1LDCA 1V93A 4EPBC 4XIAA 2ZZ2A 2P8BA 4UMBA 1H51A 2IXUA 5TIMA 4BF5A 4LY4A 2WZEA 2VNCA 3QMSA 3P80A 3LXAA 2QCFA 4WK9A 2TMDA 2X7WA 3RCYA 2QUVA 3GIYA 2W27A 4PTMA 3OEXA 3I10A 1RVGA 3LZ5A 2VVSA 2HTMA 4OTKA 3M6DA 4IP4A 1AMYA 4PODA 2V5BA 3W7MA 4Q4QA 3ITCA 4B15A 1AW1A 3TW9A 2EJAA 1BWLA 4MUPA 4E2BA 1YHTA 1E4MM 3MCNA 3GYCA 2XU2A 5A94A 3U2CA 5C55A 1XSKA 1VYPX 1KCKA 4LOCA 1HP4A 3NQMA 5G5IA 3SCTA 1K6WA 1DJWA 4C6CA 2QJJA 3GH7A 4A21A 4N42A 4F3HA 4L4PA 4XSLA 1ME8A 5FOOA 1VFHA 1XICA 3PY2A 1E15A 3TN3A 1U2YA 1L9WA 3IIXA 4B5TA 4A4AA 1K6AA 2DT2A 3EOLA 3VIOA 4RW5A 1XINA 3HO8A 1HXJA 1EO7A 4WD0A 4FX6M 3E9AA 1H5VA 2C15A 1V0KA 4FXRA 5CSSA 1WV2A 3IVUA 3VGGA 5FF7A 3TX9A 4FI4A 1J01A 3GZ3A 8CGTA 1V8EA 1CGYA 1M7PA 1RXOB 1YTDA 5ECVA 3WQPA 1FWIC 3ZJKA 1E0UA 1VBGA 5D37A 1UZDA 4IH3A 1LCOA 1UJPA 1VZWA 4HP5A 2DVUA 3FJLA 1KD0A 3E2RA 3HQNA 3CQ0A 2REQA 4ZFCA 2VRJA 4PSRA 1E4NA 2BXYA 3NNTA 4IMFA 4RJEA 3KS6A 3WJXA 2C8NA 4PFHA 1UJQA 2XINA 2WSYA 3D5HA 1H1NA 3PWGA 1VS1A 3B97A 3VCNA 4O28A 3OVGA 4IQLA 1QJWA 3PAOA 3AJ7A 4JOMA 4JKKA 4JIHA 3AALA 2YA0A 3POHA 3T8LA 4TXEA 3N34A 5DLCA 4GZJA 5I2UA 3UR7A 4LXFA 2JALA 1OF6A 1WUFA 1F07A 3NSXA 3G77A 1A5KC 4MB1A 1W3IA 5HWMA 1H0GA 4S38A 5MF5A 3ARVA 2W9MA 3NYDA 1TZ9A 3A9IA 4D1IA 5I02A 2PTYA 1UOKA 3PTQA 3RLHA 2ZXQA 1JI1A 2BS9A 1W1A1 4FIRA 2FDMA 2E40A 4LX4A 3UZ5A 3V5FA 1NY1A 4GHRA 4EK7A 4N02A 3GW0A 1IEQA 3FHAA 2BY0A 2QV4A 3BGJA 3TSDA 4WQ6A 1SU5A 1LWJA 3BPWA 1YX1A 1P0BA 4EAMA 4MTVA 3NFUA 2ADAA 5B7YA 3RO6A 3NQ2A 3ABRA 1PYMA 1EDQA 3PM6A 4LCQA 4UTLA 2C14A 3SRKA 1SR9A 3ZO9A 1HZYA 3BLLA 1W37A 3WZ0E 3W1NA 4DUOA 4E6MA 5EFDA 1FP9A 4NL1A 3B40A 4L9YA 4NVTA 3UG4A 3N2XA 4P8UA 5HPCA 4X60A 4Q33A 1A53A 4K39A 3S42A 4HU3A 5IOBA 1EQPA 1T40A 4KPLA 1QNQA 2WZTA 4MPKA 3CZKA 4OQVA 3VNJA 3KBNA 1LBFA 3WN6A 1ALDA 3AROA 3DYMA 3AI0A 2GGEA 1TX0A 5CC7A 3GVQA 5I00A 2Y88A 