4Z0JA

F96s/s73a double mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
244
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGAYTGEVSAEIAKDLNIEYVIIGHSERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Connecting Active-Site Loop Conformations and Catalysis in Triosephosphate Isomerase: Insights from a Rare Variation at Residue 96 in the Plasmodial Enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 94
structure length 244
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4z0jA00
1JCYA 3W1RA 1GTEA 5BOOA 1TCDA 4DELA 3F4NA 4WXYA 1A5CA 4OV9A 3M5ZA 3OVQA 3W2KA 1TRIA 3NPXA 3G3MA 4MYAA 4AEOA 3IIPA 2BX7A 3HF3A 2C16A 1FUYA 3BGJA 4LV9A 3N14A 1H7XA 3PG9A 1F76A 3M47A 4A21A 3UQNA 1B4EA 4O8RA 4O4VA 1S5VA 2P0OA 5LGXA 4CQ9A 4Y9AA 3O1NA 1K7EA 4O52A 3BK0A 2C19A 5C54A 1OYCA 1G4SA 3DFSA 3E12A 2E6AA 1X7FA 3QZEA 4CNNA 3EEGA 1KTCA 1TJPA 3U8GA 2Y85A 2NUYA 2C18A 3KRZA 5D02A 3L0KA 1QOQA 2VEMA 1R2TA 2E6DA 3P81A 1W8SA 4LS0A 3DFNA 1RD5A 2XN2A 1C9DA 1BEUA 2PC4A 5HINA 2Y61A 2Z2UA 3DHDA 1FXPA 4M6PA 3VCRA 4UTUA 1KBJA 2BXVA 1SZEA 3LDVA 5MHBA 5J5DA 3HGSA 3LOTA 1R46A 2CLEA 4KKXA 1B57A 4MUZA 2QJHA 3PWAA 2W0UA 1JUEA 1X8FA 1W31A 2ZQ0A 2VELA 1W0MA 4JYFA 4WY0F 4YL2A 3W70A 5HNRA 1KFLA 2P1FA 4RZ4A 3W2JA 1XM3A 3TK7A 1FWRA 1ZJIA 1KLZA 2ZA1A 1YPIA 2Q8ZA 2QCHA 4XBKA 1G4PA 4JIPA 3NQ6A 2VEKA 4O12A 5I3GA 4FNQA 4HSOA 4ORIA 1PIIA 3CIWA 4JR5A 3FKKA 2FPVA 4ZQNA 3MHGA 3PS7A 1YTKA 3WJWA 1VZWA 3DFTA 2WNZA 4O14A 4UUIA 5FEXA 4MY9A 1IGSA 1AW2A 3MI6A 3STGA 2Y63A 4NJKA 3TC6A 3OVRA 4NXSA 3M1ZA 3M5VA 4DO5A 2YSWA 3MWAA 1H61A 3NQEA 1RPXA 1YDOA 1K8ZA 1OFDA 3IV3A 1KTNA 2DJLA 2Y7EA 4RK8A 4Y90A 3NL5A 2OZ0A 1RQHA 2V9DA 1LLZA 4QISA 4UTJA 4BI7A 1AL8A 5DELA 4R7JA 3JRKA 3P61A 5I3HA 3G24A 5D32A 3UY8A 1HL2A 4C1KA 2CLFA 3C8FA 3UYCA 4ZMGA 3MJYA 4GUGA 4FO4A 2G5WA 2VFFA 3TCEA 1VR6A 3ZWTA 2C6QA 3L0NA 1TPVA 2OX1A 3GB6A 2R14A 3PB0A 3STCA 4N4QA 5H91A 2J9XA 4ONVA 3W74A 3E9AA 4Z1AA 1H7OA 4E2DA 2V5BA 1OF8A 4AF0A 1W3IA 2VFDA 4U28A 2X2GA 3SECA 8TIMA 3DFPA 1T99A 3UXAA 5CZTA 2VENA 4RV8A 1CX9A 1ML1A 1FWTA 3NNTA 3ZR4A 4UMCA 3IGUA 2HMCA 5F4SA 1Q6QA 4FX8A 3LB0A 1OYAA 4RZ6A 3NL6A 3W7NA 3NR0A 1LCOA 1RVGA 4JYEA 2OJPA 3MBDA 4KWVA 3JS3A 4JN6A 3INPA 1G67A 1LORA 2A6LA 2XN0A 3TSMA 1D3GA 4UTTC 3G1SA 1C29A 5I3JA 5HUPA 1SZFA 2QR6A 1KBIA 4MZYA 4FIRA 4A2SA 2E5CA 1LRQA 1ZAJA 2LLEA 1GVQA 2ZA3A 2TMDA 3GDTA 5AHIA 5KITA 3EX4A 3I65A 3ANYA 1L6YA 3W6YA 1FCUA 3O16A 3NL2A 1EX5A 1DHPA 1VLWA 1DBTA 2QCDA 3P7YA 4HNTA 3C3NA 2P10A 1YADA 1V7YA 2J88A 4MIMA 4NUWA 4UTLA 4AF0B 5FF7A 1QDSA 4O53A 2YW4A 1A5AA 4EF9A 3BLFA 1C8VA 3PUEA 2EKCA 1G4TA 4QJ1A 3TFCA 4X22A 3RMJA 4IMCA 1ZCOA 3LHZA 2A7PA 3O6YX 3QW4B 4QIUA 1JJKA 1T8XA 4JDBA 3M0ZA 1GVRA 1WV2A 3WK2A 3N3MA 4MJMA 1AW5A 5KZDA 1W37A 2JKEA 2VEIA 1UBSA 1X1ZA 5K4ZA 2RFGA 4NXKA 3UY7A 1EWDA 1IXPA 3GIYA 1GWJA 5EBUA 1FQ0A 3R12A 3P62A 2WSQA 1DL3A 5AC7A 4Z0SA 1VCFA 2D73A 2UV8G 1EUNA 2AAMA 4HNNA 3CC1A 4DPPA 3GDLA 3N9RA 1R30A 4N9EA 1EB3A 1JUBA 2CZEA 4HKPA 3QEZA 1TREA 4K7VA 5F2MA 3UWWA 2QCDB 3SR7A 1UASA 2ZDRA 3W75A 3KHJA 4JIQA 5HWNA 3HPXA 3P8IA 1PHWA 3W86A 4MY8A 3THQA 2C15A 4OBTA 2H3DA 1CI1A 3I7RA 4GNJA 3HB9A 4TO8A 4WQ6A 4AAJA 1W5QA 3W1PA 1OFPA 5FEPA 5CZJA 2YDAA 1JQXA 1PCWA 4DO4A 1VC4A 1FWNA 2OMAA 4IMGA 3G3DA 5AHEA 2I9EA 4JX6A 3W7KA 2CLLA 3ZFHA 3G1FA 5AYXA 4AHOA 4UTWA 4HIBA 2V8ZA 1RV8A 3M41A 3W7EA 5AHNA 5U4NA 1Z42A 3W1XA 4AMAA 2TYSA 1IXQA 4I9AA 3BVJA 3CTLA 4N9CA 5DCEA 4JS3A 3BW3A 3L0GA 2ISSA 1TV8A 4NX0A 5D05A 3CM4A 3MO7A 1NF7A 3TROA 4UCGA 3QFEA 2E5BA 4E38A 1VS1A 5FF4A 3PBVA 1QOPA 3CHVA 3L66A 1I2NA 4XWUA 1EP1A 4NQ1A 5CZSA 1W3TA 4L4LA 1SZGA 5BMWA 3FA5A 4K7YA 4ZZ9A 3A23A 2WJZA 5FEWA 2Z6IA 4IPJA 3DBPA 5DCBA 1GOXA 1FX6A 2CLMA 3UWUA 4ZQRA 2J24A 1WDWA 1TJRA 3B03A 2JGQA 5D2XA 1H62A 4HT3A 4G1KA 3QJAA 2EHHA 4PCFA 1GPWA 2CLHA 2Y88A 1L9WA 4JTTA 3WK0A 4AB4A 2H8XA 3HG4A 4O18A 5F1UA 3LHYA 4YCPA 4QITA 5C2XA 1P4CA 1BWKA 4X3ZA 1YYAA 3S1WA 3GYEA 4Q32A 3CEUA 1OFRA 3LXBA 5L6UA 2ZCGA 3LI0A 3FYOA 4I7VA 2PE4A 3NQ7A 1FBAA 5LNUA 3WFAA 3RU6A 2YYTA 4O17A 1TRDA 1OYBA 3I7QA 3CQ0A 2GVGA 2RDWA 1TTQA 3NQGA 4DPQA 3KVLA 2YCEA 2RDTA 4PEKA 4H6KA 3C2OA 4WOQA 2VOMA 2E1DA 1MZHA 5CPMA 5K9CA 4LS2A 1O94A 2QAPA 1E51A 3DKJA 2DZVA 4K36A 3WK3A 1L6WA 3ABRA 3KOFA 5D38A 3C0JA 3STEA 3KRSA 2B7NA 2PRHA 5J5RA 1QPQA 3LV6A 3VE7A 1ZY9A 1JULA 2BWGA 5SWUA 3KAOA 1ZNNA 3UD6A 1TQJA 3B0VC 3N34A 2Y6ZA 1H7PA 2XFWA 4JY9A 5IBXA 1I2RA 4TX9A 1WA3A 1IXNA 3W84A 1JCNA 2X30A 3N73A 5D03A 4TMBA 2QJIA 2R91A 3BV4A 1H63A 1ZFJA 4HPXA 5CKSA 1EP3A 1YXYA 1SU5A 4GC4A 1AW1A 4IOTA 2QCCA 5HQEA 2X16A 4QNWA 4M6QA 4X2RA 2Q8LA 3P84A 3ZWSA 4ML9A 3S1XA 1RR2A 3HMJG 3SJ3A 4AVFA 4D2JA 1F73A 4BK9A 5G1YA 4CCEA 2AQWA 2ZTJA 2NX1A 3LLFA 3S1UA 3LX9A 3W7RA 2CW6A 4K38A 3LHVA 1DORA 2GVLA 3TX9A 2E68A 3QF0A 3HO8A 1D3HA 2V5LA 2CZDA 2YGYA 2O7QA 1RZMA 2A1YA 4QAIA 4XTIA 1Q3NA 1OHLA 5KTLA 3TU9A 1YDVA 4N02A 3E49A 3R13A 3MHFA 3DU0A 1TMHA 3W7IA 4IMFA 4O13A 1VHNA 1YPFA 2DZPA 3JR2A 4O1DA 1VCVA 4LU0A 2I14A 4WJEA 2VEPA 1TTPA 1WOAA 1SZNA 3C61A 5AFDA 3IIXA 1LOSA 3HPZA 3T7VA 3TMLA 6TIMA 1EPXA 4R34A 5DLCA 3QMTA 4LS1A 