1UJPA

Crystal structure of tryptophan synthase a-subunit from thermus thermophilus hb8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
271
structure length
243
Chain Sequence
MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDGPVIQRASELALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSVEVKDLVRRIKARTALPVAVGFGVSGKATAAQAAVADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Stabilization mechanism of the tryptophan synthase alpha-subunit from Thermus thermophilus HB8: X-ray crystallographic analysis and calorimetry.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 92
structure length 243
sequence length 271
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ujpA00
4PL2A 1JCYA 1PHWA 3DU0A 3NQ8A 1G4TA 1LYXA 4JX4A 1JRCA 3HBLA 3WK0A 1DJQA 3CIXA 2VEIA 1SFLA 1R46A 2B0MA 1RVGA 1VR6A 4CCEA 3P8IA 3DHFA 3KRZA 5HWNA 5BW6A 4P2VA 1UB3A 1YTDA 3C2RA 4M7SA 4LU0A 1GVRA 4QM1A 1HFBA 4Q33A 3W23A 4AMAA 1FWTA 1VYSX 3M0ZA 3CLMA 4DELA 3NQAA 1VGAA 2JKAA 1W5MA 3CB8A 3KOFA 3W3OA 3M1ZA 3PUEA 1Q6LA 1F6KA 2ZYFA 5U7SA 2TSYA 2Y7GA 2XN1A 4ONVA 5AHIA 1MXSA 4GUIA 4PEKA 1KFLA 1OYBA 3LI1A 4HPJA 4KFNA 4O10A 1QPOA 1FY6A 2JK2A 5LHFA 3THQA 3BGGA 1TPWA 1JQXA 4IWWA 4QAIA 2DJXA 1P0NA 3QPYA 3GAKA 2YSWA 4HHPA 3FOKA 3N3MA 1BEUA 1F05A 5CSSA 4YCPA 5AB3A 4CNNA 1JCLA 3THAA 3B0VC 5TBOA 1H63A 2F84A 5G2IA 5DN1A 2HS8A 3LTSA 1XCFA 2QEZA 3JS3A 3PBVA 4AWTA 4JYDA 3UWWA 5DLCA 2ZRUA 4JYEA 1MEIA 3E02A 4QITA 6ALDA 1OX5A 3CEPA 1PHQA 4OV9A 2YDAA 4Z1AA 4Y90A 5FF2A 4UFKA 5D03A 1H51A 1LRTA 3BG3A 4RX0A 5DCEA 3NAVA 2OJPA 1K8YA 1GOXA 3EX3A 4MJMA 3OHIA 4LVDA 4O12A 4IJBA 1TIMA 1XM3A 4EF9A 1IGSA 3W7JA 2YX0A 1VJIA 1FWRA 3S8HA 4IMCA 1P1XA 4ZMGA 3O8AA 1SPQA 2QCHA 2GOUA 3GYEA 4OWGA 5HMSA 3GAYA 2NV2A 1OABA 3A22A 2ZZ6A 5LNRA 2OX1A 3T4CA 4ZQOA 2I9EA 4HPXA 5FEXA 3W2MA 3W22A 4O1CA 3C0JA 3C3NA 3I7SA 4QJ1A 2ZCGA 1EA0A 3TAOA 5K9XA 4A2SA 4O54A 3W1PA 3N73A 2A0NA 2HS6A 5CPNA 5AHEA 1I2RA 1MEHA 3W7NA 5D09A 4Z0JA 2Y6ZA 4RR4A 1TO3A 3N9RA 2Z1BA 3BW3A 4JX5A 3W73A 1WYIA 1L6YA 1F7BA 1W0MA 2BLEA 1ML1A 1Q6QA 2XN2A 5HNRA 5DBTA 3H54A 4WZHA 1SW7A 5J5RA 3NR0A 3I68A 2FLIA 1X1OA 2J88A 3NZRA 3WK2A 2RDWA 3ZR4A 1P4CA 1M7PA 3BG9A 3FJ6A 3TQKA 4ORIA 5FI8A 1A5CA 1LROA 3W1UA 3LV5A 1EUNA 5AC6A 3EKLA 3QFEA 4NNAA 4RXFA 1DL3A 4LTSA 4K8HA 1N8FA 3LTPA 2QCGA 3S1XA 4MZYA 4HNVA 3STGA 2ZTKA 1YXYA 1L9WA 3VCRA 2E5DA 3PS7A 4IXXA 4UXDA 4LW7A 1FCQA 5HWJA 3QMTA 3U2OA 1Z48A 2CLKA 2VENA 2QCMA 3IIPA 4E0CA 2Q8ZA 3SSJA 1OFQA 3EWXA 3TC7A 3W7IA 4NJGA 1H7WA 1A5SA 1KLZA 5I3IA 3W76A 2WNQA 1YYAA 3DI0A 1OFAA 1OYAA 1ICPA 3DFTA 4QNWA 3HPXA 1XBXA 1YPIA 4WY0B 3PBYA 3HO8A 3KX6A 1XXXA 3C2VA 3MJYA 4K36A 1GPWA 4TX9A 2ZTJA 3ANYA 4JDBA 1WBHA 2NXHA 2VFHA 4NJIA 3NDOA 3RF9A 2JGQA 4N2YA 3QPZA 1Q6OA 1Y0EA 3BK0A 2DP3A 3W7RA 2BWGA 2H3BA 3G1AA 1YADA 1OX4B 3RLVA 4ZQCA 5K9CA 3CM4A 3W2UA 2J9YA 1G4PA 1F6PA 5HR6A 3KVMA 3STEA 5AHMA 4KFPA 3TCEA 1QPNA 2A7PA 5AC7A 3SW6A 4CLMA 3L0NA 4YXGA 1QR7A 3QRHA 5I3JA 4XTDA 1TPEA 4MUZA 1LOLA 2V9DA 3UY8A 1FDZA 3TV8A 3O16A 3PSVA 3U6WA 3UWVA 5DY2A 4MPQA 5AHFA 3E96A 3W7HA 2BZNA 3STFA 2F7FA 4LS0A 4IMEA 3B0UX 3TFCA 4IUOA 1HO1A 1TQXA 1JUEA 3G18A 5D2WA 4ZVJA 1SO5A 2NZLA 4CQ8A 2NX1A 3FKRA 4QIUA 2EF9A 4AVFA 4FB7A 2C14A 4E2DA 3PC0A 3S1UA 5AN7A 1KBJA 1EUAA 3EX2A 4BK9A 1LBMA 2CLIA 2C6QA 3W85A 2XFWA 4MYXA 3LHZA 2WQPA 3PB2A 3A5FA 3NPVA 2C18A 4DO6A 5D30A 3OEXA 4RKAA 3P82A 2E68A 1WOAA 3ZFHA 2A7NA 4YMZA 3E49A 4CCDA 3LI0A 2ZDRA 3DFSA 5D02A 5AYXA 2ZRZA 1OX4A 1F76A 1KA9F 1VLIA 4Y8FA 3TDFA 4YLWA 3M5VA 4LOCA 1GYLA 3OG3A 5F2MA 5MHBA 4GUJA 3LLFA 1U5JA 3NQEA 1FDYA 2H3DA 1DVJA 1JCMP 4IXHA 3ATYA 1GT8A 1QAPA 1VLWA 1W3IA 4O28A 3L65A 2IQTA 1J2WA 1LZOA 1LBFA 1A50A 1WAUA 2WNNA 4HNUA 3NGJA 3EXRA 3W1RA 1YDVA 5F1UA 1TV5A 1TREA 3C2EA 4EOUA 3L5AA 2H8XA 3IVTA 5CG7A 4JTGA 1M7OA 3A21A 4Z0SA 1U83A 1AW5A 3DKLA 3A24A 3GKAA 2CFFA 2V5BA 1KM0A 4IX0A 1MEWA 5FF0A 1K7EA 1OX6A 1ZHAA 1EWDA 4ML9A 1O4UA 3EXSA 3WFAA 3CQ0A 1WOBA 4CQ9A 3PVFA 1KW1A 5IBXC 4YCOA 1UCWA 4FNPA 3KVKA 1TPDA 1A5AA 3TU9A 4BFAA 3KRUA 5E93A 5G4EA 3NPWA 4JNMA 3W74A 4K37A 5LNVA 3W1XA 1W5QA 4D2JA 4AWSA 2V2HA 1CI1A 2ALDA 4TMCA 3LRMA 5L9FA 3TW7A 3G22A 5E1QA 2FDSA 3DKJA 4LUJA 1KLYA 1P5BA 1LM1A 1TYGA 4XBKA 4DF1A 3LDVA 4ZQMA 2A6NA 2GJLA 4BF9A 3QEZA 4JS3A 4U28A 1H1YA 3EWWA 1KFJA 3EX1A 4AAJA 2ZBTA 4KWVA 1G7UA 3HGJA 4BWLC 5K2ZA 2GQ9A 5D37A 4IQLA 3A9IA 5G1YA 1D9EA 4Q4KA 3TROA 3WJYA 3CIWA 3P74A 1I2OA 3N14A 4CNOA 1JCXA 2ZRWA 1TCDA 2Z0IA 2ZA1A 3GR7A 5LGZA 5LZLA 4QISA 3IEBA 4FX8A 5K3VA 3L5MA 4MKNA 3QYQA 3LLDA 2EKCA 1PVNA 5FF4A 2ZQ0A 3HPZA 3IGSA 3TSBA 4OBTA 1CW2A 1NVMA 2VXNA 3GX9A 3N9SA 1LDCA 1HG3A 4MJZA 4O17A 4NX0A 1VH7A 2RKXA 1B4KA 3PSWA 2I1OA 2X1UA 3NVTA 3HOJA 4GBUA 4CNPA 3QSTA 1OFEA 1TPVA 3WJSA 1X8FA 2PCQA 1XUUA 1S5VA 4OU1A 2A7RA 2BSLA 4JTSA 1YTEA 4O0ZA 4DEFA 4A22A 4WXZA 4H3DA 3P84A 2YFOA 3C6CA 3TXZA 3L5LA 4UTKA 1G67A 5BNKA 2QJGA 4M6QA 1OF8A 3LB0A 4ZQRA 4E38A 1JRBA 4A29A 4KWWA 2X1SA 2QUVA 2TMDA 1ZNNA 3S9YA 1FWNA 4IX2A 1B4EA 5EKYA 1JR1A 2ISSA 3NL6A 4UFJA 3MMTA 5U4NA 3DXIA 3NO5A 2V2CA 4GUGA 3UD6A 1FBAA 2R94A 2ATSA 1GYNA 1H62A 2C19A 3BGJA 4XZ9A 5FF7A 5BMWA 