3OZPA 4MAZA 4LQ1A 1KLYA 1K9DA 1SQ7A 3OQEA 4M19A 1TIMA 5DQPA 4AD5A 1GVIA 3O8AA 3T4CA 3W2LA 2VOTA 4GOAA 1OHLA 1HG3A 4BWLC 3DU0A 2YL5A 1JRCA 2WYSA 2PDLA 2V5LA 4NIRA 3W86A 3WMBA 5A2BA 2AL2B 2QCLA 3NPWA 1Q7MA 2WM1A 3EA3A 3FSTA 4L4OA 4MMWA 3WG6A 1FCUA 4DF1A 3PUOA 1E6SM 3UJSA 1BEUA 1I4NA 3MV01 4RCXA 1W1YA 5LA2A 4N9EA 4XO6A 2O7SA 4KS0A 4E38A 2NVDA 3B9AA 4R3UA 2FZMA 3L2MA 4UOQA 1RPKA 3WJSA 1BF6A 2WKJA 2GVGA 2E7FA 5I79A 4JY8A 2FKPA 2IQTA 3IJ6A 3R5EA 2PMQA 3S1VA 1UROA 3MPGA 3ZR6A 4NAFA 3BOXA 5BXTA 1R3RA 3OGRA 5BRBA 3GRIA 3QHMA 1O66A 2B7QA 3GB6A 1W3LA 4GH3A 2G3JA 4DZAA 3ZJ8A 3ZSSA 1IEVA 2FPYA 3SRDA 2C91A 3M41A 2GJLA 5CLTA 4PFMA 2G8ZA 3DENA 4EKJA 3OVQA 1CZ1A 3GTFA 3A3HA 2FZ8A 3LSCA 4LYRA 2I9EA 1U5HA 5I07A 3NA8A 4Z2GA 2V5DA 3H2MA 4K3ZA 1SMDA 2YA2A 5EB8A 3S6TA 4PCTA 1JZ2A 3H2AA 4BZYA 3L4UA 3VABA 1IEWA 4RR4A 4DJFD 4PBGA 3T08A 1TX2A 4O12A 4PUDA 1UUQA 4FF5A 3KDNA 2DIKA 1OGSA 3EGJA 3UGRA 3CBWA 1A3HA 2A3AA 3TONA 1OK4A 4QJ4B 3VKCA 4Z1YA 3EOEA 2ZZ1A 3XISA 4YYFA 1G4PA 1PDZA 4HOZA 4O17A 3BCDA 3CV2A 1GJUA 1ME9A 3UXIA 4HU8A 1DWGM 5DMMA 2HQAA 6A3HA 2WPBA 1HKWA 3OBKA 1N8WA 3OIXA 1V51A 3CPRA 2X1TA 3WUEA 1VQTA 3OVPA 5XINA 4NZ5A 4KWVA 1HT6A 4ZO7A 4O11A 4RLIA 4NZFA 1TELA 1N55A 1W5MA 4B3LA 1ZP4A 1GOXA 3UXLA 3E2VA 4AZCB 1J5SA 4BWLA 2QPUA 4W93A 1CECA 5AHIA 1XXXA 4I8YA 1Q6OA 4H6RA 1GEHA 2BFGA 4G56A 1MUCA 4F4RA 4RE2A 1W3KA 4WXYA 4XKYB 4TMBA 4QDWA 1BG4A 2E8ZA 1VIWA 2ZRXA 2WJFA 3ZVHA 3D6NA 2ZTKA 4HYVA 1F76A 4Y9PA 3HURA 1S1PA 4OUIA 2VGFA 3UPMA 4ZO9A 2D3NA 1KB3A 1FTXA 2HXTA 1R9XA 1N82A 2DZBA 4A05A 4MYXA 2ZUNA 2QDEA 4GUGA 2DFAA 1G7UA 2CZEA 2G3MA 2WSKA 3F4CA 3VIKA 3FV9A 2A7NA 4AZGA 4M8UA 3V18A 2LLEA 1UR1A 4N7QA 3BG9A 1JCTA 2FTWA 2NQJA 3AS1A 3MI3A 3N15A 4O57A 2Y4SA 7A3HA 1W5PA 4S2CA 2AQWA 2FVMA 4DPQA 5JH1A 4PB4A 1PUDA 1UB3A 1E6NA 2QEZA 3UXAA 3R8RA 3VNDA 1XM3A 4H9TA 5A3HA 