1UJPA

Crystal structure of tryptophan synthase a-subunit from thermus thermophilus hb8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
271
structure length
243
Chain Sequence
b'MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDGPVIQRASELALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSVEVKDLVRRIKARTALPVAVGFGVSGKATAAQAAVADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Stabilization mechanism of the tryptophan synthase alpha-subunit from Thermus thermophilus HB8: X-ray crystallographic analysis and calorimetry.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 92
structure length 243
sequence length 271
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ujpA00
4YXGA 3JRKA 1T8XA 1LRTA 4O0ZA 2YW3A 4BI7A 1B4KA 5BNKA 1KBJA 5ABTA 1JJKA 3KVKA 1GPWA 4L4LA 2WO5A 2GJNA 3WJYA 1TREA 3TSMA 1GVSA 3TMQA 3C2OA 4DXVA 1SO6A 5HJLA 4O12A 1I4NA 1KM3A 4ZQOA 4EIVA 2J6XA 1ZENA 3L5MA 2AAMA 1KM5A 5K4XA 4UTHA 2B7PA 3LCWA 2J9ZA 5LZLA 4UR7A 1GT8A 1VR6A 4AHOA 2VFHA 2X1UA 2GVGA 3HF3A 5CZSA 4NJGA 1F76A 5TBOA 5BMWA 1SFJA 1R46A 1SO3A 3C4UA 4GC4A 5C55A 3Q94A 3QPZA 4JYDA 2ZCGA 5G4EA 3C61A 4C1KA 3EXRA 3PWAA 1TTJA 2CLOA 4UCGA 2YXGA 5FF4A 2VFFA 4AMAA 1JULA 1U83A 1ADOA 3TFXA 1XUZA 4MIMA 3NPXA 1IIHA 3UWVA 3G1VA 6TIMA 1EEPA 2X30A 1JCJA 1F73A 2YDAA 3LLDA 3IIVA 3WFAA 3UY7A 1L6WA 3LRLA 3EX3A 3L9CA 4KWWA 4XTIA 4Z0JA 2QCEA 3W85A 1SO5A 1OFEA 3UWWA 4LVDA 2Y7FA 1J5TA 3W7DA 2JK2A 4J9JA 2RHGA 3WK2A 4O1BA 3NL3A 4O14A 2NX9A 2ZRZA 1L6YA 3FIGA 3SI9A 3GDTA 2BSLA 2WNNA 5CSRA 1W54A 4RK8A 3DH7A 3FKRA 2VEKA 4GUGA 2X1SA 4CNOA 4AB4A 2NZLA 1AK5A 1O5KA 3GX9A 1W3TA 2D73A 2TSYA 1CW2A 4HNTA 3CLMA 4O1CA 3O07A 2B7NA 2WSYA 4JDBA 3HBLA 5C6MA 3W76A 1TPWA 2QUTA 2XN1A 1QPRA 4RZ5A 1GVFA 3W6YA 2W0UA 3NQGA 3W2JA 1TTQA 3W86A 2Y63A 3OIXA 3WJZA 2R91A 3L67A 2J88A 3KX6A 3KFTA 2B7QA 2ZTKA 3GNNA 3LB0A 4CCCA 3W7PA 1JVNA 3IGXA 5D2VA 5IBXA 5CZTA 1OX4B 3CWNA 3T4CA 3E12A 3P8JA 4HN4A 4GBUA 4PL1A 3GDKA 2E5DA 1KTNA 3W2KA 2RDWA 5FF2A 4JEQA 1H50A 3NL2A 3A24A 4MYAA 3PS7A 5DXYA 5D03A 3UXAA 3GXTA 1GG0A 2GOUA 3STEA 3W1XA 4FX8A 5C54A 3EWXA 4UNKA 3OVRA 4UFIA 5LNUA 1MO0A 3GAKA 4UTTC 1PCWA 5CPNA 3EX6A 5F4SA 1SZFA 5DELA 5AYYA 3STCA 1K7XA 1WAUA 1QPOA 4AHQA 3GKAA 5D2XA 2YZRA 1IXOA 3MHFA 2QAPA 4QIUA 3UNDA 1F6PA 1PCKA 1VPXA 1H7PA 1OK4A 3CEUA 4KFNA 4QNWA 3A9IA 2C19A 3A21A 2YSWA 1H63A 1QDSA 2VEPA 4N9EA 4OV9A 1NFBA 3LRMA 1YXYA 2GPTA 2V2HA 2UV8G 1LM1A 2Y70A 3PY2A 3U2OA 4UTKA 3EKLA 4FNRA 1DBTA 4QNEA 3TIMA 3G3DA 3VI2A 1QOPA 4HKPA 1EP1A 1D9EA 1N7KA 2BTMA 3GXPA 3FEMA 4QQ3A 1I2PA 2CLEA 4WY0B 4O10A 4X9SA 3G1SA 3W22A 2VFGA 3P84A 4LV9A 1ME9A 