1KTNA

Structural genomics, protein ec1535
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase
rcsb
source organism Escherichia coli
molecule tags Structural genomics, lyase
molecule keywords 2-deoxyribose-5-phosphate aldolase
total genus 100
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktnA00
2NZLA 2VFHA 4U4MA 4MVAA 2E09A 1T8XA 3BG3A 3CT7A 2QCLA 3W9ZA 3IIOA 4RKAA 1IXOA 5CPNA 3W7NA 3LI1A 4LRSA 1LORA 5LNWA 2YX0A 3SIZA 2ZZ1A 4D2JA 4TMCA 4HNNA 4UTKA 4MY8A 3C3NA 4CQ8A 2QJGA 1JCMP 3QF0A 4YLWA 5HQEA 3CC1A 3NEVA 3T4CA 4GUGA 1XKYA 3NPXA 1OF8A 1W5QA 2J88A 1WOBA 2LLEA 4IWWA 2J9YA 1THFD 4ALDA 3M47A 1OK4A 5CPOA 1NSJA 2QCEA 3UYCA 5K7JA 1J4EA 3SFKA 2FIQA 1OFAA 3NGJA 4JTKA 5HR6A 3CWOX 4LT9A 3QMSA 1TTPA 3HIJA 3GK0A 3NQDA 2QAFA 4K37A 3NG3A 1B9BA 1F73A 1FWRA 1JUEA 3U2OA 5KTLA 4UNKA 1H1ZA 5AHNA 4MZ1A 2DP3A 1EPXA 4AF0A 3W7GA 3WK1A 6TIMA 1TTQA 1GQNA 4XTIA 5EMUA 3W1LA 2JK2A 3M41A 1O5KA 3UY7A 2GPTA 3GVGA 1I4NA 3T7VA 1UB3A 2J6XA 4IOTA 2DJXA 2XN2A 3VI2A 4DO6A 2CLMA 3T44A 2QCHA 2Q3RA 5I3HA 3QFEA 3LLFA 2DZXA 2DU2A 4CCEA 4O1CA 1HO1A 3FFSA 3EX6A 1AW1A 1HO4A 4HNVA 3I6RA 1H7XA 1A5SA 3HG5A 1O60A 4O8RA 1D3HA 3A24A 1X1OA 3HB9A 3Q58A 5F1VA 3CWNA 3STCA 1S5TA 1ICSA 4LTSA 5EBUA 2X30A 3LCWA 4M6QA 5K4XA 1W5NA 5G4EA 3GAKA 4JS3A 5D05A 5AHLA 4AF0B 3UWWA 4EOUA 3O1NA 1SUXA 4Q33A 1KM6A 4O4WA 3PS7A 3Q37A 3UWUA 1IF2A 2CZEA 1FCUA 2VC6A 3W7DA 1XM3A 2VKZG 3SW6A 1VHNA 3L0KA 3W83A 4NJKA 4G1KA 3BV4A 1TYGA 4UTHA 3LCXA 5AN7A 3ABSA 1R2SA 3NQ8A 1J5TA 3SSJA 1K8ZA 3THAA 2Z6JA 3KX6A 4JY8A 3GAYA 4OQVA 1XDLA 3GDTA 1KM0A 3BG5A 3G1FA 5K9DA 1JUBA 1ZNNA 3LRLA 3F4WA 3BW3A 2J9ZA 4GRSA 3S5OA 4XBKA 2ZQ0A 3TU9A 2A21A 3TQKA 3STGA 2BTMA 4Y90A 4QISA 3ZS4A 3R13A 5D04C 2RHGA 1YDOA 3DFOA 3P8IA 4ML9A 4N6EA 4O4VA 3RNDA 1KBJA 5HR7A 5D38A 5U4NA 4IPIA 1I2PA 1ME8A 3C8FA 3R89A 1OF6A 4CNPA 4JR5A 3LXBA 2A5HA 1MEIA 2ALDA 3O05A 3W72A 3DBPA 2GQAA 3S9YA 2Y7FA 3P5ZA 3IRDA 2Y61A 5LGZA 4RX0A 4BFAA 1W0MA 3PR2A 4AHQA 3W7QA 4O0KA 1A5CA 1LRTA 2EPHA 1SZEA 4JTTA 1F5ZA 4RZ6A 3UZ5A 2BLEA 1H5YA 3FKKA 4PH6A 2Y6ZA 2GJNA 4WY0F 5DBUA 3ABQA 3LHTA 3W76A 1UUMA 4CCDA 2B7QA 3P67A 1TQXA 1M5WA 1L6SA 3M9YA 1D9EA 4MYXA 3DH7A 3HG4A 3M16A 4WX2A 5J5DA 2OX1A 3G1SA 3E02A 5CPMA 4JTFA 1SZNA 4LUIA 1O94A 4K39A 4HSNA 2G5WA 2ABBA 3HG3A 5AC8A 5IBXC 1F7BA 4FNTA 2YPIA 5LHFA 4C1KA 4XKYA 3C56A 1KBIA 3WJZA 4R53A 3TCEA 3DHFA 4GUJA 2WSQA 2FPVA 3TR2A 4LVBA 3LV5A 2UV8G 3U8GA 3W70A 5TBOA 1TPB1 3CM4A 4K7VA 2OMAA 4IJBA 1LROA 5FI8A 4YMZA 2NUXA 3MP5A 3SI9A 5DLCA 4B5NA 1FDZA 4FB7A 2ISVA 4FIQA 4QJ1A 5D02A 3CEUA 5DY2A 1ML1A 2HSAA 3W7RA 5T26A 5KZMA 1W54A 5HINA 5CKSA 1Y0EA 3EXSA 1J2WA 5AYXA 4DF1A 1YTEA 5FEWA 1IIGA 4IX2A 3TC6A 2HMCA 1R47A 1GVRA 4NX0A 1ME7A 3GNNA 3TE9A 4K36A 4Q32A 2W6RA 3LCFA 4UMCA 3STFA 2QCMA 3A5FA 1OFDA 4DQWA 3W1TA 3G1HA 4RV8A 3KVLA 1KFKA 2NV1A 2RDTA 4ADSA 3TMQA 4E38A 1EP3A 2X16A 1HL2A 3OIXA 1S5VA 4BI5A 1G6CA 1HG3A 5BMXA 3GLCA 4O1BA 3RMJA 1HFBA 1GZGA 5CZ0A 3IIZA 2YDAA 1PV8A 4IMFA 3B0PA 4IX0A 2G97A 5KMYA 1SO4A 1VCFA 4EF8A 4N9EA 3P8JA 1VYRA 1DOSA 3UWVA 2TRSA 4MZ8A 5F2IA 3L5AA 4ZQRA 3DI1A 5DCBA 5LNRA 1OYBA 1Q6LA 3F4NA 4KFNA 3DFSA 3M5YA 1KFLA 1EUNA 2GQ9A 3F1QA 3C2EA 1GYLA 2WO5A 4O50A 4M7SA 2IQTA 3UPWA 5G2WA 3F03K 1TTJA 3HPZA 1I8JA 3EX4A 3V75A 4MYAA 4O1AA 3LCHA 1S3HA 3LBCA 2X2GA 5DCEA 3OBKA 3BW2A 2RH9A 1LOLA 4WY0A 1Z44A 3NL3A 3PY2A 1SW3A 1ZAJA 3MI3A 1U83A 5FEZA 3R12A 1GT8A 1FWNA 1T99A 1LCOA 3B04A 4ZMGA 4LC8A 1P1XA 1ICPA 3LRMA 2EGZA 1W37A 5D09A 4HKPA 3DKLA 3VNDA 3PF3A 2E6AA 2V0TA 2V5BA 3LBMA 5IBXA 3HGRA 5D30A 2ZYFA 2Q3OA 3M1ZA 1N8FA 4KKXA 3NQMA 3TDFA 4RCXA 3W1AA 1PCKA 2TPSA 3NQAA 2NWRA 3A23A 4UMBA 2D73A 3W2LA 1G69A 3LHYA 1SFLA 4LRTA 1R30A 4KFOA 3I7SA 3R5EA 1YADA 4KWWA 4WOZA 1GVFA 3TIMA 4CQAA 1K8YA 2VFGA 4IPJA 2FPYA 3TROA 2GJLA 3L65A 2B7PA 3P60A 1QCWA 3IVTA 3NQEA 1DQXA 4ADUA 2Y7DA 4S2CA 3DENA 1AW2A 5AYZA 3TQ0A 2ZRUA 2A6LA 1I2OA 3ATYA 4ONVA 3TJXA 4MFEA 5A5WA 6ALDA 4A2SA 4AHPA 4LC6A 2Y88A 3SGZA 3DKJA 1C8VA 2H3DA 2PRMA 3NL2A 3FJ6A 1PIIA 3SECA 4RJEA 4BF9A 3TSBA 2YYTA 2YYUA 2OCZA 1W3TA 1NF0A 2R94A 2FB3A 1OHLA 5L6UA 4NT0A 2NUYA 3E49A 3CIWA 3NQ7A 3NR0A 1ZCOA 3NZ1A 3MO7A 3S1UA 4UCGA 3TKFA 3GXNA 2ZFAA 4XTDA 2P0OA 3LCIA 1UASA 1OFQA 1DJQA 2V2HA 4YCOA 5TQLA 2R14A 4AEOA 3W1RA 2X1SA 1F6PA 1M6JA 4FXSA 3TMLA 3UWQA 1MEHA 4HHPA 3TSDA 5GVJA 3S42A 3PC0A 1H7OA 3V1PA 1KM2A 1SSGA 2WV8A 4JTUA 4O17A 4TU1A 3LERA 5LNSA 3W7MA 4N4PA 3OVQA 5K9XA 3TAOA 1YXCA 3S1WA 2H3BA 3TW6A 4AMAA 1IXPA 1WQ5A 3PUEA 4JTHA 1DQWA 4BWLC 5H91A 1FWSA 1ZALA 3G8RA 1YXDA 3W1MA 1TPFA 5IM51 2VEKA 2QDGA 4K8EA 2ZDRA 3M6YA 1UBSA 4LWWA 1DL3A 2VEMA 4YL2A 5F4XA 1EUAA 4AXKA 3HO8A 4OBTA 1LZOA 4LY8A 1H63A 5C54A 1TQJA 1YTKA 2VOMA 3KXQA 1TJPA 1VHCA 4O52A 3EWWA 1BWKA 3QC3A 4UR8A 2PRLA 4O15A 2C16A 2AAMA 4QNEA 1KLZA 4MUZA 4MOZA 4BI6A 5ABTA 3B0UX 4EIVA 1WA3A 2CLEA 2CLOA 3NAVA 1SO3A 2Z6IA 4FNSA 4LUJA 4RLIA 5F4SA 2FB2A 1SZFA 3KRSA 3LCGA 2A85A 3C61A 1MSSA 2BSLA 4H3DA 3NQFA 5DBTA 1JULA 2JGYA 2CLLA 4LS1A 1A5BA 1X8FA 4OE7A 3U6WA 1FUYA 2X1RA 2DORA 3SR7A 3GKFA 3PB0A 1K7EA 3KRUA 4GE8A 2H8ZA 3L0NA 4A21A 