1ZUAX 3E0IA 1SO6A 2YZ5A 3NOYA 4JN7A 2E5CA 2CBIA 3PZOA 4IFOA 4KEVA 5AHMA 5T26A 1FA2A 4QIUA 1A5SA 3UVIA 1OINA 3BW2A 5AVNA 4YWSA 2BV9A 4GI8A 2Y24A 2HZGA 1RQEA 2Y1HA 4GUFA 4GUIA 1TWWA 1ZALA 2WNWA 1IXQA 3AO0A 4QNWA 3WELA 1W9BM 3UR2A 4G1NA 2BSLA 2QV5A 3TH6A 2C0AA 3U0HA 4A3QA 3W38A 3KVJA 2BHUA 2BG5A 1Q4WA 4QRNA 1EYWA 1MQQA 4IUOA 3HG4A 1J2BA 5B7ZA 4XISA 5JH2A 4ATLA 2A0NA 1I9CB 3U7VA 3NEVA 1NDVA 1GYLA 4HYRA 1PYFA 2OQHA 1SZEA 5F1VA 4ZVJA 3AHVA 3MT1A 3BW3A 4HNCA 4CU6A 4LGXA 3G1AA 4DI9A 4H1ZA 1KM3A 3C52A 3R2GA 4S3CA 1XQKA 1C8YA 2YDRA 4EPEC 3K2GA 5LZLA 1AG1O 3C4UA 4FALA 5IDZA 1IXNA 2ISVA 2PTXA 1VH7A 2SFPA 3T0AA 2X7VA 2EF9A 3T40A 2NZLA 2OLHA 3WDJA 1NELA 1GPWA 3LQLA 2V5JA 2BGNE 3RU6A 3GDTA 3G1FA 3BANA 1W5OA 5G2IA 1DHPA 4UUIA 2VELA 1EEXA 4AZ5A 4C6MA 2PE4A 3CYVA 4S2BA 2BLEA 3UPWA 4AVFA 3QPZA 1G6CA 3BAXA 1VHCA 3QLLA 1UD6A 4TX8A 3TP4A 4HMDA 3CHFA 1KTCA 5A95A 3HZ3A 3PJUA 4KWOA 5I7GA 1A47A 5H8PA 2J6VA 1R3VA 3TFXA 3W1MA 2CZVA 1BSIA 2QIIA 2WQPA 5AYZA 2V68A 3GU1A 1EWEA 3JS3A 4ZQNA 4IQJA 3Q67A 1JNDA 5LNSA 1LG1A 2PDKA 4YTQA 3YPIA 3FA3A 4QTGA 2ALDA 1FWWA 4EACA 3OW1A 4GRSA 4C65A 3N25A 1A5UA 3GXDA 1S5VA 2D23A 4OGZA 3IUHA 4Z2KA 2B81A 2TODA 1CB7B 3FW6A 1P1MA 3LHWA 3CH0A 3N29A 3NURA 4W8AA 3F4VA 4MFDA 2J9YA 3L4TA 3WFZA 1XIDA 1E71M 1DE5A 3H7UA 1HKIA 4OHQA 3DGBA 1X98A 4Y8EA 5H2ZA 2YIHA 3KL3A 1EBGA 3I4EA 4OT7A 3UD6A 1GVSA 3LN3A 3SSZA 1NFBA 3LHTA 3WDIA 3N9KA 5B80A 3ENLA 4MHBA 1W91A 1S2WA 5D2YA 3CUFA 1XLDA 2XSAA 3MC5A 4H6QA 2AL2A 5ENLA 3UXDA 4ERAA 3LM7A 4WKHA 2HPIA 3LTYA 4BQ2A 4PMRA 4IX2A 3AS2A 1R2SA 2PZNA 2DZSA 5I3JA 3WDQA 3M0HA 3STGA 1FWDC 4HNNA 1JZ4A 1KFBA 1GKPA 1AL8A 5KETA 1H60A 3A21A 1CB2A 5E6YA 3VDHA 1N2VA 1QXLA 1VBUA 2JEQA 5F4WA 1J0YA 1XH2A 4GJ1A 1ZBWA 4GWEA 1MZRA 1EIBA 2UBPC 3EOSA 5CLWA 1IT8A 7PTDA 4H9VA 3H21A 3RYSA 4JIIX 4AMCA 2ESCA 4AC1X 1NWUA 3MMDA 