3OG3A 3W7LA 3W22A 2RH9A 3B05A 3PBWA 3PY2A 1KFJA 4YLWA 2QJGA 1R2RA 3M43A 5G2IA 5LGZA 4DBEA 3DAQA 1YXDA 3NQCA 5HUOA 2B4GA 3O05A 5I3FA 3T55A 1TPC1 1WX0A 1FWSA 5KZEA 1LRTA 3UZJA 2QUVA 3L21A 3BW4A 4O0KA 1PHQA 5D2WA 1VYRA 3CPRA 5DN1A 1LLWA 3S6DA 3W71A 4BFAA 4BI6A 4E2BA 3B0PA 1XBVA 3CU2A 4Z0JA 4QSHA 4UNKA 3ABQA 1KM4A 4M7TA 1W1ZA 3UWYA 3DI1A 3G0SA 3U6WA 4FX7A 4JGDA 3LHTA 3DFOA 1TPFA 1ZAHA 3L67A 2Y7GA 4UFHA 1FXQA 1H1ZA 2QDHA 1H51A 4UTHA 2G96A 3E0IA 1H5YA 5LNWA 1VPXA 3TA6A 2OT0A 1N8FA 3RK8A 1OFBA 1XXXA 4TMCA 1U5JA 3LCGA 1WXJA 3U2OA 3MYPA 3FJLA 5AB3A 3MW7A 4M6VA 1S5TA 5I3IA 4LUJA 1O60A 1XBXA 2FJKA 1WQ5A 2ZFAA 4IQLA 2YYUA 5KINA 4NNBA 5DY2A 1ONRA 2PURA 1EA0A 1SW7A 1HTIA 4EIVA 2X1TA 2W79A 2E77A 3CB8A 2DP3A 3W87A 3G8RA 1JR1A 4L4MA 3TSBA 4N9DA 4UFMA 1LDCA 3CLMA 4OT7A 2A85A 4JEQA 5CPOA 4LVDA 5CPLA 4JTLA 4MYXA 4UMBA 3KRUA 3FS2A 1HFBA 1V5XA 2NX3A 3USBA 1GEQA 4JICA 3Q58A 5LNVA 1ADOA 1NF0A 5F2GA 4XQ6A 3ATZA 3TQKA 2QF7A 4N6FA 1EUAA 3C6CA 4BR1A 4ZL1A 1BKSA 3I68A 5FF3A 1GG0A 1A53A 4WD0A 2NWRA 3EXTA 5BRBA 3LHUA 3MI3A 3DXIA 4HSNA 1SO4A 3MBFA 2OCZA 3GNNA 3KFTA 2FQIA 4A2RA 2ZZ2A 3LRMA 2VFIA 4FF7A 1N7KA 1ME8A 4CQAA 3W2NA 5F4WA 3TV8A 3PR2A 3QYQA 3P8JA 1YDNA 2ZBTA 1XBZA 1P0KA 3GDRA 3TDFA 5FF2A 5DXXA 4N2YA 2XN1A 3C2RA 4KFPA 1OX6A 2R8WA 3GAYA 2GUUA 4JTIA 4CLMA 1VGAA 2V0TA 1X6UA 3W1NA 1OFEA 4MKNA 1GG1A 2Y62A 4UXDA 1DKWA 3BG9A 2Y70A 5EA9A 2CU0A 3AO0A 2BTMA 3AJXA 4CNOA 1M5WA 2TPSA 2VXNA 1QPNA 4K6AA 4WOZA 3O07A 3GNDA 1ZHAA 3B06A 3C52A 2ZRZA 3EB2A 4YWIA 5H2ZA 1H50A 2DZWA 2FDSA 3O6DA 3QSTA 1YTDA 4DXVA 3NZRA 5GVJA 1ZENA 5KZMA 3W85A 4K37A 5D04C 2WV8A 3RFAA 3BGGA 3F03K 3NQAA 4O28A 3NGJA 4LVGA 1GTHA 1OABA 1EIXA 2ZZ1A 3L5LA 1PE1A 3VNDA 7TIMA 2EGZA 2ZRYA 3GXNA 4JTSA 1F2JA 2E09A 4NT0A 2QDGA 2QUUA 4JTEA 1UCWA 2FPYA 1KFKA 3FIGA 3RLVA 3W2MA 4WZHA 4A22A 3PULA 1VH7A 5HJLA 1YXCA 5F1VA 3LERA 2ZRVA 1QWGA 3DGRA 1TO3A 2E5DA 4LV4A 4DBDA 1SO5A 3UNDA 3W2LA 4WXZA 3S5NA 2A7RA 1M7PA 1SSDA 1SR9A 3W1LA 4OQVA 1SPQA 1TPB1 3A21A 3TQVA 3EX2A 3TH6A 1B4KA 4BWLA 1B3OA 1OFQA 4OHQA 2NXGA 3BG3A 3M5XA 5CGQA 3DENA 3QMSA 5DCDA 2RHGA 5EL1A 3LLDA 1PVNA 3UXDA 3G0UA 2A6NA 3M6YA 3BLIA 3W7MA 3SI9A 3W1MA 3R8RA 3I6RA 2J6XA 2ALDA 1HO4A 1TTJA 4UTKA 1KM3A 3TFXA 4FIQA 5HWJA 4W9TA 5ABTA 4TIMA 5DXYA 1P1XA 1PL9A 3B8DA 3GR8A 1VHCA 4RXFA 1JQVA 1SO6A 4JDYA 5HWMA 4CQ8A 1A5BA 2GVJA 3C56A 3MI2A 2QCMA 5D2YA 1QPRA 1K3UA 3TQ0A 2WPBA 1T96A 5CSSA 4JX5A 3W72A 2VFGA 2WQPA 3B04A 4N9BA 2DZUA 3KVMA 4UMAA 3NM3A 4N6EA 3LXAA 2GQ8A 2NV1A 3NPUA 1O95A 4K39A 1FDZA 2ZA2A 1TIMA 4H4IA 4AWSA 3WJYA 1RQEA 1Q6LA 3LTPA 4LT9A 1DVJA 3T4CA 1QPOA 2Z6JA 4MZ1A 4JNMA 3R2GA 3O63A 3FLUA 4Z1CA 1DQXA 3UWVA 3YPIA 1LBFA 4Z1DA 1H7NA 2CWNA 2WNNA 3W3OA 5BMXA 1H60A 5G4EA 1JCJA 3QQ0A 4DF2A 3PUDA 2DZTA 3N9SA 4ORMA 2B0MA 1L2UA 1QNVA 4O54A 4XKYA 1J5TA 2Q3RA 3TW7A 1XL9A 1W5OA 4WX2A 1B9BA 3THAA 3HG3A 4MZ8A 1OFOA 2G97A 2HSAA 5D09A 4B5NA 2BLEA 5LNRA 4M5PA 1NSJA 3W9ZA 3W88A 4LTSA 2ISVA 1DOSA 3EX3A 2I1OA 3P82A 4UFLA 3CEPA 3OA3A 4IX2A 1OX4A 4Q33A 4GRSA 4HPJA 3FFSA 1XDLA 3W7CA 4RXGA 2HS8A 1THFD 1KM0A 1IIHA 1EP2A 1KM1A 3P60A 5TQLA 1M6JA 5HR6A 3RNDA 2FB3A 3DFQA 2A2IA 4FX6M 4PC8A 3TIMA 1NVMA 4HNUA 4ZQOA 3LCLA 1GYLA 2FIQA 3O06A 1F74A 1W56A 4JTJA 4U4MA 2IQTA 3L65A 5BNKA 4RLIA 2QUTA 3GXTA 3GXPA 1KV5A 2R94A 4NVTA 3W1AA 3FKRA 1JRBA 4XKYB 1WYIA 4YXGA 1MO0A 5FEZA 5K2ZA 4EWND 4KFOA 1QR7A 3S1VA 2V2HA 1OFAA 4S1FA 3G1DA 4NJHA 2ABBA 3BPWA 3L5AA 4MPQA 3WJSA 1W5NA 2Q3OA 4FEZA 4LVBA 3I7SA 1QFEA 1BWLA 2ZRUA 2Y7DA 3L5MA 1G4EA 4E0CA 3BW2A 1KFBA 1EEPA 3HIJA 1OX4B 3QC3A 4KWWA 1FWWA 4FXSA 1ME7A 1G7UA 2F84A 3MUXA 5EMUA 4MJZA 2B7PA 2CLKA 5AOUA 5KMYA 5AHMA 3QW3A 5LSMA 5AHLA 4PFMA 2WSRA 1O5KA 3PG8A 1DJQA 1F05A 4LC6A 3QMRA 3S8HA 4O4WA 3M5YA 1FDYA 2X1UA 1JUKA 4UR8A 1ZAIA 4UIOA 3W73A 3NA8A 2QCGA 2HS6A 1LTDA 1NFBA 4YCOA 3BLEA 3NOEA 3BG5A 1LOQA 3LTSA 5CPNA 5AYZA 2H8ZA 1GVSA 1Q45A 3EXSA 4R53A 5AC6A 3LCXA 4GUFA 5T26A 1N55A 3S9YA 1SFLA 3A22A 3EWWA 1K7FA 1SQ7A 3G18A 2ZZ6A 4Z08A 1MXSA 3NQ8A 2NXIA 2J9YA 3GZ3A 4UFIA 2WNQA 5G1TA 4PA8A 3DZ1A 3UWZA 3FYPA 4TR9A 3EX6A 4CCCA 1PCKA 4C1LA 1UUOA 4O57A 2NX9A 3G1HA 3PSWA 3B4UA 4K8HA 3TAOA 1F7BA 2ATMA 1XUUA 3H54A 4GXMA 1VCGA 3HGRA 2ATSA 2ZRWA 3VKJA 4UTWC 4BI5A 3GLCA 3TR2A 1XC4A 3ABSA 4RKAA 2WO5A 3KX6A 4NX5A 1K02A 2YXGA 4ZQCA 3LBMA 2VKZG 4OU1A 1VYSX 2J27A 1H7WA 4DO6A 4MY1A 1ICPA 3W76A 4UTTA 4UNLA 3S5YA 2DZXA 5LZLA 2BSLA 3LM7A 4UC5A 1LZOA 4JYDA 4ZQMA 4XTDA 2BZNA 3S5OA 1LBMA 4QQ3A 5HR7A 5G4WA 1KM5A 5DBUA 2VC6A 2V2DA 4JTKA 2QCNA 4FNSA 1AK5A 3NQ2A 3G1AA 1UB3A 5EPDA 2YFNA 3G1XA 1DQWA 1KA9F 1I2OA 1Y0EA 4O1AA 1I4NA 3Q37A 2H3BA 5LHEA 2ZZ4A 3PB2A 3LGEA 4DF1A 2A0NA 4IXXA 4QM1A 2JK2A 4TU1A 3EKZA 1ICSA 3NL3A 2Z1BA 5E1QA 3IIVA 1S5WA 2FPTA 1K8YA 4AH7A 3PM6A 5K9DA 3W1TA 1GT8A 3T78A 3PUOA 1DJNA 2ABAA 3IVTA 4GWEA 1JCXA 1OG0A 4O15A 3W7OA 2C13A 1KM2A 1QAPA 3GX9A 1O5XA 3P74A 2AGKA 2TRSA 3NQFA 2YFOA 4XBSA 4IWWA 3NQDA 5D2TA 2RDUA 3OEXA 1K03A 1TV7A 5K7JA 4LVAA 4I7WA 4LC8A 1W54A 4IGHA 3R89A 1KV8A 5DBTA 3WK1A 3QRHA 4GUHA 3EWUA 2VFHA 5G2WA 1W3NA 3N19B 1SO3A 3GKAA 4IUOA 3G22A 5HMSA 1CW2A 3S0CA 1OK4A 