3BLIA 5G1YA 3NXFA 1RQHA 3P62A 3OHIA 1QMLA 5D03A 2BZNA 3FKRA 4I7VA 1ICQA 1WAUA 2CZFA 3FA5A 2E6FA 1B4EA 1H7WA 4HNUA 4ORIA 1WXJA 1UJPA 3DFNA 4MLRA 2QCNA 1XC4A 3QH2A 4UIOA 3HGSA 4JTGA 1P4CA 1FCVA 1XFBA 3UXAA 1JCLA 3O63A 4HT3A 2Y62A 1P5BA 2WNNA 1AL8A 4UTUA 1H62A 3R8RA 2BWGA 3T55A 4YWIA 3NVTA 1QO2A 4DPPA 3KAOA 3TNOA 3LV6A 4JGDA 3LTYA 4LOCA 3O6CA 3DI0A 3GNDA 1HTIA 1TRIA 2QCDA 4PFMA 4UTJA 2ATMA 4LS2A 2PCQA 3A22A 3MW7A 3LGEA 3OA3A 1MZHA 2Y7EA 3CB8A 1VH7A 4AVFA 3TC7A 2YGYA 4O16A 1FCQA 3QRHA 1XBVA 1KFJA 2A2IA 1KM3A 4N2YA 5BRBA 3GX9A 2CU0A 5BNKA 1YPIA 2A4AA 4FIRA 3SY5A 2WQPA 5C5YA 4NX5A 4MZYA 4IMCA 5C55A 1H60A 1P0NA 4LVAA 4Z1AA 4WXZA 1LBMA 1KFCA 3L5MA 2X1TA 3GXPA 1SPQA 4RZ5A 1F6KA 4ZQCA 4N4QA 1SQ7A 4WXYA 4DPQA 3LI0A 1O4UA 2PE4A 1K7FA 4MKNA 3PBUA 2ZTJA 2RDUA 4J9JA 4WD0A 4XWUA 3FYPA 1TB3A 2V82A 5FF2A 3RLVA 1OFOA 3C52A 4FNRA 2V9DA 3LHZA 1GJPA 2P1FA 4O14A 4X2RA 1Z48A 3UQNA 4AB4A 1UCWA 1RQEA 5LSMA 1OFRA 1FX6A 4DO5A 3TK7A 4O57A 3SZ8A 3N2XA 1GTHA 3IGSA 1PHQA 2VFDA 5HMSA 4DXVA 3GIYA 2C3ZA 4LVDA 4XKYB 1VQTA 1DORA 1TPVA 2CFFA 3OVPA 3IIXA 4NQ1A 1SZGA 2Y7GA 1JRCA 3QMRA 3W22A 3W1QA 5E93A 2XFWA 2CWNA 2YW4A 5D2XA 2EAWA 2ZZ2A 3W7KA 5LZLA 3H53A 1K7XA 3WK2A 3FOKA 1KA9F 5I3FA 4JTIA 3QSTA 2BXVA 3A21A 4QM1A 3PVFA 3BGJA 2ZCGA 3W88A 1PE1A 2RDWA 4CQ9A 1H1YA 4MY1A 5CGQA 3YPIA 1SR9A 1JJKA 3BVJA 4I9AA 1FWWA 1YXYA 1FBAA 5HWNA 2Y63A 2ZA3A 1B57A 3BARA 2E5BA 2B0MA 1GPWA 2V30A 1SU5A 3BO9A 1I2RA 4EWND 1EIXA 4H6KA 4DBDA 1ZY9A 1QO5A 3M7WA 1Q6OA 4WY0B 1GVQA 5LNUA 1GTEA 4MLJA 4QITA 5CG7A 5CPLA 3QJAA 2TMDA 1OX4A 3PAJA 3DU0A 1TJRA 2ZRYA 1I45A 3QMTA 1GVSA 4XQ6A 2YW3A 3TV8A 3E0IA 1RR2A 3M5ZA 1A53A 5AHEA 3I7QA 3VFLA 1TCDA 1H7RA 4LW7A 2QCDB 1L6WA 3GKAA 1FXQA 3KHJA 4UFIA 4UXDA 2ISSA 3AJXA 1LRQA 2EHHA 1AK5A 3BLFA 3R2GA 1CI1A 1E51A 3GDRA 4FO4A 2C0AA 2Q8ZA 2Z2UA 4ZQNA 5FF7A 4YCPA 3FIGA 2CLIA 2ISWA 4OV9A 4OHQA 2XN0A 2B7NA 4FHAA 1XXXA 3MP4A 3NA8A 1UUOA 1W5MA 3INPA 4DBEA 4L4MA 4M6VA 1D3GA 4JTSA 5C2XA 1C9DA 1TPEA 1JQVA 2EF9A 4Z08A 4NXKA 2DJLA 5FEXA 2PC4A 2PRHA 1EWEA 2AQWA 1EB3A 5G5IA 1XUZA 3LXAA 3G1VA 3W2UA 1TV7A 1Z41A 2KZHA 1VYSX 4JDYA 2O7QA 2E5CA 3I65A 1Q6QA 1XCFA 4OV4A 1JCNA 3NQVA 5DY3A 1VLWA 3W87A 2JBMA 3H55A 5KITA 3UPBA 4XZ9A 4S1FA 1IGSA 2NXIA 2DZPA 3P81A 5E0KA 3USBA 3LCLA 1O5XA 2A0NA 3B8DA 1G4PA 3HGOA 4JN6A 1PS9A 1WOAA 2J24A 3NPWA 4IUOA 1V5XA 3ZWSA 1RD5A 3ELFA 1TPH1 2J9XA 3P80A 4UR7A 5AC6A 2Q8LA 1RVGA 1KM5A 3LDVA 4RR4A 2QJHA 4NJIA 3W3OA 3G1XA 4MJMA 3W2MA 4PODA 3TUUA 1KM4A 1LLZA 4NJGA 1TIMA 1JRBA 2ZRVA 5D37A 2FFCA 1MEWA 3W2JA 1W31A 5I3IA 1ONRA 4TR9A 5I3KA 4FX6M 3GDMA 1PCWA 3HJZA 3OG3A 3E12A 3RK8A 1KW1A 3QPZA 1KV5A 3BK0A 5A8GA 2PURA 4FXRA 1VCVA 4FNQA 3DFTA 2CLKA 4IXXA 1X1ZA 3M44A 2W79A 2B4GA 2HTMA 1WBJA 3PG8A 4UTWA 4E2DA 5KZEA 3LTPA 1QPNA 3G1DA 4X9SA 4HN4A 5D33A 1VS1A 5BW6A 1TREA 2ZRWA 1VLIA 3UY8A 1FXPA 2WPBA 5EKYA 4JICA 3E96A 3MMTA 1GWJA 5D2VA 2VFEA 1QFEA 4Y8FA 4RK8A 3W86A 3GB6A 3L68A 4YXGA 4JTJA 1K02A 4GXMA 3DXIA 4OGZA 2NV2A 4R7JA 3G18A 3EXRA 3EWBX 5D2WA 3FJLA 3O06A 3WK0A 1GYNA 1C29A 3NPUA 3QW4B 1G4SA 4QAIA 3S0CA 2YFOA 1K3UA 1XL9A 2HS6A 2QCFA 1OVDA 4RXGA 3EWZA 3DAQA 3PULA 3QQ0A 3MUXA 2GVGA 2WSRA 1JUKA 3ABRA 5L9FA 3NL5A 5HUPA 3I7RA 3ZWTA 3VE9A 3I68A 1ZAHA 3FLUA 1IXQA 1NVMA 4MIMA 2DZVA 3FS2A 3O07A 5TIMA 3C4UA 3NQ6A 5AC7A 3CEPA 2ZZ7A 3L9CA 1TV5A 2XN1A 4UMAA 4UFKA 3W85A 1G7UA 4S2BA 4GUHA 2CZ5A 2C18A 1SO5A 4PC8A 1ME9A 1VPXA 2QUTA 4TO8A 5K9CA 3LM7A 1ZFJA 1OYCA 3NOEA 4JDBA 2CLFA 4NU7A 3S8HA 2RFGA 4JY9A 4PA8A 1FY6A 4JEQA 3GDLA 4O19A 3GYEA 3HBLA 5BOOA 1EX5A 3IVUA 3CHVA 1QOQA 1TSIA 3NO5A 4BWLA 3W7HA 4DF0A 3TXVA 3N2MA 4WOQA 4LU0A 1LYXA 3LRKA 1U5JA 4L4LA 1JCXA 1QOPA 3NM3A 4OT7A 3MI2A 2WNZA 1ADOA 2G96A 5HULA 3GR8A 4WJEA 8TIMA 3KVJA 3PSVA 3K30A 3G8EA 1NAL1 2YSWA 1LBFA 3P7YA 2NWSA 5AOUA 3M5XA 5K3VA 1K03A 4A22A 2GVJA 2DZWA 4GWEA 1SSDA 3B03A 4FX7A 1XUUA 2TSYA 1W5OA 1WYIA 2Y89A 4AH7A 3O6DA 5G4WA 3O16A 2V2DA 1TV8A 4NNBA 3EWUA 3QYQA 3C2RA 3IV3A 4GJ1A 1VGAA 3L67A 3PB2A 5CZJA 3DFPA 3SJ3A 1YDNA 4BR1A 3IIPA 1EP1A 1WDWA 4NJJA 2QKFA 3ABOA 3W7IA 1PL9A 5BMWA 5DCDA 1R2RA 4BI7A 2QCCA 3QSRA 3ZR4A 4O0ZA 4NNCA 3WJSA 3QZEA 2H8XA 4P2VA 5K2ZA 5CZSA 4XBSA 2YR1A 1W8SA 3QW3A 4JYEA 1SFJA 1P0KA 4UNLA 2NUWA 1FCBA 4LV4A 2QF7A 1OX5A 2OT0A 4QNWA 1FQ0A 3L21A 4GUFA 4M19A 4TMBA 3P84A 5F2GA 4FX8A 4O1DA 3HPXA 4UFLA 1LM1A 1F76A 3FEMA 2OT1A 3PBYA 4JX5A 1ZHAA 2E6DA 5DXYA 3MHFA 2E68A 2HS8A 2ZA2A 1M7PA 2I9EA 3MP3A 5FF0A 2WSYA 4HNTA 2RKXA 1LP6A 3G1YA 2WOQA 3W74A 3S6DA 2ZRZA 1TO3A 5G1TA 3WK3A 3BPWA 3QEZA 2E1DA 4NXSA 4UFMA 3NQGA 4EF9A 2C19A 2ZRXA 3NM1A 1OFEA 1AW5A 4KFPA 1TMHA 2NX9A 3NNTA 3L2IA 1DHPA 2WJZA 1KTBA 1XBYA 3LHUA 1NEYA 2J27A 4TX9A 4HPXA 4M5PA 4Y9AA 3HMJG 1M7OA 4OU1A 1WX0A 4JYDA 1OX4B 3UXDA 3W1NA 3W71A 2V2CA 3BLEA 2VFFA 3C2FA 2YZRA 4LVGA 2C6QA 1SW0A 1AG1O 4PEKA 4NZFA 1OK6A 1QWGA 3MJYA 4HPJA 3D0CA 4U28A 3MHUA 4UFJA 4QSHA 4IMGA 3DFQA 3KFTA 2A7RA 2VXNA 1KLYA 3FYOA 4O13A 2VENA 1EWDA 3MBFA 3W7EA 1RV8A 3N73A 5G2HA 3SGUA 4Z1BA 4CLMA 3TAKA 2E5DA 1VRDA 2X1UA 2BX7A 5LKYA 5SWUA 4MJZA 5F2LA 4DEFA 2ZA1A 4EVZA 5F1UA 