4Z0JA

F96s/s73a double mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
244
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGAYTGEVSAEIAKDLNIEYVIIGHSERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Connecting Active-Site Loop Conformations and Catalysis in Triosephosphate Isomerase: Insights from a Rare Variation at Residue 96 in the Plasmodial Enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 94
structure length 244
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4z0jA00
2YDAA 2WSQA 1G4SA 2GJLA 2DZUA 5CZ0A 2ISSA 1HL2A 3W86A 3TJXA 3LI0A 1ML1A 1M7OA 3LCGA 1OFDA 4H3DA 3C4UA 2DP3A 4FX7A 1THFD 3SR7A 3UNDA 3P82A 1AG1O 5G5IA 4NT0A 3W7GA 5DY3A 5HMSA 3DBPA 2QJGA 4CCEA 1O94A 2WOQA 1W3TA 3EKLA 4WZHA 1DJQA 3LCXA 1FCUA 2GVJA 2ZFAA 3NXFA 4LS2A 3UWQA 1PIIA 1XM3A 2A85A 2FIQA 4BI5A 1LCOA 2A4AA 4LUIA 3NZRA 1H7OA 4N02A 3EWZA 3FLUA 3M6YA 5D32A 1DHPA 1I8JA 3LOTA 4I9AA 3W1XA 5KZMA 3BG5A 4TIMA 4O50A 1A53A 2BZNA 3TNOA 1TQJA 2ZQ0A 1XI3A 1IXPA 5D02A 1R30A 4HIBA 3BW2A 4A22A 2DZPA 3C8FA 3KRUA 1RQBA 5I3KA 4A2RA 3W74A 1KA9F 3QQ1A 4NUWA 2PRMA 3W2KA 2RH9A 1GG1A 1XL9A 4O1CA 4KKXA 1ICQA 4BWLA 4FEZA 5CPLA 2CWNA 5DY2A 3O15A 4O57A 4QJ1A 3TX9A 1OYBA 3GX9A 5MHBA 3I68A 3PBVA 4O1BA 3EXSA 4B5NA 3IGSA 3KFTA 4DO4A 2Q3OA 1TPDA 2J9ZA 1MEIA 1FQ0A 2ZZ7A 3DFOA 5EPDA 4NJIA 3W76A 4JR5A 4WY0F 1IXNA 3ZR4A 2AQWA 3UPWA 2OT0A 1A5SA 4LNYA 1GPWA 1TIMA 3RLVA 4NJHA 2V9DA 5K9DA 2R94A 3L5MA 1WDWA 1V7YA 4JEQA 2WNQA 3P60A 5CGQA 1LBFA 5BOOA 1NF0A 4LC8A 3OHIA 1I2NA 3AO0A 5FF3A 1SZGA 2QAFA 1SZFA 3G0SA 2Y61A 3CWNA 1QAPA 2C6QA 3IGXA 3LTYA 3O07A 5ABTA 5K4ZA 3M41A 1CX9A 3KRSA 2QF7A 3HIJA 1KM5A 1HFBA 3GDLA 1W5OA 3OA3A 2NV2A 4X22A 3W7MA 3MP3A 1VHNA 2YFNA 3LLDA 1WBHA 1LOSA 1JQXA 1JUEA 4DO6A 1TV5A 3N34A 4WY0A 4JX5A 2CLMA 2XN2A 1GWJA 2R8WA 2ABAA 4HPXA 4MY1A 3I7RA 3S5OA 3HG2A 2DZWA 5D03A 2ZA1A 4O1DA 1SO3A 4JXCA 3DU0A 2V5LA 1EUNA 2NUYA 1SO5A 3A21A 3O8AA 1VS1A 4LUJA 3UYCA 3T7VA 4HT3A 1FX6A 4ADTA 3W85A 3TFXA 1F74A 4LV4A 2WNNA 4OT7A 2ZRZA 1X1OA 3C2RA 3BLEA 1Q6QA 5I3HA 3QMSA 1K8ZA 4DBDA 3KVLA 2CLHA 3PG8A 1AL8A 2RKXA 4J9JA 3OBKA 3Q58A 3MWAA 4NU7A 3EX4A 5A8GA 2E6AA 3L0NA 4MZ8A 2ZBTA 4JIQA 4I7WA 4BF9A 4IX0A 3NR0A 2GOUA 3LCFA 3N3MA 5FF2A 1W5NA 4BFAA 3DFPA 2RDUA 1P5BA 1T99A 4JTJA 4YLWA 4EF9A 3W84A 3PS7A 4UXDA 2VFIA 5AYZA 3DI0A 3STEA 2YCEA 3LXBA 5G1YA 5BNKA 1JCJA 4MJZA 2Z6IA 3B06A 4GJ1A 4IMFA 1SSDA 1W5PA 2Z2UA 1QNVA 3LRKA 3ZWTA 1I45A 1NFBA 2GQ9A 3THQA 4K7VA 1OYCA 1OFPA 3FOKA 3FFSA 3P8IA 4LS1A 4AH7A 1A5AA 1X1ZA 4JX4A 1VH7A 4RCXA 5DN1A 2Q8LA 5G4WA 3WJSA 4C1KA 4QM1A 3KRZA 2YSWA 4GNJA 1Q6LA 4OQVA 4ZZ9A 1LBMA 4JDYA 5D2WA 1N7KA 2Y85A 3HOJA 3TV8A 3LHTA 1A50A 2XN1A 1Y0EA 4XUGA 4FXSA 3BGGA 3QW3A 3LHUA 4OHQA 2BSLA 3G1FA 1AL7A 3TMQA 4EVZA 4UMBA 2Y6ZA 3G3DA 3DFTA 3DXIA 1VRDA 1B57A 1M6JA 2NV1A 2ZDRA 1EP3A 4GBUA 3DFQA 3EWUA 3GR8A 3ELFA 3PB0A 3W7DA 3NYZA 4N9EA 1XCFA 3SFKA 1S5TA 3W2LA 4RXGA 2NLIA 2C16A 3TSDA 4FO4A 3TC7A 2VEIA 1HO4A 5CSSA 5U4NA 4HPJA 2QCDA 4RZ5A 3IVUA 3S9YA 3HO8A 4RV8A 4GUJA 3NL3A 3W23A 4UIOA 2NX1A 5K2ZA 4M19A 4KWVA 5CPOA 4LVBA 1FCQA 1TQXA 2R14A 4KFOA 4IMDA 1WQ5A 3PM6A 2X30A 4IMEA 4JX6A 2NXIA 5AB3A 3EKZA 4QIUA 4PTNA 2YGYA 3SY5A 4CNOA 4RZ6A 4K7YA 1OVDA 1TPH1 4LTSA 4AF0B 3M7WA 6ALDA 4O15A 2E68A 5DCBA 5F2LA 1QPQA 1BWLA 2C19A 2X1RA 3CHVA 2CLIA 5HR7A 2RFGA 1H61A 2FPYA 2VC6A 4ORIA 2FLIA 2VOMA 1AK5A 2V81A 4LVGA 5AOUA 3SW6A 4FX8A 3IIOA 2Y89A 2NXGA 4LOCA 1ADOA 2P10A 4A21A 3TR2A 3MHFA 4QNEA 1FDYA 2QCHA 3K30A 1VR6A 1GVSA 3QM3A 3HPXA 5E0KA 3L67A 1GVFA 1H60A 4MZYA 1IXOA 3W1RA 5K7JA 4Q32A 1EUAA 3PULA 3A24A 1TTQA 5LNWA 5AHLA 3HGJA 4K38A 3WK2A 4U28A 3LX9A 2E5BA 1TO3A 4OU1A 4OE7A 3W7CA 3GDMA 1LP6A 1ME8A 4NX5A 2QKFA 1N8FA 5AYXA 2PRLA 2WQPA 2A7RA 1DKWA 2J24A 1XFBA 2OZ0A 1EP2A 3O6DA 1YYAA 4Q33A 1S5WA 5HNRA 3HB9A 4AHOA 4RKAA 3P8JA 3LRMA 3M44A 1K02A 3G22A 3V75A 1KW1A 2JK2A 1AMKA 5F2GA 3P5ZA 1EEPA 1YTEA 4NZJA 3F1QA 2HMCA 1XXXA 4FIRA 3MBFA 1PVNA 4UTIA 4ZQCA 4MZ1A 3UWVA 4MY9A 1KFCA 5D2TA 3W1UA 3BVJA 5AHIA 3PWAA 1TRDA 5SWUA 3QJAA 2PCQA 1Q3NA 1NAL1 3R89A 3GXPA 5LKYA 5F1UA 4BR1A 3PSVA 4N4PA 1KBIA 1TJPA 2JKEA 2QCFA 3GIYA 1HO1A 1P1XA 4MKNA 3SGUA 3U2OA 1R46A 3LERA 1I4NA 3EX3A 2ISVA 5D04C 3DENA 5F2IA 4O4VA 4MIMA 3M5YA 1SW7A 1VZWA 3IIZA 5D30A 3KHJA 1SW3A 5LHFA 4M7SA 3S5YA 4Z1AA 1KFKA 3NPUA 3O06A 4O16A 1CI1A 2Y7FA 3USBA 3W7IA 4LVDA 1K7FA 1X6UA 3C0JA 3NA8A 2QCEA 4ALDA 3S1UA 3LBMA 3G1XA 3W7JA 2WO5A 3A9IA 3NL5A 4JGDA 4I7VA 5EKYA 3AJXA 4K37A 5KSWA 1KM4A 3NQMA 1UASA 4ADSA 1M7PA 2VFFA 4RK8A 3EWWA 4HSOA 3W22A 1N55A 4O0ZA 5C5YA 1YXCA 4HKPA 2ZRWA 5KINA 4WD0A 1VLWA 4AWTA 1OX4A 2FB2A 1LRQA 2DJLA 3O05A 5G4EA 7TIMA 1RZMA 3NNTA 1B3OA 1EWDA 4RR4A 2YFOA 2Q8ZA 3TKFA 3IV3A 2NZLA 3G24A 3UWZA 3E9AA 3EB2A 3C2FA 1H7WA 1PCWA 2H3DA 4O10A 1K8XA 1DORA 2WV8A 1W31A 1MO0A 1NSJA 1OFAA 3Q37A 4FHAA 1I2OA 4XTIA 1ONRA 2J27A 2V8ZA 4IMCA 2VEPA 3I65A 1DQXA 3GYEA 1H1YA 3B8DA 5CZTA 2WKJA 1SFLA 4X2RA 2JKAA 4FNPA 1DOSA 4QNWA 4N9DA 4JD4A 1A5BA 2GQAA 5HUPA 3TJLA 1W5QA 4R33A 2VEMA 1VLIA 3UQNA 2LLEA 2ZZ1A 1FXQA 1I2PA 1OFOA 3L5LA 1C8VA 5F4WA 4IMGA 4FF7A 