1DOSA 4DELA 1H61A 1HO4A 4FX7A 4JTUA 4ZQCA 4H6KA 3MBDA 2XN0A 3BLEA 1GVOA 3LV5A 5K7JA 2VFIA 3LX9A 4CNNA 4XKYB 1RR2A 1C8VA 3SECA 2DZSA 1S5WA 4K36A 1XDMA 4CCDA 2CZDA 1OFPA 4Z1DA 3TKFA 3D0CA 3RNDA 1OFBA 3IGSA 1RQBA 4HNNA 5BRBA 1TV5A 1JCNA 1G7VA 3EWZA 2V82A 3R89A 4PTNA 4R53A 1Z42A 2CLKA 3IGUA 1XDLA 3F03K 2VKZG 1P5BA 2I14A 4EF9A 3O6DA 3CQ0A 1LTDA 4Y96A 1QOQA 2C15A 3W1QA 3M1ZA 5K3VA 5AOUA 3TFCA 3P5ZA 3L66A 3N14A 5EL1A 3E0IA 4LS2A 1F6KA 3QQ0A 2R14A 1W37A 1YTDA 1JCLA 4A21A 3ZWTA 4JIQA 4LRTA 1VH7A 3N9RA 1ICSA 1TPFA 3ATYA 2CLMA 2V2DA 1VLIA 1AL7A 3CEPA 2ISSA 2FPVA 3N2MA 4TMBA 3L0NA 1VCFA 3CB8A 1FWRA 1MSSA 3ABSA 4ORIA 4PH6A 3BV4A 5GVJA 4FF7A 4LWWA 4MY8A 1FWSA 1OABA 4MOZA 3PBYA 2Y7EA 5AHIA 5LGXA 1XFBA 4ONVA 1M7OA 3EXSA 5G2HA 4UTJA 5KZDA 2QUVA 1W5MA 3PB2A 2G5WA 1VC4A 4N6FA 5LNVA 3QW3A 2QAFA 4OQVA 3W73A 5I3IA 5AC7A 1ZY9A 1A5CA 5I3GA 3UQNA 2E6DA 3STGA 3NAVA 4O15A 2HS8A 2R8WA 4MYXA 1DHPA 4Y6GA 5F2MA 3DHFA 3T78A 4S2CA 4M5PA 3TSBA 1WXJA 2PURA 4WOZA 1H7WA 2A85A 4WXZA 4UFMA 1QCWA 2WSQA 1UJPA 1TPVA 5HWMA 1G7UA 3HB9A 2A5HA 3UWZA 3W7KA 2A0NA 2PCQA 4ICNA 4JX5A 4LV4A 1SPQA 2WSRA 1PE1A 3MP3A 1LLZA 3TSDA 2HTMA 2ZA3A 3NM1A 1JR1A 3QC3A 4DF1A 4AWSA 1FXQA 2G97A 2YYTA 3M0ZA 1EUNA 3OVPA 3FJLA 4S1FA 4O13A 5AB3A 1ML1A 3W72A 4EF8A 3S0CA 1TTIA 2WKJA 3NQCA 5U7SA 2ZYFA 3L0KA 4WY0F 1KFJA 3EX4A 4PFMA 5L9FA 4FX6M 4XUGA 3L21A 1FWNA 3CU2A 4FIQA 5KINA 4M19A 5DY3A 4N9DA 3W9ZA 1XXXA 4LOCA 4OWGA 3PBVA 1EWDA 1QO2A 3BGGA 4KFOA 2HS6A 3G18A 1FBAA 1CI1A 2X2GA 4UIOA 2OZ0A 2BZNA 2E5CA 4NJKA 1PV8A 4IX2A 3EWUA 2G95A 5AHMA 3NQFA 1YXDA 2AQWA 4A29A 3DI1A 5KZEA 3JS3A 3W7JA 1SUXA 1GEQA 1R47A 3EKZA 4JTTA 4HHPA 3KRUA 1ALDA 2GUUA 2X1RA 1A50A 4RJEA 3SW6A 3P82A 2XN2A 1GVRA 4AF0A 2JBMA 1TJRA 4Q33A 1KM4A 3TW7A 2TPSA 4WY0A 3G1HA 5G1YA 2EGZA 4DEFA 1SR9A 2DZXA 1C29A 1VZWA 2YPIA 3KOFA 1K7EA 1H7NA 3HOJA 2GQ9A 3DFPA 4N9BA 5I3JA 3M6YA 2FPTA 3EEGA 5LKYA 1VHCA 2F7FA 4UNLA 4XKYA 1X8FA 3R5EA 4I7UA 3P7YA 3ABQA 4ZQNA 3QMTA 1N55A 4UTIA 4Z08A 3MHUA 2ZA1A 3DFNA 4FNPA 4I9AA 3N3MA 1XL9A 3A22A 4UTWC 5H2ZA 4HPXA 3GXNA 5DXXA 3NR0A 1ICPA 2FJKA 1BTMA 4BFAA 3NL6A 3BGJA 2QCGA 1K02A 3V1PA 3KRZA 3W1RA 2E5BA 3TQVA 3TJXA 3TE9A 1KFBA 1H62A 2FQIA 3NYZA 4O1DA 4OGZA 4DQWA 2Y61A 2YFOA 2C14A 1TPB1 2H3BA 5CZJA 3LBMA 1LDCA 1U5JA 3B06A 4FNSA 3LXBA 1KFEA 4UMAA 1K03A 2RH9A 1O60A 1ZCOA 3MWAA 4PC8A 4E2BA 1TPUA 1OG0A 1GG1A 4O28A 5D04C 4DF2A 4Z1AA 3NPWA 1Y0EA 3P67A 4UTTA 2HMCA 3IVTA 2I1OA 1OYCA 5CG7A 4JY8A 2JGYA 4TIMA 3S1UA 3W2NA 4GRSA 3LERA 1TCDA 1K8XA 5HUOA 3UYCA 4HT3A 3OHIA 2VC6A 1N8FA 1OX5A 1OF6A 4HPJA 2FIQA 1PL9A 3ABOA 2TMDA 5AHLA 3UWQA 3DHDA 3HMJG 1YPFA 