2ABAA 2FLIA 5EY5A 1BEUA 1KTNA 1TTIA 5FEPA 3M0ZA 2ZZ5A 1QR7A 2CW6A 1B4KA 2QAPA 3HG2A 3TW7A 1DVJA 1GG1A 3S5ZA 3W2NA 4A2RA 3G22A 3TJLA 3C0JA 4W9TA 4JIQA 3VKJA 3G1AA 3UWZA 4TIMA 3W2KA 3W7OA 3HGJA 2QUUA 4K7YA 1H7PA 5KSWA 3T40A 3W7LA 3MI6A 5AHMA 4FNUA 5AB3A 1RQBA 3TSMA 1JR1A 5LHEA 3N9SA 4RZ4A 1OFBA 1Q3NA 4I7UA 3W73A 4H4IA 3KVKA 2AGKA 3NQ2A 1ALDA 4NZJA 2CLHA 1TPC1 1OX6A 3CLMA 5I3JA 1PVNA 4ZQOA 2WNQA 2OJPA 2C15A 1MO0A 2A7NA 4E2BA 1G4EA 5LGXA 2EKCA 4UTMA 3KRZA 3EKLA 1SW7A 4JTLA 3B4UA 4CNNA 4WZHA 4DF2A 4C1LA 2ZBTA 4Z0SA 4K6AA 1BWLA 2QUVA 3W75A 4IXHA 4O10A 5HWMA 4UUIA 5CSRA 3G3MA 3RFAA 2E77A 3EX3A 3G0UA 2ZZ3A 4GFSA 4XUGA 2P10A 3EXTA 1T96A 5EYWA 1W3IA 1VC4A 4O18A 3O8AA 3KOFA 4JNMA 4FF7A 4N9DA 1EA0A 3VCRA 4JX4A 1DJNA 1RZMA 5EPDA 2VEPA 2NX1A 4UC5A 3W7PA 1B3OA 5HUOA 5D2YA 4R33A 3B0VC 4KWVA 3NDOA 5DELA 2B7OA 1Q6RA 3EB2A 2QEZA 5F2MA 4UTIA 4IMDA 1F05A 4NJHA 1S5WA 1K8XA 4PTNA 2ZTKA 1IIHA 5AFDA 4NNAA 2W0UA 4UTLA 3ZFHA 3CIXA 2CZDA 1QAPA 3S5NA 1H51A 3UNDA 3EX1A 1SO6A 4IQLA 1GEQA 1DKWA 4ZQMA 5HNRA 1G67A 2DZSA 3B06A 1HUVA 4HSOA 4IGHA 3W1PA 5AHFA 1BTMA 1GVOA 4AHOA 5LNVA 1W5PA 2DZTA 2ZZ4A 3S1XA 3LXCA 2VEIA 5CZTA 2E6YA 2I1OA 3RLUA 3W1UA 3W6YA 2FDSA 3P74A 1XDMA 5KZDA 1L6YA 2A1YA 1JVNA 2GUUA 1OJXA 2TYSA 3TFXA 5E1QA 5EA9A 4FNPA 2YCEA 4AWTA 4LV9A 1XBZA 4LVFA 3HQ1A 1H50A 3H54A 2NXHA 1A5AA 2NXGA 3HPSA 1N55A 3NL6A 3Q2DA 3P5YA 3EX2A 3THQA 3MYPA 1L2UA 1Q45A 1ZENA 3BGGA 4CCCA 4MFDA 3LLDA 2F7FA 2Y70A 3C2OA 5FF4A 1LTDA 5D2TA 3PBVA 1YPFA 1O95A 1QNVA 2V81A 5G2IA 1TPDA 5HWJA 1BKSA 3MHGA 3AO0A 3IVSA 3P61A 2QDHA 4NVTA 5DN1A 1NFBA 2YXGA 1DV7A 1LBLA 3IEBA 4UTTA 3BG9A 1LOQA 4Y96A 1W56A 3GZ3A 3KVMA 3W7JA 4GNJA 3EEGA 3PWAA 4OWGA 3P82A 4GUIA 3WJWA 3W7CA 4POCA 3LTSA 3RF9A 2H6RA 3W84A 4ORMA 4ADTA 2QR6A 5J5RA 3LB0A 1XI3A 2C14A 3WFAA 4E0CA 3M5VA 2Z1BA 3HOJA 4Z0JA 1YLVA 3N34A 4JD4A 4LS0A 4X3ZA 3W07A 4AWUA 2JKPA 4ZVJA 3VE7A 2Y85A 3PG9A 5FF3A 4QQ3A 4P61A 1VZWA 2Z0IA 1XBXA 5MHBA 2A7PA 1VR6A 3DZ1A 1QPRA 3RU6A 4JX6A 4WUIA 3PUOA 1KV8A 3EKZA 3A5VA 4PL2A 4WQ6A 1L9WA 4K8HA 1LDCA 3CTLA 4ICNA 4Q4KA 1ZJIA 2I14A 3TH6A 3M43A 2C13A 2QCGA 4MY9A 2GOUA 5FESA 4PL1A 4N9BA 4UFHA 4M7TA 3S1VA 2ZZ6A 3ANYA 4LNYA 4X22A 1W3NA 3L0GA 1F74A 2O7SA 4ZZ9A 4HIBA 3TA6A 1Z42A 4JIPA 3CPRA 1R2TA 2FTPA 2QJIA 3G24A 3TXZA 1EP2A 1CW2A 7TIMA 5C6MA 2FPTA 5I3GA 3UWYA 1T0OA 2VELA 3B05A 4A29A 3L5LA 4MPQA 1VCGA 1YYAA 1TRDA 1EEPA 3UZJA 1QPOA 2A6NA 4NUWA 3L66A 3QM3A 2V8ZA 4JYFA 1I2QA 3NQCA 1DBTA 2YFNA 3MBDA 4Y6GA 3PUDA 3G0SA 2FQIA 2F84A 2JKEA 4O53A 3IIVA 4JTEA 4DO4A 3BW4A 2FJKA 3MWAA 2JGQA 3T78A 3PSWA 3C6CA 3NZRA 5DXXA 1ZAIA 4GBUA 2R8WA 1LRNA 4IMEA 3E9AA 3C2VA 2V5LA 3GDKA 4JXCA 4O12A 3S5YA 1IXNA 3OEXA 3TX9A 1PHWA 3CQ0A 1OFPA 1F2JA 1TPWA 2JKAA 4PCFA 1W1ZA 1YTDA 1H7NA 1A50A 1FDJA 3LX9A 1V7YA 3IGXA 4AAJA 1H61A 1WV2A 1CX9A 1R46A 4A3UA 4ZQPA 3JS3A 4QIUA 1JQXA 5H2ZA 3N9RA 4FEZA 5D32A 2GVLA 3W1XA 2G95A 5AYYA 2R91A 3PM6A 1MXSA 1YDVA 5K4ZA 4ZL1A 5CSSA 1GG0A 1OYAA 3ATZA 1JCJA 1KM1A 3NPVA 5EL1A 1TPUA 2NLIA 2H90A 1WBHA 1RPXA 3LOTA 1VYPX 5F4WA 1QDSA 3O15A 3GXTA 1FWTA 1KFEA 1FDYA 2GQ8A 4O54A 1G7VA 3LHWA 3TQVA 3G0XA 2DZUA 4N9CA 4O11A 1OABA 5U7SA 3NYZA 5HJLA 2ATSA 4CNOA 2C1HA 4O28A 1I2NA 3WJXA 4RXFA 1QPQA 3IGUA 1VJIA 3N3MA 4Z1DA 3EWXA 2NX3A 1KFBA 3A9IA 3OVRA 3N14A 2VFIA 1AL7A 3N19B 4K38A 3TFCA 4UTTC 3JRKA 4R34A 3DHDA 4N02A 3JR2A 3STEA 1KTCA 3UD6A 3WJYA 1GOXA 4BK9A 4I7WA 4N6FA 4UTWC 3HF3A 1X6UA 1OG0A 1G4TA 5AHIA 1N7KA 3PBWA 2WKJA 1JCYA 3CU2A 3EWYA 3MYOA 1NF7A 4Z1CA 3G3DA 3Q94A 3GR7A 3QQ1A 3W23A 4M6PA 4AWSA 3DGRA 5KINA 4GC4A 1LLWA 1LOSA 1X7FA 3LHVA 3O6YX 3QPYA 2OZ0A 4DELA 1AMKA
chains in the Genus database with same CATH superfamily
4U4MA 1M53A 4LNCA 2PZ0A 1L2QA 4Z2GA 4AZIA 1J9YA 2FZNA 2Z26A 1NP2A 3DX5A 2IUZA 4RE3A 3SIZA 4D2JA 4TMCA 4CUCA 2RGLA 4BF5A 4KRZA 4CQ8A 2QJGA 1R3WA 3QF0A 3QQWA 4QE4A 2Z1SA 4B90A 3VOHA 1DWGM 5BOEA 2WB5A 5HNNA 4GXPA 1I1XA 4DZAA 2WANA 2E8ZA 2J88A 3AHTA 2J9YA 2ZUWA 3KWXA 3M47A 1OK4A 2NQHA 1G5AA 5HA7A 1J4EA 1OFAA 3NGJA 3UG5A 5HR6A 4FLOA 5HJXA 4CKQA 3SCVA 2CHRA 1TTPA 4PFHA 3UVAA 3GK0A 3NQDA 4XG1A 4FPSA 5I24A 2ZC8A 1F73A 1JUEA 5AHNA 2Z25A 4MZ1A 1O7AA 5CSUA 1N8IA 1EPXA 2Y8VA 4BY3A 3WD1A 2QW5A 3W7GA 3MO4A 4XD6A 6TIMA 1TTQA 3KTSA 5EMUA 1O5KA 3UY7A 1XIEA 3T7VA 2D0FA 2J6XA 4ZO7A 1G01A 2BY2A 3QFEA 4CCEA 2PDMA 3EX6A 1WXYA 1A5UA 4X61A 4B92A 1O68A 3VCCA 3B4YA 4DWSC 3N18A 3A24A 1X1OA 4IL0A 5JIPA 1MDLA 4HYVA 5EBUA 2X30A 4PR4A 4F66A 1ITXA 3GAKA 5AHLA 2PGFA 5A8QA 2PGRA 2PWFA 1F61A 4YWSA 4AZCB 4QTGA 3Q37A 3G6MA 3VGEA 3UWUA 3ZMRA 3WLRA 2CZEA 3CZKA 3SJNA 3COTA 4C5YA 2P8CA 3WMBA 4P5UA 4A4AA 8RUCA 4QP0A 1PPIA 4IIHA 5AN7A 1XLEA 3ABSA 2SFPA 1K8ZA 2WVTA 1UQZA 1KM0A 5DT7A 3G1FA 1JUBA 2Y4SA 2P76A 2CITA 4MDOA 3LPGA 1NTHA 3NGFA 4AFYA 3F4WA 3BW3A 2J9ZA 4GRSA 5I79A 2A21A 1E40A 3LMZA 2VEGA 4IP7A 4RDVA 4Y90A 3V1HA 1IEVA 5C8BB 4P8VA 3R13A 2RHGA 4N6EA 3DFOA 5D38A 5U4NA 4IPIA 3C8FA 1Q7ZA 4DRSA 1Z8AA 3OB8A 3R89A 3CQHA 2A5HA 2OSWA 3VNYA 1MEIA 3W72A 3DBPA 4AC1X 2OGYA 1PB0A 3WMSA 1QOXA 3HPFA 5LGZA 3OHMB 3PR2A 3PTQA 3GXIA 1HXJA 4AHQA 3ZLFA 