2YW3A 3W9ZA 3V1PA 3WK1A 3TH6A 1FDZA 1G4PA 2ISWA 4UFHA 5EYWA 4N6FA 3W7OA 1QPRA 3CT7A 4O54A 2Z0IA 3NEVA 5EMUA 3S42A 4HSNA 3ATYA 2YYTA 1XUZA 1SO4A 3NM3A 3NQ6A 3PBUA 4TO8A 1TTJA 5K9CA 1FXPA 3P7YA 2TPSA 5CSRA 3N9RA 4A3UA 3L5AA 3NG3A 1F6KA 1OG0A 3IRDA 1QR7A 1KV8A 5A5WA 1KFEA 3KAOA 3HJZA 3UD6A 1VYRA 3O63A 2ZTKA 5I3GA 5E1QA 2GVLA 1HTIA 4AVFA 1PE1A 2AAMA 2V82A 2TSYA 1FWTA 4BWLC 1L6SA 4I7UA 3TMLA 5HINA 3T55A 4MYAA 1TV7A 1EP1A 4JY9A 3W87A 3T40A 3NDOA 3KVKA 4JTFA 4R7JA 5D05A 3A23A 1OX6A 2A21A 1GEQA 3E49A 4NJGA 1LDCA 3MYOA 3L66A 3W88A 4GFSA 5D09A 1YDOA 4QAIA 1BKSA 3HMJG 3LHZA 2QAPA 1ZAHA 3PF3A 5D2VA 5K9XA 1ZAJA 3FIGA 5BW6A 3TQKA 4O14A 2YX0A 5F4SA 2WSRA 3W7KA 1H7RA 1MEWA 5HWNA 1JQVA 2Y88A 1FDJA 3W1TA 2O7SA 3W1NA 1KFLA 2H3BA 2Y7EA 3ABQA 5FEWA 3W75A 1OX5A 3DI1A 4AAJA 3W7QA 4XTDA 4HNVA 1YTDA 2QUUA 4K6AA 4R53A 5G1TA 5CPMA 3NOEA 4CLMA 5DBUA 3IVSA 4XBKA 4MOZA 3VE9A 3EWBX 4K8EA 3R2GA 4DPQA 4O52A 2FQIA 1TYGA 3LBCA 3W1LA 4P2VA 3W2NA 4BI6A 3UWUA 4UCGA 3SI9A 4A29A 1GJPA 3NL6A 1SO6A 3MP5A 1WOBA 2P1FA 3CEPA 1VYPX 2CZDA 1TB3A 4O28A 1OHLA 5I3IA 1H7PA 1JCMP 1QDSA 2RHGA 2C15A 3M43A 4LC6A 2EAWA 5IBXA 3DHDA 4JTTA 4FXRA 3MI3A 1KM2A 4NZFA 1YDVA 4NXKA 1G7UA 4CNPA 3QFEA 1LOLA 5KTLA 1YLVA 3LTSA 3GNNA 1W3NA 1UJPA 3U6WA 4TX9A 5T26A 5LNSA 2X1SA 4WXYA 1GQNA 5G2IA 3NPXA 3N9SA 3OVQA 3SECA 2FB3A 3LLFA 3NVTA 1XBYA 3W73A 4PFMA 4WOQA 3STGA 3MYPA 4NVTA 4QITA 3S5ZA 1K7EA 3DFSA 4TMBA 3UPBA 4ZMGA 1DQWA 1LOQA 3C52A 4ML9A 5EA9A 4IXHA 2QEZA 4M6VA 1OYAA 3M5VA 4EWND 4Z0SA 1X8FA 1IGSA 3TW6A 1VQTA 4UTWA 3DGRA 3QEZA 3UXAA 3KVJA 1YTKA 4DF2A 3NQAA 1U83A 3I7QA 5LNUA 3W07A 3GAKA 1FCVA 4RX0A 2QUVA 3M1ZA 3HPZA 1YXYA 5CKSA 3LHVA 1L2UA 5BMXA 1QFEA 4XBSA 4HNUA 3S0CA 2QCCA 1H50A 4NNBA 3DFNA 2V30A 4O53A 4YMZA 1ZFJA 4K39A 5BRBA 3HGRA 4Y90A 1L6WA 4FNRA 2CLKA 2WJZA 2OT1A 4E0CA 3RK8A 2VFGA 3FJLA 4D2JA 3LHYA 1OK4A 4S2CA 4AEOA 3OG3A 3B04A 2CLEA 1ME7A 5CG7A 3IVTA 3TAKA 4WUIA 1J2WA 2HTMA 3O16A 1KTNA 4M5PA 3A5FA 4DELA 5TQLA 1W3IA 3GDKA 1P0NA 1OFEA 4CNNA 3WJYA 5CZSA 3CEUA 4N6EA 1XBXA 3OVPA 4KFPA 2YPIA 4JYEA 1EPXA 4O18A 2C3ZA 2BTMA 1T0OA 2Y7DA 4LRSA 5AN7A 4ZQOA 3PUOA 2X2GA 3GNDA 2EPHA 4WX2A 4Y6GA 4UNLA 1TPC1 4HN4A 4QQ3A 1O5KA 5LGZA 3P84A 1TMHA 3E02A 4IX2A 2A1YA 3SGZA 3S5NA 1OK6A 4CCDA 1YPIA 3HG4A 3T78A 1GG0A 3CLMA 1F6PA 2Q3RA 4O8RA 3MJYA 5HQEA 5AC8A 4AWSA 4NX0A 3ABOA 3LM7A 1X7FA 1IXQA 5TIMA 3TQVA 2ZZ3A 3MHGA 3N14A 3L0KA 3DZ1A 3KXQA 3TDFA 3TQ0A 1ZJIA 2E6DA 1YADA 4NJKA 2ATSA 4Z08A 2BWGA 1PHQA 4IGHA 3M0ZA 5J5RA 5D2XA 2FPTA 4TMCA 3TXVA 4BK9A 2OJPA 1QOQA 1DBTA 5L6UA 3E12A 4O0KA 3EX2A 4AHQA 4UTLA 1VCGA 3CM4A 1KLZA 2G96A 3UXDA 2ZA2A 4XQ6A 4NNAA 1RQHA 2IQTA 1LZOA 4Z1CA 3LCHA 3G1YA 1WX0A 3SIZA 5TBOA 2X1UA 5F4XA 1UUMA 4E2BA 1KM0A 1SPQA 3NQEA 5FF7A 3HF3A 3W7EA 1Q45A 3EEGA 1Z42A 4M6QA 3W2UA 3HG5A 3GAYA 3IIPA 1P4CA 4MJMA 2JKPA 1MZHA 4AF0A 3Q2DA 3WJZA 2EGZA 3A5VA 2R91A 4JTKA 3QMRA 3P81A 1TPUA 4YCOA 3CPRA 3M47A 3GXNA 3QZEA 5FF0A 1T96A 2V5BA 5EL1A 5CZJA 3UZJA 5L9FA 3EXRA 4X9SA 4EIVA 1K8YA 1MEHA 2V2CA 4LV9A 3G1AA 2DZSA 1J4EA 2ZTJA 1OJXA 3C2VA 4JNMA 4Z1DA 5KZEA 1GOXA 3C61A 3B03A 3T4CA 5D38A 3W70A 4LVAA 4ORMA 2QJIA 3NQFA 1JCXA 2E1DA 4Y8FA 1B4EA 1ZALA 2QCNA 5LSMA 4FNUA 2QCGA 4N9CA 4L4MA 1QWGA 4AMAA 3G8EA 1Z44A 4OWGA 2VFHA 3A22A 3MW7A 1KFJA 2RDWA 5FEZA 2VELA 4IQLA 3QPZA 5D37A 3TE9A 3PVFA 4S2BA 4PA8A 3W1MA 3LB0A 3W7PA 3B05A 3H55A 1KM6A 4WOZA 3S8HA 1R2TA 3L65A 4AHPA 2OMAA 4NXSA 2GVGA 2QCLA 2QCMA 5IM51 1GVQA 1GYLA 2W0UA 3G8RA 1AW1A 2CW6A 4X3ZA 1L9WA 3GK0A 5F1VA 4IWWA 4NQ1A 3O1NA 5CPNA 2TYSA 3W7LA 2E6YA 3RMJA 3STCA 4KWWA 4UFKA 3ANYA 3G1VA 3HBLA 1LM1A 2B7QA 1TPWA 5DCEA 3CIXA 4JTGA 1IF2A 4MLRA 3EX1A 2GPTA 4Y9AA 4DXVA 3ABRA 2TMDA 4DPPA 4LWWA 1MSSA 4LU0A 2B4GA 1TRIA 2Z1BA 1JR1A 1ZAIA 1PHWA 3FYPA 3TW7A 4W9TA 4JTEA 3LDVA 4ZQMA 1O4UA 1RQEA 1EX5A 2WSYA 4BI7A 3M5ZA 3QPYA 3TROA 1SR9A 2HS6A 2CLFA 1FBAA 4UC5A 4XWUA 4LW7A 3RFAA 4UTMA 2VKZG 5HWMA 4MYXA 1Z41A 1MXSA 2A5HA 2E5DA 2F7FA 4MFEA 2PC4A 4R34A 1TJRA 3QMTA 2DJXA 3TU9A 4UFLA 3U8GA 3B0UX 3LTPA 4O19A 4DQWA 3PUEA 2XN0A 4UFJA 1WV2A 1OX4B 2DZVA 5DCDA 3TUUA 3MI2A 5DBTA 4IPIA 3N73A 3TK7A 2C0AA 4UUIA 2ZRYA 2NX3A 1TV8A 4N4QA 2ZYFA 4O12A 1SUXA 4RXFA 2Y70A 1I2RA 1FWWA 2G95A 2W79A 3PB2A 1BWKA 1TCDA 2DZTA 4XKYB 5EBUA 1E51A 3CC1A 1DVJA 3TA6A 4DBEA 1RVGA 1XKYA 2H8ZA 1OFQA 3YPIA 2TRSA 5C55A 4KFNA 1H7XA 3Q94A 1VGAA 1EB3A 1W54A 5AYYA 3F4NA 3F03K 3W7RA 3W7HA 1F5ZA 4EF8A 1G4EA 1EA0A 1SU5A 1TREA 4EOUA 2ZA3A 3PR2A 1TTPA 5DELA 4UFIA 2X1TA 3I7SA 3NPWA 4LS0A 3NQDA 3CTLA 3WK3A 3ZWSA 5C54A 4MVAA 3KX6A 3QW4B 1GYNA 2H90A 5HWJA 4G1KA 4RLIA 1PCKA 2A6NA 2WNZA 4AWUA 1LORA 3HPSA 3WK0A 4RJEA 2VFEA 4Z1BA 2NUWA 3NQVA 3C2OA 2FDSA 1W8SA 3LV5A 2A7NA 4YL2A 1YXDA 1KV5A 3P74A 1RPXA 1LBLA 3OVRA 2F84A 2J6XA 5BMWA 2E6FA 4MUZA 4E2DA 1LRNA 3ATZA 3S1VA 1K03A 3JR2A 3R8RA 3L68A 5G2HA 4IPJA 2GQ8A 5LNRA 2ABBA 1ZCOA 4UNKA 4CCCA 1RD5A 3BARA 4WXZA 3BW4A 4Z0JA 2G5WA 1D3GA 2DZXA 4AB4A 4A2SA 4JIPA 2VXNA 3DKLA 1L6YA 1OF6A 4QSHA 3NPVA 3HGOA 1KFBA 4TR9A 1XBVA 3TAOA 1PS9A 2FTPA 4N2YA 1J5TA 2V2DA 2HS8A 3N19B 3UWWA 1FCBA 2Z6JA 4UMCA 3C56A 4E38A 2ZZ6A 