3UWZA 4YWIA 5DELA 1IF2A 5BOOA 4TU1A 3BLEA 1JCJA 4CQAA 3MHUA 4GXMA 2QCFA 5F4SA 3MWAA 3BLFA 1KFBA 3VFLA 4O52A 3Q58A 2RHGA 3LCFA 1XL9A 1VRDA 2C3ZA 3EWYA 3HJZA 3VE9A 5KZEA 2NUXA 3W1TA 3PG8A 3NQ7A 1G69A 3W1QA 7TIMA 1GVOA 5D33A 5CGQA 3W86A 2OT1A 4WXYA 1KFKA 4WJEA 3PM6A 3UY7A 1ZCOA 3CWNA 1ZFJA 3MHGA 3LCIA 3PY2A 4M19A 6TIMA 3CHVA 1F5ZA 2Y70A 3NL2A 3ABQA 2DZXA 4RZ5A 4GUFA 3NQMA 3TUUA 2Y88A 5C5YA 4JTKA 5D2VA 2XN0A 4O4VA 1GG0A 3P81A 2GJNA 3EEGA 1RZMA 4O13A 3FIGA 4FIRA 1XKYA 3G1XA 1L6SA 3IRDA 5KINA 3M44A 1NF0A 3HGSA 2O7QA 3INPA 5LNUA 1SO3A 5HR7A 1LRQA 2J9XA 1K3UA 4UTTC 5I3FA 3QJAA 1QOPA 1T0OA 3PUDA 4O1AA 2X2GA 3T44A 4JICA 3PAJA 2ZA3A 1VPXA 3W71A 3W2LA 4NXSA 4JGDA 1YPFA 4R34A 4HIBA 3BPWA 1SZEA 3MI2A 5CZTA 1GWJA 1JQVA 3W9ZA 1DHPA 4FNTA 5T26A 5FEWA 3UWYA 1XI3A 1O5KA 2A85A 3NQGA 4FIQA 1PIIA 1O5XA 5HWMA 3TSMA 3I7QA 4UTWA 3T40A 1KTBA 3GIYA 4M6PA 1QPQA 1SUXA 4TIMA 1VYPX 3NQVA 3NOEA 3BW4A 4U4MA 4DPQA 3FYPA 1I2PA 1ADOA 1XBVA 2QAFA 4AXKA 3QQ1A 3W1NA 3L2IA 3G8RA 1ZAJA 3TSDA 1KFCA 3LOTA 5CZSA 3P5ZA 1SZNA 2V2DA 2WKJA 2VELA 3TMQA 3S6DA 4JTUA 2Y7FA 3BO9A 4UUIA 5AYYA 2EGZA 5KTLA 3O05A 4NJKA 1KTNA 1W31A 1QPRA 2G95A 4EVZA 3S1VA 2PRMA 2QUUA 4HKPA 3R5EA 3W7EA 2ZZ5A 4DF0A 1XBYA 3QSRA 4UFHA 2NV1A 4LVBA 3WJWA 2CLHA 1XUZA 3MI6A 5CPLA 5DXYA 4PC8A 4AEOA 3LM7A 1H1ZA 3HGRA 4DO5A 3O6YX 1OF6A 1G4EA 3KFTA 1R47A 3N2MA 1UBSA 2LLEA 3NPXA 1GQNA 3P5YA 4XQ6A 4FF7A 2WJZA 4UR8A 5F2IA 2ZRYA 5FF3A 2TYSA 5LKYA 3MW7A 1XC4A 3DFPA 4MZ8A 1X6UA 3PG9A 1H7RA 3TNOA 4O1BA 1W8SA 3FLUA 1S5WA 1OK4A 4PODA 3TIMA 1H7OA 3GDMA 3R89A 2BXVA 2QKFA 1I2NA 2J9ZA 1W1ZA 3GLCA 4LVGA 2YCEA 2Y7EA 4IPIA 3LRKA 4POCA 2E6YA 1LTDA 5KITA 3GXTA 4L4MA 4GJ1A 3TXVA 4I7UA 4O57A 3TR2A 4O18A 3M43A 3E0IA 4W9TA 2Z6IA 4A21A 2GUUA 3P60A 2Q3OA 3MYOA 4O19A 3CC1A 4L4LA 4WD0A 1B57A 3IVSA 3QF0A 1E51A 3MO7A 4ZZ9A 3G8EA 3F03K 3UNDA 3P80A 4NZJA 2DZUA 5L6UA 1BTMA 4LS2A 4QQ3A 2J27A 3O63A 3W2JA 3DFQA 5H2ZA 1H5YA 3B8DA 1JUKA 1YLVA 1N55A 3KVJA 4MY9A 2JKEA 4JTHA 1FXQA 3LCXA 1YTKA 4NT0A 1IXNA 3ATZA 3W7PA 2VFFA 3CTLA 3DZ1A 4KKXA 4K6AA 1QNVA 4ADTA 4M7TA 1G7VA 2ZZ2A 1FDJA 4HNTA 3GR8A 4R53A 1HO4A 4TMBA 3ZWSA 4M6VA 1ICQA 4NJJA 4K38A 3OA3A 2B7OA 2C15A 2GPTA 2VFDA 1KM3A 3W7DA 1LBLA 4O16A 3G1YA 1TPUA 2VEMA 3DAQA 3RNDA 2OMAA 1LORA 4OV4A 3KRSA 2GVJA 2QCEA 2V81A 3W7GA 2PE4A 1GVQA 2Y63A 3TH6A 5TIMA 4DF2A 3W72A 1RQHA 4K39A 1ICSA 4QSHA 3UZJA 4CCCA 1D3HA 4OQVA 5I3GA 2R14A 3M16A 2WSQA 2WSRA 3PF3A 1SSGA 4IMDA 3NL3A 3L0GA 3IVUA 4HSOA 4JN6A 3M47A 5CZJA 3TJXA 1OFRA 4JXCA 4MOZA 1RD5A 3BG5A 1LLWA 1EIXA 2CZFA 4C1KA 1TPH1 1OJXA 1QO5A 5A8GA 4QNEA 4NNCA 5D38A 1EP3A 3O6DA 1KV5A 5FEPA 1EX5A 4UTMA 3PUOA 3TK7A 4WY0A 4GE8A 2HMCA 1FCBA 4N02A 3DHDA 3LCGA 3G1FA 4RV8A 4K7VA 3QZEA 3UPBA 4MYAA 1KTCA 1T8XA 3MBDA 3LERA 1N7KA 3PWAA 4JIPA 1DQWA 5KZDA 2AAMA 1AK5A 4DPPA 4UNLA 1YDOA 2A4AA 1P0KA 1TTJA 3IGUA 1LLZA 3M6YA 4WX2A 1W5NA 3DI1A 3TKFA 1SW0A 1WA3A 4TR9A 2NUWA 3CEUA 3GK0A 4Z08A 4O14A 1AW2A 4PL1A 3HG2A 3FS2A 3NYZA 4R33A 3BW2A 4MY8A 1VC4A 3D0CA 3B4UA 1NFBA 5EBUA 3DGRA 4N4QA 3W1AA 5HUOA 3UQNA 3W7LA 3M9YA 2FB3A 2A6LA 3I6RA 3DFNA 4WUIA 1SO6A 3KHJA 3RFAA 1G6CA 1QFEA 4LV9A 3A5VA 4UR7A 5DY3A 1D3GA 2QJIA 3I65A 2B7PA 4PH6A 2GVGA 4GNJA 3FJLA 3OVPA 4NVTA 4AB4A 2CLMA 2WV8A 2QJHA 3TJLA 2E6FA 3B05A 3IIOA 1KM2A 1W37A 4ORMA 2H90A 2Y7DA 4ADSA 3CT7A 4FX7A 1SW3A 1FCUA 3H55A 5FEZA 4FX6M 1LP6A 2ZZ4A 4LUIA 5G1TA 5EMUA 1TRDA 1TPB1 2C13A 2FPYA 4O53A 4ZQPA 5CPMA 3LX9A 5G2HA 3M5XA 4P61A 4UTJA 1LRNA 5AHNA 3SR7A 3SGUA 3UPWA 3C2FA 3N2XA 2TRSA 3ABSA 1VQTA 4XBSA 4N4PA 4NX5A 2VFIA 2V8ZA 1FWSA 1W3NA 4LT9A 3O15A 5IM51 2AQWA 1THFD 3TMLA 3HQ1A 2QCDB 1I45A 1F2JA 1DQXA 4UNKA 3W84A 4NUWA 3GKFA 2D73A 4FEZA 1PCWA 4WOQA 3QW4B 3IIZA 2E6DA 3HPSA 4XKYB 4HN4A 4BI5A 3AO0A 5AHLA 4TO8A 5I3HA 1VHNA 1W5PA 4RCXA 1V7YA 4MLJA 2W79A 2G96A 5GVJA 2X1RA 3QC3A 4N9CA 1ZAHA 1X1ZA 3FKKA 2NXIA 1L6WA 2YYTA 1CX9A 1VCVA 2WPBA 1DBTA 4MIMA 3RU6A 3NQ2A 4N9EA 2J6XA 1ZAIA 4UTUA 4OE7A 1KM6A 3P8JA 1NSJA 3AJXA 2NXGA 2QCCA 3LGEA 3QMSA 1QMLA 2ZRVA 3HGOA 2NX3A 2VOMA 2OZ0A 3SGZA 3O07A 4S2CA 4LY8A 3F4WA 2OT0A 3RMJA 5IBXA 5A5WA 5BRBA 4DXVA 5LNSA 3USBA 1TV7A 4ZQNA 1K8XA 1BWKA 3MI3A 3OVRA 1MSSA 3MBFA 5D2YA 4Q32A 1Z41A 1TRIA 4FXSA 3QMRA 2QCLA 2QCDA 4WOZA 2QF7A 2P0OA 1HUVA 1TSIA 4UMBA 2W6RA 3SI9A 1RV8A 3EXTA 3O1NA 3TC6A 4IGHA 3UXDA 3LHYA 3L0KA 2BX7A 3Q94A 3G1DA 5DBUA 3TX9A 4AF0B 1J4EA 1L2UA 3DBPA 1KM4A 5F2GA 1TJRA 4GRSA 4XKYA 3GZ3A 1WDWA 3W88A 5AOUA 4LNYA 1OHLA 4FNUA 2G5WA 1Q6RA 4LRSA 5HJLA 3NM3A 1GTHA 2DZSA 4LC8A 5EL1A 1EWEA 4HNNA 5KZMA 2PRHA 3E12A 4GC4A 4JDYA 3G0SA 4BWLA 3W75A 4HT3A 3R12A 2V5LA 2VEKA 2Y89A 2FQIA 3C8FA 4MY1A 3EWUA 3LXBA 1UUOA 3W70A 2V30A 3BARA 3WK1A 1DOSA 4UTLA 1LOSA 1PCKA 4JTFA 3LXAA 1TV8A 4GUHA 4DO4A 3HMJG 3LCHA 2WNZA 4OHQA 1R2RA 3W7QA 3W7CA 3BLIA 1SZGA 5HUPA 1DJNA 1W5OA 1S3HA 3MHFA 2NUYA 4PCFA 4DBDA 2CLOA 4X9SA 3ABOA 3QH2A 4LC6A 4EWND 1ZY9A 4M5PA 2E1DA 3L68A 3HF3A 4MVAA 2Q8LA 1Q45A 2UV8G 3W83A 2Q3RA 5DXXA 2YGYA 2DZTA 3FYOA 3F4NA 4AF0A 1FCVA 5HQEA 3EX4A 3PB0A 2PRLA 1M5WA 5G2WA 2GQAA 3UWUA 5FESA 3G3DA 1O94A 1FQ0A 5F4XA 4A3UA 3S1WA 1PS9A 1OFOA 4S2BA 4JX6A 1R2SA 