2BXZA 4OTKA 4BF7A 1DWJM 2IPGA 4L9YA 3UZ5A 1GOWA 1GKPA 2GJNA 3EDEA 5E6ZA 4LB3A 3E74A 5DBUA 4AY8A 3LHTA 1HKJA 4LBRA 3W76A 2BY0A 5BYWA 3AZTA 1HKWA 1EJUC 1EXBA 2WLZA 1VFOA 1M5WA 1HZYA 3WL0A 1RUSA 4WX2A 5J5DA 3E02A 1ESWA 1MUMA 1FOBA 4ECLA 4JTFA 4K39A 3HG3A 5IBXC 3CAKA 2VDGA 4LUSB 3SQSA 3OLGA 4Z2JA 1MUWA 4XKYA 4R53A 4UNIA 2GYIA 4OECA 2FPVA 4HA4A 2BHUA 3VINA 3ITXA 3CQJA 2Y8UA 4LALA 2Q6ZA 3LV5A 1M3UA 5A8NA 3MSYA 2W9MA 1A3WA 3SI9A 5DLCA 3AYVA 4FB7A 3ZXWA 1YE4A 1PWMA 4FIQA 2HVMA 4IPPA 2DFAA 3CEUA 3TJIA 3W7RA 4FK9A 3AIRA 5T26A 5KZMA 1W54A 3T0CA 3PZUA 5HINA 3EXSA 4DF1A 3ES7A 1SM9A 1YTEA 5FEWA 1IIGA 1QHPA 5FSDC 4YTSA 1V6XA 2X40A 2XIJA 1ISXA 1R47A 4NX0A 3SCSA 3GNNA 2W92A 3Q65A 2W6RA 4NG3A 3STFA 3A5FA 4DQWA 4AD4A 1JCTA 4GINA 4UZSA 1S38A 4RV8A 3WD4A 6PTDA 2RDTA 5ABGA 4DO7A 4BI5A 1Q7MA 3MUZ1 4C6OA 3GLCA 2IPJA 2YIHA 3RMJA 4CNTA 2ZXAA 3B0PA 4IX0A 4AZ6A 5M5DA 2V69A 1S46A 2PF0A 5HMFA 1ZTVA 3CBWA 3UWVA 3EOOA 1PIGA 4ZQRA 3UJRA 3DI1A 4P7QA 3CIVA 1OYBA 3DIPA 1JPKA 2NVCA 4GY0A 2OO6A 5IFPA 3DFSA 1KFLA 1N2VA 1OY0A 2GQ9A 4O50A 2VHLA 1VBUA 1AH4A 3GTXA 2Z7KA 1I8JA 3EX4A 2PF8A 4R3UA 1FWFC 4O1AA 1TX2A 1AZ2A 3ZO9A 1E4LA 1O5RA 3B8VA 4XIMA 4XUYA 4F9DA 1HJWA 4OBRA 3C5QA 3N3TA 1U83A 5C0QA 2QUNA 1LL4A 1LCOA 3B04A 3SUWA 1ICPA 3LRMA 1XF0A 1Q66A 5DEZA 4MWAB 4HU8A 1CB2A 3HV8A 4R7WA 3PF3A 3WDQA 1MNSA 4C6CA 3LBMA 2V3GA 5IBXA 4B5WA 3HGRA 5CEWA 5D30A 2ZYFA 2Q3OA 3AI0A 4KKXA 3W1AA 3BANA 2R1KA 4M6UA 3ABZA 4C7DA 2TPSA 3CHCA 4QE5A 2NWRA 4UMBA 2D73A 3LHYA 3CK5A 1GVIA 2GJRA 4CQAA 1HKIA 4WOZA 1AVAA 1FWAC 2B7PA 4LBSA 1W9VA 1XYFA 3P60A 2BGNE 2PP0A 4ADUA 4OVXA 1CXIA 3EMCA 3WF1A 4EX4A 3LPFA 2V5CA 3VNIA 3JZEA 3J7HA 3BL3A 3VCNA 4V1XA 4AD2A 4A2SA 4AHPA 2GDVA 3SGZA 2VX5A 1RK6A 4Q7BA 5M17A 3NL2A 3UF9A 3SECA 1VEPA 4JFTA 1KXQA 2J77A 3VOFA 2VO5A 2OCZA 3PZNA 5JIWA 1OC6A 3KTXA 1W3HA 4CD4A 1Q6EA 3P3BA 3TKFA 4JTCA 4DWDA 3PNUA 1DJQA 4D71A 2R14A 4AEOA 3W1RA 2X1SA 4DJED 3WEZA 3BLDA 4PSRA 1ZLPA 4FXSA 3TMLA 1KC7A 4HHPA 5I00A 1XGDA 4G7EB 5GVJA 3PC0A 4NILA 1SSGA 4O17A 4NZ4A 3OVQA 5K9XA 4GIYA 4IG2A 3TW6A 1LUCB 4XIAA 3PUEA 4JQ2A 2WSPA 3H2OA 1YXDA 3W1MA 4C6MA 3LYEA 5F4XA 5C2CA 2G3JA 4JIIX 3HO8A 4LY8A 3WH9A 1TQJA 3A4AA 4W7VA 3KXQA 4O52A 3QC3A 4UR8A 3AMGA 3P14A 3DHPA 3JZUA 1VJSA 4S3KA 1MQPA 4HYWA 1RP8A 2CLOA 4HOZA 5HDRA 2YCLA 1GZJA 2ZUUA 5F4SA 3WQGA 3KRSA 3LCGA 1W1TA 4DI9A 1QW8A 2BSLA 4H3DA 3NQFA 1JULA 4C90A 2PDBA 1CTNA 4KT2A 3U6WA 2BMBA 1EDTA 2DORA 2DH2A 4GCXA 3PB0A 3KRUA 3LY0A 1ZCCA 3M07A 3T0DA 3B3DA 3BLIA 1RK5A 2DIKA 3VX0A 4I7VA 1KCLA 3N29A 3N6QA 4HNUA 4LUTB 3O7UA 4C6KA 2RJHA 3OYZA 4R27A 4YVPA 3QH2A 3HGSA 3GG0A 4QBXA 3MT1A 1XFBA 3UGRA 1JCLA 2OGJA 4MUPA 4XAZA 1GOQA 4AVNA 3BCDA 4GVGA 3WLHA 3UG4A 4V2XA 2BWGA 3T55A 2RUSA 4YWIA 3NVTA 1GYMA 1XIJA 1QO2A 1W17A 3UR8A 3O6CA 3DI0A 3VOCA 3ONCA 1S2UA 1UMYA 4I6VA 3ZOAA 4UTJA 1V08A 4Q8OA 2YL9A 2WM1A 3PBGA 3QKEA 2Y8KA 1KRMA 1MZHA 2RDXA 3A4WA 1M1BA 3FK4A 5CC3A 5GNZA 2A2IA 4N2YA 5BRBA 1AZ1A 3UJSA 1MNZA 4NAFA 2GSJA 1YPIA 3H2MA 3ARUA 4ERAA 1AH0A 3E0LA 1VB9A 4NX5A 2PTYA 1DP0A 1H60A 4Z1AA 2AL2A 1XIGA 3DG3A 4CVUA 2X1TA 1VD6A 1QW9A 4DPQA 3NDYA 3P93A 1B3VA 4XVEA 3RDKA 1J2BA 5CJMA 4REQA 4W7WA 3R58A 3E2VA 2V82A 1V51A 5FF2A 4GBDA 4L61A 5HK4A 4M29A 2V9DA 3WEMA 4O14A 2P1FA 3PWIA 1UCWA 3MKVA 4D1JA 4RW5A 4GJIA 1VBHA 2BNJA 1BXBA 3EEZA 2PFHA 2FMOA 2VFDA 1FP9A 4DXVA 4W5UA 5IDZA 2CIPA 3MQTA 1NQKA 3IJIA 5A94A 1TPVA 4F3HA 3QXBA 3UZZA 1G9HA 2PDUA 4GX8A 2Y7GA 3U7VA 2C0HA 1T40A 4MSSA 2CWNA 4W8LA 3WDRA 1P1MA 3W7KA 4GCAA 3KZSA 1K7XA 3WK2A 5E6YA 3XINA 4JHMA 2BXVA 3AQUA 3PVFA 3BGJA 2ZCGA 1PE1A 1H1YA 3RM9A 3C3UA 3CHDA 3URAA 3BVJA 1U22A 5EB8A 1NIUA 2PWUA 3A4JA 2GJXB 1ONXA 1CYGA 3FEQA 2V30A 1XICA 2OTDA 4H6KA 3PZMA 4IT1A 3AIUA 1GVQA 1GTEA 4HD5A 1V6YA 5CPLA 3ORWA 1OCNA 6A3HA 3QJAA 3LQLA 2PGEA 3FCPA 4HU4A 4BHYA 3F5LA 3EPNA 2G3MA 1RR2A 3BCJA 3M5ZA 3T0BA 4I9TA 5A6SA 3RM4A 1R7OA 4IJCA 3RYSA 1DIDA 2E0PA 4UFIA 2ISSA 3AJXA 3H4GA 1LRQA 1RJRA 2XTKA 1AK5A 2J78A 2ZUMA 3GDRA 1NH6A 4YCPA 1JZ6A 4LANA 3EYPA 1QVBA 4FHAA 1LJYA 3MP4A 1UUOA 3INPA 4HGXA 1ZQ5A 5HATA 2PC4A 2AQWA 1XUZA 3LXAA 2KZHA 3VK5A 1JXKA 4JDYA 1HKMA 2E9LA 2V38A 1MDRA 1MUCA 3F4DA 4DZHA 1K9EA 5BWFA 2I5IA 4PTXA 2FMNA 3EWDA 1WZLA 3W87A 3ABXA 3SY1A 1YW1A 2A3EA 4XO6A 3EDKA 1IGSA 2OEJA 4I5UA 3B8DA 2HISA 1G4PA 3AHZA 4IPNB 2PDQA 1H0IA 3WLJA 3F2DA 4JAWA 3ELFA 1CCWB 3NSXA 1TPH1 2Q8LA 1EJSC 4YU1A 3BOFA 1RVGA 1XSJA 3BSHA 1TV3A 2H9AA 1HN1A 4MJMA 4PODA 3EDFA 3L7RA 5A3HA 4NJGA 3SDOA 1TIMA 4NAEA 4GO8A 4QCEA 1FHUA 5E9AA 4TQTA 3TN4A 5D37A 1XSIA 2ZRVA 2VDIA 4NRRA 1ISWA 1ZSXA 4TR9A 2GWNA 4HMEA 1QI3A 3GQYA 3DECA 4GZJA 3HJZA 3TYAA 1Q65A 1PZ3A 2V68A 1KV5A 3N6HA 1E9ZB 4DUOA 4PTVA 1QW7A 1KXHA 3DFTA 2CLKA 1X1ZA 3M44A 2VQUA 1Q2RA 2GK1B 3PG8A 4UTWA 4PUKA 1XGZA 4E2DA 2Q02A 3GE7A 2YB1A 2XFFA 3QGKC 2ZRWA 1VLIA 2IPWA 1PKMA 1VAHA 1BG9A 4RK8A 3W86A 1XG4A 2DDXA 5I78A 1K02A 3I6TA 4QQUA 4L1WA 1NDZA 2R1NA 4R7JA 3OBAA 3G18A 3EWBX 3K4AA 5D2WA 3FJLA 4WK9A 3NPUA 3S0CA 1E0XA 2YFOA 3APTA 3AXKA 4RXGA 3EWZA 3EBVA 3QR3A 4AD0A 3W01A 3AU6A 5L9FA 3REQA 1AQHA 3FLUA 4JIEA 4XVDA 