3NGJA 2E5CA 1QCWA 2I14A 1S3HA 3C3NA 1JCNA 4HNTA 4CQAA 1Q6OA 3NQ8A 6TIMA 3INPA 1H5YA 3NQGA 1WYIA 2YR1A 5D2YA 1G67A 3GB6A 2E77A 3JRKA 3LI1A 3G18A 1S5VA 3RF9A 2ZRUA 4GC4A 3DAQA 5F2MA 3TSMA 1JRBA 1TPEA 3NQCA 4GXMA 4ZQRA 3E96A 2YW4A 3IEBA 3QC3A 4YCPA 5C6MA 5IBXC 3QSRA 3IIXA 2DU2A 1VJIA 3PBYA 4LVFA 1WBJA 3I6RA 2J88A 5C2XA 1H1ZA 2EHHA 1VC4A 4GUGA 2C13A 1NVMA 1W5MA 1JCLA 2ZRVA 4Q4KA 4WY0B 3P62A 1ICPA 1HUVA 2XFWA 1ALDA 3P80A 2G97A 3G1HA 4POCA 2CZFA 3GZ3A 2NUXA 1ZY9A 3DHFA 3CB8A 3UZ5A 2JGYA 4NJJA 2Y7GA 1DL3A 1LTDA 4IXXA 1FWRA 4UR8A 1FWSA 3W72A 1O60A 1PV8A 4MFDA 1EWEA 4UTJA 4GUIA 2GJNA 2FJKA 4O17A 1WXJA 3WJWA 4IOTA 1W56A 4U4MA 2AGKA 5AHMA 3BG3A 5EY5A 4ADUA 3GLCA 3VFLA 2ZCGA 3TIMA 4O11A 5D33A 2RDTA 3MMTA 2J9XA 4FIQA 5KZDA 5LGXA 3LGEA 3PY2A 3CWOX 3S1XA 1VHCA 3EX6A 4UTWC 3JS3A 4K36A 2C14A 1H7NA 3W83A 3BV4A 1JCYA 2GUUA 3EXTA 3G1SA 2CZEA 5I3JA 3WJXA 3ZS4A 1KTBA 3G1DA 3MP4A 4HNNA 2ZZ2A 1KBJA 4OBTA 3ABSA 2EF9A 1R2RA 4PCFA 1V5XA 5AHEA 3IGUA 1B9BA 1TSIA 2ZZ4A 1F2JA 5FESA 2QDGA 1HG3A 3NQ7A 1F7BA 3NL2A 1R47A 3CQ0A 3O6YX 4JTHA 1G4TA 1BTMA 4OV4A 2H6RA 1WA3A 4JYDA 1QPOA 1D9EA 3GVGA 3UY7A 3DKJA 3EWXA 5HR6A 2V2HA 1VCVA 3GKFA 3GXTA 3L21A 1YDNA 2A2IA 1PL9A 1XDMA 4GWEA 4FNSA 2I9EA 2FPVA 2OCZA 2UV8G 5HUOA 3F4WA 4JTIA 5AHFA 1NEYA 2CLOA 3B4UA 4K8HA 2CU0A 4CQ9A 3DH7A 4MPQA 1SSGA 3RNDA 3SJ3A 3VE7A 2CLLA 1GVRA 2C1HA 1R2SA 1UCWA 1SW0A 1JJKA 4NNCA 1D3HA 3NZ1A 1P0KA 5LNVA 4UTTC 2PRHA 3E0IA 1QO5A 1WOAA 1KM3A 2A6LA 2ALDA 1K7XA 4JDBA 5FI8A 3BGJA 2NWSA 3LCLA 1UUOA 1K3UA 3BW3A 3D0CA 3M16A 2ATMA 5K4XA 5LZLA 2HSAA 1T8XA 3R13A 4UTTA 4Y96A 5AHNA 5DLCA 3KOFA 4MLJA 1VCFA 3QQ0A 2VENA 8TIMA 4UFMA 1RV8A 3BLFA 4ZQPA 5FEPA 1H51A 3R12A 2J9YA 4FX6M 3VNDA 3GKAA 1SQ7A 5FF4A 1VPXA 2QCDB 4O1AA 4S1FA 2Y62A 4UTHA 4O13A 1XC4A 3C2EA 1O5XA 2EKCA 2QR6A 3CU2A 1GT8A 4FB7A 1OFBA 4GUHA 4WJEA 3KVMA 1IIGA 4GUFA 1AW2A 3L9CA 4HHPA 5I3FA 3FS2A 2H8XA 2X16A 1LRTA 1JUBA 3MI6A 4ZQNA 4P61A 2BLEA 3MHUA 4IUOA 1ME9A 4PODA 1DJNA 4OGZA 1ZENA 3TC6A 2PURA 3PC0A 4OV9A 1F05A 2JBMA 2A7PA 3NQ2A 1LLZA 4C1LA 2ZRXA 4L4LA 4LY8A 5HULA 5H2ZA 5HJLA 3H53A 3VI2A 3GDRA 5AC6A 1H63A 5DXXA 3VKJA 3PG9A 1Q6RA 4FNQA 1WAUA 4JTSA 3P5YA 2P0OA 2FFCA 1DV7A 2C18A 3FA5A 3IIVA 4CQ8A 2CZ5A 4O4WA 4JY8A 1ZHAA 1YPFA 3BG9A 1F73A 1LYXA 3CIWA 3HGSA 3N2MA 4UR7A 2NWRA 3LHWA 4PL1A 4ZL1A 4JTLA 2YYUA 1KTCA 3QYQA 1GVOA 1IIHA 3LCIA 1GZGA 2CFFA 1XBZA 2QJHA 4FNTA 3TSBA 2BX7A 3MUXA 3L0GA 3TCEA 2V0TA 4QISA 1LROA 4LT9A 4UTUA 3TFCA 4DF0A 3FYOA 3W7NA 5AC7A 1SFJA 3BK0A 4IJBA 5H91A 4JN6A 5LHEA 3G0UA 1TPFA 3GR7A 4UMAA 1O95A 4M6PA 3VCRA 5E93A 2W6RA 5G2WA 4UTKA 4PC8A 3P61A 3G0XA 2VEKA 3HQ1A 3M9YA 2O7QA 2B0MA 3T44A 1W37A 3W2MA 3STFA 3OIXA 3LXCA 3BLIA 1U5JA 1OABA 1W1ZA 3UY8A 3QH2A 4TU1A 2QUTA 1QMLA 2VFDA 5J5DA 3QSTA 4ONVA 1M5WA 2KZHA 4GE8A 1OF8A 2D73A 2YZRA 4PL2A 3EWYA 1SZEA 1KM1A 1JULA 2WPBA 4ZVJA 1Z48A 1F76A 1H62A 3W71A 1ZNNA 3W1PA 1FY6A 3W2JA 4H6KA 1G7VA 3FKRA 5DXYA 1QOPA 3LXAA 3H54A 2I1OA 2B7OA 2NXHA 4H4IA 4MY8A 1TPVA 1QPNA 3PSWA 3NO5A 3FJ6A 4JS3A 3P67A 3RLUA 1XDLA 1TTIA 2PE4A 1JUKA 1AW5A 3BPWA 5KITA 4N9BA 4AXKA 1QO2A 3OEXA 5AFDA 2QDHA 4DF1A 1JRCA 2DORA 4GRSA 3M5XA 4DO5A 1FWNA 1VYSX 1GTEA 3NM1A 3THAA 1SZNA 1BEUA 3TXZA 3W3OA 4PH6A 1FUYA 5GVJA 4XZ9A 3B0VC 3GDTA 3C6CA 5KMYA 2YXGA 1EIXA 5FEXA 1RR2A 3WFAA 3UWYA 1ICSA 3W1QA 4JICA 3SZ8A 2NX9A 2B7PA 3R5EA 4WQ6A 4PEKA 2Y63A 2A0NA 4DEFA 4JTUA 3O6CA 3SSJA 1OFRA 3LRLA 3ZFHA 1NF7A 1W0MA 3S6DA 3FKKA 1I2QA 1JVNA 3N2XA 3HG3A 3W6YA 1UBSA 1A5CA 2E09A 1G69A 3RU6A 1UB3A 1C29A 1C9DA 3PUDA 4ICNA 5K3VA 3NAVA 3MBDA 2BXVA 4RZ4A 1GTHA 3PBWA 3PAJA 1LLWA 1KLYA 1CW2A 3QRHA 4YWIA 4LRTA 1TPB1 4M7TA 2B7NA 3W1AA 3BO9A 3LV6A 2JGQA 3FEMA 1XUUA 3S1WA 3L2IA 3LCWA 1B4KA 4XKYA 2ZZ5A 3QF0A 2OX1A 3G3MA 5U7SA 3B0PA 3MO7A 4YXGA 1G6CA 4JYFA
chains in the Genus database with same CATH superfamily
4HA3A 5RUBA 5HPOA 3GHSA 3UBPC 5J8LA 3W86A 3VNYA 2PCEA 3KOYA 1M7OA 3LCGA 4QROA 4QSFA 4HNOA 1S2UA 1THFD 5AKQA 1J6OA 3W7GA 1O7AA 2OZ8A 5HMSA 3UVIA 3DBPA 3K5XA 3ALGA 1GOIA 1R9ZA 1O94A 1W3TA 3EKLA 4WZHA 1V3KA 3LCXA 1CXLA 3NXFA 4LS2A 4A8LA 3UWQA 4CD6A 5JBFA 2J6VA 2A4AA 2VHLA 4GI6A 5GQBA 3WQ6A 1JPHA 1MDRA 4A4AA 3W1XA 5C2GA 2YA0A 3EMZA 3APTA 5D9MA 3TYUA 1OC6A 1Y7VA 5D02A 2IKHA 4HIBA 3RPMA 3PBMA 4A22A 3C8FA 3GVWA 4M8UA 2X0SA 1Q6FA 3NJ3A 4A2RA 3SCPA 3QQ1A 5CH9A 3W2KA 1JPKA 3T8QA 2WWDA 4FEZA 4TTUA 2GGJA 4O57A 4IGMA 4QJ1A 3GX9A 2NQ9A 4B5NA 3EXSA 4DO4A 2Y24A 3EDEA 4QG6A 1TPDA 2HEJA 4F66A 1MEIA 2BGNE 2R9RA 3DFOA 1B54A 1IXNA 1U1HA 4AD2A 3UPWA 2OT0A 3WLRA 3ZJKA 3RLVA 2P8CA 3H7RA 2V9DA 2ZUNA 4XVEA 3VYLA 4F0MA 4DUVA 4C5ZA 3S5SA 3P60A 5CGQA 4IPNB 4K2SA 1XLFA 5BOOA 2HROA 4UZSA 3AO0A 1SZGA 4O1FA 3GC2A 4H9XA 2QAFA 1FWBC 3LTYA 4AYSA 3O07A 5I0DA 5JH2A 1XLDA 1IWAA 2X42A 3PZOA 3EYPA 3HIJA 3TTOA 4ZENA 3GDLA 4H19A 4J3VA 4RDWA 1DIOA 3MO4A 2VZTA 4W85A 1W9XA 2JF6A 4IZGA 1TG7A 1XD1A 1WBHA 5CJ5A 1LOSA 4HU8A 1JQXA 1AMYA 1Y5WA 1R6WA 2P53A 1A5KC 2P88A 1E0XA 4WY0A 3FNDA 1LLOA 3OU8A 4IIGA 4KS0A 4MY1A 1XGEA 5D8ZA 4HTBA 1J5SA 3EA3A 1NFPA 5D03A 1QNQA 3KDNA 1SO3A 3DU0A 2V5LA 1EUNA 1SO5A 3O8AA 4LUJA 1J18A 