3G0XA 4ADTA 3QPZA 1U83A 1MEHA 2CZ5A 3FJ6A 2C14A 3K30A 1LYXA 1SUXA 2NZLA 3SGUA 2TSYA 1OF6A 1WBJA 4CCDA 1J2WA 2CLOA 4A29A 3STFA 2ISWA 3N2XA 3L68A 4UR7A 2Y7FA 3OVPA 3A9IA 4WUIA 1TTIA 2GOUA 4JTGA 5K9XA 4Y8FA 2JKPA 1GZGA 3UWQA 4EVZA 2QEZA 3G1VA 1P0NA 1IIGA 4MVAA 2C3ZA 3TXZA 4UFJA 3MMTA 4EOUA 2NLIA 4OWGA 2RKXA 1I2PA 4H3DA 3W23A 4Q4KA 3QQ1A 3W7DA 4JXCA 5IBXC 1L6SA 4LVFA 4FB7A 5D2VA 1GJPA 1GYNA 1GQNA 4NJJA 3NQVA 3WJZA 4BF9A 1ICQA 3QPYA 3EXRA 4IJBA 1SSGA 3DKLA 4DQWA 2YPIA 4WY0A 1XFBA 5EYWA 1SW3A 3ELFA 3O15A 4JD4A 4O19A 3QSRA 3LHWA 5C6MA 1OX5A 5AN7A 3SW6A 3PSVA 4RX0A 3GDMA 2E6FA 3DHFA 4JX4A 1YLVA 1OVDA 1LROA 1QO2A 4UTMA 1F5ZA 1D9EA 2NV2A 3LTYA 3FOKA 1J4EA 3HGOA 1NEYA 3GR7A 3NPWA 4LWWA 4R33A 4IMDA 3A5VA 5EKYA 3CWOX 4ALDA 5LHFA 3VI2A 3OIXA 4FXRA 3QH2A 5FI8A 3HG2A 3PAJA 4QNEA 3V1PA 3OBKA 3NO5A 1XKYA 3GK0A 1Z41A 4KFNA 5F2IA 3CWNA 4NJIA 4P2VA 2WSYA 4XZ9A 1XUZA 1SFJA 1VYPX 3HBLA 3TJLA 3IVSA 2GJNA 1XI3A 3BO9A 2VFEA 2X1SA 4O1BA 3GKFA 5CG7A 4GE8A 5LNSA 1JCMP 3LRLA 4WY0B 3B0UX 5K3VA 1LOLA 5BW6A 3KXQA 2PCQA 1QCWA 1R47A 3S42A 4AWTA 1H1YA 3IIOA 1GVFA 3C2FA 4O10A 2X1RA 2FB2A 3EWXA 3P5ZA 5FESA 3UPBA 1JCLA 3NVTA 3W07A 1X1OA 1AG1O 4IPIA 3W7JA 5HULA 2EPHA 2YR1A 1TPDA 2O7SA 4AHPA 1VLIA 3IGSA 2WKJA 5AYYA 5U7SA 3N2MA 3F4WA 3C2VA 1MEWA 4MFDA 2YW3A 3LCHA 4A3UA 5E93A 3SGZA 4GUJA 3DH7A 2QAFA 4J9JA 1P5BA 3HQ1A 3TNOA 2OT1A 2WOQA 1W5MA 5F2LA 4I7UA 2ZZ7A 4UFKA 3EWYA 3CIXA 1AMKA 3D0CA 3PBYA 5F4XA 3O6CA 4PODA 5CSRA 1A5SA 4ADSA 1K8XA 2EF9A 3IEBA 1UUMA 4NZFA 3EX1A 3KVKA 4O16A 5FF0A 3IRDA 1LRNA 4EF8A 2CFFA 1O4UA 3L9CA 2NWSA 3TKFA 1OK6A 3O8AA 2H6RA 2CLIA 1TPUA 3ABOA 1WBHA 5L9FA 2JBMA 3WJXA 4IMEA 4FNTA 5EY5A 1LP6A 1EWEA 4FNPA 3A24A 3E02A 3TXVA 1WAUA 3SY5A 1JVNA 5TBOA 3LBCA 4MOZA 3TMQA 4IX0A 1F6KA 3M7WA 1UJPA 4LNYA 4O0ZA 3H53A 4GFSA 1IXOA 4IXHA 4NNAA 3GVGA 3C2EA 4RCXA 4X9SA 2YX0A 3QM3A 1QMLA 3TE9A 2JKAA 1AL7A 4JTFA 3TSDA 4RZ5A 3NAVA 1K7XA 4GUIA 4XUGA 2DZSA 3MP3A 1M7OA 3ATYA 3C4UA 2DJXA 3H55A 3BARA 4AHQA 1JRCA 3P67A 1DV7A 4HN4A 3TAKA 2DORA 3R5EA 4POCA 3NDOA 4FNUA 3MP5A 3DI0A 4HNVA 3Q2DA 1Q6RA 3LCFA 4LUIA 3ZS4A 2E6YA 3HPSA 1T0OA 3W7GA 3M16A 1F6PA 3IIZA 4OGZA 3LRKA 3LCIA 5DY3A 2CZFA 3P5YA 1KFEA 3W2UA 1RQBA 2DU2A 3VFLA 2W6RA 3IVUA 3MP4A 1TB3A 2GJLA 4RR4A 1FY6A 2Z0IA 3NEVA 4LOCA 3TC7A 4K8EA 5I3KA 4LW7A 3LXCA 2H90A 3TJXA 1VQTA 2QKFA 3UZ5A 3PC0A 4N4PA 4NU7A 5A8GA 2V81A 3TW6A 1WOBA 3Q94A 4LRSA 4ZVJA 2Y89A 5G2HA 3PF3A 4M7SA 3NQMA 3M9YA 4MFEA 3NM1A 1S3HA 1Z44A 4JTUA 2KZHA 4ZQPA 1G7VA 3SFKA 2A4AA 3W1QA 3EKLA 1FDJA 4JY8A 1TPWA 4AXKA 4NJGA 2EAWA 2C0AA 4ICNA 5D37A 2A5HA 2NXHA 4O1CA 2QCFA 5AC8A 2FLIA 3F1QA 2F7FA 3KVJA 5D33A 4AWUA 2ZZ3A 3SSJA 1BTMA 1KTBA 5K4XA 1KLYA 4HHPA 1TPH1 1QO5A 1I8JA 4DEFA 4UTIA 1GVOA 3LV5A 3E96A 3NXFA 1KFCA 3RF9A 3EWZA 2JGYA 3NG3A 3W83A 2PRLA 4PH6A 1FCBA 3RLUA 2A21A 2V2CA 1R2SA 5CZ0A 5TIMA 2HTMA 1VJIA 5E0KA 4CNPA 1XCFA 3MYOA 1YTEA 4BWLC 2GQAA 3NYZA 4O50A 2C1HA 2GQ9A 2V30A 3HGJA 2NUXA 4LY8A 1TPEA 1LBLA 1SW0A 2V82A 4LRTA 6ALDA 3L2IA 1HUVA 3GAKA 3G1YA 3W7HA 3W7QA 3FEMA 4DF0A 4O11A 3VE9A 1KM6A 1KW1A 2B7QA 2ZTKA 1FCQA 3UPWA 3G8EA 1PV8A 2NUWA 4JTHA 1Q6OA 3HG5A 4YMZA 1MEIA 3W1UA 1G69A 1FCVA 2FFCA 1TYGA 5G5IA 3T44A 1TV5A 4GJ1A 3HJZA 3W7PA 1HG3A 1H7RA 2YZRA 3T40A 1IF2A 1OJXA 4ADUA 4NZJA 3TUUA 1A50A 5C55A 4GBUA 3M44A 4Y96A 3PBUA 4PL2A 4S2BA 1I45A 3CT7A 4MLRA 3SIZA 3IGXA 1W5PA 3PVFA 3MHUA 3NZ1A 2ZZ5A 2GPTA 4PTNA 4Z1BA 5LKYA 5C5YA 1Z48A 1XDMA 3LCWA 5AHFA 2ZRXA 1G6CA 4FNRA 3OHIA 3SZ8A 2J9ZA 4MLJA 1PS9A 2QCEA 5KSWA 2A7NA 1HO1A 3LI1A 3S5ZA 3NPVA 4P61A 4NNCA 3EWBX 2G95A 4OE7A 5A5WA 2B7OA 1MSSA 4OV4A 4Y6GA 1ME9A 3GDKA 3V75A 1ZALA 1TQXA 1TSIA 3HOJA 1I2QA 4FHAA 2ZYFA 2FTPA 5IM51 1VRDA 1NAL1 3P80A 4PL1A 1LM1A 4RJEA 4M19A 5D30A 1ALDA 2PRMA 1XBYA 3A5FA 4S2CA 2QCLA
chains in the Genus database with same CATH superfamily
1X98A 3CZKA 3W1RA 4C5ZA 4OV9A 3MUZ1 4XAFA 4C6PA 3OVQA 4AEOA 3IIPA 3KOXA 2MUCA 1KGWA 2C16A 3BGJA 4B2DA 1PSCA 1UR4A 3PG9A 1F76A 3R8GA 1B4EA 5I6SA 4CQ9A 1CXIA 5FJTA 1G4SA 3B0XA 4PUNA 3FX4A 4PULA 1OGGA 3S2JA 1KTCA 1TJPA 2INZA 2NUYA 3KRZA 3WG6A 1RCOB 4IPNB 1W8SA 4J27A 5I2UA 1W1IE 1JPDX 1DIKA 2XN2A 3U4FA 4HZ7A 1CGTA 2HV5A 1H49A 2WCAA 3ABXA 1MW1A 4YVXA 4QFUA 5AC5A 2IKGA 3IJDA 2BXVA 3LDVA 4ZO6A 5J5DA 1R46A 4P7OA 3EA1A 4GZJA 1EOKA 3TYCA 1W31A 4GYFA 3WLNA 2VELA 3I3DA 5IHSA 3O7UA 3CXOA 1TX0A 1Q5MA 5HNRA 3VX0A 1DJGA 2P1FA 3AQUA 3URNA 3W2JA 1T41A 1FWRA 1ZJIA 1UD3A 2ZA1A 2Q8ZA 1Q6GA 1G4PA 3NQ6A 4D6DA 5CSYA 4XAPA 1PIIA 3CIWA 4JR5A 5DF0A 3N6QA 4DB7A 5KETA 4C90A 2YDSA 4UUIA 4G56A 1IGSA 3QFWA 2E1WA 2Y63A 3ES8A 3CUHA 2YSWA 1YDOA 2X42A 3IV3A 2PWVA 2HRWA 1HJVA 4HB7A 3S2LA 5HATA 3NL5A 4B3LA 4N42A 5DMLA 4GACA 1AL8A 3BQ5A 2A3EA 5JQ9A 4R7JA 5HQMA 2ZUWA 2F61A 2XFRA 5I3HA 1JZ4A 1M1BA 2XVPA 2CLFA 1W9UA 1DE6A 1DIDA 4GUGA 4HU4A 2C6QA 4EACA 4TTGA 3GB6A 1XX1A 3PB0A 4AC7C 5C7VA 2Q01A 2WB5A 2WHLA 2FH6A 1YQ2A 2WCGA 3E9AA 1H7OA 4IPPA 1TJ2A 1V93A 1JEZA 3WMLA 3SECA 1T99A 3E0VA 1D3CA 1OBAA 2VENA 3NNTA 4UMCA 3LB0A 2HVOA 4B3KA 3QTPA 2DSKA 1MQRA 4AZ7A 1HL8A 1W2PA 2VWTA 2OJPA 3GBDA 3MBDA 2BOGX 2VO5A 4UTTC 