2XN2A 4XG1A 4CCDA 2VEFA 3UFYA 3AFBA 3JZUA 5REQB 1KW1A 3AMKA 4ZTXA 2C18A 3CHDA 1DQUA 1XD0A 3L5LA 2HBXA 4UQCA 3PR2A 1ZLPA 3VNYA 1OG6A 3NQAA 3PNZA 1A5CA 5FI8A 2OZTA 3QW4B 2ZA2A 2CLKA 1R9ZA 4H4IA 4P2VA 5FAJA 2DT3A 5LIUX 2J8GA 3O05A 4TTGA 1HO1A 4MB3A 2FVLA 2GSEA 3P5ZA 3WO8A 4LBRA 1OCQA 2D73A 1LT7A 2V0TA 4KCVA 3W84A 4FOUA 4XAPA 5FKYA 2PRLA 3ZT7A 1UC5A 3NVTA 4J1OA 2VDIA 4LCSA 4R88A 4WEVX 2YBTA 1BRLA 3H22A 3EB3A 3AXKA 1RH9A 4LU0A 2ICSA 2ZUMA 3ZLGA 3NQ8A 3N04A 3S9ZA 1L6YA 3K8LA 2PWUA 4W9TA 2XIMA 5A5WA 1KBKA 4ZR8A 5AC6A 1OQFA 3T0DA 3LLFA 5GJMA 2P0IA 3O6CA 3W7EA 3MSGA 2PRMA 4AZCA 3DGRA 1B3XA 4US5A 2Q02A 3UJRA 1BVWA 3LG3A 4V1YA 1PXGA 4RZ4A 3V5OA 2H8XA 2AL1A 1FDZA 4YHEA 4XKYA 5I03A 5C8BB 1GQKA 3N4FA 1AJ2A 3B3DA 2VDHA 4MF4A 1TMHA 4DNMA 4UTKA 1FHLA 4AIOA 2DH2A 3EPNA 1YNQA 3VM7A 2KX9A 3CPGA 3KTXA 3OZMA 4ICCX 2AMGA 3V0UA 2VX5A 1ZB5A 4GQGA 4B91A 4X2PA 2WNZA 4DJDC 1WP6A 1VFFA 3IGXA 3AISA 5HR7A 4E3VA 4FX7A 5CKSA 1EBHA 4AEOA 4K8EA 4AZHA 3GU2A 3B9DA 1MRAA 1HKMA 2QPXA 1ZRQA 4UTMA 1RA0A 1PTGA 4B2DA 1TVLA 4K38A 4KERA 3WD0A 3O07A 1RUSA 3WQGA 1V6YA 1HUVA 1K8CA 5FL1A 2IMRA 1XG4A 4H3DA 4JICA 3N3MA 2CLFA 3QGKC 2WNQA 1O5KA 1EJTC 3PUGA 5GNYA 2OYKA 2XPKA 4RL3A 2ZX5A 2W4XA 1C8QA 1FXQA 4GZEA 3AIVA 1GG0A 4WRHA 2E9LA 3CWHA 3T78A 3LPOA 3GHRA 3E74A 4GABA 2OEMA 2X0HA 1LROA 5U4NA 2YB1A 4Z17A 1SJBA 4GKLA 4P7OA 2BB0A 4W7WA 3RK8A 1C92A 3L4ZA 2JF6A 4G5DA 1HJSA 3CYJA 3GTXA 3HN3A 1Z3NA 3GAKA 1YE6A 3WQ4A 3GE7A 4P5UA 1PWLA 2BOFX 1Z48A 3T7VA 3VK5A 1E3XA 1M7JA 1SR0A 4F2UA 4LCRA 1YPFA 1K8ZA 5IXEA 5DT5A 3KP1A 3U48A 4HNVA 2XH7A 3WBWA 2C19A 2GDQA 2V6AA 2V81A 4ICMA 4F2TA 4MJMA 4YHGA 1W2PA 3W2UA 4ADUA 1QI4A 1G67A 1XLMA 1DPMA 2Y70A 1W1IE 4UFLA 4L1XA 4LAUA 1JFXA 4DX3A 1QPOA 1XHGA 3OTRA 1YDVA 4J3ZA 2XIOA 1UKSA 4KWWA 4JQ4A 4IUGA 3WQ8A 2O9PA 2GQAA 3LQGA 4N2YA 4XKMA 3M46A 2GGHA 5HJLA 