1YMYA 3SGGA 3BGAA 1EDTA 3H2CA 1J0JA 9CGTA 4YTSA 3CUGA 5BU9A 4GISA 4IIHA 2QVHA 3IV8A 3QMSA 3T9PA 5I6SA 1OD0A 3L23A 1Q8JA 3T81A 3PG8A 1AL8A 2RKXA 3H2EA 1T6MA 3BMXA 3RGTA 2X1IA 3RM9A 5A8GA 3QVQA 4I7WA 3PZTA 4IX0A 1MQPA 4BFAA 3VD9A 1P5BA 3ABZA 3PS7A 1NWUA 1VJSA 1ZJHA 3B8TA 5AYZA 3QC0A 4IFRA 7A3HA 1TUXA 1E56A 6CGTA 2V6AA 5BNKA 1JCJA 6XIAA 2Z6IA 1W9UA 3B06A 3H70A 4H01A 5FJOA 1QT1A 3A3XA 4BHYA 1OFPA 3FOKA 3P8IA 4AH7A 3UR7A 4XAZA 4D9PA 3GTFA 2YXOA 4LAUA 4QBXA 3WJSA 4YN5A 4C1KA 4QM1A 2RJGA 4WIWA 4GNJA 1Q6LA 4OECA 3PNUA 1N7KA 1R8LA 2PDHA 4MKSA 1A50A 1K4GA 4XUGA 1JYWA 3IARA 1K1DA 2D3LA 1GYMA 2BSLA 4M1RA 2D0HA 2BHZA 2BODX 4EVZA 1CGYA 4P7RA 3TYDA 4DM1A 1F3XA 3VZYA 1CZ1A 3CHCA 4IL2A 5EMYA 3CAWA 3DFYA 3TSDA 3EDJA 3BLKA 3GD6A 4L61A 4YS1A 4L1XA 5U4NA 5XIMA 1AH3A 3HO8A 4RV8A 3NL3A 4LSBA 1LF1A 1XW8A 4KWVA 5CPOA 5D9OA 1BYBA 1WQ5A 3PM6A 4C6MA 4IMEA 4JX6A 2NXIA 2WLYA 4D6JA 3KM8A 2VCAA 4WGXA 2DUAA 3M7WA 4GK8A 5DCBA 1ZU8A 5F2LA 1QPQA 3MA8A 3EMCA 2BP1A 1KC7A 2X1RA 2WVUA 1H61A 2FPYA 2FTYA 2VOMA 1AK5A 1RY0A 1BG9A 3IJ6A 4M24A 4W8BA 5LIWX 4HPNA 2YCJA 5I5RA 3MHFA 4QX4A 2QCHA 3HPXA 1H60A 1CLXA 1QVBA 3GG8A 1IXOA 2PDXA 1WDQA 1QOXA 3G6MA 2F9RA 4JAWA 2G41A 3HGJA 4J2PA 3QLLA 3AS2A 3LX9A 2E5BA 4JIRA 1QK2A 5C71A 4HK7A 1JZ7A 4IPPA 2VP8A 5I7GA 3LPFA 3EGJA 3WH5A 2YIHA 2G3JA 2QPSA 3RUBL 2OZ0A 1XINA 3VMNA 3O6DA 1S2VA 2JEPA 4Q33A 3LZ5A 3WY1A 5JIWA 4MGGA 4J27A 3ANUA 3DHUA 2XG9A 3LRMA 3BJTA 4E8CA 1BRLB 5F2GA 1JF5A 2X7WA 4FIRA 2EG8A 3MBFA 4IMAA 4OOZA 4ZA0A 1ZRQA 5D2TA 3W1UA 1BXBA 3I10A 2PCQA 5F1UA 3H21A 4BR1A 1ECEA 4N4PA 1XJBA 1W17A 2BB0A 2PF8A 4GCAA 4LUSA 3TONA 1KBIA 3DOPA 1HO1A 1JD9A 1JZ3A 3LERA 2WMJA 2DQXA 1Q13A 1UIOA 1UKPA 2PP0A 5HJXA 2Z1VA 1LWHA 3ZO9A 4OBRA 1IE7C 3M5YA 1SW7A 1VZWA 1OBAA 3KHJA 3S5YA 4Z1AA 1KFKA 3NPUA 3W7IA 1K7FA 2QCEA 2WJFA 4QS6A 4GYPA 4X0VA 1HF6A 1N82A 3NQBA 3VKDA 1M7PA 3TWAA 4S3DA 3W22A 4ZTYA 4M1BA 3ZMRA 2ZRWA 1NDZA 4IIBA 1VLWA 2FB2A 2DJLA 1R3TA 1RZMA 4RR4A 3IV3A 3TN3A 4PGLA 5DMMA 4O10A 4M80A 1K8XA 3WUBA 2WV8A 1MO0A 1O12A 1U1JA 4PN2A 3WEOA 2D23A 2ZXQA 4JHOA 4XTIA 1MQQA 3KWXA 3I65A 3B8DA 4FLQA 1PX3A 4HYWA 1E6SM 1SFLA 1K9DA 5DT7A 5FJPA 4N9DA 1W5QA 5EMJA 2VEMA 4RE0A 3FW6A 3N04A 3SY8A 1I2PA 4H8HA 4DIAA 3N6HA 3N6QA 2XFRA 1G4PA 1UH2A 4QLLA 1QPRA 4G7EB 3CT7A 3K4DA 2Z0IA 3NEVA 3K4AA 3S42A 4TO8A 2VWTA 1FXPA 4JN7A 3DESA 2DT2A 3AJ7A 1E0TA 1OG0A 3IRDA 1QR7A 4D6CA 1TUFA 1LQ2A 1CCWB 3TYCA 4HVXA 4AVFA 4AVNA 2AAMA 1A5UA 1H0GA 3TMLA 1TZZA 5MKGA 4MYAA 1TV7A 5JUVA 4S38A 4V1YA 1J0IA 2J7BA 3SBFA 3T40A 3NDOA 2WAGA 1GEQA 4NJGA 7ODCA 1LDCA 2PLJA 1BKSA 2QAPA 1JDAA 3DUGA 4IJCA 2VM8A 3IAQA 1BLIA 5K9XA 1ZAJA 3VKBA 3TQKA 2ASHA 1P43A 2YX0A 3W7KA 1PWMA 5CG0A 1KGWA 1REQA 4A8NA 2C1IA 4D71A 1FDJA 4EXQA 5C9WA 1OCNA 4KWOA 3REQB 3W1NA 3IPWA 4HCHA 3WDQA 2GK1A 4B15A 5FEWA 3W7QA 3NO1A 1E6QM 4HNVA 3V0SA 2GGGA 3H2MA 1EF2A 4DPQA 4D1IA 1TYGA 2YOCA 3W2NA 4W84A 4BI6A 3EPNA 1GJPA 1T7LA 3AICA 1YNYA 3NL6A 1V0KA 2XSAA 3MP5A 1WOBA 2HXTA 4X0NA 1B3YA 2HCVA 2CZDA 2G8ZA 1OSEA 1OHLA 2L5HA 2RDXA 4IF2A 1JCMP 3BWWA 5HNUA 5IBXA 4Q8MA 3T2OA 4FXRA 1KM2A 2FVLA 1MI3A 1UP0A 4NXKA 3N18A 1PKLA 4UQCA 1FOBA 1YLVA 4XZWA 3KL0A 3DX5A 5LNSA 4B3ZA 2X1SA 2INFA 3NPXA 3OVQA 3R4IA 1XBYA 3GFXA 4R88A 4QITA 5ABEA 2VGBA 1O5RA 4JQAA 4AG0A 1EBGA 4DJEA 1DQWA 3C52A 2Q6ZA 3M5VA 3VKCA 1IGSA 3H7UA 1FWJC 1IEVA 1VQTA 4UTWA 3WQWA 1YTKA 2HPMA 4DF2A 4E4UA 2RUSA 1FP8A 5LNUA 4P8WA 2Y8VA 3W07A 3I3BA 1N8IA 2OQYA 2O9TA 1MRQA 3A6OA 1BXNA 3FAWA 1OEPA 2RGLA 2XISA 2Y5JA 3E2QA 4OBSA 4ROQA 3HGRA 3BZJA 1L6WA 4NG3A 1FWHC 3ZSSA 4D8AA 2QDDA 3VIJA 5ABFA 4ECLA 3FJLA 4HU4A 4UBPC 2PWEA 3U2EA 4NAEB 4NZCA 4S2CA 3OG3A 6XIMA 2CLEA 4MADA 1E4LA 1WDSA 4D72A 4WUIA 1PKNA 2HBXA 1KTNA 3RDKA 3AUOA 4DELA 2VR4A 3LM3A 2PP1A 1W3IA 4XK2A 5TQLA 1P0NA 1OFEA 4CNNA 1GGOA 3E0LA 3CEUA 4N6EA 1XBXA 2ZUMA 4KFPA 4X63A 4JYEA 3VD7A 3SIMA 1XD0A 2Y7DA 5DRCA 4DAFA 1HZYA 1GEHA 2BY0A 4H8UA 3CV2A 4UNLA 1U1UA 4HN4A 2NQ5A 2BDQA 3JZUA 2BFGA 1O5KA 4L65A 3P84A 1TMHA 3ARUA 1NARA 2A1YA 4IX2A 4RNJA 1OK6A 4HK5A 3IJDA 3FA4A 2PZNA 2EPNA 5HQEA 1OCQA 5AYBA 4AWSA 2Z1KA 1W1TA 1RHCA 1HVQA 4WDWA 1IT8A 1EIBA 3W53A 1YADA 2ATSA 3AWOA 3RR1A 4IGHA 3M0ZA 5J5RA 1V3HA 4W86A 1KWGA 2FPTA 1WZLA 2PGRA 5T9BG 4JKKA 1E0VA 4W87A 2C79A 2G3FA 3EX2A 4UTLA 4GKLA 3CM4A 3UXDA 2ZA2A 3LGDA 1LZOA 3B0XA 4WKAA 1WX0A 1XIBA 4E8DA 3N12A 4M3PA 1GQJA 1UUMA 5HNTA 1E6ZA 1KM0A 4DN1A 1I0DA 3NQEA 4LBUA 3HF3A 3W7EA 2MNRA 3J7HA 1DJZA 1JZ4A 4M6QA 3W2UA 3GAYA 4MJMA 1SVDA 1DIKA 3Q2DA 3GU2A 1BTCA 1HJXA 2D69A 3QZEA 1RXOB 5EL1A 2NW0A 1DJXA 3S6OA 3WF1A 5CPTA 5CZJA 1PZ3A 4CN6A 3UZJA 4M82A 5L9FA 1Q4NX 2BOEX 1A47A 4XAPA 3N1AA 1UR9A 4BZYA 1K8YA 1MEHA 1KBBA 4D6IA 3MV01 3G1AA 3B8IA 1BVWA 4JNMA 3KE0A 4Z1DA 3P0WA 3B03A 4F2BA 3WQFA 3WD4A 3AIVA 2QCNA 4FNUA 1QW7A 1X39A 4LYRA 4C5YA 1XRVA 2VZSA 5FSEC 2ZUTA 1EXBA 4ILSA 2VO5A 1Z44A 1MUMA 1RD6A 3VIPA 1KFJA 3WO8A 5FJIA 4IQLA 1W3KA 5D37A 5HQLA 1SJBA 5GJMA 3V5OA 3AU2A 1M7JA 3GBEA 3KBSA 4C91A 4PUDA 1KM6A 3L65A 2CITA 1QI3A 5JBEA 2W92A 3SRFA 2QCMA 3BJFA 1Z89A 1AW1A 2CW6A 4X3ZA 3GK0A 1J93A 3HFYA 4MSSA 4IWWA 4J1OA 3VNZA 3W7LA 