4GVHA 1SZFA 1KBIA 1R3WA 1LRQA 3N1AA 1GONA 2TMDA 2GWNA 2PCEA 2DUAA 3ANYA 3GD6A 4H7CA 2J66A 2YCLB 1KKRA 4V1YA 4HNTA 4Y2WA 4MIMA 3NZPA 3ZR6A 4CU8A 1QDSA 4O53A 2YW4A 5CQ1A 2R82A 1FTXA 3TFCA 4IMCA 3LHZA 1U1JA 3O6YX 2CIPA 4GIYA 4QIUA 5I02A 4JDBA 4K68A 3PZVA 3R58A 3M0ZA 4W86A 3PTQA 4DLFA 3OLDA 3WK2A 2Z1KA 4MJMA 1AW5A 1XF0A 4E8GA 3GDBA 2G50A 3A64A 3CL6A 1IXPA 5H8MA 1V3LA 3TTOA 1EPVA 2UV8G 1AA1B 4BF5A 1WKYA 1R30A 4HNCA 1EB3A 1XLHA 1YEYA 4DJED 4I8YA 3QEZA 4HN8A 5F2MA 1VD6A 3W75A 4ACYA 5HWNA 3OHMB 3EDKA 4ML4A 3P2VA 1UBPC 3W86A 4P7NA 2ZC1A 3THQA 3UJ2A 3E2VA 2QW5A 4US5A 2G3JA 4G1NA 4UZSA 3CJPA 3I7RA 1EEXA 4TO8A 3W1PA 3KTCA 1XIIA 1XSKA 2VDGA 2YDAA 1JQXA 4AVOA 1DWAM 3C0QA 1FWNA 4DZIA 2ZKMX 1ISYA 1XH0A 2OMAA 3RG6A 4AZHA 4X9YA 2I9UA 4F48A 3VDAA 4AHOA 1UROA 4HIBA 1VFLA 3EGJA 2YL9A 3L4YA 5AHNA 1Z42A 2Y1HA 3CO4A 2Z24A 1IXQA 4I9AA 3CTLA 3WEZA 4JNYA 4I9MA 1RJRA 2YB1A 4N9CA 5DCEA 2GQ3A 2W4XA 2QNEA 2BVTA 1GKQA 4UCGA 3QFEA 4W84A 3UG4A 1VS1A 5FF4A 1DIEA 2FMNA 1W2VA 4XWUA 1BGAA 3R0KA 4ACZB 4C7FA 4A6GA 4EPKA 4F40A 3TN4A 3GG0A 4C6BA 1DWHM 2Z6IA 4IPJA 5GNYA 1FX6A 4YHGA 4PCPA 2J24A 1TV3A 1XINA 2GK1B 4YYCA 2I56A 5JVLA 1WDWA 5JBFA 3B03A 2WC7A 1H62A 2OKTA 1H0IA 3KLKA 3HA1A 1DTNA 1GEHA 4PCFA 4ZE4A 3BOLA 4DUVA 3HG4A 3WL1A 4DWSD 4DBSA 3WBWA 2IS7A 1P4CA 4KW2A 3GYEA 4J3XA 1EO7A 1N82A 4GY0A 4Q22A 3NQ7A 4WIWA 5LNUA 3WFAA 4D6IA 1HKMA 1OYBA 1ZJBA 3MO4A 2R24A 2HBXA 1O68A 1TTQA 3LY0A 4KIEA 3CAWA 3WX7A 3CUGA 3RLGA 3MUCA 4PZVA 1S2UA 2GSEA 2VOMA 1MZHA 4LS2A 4JHMA 3DKJA 3WK3A 1L6WA 1B54A 3KOFA 5D38A 1XLKA 3TYDA 2UY2A 1YE6A 2PRHA 5J5RA 1QPQA 5SWUA 1MZRA 1TQJA 4GZEA 4IGNA 3OIHA 1W6TA 4F9DA 1H7PA 3GUWA 4JY9A 4TOQA 3SRKA 2X30A 1MRQA 3BV4A 1R9YA 3ZJ6A 3B3DA 4AD1A 3TYEA 6PTDA 2HXTA 4NZ5A 1YXYA 1OY0A 2QCCA 5LIYX 2X16A 1Q8AA 4LANA 2BXYA 1JFHA 3GFZA 2Y5JA 2EJAA 4J28A 1US0A 3S1XA 5BRPA 1M7JA 1RR2A 3SJ3A 4LYQA 5G1YA 3MCMA 1NP0A 3WQDA 2HISA 5E0FA 2PTYA 4K8GA 2E68A 3T0DA 3M0XA 2O7QA 1J5SA 4YPJA 4QAIA 1C91A 4IT1A 1GQJA 2VI0A 3OQEA 4GH3A 4WKFA 1KR0A 3PZ9A 3R13A 5HNUA 1U1UA 4NG3A 4DJEC 4O13A 3FA3A 3PZUA 1YPFA 3UZZA 3GNPA 4O1DA 4LU0A 3KP1A 4WJEA 3ECQA 3VNYA 3HPZA 1V3JA 3ARSA 3QMTA 3OG3A 4LS1A 2RH9A 3SY8A 2XH4A 1MDRA 1NARA 3SB0A 4BY3A 4C6DA 2YCIX 2HJPA 1R2RA 3M43A 9RUBA 5G2IA 3WLHA 4XAYA 4LUSA 1BLIA 3EOOA 1CPUA 3NQCA 3V7PA 3UA4A 6TAAA 1TPC1 1W1VA 1G0CA 3IUHA 4D8ZA 3IJLA 1QNOA 3UZJA 4UCFA 4BF7A 2QUMA 3L21A 3F4VA 1J12A 1QPKA 1XRTA 3S6DA 2DT0A 2RAGA 4BI6A 2XG9A 3B0PA 3IJ6A 4UNKA 4ZR8A 3RMEA 1UH3A 1KM4A 4EX4A 3UWYA 2NT1A 2VP8A 2OLHA 3LHTA 3PZQA 2P0IA 3UR8A 4EXBA 3L67A 2Y7GA 3SIMA 4A3YA 1GKRA 1H1ZA 2QDHA 1H51A 1SZRA 3OZMA 1UMYA 5LNWA 3TA6A 2OT0A 3BAJA 2ZE0A 2R1KA 4LUSB 1WP6A 2FVLA 4KRTA 4G7EB 2NVDA 3MW7A 1A5NC 3SBFA 1J18A 1XBXA 4IQLA 1WQ5A 2ZFAA 4NYUA 2PURA 3CPGA 1EA0A 4EIVA 2E77A 1W1TA 1JR1A 2J77A 4DWSC 4A35A 4X60A 4GJJA 4UMBA 3KRUA 3FS2A 4MB4A 3KWSA 3APGA 4ASTA 3DC0A 3QHNA 5LNVA 3FXYA 3H2EA 3AUJA 5A8PA 3NDYA 4N6FA 1FHLA 4WDTA 1GG0A 1A53A 3AROA 1ZBKA 3RPDA 3MI3A 4NHVA 3DXIA 1E0UA 3U5UA 1ZL1A 1MMFA 4KESA 3MBFA 3GNNA 3WBXA 2Z1VA 3BCFA 4FF7A 3NQBA 5A2AA 3W2NA 2BHUA 3PR2A 3QYQA 1J8VA 1YDNA 2P3ZA 3VCCA 4E2OA 1IR1A 1ONXA 1JIBA 4PSRA 3TDFA 5FF2A 4M82A 1JYXA 1QI4A 2QPUA 1V6WA 5GJPA 5ENLA 4JCLA 2Z1XA 1KBKA 3W1NA 3OYXA 4MKNA 3WQGA 3L4UA 1L0PA 2Y62A 2EG8A 1DKWA 3BG9A 1XIJA 2ZUTA 2BTMA 4XD3A 4IIGA 1S2TA 3BICA 2TPSA 1QPNA 3GNDA 1ZHAA 3RX2A 1CLKA 4YWIA 4C6MA 1H50A 5H8PA 3QSTA 3NZRA 5EBAA 5GVJA 5KZMA 4FLOA 2WV8A 1PEZA 1OABA 4DXXA 3L5LA 2GUYA 3AALA 2E09A 1M03A 1F9CA 2TODA 2QUUA 2QT3A 2Z26A 2W63A 3U3HA 1KRAC 3P6LA 1QXLA 3IJ8A 4WZHA 4A22A 3PULA 2WC4A 5F1VA 4FXFA 2ZRVA 1QWGA 1UJQA 4LV4A 3LZ5A 1YKWA 2PP3A 3WH9A 4GO8A 1EDGA 1M7PA 4AQLA 4OQVA 3EWDA 5BROA 1UZ1A 1VKFA 3EX2A 5REQA 1R3TA 1B4KA 1S38A 3BG3A 3M5XA 4MWAA 2PWEA 3QMSA 3DBNA 4WDXA 2RHGA 2FZ9A 5EL1A 1PVNA 3G0UA 3BLIA 3UESA 3W1MA 3R8RA 2J6XA 4UTKA 3MV11 3SEPA 4NRSA 1V79A 3AIBA 1CTNA 3PBGA 3TTSA 3WMBA 2E8ZA 2DSVA 1BSLA 4TV6A 2PEVA 5DXYA 3VGBA 3B8DA 4RXFA 5I07A 5HWMA 1F3EA 3MSYA 1A5BA 4PRTA 3MI2A 5D2YA 3WY1A 3DYOA 4D6CA 3TQ0A 2WPBA 3WNOA 3GC5A 5TF0A 1MQQA 3VDGA 2DZUA 3KVMA 4ICMA 4TX6A 3LXAA 1OQFA 3AMKA 1UKTA 4F66A 1O95A 1XJBA 1FDZA 5REQB 4AWSA 3IRSA 3T07A 1RQEA 4OBRA 1XCWA 4QGCA 3LMYA 1TA3B 3N2TA 3MY9A 4UOQA 1P0DA 1HP5A 1N8WA 3R2GA 1H5VA 3RYSA 3FLUA 4Z1CA 1DQXA 3QHMA 3FJ4A 1RH9A 3LA4A 3H24A 3V0UA 3Q65A 3VNIA 2HVMA 3N6HA 5BMXA 3CYJA 1K8CA 1AZ1A 4HNLA 4DF2A 3N9SA 5GNZA 2B0MA 4O54A 5LA0A 1J5TA 2Q3RA 4JQAA 1W5OA 3L4VA 3HG3A 4MZ8A 1OFOA 2G97A 3URQA 2O9OA 4KCTA 2BLEA 4M5PA 1NSJA 2XH0A 2I1OA 1HL9A 3P82A 1MW3A 5EMLA 1K9DA 2ZUUA 4JKKA 1X39A 4GRSA 4PMRA 1AQ0A 1YIXA 1FWJC 5A2CA 2Y0FA 3FEQA 2VCCA 1KM0A 1IIHA 1EP2A 3P60A 3RNDA 1ZBVA 4HBKA 1NVMA 4H00A 2F2HA 1EQPA 3B8SA 4DUXA 1K6WA 4LEFA 3RHGA 2IQTA 3L65A 5BNKA 4RLIA 3O0FA 3GXTA 6CGTA 3VIGA 4RW3A 3N15A 2R94A 3FKRA 3L4WA 4ZBCA 4YXGA 2V2HA 1FWCC 4S1FA 3G1DA 4MB5A 4S3BA 1E6QM 1XPGA 1TVNA 4Z2JA 2JIEA 3JZUA 3K4DA 4FEZA 5MKGB 1G4EA 5HDRA 3DFHA 1GCYA 2BB0A 1P6BA 1XGEA 3HIJA 3QC3A 2DUZA 1ADSA 4HZ6A 3T6CA 3MUXA 2XVKA 2DT2A 1GOIA 4MJZA 