4QHRA 4HTYA 3RG6A 1QDSA 2GJXB 4RDYA 2KZHA 1FWGC 1ITQA 2A3CA 5A6MA 3PC0A 3SURA 3PVFA 4DJED 1UOZA 1ICSA 5D2WA 2CHNA 3SGGA 4ML9A 2QDHA 4Y9MA 2EBNA 1FH8A 4PBFA 2VEMA 3NM3A 4QISA 4LW7A 5BXPA 2W0UA 4HK7A 4HZ6A 1JZ6A 2EGZA 2VX4A 3BZJA 1KA9F 3LGEA 3NQEA 3PZTA 1YE4A 2C6QA 1JULA 2ZX8A 1O1ZA 3ZWSA 1KRBC 4UFHA 4GQRA 3SJNA 4PMZA 3WNLA 5HAOA 3B0UX 2WNNA 3EPMA 2ONEA 4EF9A 2PUZA 3RDKA 3E0VA 3O6AA 4Q8MA 3TWBA 3SQLA 4WLCA 4OFCA 2I5QA 2TRSA 3FX4A 4DEFA 3A4AA 4MLJA 4DBDA 3CMGA 3JUGA 4QAWA 1DWFM 4IMAA 1ZNNA 2OSXA 1KRAC 3B05A 4KQNA 2IPJA 4TIMA 1LLOA 4IGHA 1K02A 1UYQA 4K2SA 4W8BA 4MG4A 3GYEA 4UQEA 1GNXA 2NUXA 3PB2A 4GPNA 1JPMA 1G9HA 3QF0A 3ARRA 4C6QA 4ZXOA 1AVAA 5CZ0A 3VOCA 3A64A 1V6VA 3LPFA 4YLWA 2A79A 1M6JA 4DXKA 2EG7A 2BBFA 3IK4A 1RJRA 1DEDA 2V3FA 1V03A 1FCBA 3LNMA 4IT1A 4EPDC 2WZMA 3WNNA 3WNOA 4BF7A 3A4JA 1OBAA 4GYKA 1OYAA 2JBMA 3CHVA 5CQ1A 5AYIA 2Z1KA 3KOYA 3TNOA 2VZSA 2Y61A 4EWND 3C2RA 1V77A 2VP8A 1MEWA 3W02A 3CZLA 1XLHA 3EWDA 3BO9A 3H7RA 4XZIA 3LNPA 3ZJ6A 3TW7A 4A6GA 4JGDA 3EX6A 2DU2A 3VDGA 3W2JA 1TFVA 4FOKA 1Q2SA 3KVKA 4OU1A 4DXXA 3BAWA 1I2OA 3AICA 2D20A 2NUWA 2XVGA 1S5MA 2ZDSA 4OOUA 2DP3A 4DJFC 4NJJA 2Q01A 4S39A 3DOPA 3KVMA 4FXJA 3UJ2A 2V2DA 1QFEA 2INZA 3THQA 2FZBA 4G7FA 5J5RA 5BRPA 3B8SA 5REQA 3BSHA 2JK2A 1H7RA 4B5UA 4DLMA 1RD5A 3WLHA 3FLUA 3GXPA 1Z44A 4QX4A 3TV8A 1ZAJA 1GHRA 5BWFA 2EHHA 4XIMA 3SN1A 1FX6A 3LU2A 2EEXA 5CZJA 4IXHA 1MQRA 2QCMA 3SEPA 3ZR4A 1S2CA 1EJRC 5BOFA 5LNRA 2W6RA 4WSJA 1YYAA 3DI0A 2QCHA 2XZ7A 4L4LA 2EQDA 3W7PA 4HZMA 1XP3A 3CAWA 4RKAA 4KCWA 4AZ6A 2Z0IA 1PX8A 1E1CB 2E6YA 3B06A 5EPDA 3DKLA 2BNJA 1YTEA 1TPWA 3NIYA 2X8RA 3WBEA 3N17A 2VZUA 3BICA 1B4KA 1XIMA 1VBJA 1V3HA 1E5JA 1EQCA 1HF6A 5C54A 2E8YA 1NJJA 3WFLA 1QI0A 1P0DA 4IGMA 1LF1A 2RAGA 1XBZA 3OHMB 5CSUA 1CWYA 1Z32X 3BC9A 3WY1A 8XIAA 1FKWA 1ITXA 1WDSA 2DVTA 4C6PA 4AISA 4DQWA 