1I8JA 5D2XA 4AHPA 5AC8A 1KBIA 3NQCA 4KFOA 3KVLA 3TAKA 3PBWA 2YFNA 2ZA2A 3B06A 4ADUA 1NEYA 1A5BA 3LXCA 1KV8A 2V0TA 5EA9A 4LS1A 3SJ3A 3N34A 2QCNA 4JTEA 2DORA 2J24A 4GWEA 1WV2A 3GDRA 2EHHA 3T55A 1K03A 4AH7A 3HG5A 1AL7A 4AHOA 4FNSA 3UXAA 3FEMA 3NL5A 3M41A 2O7SA 4R7JA 3M5ZA 4DBEA 1C9DA 1ME8A 2ZZ1A 3ELFA 2CWNA 3VNDA 4G1KA 3U8GA 1Z42A 1UASA 1TTPA 3PBUA 4LVAA 3LHWA 3MP3A 3NQ6A 5LHEA 2PURA 2B7QA 1VCFA 4MFEA 3VKJA 2ZZ3A 3E9AA 1FWWA 1FX6A 3CPRA 4K7YA 4UTHA 4N9BA 3W87A 4H4IA 3GDTA 4I9AA 2X30A 2YXGA 1O95A 4LV4A 4Z1CA 5TQLA 3RK8A 4AWUA 2WOQA 4UTTA 3L67A 3SFKA 3C52A 4O1DA 3NQDA 5CKSA 3GDLA 1OK6A 2YW3A 1K7XA 3W2KA 2VFEA 4FO4A 1VYRA 4Z1BA 3K30A 4NQ1A 1PE1A 2NWRA 4RXGA 2Z2UA 1VHCA 2TPSA 1TQJA 2ISVA 3G3MA 4XUGA 2E6AA 3L9CA 1ZENA 2A2IA 2WSYA 1PL9A 1ZALA 2RH9A 3MYPA 3I7RA 1KM5A 3C61A 2VEPA 1W54A 2V82A 1Z44A 8TIMA 4O0KA 4UMCA 1R30A 1R2TA 1JCNA 1ZJIA 3G0UA 3ZS4A 2ZFAA 2E09A 5DCDA 5HINA 5D2TA 5F2LA 2R8WA 4UTIA 4RZ6A 4XTIA 4DQWA 3QM3A 3T78A 1VS1A 3IGXA 3L21A 2YZRA 1SFJA 3NQFA 4E2BA 5CZ0A 5I3KA 3NNTA 1NF7A 2I14A 4FXRA 3B03A 5D32A 2P10A 1SQ7A 4O4WA 4IPJA 1AL8A 4NJHA 1HL2A 4WY0F 1WX0A 5EY5A 1JUBA 4UFMA 3SZ8A 5F4WA 5J5DA 1ONRA 4UFIA 3C2OA 2KZHA 1I2QA 4NNBA 2ZZ7A 3M5YA 3W6YA 2DZVA 4UMAA 2DU2A 1Q3NA 2HSAA 4OGZA 5LNWA 1ALDA 4JEQA 1S5TA 1OYCA 4JTTA 1IXOA 4H6KA 1YXDA 3NEVA 3CWOX 3GXNA 1AMKA 3V1PA 1DKWA 1H7NA 1F73A 4N6EA 1SZFA 1TB3A 1TPFA 3GB6A 1AG1O 3JR2A 1EEPA 5D05A 3S5ZA 2AGKA 4B5NA 2Z6JA 5E0KA 3UZ5A 1SU5A 3QW3A 4WQ6A 2JBMA 5ABTA 2Y85A 4NZFA 2NWSA 1GVFA 2ABAA 4EF8A 3HB9A 3TE9A 2B7NA 2R91A 4LVFA 4N9DA 1TPC1 4UCGA 1GG1A 4Z1DA 1KM1A 2GVLA 3S0CA 4OT7A 2QR6A 4Y96A 1OFPA 2DZPA 3W2NA 2ATMA 4HSNA 3GDKA 3GVGA 3BV4A 1LOQA 3P67A 5BMXA 3IIVA 5CPOA 1RQBA 1YXCA 4A2RA 1T96A 1WXJA 2H8ZA 4K8EA 2JGYA 1RR2A 2ABBA 1XDMA 1WBJA 3LTYA 1IXPA 1OFDA 3C56A 1IXQA 4C1LA 2OCZA 2RFGA 3UYCA 3NM1A 1ME7A 1H60A 2DZWA 2Y61A 1F74A 2VKZG 1M6JA 3KAOA 4XWUA 3LHUA 2BTMA 2GQ8A 3LHVA 4ZL1A 4RLIA 2RDTA 4O8RA 4MLRA 3TFXA 3V75A 4JD4A 4JTJA 2FJKA 1TTQA 1HTIA 1LCOA 3TW6A 3G0XA 4Y6GA 4JIQA 3EKZA 3G1VA 1T99A 4BI6A 1EPXA 1XFBA 2HTMA 5EYWA 1H50A 2C1HA 3W7OA 3LHTA 5EPDA 1X7FA 3T7VA 5C55A 3R2GA 4UIOA 3IV3A 5C2XA 3WJXA 4JY8A 2X1TA 4UFLA 4JYFA 3EB2A 1WQ5A 2A5HA 5LSMA 4S1FA 1J5TA 5F1VA 3JRKA 1FUYA 3NZ1A 3Q2DA 3RLUA 3W1LA 2QDGA 3S5NA 2C0AA 2YYUA 3B04A 4JY9A 5HULA 2CZEA 5LGXA 1FXPA 1H61A 1QOQA 4X3ZA 1GEQA 3P7YA 1UUMA 3F1QA 2FFCA 2CU0A 2E5CA 2ISWA 3FFSA 3FA5A 1QDSA 3NXFA 1VCGA 2C16A 1GTEA 4O15A 3WJZA 4RK8A 3N19B 3W1MA 1QCWA 2PC4A 2NX9A 1SR9A 5H91A 3S5YA 1K7FA 1VZWA 4LWWA 1H7PA 3LV6A 4O50A 3TA6A 3L66A 2H6RA 5D04C 1H7XA 3SY5A 1BKSA 1JVNA 1SO4A 3LCWA 4UC5A 5C54A 4X22A 5CSRA 4IOTA 5K7JA 2FPVA 2FIQA 3HIJA 3TQ0A 5KMYA 3MP4A 2ZRXA 4EIVA 1IIHA 2CLLA 3BVJA 1PV8A 3SIZA 1EP2A 2QAPA 1BWLA 3PULA 3W07A 3A23A 3TQVA 1YDNA 1B9BA 4IMGA 2E77A 4PFMA 4I7VA 1K8ZA 3DFOA 3C4UA 2CW6A 1I4NA 3IIXA 4ALDA 3M7WA 5SWUA 1OFBA 3OIXA 1TJPA 3STCA 3S42A 3ABRA 3Q37A 2VFGA 3EX6A 4AHQA 5AFDA 3W7KA 3GXPA 3P61A 5K4ZA 1QWGA 3NPUA 5C6MA 3MP5A 1G4SA 1C8VA 2CZDA 1OVDA 4IMFA 2Y62A 1MO0A 4FNRA 1RQEA 3YPIA 2FTPA 1MZHA 1KFEA 1DORA 3R13A 4LRTA 1RPXA 2CLFA 3GNNA 3LRLA 4FNQA 3R8RA 3LCLA 3S5OA 2QDHA 2G97A 2B4GA 3HG4A 2YW4A 3QQ0A 4RZ4A 1JULA 1EP1A 4I7WA 3W7MA 3UWQA 4J9JA 5DCBA 5G5IA 2X16A 2QUTA 4Y9AA 4NXKA 3EWZA 4GFSA 5G4WA 1B3OA 4RJEA 1EB3A 1W3TA 3KXQA 3HG3A 2DJLA 3WK3A 3DH7A 3OVQA 3VE7A 1SSDA 3H53A 1ME9A 3ZWTA 2YR1A 4JTLA 5KSWA 2W0UA 1V5XA 3OBKA 3G1SA 2CZ5A 2EPHA 2WO5A 3MUXA 3CU2A 3PR2A 1GJPA 3G1HA 1C29A 4YL2A 4N6FA 4UTWC 1OG0A 2A21A 2NLIA 3LBMA 3NG3A 4NU7A 4PA8A 4O11A 5K9DA 3GNDA 1TTIA 1DV7A 5K4XA 2VC6A 4X2RA 1QO2A 1A53A 3P62A 4JTIA 2YPIA 2FB2A 1W56A 2EAWA 3O06A 1K02A 3DENA 1XBZA 1GZGA 1GVSA 4MZ1A 4PTNA 1O60A 2JKPA 3LBCA 3NA8A 1TMHA 4JR5A 4FHAA 1IIGA 1XDLA 3SECA 4BI7A 2RDUA 1JJKA 4MFDA 1UJPA 1NAL1 2A1YA 2FPTA 5AYZA 4ICNA 3O6CA 3G24A 1AW1A 2CLEA 3B0PA 2E5BA 3EWBX 4BR1A 3VI2A 2P1FA
chains in the Genus database with same CATH superfamily
3LG3A 1JCYA 3AZRA 2V3FA 3NQ8A 4RDYA 1JRCA 3HBLA 3KBMA 2WKGA 3OZMA 4F0LA 2E28A 1MUWA 4CCEA 5C9ZA 3DHFA 2INZA 3RN6A 2VQUA 4GZJA 3PAOA 1HFBA 4JAWA 1VYSX 4LB4A 3APGA 3KOFA 1MW3A 5U7SA 3TTOA 4FK9A 2XIIA 1B90A 2XN1A 5CSUA 5AHIA 3EOUA 4HOWA 4PEKA 1QPOA 1FY6A 1UP3A 1ADDA 5LHFA 1PKNA 1BHGA 2A3LA 3BGGA 1MYRA 1D8WA 1JQXA 4IWWA 2IQDA 1P0NA 3GG8A 4QFUA 3FOKA 3N3MA 1YEYA 2MANA 4C7FA 4XD3A 3H7VA 3T05A 3THAA 5TBOA 1W9UA 4DXKA 3ALFA 3VGFA 1S5MA 4AWTA 4CQBA 2XVPA 3OHMB 4Z1YA 2BVTA 1JZ5A 1OX5A 3CEPA 1XIMA 4CU8A 4Y90A 1H51A 4JZ5A 1VFLA 1CDGA 1LRTA 2YXXA 2DPEA 4LBUA 1OZMA 4LVDA 1XM3A 2WK2A 4GJIA 1VJIA 3TYUA 3I3DA 2PWFA 4IMCA 2GOUA 3GYEA 5HMSA 2NV2A 3SBFA 3OBAA 3CZGA 3APTA 4ZFCA 5E9AA 3QZAA 4NZ3A 4Q4RA 3I7SA 4GQRA 4O54A 1KGWA 5AHEA 1EGZA 4UQ9A 4PMYA 4UB9A 3W4RA 2XSAA 4XISA 1O1ZA 2Z1BA 4A3RA 3BW3A 2PU1A 4PMOA 1VBRA 2E4TA 4IICA 3W73A 1IEVA 3SUWA 1ML1A 1Q6QA 3MCMA 6REQB 2YCIX 5DBTA 5E0CA 2QQ6A 1SW7A 2G3NA 1X1OA 1ONWA 2J88A 3WK2A 4M0XA 3AJ7A 4C1NA 3BG9A 3FJ6A 4UTFA 3TQKA 4ORIA 4B16A 1EJUC 1XDJA 3H23A 3VNLA 1EUNA 2BOEX 2HEJA 1ZBCA 1JF6A 4HYWA 2BY0A 4MZYA 4FLQA 4YYFA 3ZLFA 1YXYA 4B5VA 