2CLKA 5AOUA 3UA3A 5LXEA 3QW3A 4M1RA 1V3MA 4CVUA 2BBFA 1PPIA 3VGDA 4MADA 5HA7A 1OEPA 2VT0A 4E4FA 4S3CA 2CESA 4O4WA 3KCJA 5BWAA 1JUKA 1MNZA 4QQUA 4UR8A 1ZAIA 3W73A 1A0DA 1RAKA 2AL2A 1NFBA 3NOEA 3BG5A 3H6OA 4U10A 1UR8A 4AD5A 3LTSA 3FN9A 4L1GA 1GVSA 5AKQA 2Z27A 5AC6A 5T26A 4LAKA 3BLPX 3WLTA 1SFLA 4XKMA 5EMJA 3EEZA 3FCPA 4L4OA 2X05A 3OYZA 3FY1A 2D69A 3GZ3A 2Q09A 2WNQA 3PTMA 5G1TA 2XJ7A 4MDPA 3CQJA 1GPFA 1I60A 2JFEX 4C1LA 4O57A 3SCSA 3PSWA 5I5RA 1F7BA 3MKVA 4PMOA 3CB3A 3LSBA 2OO6A 3PPHA 4IJCA 3HGRA 1FKXA 2ATSA 1Q6FA 2QYGA 4BI5A 3KL5A 1XC4A 1BF2A 3UF9A 3PP7A 4K3ZA 4CNSA 2OEKA 3CZ8A 4IGMA 4PRRA 3LBMA 3OVGA 4OU1A 3OZOA 2J27A 2PDLA 2AL2B 1FWEC 4DO6A 3FGCB 4MY1A 3AXIA 2XVLA 7A3HA 3W76A 4UTTA 4UNLA 2OR2A 4AY1A 1TV2A 4UC5A 4W5ZA 1LJYA 3S5OA 3TN3A 4YTUA 4LPCA 5HR7A 3N3TA 1KM5A 4J1OA 1G94A 3BMWA 5CG0A 4ZO8A 1XDJA 4YVVA 2F38A 1WNOA 2QCNA 2WHJA 2XFFA 1HJQA 1XS2A 3GHRA 1UIOA 1I2OA 2OELA 1TR1A 1EOMA 1QNRA 3Q37A 1Q7ZA 2H3BA 1W1PA 2PGEA 3MJMA 4WK9A 4PUEA 4DF1A 4IXXA 1ICSA 3NL3A 1S5NA 5E1QA 4QP0A 1S5WA 2PDGA 4M1BA 4HHHA 3T78A 1TJ0A 5GNXA 2ABAA 1RP8A 3RDKA 4GWEA 4E3TA 1JCXA 3ZXWA 4LGXA 3W7OA 2QQ6A 4GNKB 1E9IA 1X8CA 1XHGA 1O5XA 2EO7A 3VGFA 4GPNA 3P74A 2AGKA 1EJWC 1FWDC 2PFHA 1TV7A 3LQLA 4DM2A 1B90A 1W54A 3R89A 5I0DA 2YDQA 9XIMA 3M7SA 3QRHA 4GUHA 2D2HA 3EWUA 5B7ZA 3KRBA 4IUOA 4W85A 3M0HA 4MTVA 3WEOA 1A3WA 1FRBA 1U83A 1EKOA 3FJ6A 4GCXA 4X63A 3VM5A 1SUXA 1UHVA 3HPFA 4NI8A 1OF6A 4BCEA 1GVIA 3WN6A 1J2WA 3EA3A 3WUEA 2FTYA 4UR7A 4WUIA 1P1MA 7PTDA 1YBQA 4EVZA 4A8LA 2NLIA 2RKXA 3W23A 3R79A 3QQ1A 3W7DA 4H9YA 5IBXC 1L6SA 3ANVA 5D2VA 3FA4A 4HMCA 2OSWA 4RE3A 2FVMA 1M65A 3WQCA 2VM8A 3H7VA 3VIHA 2YPIA 3AXXA 3SQMA 2PUZA 1UWQA 1UYQA 1KRCC 4F9JA 4JD4A 4J40A 3ZLFA 1OX5A 5AN7A 2V3FA 4PTXA 3V16A 5A2BA 5A94A 2D23A 1YLVA 1QO2A 4XIMA 1OB0A 4UTFA 1D9EA 2NV2A 1HJXA 1J4EA 3ITVA 3HGOA 3NPWA 3GR7A 4LWWA 4F0MA 3JZEA 1UD8A 4JHOA 1EBHA 1O6IA 3KBMA 1LQ2A 3QH2A 1TIWA 4QNEA 3V1PA 3UZXA 3A13A 1XKYA 5EMKA 2OGYA 1SM9A 2FZNA 1DTUA 4KFNA 3NYDA 4XZ9A 4IIDA 1VYPX 4DYKA 4AIEA 2GJNA 4XD6A 3ZJKA 4H41A 4HJFA 4O1BA 3GKFA 3N9KA 5CG7A 1RA0A 1EF2A 2ZXQA 3LRLA 4RDZA 5G1MA 1HW6A 1LOLA 2QJNA 3ITCA 1C93A 3CUIA 5CGTA 1E1CB 3C2FA 3RU8X 3MSDA 1UR3M 2FB2A 2OOGA 4B5SA 1DIOA 3UPBA 2BVWA 3OTRA 5HULA 2YR1A 1TPDA 4OTKA 4WJ8A 3CHFA 4KCVA 2WSPA 1RP9A 1XIGA 1T7LA 3MCOA 3MUY1 3SGZA 4GUJA 1GKPA 4HK7A 3RPTA 1P5BA 3GBEA 3HQ1A 3AAMA 4IG2A 5F2LA 1AMKA 3R11A 3MKKA 4PODA 5CSRA 2EF9A 1FWIC 4EF8A 3GNOA 1O4UA 2YCKX 3NSNA 4FI4A 3SRFA 1BG4A 3AHZA 1E6PA 1TE1A 3ABOA 4IUGA 1WPCA 5L9FA 1EJVC 5CPTA 3VOIA 5EY5A 3MVTA 1W3HA 3NUKA 1PTDA 4FNPA 4WVXA 4RE2A 1UQZA 3KTXA 1FFRA 4B90A 1IZKA 1UJPA 3ICJA 3QGKC 4AFYA 1J01A 4NNAA 1IXOA 3GVGA 4QLJA 2VGFA 1B3WA 1IT8A 3TWAA 2OQYA 3BZGA 3C2EA 2YX0A 5CZKA 1QMLA 5FOOA 2X40A 1UC4A 2FZMA 3S3GA 3I3BA 3TSDA 4CUCA 4RZ5A 3ARPA 3S2MA 1K7XA 2YA2A 3C4UA 3O3RA 3WQ6A 2G3IA 1CNVA 1HN1A 1MUMA 1XSJA 2XYLA 3U0HA 1UR2A 1QNQA 1BXCA 1CB7B 2IPGA 1DJHA 3NDOA 3L4ZA 2WMIA 4LAUA 3SUUA 2WZMA 4DJEA 3B40A 1B5TA 4FNUA 4HNVA 5HMFA 1Q6RA 3ZS4A 3HPSA 1TWDA 3VNLA 4LJ3A 4OGZA 3LRKA 1N2VA 2CZFA 4GBDA 3WQOA 5H1WA 3Q67A 2DU2A 2W6RA 1TB3A 1D7FA 3N2OA 3NEVA 1TE6A 3ERPA 3TJIA 3R4IA 2WBKA 5LYRA 1UR0A 3MKCA 2PF8A 5A8GA 2V81A 2XM2A 2BP1A 3TW6A 3WFZA 3Q94A 2Y89A 3PF3A 2IMRA 3NM1A 3VIIA 1Z44A 1NDZA 3AWNA 4OZOA 4ZQPA 5HPCA 3A9BA 2QLYA 5HJYA 3SFKA 3WH8A 2A4AA 2Y24A 3W1QA 1TPWA 2EAWA 4GISA 4O1CA 3KBVA 2FLIA 2J8TA 4E3VA 3BCJA 3IUDA 4P8WA 2O9RA 2ZZ3A 3TTQA 3N18A 3SQLA 1BTMA 2D0GA 5JIPA 2VGIA 1CLVA 5TD4A 1TPH1 4UTIA 1GVOA 3GYCA 2ZDSA 4AU0A 1KFCA 5ABEA 1CECA 3RF9A 3NG3A 4PUKA 3UJRA 3W83A 4XISA 2POTA 2A21A 3TC3A 5ABHA 1PB0A 1SFTA 3BANA 4ZB2A 4CNPA 1XCFA 3MYOA 2GQAA 5HNNA 3NYZA 4I8DA 4O50A 1BVWA 3WNPA 2VVSA 4K1WA 3M64A 1ITXA 1R0MA 1K9TA 3WLRA 1XLAA 4AIOA 2V82A 4LRTA 3W7QA 4DF0A 3FEMA 1Q2RA 3LENA 3VE9A 4W88A 1KW1A 1EJ7L 4DWSA 2ZTKA 4L64A 1IEXA 4I9TA 3K4AA 1G69A 2IXVA 3GNRA 4AEFA 1FCVA 4ROPA 4GX9A 1IEVA 3HJZA 3HV8A 1TVPA 1HG3A 1H7RA 4B15A 3ZSTA 2Q6ZA 2DIEA 1OJXA 5I77A 3TUUA 4GBUA 4Y96A 3PBUA 1I45A 4OFCA 1EDTA 1RUSA 1LUCA 2G8ZA 3AJ7A 1JPMA 4IPLA 5C5YA 1EXBA 1Z48A 1Q6DA 4FALA 1I1XA 2VX5A 2JEPA 3OHIA 3R1ZA 3SZ8A 4C7GA 2QCEA 3TN5A 3S5ZA 2OB3A 2BDQA 2J7GA 4OV4A 3GDKA 3V75A 4GD0A 1TSIA 1FP9A 4B4HA 4DWSB 1IZCA 4ROQA 3KW3A 3ZOAA 2C79A 2WW5A 1CBGA 5IM51 1ZCCA 1VRDA 3T09A 2CHRA 4L1XA 4RJEA 5ABGA 4XO6A 3VNKA 4S2CA 2ISFA 4DELA 4F3HA 1CGVA 4A8IA 1A5CA 4QTGA 1Z6KA 1JNEA 3HTWA 3NPXA 2BX7A 4C6IA 1WUEA 4HYWA 2PDWA 1XIMA 3M47A 5FJPA 3UQNA 4O8RA 4BQ4A 1S5VA 3ALGA 8A3HA 4I5RA 3O1NA 2IPFA 3USZA 1P6WA 3BK0A 4REQA 3VD3A 5C54A 1QI0A 3ZQ9A 3E12A 2OZ8A 3EYPA 5D9NA 2E6AA 1X7FA 1C8QA 4CNNA 4L9XA 4HU8A 1F3TA 1V6XA 3OP2A 2Y85A 1W3JA 3L0KA 1QOQA 2VEMA 2E6DA 3SCUA 2CHOA 1C9DA 1KFWA 3WMSA 1CIUA 4U3AA 1JZ8A 1FXPA 1WB0A 3VCRA 2HROA 1DEDA 1SZEA 1LG1A 4RNHA 4KKXA 2A3AA 1JUEA 3RRAA 5CBJA 3AISA 3MSGA 1C92A 1VJZA 2ZQ0A 4JBRA 4GVGA 8RUCA 4WY0F 1X38A 4MJ4A 5CBIA 4RZ4A 4WGHA 1NIUA 2GSJA 1O5QA 3BCDA 2JQXA 2RGMA 4JIPA 4REQB 3GXMA 3K8LA 4O12A 4UOJA 3ZYZA 4HSOA 3V18A 4ORIA 2E7FA 3EMZA 3W26A 5MF5A 