2E6YA 2PSNA 3UPMA 1RJRA 2QQ6A 3HBLA 3VFCA 3CIXA 4JTGA 3K1GA 3Q4DA 2GJXA 1HIZA 3EX1A 2GPTA 2GSEA 4DPPA 2CHNA 3W6LA 2Z1BA 1JR1A 4MB3A 1JZ5A 1XCWA 3TW7A 1G1YA 3KOWA 6ENLA 4XD3A 1C7TA 4ZQMA 3QHOA 1RQEA 1XYFA 2EJAA 2ZUUA 3QPYA 1SR9A 2HS6A 1GOKA 4LW7A 3RFAA 4TVCA 3L4TA 4X61A 3SN4A 4MFEA 3CMGA 4JL1A 2DJXA 1SR0A 1YKWA 3U8GA 3LTPA 4DQWA 3PUEA 2XN0A 4GO8A 3XISA 4HCDA 3F5KA 5DBTA 4IPIA 3ZJ8A 3N73A 2WLZA 4IJRA 1IGWA 1A4MA 3QV7A 1SUXA 4GVHA 3ZLFA 4RXFA 1KQZA 1R9YA 3TN6A 3PB2A 1BWKA 4XKYB 3EWCA 4GGBA 3RN6A 1GQIA 1XKYA 3WQVA 3MTWA 3YPIA 1R85A 5C55A 2FDMA 2ADAA 4GIRA 1VGAA 2REQA 3KW3A 4W8LA 1FH7A 5M3WA 4C6KA 5I79A 3L4ZA 3SQSA 1TTPA 2YLLA 4WGHA 4UFIA 3I7SA 4L6OA 1XYZA 3NQDA 3ZWSA 1U5VA 4QCEA 4NRRA 1GYNA 4G1KA 4AIBA 3CB3A 3EA1A 4D6GA 3UG4A 2GOKA 2A6NA 3GFZA 1LORA 7ENLA 2EPOA 1LL4A 4PRTA 2HDJA 4JFUA 2IKJA 1GHRA 1W9DM 1C92A 3NQVA 3GG0A 2FDSA 1JDEA 4C6FA 5C0QA 3H2AA 2A7NA 4YL2A 1L2QA 3NZGA 1PBGA 1HJVA 2XWDA 1LBLA 3MCMA 2J6XA 1LRNA 4CEXC 4DJED 3DCPA 2Y1HA 1XLBA 5BXRA 1UP3A 5LNRA 1LQ0A 4I9JA 4WXZA 2G5WA 3RX2A 1EJ7L 4PCTA 4ZFMA 1XSKA 2DZXA 4QXIA 2HE8A 2BY3A 3G2GA 4XKMA 4ZE5A 1FA2A 3V0UA 3HGOA 3H8AA 4Q6XA 1XBVA 3TAOA 2FTPA 4MWAC 1AVAA 1J5TA 2V2DA 3CYJA 4WDUA 2RJHA 1UR1A 3N19B 4LH8A 4Q4MA 1G9HA 2CEQA 1EPVA 2I14A 3ARVA 4EX4A 1S3HA 3C3NA 1JCNA 4GVIA 3HMCA 4CQAA 4J3ZA 4MNMA 2GFTA 1Q6OA 4G5DA 6TIMA 1MFVA 1WYIA 1ZBVA 2OKOA 3V4BA 1G67A 2E77A 2A3CA 1S5VA 3RF9A 2ZRUA 3N2BA 3C86A 4ZQRA 1WDRA 2J74A 2YW4A 3M0IA 2PGFA 5EBAA 3ES8A 1NU5A 3IIXA 2WSKA 3PZMA 1XLJA 1E15A 2R82A 4LVFA 3TP4A 2PWFA 2WBKA 3UU0A 3DFHA 2C13A 1SJDA 3WNPA 2G97A 1FHDA 2NUXA 3F5LA 1ZY9A 3DHFA 3CV6A 3UZ5A 2JGYA 1UKOA 4NJJA 2Y7GA 3WLHA 1DL3A 4DX3A 4WKFA 1O60A 1TE1A 2GJNA 3HM7A 1WXJA 4IOTA 1W56A 3B4YA 3BG3A 1US0A 3GLCA 2X05A 2ZCGA 5JIPA 3MSYA 2RDTA 2J9XA 4HA0A 3S4TA 4PRRA 1IWBA 3PY2A 3UP8A 5CAHA 3VOIA 1KR0A 2DW7A 5CC7A 1JCYA 4Z2LA 5I3DA 2J7EA 2IPFA 5BOEA 1EZWA 1XH1A 1KTBA 1MXDA 5H8PA 3LZ3A 2ZZ2A 1UW9A 5A8OA 4D1JA 3ABSA 1TVLA 3T42A 2X2YA 1BGGA 1R2RA 2PTYA 1V5XA 3IGUA 1B9BA 1Y5VA 3ME3A 5FESA 3ITLA 1HG3A 5BXPA 1F7BA 3PBGA 4DWSC 3USZA 4UOJA 2H6RA 1WA3A 2O0TA 1QPOA 3UY7A 3DKJA 1LUCB 4QAWA 4PUKA 4W7VA 2V2HA 1VCVA 1YDNA 1NOFA 1XDMA 2FPVA 2OLAA 4NZ1A 3DGBA 2PD5A 3CL7A 2WHKA 1MMFA 4K8HA 3DH7A 3RNDA 5GJNA 3SJ3A 3VE7A 4BCEA 3WQ5A 3ZT6A 4NNCA 2PLMA 3PJTA 2J78A 1P0KA 4RNFA 3QKZA 4C6JA 3VOCA 2ALDA 2CERA 1R87A 1K3UA 5H6HA 4PB3A 3D0CA 4J3XA 4Q8QA 4C1NA 3MB9A 1J0ZA 1UWTA 1T8XA 4QLJA 1PXGA 3KWSA 2OPJA 4I8YA 1VCFA 4QS5A 3A64A 1VEOA 3QQ0A 8TIMA 3C0QA 4HGXA 1RV8A 3B8WA 3SSZA 4R27A 4ZQPA 2VTFA 3DYOA 3CQJA 4BY3A 4Q3MA 1SQ7A 3LPGA 1VPXA 2Y62A 1XC4A 3WN6A 1O5XA 2PDNA 1XLLA 5TD4A 4XZHA 1ODUA 2GYIA 2FKPA 3KVMA 3CH0A 3P2VA 4GUFA 2VCCA 4GLEA 4Q8TA 1QU4A 5I3FA 3FS2A 1EDQA 4LY4A 4RPQA 4F79A 1JUBA 4BQ3A 1O68A 4ZQNA 1GQLA 2BLEA 4IUOA 3MCOA 4KIRA 5I06A 3NIYA 4JTCA 2PURA 1L8PA 2ACUA 1VFLA 2WPGA 4ICMA 4KESA 2A7PA 3NQ2A 3IUHA 2SFPA 1LLZA 4C1LA 5HULA 5H2ZA 2G4FA 5TAOA 5C7VA 2XSBA 2ZADA 3B8VA 2DT1A 2PAJA 4AQLA 4URIA 1WKEA 1RA5A 1Q6RA 5C9ZA 2CCRA 2F6KA 3P5YA 4RDYA 1ZCCA 4ZXLA 3HGSA 3GH5A 4NKCA 3K8KA 1GVOA 2DSUA 1GZGA 4Q7NA 2BVDA 4C6LA 3VUPA 3OLIA 2R1NA 4BS0A 2XIMA 2V0TA 3E0FA 4UTUA 3ZXWA 4W7UA 4IJBA 3ZYZA 1HQTA 1WXYA 4JN6A 1CTNA 3N2TA 4M51A 1GUVA 3Q65A 5E93A 2AOSA 4FP1A 1Q2RA 2FGZA 5CC3A 4NRSA 1XRFA 3HQ1A 3AHZA 2A79A 4XD6A 1W37A 1DEDA 3W81A 3EOSA 4GFIA 2CHRA 2IW0A 5A2AA 5DO8A 3T2QA 2VRQA 1M5WA 1RCXB 3D5HA 3EWYA 3CTTA 3UVAA 3MY9A 1Z48A 1W2PA 2ACRA 3VABA 4ACYA 1PYMA 1F76A 2WYSA 3OODA 3W1PA 3SJNA 4W8AA 3SRDA 4TVUA 3WLIA 1QOPA 3H22A 1E1CB 3ECQA 3W02A 3CBWA 3H54A 2NXHA 4GA8A 1D8WA 3TLQA 1BRLA 1V6UA 4JS3A 4JL2A 2DUXA 4B5XA 2OLHA 3AS0A 1WZMA 3FSUA 4O8AA 4XZMX 5IOBA 4U2ZA 1FHVA 1TTIA 2PMQA 3WLLA 3RCYA 3GRIA 2WMIA 4N9BA 1UWRA 4AXKA 5AFDA 2QDHA 4DF1A 1JRCA 1HVXA 4GRSA 3M5XA 4DO5A 2QUNA 2PBOA 3SQLA 3GG1A 3W3OA 5GVJA 3RRAA 3OJGA 1KGUA 3C6CA 5FEXA 3PTDA 4ZB2A 1ICSA 4US5A 1C8QA 4PEKA 2Y63A 5BZAA 4GNKB 4DEFA 3LRLA 1RJQA 1S2CA 1W0MA 3AYSA 1TZ9A 1AQ0A 3N2XA 3HG3A 1EL3A 3WKZA 1V03A 4R9OA 5LIKX 4UQAA 1UB3A 5IDIA 2AL2A 1C9DA 3WLPA 1PEZA 1E4IA 3NAVA 3MBDA 2BXVA 1PX4A 4K1WA 4RZ4A 3PBWA 1W1A1 1KLYA 2QGHA 4Q8OA 2PDGA 1S38A 1A3XA 2W61A 3G77A 1TPB1 1ODZA 3BOFA 3GWQA 3BO9A 2QT3A 3R8GA 1JPMA 3FEMA 3LPOA 1S1PA 5FCZA 3LCWA 3PAOA 5D4YA 2IQDA 4YXGA 2E28A 1G6CA 1KXTA 4GY7A 2GJPA 2E9LA 3MMWA 3R43A 5A8PA 4FOUA 2GJLA 5CZ0A 2ISSA 3QKEA 5LIUX 1WUFA 4D8LA 4GJIA 1FH8A 2Q02A 2NV9A 2O9PA 1ZL1A 1E1EA 3PZGA 3AOFA 3FGCB 3P82A 1AG1O 2P50A 2Y8KA 4NT0A 3VNKA 1GOMA 3BAIA 3KBNA 1HKKA 2FMOA 3IJ8A 5EU9A 4CCEA 4NHVA 4I3GA 1XDJA 3Q45A 4HNLA 2GVJA 2ZFAA 1B3XA 1XM3A 3MKVA 4XIAA 2FIQA 1W91A 3IJ9A 4W7WA 1NDYA 1LCOA 3ARRA 2DT3A 4N02A 5CGTA 1DHPA 3BG5A 1ZUAX 1XYLA 1POJA 1TVNA 2WKGA 1ISXA 1ZGDA 2ZE3A 1TQJA 2ZQ0A 5FOOA 1XI3A 3BW2A 2E1WA 4AWEA 3ITXA 2DZPA 3KRUA 4K1GA 1IV8A 5I3KA 2VC5A 5H8UA 1EJTC 1KA9F 1V02A 2PRMA 1V0NA 4UZUA 1UD5A 3VCNA 3ZLHA 4N42A 1XL9A 1DJWA 4MWAB 4KKXA 1ICQA 4KWUA 1PYFA 1E71M 4BWLA 5REQA 4R85A 1PIGA 3O15A 4QDMA 5DY2A 5MHBA 2DSWA 3I68A 4O1BA 3NCOA 3MSRA 1FQ0A 2J13A 5EPDA 