1F3WA 3VDAA 5FD0A 3TYZA 4ZB2A 4PBFA 3C4UA 2ZZ7A 4HP5A 2YZ5A 2XN1A 3FAWA 3VUPA 4S2BA 2PI6A 2C18A 4PC8A 1DIOA 2E4TA 1RXOB 2D24A 3A9BA 1OYCA 1CXHA 4JDBA 2CLFA 2XVPA 3UGVA 1HL8A 2D2HA 3GDLA 4O19A 1ZBCA 1OADA 3BLKA 3VFCA 2R1PA 1QOQA 3W7HA 3CQIA 2WZEA 4W5ZA 2XM2A 4OBSA 2VVNA 3TA9A 1U5JA 2PZNA 4FR6A 2ZDSA 3B8UA 1E9YB 1QOPA 1ZBKA 4HN8A 5LYRA 2HE8A 5RUBA 1R86A 7A3HA 1VFFA 3MI2A 4JQAA 4WIWA 3T2PA 3GR8A 2GUYA 4WJEA 2OU4A 3KVJA 2XVKA 3R0UA 1BTCA 3AISA 3ITCA 2YSWA 4UQBA 2NWSA 3M5XA 2I16A 3LZ5A 2DZWA 1SSDA 4JQ1A 1W5OA 4W87A 1WYIA 1VEMA 4AH7A 4B16A 4ZO9A 2G41A 3GDBA 5G4WA 4QJ5B 3EA1A 3EWUA 2CKRA 3HZ3A 2CKSA 5CZJA 3PB2A 4O1FA 3ABOA 3B8TA 5MKGB 5DCDA 3EB4A 2WHKA 3QSRA 3HM7A 4LYRA 1A3XA 3WJSA 4G7EA 3UYIA 3F4CA 4Y9MA 4E4UA 4PRRA 4UNLA 2NUWA 3GFXA 4WCJA 2QF7A 2OT0A 5GJNA 3WBXA 1XIMA 3L21A 1CLXA 3QR0A 3FHQA 3VGGA 3HPXA 2F6XA 3WCZA 1LM1A 4RNJA 2OT1A 3PBYA 4JX5A 2POZA 1KGXA 2ZA2A 3MP3A 3TW9A 5FF0A 2RKXA 2QXWA 3G1YA 4MADA 3S6DA 3VKCA 4Z1YA 5A6MA 4HZ8A 4B2DD 1A0DA 2XH0A 2WBGA 4UFMA 4KQNA 2C19A 3S1GA 1OFEA 4KFPA 2NX9A 3NNTA 2WJZA 1FVPA 1KTBA 1AJZA 1XBYA 1M65A 1CEOA 4FOJA 1GQIA 1V6UA 1Q6FA 3HU7A 2E25A 2R1MA 4LVGA 2ZVIA 2D2GA 1P48A 1OBAA 4O8AA 2F2HA 3VDHA 4H9ZA 1QWGA 4G6CA 5LIKX 4HPJA 4UFJA 2CWXA 4QSHA 3RO6A 4IMGA 3DFQA 3KFTA 2A7RA 3OZYA 1B3WA 3H4XA 3SUUA 4HNCA 2BS9A 3MBFA 3UEQA 4GD0A 1OINA 1WZAA 3N73A 5G2HA 3VMNA 5FJPA 4DYEA 2FHBA 5SWUA 5FL1A 2DZAA 4TTUA 1UQYA 4EVZA 3EAUA 2CEQA 4H9VA 1CXFA 3QFWA 1B4KA 3TW7A 3HG2A 1DVJA 3CH9A 3U4FA 4A2RA 4JIQA 3G1AA 4I9JA 3UWZA 3VOIA 4OIFA 1TWSA 2QUUA 1H7PA 5C2GA 4FNUA 1RQBA 5LHEA 1PZ1A 1UD2A 3ICJA 1A0EA 4MDPA 7CGTA 3TN3A 2Y5EA 1Q3NA 3W73A 2AGKA 3ITOA 3VABA 1OZMA 1QRQA 4AZHA 4ZQOA 2C15A 2WJEA 1QI5A 1G4EA 1NQ6A 4UTMA 5CGMA 4MB5A 3EKLA 1SW7A 4WZHA 3GU2A 2HCVA 3NXLA 4NZ3A 4K6AA 4Z0SA 3CAQA 1V3HA 3M46A 1KRAC 3G3MA 3NO3A 3G0UA 3WBWA 1ADSA 1QBAA 3NOYA 2QULA 5EYWA 4HZMA 2OLSA 2CNCA 4FF7A 1FH8A 2WJDA 3AALA 1D3CA 3BAJA 2FZ9A 3KDOA 3VM7A 2EKGA 4L4PA 3F5KA 4UC5A 1B3OA 5HUOA 4NI8A 5D2YA 4DHGA 3WD3A 1J18A 4L1GA 3B0VC 4KWVA 2ZX6A 1KGWA 1M7XA 1FWHC 2HBXA 2B7OA 1JYNA 1Q6RA 3PZGA 3E6EA 2QEZA 3EB2A 4S38A 4NJHA 1K8XA 2OX4A 4IFOA 1F6YA 5REQA 1EC8A 2ZTKA 1NELA 1IT8A 4S23A 2J8GA 4NNAA 1UWTA 5C9RA 1OWQA 4IQLA 3GO2A 1W1YA 4ZQMA 2C71A 4U31A 3AU2A 2INFA 4W85A 5LNVA 1W5PA 2DZTA 2ZZ4A 3TC3A 3BOLA 5GPRA 1YNQA 3D5HA 4J3ZA 2A1YA 2G0WA 2YLLA 1Z32X 1OJXA 3KOXA 3FVMA 4MB4A 5EA9A 2YCEA 2GJXA 4AIEA 3AWNA 1A5AA 1BRLA 3CPGA 1KRBC 4CU6A 5D8ZA 1RJQA 2RJGA 1REQB 3Q2DA 2X7WA 3G2GA 4XD3A 3THQA 2QLYA 1L2UA 1Q45A 5C9UA 3TNBA 4MFDA 3LLDA 3V18A 1KCKA 3C2OA 3F2CA 2XUCA 1UH2A 1O95A 5G2IA 1TPDA 2QDDA 3UBPC 2PDXA 1LBLA 3IEBA 4UTTA 1H41A 1KCZA 3KL0A 3KVMA 4GYFA 3P82A 1IWPA 4GUIA 1Z69A 2YB4A 2NV9A 1EHNA 3ZVIA 3ALGA 3LTSA 4ZEPA 1EQPA 3A4XA 2BHZA 2I57A 2H6RA 4PMDA 4ORMA 1VBGA 2QR6A 4ZTYA 3UA4A 4I9MA 3WQOA 4NKCA 5BROA 1QHOA 2C14A 4R9OA 1RVKA 4E0CA 1I9CB 2Z1BA 3HOJA 5T9CE 3N34A 4JD4A 4X3ZA 4ZVJA 3PG9A 1J93A 1JPDX 2VR2A 3MCMA 3GD6A 1QK0A 5BXTA 3N9KA 4HMDA 4QQ3A 1VZWA 1TWZA 1BD0A 5D8WA 3MMWA 4H8NA 3RU6A 4JX6A 4WUIA 3MSDA 2OYLA 1KV8A 4CN4A 3A5VA 4PL2A 3WQVA 2BGSA 2C91A 3L4VA 1QNSA 4NSBA 2I14A 3M43A 3PJWA 2QCGA 4XZHA 5BXRA 4XSMA 4PL1A 2QHAA 2XISA 1XLMA 1B54A 2BOGX 3UP8A 3OO2A 3R8GA 4K1WA 3ANYA 2DSKA 4X22A 1RH9A 3L0GA 2BXYA 2R82A 4ZZ9A 3GXFA 3TA6A 3CPRA 3G24A 3TXZA 4RNHA 2WKGA 2FPTA 1T0OA 1H5VA 2J7HA 3ZR5A 4ICMA 1YYAA 3WQEA 4CCZA 1EEPA 5A6KA 3BURA 4S3GA 1I2QA 3AFBA 3ITVA 5CPTA 4NZ1A 3PZQA 2QT3A 2YL5A 2CBIA 2PTZA 4O53A 2FJKA 1F8IA 3MWAA 3CL8A 1NP0A 3T78A 5DMNA 4HU3A 3C6CA 4AX6A 3IANA 1ZUAX 4PB4A 1MXDA 4WSHA 3CQKA 3C2VA 5HAOA 3GDKA 2GVEA 4F0HA 5FOOA 3VO0A 1Y5WA 1GHRA 3WNOA 4E4FA 5AECA 1W1ZA 1XINA 4ZODA 1H7NA 1L0PA 1V7YA 1H49A 3WUFA 3IGXA 5JU6A 1WV2A 1J6OA 1R46A 2WK2A 1UWQA 1JQXA 5IFTA 3DOPA 4TTGA 2G95A 2FKPA 3OGSA 2YBUA 3PM6A 1FWIC 3WLMA 3WQ5A 1ZP3A 1DJIA 4ZOBA 3E3HA 3S3GA 1TPUA 2NLIA 1WBHA 2DVUA 5ECUA 1TZ9A 3KOWA 4F79A 4QEEA 1V8EA 1NARA 4B5VA 1M68A 4YTRA 3K8LA 1J6PA 3LHWA 3TQVA 2P5NA 4N9CA 3QYSA 3QZAA 1DJYA 3OU8A 3CMJA 4CNOA 3H21A 1O1HA 3A13A 2C1HA 1HGWA 4PZVA 1I2NA 4E2OA 1R9XA 3GU9A 1QI4A 5EBAA 5HMEA 2NQJA 3EWXA 2NX3A 4PMNA 3A9IA 1BQCA 2CBUA 3E5PA 4J3XA 4NL1A 1ITCA 5JBDA 3JRKA 3O0FA 4R34A 2ZICA 3T05A 2PDLA 4N02A 3JR2A 1B31A 3WLNA 2EPNA 3GS6A 4I7WA 4BK9A 4UTWC 2BB0A 1X6UA 3WBAA 3GH4A 1L8NA 5AHIA 3PBWA 4B3ZA 1JZ2A 1IWBA 1W9PA 1TWIA 3G3DA 3LGDA 5CC6A 4AWSA 1P6WA 1J0IA 1EJTC 3F7JA 2PWGA 3EMQA 1X7FA 3O6YX 3QPYA 5T9BG 3SQMA 1J96A 2GOKA 3HTWA 3CZJA 2E09A 3A6OA 3CT7A 3RX2A 3PTKA 1XD1A 4PMUA 1HP5A 4QSFA 1IXOA 1Q7QA 5CPNA 1S2TA 3LI1A 3W7NA 2J13A 4KEMA 1LORA 2YX0A 2YDSA 2Z1VA 4MY8A 5CQ1A 5A2CA 4YLWA 4AX7A 1GVYA 4YHGA 3NEVA 3T4CA 2QUMA 4GUGA 4HA3A 3NPXA 3P2VA 1OF8A 4AWEA 1WOBA 2LLEA 2VC7A 2VWSA 2WHMA 2NT0A 2QCEA 2GVYA 4HA1A 3TLLA 4E8GA 3SFKA 1NFGA 1CECA 2FIQA 2WZHA 4ZOEA 3M0IA 3VAVA 2C7FA 2XGIA 4H8VA 3CUGA 4FXFA 1ENUA 3K8MA 2R9RA 4K37A 1XLBA 3B9AA 1QT1A 3U2OA 1RBAA 2XYLA 3BICA 2V3EA 5BXPA 2W62A 4AZBA 1EPVA 3PJTA 3W1LA 5FIPA 3M41A 4HPGA 5FJJA 3SUTA 1IZJA 3SCRA 5B80A 