1IWPA 1BYAA 2E5DA 2XIMA 4I6VA 2PWHA 4UXDA 4YTQA 2X05A 1Z69A 2BMBA 3JZUA 4HA0A 4E0CA 2ADAA 5IDIA 1WDQA 3AIQA 3PPFA 2J7HA 3WH9A 1JDAA 2OQHA 3DI0A 2PDPA 1OYAA 3CUIA 3ZR6A 1U2YA 5HA7A 4GBDA 2XDFA 1Z3NA 3ZLHA 1NWSA 4CU6A 3HPXA 1CLXA 4W7UA 3PBYA 3TYCA 5I77A 3ZVHA 5BOEA 2WHJA 3C2VA 3MJYA 4K36A 4JDBA 1I6NA 1WBHA 2NXHA 2VFHA 3NDOA 3EA3A 3SADA 1Y0EA 4DUOA 3AXXA 2H3BA 3LK6A 2GJRA 2NVCA 3GNPA 1OX4B 1E6QM 3VIMA 3W2UA 5EMLA 2J9YA 1G4PA 4EAMA 1KXTA 4NI3A 3KVMA 1V8EA 3STEA 3UG4A 5IFTA 3TCEA 2A7PA 3WDJA 3N6JA 5AC7A 3W81A 4KWOA 5I3JA 1KXHA 1XGEA 3VCNA 1IT7A 3DEQA 4CVUA 4ATLA 4IH3A 2PP1A 1FDZA 4HQVA 3PSVA 2UY4A 3T1GA 4LGXA 2F7FA 3PN8A 2GJPA 5C70A 4GYPA 2OEMA 4LAOA 3DESA 2WZIA 4CQ8A 2OU4A 4HTYA 4EPBC 3PC0A 3EX2A 1LBMA 2CLIA 2C6QA 3W85A 4MYXA 4GXWA 3LHZA 3QV9A 1RY0A 4DO6A 3OGRA 5JH2A 3IRSA 3W37A 1WOAA 4ASTA 2ZDRA 3MKCA 3ARYA 5CH9A 3QGKC 3TTSA 1DYSA 2A3EA 4GNVA 3VMNA 5I6SA 4GUJA 2F38A 4Q8OA 2BG5A 4RE4A 1DVJA 2V38A 3GNOA 1VLWA 3NWRA 4NAEA 2IQTA 5AKQA 1J2WA 4IL0A 5E5CA 3U48A 2ZWZA 2WNNA 1OZQA 4PRTA 2OYKA 3AISA 2VYOA 5T9BG 1M7OA 3A21A 1U83A 1UWQA 1AW5A 3DKLA 3B8IA 2IQ0A 2J62A 2J6VA 3GKAA 2VZUA 1RALA 1C8XA 4DJDC 3CQ0A 4I8DA 1WOBA 2CXGA 4F8XA 4CQ9A 2C79A 1KQZA 4HJFA 2ZVRA 4KQNA 1A5AA 3JU2A 4BFAA 5E93A 5A6BD 2BODX 3W74A 4GNKB 5C7HA 2ZUNA 1V3IA 4TMCA 3USZA 2V6AA 3G22A 3BDKA 1OQFA 4LUJA 1SFSA 3CYVA 1XH2A 5HOSA 1W9BM 4XBKA 2PDQA 3EB4A 4BF9A 3QEZA 5HMDA 1X1NA 3H8AA 5CPQA 3AYVA 1H1YA 1KRMA 3UCCA 3EX1A 3UPMA 2ZBTA 3SCQA 4F0MA 1OC6A 2GQ9A 4DWSD 2EG7A 1PYFA 2BP1A 1CZ1A 3P74A 4B2DD 1GOMA 3VU2A 4ZR8A 4S3KA 1VBJA 5B7YA 3GTIA 1TCDA 2Z0IA 3GD6A 1XS2A 1VBUA 4QISA 2IPGA 5BXTA 3QYQA 3LLDA 3QLDA 3H26A 2ZQ0A 3ITXA 4ZXLA 3FGCB 3N9SA 4MJZA 4QJ5B 2GWGA 4NX0A 3T4WA 1CXIA 5BXSA 3U0HA 2I1OA 3NVTA 3WDIA 2VZVA 3RIKA 1X8FA 3VIHA 5M1TA 1S5VA 2GDUA 1SVDA 3N25A 4JTSA 4S39A 4WXZA 3TTYA 5EB8A 1D3CA 1J0YA 2GGJA 3C6CA 3NDYA 1ZUAX 1H1NA 1DHKA 1G67A 3LYEA 4KBXA 3VX0A 2R6OA 3R0DA 2QUVA 1FWNA 4NZ5A 1HJSA 4UFJA 1UUQA 4GHRA 1B3VA 4JFWA 3H7UA 3RRXA 1JCTA 1GYNA 3BGJA 5BMWA 4MNKA 3UWZA 3WLQA 3D47A 3WQ4A 3UVAA 4W85A 3A4XA 4O52A 1G9HA 2A3HA 3LCFA 3EWYA 2C3ZA 3VE9A 3HJZA 5KZEA 4G8TA 4ZO9A 4A8RA 4GVIA 3FDGA 4IPLA 3PM6A 1BSLA 1ZCOA 3LCIA 4FOUA 3VC5A 3S2CA 5JXQA 2OKOA 1BTCA 5DRCA 1MRQA 2WMGA 1IZCA 3TUUA 2Y88A 5D2VA 3URNA 4Y7EA 4BKNA 3CV2A 4JHOA 3WBYA 4WJ8A 1EFZA 1U30A 3G1XA 1A0EA 1L6SA 3BOFA 5LIYX 2NLYA 2VRKA 5A6MA 4MMWA 4GGHA 3W0KA 5LNUA 4CU7A 5HR7A 3KBJA 2J7GA 1IE7C 1CXKA 1T0OA 3T44A 4YTRA 4NYUA 3B40A 1KCXA 1SZEA 5CZTA 1JQVA 1EBHA 4CD6A 4JNYA 4F3HA 3I7QA 1V02A 4Y9MA 4IGSA 1XIFA 2WJFA 2CYGA 4GQ0A 3SAZA 2G4JA 4YPJA 1VYPX 3NQVA 4XZHA 4U4MA 4DPQA 1WO2A 4PE8A 4YWSA 3LQGA 3AICA 3OA5A 1LQAA 1KFCA 2PWEA 3S6DA 4H01A 5AYYA 1REQB 2QUUA 1HN1A 1ZJBA 2ZZ5A 5CCZA 1DP0A 4LVBA 4PC8A 4XZIA 1DJZA 2CWXA 1OF6A 1GQNA 4C6LA 3CHFA 3SO7A 3HJEA 4UR8A 2PDKA 5F2IA 2ZXBA 3IUDA 3NSNA 1QI4A 3KP0A 4S3JA 1C93A 1DJWA 4AIEA 1T6MA 2DSZA 1X6UA 2WQDA 1H7RA 2NQZA 4R3UA 1R85A 1R3RA 1A4LA 3AIWA 4PODA 3TIMA 1H7OA 2BXVA 1I2NA 1TMLA 1I1XA 1QATA 3PJUA 4QDPA 1DIDA 4IPIA 3LRKA 4POCA 2E6YA 3WENA 3IK2A 1LTDA 3MY9A 4XKMA 5KITA 3ME3A 4H8UA 4GJ1A 4O57A 4M24A 4QG8A 5M03A 4LYKA 4W88A 2A3CA 4L1GA 3P60A 2VTFA 2Q3OA 4L4LA 3F5JA 1B57A 1XR2A 4ZZ9A 3ARUA 3G8EA 3WLMA 1EKOA 2G50A 1CGWA 3ZT7A 3PFMA 4LS2A 1GEHA 3DFQA 3RG6A 1V3HA 3B8DA 3ZJ7A 2XGIA 3LUTA 1US3A 2PU0A 1N55A 1BRLA 4CCZA 3ATZA 5JU6A 1Z89A 4L80A 4MB1A 4GKLA 4PUDA 3WQCA 2Y4SA 4ADTA 1G7VA 2VRJA 4HNTA 3GR8A 4R53A 2QPUA 3WFLA 4W8LA 3ZWSA 5BWAA 3PTMA 3ZOAA 2JF7A 2B7OA 2VFDA 1OM0A 1E1CB 4O16A 2WJEA 4AG0A 4OV4A 2GGEA 3CAKA 3KRSA 5A95A 2QCEA 1U1UA 1GVQA 3OG2A 1MI3A 3TYAA 1RQHA 4QSHA 3BZJA 1G94A 4K3ZA 2PDLA 4OQVA 5I3GA 2R14A 4LEFA 2WSQA 3B8VA 3BV7A 1CGUA 3E0FA 1IQ8A 4IMDA 1UR1A 4RW5A 5CZJA 2QMJA 3RJYA 4JXCA 3T42A 1LLWA 4D6GA 4C1KA 4FMVA 1TPH1 4CNUA 1OJXA 1QO5A 5EMKA 1M3UA 4C6IA 3R58A 1WNOA 3O6DA 1HQTA 1MQQA 2RGLA 2J4GA 1ZU8A 1EX5A 4GMEA 1FCBA 5ABFB 3FW6A 3MQTA 1U1JA 3LCGA 2V5KA 3NDZA 4JFSA 3G1FA 1TE6A 4RV8A 3PPHA 4RDZA 4LCQA 4MYAA 1KTCA 3WF2A 3RO8A 1DQWA 3IJLA 1YDOA 1UOKA 3VUPA 3IGUA 1JAKA 4PUWA 1XSJA 1PKLA 4G7EB 3AMLA 3ISIX 1SW0A 4O14A 3TJ4A 3FS2A 3DBNA 3GBEA 1N8WA 4R33A 3BW2A 1VFOA 3B4UA 3PZQA 5EBUA 4CD7A 5EMMA 4LB3A 3VIFA 2J79A 4ZEPA 5H1WA 2A6LA 4HZ7A 2Y8KA 3ITOA 2DZBA 2IPJA 3NQBA 1QFEA 2EPLX 3A5VA 4UR7A 1D3GA 2QJIA 4KEMA 2ZUVA 1R86A 4ZOBA 4AB4A 1VJSA 3B05A 1EHAA 1YE6A 4CQDA 3ORWA 2CKSA 3PZVA 3R8GA 2WBGA 1SW3A 5CXPA 4JFTA 5FEZA 1EZWA 1B5TA 4WDTA 4LUIA 4G1NA 4GO8A 2GSHA 3CLWA 4OUEA 1C3FA 5CPMA 4YN5A 3RCYA 4MF4A 3M5XA 3GU9A 4C6EA 1A5MC 4NRSA 3SGUA 4YTTA 4Z2HA 3GZAA 4U2YA 3LU2A 4Q7NA 1BQGA 2HVNA 1V79A 2VFIA 1FWSA 1XG3A 2QYGA 4K1WA 1W3NA 4GVGA 5J8LA 5IM51 1GNXA 3VIJA 1THFD 2YL8A 3WYZA 3TMLA 1MUCA 2GOKA 1I45A 4UQAA 5BXRA 3M0JA 3VPLA 2FZMA 2E7FA 4QJ4B 4NUWA 4LEQA 5I78A 4HZ6A 3MKKA 4LXFA 4JHZA 3SGGA 3VM7A 3IIZA 3HPSA 2QJNA 3FVMA 4XKYB 1JL8A 4XAGA 4TO8A 5I3HA 4FR6A 1ZRQA 1OG6A 2EPNA 2XVLA 2ACUA 3QGVA 4B5SA 4DWDA 4LYPA 1XRVA 1QNSA 1ZJAA 2G41A 4PMDA 1BVNP 2GJXA 3AIBA 3QC3A 4DYKA 1L6WA 1DBTA 3RU6A 3NQ2A 4N9EA 2W63A 2YCLB 3BE7A 4OOZA 3ONBA 