4ZQMA 1RPXA 3QF0A 3W7QA 4WOQA 1QMLA 2J9YA 3FYOA 1R2TA 3C8FA 2ZRUA 3MI3A 1QO5A 5F2LA 1DL3A 4OBTA 1ZNNA 3W7LA 4KFPA 3W84A 3S5YA 3QW4B 4PEKA 1H7OA 2YCEA 4Z0SA 3ELFA 4GJ1A 5U4NA 1EB3A 5AHFA 3T40A 2XFWA 4A22A 2JKEA 2A4AA 4TMCA 3MYOA 4NNAA 3HG4A 1R2SA 2A2IA 2NX1A 3UY8A 1D3GA 5F1VA 3WK3A 2X16A 3W1TA 3EXTA 3S8HA 4IX0A 5DBUA 3Q2DA 1RVGA 3FYPA 4S2BA 3W7RA 3W74A 4JTIA 4EVZA 4HNVA 3LTPA 3O05A 1DKWA 3PF3A 3UPBA 3W83A 2E77A 5K9XA 4RXFA 4IGHA 3EX2A 3KAOA 3O6CA 3O1NA 1NF7A 3KRSA 3TXVA 5C2XA 5J5RA 5IM51 4LUIA 3TC6A 5I3HA 3S42A 3ZWSA 2VXNA 3G1XA 4O8RA 3W2UA 3H55A 4JTJA 1A5AA 1I2RA 1NF0A 1LYXA 3F4NA 3WJXA 3BARA 1OJXA 4MLJA 1NSJA 4Z1BA 2GJLA 4B5NA 3IIPA 3KHJA 4QITA 1O4UA 4NT0A 3RK8A 5HWNA 5K4ZA 4GUFA 3L5AA 1IXNA 3QSTA 4RX0A 1I45A 1PHQA 2J27A 2YR1A 1SQ7A 4BWLC 5AC6A 3TC7A 2Y89A 3OG3A 2H8ZA 4A2RA 1HTIA 2E68A 5F4WA 3PBWA 5MHBA 1YADA 2PE4A 3BLFA 3G0SA 1YLVA 4M6VA 4MJZA 2B4GA 3W7NA 2V81A 4P2VA 4AAJA 4UUIA 4DO6A 3W88A 5CPLA 3C56A 3DKJA 3W7CA 2Z6IA 1F74A 3B05A 2C3ZA 1OFOA 4X22A 2E6FA 3IVUA 2TYSA 4MVAA 5FEWA 4WD0A 4JX4A 3NPUA 4DBDA 4NNCA 4YCOA 4JD4A 3HG3A 3W71A 4D2JA 5FEPA 1G6CA 3HGSA 5FI8A 4GFSA 3E02A 3P8IA 5EBUA 3S6DA 2NV1A 3SJ3A 5AYZA 1LOSA 2C0AA 1XBYA 3M5XA 4O11A 4R33A 3H53A 3S1XA 3IIOA 1SZNA 3PB0A 4GWEA 1SW7A 3M44A 1I2NA 5LGZA 1YDNA 3NM3A 4O54A 2B7OA 2RDTA 2W6RA 1TPC1 3C52A 4GE8A 1VHNA 1I2OA 1G4EA 5LSMA 1EA0A 5CGQA 1W56A 2PRMA 4QISA 2DORA 3CTLA 2V9DA 2C13A 1UUMA 2OMAA 2A7RA 1OF8A 2OT0A 3SIZA 1SSGA 1W3IA 2NXGA 3L5LA 1W3NA 4KKXA 5DLCA 3L65A 4FHAA 2ZZ3A 4UC5A 1KM1A 1JRCA 4UR8A 3TNOA 4LS0A 2V5LA 2G96A 3MHGA 3PC0A 1E51A 5HQEA 2YFNA 2E1DA 4AVFA 3HPSA 1L2UA 1TYGA 4LY8A 1AL8A 1BWLA 5TIMA 5DBTA 1FCBA 4HIBA 1S5VA 2FB3A 3GDRA 4FNQA 3EWWA 3P60A 2BLEA 5D2WA 3DFQA 1GTEA 2QUUA 4RZ6A 2X1TA 1KFKA 1ME7A 1RD5A 3GVGA 4X2RA 1VJIA 4RR4A 3NXFA 3S5ZA 2HSAA 5CPOA 3PSVA 4N9CA 1GVQA 3DKLA 3WJWA 3IVSA 3M7WA 4M7TA 4XTDA 2Z6JA 4NXKA 5F4XA 4LVFA 3M5YA 3MJYA 1EPXA 1MEHA 4TO8A 1HO1A 1KFCA 1WYIA 3MYPA 1I8JA 1LLWA 3Q58A 2AGKA 1TSIA 4IMGA 5D2YA 3O6YX 5CSSA 1UBSA 1VYPX 1A53A 3QPYA 2ABAA 3G22A 4L4MA 2NLIA 1GOXA 1B9BA 4ML9A 3N34A 4XBKA 3CM4A 4NJJA 3LM7A 1H1ZA 3MW7A 2EPHA 2VENA 2P1FA 3QRHA 4I7WA 4LU0A 4H4IA 3MI6A 1QWGA 5G2IA 3DAQA 4OV4A 1VRDA 2ISVA 4K8EA 4XWUA 2WQPA 1G67A 3TDFA 4N4PA 4Q32A 3CHVA 1Q3NA 1P1XA 1W5QA 1BWKA 1Q6LA 4PL2A 1EP2A 1FDJA 4IJBA 1OX6A 1JRBA 3DFTA 3VFLA 2C18A 2A21A 4WQ6A 1B3OA 1JQXA 3BW2A 3GB6A 4OU1A 3W1UA 4Q4KA 2VEIA 2ATSA 4WUIA 1Q45A 1SU5A 2J9XA 4MJMA 1QNVA 2NUYA 2O7QA 4UTWA 4JS3A 3ATZA 5J5DA 1K7FA 4MY9A 3VCRA 1FCVA 2CLHA 1TMHA 5A8GA 1DJQA 1SW0A 3GAYA 2V0TA 2VELA 3DENA 2QCMA 3PG9A 4ADTA 1EUAA 