1Q6CA 1Q8JA 2FPVA 3PS7A 3DFTA 2WNZA 2GVYA 4W7WA 5XIMA 3ARUA 3OQ8A 1AW2A 3AICA 1ZU8A 4DYEA 3II1A 3TC6A 7TAAA 3MWAA 4W7VA 1RPXA 1K8ZA 1OFDA 1C7SA 3B9DA 4RK8A 3FAWA 2V9DA 4UTJA 3JRKA 2VR5A 4JKMA 4MAVA 1EA9C 3UY8A 4KWSA 2V6AA 1UKSA 3UYCA 4ZMGA 3WCZA 2VFFA 2VCAA 3TCEA 1CYGA 4A8NA 4B5UA 1LLOA 3STCA 4GNVA 3QV6A 3DG3A 2J9XA 3CBWA 4IIEA 3FHAA 1TV4A 2VFDA 1JZ3A 2X2GA 3T0AA 2PD9A 4H6EA 1TG7A 2FFIA 3WD3A 2EPLX 3UXAA 1QNPA 1V3KA 4NIRA 4AD3A 1QK0A 1ML1A 3ZR4A 3IK2A 2HMCA 1HKIA 4PMVA 4JN8A 5F4SA 1E5JA 3G5EA 1IGWA 1WO2A 3I10A 2GL5A 4FX8A 4RZ6A 3W7NA 2XU2A 5FJJA 1BGGA 4AX7A 5ECVA 4S3JA 1NDVA 1GQIA 4MGGA 1E0WA 1E55A 2GGIA 2V38A 1D3GA 1QVBA 5HUPA 2CHNA 5BU6A 4A2SA 4FIRA 4F0RA 5C9WA 1QATA 1GVQA 1RJPA 2ZA3A 3EDJA 3K2GA 2PP1A 1B3ZA 3F4DA 3V0SA 5KITA 5I7GA 3EX4A 3VIOA 2A3HA 3I65A 3AYRA 3H23A 5AZ0A 1L6YA 3W6YA 1RD6A 3CV2A 3O16A 3NL2A 3BLLA 4M8UA 3N13A 1VLWA 1WUFA 1DBTA 1MWOA 5KZ6A 1VFUA 1Q7MA 1YADA 1PZ2A 3U2CA 2YL6A 3O0KA 3F2BA 4UTLA 4C6JA 4EF9A 1HKJA 3BLFA 3EAUA 1HKVA 1TVLA 5BZAA 1P7TA 4XUYA 3E38A 3KEHA 4RW5A 3QW4B 2WPGA 2HNHA 4MHBA 1AJZA 2ZICA 1NOFA 3K4WA 4J4KA 1Q13A 1WV2A 3N4EA 5ECUA 3N3MA 3WENA 3EDFA 3NCOA 5KZDA 4KEVA 1W37A 2JKEA 3E6EA 1YMYA 1T5AA 1L8PA 1O7AA 2CLPA 4GIEA 3U2ZA 1EWDA 1OGBA 1GWJA 4JTDA 2PPGA 1Q6EA 1VEOA 1YRRA 4A8RA 5LA1A 1XD1A 4JPGA 5B80A 2J6VA 4Z0SA 1VCFA 4Z17A 1EUNA 4HNNA 3H2MA 4E6MA 4GG9A 3SCRA 4ILSA 2W91A 2YLAA 1VFOA 3VKAA 3TONA 3ES7A 1TREA 4K7VA 3RXZA 3VILA 1UASA 3W81A 4JIQA 3HPXA 4WKAA 3P8IA 2B31A 4KCWA 4DO7A 2C15A 2Y5SA 4OBTA 5AC4A 1KQZA 1IZJA 3D5HA 1CI1A 5XIAA 1P7TB 4GNJA 3IJ9A 1BXNA 5FEPA 1XR2A 2ASHA 1DJWA 5CZJA 5FD0A 1PCWA 3H2AA 1O12A 4M24A 4PCSA 2XUCA 1L6GA 3G1FA 5AYXA 3M41A 5U4NA 4NZ4A 3W1XA 5I3DA 2CCRA 1XIDA 2GGGA 1XGZA 1R87A 3HJEA 3SCNA 4JTCA 5FJOA 1DJYA 1FVPA 2HQAA 2ISSA 1GYMA 1B0IA 4NX0A 3CM4A 4I5UA 3TROA 2HCVA 4DAIA 4E38A 3CHVA 1I2NA 3MMDA 4HK5A 4BQ2A 5CPSA 4NQ1A 5I03A 3MDWA 3OA5A 1RBOB 5BXTA 5C0QA 2CITA 4PBEA 4ZZ9A 4KIRA 1A5LC 3IAQA 1MI3A 3B9AA 3OLEA 2AQVA 3GW0A 4M3PA 2PDIA 4J5NA 3WDIA 3E0FA 3U2EA 2QULA 1HF6A 1V77A 4H01A 4ZQRA 2BY1A 3ARTA 4MWAE 1VB9A 3FSTA 1TJRA 2JGQA 1BHGA 4HT3A 4XZLX 1XIFA 2YCJA 1TZ7A 3EKGA 3QJAA 2Y88A 1L9WA 4R9XA 4AB4A 5A8NA 4IP5A 1BPLB 2H8XA 3PZMA 2R1PA 4LCRA 2EG7A 5F1UA 5HBFA 1NOUA 4X0NA 6XIMA 2CBUA 3BUVA 1OFRA 5L6UA 1X96A 1K9FA 4I7VA 1UKOA 3BGAA 1FBAA 3E74A 3KOZA 4O17A 1FH8A 3GM8A 1UP0A 4A4AA 2J75A 4CD8A 4RPPA 3KBJA 3CQ0A 2DIJA 3AZRA 5CXPA 3NQGA 3KVLA 4H9XA 2YCEA 3QKEA 2RDTA 3IK4A 4OECA 4WOQA 1BKHA 2FKPA 1UP3A 4O0QA 1OCQA 1XPYA 5CPMA 4WJXA 5K9CA 1O94A 3WIJA 2QAPA 2DZVA 1XSIA 1R7AA 2I57A 4C6EA 1R8LA 1LWJA 1U5HA 5A6TC 2B7NA 2XVGA 3LV6A 1AMYA 1QW8A 3KAOA 3UD6A 5CH9A 3B0VC 2V68A 4PUMA 1D8CA 3N34A 4C5YA 2XFWA 1F8MA 5IBXA 1XCXA 2JALA 4Q4RA 3ARRA 3CO8A 4DLMA 2QMKA 4TMBA 4FP1A 4M80A 2QJIA 2R91A 4H8UA 3VNZA 2PDQA 4LNCA 2BHZA 3WNLA 1SU5A 4M6QA 4Q8TA 4QX4A 1UIPA 1JDCA 4IFOA 3HMJG 4IQJA 2P8CA 4J2PA 2ZTJA 2VHLA 3S1UA 3W7RA 2CW6A 3LHVA 3B9EA 3TX9A 3QF0A 2VD8A 4C1NB 1O1HA 2A1YA 1UA7A 3VX1A 3CTTA 1B3VA 4XV0A 4XTIA 4WSJA 3AU2A 2Z2AA 4L9YA 5E6ZA 3K46A 1H2JA 3NZQA 3TU9A 1J96A 5EFDA 1C90A 5FJUA 3E49A 3DU0A 2WHMA 4G7FA 3CUZA 4IMFA 4H9UA 1SMDA 3NSMA 2P53A 3T1GA 5AECA 2DZPA 2Y8VA 3JR2A 1KO0A 4MUPA 5M2FX 2R1MA 2VEPA 1TTPA 1SZNA 5AFDA 2IKJA 3T4WA 6TIMA 3CL7A 1H3GA 4R34A 1QHOA 3W7LA 3WLKX 3I4KA 3OLGA 3PY2A 1EC8A 1KFJA 2QJGA 1YNYA 1JFXA 3CK5A 3DAQA 1J9YA 1YXDA 3S5SA 5HUOA 4QLKA 2VDIA 3ZT5A 3CHCA 1IEWA 3O05A 1GGOA 5I3FA 4C6QA 2IPJA 2ZXDA 4DJFA 1LRTA 3L12A 4W8LA 3NOYA 1Z69A 4O0KA 3H2NA 3RCYA 3CPRA 4CNTA 4UQBA 4OIFA 4E2BA 1XBVA 2PDBA 3CU2A 4Z0JA 4QSHA 2WCSA 4AZBA 4CCZA 1NWUA 3R25A 1TMQA 2ZUMA 4PB5A 3HFYA 3U6WA 4FX7A 1BTCA 3DFOA 4W5UA 1ZAHA 4LX4A 3U48A 1K4HA 3KWXA 3ME3A 4XZIA 3LSCA 3KBSA 3K13A 1H5YA 2AMGA 1VPXA 2YLLA 1N8FA 2G4JA 2E4TA 1OFBA 4TMCA 1E9ZB 3WF1A 3WF2A 1R6WA 2PGFA 3FJLA 5AB3A 2HE5A 2D1ZA 1O60A 1SJDA 2J74A 1Q66A 5KINA 5DY2A 1ONRA 3SADA 2BG5A 1SW7A 4G6CA 1VFTA 2W79A 1VBGA 4KRZA 3E5BA 4Q8QA 4ZGYA 1XLMA 3ITLA 3CB8A 2DP3A 5HNTA 3AUOA 4R5EA 1I0DA 4L6DA 3CLMA 1UC5A 1ZJHA 1PBGA 1V5XA 2NX3A 5IFPA 4YS1A 1ADOA 4MMWA 1UPPA 4Z2HA 5F2GA 4RNFA 1EUAA 1VBJA 3DUGA 1YPXA 4DM1A 5FF3A 4ZL1A 3AHXA 3GWQA 2NWRA 2XIBA 3EXTA 2P8BA 5A6KA 5BRBA 2Y4SA 3GXDA 1TELA 1RALA 4HSNA 3VNMA 4BQ5A 1YNPA 1QHZA 2OCZA 3KFTA 4GYPC 4LSBA 3LRMA 2VFIA 1N7KA 3P8JA 2OSXA 1XBZA 3VKKA 1LWHA 2OU4A 2OSYA 3VMOA 3GDRA 2WVVA 1T8QA 4DUOA 2V69A 4JTIA 4CLMA 1VGAA 4OKDA 4MNKA 1X6UA 3ZLGA 1OFEA 3VD7A 4C6FA 4UQAA 1UQYA 1R7OA 3RM9A 3AO0A 4QEEA 1EZWA 4K6AA 3C52A 3EB2A 5FSEC 1K9EA 2FDSA 3O6DA 4I6VA 4DXVA 3BDKA 4KH2A 5EU9A 5D04C 3RFAA 1DJZA 3PZTA 4H83A 2QDEA 7TIMA 1PE1A 5CAKA 3VDCA 3OO2A 2ZRYA 4ZENA 1XYFA 1ZB5A 4JTEA 1UCWA 2FPYA 3GHTA 3W2MA 2F9RA 1XLJA 1YXCA 2WVVB 4DBDA 1SO5A 3UNDA 1J0YA 1XC6A 2OQHA 4BZYA 1SR9A 1SPQA 3TQVA 2ZVIA 1A4LA 4LBUA 2FVKA 1B3OA 3AIWA 4OHQA 3DENA 5DCDA 4IL0A 3M6YA 4XK2A 2J7DA 2XIOA 3KCOA 5CJMA 4KWOA 2WLYA 1ZBWA 4PE8A 1HO4A 1TTJA 4B92A 4CVWA 2F6KA 3SCQA 3LBOA 2PWGA 4FIQA 1P1XA 4DRSA 1PL9A 1VHCA 1WCGA 1JQVA 2PBOA 1R3SA 2W67A 4TV5A 2GVJA 3C56A 2HBVA 