3DN5A 3AJXA 3CASA 2QCCA 3QMSA 3QLLA 3U7BA 2F8QA 1W1PA 2NX3A 2PGWA 1AQ0A 2PCEA 4LCSA 2POTA 4DJDA 4BHYA 3O07A 4S2CA 3CT2A 5CAKA 1XCWA 4ZBCA 1UJQA 2F6KA 4Z2KA 5BRBA 2P76A 5MKGB 1BWKA 3WH6A 3MI3A 3PWGA 1PO9A 2E3ZA 1GQJA 3VIGA 1ISVA 4IUGA 4HNCA 5D2YA 4Q32A 2VGGA 4FXSA 3KBWA 3QMRA 4WOZA 5CEWA 3EXTA 2VGFA 3O1NA 3UXDA 3L0KA 3Q94A 3EDKA 1DQUA 4U33A 3TX9A 3A47A 5C9WA 3BSHA 1J4EA 1L2UA 1KM4A 2ZC8A 3TJIA 4HMNA 1WDWA 2DVXA 4US5A 1DJXA 4LRSA 3WLSA 4DBWA 2Y5SA 3IJDA 1GK8A 3W00A 1GTHA 1UWTA 4F0RA 1VFUA 2VR2A 3KLLA 3E12A 3FGCA 3KOYA 3E38A 7XIMA 2ISFA 4V15A 4PBFA 1ZS2A 2VEKA 3NUKA 3GC5A 3CQJA 4MY1A 3NO3A 2QZRA 1UUOA 1NH6A 2OYMA 1WZMA 4XO7A 1DOSA 3GVVA 4Q4SA 1XLFA 3LXAA 4ZO6A 4YVPA 3WQEA 1ELSA 4TQTA 4DO4A 1HNYA 1XIGA 4IQEA 4OHQA 4Z2GA 1TUFA 1R2RA 1SZGA 3UT0A 1DJNA 3WUGA 1S3HA 3MHFA 3AHYA 4HOXA 3QH2A 1UH2A 2VGIA 1ZY9A 4EWND 1UD8A 2OOGA 2UV8G 3W83A 5DXXA 2YGYA 3FYOA 3WQWA 2XYLA 3W24A 2GVYA 2W67A 3UBPC 5G2WA 2GDVA 1XLHA 3VGBA 3GC2A 4FOJA 4AVNA 5AC8A 1Q5MA 1TA3B 4GY0A 2HNHA 3B06A 4ADUA 1EO7A 2J47A 1ZZMA 1XSIA 1HKMA 3ZQ9A 5HMEA 5KZ6A 4LS1A 4F2BA 1VFFA 4KESA 2VCBA 1EHNA 2CKRA 3ITLA 3UXAA 3I4EA 3K8LA 4DBEA 1A47A 1BQCA 4G1KA 3FX4A 3U8GA 1Z42A 1UP2A 3SY1A 3OZPA 4PTDA 4LVAA 3IJIA 5LHEA 3PHAA 4AFYA 3T08A 2PURA 4PRRA 4FLRA 4MNJA 1VCFA 4MFEA 5CJ5A 2ZZ3A 4YIWA 2HBVA 1H0IA 4UTHA 2Y5EA 1QOXA 2AMGA 1WPCA 1W3HA 4H4IA 4AD1A 3KOWA 2VC9A 3QV7A 1GOWA 1VEPA 1E0VA 1O95A 3ARPA 3KDOA 3S46A 6XIAA 1XIIA 3BSMA 1M03A 3RK8A 4AWUA 2HPIA 1XF0A 3SFKA 1M53A 3FHAA 4IFRA 3K30A 4NQ1A 3WNOA 4S38A 4EXBA 1S3TC 2NWRA 1VHCA 2TPSA 1SGJA 4DLMA 2QPXA 5FKYA 3VMOA 3AOFA 2AOSA 4C6OA 3T2QA 1UWAA 1KM5A 2WHLA 4P7LA 2VEPA 2WMHA 5AVHA 5CBIA 3II1A 1JYXA 4KF1A 3AYSA 2H9AB 7A3HA 1R30A 3THDA 1Q7QA 2WMJA 1JCNA 1ZJIA 1W9DM 3G0UA 1OINA 4JNZA 2E09A 2DUZA 2V5DA 4IG2B 5F2LA 1GHSA 3QM3A 4YVVA 3IGXA 2YZRA 4WK9A 3NQFA 3GS6A 5I3KA 3NNTA 1NF7A 4QLKA 2I14A 2ZC1A 4FXRA 2PP0A 3CUHA 4GINA 2G3IA 2PDYA 1DWJM 3T6CA 5CC5A 5EBAA 4PYSA 4D6JA 3KBNA 1WX0A 4NZ1A 1UD5A 1E72M 3BWWA 3MZNA 3BGAA 3EMQA 3C2OA 9XIAA 3H2NA 4J2MA 3H4GA 4ZB2A 1E5JA 4FA3A 1QW9A 3M5YA 2DZVA 4UMAA 3WQFA 1GOIA 1EF2A 2XM1A 3S1GA 3SQSA 4JTTA 4PCPA 4LSBA 1IXOA 1AD4A 3GTHA 3TOYA 3SCSA 1V03A 3TZFA 3V1PA 4IJRA 4UQDA 1FP9A 1GUVA 1SZFA 1TPFA 5HXMA 1WXYA 1EEPA 5D05A 4HA4A 2QT3A 1OC7A 4B5NA 3QW3A 3GYCA 5ABTA 4TV6A 4NZFA 1GVFA 1J79A 2BGQA 2R1LA 3SUSA 2B7NA 1CXHA 1GG1A 4OT7A 4HD5A 1D7KA 2ATMA 1F3WA 1OSEA 3W02A 4CEUC 1TZ9A 4HSNA 3L2LA 3NVDA 2WVVB 1LOQA 3M0KA 4HNOA 5CAHA 4ERIA 1CGTA 2VD8A 4UOQA 4A2RA 2Y2WA 5E70A 4K8EA 4W84A 1XDMA 3LTYA 3ZJ6A 3SRDA 3JVAA 4DWSC 1P1MA 1SFTA 4P8VA 1TWZA 1M6JA 3T9PA 1G5AA 4ZL1A 2PTXA 2RDTA 2ISDA 3QY8A 4AIOA 3TFXA 1T7LA 3V75A 4JTJA 2Q01A 3PTDA 2FJKA 2ACSA 5D8ZA 3GVRA 3TQPA 1XYCA 1T99A 2VMFA 4BI6A 1XFBA 5EYWA 4EXAA 3LHTA 2DIJA 5EPDA 1X7FA 3BAKA 4FP1A 5C55A 4GD0A 3HQNA 3LBOA 3R2GA 3N1AA 1E1FA 4PGLA 4K68A 1XIBA 2YA0A 2Z7KA 3D3FA 1MUMA 3Q45A 3CV7A 1WQ5A 2XM2A 5I0DA 1RP8A 5LSMA 4NSBA 4Q4OA 3A64A 3TN4A 4TVUA 3AIVA 1F3TA 3N6HA 5LGXA 1H61A 1E4IA 4X3ZA 3I6TA 4KRUA 4AXNA 1RA5A 5C7VA 1HKKA 4IGMA 4B5TA 3FFSA 1QBBA 1VCGA 2F61A 2EXOA 1F3XA 3VGHA 4O15A 2NSXA 3WJZA 4RK8A 4LUTA 3W1MA 4H9VA 4PN2A 3CK5A 1VZWA 4LWWA 4B4FA 4GLEA 3LV6A 4O50A 4KS0A 2B31A 3WNPA 4ERGA 2X0YA 4YS1A 4FAMA 4UC5A 5HJYA 2D2OA 3UU0A 3C3UA 5ABHA 3TQ0A 3AYRA 3OBEA 2YA1A 1IIHA 3O7UA 1P0BA 1PV8A 4PTVA 3E6EA 4V1XA 3SIZA 3VOJA 1SMDA 5I09A 3FCPA 3W07A 1ZTVA 4LALA 1YDNA 3V35A 1CLVA 3NCOA 4IIHA 1E0WA 1I4NA 2QJJA 3OIXA 2J7CA 4HP5A 4P8WA 4BZYA 3MPGA 1P0EA 2VFGA 3Q37A 4D6IA 1E70M 3AALA 3CHDA 3UCQA 1K4GA 4V2XA 1KKOA 3S47A 1EJWC 5CJMA 5FD0A 4H7VA 4LAMA 1G4SA 2PDWA 2CZDA 4Z2JA 4IMFA 3TYEA 4FNRA 2FTPA 4X63A 3R13A 4D6HA 3LM3A 2G97A 4GVFA 2OSYA 1DJHA 2YW4A 1VIZA 4Q7IA 3UJRA 1EP1A 3UWQA 2D0HA 4J9JA 5C9UA 3PJTA 5G5IA 4J2PA 2QUTA 4NXKA 3EWZA 1HW6A 4RJEA 1W3TA 3WMLA 1E15A 3BMXA 1UHVA 1K9DA 2IPWA 2G37A 3WK3A 1EC8A 2E9MA 1XRSA 3VE7A 3SURA 2AL2A 1TWSA 2VZOA 4YTSA 2G3MA 1ZSXA 3J7HA 1V5XA 3B8UA 3MUXA 3A3XA 2ZXQA 1XLJA 1GJPA 3TN6A 1C29A 4GJJA 4C65A 2OWXA 2FZ8A 2WW5A 2A21A 2NLIA 1KRCC 3UR5A 1EGVA 4Q7BA 3VKBA 5K9DA 3DOPA 1OCJA 4GK8A 3E5BA 4FR1A 3QZ6A 4F0SA 1E6ZA 3CMGA 3ZT5A 3VAVA 3AHTA 3O06A 1XBZA 1GZGA 3UGRA 2JKPA 3PZUA 1TMHA 5FSEC 3TC3A 3I10A 4JR5A 2WLZA 1CGXA 4JTQA 3WDRA 1IIGA 4J3SA 4BI7A 3ARTA 2RDUA 2WWCA 4MFDA 1DXEA 1EOMA 1UJPA 4I5UA 2VZSA 5AYZA 3EOLA 1AW1A 3EWBX 2D2JA 2CLPA 3N3TA 2HQAA 1PHWA 2PDHA 1LYXA 4JX4A 1M68A 4LAKA 1US2A 2VEIA 1SFLA 1R46A 2B0MA 3AWOA 1VR6A 3GVQA 5I02A 3OIHA 3P8IA 3DC8A 3KRZA 4P2VA 4HZ8A 1EJRC 2VJXA 4QM1A 1W3LA 4Q33A 3M0ZA 4DELA 1S39A 3E2RA 3WLHA 1UR4A 2JKAA 4KCUA 3CB8A 3B9NA 3SY8A 2E0PA 2VVSA 4QTGA 3PUEA 1NWTA 1ZBVA 2EKGA 3NO1A 1Q6LA 1F6KA 2TSYA 4IF2A 4ONVA 4LF1A 1MXSA 1OYBA 4O10A 2JEQA 4QAIA 2XVNA 1E40A 3QPYA 1GZ1A 4HHPA 4QE4A 3ZT6A 1IYXA 1XJBA 2OTDA 2ON3A 2YLLA 4Y2WA 4YCPA 4KEVA 5BRPA 3B0VC 2HS8A 5AC5A 3LTSA 3WBAA 2QEZA 1FWAC 3MUZ1 3PBVA 2XVGA 5ABEA 4WSHA 4XO6A 5DLCA 2ZRUA 3E02A 4QITA 6ALDA 2YDAA 5FF2A 4L65A 2AQVA 3RM4A 3EX3A 3L2MA 3MVIA 4IJBA 1E5NA 3LD5A 3FXYA 2YX0A 3NYDA 4XVEA 4DXXA 1SPQA 4OWGA 4C6FA 3L4UA 