1U30A 1BVZA 2ON3A 1PUDA 7REQA 3ZR4A 3VPLA 1ZBCA 3AIUA 1EJVC 2VDHA 2R94A 3L5MA 2ZX7A 5FA5A 1GORA 3FK4A 1V7YA 2OX4A 4HHLA 1YE4A 1U33A 1QRQA 1LBFA 3OHIA 3KOZA 3ZSTA 2WC7A 4CQDA 4KT2A 2HXUA 1F3TA 1GHSA 1R3YA 4E3TA 4PR4A 3OA3A 2JE8A 4X22A 3W7MA 1XWYA 3WD2A 3BCFA 3FEQA 1JUEA 4Z2HA 4DO6A 3N2CA 3KP1A 4ZOCA 4GI8A 1TV5A 4JX5A 3ZZ1A 3UXLA 2R8WA 4LCSA 4TOQA 1QBAA 3S5OA 3WQCA 3H2OA 4MWAE 2NUYA 3AXHA 4HT3A 1FX6A 1TJ1A 5A3HA 4J5NA 2QMKA 3QR3A 3C2RA 5FSDC 2ZIDA 3K8MA 3DN5A 1K8ZA 4G8TA 1E70M 4DBDA 2HPIA 3MCNA 4QG8A 2CLHA 3IACA 4J9JA 2DY3A 3GBDA 4J2MA 5CBJA 1FFRA 4A35A 1R3VA 1MFUA 3OBKA 2POZA 3Q58A 3MWAA 3E2RA 1XICA 1PJ9A 4I8DA 2OEMA 5J04A 1GKRA 1CECA 2IPJA 3L2MA 3BJSA 3SADA 4DWSB 3LCFA 5M1TA 5A6LA 5KETA 4Q4SA 5LXEA 2PTZA 2ZKMX 1O1ZA 4U2YA 4UXDA 4B90A 4OOUA 3PPHA 2P76A 5M17A 3LXBA 4BF5A 1H49A 1JGMA 3EOOA 1SSDA 4H9ZA 2DH2A 1QNVA 1UPPA 3CHFA 1TWZA 3NVDA 3CV7A 4LUYA 3DG7A 4PUEA 1K9EA 3TJIA 4RCXA 5DN1A 2VL4A 1FWDC 3V36A 3KRZA 3QFWA 3O6AA 4Q7BA 1LBMA 3P3BA 1J01A 4EXAA 1Y0EA 3U2ZA 1XQKA 1JAKA 1XIIA 5BCAA 5CQ1A 4AD4A 2Y6ZA 3G3DA 3VILA 1B57A 4GHRA 1PZ0A 2NV1A 2ZDRA 5HBFA 3DFQA 1XCFA 2FFIA 1ITCA 1KFWA 1XQLA 2NLIA 3R0KA 4GBDA 3BOLA 4UTFA 2X0YA 1UZHA 4INFA 4FZIA 4DZHA 3MC5A 2QCDA 4RZ5A 3WLKX 4REQA 2PS2A 4UNIA 4UIOA 2NX1A 4F2TA 4J35A 4C7GA 4LVBA 1J10A 1XYAA 1H1NA 4NL1A 4IMDA 4F48A 4F0HA 6REQA 2A3EA 4PTNA 4S3FA 4LAKA 4US5D 2GGIA 4O15A 4GXWA 2PI6A 7PTDA 2NSXA 3AROA 4JTQA 3CHVA 4WF7A 2RFGA 1EGVA 2FLIA 4HCLA 4GI9A 2WMHA 4S3AA 2Y89A 1YEYA 2J7FA 1KCZA 1CGTA 4QNEA 1FDYA 1VR6A 1GVSA 3MUAA 4NI8A 5E0KA 3S2LA 3B9DA 3UCCA 3PULA 3SURA 4YPJA 5AHLA 4P8VA 3WBXA 3F5JA 4F2UA 9XIAA 1TO3A 4OU1A 2O92A 3MS8A 4D8ZA 3PK7A 1ME8A 4NX5A 5AYXA 2WQPA 2GJRA 3K46A 2NVDA 4GIYA 2V3EA 4GD0A 1SJAA 2Z2AA 3WIJA 1JCTA 4KW2A 5FJTA 5HNRA 3HB9A 4AHOA 4P8UA 4FLRA 3P8JA 3KP0A 1K02A 3U48A 3LMZA 1XGZA 3P5ZA 1EEPA 1YTEA 4NZJA 3FDKA 5A8NA 8XIMA 3DHPA 3V1HA 1LQAA 4ZQCA 3BVJA 3JU2A 3B9NA 3PWAA 1TRDA 5AHIA 1EF3A 2PDIA 1UC4A 5SWUA 2Z7GA 3FVDA 4J28A 1NAL1 5LKYA 4P7QA 3PSVA 1NWSA 1PTGA 3DECA 2QCFA 3SGUA 3EX3A 4HZ8A 2ISVA 3WQPA 1XIJA 2ALRA 3XINA 4GXPA 3DENA 2OG9A 2JFEX 4MIMA 3HPAA 3KEHA 5I2UA 5D30A 1W1YA 1SW3A 5LHFA 4DXXA 1C90A 1MW1A 3O06A 4GQBA 5I78A 1RCOB 1X6UA 4PTVA 3THUA 4HZ6A 4ALDA 3QXBA 1XLGA 4K8GA 1QHZA 2ZVIA 4ZO6A 4IFKB 4I7VA 1SJCA 3EOUA 4OKDA 1UH3A 3WQEA 1UASA 3JUGA 1ECQA 2VFFA 3KHDA 2QMJA 3EWWA 5LA0A 1XLKA 4NZ3A 5C5YA 3OLDA 3GNPA 5B80A 3O05A 3WLOA 3BZGA 3MVTA 4PCPA 4AX7A 1B3OA 3TKFA 2NZLA 3WDRA 1J0HA 2WZHA 3S2MA 4HB7A 5A69A 5LIYX 3WD1A 1I1WA 1W31A 2EKGA 4FI4A 3WBAA 4TX8A 1XKJA 4IMCA 2XVNA 3GYEA 5CZTA 3TTQA 3ANVA 2Z2BA 3JW7A 3SRKA 1EEXA 2HNEA 3NSMA 4QNWA 4E2VA 5FJUA 2I7GA 1A5BA 3SM0A 1KCKA 3BDKA 1W1B1 3VDHA 1UHVA 1LG1A 1ISYA 1DXFA 2LLEA 4M29A 1OFOA 1C8VA 1NQKA 1VKFA 4FF7A 1M03A 3WK1A 3FHAA 1FDZA 2E67A 2Z1WA 3RLGA 4UFHA 1R3SA 4LNCA 3LEPA 4O54A 4F0KA 5EMUA 4JNZA 1PPIA 1K6WA 1P48A 2YYTA 1XUZA 3NM3A 3NQ6A 3EEZA 5K9CA 4XG1A 1LL7A 4A3UA 3L5AA 1ZLPA 2FZ8A 4FR1A 1KV8A 1KFEA 3KUMA 4MB4A 3KAOA 3UD6A 4AZCB 1P0BA 1HTIA 3AXIA 1AUSL 1PE1A 2PZ0A 4GZIA 2I5QA 4PMQA 2TSYA 1FWTA 1L6SA 3BAWA 3T55A 1CB7B 3UWEA 2X40A 3FJNA 3BL3A 4JY9A 2OGYA 4LB4A 1OX6A 1RP8A 1UD3A 2DQWA 3VD5A 5DF0A 3OYZA 2YCLB 1ZAHA 3NTYA 4H9VA 2PWUA 3CUHA 1JD7A 4O14A 4Z2GA 1UIPA 5KZ6A 1H7RA 1XISA 4C6QA 1BQCA 1W1PA 1DWHM 3M4HA 3HZ3A 2Y7EA 3T09A 4D6EA 1T5AA 4S23A 4XTDA 3GVVA 4R53A 2QUUA 4XUYA 3M0MA 3QV8A 2V3FA 4GY0A 2OSWA 4XBKA 3GNXA 4CU6A 4MOZA 1P6BA 4XX6A 3H24A 1NWTA 3VOGA 2FQIA 3LBCA 3W1LA 4P2VA 2CBIA 4A29A 3W38A 1HKWA 1SO6A 1UKTA 2P1FA 5C2CA 1VYPX 5A95A 2HRWA 1CGXA 1TB3A 2CHOA 1BYCA 1H7PA 1E0UA 3KBVA 4LC6A 3S2NA 4JTAA 3WEZA 3IRSA 3TQPA 4NZFA 4WDXA 1S5MA 3VOHA 2HISA 3MZNA 1G7UA 3VZZA 3QFEA 1LOLA 2BG5A 5KTLA 1GQKA 2YB1A 4FOJA 4QEEA 1V6TA 2XJ7A 1VEPA 5T26A 4GACA 5BWFA 4XZIA 2BXYA 4WXYA 3A13A 3MDWA 3N9SA 1E6NA 3LLFA 2NQLA 3H2NA 4E4FA 4WOQA 2ZXAA 1XLCA 4PMXA 4PMJA 4U5KA 3DFSA 3UPBA 4ZMGA 1E6XM 2WZEA 3POCA 3WLSA 1FWFC 4JIHA 1LOQA 5BXSA 5EA9A 1GZ1A 4IXHA 1TWSA 2QEZA 3ARSA 1UYQA 3A4WA 4EWND 3N11A 4DZ5A 4KEVA 1X97A 1X8FA 1YDYA 1G5AA 3BAJA 3DGRA 3KVJA 3I7QA 3GAKA 4DNMA 4RX0A 2OR2A 3M1ZA 3VZXA 3HPZA 3SN1A 1L2UA 3LU2A 3CAVA 4HNUA 3OA5A 5EGRA 2HNHA 3T0CA 5A2CA 2XM1A 4NNBA 3DFNA 3W82A 1TA3A 3U57A 1ZBWA 2XVKA 3LGGA 2VR5A 3GSMA 1IQ8A 2CLKA 3FX4A 3U2CA 2A3HA 3P6LA 3MWCA 1GOWA 3RPTA 3SUVA 4E8GA 3UF9A 2VFGA 1TX0A 1J6PA 2EPMX 1OK4A 2Z7KA 3WZ0E 1DWIM 3IVTA 1X6LA 3DC8A 3KTSA 3CZEA 1VPQA 1J2WA 5I00A 3O16A 3G6LA 1TWIA 4EPBC 5AYIA 1QNPA 3OVPA 4IGSA 2YPIA 4US6A 1J8VA 4LXFA 3KL3A 3E38A 2C3ZA 1T0OA 2J7CA 2ZVRA 3L4XA 4LRSA 3G1RA 4RDZA 2NQJA 1IR2A 1Y5XA 4QR6A 2X2GA 3GNDA 2EPHA 4QE1A 8XIAA 1TPC1 3WD3A 3L4VA 3SGZA 4X9YA 4Y7EA 3HG4A 4ZO9A 1GG0A 1F6PA 3OBAA 2DPEA 3MJYA 3ZVHB 3GQYA 2OWCA 5AC8A 4HMCA 2IS7A 4GPNA 3UYIA 1A3HA 1X98A 4AZIA 3CZ8A 3HV8A 1FH9A 4F3HA 2JALA 1S2AA 3WNOA 2G37A 4YU1A 3KXQA 3EA2A 3TDFA 1ZJIA 2F38A 5HNNA 3MMDA 4P8XA 1JZ2A 3AZRA 2TAAA 1YQ2A 4LPCA 2ZUSA 4W5ZA 3TXVA 1DHKA 4BK9A 2OJPA 1DBTA 5L6UA 3E12A 1VCGA 3GC5A 3IUDA 1SYTA 1QHOA 1KLZA 4QDWA 4NNAA 3DEQA 1VPYA 4S3BA 