3E9AA 3LHTA 3NDOA 1XCFA 4CNPA 1SZEA 4ALDA 5K2ZA 1OYAA 1T99A 2ZRWA 3BPWA 3TMLA 2CU0A 1HUVA 1BKSA 4RCXA 5D02A 4NVTA 1FQ0A 5HR6A 3QMRA 3TU9A 1XKYA 4JTHA 3SFKA 4CQ9A 1OFQA 4FB7A 4O50A 4M6QA 2Q8LA 1PHWA 4NX0A 5FF0A 1TV7A 2ALDA 1FDYA 4UFLA 1W5NA 3W2LA 3TQ0A 3RMJA 2EHHA 3LCLA 3PM6A 1OX4A 4U28A 5D33A 3O63A 5G2WA 1YDVA 2DZVA 3W75A 3LXCA 3LDVA 1OYBA 5EA9A 4IXXA 4XQ6A 3TV8A 1AW2A 5E0KA 1Q6RA 5G4WA 3T55A 3GZ3A 2VFEA 3E49A 1IF2A 2Y6ZA 2CZFA 3UWUA 1G4TA 5HINA 1ZAJA 3PAJA 4ZQPA 2QR6A 3HPZA 2NV2A 3TAKA 1V7YA 4DO5A 1X6UA 2DJXA 1OFRA 4IMFA 4MLRA 1AMKA 1K8ZA 2YX0A 2NUWA 3ABRA 3HGJA 3MP4A 3TK7A 2H3DA 2H6RA 2CWNA 3FA5A 2WV8A 3P62A 1KW1A 4ADSA 3B0UX 4RKAA 2KZHA 3W70A 2WPBA 3NQVA 3L0GA 3G8RA 1WA3A 2E6YA 3G0XA 4MFDA 1J2WA 3VNDA 3EB2A 3BLIA 2DJLA 3DFSA 1KM2A 3KVLA 1YPIA 4UTLA 1PIIA 1LRNA 4AEOA 3N19B 3QEZA 3QJAA 4OHQA 3NEVA 4E38A 4NX5A 3I65A 1YYAA 2A7NA 3HIJA 3NPVA 3FLUA 5CZ0A 1K3UA 1LCOA 5EY5A 4IPIA 4LRSA 2VEMA 1TQXA 4RLIA 1LBFA 1WX0A 1VYSX 3TXZA 4P61A 1VLWA 4LC8A 1H51A 3W7HA 2JKPA 1IXPA 3G24A 3LI0A 5E1QA 2FDSA 3T7VA 3FS2A 4JXCA 4WZHA 3W07A 2RFGA 1Z41A 3NZ1A 1KFLA 1TPH1 3I68A 3UZJA 4MKNA 3UZ5A 4ZL1A 3LCHA 1C9DA 1YXCA 1L9WA 3G1YA 2C6QA 1TPDA 1MZHA 4UMBA 5K9CA 1TQJA 2GVJA 3KVJA 3MI2A 3LV6A 3P74A 3I7SA 4HNUA 2NX3A 1J4EA 2QCNA 1TIMA 3M5VA 3SGUA 1I2QA 5SWUA 5DCEA 5AYXA 3M41A 3W7OA 3NQ8A 1D3HA 1R30A 1GZGA 3LHYA 5I3KA 3BW3A 3R2GA 4MZ1A 4XBSA 1NAL1 4AH7A 1M7PA 4K6AA 4WJEA 4YWIA 4MY1A 2OCZA 2ZZ7A 3B4UA 4UMCA 2ZBTA 2ZFAA 1FWWA 1QFEA 2F84A 2QDHA 5BMXA 2CLIA 4I7VA 4JTEA 2ISWA 3PUEA 4ZMGA 5G1TA 1WV2A 1OFAA 2FFCA 1S3HA 3SR7A 5FEZA 3V75A 4BR1A 4CQ8A 1A5BA 4POCA 3QM3A 4LT9A 3WK1A 3LHWA 4Y8FA 4NUWA 5LNWA 1DORA 1H7RA 5KSWA 3DI0A 3L2IA 3ZR4A 1DQWA 4UTUA 1O95A 2H8XA 4FO4A 2CZEA 3LCXA 4O52A 1SSDA 3HQ1A 1G69A 5AC8A 3NQEA 4O17A 2R94A 1KBIA 5TQLA 5G5IA 3ANYA 2ZZ6A 3LXAA 3W3OA 3C0JA 3M47A 4MZYA 1GJPA 4BF9A 3TUUA 3CIWA 5KZMA 4HSNA 3RLUA 3E96A 4LUJA 2WNZA 3I7RA 3NQMA 4QM1A 4JICA 5D09A 2V2CA 1H60A 1JUEA 2ZDRA 3HG2A 1DQXA 2CFFA 4JTKA 4O53A 2DZPA 3Q37A 5C5YA 2QCHA 1HFBA 4NJHA 1GYLA 2C1HA 3RFAA 1LRQA 1HG3A 1EWEA 1TO3A 4DBEA 4K7VA 3LHUA 4YMZA 3TH6A 2ABBA 2CLLA 3BK0A 1YTKA 3GNDA 4O1AA 1W5PA 4EOUA 2ZTJA 1TRIA 4Z1CA 3TROA 4N02A 4UXDA 2CW6A 4NZJA 1YDOA 5D37A 2WOQA 1VCVA 1B57A 1F05A 1LORA 2QCDB 3CT7A 1ZAHA 5DCBA 2B0MA 1W1ZA 3U6WA 3G8EA 3JR2A 2NXIA 4XZ9A 3W7MA 3UXDA 3C6CA 3U8GA 2ZZ1A 1OVDA 5KMYA 1W5OA 5DCDA 1EP3A 3LBCA 2DZWA 2I9EA 3B03A 3BO9A 2TRSA 3MP5A 4ADUA 3W1NA 4X3ZA 3QMSA 4ZZ9A 3KVMA 3NQAA 3ZFHA 3I7QA 2C16A 3B04A 2Z0IA 2A6NA 3HG5A 1WBHA 4QSHA 2QCCA 4BI6A 4O19A 5FEXA 1THFD 1L6SA 1VS1A 3N73A 2OT1A 3S1WA 