4GGHA 2DT1A 3JVAA 3A12A 2QCMA 1K3UA 2GJXA 2PLCA 2E40A 3NGFA 4JX5A 3U7VA 3W72A 3TP4A 4AD0A 1UWUA 2VFGA 3B04A 3GVQA 4N9BA 4UMAA 2EPKX 1ZS2A 1A3XA 1CENA 2NV1A 3RO6A 2CBJA 5FL1A 5CCZA 2GDVA 2CETA 3QV8A 3WJYA 3GY1A 1RBLA 1DWFM 1A80A 1J0IA 3CH9A 4JEJA 4LT9A 2PAJA 3VVGA 5HMEA 3T4CA 1QPOA 4MZ1A 2VQUA 3O63A 1CB2A 5IHRA 2QXWA 2PDJA 1S2VA 4GIAA 3ANUA 1RBAA 2OTDA 4Z1DA 4F2UA 1AQHA 4HNOA 3W3OA 2VRJA 1H60A 4UNIA 2E9MA 4ZTYA 3OG2A 4ORMA 1AZ2A 1QNVA 1B3XA 1S1PA 4LF2A 2GJXB 3WBYA 3TW7A 1J79A 4HOZA 5RUBA 4WX2A 2HSAA 4H9MA 4R27A 4JQ4A 5D09A 1I75A 4Y9MA 3W88A 4LTSA 2ISVA 1PWMA 3LZ3A 1DOSA 3PTKA 4EP8C 5DRCA 3WQPA 3OGRA 4WF7A 5DFAA 1DP0A 4IX2A 1REQA 5C2CA 3H22A 3CZGA 1XYMA 3KDNA 4IFKA 2UY5A 4RXGA 1THFD 1TFVA 2QDDA 1F4HA 3F5LA 5TQLA 5HR6A 2FB3A 3DFQA 2OWCA 2A2IA 4FX6M 1E56A 2WJEA 3TIMA 5BOFA 1GYLA 4BS0A 3O06A 3WLPA 1KBBA 1F07A 1AJ2A 2QUTA 1KV5A 1R38A 4NVTA 3W1AA 1XH2A 4H7VA 4J3UA 4YN5A 4Q8VA 4C6CA 1WYIA 1MO0A 3CUJA 4EWND 1R3QA 1OFAA 4W89A 4NJHA 2A3CA 2ABBA 3L5AA 4LVBA 2G3FA 2ZRUA 1NDWA 1HP4A 4Q7NA 3W38A 1ZLPA 3BOFA 1EEPA 2QHAA 1JZ6A 1CCWB 1REQB 2XH7A 1FWWA 4W4QA 3QOKA 1ME7A 1G7UA 3T08A 2F84A 1EDQA 5HK4A 3P14A 4KPLA 2WWDA 5KMYA 3QLDA 5FJRA 4PFMA 3EZ4A 3SCVA 1DJXA 3M0JA 2G0WA 1DJQA 2V3GA 3DCPA 1BYAA 2D0FA 1JI1A 4LC6A 4PRWA 2O92A 2DIKA 1PZ1A 2C1IA 2YXXA 1LTDA 4HHLA 3BLEA 5KEZA 3GC4A 3KDOA 4UQCA 5CPNA 5AYZA 1VFHA 4QG9A 4KETA 3S9YA 2WMHA 3A4AA 1U1HA 4GGBA 3WD1A 7ENLA 4BHYA 3POHA 2V3DA 4YTTA 1W3LA 2NX9A 1K4GA 3B4UA 4BA0A 4Y8EA 4K8HA 5I23A 3ISIX 4DZAA 2ATMA 2J7BA 3QVQA 4JIEA 3GVWA 3VKJA 1KCXA 2NQJA 3D6NA 4ZFMA 3ABSA 5C9RA 3U4AA 3B4YA 4MJ2A 5DT5A 3TR9A 1ICPA 3TOPA 2DY3A 4XD5A 3ZMRA 3OODA 3PTDA 2DZXA 4G9PA 3RGTA 2Z1SA 4JN7A 4QQ3A 2HXUA 1KRBC 3U5YA 4JQ3A 2OPJA 4QLLA 2OGJA 2PZNA 3VIKA 1CDGA 2EKGA 3G1XA 3S9ZA 1KA9F 1Y0EA 1ZQ5A 1G9HA 3C2YA 1NTHA 3LGEA 2A0NA 2R9RA 3U9IA 2BOEX 5C9XA 2ZXAA 3IIVA 2PLKA 2FPTA 1W8GA 3N11A 1EF3A 2CYGA 2GFTA 4L80A 3W4RA 1DJNA 1CGYA 1OG0A 4A3RA 4AZCB 4O15A 4LXFA 3GX9A 4XSMA 4XIAA 3MU7A 2EPMX 3FSUA 4JHZA 2YFOA 1XYBA 1VF8A 3OEXA 1K03A 4CU7A 2IW0A 4QAWA 4AD4A 1Z89A 3UZYA 4IGHA 4PMZA 5DBTA 3WK1A 1M9HA 9CGTA 1FFQA 2VFHA 3QC0A 1OGSA 1Q85A 1GOQA 1KXTA 4P8XA 3LG3A 1WAWA 1OK4A 3G0XA 4WHBA 4XVDA 2C14A 1R9ZA 2NZLA 3LEPA 2A3LA 3R43A 3WDPP 2CLOA 4A29A 1VBUA 3STFA 2ISWA 3GFYA 4YVPA 3N2XA 4ICCX 2QF8A 3A9IA 4JTGA 4O8AA 4Y8FA 1BAGA 4HSHA 4OJYA 1A5OC 3G1VA 4MVAA 2POZA 1JPIA 2CBIA 1UWSA 4PCNA 4OWGA 2NQ5A 1V03A 1UP2A 1I2PA 2PD5A 4JXCA 3I6TA 4LVFA 5DMYA 4BF9A 3QPYA 3EXRA 1SSGA 3DKLA 1XLIA 4DQWA 4WY0A 3W01A 4GI4A 4DZ5A 2WMKA 1AD4A 5C6MA 2NLYA 3PSVA 3GDMA 2YCLA 3PPFA 4JX4A 1OVDA 1XLDA 3H7RA 4M6UA 3FOKA 1KD0A 5LIXX 3D46A 4ZA0A 3A5VA 3BH4A 5EKYA 2WZEA 3CWOX 4ALDA 3VI2A 3OIXA 4GXPA 3HG2A 3V4BA 3VDHA 3OBKA 4IL2A 2NQLA 1FWBC 5JH2A 1QBAA 2WSYA 5C2GA 5I78A 4HMNA 3HBLA 1O1ZA 1WKFA 3IVSA 1XI3A 2O4QA 4GE8A 5LNSA 4GCAA 4WY0B 3OBEA 4QE1A 3KXQA 2PCQA 2X8RA 4PMDA 3GIPA 1HJSA 1PYFA 1UR1A 4AWTA 3W82A 2DH3A 4O10A 2RDXA 5FESA 1V3HA 3W07A 4IPIA 4MDOA 1HIZA 2O7SA 5D8ZA 4AHPA 1VLIA 5AYYA 5U7SA 1MUWA 3C2VA 4F8XA 4MFDA 2YW3A 3OZPA 1TUFA 1KXQA 3LNPA 3E5PA 4A3UA 3WFLA 2QAFA 3TNOA 4ZOCA 3T0CA 2WOQA 3EPNA 4I7UA 4Q8WA 2WK2A 3LQGA 1BVZA 3PBYA 3O6CA 1A5SA 4ADSA 1NQ6A 4B4FA 1UUMA 3EX1A 4O16A 1P0BA 4D6EA 2CFFA 4D72A 3L9CA 2NWSA 5AVHA 3O8AA 1Z3NA 1TPUA 2ZX6A 3TQPA 1JYWA 1ZBCA 2JBMA 2EJ1A 3WJXA 4IMEA 5CBBA 4QRNA 3UR5A 3Q45A 2AL1A 3A24A 1E1EA 2WKLA 4LUTA 1JVNA 3ENLA 5C70A 4IX0A 3W6LA 1F6KA 1LWIA 3PPCA 4IXHA 4ZTXA 3VD5A 3ZJ7A 2XZ7A 1QNSA 2PWHA 4PTWA 4ACZA 4LBSA 1PX8A 1EFZA 1DHKA 3TE9A 2VRKA 3GC2A 3NAVA 3WF4A 3S1GA 2WZTA 2UY3A 2GK1A 4AHQA 4URIA 1JRCA 2ZWZA 3P67A 1DV7A 4HN4A 5A8MA 2EXOA 4POCA 1NU5A 3S6TA 4IIFA 2PTXA 1A47A 4Y7EA 4YJ5A 2ICSA 3MP5A 5D4YA 4KRUA 1JAEA 2AOSA 3DI0A 4ZEPA 3Q2DA 2E6YA 1T0OA 2FGBA 1YNQA 3IIZA 4H9VA 3W27A 4LYPA 4LUTB 3LCIA 4D6GA 3RUBL 2HK1A 2VCBA 3MS8A 1FA2A 1KFEA 5HXMA 3W2UA 1RQBA 2XGIA 3VINA 4G2DA 1V6UA 3MP4A 4RR4A 1GJUA 3TC7A 2ADAA 3KOYA 1E73M 1PUDA 5I3KA 4LW7A 5HMDA 3TJXA 1VQTA 3F5KA 3O9NA 3WO8A 3WQEA 5BYWA 1K6AA 3BSMA 3PC0A 1PKNA 4N4PA 4AW7A 3AIUA 1WOBA 4ZVJA 5G2HA 1MXDA 1SGJA 3M9YA 1S3HA 1KCLA 4JTUA 1G7VA 2VUYA 5GJMA 3GH4A 3PJXA 3ITGA 1V6VA 2P88A 4MB1A 3RM4A 5EB8A 2NQ9A 2A5HA 2NXHA 3VZYA 2QCFA 2O9PA 2OWWA 3F1QA 3R0DA 2F7FA 5D33A 4AWUA 3SSJA 1KBLA 1QO5A 2AAAA 3H21A 1R3RA 4S3KA 2ZUVA 4FZIA 1EJTC 4AVNA 4Q6XA 3WL0A 2PRLA 1FCBA 4NY2A 3RLUA 1W1A1 3VMPA 4Q8UA 5TIMA 1VJIA 5E0KA 2ZXBA 1K77A 5T9BG 1FWGC 1AD1A 3T2OA 2P5NA 2OQLA 3L4XA 4PMJA 3R10A 5H8UA 4LY8A 1TPEA 3IV8A 3E0WA 1DXIA 1HUVA 3RX3A 4DHGA 3G1YA 3W7HA 1DE5A 3V5OA 4EANA 1KM6A 1VFMA 2B7QA 4F79A 4YTSA 3UPWA 3G8EA 3V0TA 3HG5A 3LPOA 1SJBA 3VUSA 3CHDA 1TYGA 3T44A 4GJ1A 3NZGA 2YZRA 4NZJA 1S39A 3O2LA 5DQPA 5JXQA 1VJSA 1RLCL 3MHUA 3ABZA 3HQPA 3NZ1A 4GYPA 2GPTA 3RIKA 5LKYA 1M01A 4KMQA 2CPUA 2XWDA 1G6CA 5ABFB 4Z2LA 1PS9A 3NWRA 2A7NA 1VIZA 4LEQA 3NPVA 4NNCA 1TZZA 1SJCA 1MSSA 3RR4A 2Q71A 4Y6GA 1ME9A 1XLLA 4RE0A 1I2QA 1W9VA 5CC5A 4FHAA 3DG7A 4IIBA 2FTPA 2DDXA 4Z42C 3AIRA 1LM1A 4CD4A 4M19A 5PTDA 2QCLA 4DIAA 1EH9A 3SQSA 1TCDA 3F4NA 