1QATA 2DJXA 3CL7A 3VI2A 2CLMA 2QCHA 2Q3RA 5I3HA 3OW1A 4GGHA 1K6AA 4YIWA 1VPYA 1HO1A 4S3EA 3WKZA 4DIAA 3FFSA 1X98A 2HBVA 1AW1A 2O9PA 1H7XA 1A5SA 5D4YA 2V5KA 4DJDD 5F1VA 3H6OA 1ICSA 5DF0A 2QQ6A 4M6QA 5G4EA 4H8HA 3I4EA 5XIAA 1QHZA 1RHCA 3UWWA 1SUXA 3UR5A 1PIFA 3PS7A 4NAEB 4Q8QA 1KB3A 1WZKA 3GZAA 5ABHA 5JMUA 1FCUA 2OB3A 1R3RA 3CXOA 2I9UA 1XM3A 2VKZG 1PBGA 5DANA 3L0KA 4E8DA 3T09A 3CO4A 3OP2A 3R0KA 3K2GA 3P6LA 1Z6KA 3WQ8A 1E1EA 1EJ7L 1J5TA 1CGTA 3KE0A 3KX6A 4F48A 3GAYA 2CHOA 4OQVA 4S3BA 3GDTA 3BG5A 3WF4A 1ZNNA 3TJ4A 1SMDA 3LRLA 3K1GA 4IP5A 4HNOA 3S5OA 1HIZA 3OQ8A 4JCMA 3TU9A 2OOGA 3NCOA 3AMDA 4C6PA 4QISA 2NLYA 3MA8A 4O4VA 3TONA 4G56A 1KBJA 2XG9A 1Q8AA 3AHXA 4IFKA 3UXLA 1MMFA 4YJ5A 3FYYA 3PNZA 2ALDA 4HVXA 1UR8A 3O05A 4PMQA 3AUJA 2Y7FA 1EFZA 3IRDA 4X63A 4BA0A 4RX0A 1W0MA 4MNKA 4CQCA 3BAWA 4HCHA 2X09A 1A5CA 1LRTA 3TTQA 2EPHA 3AZRA 2J74A 4B3LA 1YQ2A 1YNPA 5BRPA 3VYLA 5AZ1A 2FZMA 4LUSA 3VIHA 4CCDA 5AVHA 2B7QA 1C3FA 1OEPA 3GTHA 1H1NA 3P67A 3KS6A 2FYMA 2GGJA 4MYXA 4H1ZA 4W88A 3HG4A 2NSOA 4DJFD 2WMGA 1SZNA 1ZL1A 1O94A 4PBEA 2ABBA 5AC8A 4DB7A 1H11A 2BP1A 3GVRA 1BVNP 3QV6A 2WSQA 3U2EA 3TR2A 5AC5A 4KCVA 3S46A 2JE8A 2V67A 2VGGA 4QJ3B 3U8GA 2FVMA 3CM4A 4K7VA 4S3FA 3A3XA 1EO5A 3R43A 4UQCA 4IJBA 1LROA 4LXFA 4UR9A 2DUAA 3PAOA 4B5NA 1OQFA 1X8CA 3LD5A 3W00A 3WNNA 4QJ1A 4G9PA 1FP8A 5D02A 5CZKA 3GTFA 2NQ5A 5DY2A 2HNHA 3BMXA 1VF8A 3U9IA 1K4HA 3W0KA 4AU0A 3CZ8A 4JFSA 1Y0EA 2VGFA 1J2WA 2EJAA 2PDWA 1W8GA 4IX2A 3T6CA 4K36A 4GK8A 5EMJA 3CASA 4DI8A 2YL6A 3ZLHA 2G4FA 1SJCA 1OFDA 1ISYA 3W1TA 4LX4A 3QOKA 3KBWA 2VTFA 3KVLA 3VOJA 3TMQA 2X16A 3M0VA 9CGTA 2P53A 3SB0A 3OVGA 3N17A 3TTOA 4AQLA 1G6CA 1HG3A 2YCKX 4Q8UA 5BMXA 1O1ZA 2EPLX 4F8XA 5CZ0A 3IIZA 1UWUA 2QMJA 4XAGA 1H3GA 3H70A 1SO4A 4JFVA 2HVNA 4EF8A 2WC7A 1XYLA 1WCGA 1XIHA 3QN3A 3VIGA 3SRKA 2Z29A 4N9EA 3P8JA 3U3HA 3VU2A 2TRSA 5F2IA 1ISVA 1WKYA 1V0KA 4ZE5A 3L5AA 3CHEA 1PDYA 1OT2A 3MMUA 2XVGA 1Q6LA 1VFUA 3M5YA 1S2VA 3C2EA 3MZ2A 1XD0A 3AS1A 3AXIA 1TTJA 3GW3A 1BXNA 5E5CA 3V75A 4IF2A 4MYAA 4EK7A 4MKSA 4UTFA 5REQB 2PLCA 3VDBA 2OLHA 3PJXA 3BW2A 2DY3A 1O5QA 1WDQA 2RH9A 3PY2A 1SW3A 3PBMA 1FWNA 1T99A 1P1XA 2PLMA 2EGZA 2J62A 3R0DA 4Y7EA 1PTDA 4F2BA 3IJLA 3BH4A 4HKPA 3DKLA 3VNDA 1Z9AA 2E6AA 4MNJA 4YTTA 3DC0A 3M1ZA 1N8FA 3IJ6A 1K6WA 3ME3A 1PCKA 3ANUA 3NQAA 3W2LA 3M7SA 5JH1A 4KWWA 3R5EA 1YADA 1K8YA 4B3KA 2FPYA 2GJLA 3TYDA 1FH7A 1UD4A 4R85A 1QCWA 3NQEA 2ACSA 4JKKA 4D8ZA 1OC5A 1JD7A 4QX4A 2DGAA 5AZ0A 3W25A 1AW2A 5AYZA 2ZRUA 1KRCC 1VJZA 3PPCA 4PN2A 6ALDA 4LC6A 2Y88A 1C8VA 3K5XA 1UHVA 3EOLA 2CBVA 4GQGA 5F7UA 3FJ6A 2OZTA 3BLOA 4BF9A 2YYUA 1DJWA 3OZMA 1W3TA 3S2MA 1X96A 3V0UA 5L6UA 4X2PA 4NT0A 1EF3A 2NUYA 3ARPA 4GVIA 3NQ7A 3NR0A 5EMMA 1ZCOA 3PZIA 4UCGA 2PDCA 3S4TA 3LCIA 3KLKA 1IEXA 4L1XA 2WMKA 5C9WA 2HXTA 5AKQA 1MEHA 4GH3A 4WJXA 3DN5A 3WH6A 4ZE4A 3S42A 2X1IA 1E3XA 3LERA 1HJUA 2F38A 3S1WA 1AMYA 2Z1WA 1HJSA 2YA0A 2H3BA 4DAIA 2HRWA 1WQ5A 2QDGA 2ZDRA 3M6YA 5A6JA 3FXGA 3PHAA 1WP6A 4AXKA 1ZB5A 9XIAA 3VKBA 3ZYZA 2ACRA 5HNUA 2QS8A 1KCXA 1JGMA 4O15A 3HN3A 4KCTA 4MUZA 4MOZA 4BI6A 5ABTA 3B0UX 4GFIA 4WKFA 1EC7A 1XYBA 5C71A 1XLLA 4RLIA 1S2AA 2X0YA 3UXIA 2A85A 3C61A 4ICCX 1MSSA 3SRDA 1ISZA 4LS1A 2ZOXA 2XM1A 3NZQA 3TWAA 2BVTA 2ZXQA 5BZAA 4AYSA 2H8ZA 2D3NA 4QRNA 2O56A 3BOXA 5G1YA 1A5MC 3NXFA 4IQEA 1RQHA 4L64A 5D03A 2BZNA 3FKRA 5AYBA 4KIEA 2CZFA 1ZP4A 3CV2A 3FA5A 1B4EA 4PB5A 1TELA 1I75A 1UJPA 4MLRA 5I5RA 1DJHA 3KL5A 5DQPA 2YLAA 1E0VA 1XH2A 4PTWA 1UR1A 2V6AA 4QXIA 3UXAA 3O63A 4XISA 3CL6A 1AL8A 2XVLA 3GTNA 3W29A 4KWSA 2PBGA 4XAYA 4A6GA 3KAOA 2ZX9A 1TX0A 3LTYA 3SGGA 4QJ4B 4TVCA 3GNDA 3ITYA 1HTIA 3HQOA 1O12A 5FJOA 3W26A 4QS6A 4CD5A 4LS2A 3URNA 4B5SA 1IEWA 3UFYA 5HQLA 2Y7EA 3NZGA 1OM0A 3TC7A 1AH3A 3VTRA 1FCQA 3QRHA 3C8NA 1KM3A 2PWHA 3GX9A 4RUBA 3B9OA 1K77A 4LBUA 4M24A 4QDPA 2OOFA 1PX4A 1Q5MA 1ODUA 1ZZMA 4MZYA 7ENLA 5C55A 3DYOA 4LVAA 4WXZA 1LBMA 1UR2A 3L5MA 4ZQCA 3ANVA 2OG9A 1SQ7A 3WX7A 2BVWA 3MKKA 4WXYA 2OSXA 2NT1A 2OEMA 1GQJA 1TG7A 3LI0A 2J47A 1CGYA 3WBYA 2PE4A 1DWFM 1K7FA 3ZJ6A 1K9TA 1W1A1 3PBUA 2AL2B 4XWUA 3WUGA 4ASTA 3KBVA 2ZUTA 1BSIA 4LAOA 3LHZA 2HQAA 4RE2A 1Z48A 4AB4A 7REQB 4Q8PA 1RQEA 4I5XA 1OFRA 4DO5A 3APGA 4GI8A 4MWAD 3WH7A 3TTYA 4GKTA 1K70A 3K13A 1J10A 4G7FA 3T08A 1E56A 1XRVA 5HMSA 4MF4A 4LVDA 1T8QA 1DORA 5A6BA 1JDEA 3WF0A 3OVPA 5AC4A 1JIBA 3OPSA 3W22A 3W1QA 5J8LA 3WNPA 3TYCA 2HXUA 3TYBA 4DNMA 2QGHA 1KA9F 2J7CA 4JTIA 3W4RA 2YBTA 3A21A 3SCOA 3MVTA 5D9NA 3N2BA 2RDWA 5CC7A 1SR9A 4I9AA 1FWWA 3GG8A 5A6AA 4HB7A 5HWNA 2UWFA 2VR5A 1EKOA 1B57A 3KBNA 3BARA 4M1BA 4OJYA 3EB3A 1SU5A 3BO9A 4H7VA 1I2RA 1R8LA 4EWND 1EIXA 1MQQA 1ZY9A 1UOKA 3AMLA 1Q6OA 4WY0B 4J4KA 1M41A 4IPLA 4MLJA 1U1JA 4ROPA 5CG7A 1D7FA 3CWHA 5BU6A 3UG3A 2TMDA 4PMXA 1OX4A 3PAJA 3QMTA 1GVSA 1FWBC 3DYMA 3TV8A 3E0IA 3AYTA 5A1AA 1HQTA 2XZ9A 4H41A 2VRJA 2X2YA 4GACA 2DT3A 2QGYA 1WKFA 4LW7A 3VGHA 3KHJA 4UXDA 3L4ZA 1F8MA 3V0SA 3RLHA 4NYYA 5ABFB 3TN5A 5FA5A 1C7SA 1EJRC 4FO4A 2Z7GA 4ZQNA 4V1YA 3FIGA 4OV9A 4AC7C 2E3ZA 4OHQA 4QCFA 2XN0A 3GM8A 3LBOA 5IOBA 4OOUA 3QR1A 4DBEA 4L4MA 