5T26A 4LS1A 5HUPA 3CPRA 3FJ6A 5EKYA 8TIMA 2PRHA 3TW6A 2W79A 2J24A 5CKSA 3LOTA 2QEZA 3GDLA 1G4SA 5D2TA 2YYUA 3PVFA 2QDGA 4KWVA 4U4MA 2DP3A 5EYWA 1KTCA 4G1KA 2EKCA 1ZFJA 4OT7A 3RF9A 1F5ZA 3DXIA 3UWYA 1AW1A 3HJZA 4C1LA 1JCMP 3GDMA 3W7EA 2EF9A 1TB3A 4JYFA 4JDYA 5EMUA 3G0UA 1IIGA 3BVJA 5EPDA 4UFHA 2DZTA 4FIRA 3S9YA 1FCQA 1RQHA 2FPYA 4HSOA 1T0OA 3CC1A 3IIZA 1LOLA 3G1DA 2QCLA 4NQ1A 4UFJA 3VE7A 4MZ8A 3NVTA 2NXHA 4O18A 3TCEA 1WBJA 5K9DA 3GYEA 4O4VA 3W23A 4NU7A 4NJIA 1Q6OA 4WX2A 1X7FA 2WNQA 3GR8A 6ALDA 4GNJA 4LNYA 3I6RA 3NQ7A 3N9SA 3STFA 1CX9A 3SZ8A 4E0CA 1GQNA 2GQ8A 3BG5A 4RZ4A 5HMSA 4BK9A 1F7BA 3SGZA 4M6PA 1UUOA 1ZALA 2RDUA 5AFDA 3VKJA 2VOMA 2ZRXA 3R12A 3GLCA 1ICQA 1LBLA 3C2EA 1QAPA 1FWTA 1XBZA 1JQVA 5H91A 4PODA 3RLVA 2CZ5A 3F4WA 3C2RA 3LHZA 4N6EA 1RZMA 3NQ2A 3OBKA 5D05A 3A23A 3M5ZA 4A3UA 4AWUA 5BW6A 3BG9A 4FXSA 1SO4A 1WOAA 5DN1A 2Y62A 2ZZ2A 4AF0B 3AO0A 4RXGA 5HWJA 3FOKA 3B8DA 3INPA 3UPWA 3LLFA 7TIMA 1X1OA 4JR5A 4LW7A 3W7IA 1JUKA 1P4CA 3R13A 3NG3A 3PG8A 2VFDA 2Y85A 3R8RA 3C2FA 2BWGA 1JCYA 1XUUA 4K37A 3VE9A 4WXYA 1QPQA 4GUIA 1ZAIA 1NVMA 3S5NA 3SSJA 3B0VC 2Y88A 2P10A 1HL2A 1B4EA 2YW4A 3PBUA 4JTFA 4DF0A 3ZS4A 3G1FA 1AW5A 4IOTA 1VCGA 3MUXA 4M7SA 4ZVJA 1KV8A 4IQLA 3O15A 1W8SA 4E2DA 3O06A 4CQAA 2IQTA 1FY6A 1OHLA 5F1UA 2PRLA 3NQDA 4YCPA 4IMCA 3TR2A 3LCIA 4N4QA 1W31A 4DPPA 3W1PA 3PUDA 3MMTA 3LGEA 3W7GA 1H5YA 1O94A 3A5FA 1TPEA 4BI5A 3KXQA 4JTGA 3C3NA 3W2MA 1AG1O 1VQTA 3L68A 3K30A 1FX6A 1KA9F 3O16A 1A5SA 5BOOA 2Y7DA 4CCEA 3LI1A 2Y7GA 3DGRA 2DZUA 3CWOX 2JGQA 2QCDA 4TR9A 1FDZA 2QJHA 3NO5A 2E6AA 5AHEA 4MFEA 3PSWA 3PULA 5L6UA 2LLEA 3LCGA 5IBXC 4JY9A 4FNTA 5LHEA 1SW3A 3IEBA 3DFOA 1EIXA 4PA8A 4IXHA 2Q8ZA 1MEIA 1XC4A 3LTSA 1M6JA 4NXSA 5HR7A 4W9TA 2V30A 5FF7A 4YL2A 4ORMA 3SY5A 1YTEA 1TRDA 2QF7A 5LNSA 5FF3A 1K8YA 2Q3OA 2NWSA 3FKKA 4JTSA 3IV3A 3QQ1A 3THQA 1Q6QA 4O16A 1TV8A 1H7XA 1KTBA 1P0KA 3LHVA 2H90A 1BEUA 2FLIA 2PC4A 2FTPA 1VYRA 3P81A 4IMEA 4RV8A 2ZQ0A 5KITA 3TJLA 2ZZ4A 1RV8A 1JCXA 4GUHA 1TTPA 1S5TA 5HULA 3DBPA 3P5YA 2V5BA 2QCFA 1SFLA 3NOEA 1FXPA 3G1AA 1R2RA 3OEXA 2V8ZA 4K39A 1QR7A 1PS9A 4H3DA 4IPJA 2ZZ5A 3A5VA 3M43A 1O5XA 5LHFA 1ME8A 4Y9AA 3AJXA 2A7PA 4R34A 1KLYA 3YPIA 3WJSA 1XBXA 3GK0A 2BXVA 4DPQA 3TAOA 4CLMA 1IGSA 2ZA2A 1ZJIA 2JKAA 2QKFA 4JNMA 3QYQA 5KTLA 4JGDA 3P61A 1PVNA 3H54A 2Q3RA 4R7JA 1LBMA 4AHPA 4LTSA 4O57A 5LNRA 2EAWA 4A2SA 1VGAA 4UTMA 5E93A 4UFKA 2GQAA 4IUOA 2OJPA 1W0MA 3T44A 2ZRVA 1LZOA 3W1AA 3OVQA 4JYEA 2DU2A 4IWWA 2BX7A 2E09A 3HO8A 3O8AA 4O0KA 5DY2A 3THAA 5I3FA 1WOBA 1XM3A 3QFEA 3BW4A 4LVBA 1JUBA 2YGYA 5D32A 3CIXA 1KLZA 2A1YA 2CLFA 2QJGA 1T96A 1UCWA 2NWRA 1GTHA 