4W7WA 2ZZ6A 4P8XA 5LNRA 4B90A 3WQOA 2GGGA 4O1CA 3C3NA 4QJ1A 2ZCGA 3TAOA 5K9XA 1Y5XA 2O56A 2XIJA 1XSKA 3FAXA 3W7NA 5D09A 5A8OA 4RR4A 3N9RA 5CGTA 2D20A 4QLJA 4XV0A 3LEPA 3VKCA 3B4YA 1WYIA 2P0IA 3WLTA 2AGTA 1AQFA 1A0DA 3IJQA 3NR0A 4HCLA 2E1WA 3PPCA 4AWEA 4ZOAA 4H41A 1P4CA 2FDMA 5HK4A 5FI8A 2CITA 4ZOEA 3PBGA 3EKLA 4M8UA 4ACZA 2D22A 4RXFA 3KP1A 4HZMA 4JTRA 4F79A 4K8HA 4YTUA 4AEEA 2ANUA 4QE1A 4GY1A 4CD8A 1XLKA 4X9YA 3VCRA 5B7ZA 2PDJA 3LMYA 3K4WA 4IXXA 4LW7A 4ROPA 3LMZA 3QMTA 4H6RA 3U2OA 2FZ9A 1H41A 2Q8ZA 3EMCA 3EWXA 1JZ8A 2QGHA 2X1IA 1XX1A 3M0YA 1QASA 1H7WA 1E9IA 2WNQA 2R24A 1OFAA 4DAFA 3RMEA 1Q8JA 3DFTA 1N8IA 1UR3M 1YPIA 2ZUMA 1Q6DA 4WY0B 3H7RA 3HO8A 3KX6A 1XXXA 5G4HC 4UBPC 1GPWA 4TX9A 2C1IA 2J66A 4NJIA 1O12A 3GNRA 3PZTA 2JGQA 1XFCA 4N2YA 1Q6OA 4MWAE 3HTWA 1GORA 2BWGA 2I57A 3PZGA 5D9NA 3RLVA 1YBQB 1U22A 4ZQCA 3CM4A 1W1A1 3CZJA 1XD1A 1F6PA 2RJGA 2PDUA 4KFPA 2VHLA 1ITUA 3SW6A 1DWGM 4CLMA 1E9YB 4O1EA 4XTDA 5A2BA 1W2VA 1TPEA 1LOLA 2O0TA 1I9CB 1VF8A 4JL2A 4HU3A 1XYAA 1XQKA 3UWVA 3O16A 1PYMA 2BZNA 4R7WA 3STFA 4LS0A 4IMEA 1UA7A 4IUOA 1HO1A 4OBSA 1JUEA 2P53A 4JIRA 8XIAA 4Z2LA 5D2WA 4ZVJA 2ZUUA 4H2CA 1XIDA 1R38A 2NX1A 2OG9A 4QIUA 3QV8A 2PPGA 4H7ZA 5IHRA 5A6SA 1LT7A 5I00A 4AVOA 2OEJA 2XFWA 2C8NA 3A5FA 2C18A 1X39A 3HZ3A 1WCGA 2E68A 2PWVA 2OSXA 1RP9A 3SUUA 4YMZA 3E49A 1LL7A 4E4UA 1N2VA 1V6XA 3LI0A 5AYXA 4KCVA 3CL7A 1VLIA 3VXGA 4Y8FA 4YLWA 3M5VA 4LOCA 4HMEA 3DG7A 5F2MA 2NQJA 3EWCA 4DUVA 4MKSA 3NURA 1KCKA 2YBVA 1JCMP 1QAPA 1MQPA 3KBVA 2X2YA 3DHUA 1TFVA 1AZ1A 3W1RA 1YDVA 3HV8A 1TV5A 1TREA 4QHRA 3K1GA 4Q8TA 3L5AA 1FWBC 4GI6A 4GYJA 4C6BA 1Q6CA 5CG7A 3URAA 4AD0A 4P7QA 3GUGA 3QTGA 5A6BA 4UR9A 1KM0A 4B4HA 1CECA 3B3DA 3AXHA 3S2MA 3WFAA 3JW7A 3R0KA 4A3HA 4DN1A 1UCWA 2DT0A 3MKVA 1W1TA 3V7PA 3KVKA 3PZMA 1TPDA 4AZHA 4QCEA 2I5IA 2PA6A 3T8LA 3KRUA 4HOZA 1NDWA 5G4EA 3NPWA 2DY3A 2FFIA 5LNVA 4AWSA 3SUTA 4W8BA 1KXQA 3TZNA 3KOXA 3LRMA 4DWSA 2JIEA 3TW7A 2IKJA 4B2DA 1QW8A 3QHMA 2FDSA 1KLYA 2A6NA 1FFRA 1LWIA 1SJBA 1S1PA 3W6MA 1T40A 3ARWA 1G7UA 1X7IA 4BWLC 5K2ZA 3A9IA 4IT1A 2QF8A 4Q4KA 3WJYA 1BGGA 5CQ1A 5FJTA 3LPOA 3N14A 4CNOA 2WCGA 2Q6ZA 3OOQA 2ZA1A 1I1WA 4Q6XA 5LGZA 3W01A 3WLKX 4AZBA 1LUCA 3UR8A 3TSBA 3HPZA 1RBLA 5FACA 1NVMA 3GX9A 1HG3A 3GXFA 1VH7A 3PSWA 5LA1A 4DJED 3PPGA 4GBUA 4J27A 1C92A 1OGSA 2PCQA 4CN6A 1XUUA 2IPFA 4DEFA 2CHOA 3P84A 4ZSTA 3WEOA 1R9XA 1GVEA 4UTKA 5BNKA 2QJGA 3LB0A 3P93A 4C6NA 4E38A 3GWQA 1JRBA 3EYPA 4A29A 3VNKA 1J0JA 4QEEA 3S9YA 5EKYA 2ISSA 3NL6A 2R1PA 3MMTA 1LT8A 5U4NA 3L4TA 3LGGA 1FBAA 2ATSA 4XZ9A 1RBAA 1XIHA 8CGTA 3F5LA 1JCJA 3MHUA 4S3DA 4GXMA 4NZ4A 2QCFA 5F4SA 3HPAA 1EC7A 1HF6A 4F40A 4DZIA 3Q58A 1VRDA 4RPPA 3VNYA 2NUXA 5I3DA 2WLYA 3CS2A 3N15A 3K2GA 5CSYA 3K1DA 5DFAA 4AYGA 3IJ9A 5CGQA 2JF6A 4XX6A 4WXYA 4RNHA 3N29A 3UY7A 3PY2A 3TVAA 4M19A 1KQYA 3CHVA 4G9PA 1F5ZA 4PMUA 3NL2A 1X96A 4KIRA 4GUFA 5C5YA 4O4VA 5LYRA 2GJNA 4FXJA 1WUFA 5KEZA 1J0HA 1S38A 3IRDA 3B0YA 2VC5A 2Z1VA 3NZGA 3INPA 1RSCA 1K3UA 4UTTC 4BQ5A 3H2EA 1QOPA 3PUDA 4JICA 3CXOA 1KCLA 4HIBA 1GWJA 4FNTA 2Z29A 5JIPA 5T26A 5E6ZA 3MMWA 3EKGA 2SFPA 3UWYA 1GONA 4S3CA 2A85A 2XH0A 4FIQA 4IGNA 3DC0A 3TSMA 4NHVA 3AWNA 1KTBA 3LPFA 5BOFA 2YIHA 5HPOA 4QRNA 4TIMA 4HGXA 4U10A 3IS4A 5DT7A 3V5FA 1CBGA 3BW4A 3FYPA 4JPGA 1ADOA 1E43A 1KR1A 4WSKA 3H6OA 3QQ1A 2FYMA 3TP4A 4UOZA 3G8RA 4QDMA 3TSDA 4CD4A 2ZE3A 1SZNA 2V2DA 2VELA 3F2DA 4KERA 3BO9A 4UUIA 5FSDC 3O05A 4ACYA 3SCWA 1XIJA 1IEWA 4WGHA 4HKPA 3R5EA 5A8MA 3VDHA 2PAJA 1XBYA 4RE3A 4DHGA 1XUZA 4ZB5A 2WC3A 3U5YA 2GK1B 3H22A 4AEOA 2OYLA 3LM7A 4DO5A 2WBKA 3PUGA 2Q71A 1G4EA 3KFTA 1R47A 1FH7A 2PB1A 2LLEA 3VNIA 4MDOA 4XQ6A 2WJZA 3EPNA 2FZNA 2ZRYA 5FF3A 5LKYA 2CPUA 3OB8A 1AUSL 3DFPA 4MZ8A 2PLKA 1KKRA 5FL0A 3CO4A 1MXDA 1S5WA 1PX8A 3RPTA 3R89A 1E6XM 3F5KA 3ARSA 4B5WA 1H49A 1XPYA 2J9ZA 2G4FA 3VUSA 2Y7EA 4IPNB 5BYWA 3GXTA 2I16A 4I7UA 4GCAA 8A3HA 5D9MA 4S3AA 2GUUA 3BLDA 3CC1A 4WDUA 1O7AA 3I3EA 4GYPC 1RCXB 2WHKA 1E51A 3MO7A 4R27A 3UNDA 3MSYA 2QMKA 2Y8VA 1Q6GA 1JUKA 1YLVA 1K6AA 1JPDX 2V3EA 1FXQA 4XAYA 3TYDA 3EDDA 1IXNA 2PTZA 2HK0A 4L6DA 3W7PA 2VFFA 7TAAA 3ONCA 4D71A 3EBVA 2Z1SA 5I23A 1P6WA 1P7TB 5TF0A 4MSSA 4TMBA 2OPJA 3OA3A 3BC9A 2NVDA 2C15A 2GPTA 2QV4A 3DECA 1RCQA 1TPUA 2VEMA 2QHAA 3DAQA 3RNDA 3UCDA 1TKKA 2R1MA 3CUJA 2OMAA 1OCQA 2GVJA 5CJNA 3R8HA 3P2VA 2PE4A 3E1F1 2Y63A 3TH6A 4LAZA 3LSCA 4B91A 2E67A 3COTA 2HRWA 4S3GA 3UZJA 2A3BA 1D3HA 1KD0A 3H2CA 2XFYA 1Z32X 1AZ2A 3T8QA 3NL3A 3VKKA 3IVUA 6PTDA 4YYCA 3BLPX 4JN6A 4TV5A 1R87A 4WLCA 2BS9A 4MOZA 5ABGA 1XICA 3BG5A 4A35A 1EIXA 2QVNA 1MWOA 5A8GA 3BICA 4NNCA 5D38A 2HXUA 5FEPA 4UTMA 2PF8A 3PUOA 3TK7A 4WY0A 3VZYA 2OZ3A 4GE8A 3DHDA 1WKDA 4NP7A 3WDQA 1ZP4A 1J11A 1UR9A 2EPKX 4HPHA 4K7VA 3G6LA 2QXWA 3B97A 1IWAA 3UPBA 3N6QA 1L8NA 1E4MM 3NSMA 3PWAA 5KZDA 5JBDA 2F2KA 1AK5A 2WB5A 3NIYA 1J2BA 4UNLA 2A4AA 2XWEA 3P14A 3ZSTA 3M6YA 1W5NA 3DI1A 1VENA 3TKFA 5FIPA 1W3KA 1WA3A 2AL1A 4DM1A 2DVTA 4PEEA 4Z08A 4OUIA 2ZDSA 3NYZA 3EA2A 4LUSB 1VC4A 1PUDA 4C6CA 1IHIA 4E3TA 4N4QA 4KRTA 5HUOA 3M9YA 1BFNA 4V33A 5C0QA 1YDYA 3KHJA 3RFAA 2YL5A 5I79A 2DH2A 4LV9A 1QNRA 4FALA 3UJ2A 4PH6A 