4WXYA 3M5ZA 2DEPA 3AHTA 3G3MA 2C8NA 3HF3A 3N29A 2O4MA 4LV9A 3N14A 3GVRA 3GIQA 4YYFA 4A21A 1IE7C 1QU4A 5DMMA 4O4VA 2VX4A 2P0OA 5LGXA 4Y9AA 3NEHA 4GYJA 1K7EA 4O52A 1OYCA 3UWEA 7ODCA 1JAKA 3DFSA 3V5CA 1E4NA 3QZEA 4G7EA 4JTAA 3JU2A 4JFTA 3U8GA 1XH1A 4GI9A 4RDVA 2C18A 1QRQA 1GORA 3P81A 2WZIA 4LS0A 3DFNA 2WKGA 2J7HA 4AXNA 3ZIZA 5HINA 1XQLA 4FOUA 1SVDA 4GKTA 3DHDA 3TN6A 4M6PA 4UTUA 2PWUA 2XGBA 1KBJA 1UKQA 4S38A 4C65A 3LOTA 2CLEA 1B57A 3FXGA 2QJHA 1XYZA 2CXGA 3ZZ1A 4QG8A 1U22A 2MANA 1NQKA 2WJDA 1BRLB 2VZVA 4ZO7A 1W0MA 3W70A 5C9UA 1JXKA 1R3VA 1XM3A 1I0BA 3TK7A 5I09A 1YPIA 2QCHA 3GTNA 2AGTA 2VEKA 3H2FA 3ZR5A 4S3GA 1WDRA 3CMJA 1EHNA 4MB3A 3FKKA 4FF5A 1YTKA 3CPUA 3WJWA 3UP8A 2VGGA 2BASA 4FLSA 5FEXA 5BCAA 5CC7A 5LIUX 5HOSA 1XYLA 3MI6A 4GOAA 1JD7A 3STGA 4NJKA 1QI5A 3OVRA 2FJUB 1W3KA 3M1ZA 4DO5A 5CLTA 1H61A 2G4FA 3NQEA 4X61A 3VOFA 2Z7KA 2Y7EA 4W7UA 1OCBA 3NO1A 4QISA 5DELA 1YE4A 3LM3A 2WZHA 4O1EA 2X7WA 3KS5A 4GQGA 3EPMA 5D32A 4TX8A 1JI2A 2FZ8A 4Z2GA 1KC7A 1PXGA 4JFWA 4JTQA 1PX3A 5GJNA 4D1JA 1VR6A 2AMXA 3ZWTA 4D8LA 4UOZA 1JXJA 1TPVA 2R14A 2VD9A 4ENLA 1MW2A 3BV7A 5H91A 3SUTA 3W74A 4E2DA 1OF8A 4AF0A 2DQXA 4U28A 8TIMA 1QTWA 3PJTA 3UR7A 5A6JA 3WSUA 5CZTA 3UXKA 4RV8A 1CX9A 2G3NA 1FWTA 3UU0A 4MWAD 3LUTA 1OINA 3M0IA 4U3CA 4B5TA 3NL6A 1RVGA 4JYEA 3VDBA 3KZSA 3JS3A 5LIKX 2WQDA 1QW7A 1G67A 4RNIA 3VABA 2A6LA 3W6MA 2XN0A 3TSMA 3NSXA 3RX4A 3G1SA 1C29A 3WUGA 2QR6A 2D2OA 4MZYA 1G01A 3N12A 1ZAJA 2GWGA 5AHIA 3CLWA 1FOBA 3ZT7A 3VK5A 3QY6A 3P7YA 3C3NA 3R0UA 3TNBA 2P10A 3NVDA 3OLIA 1V7YA 4AF0B 5CC3A 1JF5A 2NW0A 2W92A 2OXNA 1A5AA 1C8VA 1G4TA 4QJ1A 4NAEA 1YHTA 3WLOA 2DV0A 3SN4A 4HA1A 2A7PA 1UZ4A 2XSBA 1WDDA 2ESCA 1G1YA 1T8XA 4ATLA 2E67A 1QI3A 1GVRA 4A05A 2VEIA 4U2YA 3GU9A 1UBSA 1X1ZA 4HGXA 4WEVX 2RFGA 1GVEA 4NXKA 3UY7A 1E9LA 1TA3A 2DSZA 4GLEA 3EOLA 4QROA 3U7BA 3GIYA 1V6YA 3R12A 2Y2WA 3P62A 4Q6JA 4J7RA 7REQB 1V3IA 2D73A 2AAMA 4L9ZA 3CC1A 4DPPA 3N9RA 2X7VA 4N9EA 1JUBA 3STPA 4HKPA 3S2CA 3UWWA 3SR7A 3AYVA 2HWGA 4GI6A 4MY8A 5T9CE 2ACSA 3IGHX 2DPEA 3EOSA 3K5XA 1M53A 4JKLA 3A3WA 4NAEB 2PP0A 3CGTA 4AAJA 4UZUA 2QGHA 4UQDA 4GMEA 2OLSA 1LQAA 4DO4A 4H19A 4QJ5B 4F2BA 3W7KA 2O0TA 1WZAA 4KWUA 3KZPA 4OBSA 2V8ZA 1ADDA 2TYSA 3BVJA 3AYSA 3WLSA 4JS3A 1BFNA 3WQ4A 3L0GA 2ALRA 5A6SA 5D05A 3MO7A 3THCA 3WD0A 3G2GA 2E5BA 4OUIA 3PBVA 1QOPA 3MZNA 1E9YB 3W02A 3L66A 2QPXA 1GJWA 1GZ1A 2E8YA 2PTZA 1EP1A 2J8GA 5CZSA 1XLEA 4L4LA 1POKA 2VURA 3LPGA 2ZIDA 4MAZA 2X2YA 3PJWA 4LALA 3SCTA 5MKGA 1AH0A 3GZAA 1V02E 3DBPA 5DCBA 4GO9A 2CLMA 3UWUA 3TYBA 3URBA 5CSUA 3SCOA 3LNMA 3CZJA 4ES4A 5D2XA 3DG6A 4HQVA 3CWHA 3BE7A 1UD6A 4GVIA 1H4PA 1TX2A 4G1KA 1FH9A 1GPWA 1RK6A 2D20A 4JTTA 3WK0A 4O18A 3GHUA 5CGMA 4YCPA 4QITA 1TR9A 5C2XA 1BWKA 1UD4A 3FDKA 3S1WA 3CEUA 3VGHA 3N4AA 3LXBA 2ZCGA 3LI0A 1DYSA 2F6XA 2GSHA 4ZCWA 4L65A 1TRDA 4LUYA 3I7QA 4AZIA 4D71A 2GVGA 3AIVA 1EJRC 2RDWA 3KM8A 1Z9AA 4H2CA 3HV9A 3H70A 4MWAC 4PEKA 4H6KA 5E09A 4FR6A 4WKHA 1IT7A 2IKIA 2F2KA 5B7YA 4EPDC 3ZVHB 4KBXA 2E1DA 4RL3A 3ITXA 3TW9A 4L5ZA 5I00A 4A3HA 2VR2A 1XLCA 4C6NA 4K36A 3ABRA 3IJ7A 3C0JA 2QMJA 3KRSA 1I9CB 3D3FA 1ZY9A 1JULA 1M04A 1ZNNA 1V4YA 4I9JA 3GU1A 4TVDA 4C6LA 4QHRA 3KE0A 2Y6ZA 4PB3A 3WF0A 2IXUA 3HQOA 1I2RA 2VMFA 3FGCA 3K1GA 1IXNA 2VZOA 5D03A 3PBMA 4Z2KA 5M17A 3VIFA 1DWJM 1ZFJA 3AMGA 1JD9A 1WE5A 5CKSA 1EP3A 3EBVA 4JL2A 1TWZA 2Q8LA 4QJ3B 2F6UA 4ML9A 4YIWA 2VEFA 1WZKA 4AVFA 4D2JA 2WVUA 2PDFA 1F73A 3WZ0E 4CCEA 1QBBA 3CUFA 4CNUA 4K38A 1DORA 1ITUA 4KCUA 3HO8A 2CZDA 2EQDA 2YGYA 3CMGA 1RZMA 2X09A 2J4GA 3Q4DA 1Q3NA 2PC8A 4U5KA 1OHLA 2ODOA 1JGMA 5KTLA 3KL3A 1I6NA 1YDVA 4GZ7A 4V28A 4Q8OA 1ISWA 4P8UA 2GOKA 3MHFA 4E4UA 5D9OA 2W5FA 3QGAC 2AQOA 3H4XA 3WLLA 1HZYA 3TEVA 3H26A 4F0LA 3C0SA 1WOAA 3C61A 3OOQA 1LOSA 3AXMA 3DIPA 5DEZA 4IJRA 5DLCA 1KNWA 3W22A 4FS9A 1PKMA 3IS4A 5I06A 3WMCA 2X0YA 4IF2A 2VL4A 3GG8A 2B4GA 4UB9A 2XSXA 1V7AA 1WX0A 3BTNA 2WC3A 1UKPA 1FWSA 1UPMB 3R7MA 2QUVA 2H9AB 2HDJA 3BW4A 1VYRA 1LLWA 4EAMA 3KLLA 1Q4WA 2IUZA 4BEUA 4LQ1A 4M7TA 1QUMA 3DI1A 2PDYA 3G0SA 4JGDA 2XFYA 4P8VA 1TPFA 2FDMA 4DI8A 2GYIA 3DECA 3B8VA 4UFHA 4DZHA 2SFPA 3E0IA 1PIFA 2WYSA 4KEMA 1R9XA 4EPBC 4PUDA 1WXJA 1G5AA 2CZVA 3MYPA 1VEPA 4M6VA 3RPMA 1ZJAA 2YYUA 3QTGA 4NNBA 3T2PA 1B1YA 1W17A 4TVUA 3AS1A 1IQ8A 4JZ5A 4L4MA 3TSBA 3AS2A 4N9DA 1LDCA 1M68A 1ZGDA 4OT7A 5HJXA 2A85A 4JEQA 5CPOA 4GQBA 4B3ZA 3H2CA 4HTYA 4JTLA 4HPHA 1HFBA 1QK2A 5DT7A 3USBA 1GEQA 3Q58A 2F8QA 1NF0A 1CGUA 4HYVA 2GGHA 5C71A 3G1RA 1BKSA 2ZC8A 1EGMA 3N04A 4AZ5A 4Q4PA 1SO4A 6XIAA 1HT6A 4MNJA 4A2RA 2VC5A 4U31A 4CQAA 4HK6A 3EB4A 2VC9A 4XAGA 3TV8A 3CH0A 1P0KA 1TWIA 1SMAA 5DXXA 4N2YA 3T0BA 2XN1A 3I6EA 2FH8A 4KFPA 1LG2A 1OX6A 3GAYA 2GUUA 3WQWA 1E1CA 2V0TA 3W24A 4K1GA 2MNRA 2ON3A 3UW6A 4CQCA 4U2ZA 2Y70A 5EA9A 4HMDA 2VXNA 4MNMA 4R7WA 4CD7A 3C86A 3ZSSA 3B06A 3WQ8A 5H2ZA 2DZWA 2J62A 4JIHA 1ZENA 3W85A 2A3BA 3F7JA 4LB3A 4O28A 3NGJA 1GTHA 2ZZ1A 3VU2A 1V0LA 2E0PA 4O1FA 3SN1A 2EGZA 2REQA 1QHPA 2INEA 3GXNA 4JTSA 2PDHA 4NT0A 2W27A 5H6HA 1CEOA 4M56A 2GGEA 5M03A 5FA5A 1KFKA 3FIGA 1GK8A 1VH7A 5CLWA 2RJHA 4B9YA 1C9WA 3S5NA 2ZWYA 1SSDA