3OA3A 5AN7A 4GXMA 1XI3A 3PUOA 3GKFA 1LP6A 3NZRA 3EWYA 4JIPA 5FESA 1P0NA 3N2XA 3QZEA 2WJZA 1GWJA 3DZ1A 3LCFA 1NEYA 4QAIA 3P80A 3IIXA 4GUJA 4JN6A 3DU0A 3HPXA 3EWBX 3NGJA 1GYNA 4NNBA 4JX6A 1TJPA 2P0OA 4YLWA 1XBVA 3F1QA 3W1LA 1OFDA 4MUZA 3QH2A 1KM6A 3TQKA 3NL5A 1MXSA 5A5WA 1X1ZA 3MBFA 3WK0A 1IXQA 4BWLA 4LVAA 1MEWA 2Z2UA 3G3MA 3IRDA 5CPMA 2QJIA 4TX9A 1M5WA 4N2YA 4O4WA 1H1YA 3NQ6A 1ZHAA 3PR2A 3S5OA 2GVLA 1V5XA 4FEZA 3FFSA 4LVGA 2A6LA 3GR7A 1FUYA 1G4PA 3UD6A 3QSRA 4FXRA 5D30A 3HGRA 4K7YA 4LC6A 1UASA 4PCFA 4OE7A 5AHNA 5D38A 1QPNA 1WDWA 1RQEA 2OX1A 3W1MA 4Y90A 1KM0A 1DJNA 4DO4A 3M9YA 4QJ1A 4ZQRA 4JTLA 3W87A 1DV7A 2ZRYA 2Z1BA 3GIYA 1LROA 4K38A 3TA6A 3C2VA 5HNRA 3M16A 5F2GA 3NNTA 3HGOA 1FCUA 5F2IA 4FNUA 3S1VA 1Z44A 1OK6A 4NZFA 2FB2A 3B0PA 1F2JA 1KV5A 3NA8A 1Z48A 3LRKA 4AXKA 2NUXA 3MO7A 2ATMA 3TX9A 1ONRA 3BG3A 2O7SA 4AWTA 3USBA 1EX5A 4K8HA 4EWND 1DVJA 3RU6A 4TU1A 2RKXA 1SZGA 4IMDA 1UB3A 3LTYA 3EX1A 1LOQA 1WQ5A 4MPQA
chains in the Genus database with same CATH superfamily
4YXGA 1T8XA 4BI7A 1B4KA 5ABTA 1JJKA 1V08A 1W1YA 1Q6FA 2VZUA 1TMQA 3FSTA 3WJYA 5AZ1A 4G5DA 3SFWA 3EMQA 3GTFA 5ECVA 1CXEA 4PB4A 1NDVA 2Z26A 3LCWA 2J9ZA 2WVVA 3TOPA 4AHOA 8CGTA 4NJGA 3ABXA 2P5NA 4GOAA 1R46A 5C55A 2G50A 1EEXA 2VP8A 1B9ZA 1EHAA 4GH3A 2CBUA 3PWAA 4XB3A 1TTJA 3TNBA 1UBPC 2YXGA 4RNFA 2O9TA 3AROA 4L9XA 5FF4A 3RRAA 3KCLA 3TFXA 1UKOA 1EJVC 1IT8A 1XUZA 3CPGA 1IIHA 3G1VA 4J5NA 4LY4A 4KPLA 2X30A 3TYCA 3LLDA 3IIVA 3AIBA 1WZAA 4JTAA 1E1EA 3EX3A 3NUKA 1UYQA 4Z0JA 1SO5A 3POCA 3UWWA 1CIUA 1UH2A 1J5TA 3W7DA 4XZLX 1XINA 2YCKX 3L7RA 2RHGA 4ZSTA 4O1BA 3THDA 2NSOA 1CTNA 2MANA 1GK8A 3BZGA 4RK8A 1H09A 4I8DA 3DC0A 3AYTA 2D73A 5CCZA 2TSYA 1CW2A 2PBOA 3QZAA 3BLKA 2PLCA 1PDZA 2B7NA 4H83A 4JDBA 2DT0A 1BXBA 3NWRA 1OZQA 4JTDA 1QPRA 4DWSB 5HQLA 4QLLA 3OIXA 4AZBA 4Z2IA 4GVIA 2WSKA 1EJXC 2ZTKA 3E2RA 3GRIA 3W7PA 2Z1WA 1R6WA 4HN8A 4ZFMA 3IGXA 2HQAA 4L61A 5D2VA 3TWBA 4LX4A 5CZTA 1UUQA 1BSIA 1A0EA 4HN4A 4GFIA 1XLFA 3AIUA 1FP9A 1EF2A 2WHJA 3EDFA 4C6BA 3W2KA 2RDWA 4NAFA 1H50A 3A24A 4PB3A 3PS7A 2XHYA 3UXAA 3LNPA 5GNYA 5C54A 3BLDA 3Q45A 2RJHA 3URBA 3EX6A 1LL4A 4I9JA 5F4SA 1SZFA 2O9PA 4D6GA 5DELA 1E0VA 4OTKA 1OGSA 2O92A 2X0YA 3STCA 2PLMA 1P6CA 3GKAA 3ZIZA 1IXOA 3MHFA 1YE6A 1PCKA 1H7PA 1TE6A 4QNWA 1G94A 4Q8OA 2NQHA 2KX9A 3VNMA 2YSWA 2ZUVA 1H63A 5FCZA 4US5A 5CSUA 2FVKA 1NFBA 4G7EB 2PB1A 3LS9A 3GW0A 1J12A 1WDQA 1JL8A 4HKPA 1OY0A 1N7KA 3TTEA 3GXPA 4LBRA 2V67A 1RALA 4LV9A 1DOSA 3B8IA 1H61A 4DELA 1HO4A 4FX7A 2I56A 3CUJA 4ZQCA 3LV5A 4ZOAA 1EOKA 3K2GA 4XKYB 1C8VA 4QS6A 4LF2A 4QROA 4JIHA 3PPFA 2GZXA 2J62A 1S2TA 5IFTA 1AODA 1OFPA 