1K9FA 3MSRA 3FJLA 4NVTA 1XHGA 1F8IA 3BCFA 2QJHA 1EQCA 1KM2A 2WJDA 4ORMA 4ADSA 1PKYA 3T2PA 4K2SA 7REQB 3PFRA 1P6CA 1B31A 1W9VA 3ALGA 4QP0A 1UP0A 1RUSA 4O53A 3Q4DA 4P61A 4UTJA 5AHNA 4IIDA 4BCEA 3SCVA 3FDKA 4Q8PA 4HYVA 4XBSA 2CETA 5AC4A 4N4PA 4TUFA 3AXKA 3VTRA 5HNUA 4LT9A 2D23A 2PC8A 5FL1A 4IFKB 4KEUA 2QCDB 3KRBA 1U1HA 2VURA 5IFPA 3CIVA 2WZTA 3IJ7A 4FEZA 1E55A 4WHBA 3QW4B 3S2LA 3I3BA 3STPA 1GJUA 4HN4A 3AO0A 3DYOA 3PWIA 1BF6A 2DUXA 3MO4A 2Z24A 5LA2A 3NJ3A 3VNZA 1YW1A 4OFCA 4U3CA 2CZVA 3FKKA 1CX9A 2WPBA 4U2ZA 1ZAIA 3RRAA 2VQTA 2FKPA 2VOTA 1A5OC 1ITCA 2NXGA 4WKAA 3GHUA 2VOMA 2OZ0A 3N2OA 1S2AA 4RDWA 1QNQA 4Y9NA 2RDXA 3ITVA 2Z1KA 5A5WA 3AFBA 3F4DA 1IZJA 1MDLA 4ENLA 1MRAA 3O3RA 4CKQA 4GIAA 1MSSA 1XWYA 4LBRA 1EDQA 3GFZA 1TRIA 4Q4PA 2W4XA 1ECQA 1TSIA 2XGBA 3TC6A 5HATA 3G1DA 2B81A 4AF0B 4WRHA 4HYRA 1ITQA 2YL9A 1W6TA 4NILA 5AOUA 4FNUA 2G5WA 2CBIA 4LC8A 1EWEA 4B9YA 5REQB 3EPOA 3KLKA 3V5OA 3G0SA 4BWLA 3AUJA 2VO5A 2V5LA 4BS0A 2Y89A 3UNTA 3M4HA 3C8FA 4XBJA 4HCDA 2W62A 3W70A 4H6QA 1ZL1A 2PGFA 1RH9A 4J40A 4JTFA 4X0NA 4UZSA 4J35A 1X97A 4OECA 3LCHA 2WNZA 4XAPA 4L5ZA 2FGBA 3GXDA 3PTKA 4IPPA 3NSXA 4LPCA 1BPLB 2NUYA 1HJUA 2XSXA 2CBUA 4ROQA 3CQKA 3LS9A 5BU6A 3KTCA 3IWPA 4M5PA 2E1DA 2PDCA 1Q45A 4RUBA 1SJAA 2V3DA 1NDYA 2Q3RA 5IHSA 3CAWA 4IP5A 1Q7ZA 1EBGA 5CPTA 5I2UA 1S2WA 2GQAA 1ZP3A 2DW7A 4L1XA 3SSZA 3RYSA 2MUCA 1FQ0A 5F4XA 1KR0A 4Q8MA 1PS9A 4S2BA 4JX6A 5CC6A 1R2SA 3BJSA 5D2XA 3NQCA 3TAKA 3R6IA 1V4YA 1TJ1A 1XQLA 2GYIA 3LXCA 4I9MA 5EA9A 1HGWA 3N34A 2QCNA 3IJ6A 4JEJA 1WV2A 3GDRA 3T55A 4AH7A 1AL7A 4AHOA 3ERPA 4FNSA 5LIXX 4MJ4A 2W3ZA 3M41A 2J13A 3M5ZA 1X98A 4TX6A 2Y5JA 1C9DA 1ME8A 2CWNA 3VNDA 5GNZA 3IACA 5A8NA 1E71M 1V02E 2ZE0A 3NXLA 3MP3A 2B7QA 2VNCA 4MWAB 1P6BA 1AVAA 1QUMA 1ZBKA 1J18A 3E9AA 5DMNA 1FX6A 1TWDA 3CPRA 1J0ZA 4NZCA 2WPGA 1E6PA 5TQLA 4UTTA 1OB0A 1B1YA 3C52A 3E5PA 4O1DA 5I03A 5CKSA 3GDLA 4JIIX 1OK6A 2YW3A 1OT2A 1HJXA 1YNPA 3B9EA 4MHBA 4Z1BA 3G3MA 4DYJA 3ID7A 4D6FA 4ATWA 1PL9A 3CL8A 2G0WA 4H1ZA 3I7RA 4NRRA 3C61A 1W54A 1O1HA 3RITA 5FJRA 3XIMA 1UZ1A 1AODA 2GQ3A 3VX1A 2WSKA 4I90A 1AJ0A 5DCDA 4RZ6A 1S46A 4DQWA 3E0WA 2GK1A 4U5KA 1SMAA 2AKMA 1XLLA 4E2BA 4FZIA 3GDBA 1QJWA 5D32A 1HX0A 1UC4A 1FTXA 2P10A 4PMNA 1SQ7A 4IPJA 1QTWA 1AL8A 1KRBC 5FJOA 3VM5A 1HL2A 2V69A 2FTYA 3K8MA 4UFMA 5F4WA 1PPIA 5FOOA 1ONRA 4UFIA 3S5SA 4K8GA 3CWHA 1E1EA 4F0HA 1I2QA 4MDPA 4NNBA 2ZZ7A 4AZCB 1E9ZB 1Q6FA 1UD3A 3URBA 1Q3NA 1F61A 2HSAA 2WCSA 3FEQA 3EDJA 4DY1A 3UERA 2HV5A 4H6KA 3NEVA 1Q4NX 1C7TA 2YXOA 1DKWA 1H7NA 4HHLA 1F73A 1GQIA 4N6EA 1L2QA 2W5FA 1XLIA 2PWUA 1TB3A 1GOKA 1JNDA 3GVWA 2Z27A 4TTUA 2Z6JA 1SU5A 3CH0A 3W29A 3SRFA 2NWSA 3IAPA 4V1YA 4I3GA 3HB9A 4UWMA 2VX5A 4X60A 1TPC1 3DERA 4UCGA 4CGTA 2GVLA 3S0CA 1BXBA 4I9TA 1TX0A 4Y96A 1OFPA 4HK5A 3EA1A 3W2NA 3HQPA 4KGJA 3GDKA 3GVGA 3BV4A 1PTAA 3VZZA 3P67A 5BMXA 1Q65A 3ZSSA 3EOEA 1KBLA 3T0DA 1RQBA 1YXCA 2REQB 4ZCWA 1ZCCA 1WXJA 2DIEA 2H8ZA 2XINA 4IL2A 2JGYA 4LYQA 4XB3A 2ASHA 1JD9A 4C1LA 2RFGA 2QS8A 3DGBA 3AC0A 2YBUA 1ME7A 1H60A 2J77A 1KNWA 3L4WA 1P7TA 1F74A 2VKZG 3KL5A 4M82A 3LHUA 1HKIA 2BTMA 3G6MA 4RLIA 4DBSA 2BNJA 1K70A 4N0RA 1LCOA 3N2TA 4L56A 3G0XA 4JIQA 1F4AA 3EKZA 3G1VA 2HTMA 5CBBA 2GVEA 1GHRA 1R9ZA 3S6OA 3C0SA 2QULA 4DJEC 5C2XA 2VDIA 3CYJA 2PBOA 1XLBA 1M01A 2D69A 1CNVA 4UFLA 3H2OA 1OCNA 3EB2A 2IXVA 1HJQA 1J5TA 2XFFA 3NZ1A 3W1LA 1MVYA 2OELA 3EWDA 3VMPA 4JY9A 5HULA 2CZEA 3WY1A 1ZGDA 1FXPA 4Y9OA 4PMVA 4MADA 1GEQA 1J10A 1KC7A 3P7YA 1W91A 4AX7A 2FFCA 3MMUA 2CU0A 1UD4A 2ISWA 3QR1A 2C16A 3B8SA 1MXGA 4PMJA 5TNVA 1DIEA 4EXQA 2HE5A 1SR9A 1VAHA 6XIMA 5H91A 1K7FA 5T8GA 1E4LA 5JUVA 3E74A 4M29A 1B3WA 5D04C 2YA2A 3K46A 2DSWA 3LCWA 4CUCA 3QGAC 5C54A 1AJ2A 4X22A 1B2YA 1US0A 1QU4A 4IOTA 1A4MA 1QI3A 3CNYA 5K7JA 3GC4A 2FIQA 4UZUA 3HIJA 1NWRA 5KMYA 3R4IA 3KOZA 4EIVA 2QAPA 3A23A 1A3WA 3E2QA 4F48A 1XCXA 2E77A 1JZ7A 1JYWA 4PFMA 4CNTA 1C91A 1K8ZA 4H8HA 4JFUA 3GRIA 3C4UA 5FJPA 4JOMA 3N4FA 3IIXA 1YX1A 1JI2A 5SWUA 1OFBA 2A3AA 5JH1A 2DT2A 2FJUB 1HJVA 4WDWA 4ZE4A 4ZTXA 1FWHC 4NF7A 3GXPA 1SR0A 2WMIB 4AQLA 1EO5A 4OIFA 1XRFA 3MP5A 1HP4A 3R10A 5C6MA 1C8VA 4QLLA 1I75A 1RQEA 3VDBA 3LRLA 4J3VA 4FNQA 1XRTA 3LCLA 3R8RA 4G5DA 1Y7VA 2BHYA 3FNDA 1JULA 1MNSA 4I7WA 5MF5A 5DCBA 5G4WA 3KCOA 1B3OA 1J01A 5A3HA 3HG3A 4IMAA 2HWGA 3AIEA 2INFA 4RDVA 1WE5A 5B80A 3WNMA 3W53A 3H53A 3ZWTA 2QW5A 4IFKA 3VCCA 3SN4A 3CB3A 4GYKA 3OBKA 2GUYA 2QV5A 4N42A 3CU2A 4JL1A 3NTYA 5BRQA 3BQ5A 2WVUA 2E25A 1UQYA 4N6FA 3P0XA 4JQ1A 4UTWC 3C86A 5AECA 4MJ2A 4PA8A 4KPLA 4O11A 1WP6A 3GNDA 2XVKA 1H2JA 4PUUA 2BVDA 5K4XA 1E56A 4X2RA 3P62A 2J78A 2YPIA 2TODA 1W56A 5JMUA 4EPKA 4GH3A 4PB5A 3WMBA 1K02A 2F9RA 3MB9A 2PDNA 3WQDA 4DI9A 4PTNA 4FOKA 3LBCA 1TWWA 5GNXA 5C2CA 3NA8A 3GR4A 3L23A 2AQOA 1JJKA 1NAL1 1FRBA 2FPTA 3QN3A 3GIPA 3O6CA 2CHNA 1RBOB 2CLEA 2E5BA 4OZOA 2P1FA 3DU0A 1GVIA 3N11A 1DJQA 1H0GA 1EJSC 5IRPA 1RVGA 3FHQA 3SCUA 3B8TA 1VIWA 5HWNA 1YTDA 2WC4A 3M0LA 4LU0A 2VX7A 1X8CA 4KW2A 1W5MA 4US6A 3W3OA 2EPOA 4J3TA 3ARXA 2ZYFA 1W17A 4GX8A 4REQA 4GUIA 3VD5A 5REQA 1EOKA 1WDPA 4HPJA 4KFNA 3THQA 1PEZA 4RZBA 5ECUA 2PTYA 3GAKA 2YSWA 3CAVA 1BEUA 