3O15A 2PLCA 3W73A 1UD4A 3ZJ7A 3P67A 3VCCA 5K3VA 1FWNA 3O3RA 1V3IA 2OXNA 4S3GA 5E93A 2VO5A 2XSXA 2WLYA 3AUJA 2PLMA 4DO5A 1XR2A 3EDEA 5FEPA 3TFCA 3ARYA 3DI1A 3W2NA 4FP1A 3LMZA 3PBUA 2VZTA 3TN4A 3DFHA 3TZNA 3LRKA 3PPGA 1H0IA 4LYQA 2VYOA 4PMDA 4XZLX 1FUYA 1TPC1 4FXSA 5JU6A 5EBUA 1VFUA 4S1FA 3OPSA 5A8MA 3OLEA 3ZZ1A 2QQ6A 2OO6A 2PDQA 3WDRA 1EJVC 4ZFMA 4UTFA 4DJFA 1LBLA 4HYWA 1BGAA 3K13A 4KGLA 4HZ8A 2WJZA 1R3SA 2POTA 4P61A 1SFLA 2YGYA 3W00A 4W86A 1KNWA 5I77A 1Z8AA 1DWJM 1Q7QA 2YKKA 4PULA 3GBDA 2IXVA 4QM1A 4MJ4A 4XBKA 2OKTA 4JTGA 2YZRA 2VI0A 3MZ2A 1XDJA 1UWSA 3QKZA 3G3MA 5CCZA 2FMNA 1UASA 2QAPA 5DXYA 3L21A 4WX2A 1R3TA 2GOKA 3KUMA 3ABQA 2WVUA 1MWOA 4UQBA 3GFXA 3GD6A 1KQYA 3KOWA 4AYSA 4W5ZA 1TJ1A 2XIBA 4IPPA 3XINA 2OO0A 4QLKA 1E0XA 1XGDA 3I7QA 3PHAA 3EWYA 2Z25A 4X9SA 4ZQCA 5LA0A 5D2VA 3FA4A 1D3HA 4IICA 3CQKA 3W1AA 4PRRA 4BEQA 3P82A 5DCEA 4DXVA 1VRXA 3W87A 1O7AA 1PE1A 4QQUA 4RUBA 3DFNA 1ICPA 3IACA 4Z1CA 1MXSA 4B5XA 2AGTA 2UY5A 1OT1A 1UA3A 1M3UA 3VGBA 1IV8A 4I7UA 4E8CA 1MVYA 4PMXA 4KCTA 3BTNA 3ARQA 1KXTA 4KGJA 1HW6A 4PMVA 2QJGA 3S1UA 3BJTA 2CFFA 1IF2A 1ISVA 1TV8A 3DHUA 3TC7A 1ZY9A 1TRDA 3AHYA 3RF9A 4UZSA 1U30A 2OT1A 3I3BA 3PZQA 2JE8A 3II1A 4CUCA 1V5XA 5JMUA 4JYEA 3NO5A 1QU4A 2I57A 2QMJA 3VMOA 4LUSB 2ISSA 3MV11 2WJEA 1MFVA 2J7DA 4M1BA 1UUOA 4GVGA 1IHIA 2XN1A 2PDXA 4M1RA 3QZEA 2ZXBA 1UW9A 4J3VA 1WOAA 3IIZA 5AHEA 4IISA 4A3RA 5I78A 1KFCA 2DUZA 1EO5A 3FNDA 4LS1A 1R87A 3T44A 1H7XA 2QXWA 1J9YA 2GJXA 1QK2A 2WV8A 3HG3A 3QTPA 4GCAA 3GR8A 4JIEA 3WK2A 1EF3A 4IFKA 3UA4A 3MO4A 5C7HA 1IT0A 2R14A 3FKRA 3P6LA 4DN1A 2Z26A 5E09A 4RE4A 1QPKA 1J8VA 3V0SA 1REQB 5G4WA 4J28A 2J88A 4GIYA 4B5VA 1IYXA 2J9XA 4QS6A 4UTWC 4DM2A 2BP1A 1PS9A 1O60A 2Z2AA 4DBUA 1HO4A 4UTTA 1E70M 1KBJA 3VOHA 4CNPA 2QT3A 4H04A 1TJRA 2J7HA 2YPIA 3QV6A 3LCXA 3GIQA 4H83A 3WFAA 3UJEA 1QNSA