3MZ2A 4Z1CA 4EK7A 3NZPA 3RCMA 3SIZA 3UZZA 2OLSA 4UQBA 2WM0A 1SMAA 3KS6A 3ZT5A 1SPQA 2E3ZA 4A3YA 5FF7A 4PYSA 2AQVA 2V68A 3QY6A 2WCSA 3EEGA 1NOUA 3BLLA 5C9XA 2IQ0A 2IKIA 3L4UA 2JKPA 4AF0A 3GXMA 2EGZA 3A5VA 4S3KA 2HK0A 3P81A 3CYVA 3GM8A 3CPRA 1HGYA 4Y9MA 5A6SA 5FF0A 2V5BA 2VGFA 2NT1A 1M68A 4XD4A 3OZPA 3M46A 1BF2A 2ZTJA 3ITGA 3C2VA 5D38A 4JOMA 5LIXX 4R7WA 3AXKA 5F7UA 4FA3A 3HTWA 2ESCA 3E0VA 1P7TA 2YBVA 4L4MA 1QWGA 5H8MA 1KBKA 3G8EA 4IUGA 4NP7A 4H6RA 3VIIA 3A22A 3MW7A 2E9BA 3PVFA 1MQRA 4S2BA 3BQ5A 3LB0A 2WCGA 3H55A 2Z4GA 4AHPA 4NXSA 3WF2A 2GVGA 1HP4A 1GVQA 1GYLA 3G8RA 2VUNA 2PODA 5F1VA 2GUYA 1Z8AA 5E70A 1BYAA 3O1NA 4WKHA 3COTA 2TYSA 2EO7A 1E9LA 2XSXA 1EQPA 4J3SA 4L9XA 1JDDA 3OLGA 1Z69A 1TPWA 2PWDA 2FGLA 3WSUA 4MLRA 2TMDA 4GYPC 3PZQA 1RA0A 2Y4SA 3OPSA 3U3HA 1ZAIA 4QCFA 4IT1A 3FYPA 5GNXA 2VWSA 5FL1A 3LDVA 4JZ5A 1JGIA 2X0HA 3SB0A 1EX5A 2WSYA 3M5ZA 2XZ9A 4OTKA 3AYVA 4JIIX 2CLFA 1FBAA 4UC5A 2VKZG 5HWMA 4NILA 1Z41A 2J7HA 4KCUA 3TZNA 4R34A 4MTVA 2POTA 3WFZA 4DZIA 1WV2A 1OX4B 3MI2A 4KEZA 4UUIA 2ZRYA 1TV8A 4N4QA 2ZYFA 1QPKA 4GVGA 3PZ9A 2XDFA 4FALA 1HKVA 1FWWA 5EBUA 2DZTA 1E51A 3CC1A 1DVJA 2BVYA 4H9UA 4ACZA 1XH0A 2H8ZA 1JNEA 1EB3A 3WUEA 3F4NA 3W7RA 3UFYA 2R1MA 3BXWA 4S3EA 1TREA 1OC7A 2GGEA 1F4AA 2PWGA 4HZMA 3RM4A 1HN1A 3FXYA 3AU6A 2JIWA 3E74A 3CTLA 1EX1A 2CPUA 4MVAA 2IKGA 3QW4B 2VQUA 5HWJA 2C91A 2DSKA 3RXZA 3HPSA 4OFCA 3AIWA 3B97A 4AEEA 3NUKA 1OCBA 1YXDA 3P74A 4CN4A 4PZVA 2QIIA 3ARYA 2F84A 1M04A 3W28A 4MUZA 1BGAA 2IMRA 1K03A 3R8RA 3WNLA 1AODA 4A05A 5G2HA 1ZP4A 1ZS2A 2HVMA 4Y9OA 5AZ1A 3BARA 1SFTA 4UQ9A 4CNSA 3BW4A 2FGBA 4EPDC 4AB4A 2QGYA 1XPGA 1S2WA 4XBJA 4A2SA 2VXNA 3DKLA 1XGDA 1W3JA 1OF6A 1KFBA 4Z2IA 4H6QA 3WQOA 4DHGA 4N2YA 2PLKA 2VX5A 3FJ4A 1DIEA 1R3RA 4GX9A 4C6BA 4JFSA 1J12A 2PBGA 3QGAC 2IXUA 4E38A 2ZZ6A 3RO6A 3NGJA 2XIOA 4CU7A 1WKFA 1HJSA 1KKRA 3W4RA 3AIQA 3NQGA 2YR1A 5D2YA 3JRKA 4BF7A 3DAQA 4C60A 5F2MA 4PBFA 3IEBA 3QC3A 4FF5A 5DT5A 5FL0A 1N2VA 4YCPA 5C6MA 3WQ4A 5C9UA 5IBXC 3QSRA 1DIDA 4LBRA 3PBYA 1GVYA 4KCVA 3IJQA 2J88A 5C2XA 2I9UA 4AD3A 1RSCA 2GSHA 1NVMA 4IICA 4Z2JA 2WC4A 3VCCA 2J25A 2VX4A 3MANA 4WY0B 3SCTA 3P80A 2XFWA 1XIEA 3CB8A 2Q8XA 1LTDA 4DWDA 4GQ0A 1FRBA 2BMBA 1EWEA 4GUIA 2FJKA 3IWPA 2OWWA 3WJWA 5CJMA 1F9CA 4U4MA 2ACQA 3GO2A 4PE8A 5EY5A 4DJEC 3VFLA 3DG3A 1F8MA 2NQHA 4O11A 5D33A 6A3HA 3LK6A 4FIQA 5IFTA 1VHCA 1E3XA 3FDGA 4UTWC 3JS3A 2GUUA 1HKIA 3G1SA 4YIWA 5I3JA 1E9IA 2I16A 4HNNA 2PWHA 4OBTA 4G1NA 4FXJA 2MANA 1E55A 3WNNA 4GABA 5AHEA 1NY1A 2ZZ4A 3CH9A 1F2JA 4IFOA 3CL6A 2DIJA 2GL5A 3QHMA 4PB5A 3NFUA 1R7AA 5HMFA 4OV4A 1DWJM 1V6VA 1D9EA 2D2JA 2VX6A 3GG7A 3GXTA 8CGTA 2FJUB 2DT0A 1PL9A 3PP7A 3VDAA 4GWEA 4H8NA 4HPHA 3SCOA 2I9EA 3VC6A 3SCUA 2WK2A 2PP3A 1SSGA 2CLLA 1M9HA 1GZJA 1UCWA 3C0LA 1JJKA 1BD0A 2XVLA 4HHMA 8A3HA 5LNVA 4UTTC 4DJDA 3WH7A 1WOAA 1UUQA 1KM3A 2YL8A 3KOXA 3S9IA 3BGJA 1FP9A 1UD8A 1KRAC 1UUOA 3NSNA 4KF1A 2ATMA 3SFWA 5K4XA 1UH4A 5LZLA 2W27A 2NSOA 2QNEA 2E4TA 3CUJA 3WD0A 2O9OA 3CAQA 4L6DA 3LD5A 1EC9A 3OB8A 1V3MA 2WQDA 1B5TA 2VENA 3RIKA 3TTEA 5A6MA 4UFMA 4B5SA 3QTPA 1NDWA 4PCSA 4GY1A 3ARTA 2CXEA 1H51A 3R12A 4LYPA 1IT0A 3VNDA 3II1A 4S1FA 1MYRA 4DXKA 4AFYA 2EKCA 2QR6A 4WSKA 1B3ZA 5BXTA 4X60A 4FB7A 1OFBA 4GUHA 1EOKA 1U5HA 1OM0A 1MW2A 4HHPA 3U5UA 2H8XA 2X16A 1X6NA 2PDMA 3MI6A 3EBVA 3TYEA 3MHUA 1UPMB 1KO0A 1ME9A 1KRMA 3W26A 3TNBA 3STPA 4OGZA 1OGSA 4KIEA 1PTDA 4OV9A 4CVUA 1F05A 2JBMA 3QN3A 4ML4A 4HOWA 2WHJA 1J96A 4QE4A 5IHRA 4RL3A 3VNJA 2VZOA 5ABHA 3N6JA 1GONA 1XYMA 4DM2A 4FNQA 4JTSA 2P0OA 2CZ5A 4CN1A 1ZHAA 1JNDA 3BG9A 3GVQA 1F73A 2J4GA 3ORWA 1AQHA 1AD4A 1VFFA 4JTLA 4N0RA 1KTCA 2NVAA 1QNSA 3BQ6A 3NGFA 3LCIA 2CFFA 3ARWA 1XBZA 1AD1A 5XIAA 1DWGM 3BLPX 1B31A 4LYKA 4DF0A 3FYOA 4HNCA 5AC7A 3PZIA 5CSYA 5H91A 4AIOA 4DYEA 1QXLA 3W27A 4UMAA 1O95A 3AWNA 4KRTA 2WVVA 3KCJA 4KRZA 1Q63A 2PTWA 1BYDA 1Q7ZA 3BMWA 3P61A 3G0XA 2XVPA 3M9YA 2Z28A 3BC9A 2O7QA 3AIRA 3U7VA 1DJGA 3SO7A 1TELA 2VNCA 3RJXA 3BLIA 3GU9A 1EXPA 1QMLA 3RJYA 1V3JA 4JHZA 2KZHA 2YZRA 3CQHA 4PL2A 4IP4A 1NJJA 3HU7A 1AH4A 2WPBA 3OYXA 5C7HA 2YXXA 3M0YA 1J2BA 4H6KA 4XD5A 5C70A 3ARPA 3LXAA 4E6MA 4H4IA 3WLJA 4MAZA 5A6JA 3PSWA 2E7FA 1CBGA 1Z9AA 3GIQA 3LPPA 5A2BA 4XISA 3PTKA 1SFSA 4YHGA 4P7LA 2PE4A 2O4QA 4TXEA 3BPWA 5KITA 1JEZA 3L7RA 1VAHA 3PJXA 1K9TA 2J75A 4L9YA 2J66A 1Q7MA 1VFUA 2XFFA 1GTEA 3THAA 2VI0A 3OG2A 3UJ2A 5ECVA 3GHUA 3UJEA 4XZ9A 2HE5A 3B0VC 3GDTA 3CUFA 5AZ0A 3VU2A 3LENA 3HQNA 5KMYA 3WFAA 3UWYA 3W1QA 4JICA 4WQ6A 4L1GA 2A0NA 5G1MA 2XIIA 3O6CA 4J3WA 3TOPA 1NF7A 3S6DA 3BTNA 1I2QA 3JZEA 3W6YA 3AHTA 3N25A 1G69A 3GNOA 3RU6A 4Q8PA 4PB4A 1Q4WA 3PUDA 5CSUA 3ERPA 1ISWA 2WVSA 3QRHA 2D2OA 4YWIA 3BE7A 3W1AA 4OUEA 1ITXA 2VRKA 1GW9A 1B4KA 3ALFA 2ZZ5A 2G0WA 3G3MA 3QV9A 1M1BA 3Q67A 1F3WA 4ZOBA 2W91A 3M64A 1D3CA 3IAPA 2YDAA 1PDZA 2FZ9A 3SCVA 2DZUA 3K13A 1PKMA 3W29A 4BEQA 4GKTA 3WBWA 3KS5A 1ML1A 1OFDA 3ZR5A 4H3DA 2PDQA 1HT6A 4FX7A 1VD6A 5BROA 3UNDA 3VA8A 2V38A 2WHMA 4I9MA 4F0RA 2WMFA 3VGDA 2D2GA 2E40A 2PB1A 3KBJA 5FKYA 1DJQA 1UWAA 3T0AA 5MKGB 2JQXA 4B4FA 4LUIA 3NZRA 2JF7A 1KKOA 3EWZA 3M6YA 4I9AA 3LSCA 