2JE8A 5CSSA 3DG3A 1OT1A 4CNNA 1LG2A 1MW1A 2F84A 5G2IA 5DN1A 3OVGA 3BTNA 1XCFA 3JS3A 1CGYA 3KUMA 3UWWA 1JZ2A 2GZXA 4RW3A 1PHQA 4OV9A 1S2TA 3WH7A 1WKYA 1RJRA 4S3BA 4C1NB 4GI4A 5DCEA 2OJPA 3WSUA 1K8YA 1GOXA 2BHUA 4HJWA 2C71A 4O12A 1TIMA 3WD4A 1XLCA 1IGSA 3GTNA 2R1NA 1FWRA 1P1XA 3O8AA 3S3GA 2QCHA 1R7OA 4NI8A 3GAYA 4WIWA 3MJMA 5JQ9A 1NOFA 1JDDA 2OX1A 4DB7A 4JQ2A 3LY0A 5FEXA 3W2MA 3W22A 3QHOA 4WSJA 3GW0A 3WL0A 1EA0A 5FA5A 4A2SA 2X8RA 2XHYA 2A0NA 2PF0A 2HS6A 4WF7A 5CPNA 2FZBA 2W27A 1JPIA 3W25A 3OZYA 1O66A 2Y6ZA 1TO3A 1IR2A 2JFEX 1KO0A 3ZVHB 3WUBA 1L6YA 1W0MA 1PDZA 4AEFA 2OFJA 2BLEA 4DZ5A 2XN2A 2QGYA 3M0VA 5HNRA 1FFQA 3C5QA 4GQGA 1HGYA 4C60A 2EJAA 3A3WA 4I5XA 5I07A 4N7QA 3LLXA 5J5RA 4V28A 3UA3A 4QXIA 1NM9A 1LROA 2W9MA 3KS5A 3QFEA 1XD0A 1DL3A 3GUWA 4HU0A 3VILA 2ZTKA 3AUOA 4MB5A 2PEVA 4XVDA 3VKAA 4M6UA 1L0PA 4D6DA 1FCQA 5CG0A 8XIMA 1WB0A 1Z48A 2CLKA 3WF1A 3F2CA 2VENA 4XZMX 3SSJA 1OFQA 2PLCA 3D3AA 3BL3A 4Q22A 3WEZA 1V93A 3AMKA 4FF5A 3VO0A 4Y9PA 4DZAA 4HHMA 3MDUA 5ECVA 3SCRA 3S6TA 3WF3A 4HB7A 2PDMA 4QNWA 4QGCA 1GKPA 1O5QA 3CUGA 3IV8A 2ZTJA 4M81A 3NGFA 4H9UA 6REQA 1NOUA 3QPZA 5F7UA 3UG3A 2DP3A 3U57A 3W7RA 3CL6A 3GU1A 2Z25A 2C0HA 3R25A 1GGOA 5EMJA 1NFGA 4GIYA 1QPNA 4DRSA 3BMVA 4C6JA 3L0NA 1QR7A 3O2LA 2FTWA 1Q66A 4NAEB 3S9ZA 3GTXA 1TZZA 3U9IA 1PZ0A 3K8KA 2BY3A 1JXKA 1GJWA 5DY2A 4P8UA 3W7HA 2ACQA 3B0UX 3TFCA 2WXDM 3LQLA 1JI1A 1SO5A 2IMRA 1V6VA 2NZLA 2EF9A 2J75A 3KL0A 2CBJA 2C14A 4E2DA 3G77A 3S1UA 3GH5A 4IIGA 1EUAA 1XYMA 4O1FA 4PTWA 3BAXA 5J04A 3BOXA 1DXFA 3NPVA 2OXNA 4BEUA 1O5RA 1FWEC 4RKAA 5LIUX 3BAJA 1B54A 1UKQA 2I9UA 2ZRZA 1OGBA 2G8ZA 1OX4A 2ZX8A 5HPCA 2BASA 4AZ7A 1GYLA 4EKJA 2HNEA 3LLFA 2RGMA 4Q8QA 3TONA 3RO6A 3NQEA 3VNMA 4LH8A 3ATYA 1W3IA 1WAUA 1LBFA 2Q09A 2VZTA 3CZKA 4P7RA 3EXRA 2V63A 4FI4A 3CMJA 3CUFA 4EOUA 4OBRA 3OJGA 3UXKA 4HA3A 4Y8EA 3TWBA 3QR3A 1J6OA 4GOAA 3A24A 3THCA 2D2HA 2CFFA 2G3JA 5C9XA 1JGMA 2VCAA 1MEWA 1H5VA 1K7EA 1OX6A 5FCZA 1EWDA 1X6LA 3KBSA 2DUAA 4ML9A 4BEQA 2VVNA 3KWSA 3T09A 5IBXC 4YCOA 1UW9A 1BAGA 3TU9A 1V51A 3PNUA 2J25A 4KMQA 2O9OA 2J7BA 1EA9C 4JNMA 1SJDA 2XIQA 4K37A 4PUMA 2ZICA 3W1XA 3IJ8A 1CI1A 4CNSA 3BSGA 3V0SA 1XLDA 3UF9A 4AC1X 4H2HA 3DKJA 1ESWA 1P5BA 3S2NA 4DF1A 3C2YA 3F7JA 4AD4A 3V5CA 2C91A 4JS3A 1UPMB 1ENUA 5BWFA 1KFJA 3SRHA 3TA9A 2WZHA 5D37A 4IQLA 3CZLA 1B9ZA 1AD1A 1SZRA 1O6IA 4Q6JA 4PULA 4ZXOA 4DJEA 1NELA 3CIWA 1ADSA 4LNCA 4NKCA 1I2OA 2FVKA 1JCXA 2ZRWA 3GR7A 4GQBA 4J3UA 5LZLA 4ZA0A 4NL1A 2Y0FA 1GVYA 1RJPA 4FX8A 1JIBA 5K3VA 4MKNA 1JFHA 1I0DA 1PVNA 1RK5A 3SQMA 4AZ6A 1AH3A 4L9YA 2VXNA 3K4DA 4AZ5A 3FVDA 4AD2A 1B4KA 2X1UA 1WDRA 1TX2A 4CNPA 3QSTA 1OFEA 3WJSA 3KCLA 4OU1A 3CUZA 1YTEA 4C6MA 4H3DA 3ES7A 3R94A 4HBKA 3QVQA 3TXZA 4C6KA 3CPGA 1UWIA 1TJ2A 3L4VA 3VOIA 4A8LA 2W61A 3H2FA 1J96A 2X1SA 2TMDA 3WIJA 1ZNNA 2DH3A 4A8IA 1PTGA 4IX2A 1JR1A 1R6WA 3DXIA 4GUGA 4ZE5A 2R94A 2C19A 4KGLA 2RJHA 3GIQA 4IQDA 5DELA 1EIBA 1IF2A 3HFYA 3AS3A 1QI0A 4CQAA 3VVGA 3ITYA 2NT1A 4Q8NA 2DSKA 4V27A 3ES8A 1QPKA 1A3XA 1YQ2A 1NQKA 2RHGA 1EZ2A 1E73M 4HPGA 3F4CA 3RX2A 3PG8A 3W1TA 3HU7A 1G69A 2TAAA 1TMQA 2J8TA 1KFKA 2RUSA 1L6GA 4D1IA 3ABQA 4Q3MA 1UYQA 4RZ5A 4E2OA 3NQMA 2XN0A 1CXEA 1GG0A 1RZMA 2VRQA 3AHZA 4O13A 3ZLGA 2WANA 4L6OA 4PB4A 4BJHA 2UBPC 5HNNA 1TV4A 2O7QA 3URQA 1YIXA 2NT0A 3CMFA 3QFWA 4MM1A 5I3FA 1QT1A 4HU4A 3RR1A 5AZ1A 2D3NA 1VPXA 5BROA 4U31A 3W2LA 3RGTA 4NXSA 1YPFA 1OCBA 4R34A 3RJXA 1OEPA 3W9ZA 1Y65A 1DHPA 3MWCA 3MC5A 3KZSA 2OODA 3D5HA 4IIFA 1XG4A 1ISZA 4ICCX 4UTWA 3U3HA 3L12A 1XLAA 4M6PA 2O92A 2FMNA 1QPQA 1SUXA 1ZPTA 4HMCA 3NOEA 1PKMA 1XBVA 4AXKA 1W3JA 3RX4A 6TAAA 3LOTA 3P5ZA 1UKOA 1HKVA 2WKJA 3ANUA 3UA4A 3TMQA 2YOCA 2FHBA 2XZ7A 4JTUA 2Y7FA 2EGZA 5KTLA 5BU9A 1KTNA 1W31A 1QPRA 4EVZA 1J0IA 3FAWA 3W7EA 3LGDA 2GWNA 1JZ6A 1IEQA 5CC7A 4HA1A 1H1ZA 3HGRA 3O6YX 3BXWA 4OOUA 3N2MA 1BRLB 1UBSA 5I06A 3P5YA 4FF7A 2BXZA 1ONEA 3GHTA 3ZO9A 2OGJA 4CN4A 3N2BA 3I6EA 4LF2A 3TNOA 4O1BA 1W8SA 4F0KA 3GDMA 3BANA 2QKFA 2ICSA 4XD4A 4XZNX 1TG7A 3MTWA 2CIPA 3MU7A 3JZEA 4LVGA 4XAFA 4LX4A 2YCEA 1QBAA 3BLKA 2GUBA 3VC6A 4L4MA 3WL1A 4AD5A 1AJZA 3M0IA 3TR2A 2HPMA 4O18A 3CQIA 4TX8A 4W9TA 1BG9A 4A21A 1M7JA 1A5NC 1REQA 3KEHA 3QF0A 3QXBA 3SCTA 3BLOA 2HISA 4ZGYA 4GO9A 3F2BA 3WNLA 1GOQA 1AH4A 3WLLA 2AKZA 2NV9A 3P3BA 4NZJA 1BTMA 3H21A 4QQ3A 4PUNA 3W2JA 3O63A 5H2ZA 2C1GA 2ZX9A 3KVJA 3VIIA 2JKEA 4JTHA 3LCXA 2QVHA 1WZLA 3CTLA 3DZ1A 4KKXA 1QNVA 2ZXDA 3CUXA 4M7TA 4W4QA 4GYFA 1TR9A 1FDJA 4AX6A 4JCMA 1ICQA 4K38A 3UWEA 3E0VA 4WKHA 3C0LA 4BY3A 3N04A 5PTDA 2P8BA 3XINA 2PDGA 1LBLA 3G1YA 4H9TA 3AXMA 3NFUA 4W5ZA 4QE5A 2BVYA 3AZSA 2HZGA 2V81A 3FA4A 3W7GA 1ECEA 1VFHA 3UJSA 3SM0A 2VCCA 4GI8A 1YRRA 4K39A 4CCCA 2YL6A 3M16A 1VFSA 5HNTA 2WSRA 5DF0A 1OD8A 1PSCA 3WMSA 4HSOA 3LZ3A 1QXLA 3QBUA 3M47A 1SJCA 1A80A 3KTXA 3GW3A 3TJXA 1OFRA 5AYBA 1V08A 3DUGA 2PWGA 1ISXA 4LBSA 1KV5A 2HCVA 1NTHA 4DO7A 3CV1A 2EEXA 4N02A 3AYTA 3SEPA 4KH2A 3UR7A 4AYSA 3QZEA 1T8XA 3VKDA 4WR3A 2OLSA 2PTDA 2AAMA 1E1CA 4DPPA 3WNKA 3PNZA 3RDKA 1P0KA 2VR5A 1TTJA 3KDNA 3MCNA 3WLOA 4EACA 4TR9A 2GGHA 2HXTA 2NUWA 3CEUA 3GK0A 4F2UA 2WVTA 3HG2A 2GSJA 2FVMA 1HP5A 3D0C