4M6VA 1D3GA 4JTSA 2CZVA 2IKJA 4Z08A 2IXVA 4BQ2A 4NXKA 1FKWA 2DJLA 5FEXA 2PRHA 1EB3A 5G5IA 3W2UA 3QOMA 2E40A 1TV7A 2I56A 1VYSX 3TZFA 3GHTA 3TLQA 3VNJA 2E5CA 3I65A 1Q6QA 2DZBA 2GGEA 3OLIA 3WQ6A 4H7ZA 1XQLA 1VLWA 3I4KA 2XGBA 4TVUA 4ZA0A 3UPBA 4HOXA 4C6IA 4S1FA 1XSKA 2DZPA 2IPFA 2A0NA 3W02A 1V93A 4JN6A 5H6HA 1PJ9A 2AMGA 3MMDA 3NPWA 1V5XA 3ZWSA 2P8BA 1RALA 3P80A 4A8NA 3LDVA 4RR4A 2QJHA 4NJIA 4GC3A 5JXQA 3IUIA 4FZIA 4BCEA 2IW0A 1E1CA 2WM0A 3TUUA 1KM4A 4YTQA 1B1YA 1LLZA 3WBEA 4RDYA 2WVSA 2DT0A 2ACUA 2FFCA 5I3IA 1EQCA 4M81A 2Y5JA 5JH2A 4S3JA 3AIBA 5I3KA 1ODZA 3GDMA 3HPAA 1TZZA 1PCWA 1J12A 1FA2A 2BDQA 5TAOA 3RK8A 1KW1A 4HZ6A 1BWVA 3QGVA 2C79A 5G4HC 1XYAA 4TV6A 1VCVA 2P50A 1NY1A 4FNQA 4HZ7A 3N1AA 3IJ9A 2W79A 1WBJA 3CMFA 4U2YA 3WG6A 2JQXA 3LTPA 4FR1A 1JZ3A 1QPNA 4X9SA 4HN4A 5D33A 1VS1A 4M3PA 4P7LA 3UY8A 2J7DA 1DHKA 4JICA 3GB6A 3GBDA 3H2AA 3L68A 3IJDA 3H7RA 1NDYA 4TUFA 3CGTA 3KP1A 3VMOA 3RAOA 3GG7A 4OGZA 2NV2A 2VJXA 1E70M 4IZGA 4X0VA 3MUY1 1GYNA 3QW4B 1G4SA 4QAIA 1K3UA 1XL9A 1YMYA 2HS6A 2QCFA 1LG1A 3NJ3A 1W2PA 3DAQA 3MUXA 1IWAA 3IK2A 5HUPA 1ZBWA 3IUDA 4HHLA 4MIMA 2DZVA 1UKTA 4GKLA 2EPMX 2GQ3A 2CCRA 3EOUA 1RCQA 3PTDA 1TV5A 4HK5A 1CGXA 1FWJC 1UA7A 3KHDA 3P0XA 2CZ5A 4J27A 2OYMA 1SO5A 1EZ2A 3BCFA 2PSNA 4HCDA 1VPXA 1EO7A 4DXXA 1EGMA 4TO8A 5K9CA 3LM7A 4ZFMA 3T8QA 4GA8A 3S6OA 4DJEC 4LF1A 3S8HA 4PA8A 3H2FA 4IGMA 3IVUA 3MCNA 4BWLA 4DF0A 3G1RA 1UWRA 4ATDA 4IL2A 1JCXA 2WNZA 1ADOA 3CB3A 3NWRA 3PSVA 3AROA 1EJVC 3K30A 5H1WA 3G8EA 4RZBA 2F8QA 3P7YA 5AOUA 5K3VA 3A47A 4W8AA 2WVVA 2GVJA 2REQB 1DIKA 3M0YA 4GWEA 4FX7A 1XUUA 2G3NA 3IV8A 4XSLA 3UA3A 2Y89A 1FRBA 3NIYA 1HKVA 2IQ0A 2V2DA 1TV8A 4MAVA 4NNBA 2J7GA 5FKYA 3QYQA 2ZUNA 3GC4A 1W91A 4GJ1A 3RR4A 5GJPA 1YDNA 3IIPA 1EP1A 4NJJA 2Z24A 2QKFA 4WDWA 3DUGA 3WD2A 1R2RA 4MAZA 2QCCA 4A3HA 4BI7A 3VGFA 1EA9C 1U30A 2E1WA 3WMCA 4GNKB 4XAPA 1LT7A 3ITGA 4JYEA 3KLLA 3QW3A 1SFJA 5A95A 1R7AA 1FCBA 1F4AA 4LV4A 3VA8A 1WDSA 3AWOA 3BLLA 4U5KA 2C8NA 4O1DA 2OZ3A 3FEMA 3T4WA 4KETA 2HS8A 1LQ2A 4C6NA 4L7ZA 2E8YA 4HNTA 1LP6A 2PDKA 3MS8A 4GABA 4KWOA 2ZRZA 2X41A 3BPWA 3CNYA 3QEZA 4AIBA 1POJA 2Q09A 4HK6A 5LA1A 4EF9A 1CXKA 1UR4A 1UC5A 3SADA 4W4QA 1TMHA 4UQ9A 1DHPA 3HQPA 3LHUA 4PUNA 1NEYA 4Y9AA 2DW6A 3POHA 3UXDA 2V2CA 4REQB 1Y8BA 3DFHA 4J35A 1KBKA 3I6EA 1XLFA 1LG2A 3HJEA 1FHDA 2BY1A 1LL7A 3ITLA 4PEKA 4NZFA 1OK6A 3MHUA 4AW7A 1GZ1A 2VXNA 1KLYA 3ZSTA 3FYOA 4O13A 4JIRA 2VENA 1AQFA 3N13A 3MB9A 3CH0A 2WBKA 3TAKA 4CLMA 2E5DA 2ZE3A 2X1UA 1ECEA 4AZ7A 5LKYA 1WDDA 4DEFA 1KBLA 1NJJA 5F1UA 2Y1HA 2ABAA 2FTYA 2FLIA 1MW0A 1ECQA 1RPKA 2GDUA 4WKAA 3PP7A 3XISA 1XPYA 4PBGA 2QAPA 3S5ZA 2UY2A 1LQAA 4JBRA 4AYGA 2G8ZA 3VKJA 1EIBA 4A8LA 4K7YA 1ZRQA 4LYQA 3UG8A 4CN1A 2Z1KA 5AB3A 3TSMA 5EMYA 1RCXB 3N9SA 1OFBA 4I7UA 2GK1A 1CIUA 1OSEA 4RE4A 1ALDA 2O9TA 1PVNA 4A8RA 3GH7A 2EKCA 2C1GA 3TOYA 1UZ1A 3HURA 4PEEA 5A2BA 3B4UA 5DT5A 1DIEA 4WDTA 2ZBTA 2UY4A 1BWLA 2QUVA 4GY7A 4O10A 4ILSA 3STPA 1FWGC 5HWMA 2JEPA 1WZMA 4UUIA 3VD4A 1JDDA 5CSRA 1KXVA 1J8VA 2VCBA 2JIEA 1TA3A 1JZ7A 4XUGA 4A35A 3E2QA 3RRXA 2P10A 3EXTA 3SFWA 1T96A 4J1OA 1VC4A 3O8AA 4Q7IA 3MY9A 5M1TA 2WC3A 5CLTA 1FKXA 2EG8A 2J7BA 1EHAA 4HCLA 4JN7A 3NDOA 5DELA 1GEHA 2VWTA 1N8WA 1JG9A 4UTIA 4F0KA 3N12A 1F05A 2PD9A 1UZ4A 3RX3A 1HJXA 4PTNA 2VX4A 4UTLA 2D22A 3CIXA 4J3UA 2CZDA 1E6ZA 3M0JA 4BEQA 2FGZA 2BOEX 1TV4A 2IQDA 3UNDA 1SO6A 1DKWA 5A69A 4LPCA 1G67A 3B06A 4HSOA 4IGHA 3V16A 4WSKA 1BTMA 3B9EA 4WR3A 1Y5VA 2WW5A 4C7GA 2NVDA 3S1XA 6XIMA 3AS3A 3DDMA 2I1OA 2VUYA 4U10A 3P74A 5KZDA 3PANA 4ZR8A 1OD0A 4TX6A 3POCA 1IT7A 2GUUA 2TYSA 4Z2LA 4FNPA 3GRIA 5CPSA 2PS2A 1B30A 3AYSA 1GQLA 3U5YA 1US0A 1XRSA 2J79A 1N55A 3NL6A 3OYXA 3AMKA 3BGGA 3BZGA 4GH1A 2Y70A 5D2TA 1YPFA 1Q4WA 4BEUA 2G37A 1QNVA 3E2RA 2V81A 5HWJA 1BKSA 1XV8A 1ZGDA 3MHGA 4YN5A 1R3VA 2R1LA 4JHOA 1RY8A 3QHNA 2Z00A 1NFBA 4B2DA 2YXGA 1DV7A 1GORA 5I07A 1E4IA 2E9BA 2QJJA 5E0CA 4S39A 3VGDA 3EEGA 4OWGA 3W7CA 4POCA 2PTDA 1K8CA 3U2ZA 3W84A 3CAVA 1P6CA 4IIDA 2XIIA 4GMEA 1XI3A 5C7HA 1YLVA 3M0MA 1JAEA 5EFFA 2Y85A 3VIIA 5I0DA 1ONEA 1DYSA 4P61A 5MHBA 2A7PA 1VR6A 1BYCA 3DZ1A 1TVLA 1GHSA 3PUOA 3M0XA 3CTLA 4ICNA 3TH6A 2AAAA 4Z2KA 4H7CA 2YJQA 4N9BA 1CGUA 3KOZA 4JQ3A 1QXLA 4NI3A 3EMZA 4LNYA 2J25A 1LQ0A 1P43A 1V6WA 3DYPA 4XD4A 3L12A 1S3TC 3CLWA 2PWDA 1E0UA 2FTPA 2QJIA 5LIUX 1EP2A 1CW2A 1GW9A 1MFVA 5I3GA 3LPOA 3VNLA 5GNYA 4MPQA 5FACA 4EACA 1VBRA 1OT1A 4YVVA 4NUWA 3L66A 2AL1A 3LEPA 3QM3A 1DBTA 2WPGA 1KKOA 2EJ1A 3MBDA 4Y6GA 2FQIA 3GH5A 4Q4RA 1W3KA 4LYPA 2J7EA 4UWMA 3H23A 1C93A 1PDZA 2PLJA 3BC9A 3BW4A 4DO4A 2QDEA 2AOSA 1T41A 3NZPA 3I3EA 4QG6A 5I77A 1TWDA 1LRNA 4O12A 3S5YA 4JXCA 4YTUA 1RA0A 3OEXA 4HU0A 1TPWA 2JKAA 4PCFA 2HZGA 1DTNA 2IMRA 5CPQA 1A50A 3LX9A 3MSRA 3L2MA 1H61A 1A49A 1CX9A 1H09A 3QV9A 4ZQPA 1R38A 4GZIA 5H2ZA 3NO1A 4FEZA 5JBEA 4DM1A 1L8PA 2XIMA 3I10A 3W1XA 4FALA 4AZCA 3EA3A 3SCWA 2Z4GA 1UP0A 3GW0A 3S2LA 4DVOA 4K2SA 5AVNA 1E9LA 2H90A 1WB0A 1VYPX 5F4WA 1RBLA 3F4VA 3T2OA 4K68A 4AY1A 1YEYA 3OODA 3O15A 1UH4A 1KFEA 2GQ8A 4O54A 1G7VA 2DZUA 3OGVA 3VDCA 5U7SA 3NYZA 5HJLA 2ATSA 4D6DA 