3M0XA 2W9MA 4LUSB 4NL1A 3D0CA 2VCAA 2VWSA 3H4XA 2IPJA 3FGCA 3K5XA 3LPFA 3P0XA 2HV5A 1E6NA 2VQTA 2V3EA 2VZVA 1G7VA 5HQMA 5C9XA 3D3AA 2V82A 4PTNA 3B3DA 4R53A 1Z42A 1RY0A 2B81A 2CLKA 1XYZA 1XDLA 4S3JA 1E9ZB 2GJRA 4DZHA 4Y96A 3W1QA 4EPBC 1QPKA 3U9IA 2UWFA 2WJEA 1OC7A 3NGFA 3GO2A 4LS2A 4GYFA 1S2VA 2INFA 3N2OA 5A6BD 2BY0A 3HV9A 1DXEA 3CHCA 2DUXA 1TPFA 3UU0A 3APYA 2QJNA 1AL7A 1MW3A 4L5ZA 3OB8A 1V3HA 2A79A 1VJSA 1M7JA 3RPTA 4IG2B 1UC4A 1FWRA 2GOKA 2BFGA 4PH6A 1SZRA 4GX9A 4ATWA 4A6GA 3PBYA 5AHIA 5HA7A 5LGXA 1JPDX 1EXBA 3EXSA 4H00A 4KCUA 1H11A 5KZDA 2X2YA 1WKYA 4N6FA 4F2BA 1FA2A 3W4RA 3AYSA 4H8HA 5AC7A 3ZLHA 2DQXA 3QN3A 2OLSA 3TSBA 2PURA 1JPKA 2PODA 4WOZA 3WBWA 1OD0A 2UY4A 4WXZA 2WSQA 1TFVA 3WH6A 1M65A 5HWMA 1G7UA 3HB9A 2IKGA 3PZTA 3UWZA 2HZGA 2PCQA 2FZ8A 1TE1A 3W82A 2ESCA 3ZJ6A 3TSDA 2DGAA 2ZA3A 3WDQA 3IS4A 3NM1A 2HPMA 2G97A 3ZLGA 4L6OA 1EUNA 1O66A 4R3UA 1ML1A 3W72A 1RUSA 2DT2A 3N13A 3NQCA 2PTDA 1QNOA 5I7GA 4DXXA 3TTOA 4XSMA 4WGXA 1OEPA 1FWDC 3FA4A 3N6HA 4PFMA 4E4PA 3L21A 2I5IA 2Y0FA 1RCQA 1R87A 3OODA 3PBVA 1NELA 2YB4A 2WKLA 1NTHA 4NJKA 1PV8A 1R8LA 2QYGA 4YTUA 2AQWA 4A29A 7PTDA 3DI1A 1UR4A 1SR0A 2VGIA 3MJMA 1R47A 3KRUA 2WMIA 1A50A 4RJEA 3SW6A 3P82A 1RP8A 1JD7A 2AKMA 4W86A 1M9HA 2JBMA 4PUMA 2TPSA 3ARXA 7XIMA 1XDJA 3ZVIA 4DEFA 1SR9A 3EPNA 2PDJA 3IANA 4GIRA 4LAUA 1N55A 1H41A 4Z08A 3MHUA 3DFNA 2PD5A 9RUBA 1Q6GA 2XVLA 3HFTA 5GNZA 4HPXA 5E70A 3MUAA 3WH7A 4KWSA 2EJ1A 1K02A 3KRZA 4AZIA 4HCDA 2E5BA 4F9DA 1PWMA 2EPMX 2BY2A 3AIEA 3H26A 1KFBA 3MDUA 5AYIA 1A3XA 4HOWA 2XINA 1SJDA 2YFOA 2C14A 1TPB1 2H3BA 5CZJA 1VIWA 1LDCA 3LNMA 1U5JA 1W3HA 3EGJA 4UMAA 1U1UA 4HMEA 1SJAA 3MWAA 1JDFA 1TPUA 4CD8A 3GE7A 1OG0A 4Q4QA 4O28A 4IISA 4OFCA 2FZNA 4UTTA 4Q6JA 3QKEA 1KXHA 3OYXA 2I1OA 2RDXA 4JY8A 2JGYA 4GRSA 4U3AA 1TCDA 3RUBL 4NI3A 1UMLA 6XIMA 4XD3A 1FWJC 3ABOA 2C7FA 1XCWA 3ZXWA 4ZQMA 4GJIA 3W7QA 1TV2A 4ROPA 5F2LA 2ZRUA 3MI3A 1W1IE 4OBTA 4PMOA 3OBAA 3QW4B 4PEKA 1REQA 1WXZA 4Z0SA 4GJ1A 4ICCX 1EB3A 1HKMA 5AHFA 1E0XA 4A22A 1KGWA 3S6TA 4TX6A 3QYSA 2W92A 3MYOA 1GQKA 1AVAA 4QS5A 1E4LA 3ES7A 1A3HA 3S8HA 5B80A 4IX0A 4TXEA 1KGXA 2PF8A 3CTTA 3FYPA 4S2BA 1YX1A 4HNVA 4DI9A 1DKWA 4G6CA 4MWAD 4GK8A 3W83A 1HJSA 3EX2A 4I5UA 3KAOA 3TN4A 3KRSA 1XSIA 4LUIA 2F38A 3TC6A 3K4AA 3IRSA 3G1XA 4EPDC 2DUAA 2I16A 1Y7VA 3TYBA 1X6LA 3V18A 3N2BA 3LYEA 2XFFA 2WVSA 2JEQA 1LYXA 3WJXA 4EAYA 1OJXA 4MLJA 3UA3A 1QW7A 1NSJA 4Z1BA 2GJLA 1DIDA 3FHAA 3W37A 3L5AA 1IXNA 3IWPA 2D0FA 1H0IA 1BKHA 1W3KA 2XIBA 3CYJA 4QHRA 4X61A 2OSXA 4KCTA 1R9ZA 3SCVA 4D8AA 4YJ5A 4IICA 5M03A 4KW2A 2B4GA 2ZADA 5FACA 2CNCA 5CPLA 3W88A 5I78A 3B05A 1NDYA 2J7HA 