1TWWA 1QWKA 4O50A 1RPKA 1A53A 5HMDA 5M5DA 4C6EA 4ZSUA 1IXPA 1NM9A 4F40A 1DPMA 2ONEA 2GUBA 2QW5A 1Y8BA 4AD1A 1K4HA 1RQBA 3BURA 3WLMA 3W74A 3PN8A 5I02A 1FWAC 1REQB 4M6UA 5CZKA 1HKMA 5JXQA 2RH9A 3LYEA 3CV1A 1KXHA 4O1CA 4QJ4B 2G3NA 3AMDA 2CWNA 1QI0A 1M65A 3TX9A 1OYBA 1OGBA 4IL0A 2ICSA 4DJDD 1D8CA 2ZZ7A 4NJIA 3PTMA 4WEVX 4JR5A 4I5RA 2ZX8A 3CJPA 4IISA 5BRPA 4U10A 2R1KA 2AQWA 1KGXA 1GPWA 3MQTA 1P0EA 1TE6A 4PRWA 1WDWA 3QHNA 4JEQA 3VAVA 4MNJA 3VIKA 1HNYA 3H4WA 1I2NA 3A3HA 2Y61A 1QAPA 5I77A 1W6TA 1KXQA 5ABTA 3RYSA 4GH3A 5K4ZA 3M41A 2ACSA 3A12A 3KRSA 2X41A 3WX7A 1FWCC 1KM5A 2OZ3A 2PU0A 1S1RA 1W5OA 3BAYA 4WLCA 2NV2A 4HP5A 3DDMA 3CZKA 3MP3A 2BXZA 3MPGA 1L0PA 4GYKA 2MUCA 4LBSA 4L6HA 2CYGA 4MJ4A 1QATA 4X2PA 3FVMA 3N34A 2CLMA 1GWJA 4DBWA 2ABAA 3WQGA 2PGEA 1F8IA 3I7RA 3HG2A 2DZWA 1K77A 2OEJA 2ZA1A 4JXCA 4C6OA 3A21A 1VS1A 3UYCA 2J8TA 3E5BA 1F4HA 1VBGA 1CXHA 1GOOA 2I5GA 4LV4A 1CEOA 4CCZA 2ZRZA 3LMYA 2PA6A 2HV5A 3K4WA 1Q6QA 4HU0A 3LSBA 4HQVA 3H23A 3KVLA 3WDJA 3F4CA 4B5VA 3RO8A 3EX4A 4PMOA 3NXLA 3GYCA 3HN3A 4AC7C 4MZ8A 5ABFB 2ZBTA 4JIQA 4BF9A 3N3MA 1TV3A 1W5NA 3DFPA 1XYCA 3LG3A 2VVNA 4JTJA 4YLWA 4CD8A 3W84A 1XLAA 4NSBA 4B9ZA 1CLKA 7XIMA 1VIZA 2PUZA 4C90A 3BV7A 5G1YA 3RCNA 5TF0A 2QS8A 4MJZA 4IMFA 1W5PA 4AU0A 1AZ2A 3TN5A 2FTWA 5A6KA 3LRKA 3GH7A 1NFBA 2GQ9A 2AMGA 3THQA 4K7VA 3TEVA 1OYCA 4JFWA 3FFSA 3ENLA 1X1ZA 2Q8LA 5G4WA 2XGZA 4C7FA 5I03A 4JIEA 2OOGA 1PWLA 2PDLA 1YBQB 4L5ZA 4KQNA 3CXOA 2Y85A 2KAUC 4P5UA 3TV8A 2XN1A 4KRUA 3BGGA 1GVIA 3APYA 1DJIA 3LHUA 1UA3A 3AYTA 4OHQA 1ISZA 3G1FA 4QEHA 2J79A 1XFCA 4NIRA 1J0YA 2VZVA 3DFTA 1ADSA 3DXIA 1VRDA 5GNZA 1I0BA 3WQDA 1EP3A 4GBUA 1UOKA 3GR8A 3ELFA 3PB0A 3W7DA 2XIBA 1WDPA 1EDGA 3SFKA 1S5TA 3TCSA 1EJXC 4RXGA 3VMOA 2BY1A 4PFHA 4LAOA 2VEIA 4DO7A 3GNRA 1VFSA 4EACA 1HO4A 5CSSA 1GW1A 3POHA 4HPJA 3KCOA 3W23A 3MDUA 5HJYA 3S2CA 2DH3A 2C1GA 1FCQA 2X30A 4QIUA 2J8FA 3SY5A 2W3ZA 4RZ6A 2PDJA 4LTSA 2FZNA 1EC7A 4OZOA 3VGFA 2CLIA 5HR7A 5H1WA 4ORIA 1ITUA 1BSLA 1V77A 4Y9NA 5IFPA 1OT2A 4ERAA 1NP0A 3KLKA 5AOUA 3SW6A 1YNPA 2FVMA 4FX8A 3IIOA 1Q8AA 2NXGA 4I5XA 4DVOA 1ADOA 3UCQA 2P10A 4QJ5B 3ITVA 3TR2A 2QF8A 4KGJA 2FVKA 3ZIZA 1GVFA 4TTGA 2C0HA 1GCYA 3W1RA 5K7JA 4Q32A 4YVPA 1EUAA 3VKKA 3WK2A 4U28A 3CT2A 3W7CA 4AY7A 4AD5A 3GDMA 2QKFA 3UR8A 3LNMA 1ZPTA 2A7RA 2QJJA 1B90A 2J24A 1EP2A 4LUTA 1YYAA 1DWFM 1T8QA 4RKAA 3LLXA 2VQTA 3T6CA 4GGHA 1W9VA 1V4YA 1XLIA 2JK2A 3PANA 3F1QA 2HMCA 1XXXA 1ZJBA 1PVNA 4MZ1A 4EKJA 3VIFA 3QJAA 1Q3NA 3TYAA 4HTYA 1KRBC 3UT0A 3QYSA 3V7PA 3IJLA 1XLEA 2JKEA 3GIYA 1EA9C 1XR2A 1R46A 1I4NA 3IJ7A 5T9CE 5F2IA 4TV6A 2XYLA 1X96A 3RLHA 5E6YA 4S39A 3WFLA 4M7SA 4AMCA 2BBFA 4W88A 4O16A 1MDLA 4I6KA 3MJMA 4FPSA 3VMPA 4AISA 4LVDA 5BYWA 3S1UA 4C65A 3W7JA 2WO5A 3A9IA 3VO0A 3NL5A 1EGZA 1TIWA 5KSWA 1KM4A 4MAVA 3I4EA 4HSOA 1I75A 2EG6A 4N7QA 4HKPA 5KINA 2A3BA 4AWTA 1MNSA 1OX4A 1LRQA 2REQB 5G4EA 4B16A 2VGIA 7TIMA 3RPDA 3CS2A 1EWDA 2VD9A 2YFOA 3MUIA 3UWZA 1P0DA 3C2FA 1H7WA 1PCWA 5CC6A 1DORA 4JEJA 2DFAA 4GJJA 4M56A 1DQUA 2DZAA 1I2OA 3QZAA 3T2PA 4EAYA 2J27A 2V8ZA 3BLOA 4Y2WA 4FS9A 2GZXA 4CNUA 4JCLA 4X2RA 1GJUA 4FNPA 2Z00A 4JD4A 2GQAA 1XPYA 5HUPA 2VUYA 1JG9A 3WH8A 5EFFA 3L2LA 4R33A 3TA9A 3UQNA 5CPSA 3VX1A 2ZZ1A 3L5LA 5F4WA 1H4PA 3W9ZA 2GQ3A 4XAGA 2IPGA 5EYWA 2QJNA 3CQIA 3WH6A 3VVGA 4XO7A 3BSMA 3SUSA 4HSNA 1SGJA 1SO4A 3L12A 3PBUA 1TTJA 2FH8A 2TPSA 1XRTA 5CSRA 2QVNA 4W5UA 3M0KA 5A5WA 4Q4OA 3HJZA 3O63A 2ZTKA 1MNZA 5E1QA 2V82A 5JH1A 3AISA 4BWLC 4I7UA 4V33A 3M0JA 1XP3A 3CMFA 1EP1A 2EJ1A 1HX0A 4JQ1A 3W87A 5CBBA 4XAFA 3AIEA 3KVKA 3OZOA 1TMQA 2A21A 3E49A 4FOKA 3MYOA 3TTSA 3W88A 4GFSA 1YDOA 4QAIA 1VFOA 3HMJG 3LHZA 3TYZA 2WSRA 2YKKA 5BRQA 3A9BA 1JQVA 3GXIA 2Z24A 3W1TA 4C6NA 1V08A 3ZJ7A 3UW6A 1JZ8A 3ABQA 4D6FA 3W75A 4GH1A 1OX5A 3DI1A 3D47A 4AAJA 1IZKA 1FKXA 3QGKC 3AMCA 5CPMA 2XH7A 3VK5A 1LWJA 5DBUA 3IVSA 3M0XA 5JVLA 3VE9A 3ES7A 2V5KA 3FV9A 5IHSA 3EWBX 2GVYA 4O52A 3T05A 3SI9A 4FMVA 3TZFA 5CJNA 4F9JA 4KMQA 1W9BM 4H7CA 3ZJ6A 3MVIA 3VINA 2PWVA 4TV5A 1LG2A 1QDSA 4PTWA 1ONXA 2VCBA 3VIOA 2EAWA 3SCRA 3CMJA 3DHDA 3TR9A 3N4AA 2YL5A 4CNPA 2GVEA 2INZA 2ZC8A 3GNNA 1W3NA 4WDTA 4TX9A 5G2IA 1GQNA 1EGMA 3WQ8A 2PDCA 3SECA 2EG7A 1E6RA 1NTHA 4PFMA 3IGHX 4YWSA 4NVTA 3GC4A 3S5ZA 2WCAA 1UROA 2P3EA 4PMUA 3BUVA 4CKQA 4QHRA 1EQCA 4DUWA 4ML9A 2GWGA 4DJFC 1HXJA 4UOZA 4Z0SA 3WLTA 3TW6A 3B9AA 2WWCA 2VD8A 5BWAA 3IK2A 2QUVA 1RJPA 5ECUA 5CKSA 3LHVA 3QGVA 5T8GA 1QFEA 4XBSA 1CXFA 1E5NA 5B7ZA 1H50A 1MZRA 3WBEA 2V30A 4O53A 3T07A 1ZFJA 4K39A 5BRBA 4EP8C 3OLEA 3PPCA 1YRRA 3M0LA 1KCLA 2V3GA 1E3ZA 4G2DA 4HMNA 2WJZA 1UQYA 1F61A 1YPXA 3WMLA 3R79A 2OT1A 4E0CA 3CUXA 3RK8A 1MW3A 4C1NB 4TUFA 5JBDA 3RITA 4D2JA 3LHYA 1TJ0A 1PZ1A 3B04A 1KRCC 1ME7A 1MUWA 5HAOA 1Q66A 3T4WA 1JPIA 4WVXA 4M5PA 2W63A 3GDKA 2O9RA 5CZSA 4G7FA 2J77A 4RV3A 1EPXA 3WMSA 2O55A 4O18A 2GGHA 2BTMA 4O0QA 2P0IA 5A8MA 1CT5A 1EFZA 2VZUA 5AN7A 1Q65A 4WX2A 4RE3A 4QQ3A 4H6EA 5LGZA 3SRHA 4F8XA 1N8WA 3S5NA 5JU6A 1X1NA 3T78A 1R38A 3E3HA 3N2OA 4O8RA 3MSDA 2XM2A 3I6EA 2XWEA 2CXGA 3ABOA 3DYPA 4QTGA 1BWVA 1HL8A 3TQVA 2ZZ3A 3F7JA 2DGAA 3DZ1A 3L0KA