1TVNA 3EWCA 3QY7A 3BSGA 5FJRA 5C9XA 3NDZA 4QS5A 1VJIA 2XJ7A 3A64A 3N3MA 4Q6JA 2ZC1A 4CD8A 4PCTA 1CLKA 3GWQA 3N14A 4F0SA 3QV7A 4Q8NA 4K38A 2AKZA 4UTTC 1EBGA 2DSVA 3STEA 4MB1A 1UR3M 3WJYA 3C0SA 2YCLB 1GOXA 4FLRA 4LAZA 4N6FA 2VD9A 5M3WA 4F0MA 2KX9A 1OG0A 4Q4MA 1JCYA 3WQPA 4QG8A 1JXJA 1SYTA 3S2CA 4BZYA 4GVHA 3DGRA 4GC4A 1LLWA 3UJFA 3WYZA 5BCAA 3LHVA 4CVWA 4D8LA 4WRHA 2NZLA 4MVAA 3BG3A 3IIOA 4RKAA 1AD1A 1S2CA 8XIMA 4LEQA 1H2JA 1W9DM 4OUEA 4LCSA 1F9CA 3GXMA 1JCMP 5HQEA 2PODA 4LB4A 4XBJA 1XKYA 4LSBA 4Q8WA 2WZIA 3B8IA 1GCYA 1THFD 1YIXA 4GQQA 3W27A 2QYGA 4HTBA 1JDFA 1CDGA 1WPCA 5K7JA 1E6RA 3VD5A 2DUXA 3WH8A 3CWOX 2X0HA 4FS9A 4URIA 4DJEA 3DFYA 4ZENA 1QPKA 1FWCC 2QAFA 4C6EA 9XIMA 4B4HA 1B90A 1B9BA 2YXXA 2ZUVA 1FWRA 4H6QA 4UNKA 4FF5A 3FHAA 3CUJA 2ZX5A 2OQHA 3RUBL 1MWOA 1V3LA 2JALA 3NQBA 4IOTA 3U5UA 1M04A 1Z3NA 3LLFA 4FAMA 2DZXA 2DU2A 4O1CA 2D20A 3PK7A 1C8YA 3I6RA 3HG5A 1O60A 4O8RA 1JDAA 3TCSA 1XDJA 3HB9A 4JFWA 1NDWA 4L6OA 3Q58A 4JTRA 5I02A 2W66A 3CWNA 4GYPA 3STCA 2PCEA 4LTSA 1QTWA 3L4YA 4Q4QA 3TYEA 5K4XA 1OGGA 2Y2WA 4JS3A 1US3A 4R9XA 4DUWA 3RPDA 1KM6A 3HFTA 5HMDA 3IARA 3W28A 4JFUA 4PUEA 1SFTA 2VC6A 1UP3A 4FLSA 1VHNA 3G6LA 4NJKA 4G1KA 1NU5A 1TYGA 3NURA 4OKDA 3LCXA 4DJFC 1VENA 4DM2A 5IRPA 3T81A 1JGIA 1LUCA 3THAA 2Z6JA 3ISIX 4JY8A 4ES4A 1SJDA 3UCCA 2WWCA 1XDLA 2XSAA 2X42A 1UPMB 4US5D 3URQA 4KF1A 1KQZA 4GOAA 4ATWA 3BMWA 3WLOA 4IFKB 4XBKA 2ZQ0A 2CPUA 5BXSA 3PFRA 1S5NA 3STGA 1SR0A 3ZS4A 4ML9A 1YDOA 3RNDA 3LGGA 3AIEA 2JEQA 5HR7A 1I2PA 1ME8A 4PRTA 3AIWA 3GG1A 1VIWA 3LXBA 3C86A 4J2PA 4JL1A 4EAMA 1JZ5A 1BSLA 2PA6A 1RA5A 3T2QA 2Q71A 4BFAA 5HBFA 2EPKX 1UPPA 2Z1XA 3U48A 1MXGA 1DXEA 4JTTA 1H5YA 3BV7A 5E70A 4G5DA 4WY0F 3ABQA 3W6LA 2POTA 3IJQA 5HPCA 4CNSA 4W84A 1FWDC 1W3JA 2OKOA 2VR4A 4QDWA 3VMPA 1A5NC 4JN8A 1TQXA 1XGEA 2QIIA 3M9YA 1D9EA 3D6NA 3S6TA 3M16A 2OX1A 3G1SA 4BQ5A 5CPMA 4LUIA 4HSNA 2G5WA 2W61A 4FNTA 2YPIA 3QLDA 1YNYA 2GUBA 1J0KA 2WXDM 4B9ZA 3C56A 3WJZA 4ERGA 1XKJA 4ZO6A 3VD7A 3WUEA 1AA1B 2AMXA 4WDXA 1OGBA 5G1MA 4P8XA 5AY7A 4B5TA 2IKGA 3AUOA 1UIPA 3W70A 5TBOA 2ZVRA 1HT6A 3MDUA 1A4MA 5FI8A 4YMZA 2NUXA 1HF6A 2D2JA 3U7BA 4IICA 3IWPA 3NYDA 1HJQA 5CKSA 3EKGA 3BAIA 5XINA 3FXYA 5AYXA 3DG7A 4QGCA 3WNKA 3IS4A 2WZTA 4QROA 2HMCA 3KM8A 3V5OA 1YBQB 3CJPA 1XIBA 4DJFA 4UMCA 3USZA 3QY6A 2QCMA 4XKMA 3VNZA 5DX7A 4PUWA 3V4BA 1UMLA 6REQB 3G1HA 4GQ0A 4Y2WA 1EP3A 3MV11 1S5VA 4Z42C 2OQLA 1AODA 4DLMA 1EDQA 3MUIA 3UZYA 4O1BA 1GZGA 3K8KA 2EPOA 1J0JA 4GLEA 2GSHA 4NYUA 1VCFA 4XD5A 4US5A 3MANA 2I5GA 4I8YA 4LY4A 1VYRA 3DC8A 3M0HA 4MZ8A 3CUZA 1XRTA 1GOIA 1R85A 4D6HA 1DE6A 3F4NA 4KFNA 2AQVA 3B9NA 3F1QA 1J5SA 1GYLA 2WO5A 4HTYA 2DSUA 2IQTA 3WQDA 1YRRA 3F03K 2PEVA 3HPZA 1JNEA 3PZOA 4MHBA 3VOGA 5PTDA 2PDIA 4N42A 3LBCA 3R25A 5DCEA 1V0MA 1RP9A 1KWKA 1H0GA 3OBKA 3GVQA 3NL3A 4HHMA 1ZAJA 3MI3A 1GT8A 1XLHA 3ZJ7A 5HOSA 2VC9A 1PEZA 5D09A 5GNXA 3D3AA 2V0TA 1DWAM 2PWVA 4RCXA 3A3WA 3H2CA 4XZWA 2RAGA 5DO8A 2D23A 2XH2A 1SFLA 3RLGA 4LRTA 3FW6A 4Q7NA 3I7SA 3SCTA 1GVFA 2VFGA 4JKMA 4IPJA 3L65A 5FL0A 3IVTA 4MWAE 1DQXA 2Y7DA 1U5HA 4S2CA 3D47A 2A6LA 2OODA 2R6OA 3TJXA 4ONVA 5I03A 1UBPC 1CWYA 3BSMA 3FJNA 3R6IA 4J3TA 4IG2B 2YKKA 1E43A 4AD5A 3ARXA 1PIIA 4M56A 2EBNA 4MWAA 3F5JA 1XIIA 4KEUA 3TSBA 2YYTA 4GZEA 2R94A 4JQ4A 3WUBA 2WJFA 1Q85A 4E5TA 1WO2A 3E49A 1E4MM 3CIWA 5C7VA 2GWGA 3NZ1A 1PZ2A 3S1UA 4KIRA 4US6A 2ZFAA 4V15A 4XTDA 4AD3A 6XIAA 1BQGA 5TQLA 3N4FA 2HE5A 1F6PA 1M6JA 1BG4A 2VD8A 3BTNA 3TSDA 1DTUA 5TD4A 3V1PA 1H7OA 1KM2A 3EA2A 4DYKA 4N4PA 2PDFA 3WLQA 1YXCA 1PYFA 1BYBA 3CV1A 1DQWA 2DSZA 4BWLC 1QUMA 5H91A 3U0HA 1ZALA 3G8RA 3M4HA 3GNXA 1V3KA 4INFA 4P7OA 2B31A 1TPFA 1UBSA 3CV7A 1DL3A 4M51A 3K4WA 4IP4A 1B3ZA 1EUAA 4OBTA 1LZOA 3LN3A 4MGGA 1OB0A 2YDQA 4RV3A 1YTKA 2JFEX 2VOMA 4ML4A 3M64A 4H2HA 4PUDA 3SAZA 1TJPA 3EWWA 1KLZA 2XINA 2ZWZA 4Z2IA 4JL2A 4EIVA 1WA3A 2XFYA 4U3AA 4DZ5A 1HVQA 1YX1A 4JNYA 1BHGA 4DYJA 1ZPTA 2VDHA 3NAVA 1SO3A 3S47A 4FNSA 1QI2A 1EL3A 3LG3A 1WAWA 4L65A 3II1A 2FGBA 5DBTA 4KWUA 2CLLA 3VIPA 4OE7A 1FUYA 2X1RA 1HNYA 3AHYA 3SR7A 3BXWA 3GKFA 4QHRA 4ERIA 4GE8A 2INZA 1AQMA 1XLJA 1PX3A 4PMVA 3RJXA 3BAKA 3P62A 3OHIA 1QMLA 1UD5A 1ICQA 1WAUA 4EKJA 3SCPA 3VD9A 2E6FA 2NQLA 3PZTA 2Y0FA 1H7WA 4ORIA 1TZ7A 1Y65A 1F3XA 1MFUA 2QCNA 2BASA 4JTAA 1XC4A 3UT0A 4UIOA 4GX9A 4LAKA 5B7YA 1P4CA 1FCVA 4AD1A 1NOWA 4FXJA 4R7OA 2Y62A 4XZMX 1BPLB 1XH0A 4UOZA 2XSXA 2HPIA 4KS0A 1JFXA 3LV6A 4JGDA 3VZYA 1U33A 3QHMA 2F9RA 2X7VA 3T42A 1S2WA 1V3IA 3A22A 3MW7A 3FGCA 3OA3A 4CGTA 3RR1A 1KWGA 4AVFA 2YGYA 4LAMA 4O16A 3SN4A 1XBVA 4Q8MA 3ARZA 3ES8A 2CU0A 3XIMA 4NHVA 3THUA 1TMLA 4ZGYA 2PP3A 3WDJA 4FIRA 2XZ7A 3UWEA 1XYMA 5T91A 1CB7B 3R8HA 3V36A 3WN6A 1A0CA 3WZ0E 4PMOA 4L9XA 4ZTXA 4HHHA 1SPQA 4RZ5A 1F6KA 1KGUA 1R3SA 2HEJA 3VNMA 5EFDA 1VFTA 3VXGA 2QMKA 5A8OA 4C1NA 4ATLA 1YKWA 2DH3A 2XGZA 2ZTJA 4J9JA 4WD0A 4J5NA 3BZJA 3SCNA 1TB3A 2XWDA 3VKAA 3RLVA 4D9PA 1OFOA 3B0XA 1OD8A 1TFVA 3Q67A 2WKLA 3N2OA 2PDPA 3UQNA 4X2RA 2FVLA 1P6BA 3K46A 5LSMA 2EO7A 1FX6A 4IMAA 3C2YA 4Q4SA 2VI0A 1GTHA 3IGSA 3APYA 3MSGA 4V27A 3GIYA 1QNQA 3TN6A