1TJ2A 3ZQ9A 4IP7A 3NPUA 4JZ5A 3HQNA 3T07A 2Y4SA 3ZM8A 5FEPA 1G6CA 1EXPA 2ZWZA 3ZZ1A 3VC5A 3E02A 3A3HA 4BQ3A 2WXDM 3H53A 3M44A 2PDXA 3N25A 3WMCA 3BANA 4JQAA 1CDGA 1UKPA 3HFYA 4GE8A 3UCCA 4HOZA 1ECEA 1Z7AA 5CGQA 1W56A 3IJQA 1JFHA 1JPIA 3CTLA 1PKYA 4GD0A 3SBFA 2C13A 4MWAC 2A7RA 1E55A 1BVZA 4U5KA 4CVUA 3SCTA 3L5LA 5D8WA 4WJ8A 4KKXA 2IW0A 3L65A 4FHAA 2OLHA 3F2CA 2QPUA 1WDPA 4FLOA 1XICA 2G96A 3MHGA 5IXEA 5A95A 4AVFA 1L2UA 5GJNA 3VGFA 1TYGA 2PGEA 4LY8A 3TP4A 3VOCA 1BWLA 2YB1A 1FCBA 5D4YA 1S5VA 2FB3A 5DT5A 2YCLB 5HJYA 3EWWA 3P60A 2BLEA 1C3FA 3MCMA 4RZ6A 1KFKA 2Z24A 3VU2A 1RD5A 4X2RA 1VJIA 4RR4A 2X05A 2HSAA 4MDPA 3OW1A 2IKIA 3IVSA 4M7TA 2Z6JA 1XSKA 3VZYA 5F4XA 2HBVA 3OU8A 4LAZA 1OT1A 4US5D 1X38A 3LM3A 1J0JA 5RUBA 4XVDA 3S2CA 1MEHA 3TW9A 4TO8A 1HO1A 2DSWA 1D3CA 1HF6A 3GY1A 1DJZA 3Q58A 3VDGA 1TVLA 2IUZA 3LUTA 4L6HA 3WELA 4OUEA 4IHCA 5CSSA 3AYVA 2PA6A 1UBSA 3MMWA 1A53A 2ABAA 1I0BA 4Z42C 4V15A 4I5RA 1B9BA 2QHAA 3MW7A 1CENA 1EBHA 2BOFX 2EPHA 3PZIA 2YOCA 2P1FA 1HL9A 1CBGA 2YL9A 1XD0A 3QGKC 4K8EA 1G67A 4N4PA 3LU2A 4QRNA 1DEDA 5EMYA 2QIIA 3CHVA 1Q3NA 1P1XA 1PKMA 1BWKA 1Q6LA 4PL2A 1UROA 3VK5A 3GHSA 9CGTA 1QU4A 3W1UA 2BGSA 1PO9A 5EGRA 5CQ1A 1E72M 4KCVA 1SU5A 2J9XA 3PZQA 3ATZA 4YTSA 1VBHA 3URQA 1DWGM 2CLHA 5A8GA 1JZ5A 2WLZA 3CQHA 2FTWA 4MWAB 1EA9C 3PG9A 4ADTA 1EUAA 4PSPA 3PAOA 4CNPA 2PD9A 1SZEA 2Z27A 2SFPA 3LY0A 4PCNA 2WB5A 1LL7A 4RCXA 2XH4A 2WVVB 5HR6A 3QMRA 4BF5A 4FB7A 4XV0A 1OBAA 2ALDA 5CH9A 4UFLA 5D9OA 2PDWA 3GFYA 4XUYA 3WCZA 3PM6A 1E0WA 2CLPA 1EQPA 4F2TA 3C0LA 3XIMA 2GLKA 3LDVA 4UWMA 5EA9A 4IXXA 2CIPA 4XQ6A 4JIEA 4RPPA 4RNIA 3UXKA 1R0MA 4HU4A 2WWCA 4PEEA 3S9IA 3PAJA 1V3MA 2ODOA 3HPZA 2WZMA 3K8KA 1X6UA 2DJXA 4YS1A 4H9YA 1OFRA 4HSHA 4IMFA 2J13A 1AMKA 3IUHA 2NUWA 3HGJA 5LXXA 2QV4A 4U33A 3B0UX 4RKAA 3W70A 2WPBA 3SUUA 1C8XA 3NQVA 4K68A 4D9PA 3G8RA 3UJSA 1P7TA 4F66A 3DX5A 1DXIA 4MFDA 3VNDA 3T2QA 3BLIA 3EBVA 1LRNA 3N19B 1XH1A 3M0YA 1EJWC 2DSZA 1X7IA 4A8LA 1WNOA 1K3UA 3ZT6A 3UW6A 2VEMA 1TQXA 2PC8A 4E2OA 4P61A 1H51A 3GU9A 3AIRA 3WF2A 1IXPA 3F5KA 4US6A 4AZ7A 1PZ1A 1YNPA 3FS2A 4PTMA 3W07A 2RFGA 4LBSA 3NZ1A 1KFLA 3UZJA 4NAFB 4P7LA 3U5YA 4ZL1A 1C9DA 1YXCA 1JAKA 2X40A 1MZHA 4UMBA 2BXZA 4WHBA 1D2KA 3LV6A 3BE7A 3I7SA 2NX3A 2XVGA 1NWTA 1TIMA 3AALA 3M5VA 3WDJA 4Y9NA 4P7RA 5DCEA 2OG9A 4C5ZA 1K9TA 3WEOA 1UG6A 3NQ8A 4MNMA 1TZZA 2ZE0A 3WEMA 3KBJA 1Q7ZA 4DBSA 2OCZA 2ZZ7A 4OBSA 5HJXA 2ZFAA 5A2BA 5BMXA 4QXIA 4I7VA 3PUEA 4B91A 1B3WA 3M0LA 4ZMGA 3CQIA 2P8CA 4DAFA 1S3HA 2F2KA 1VKFA 4C7DA 1W17A 3QM3A 4ZB0A 1PUDA 4DUWA 4MWAE 5C9UA 3LHWA 3CZKA 1IV8A 3FX4A 2VD8A 5LNWA 1DORA 1H7RA 3L2IA 2PS2A 3ZR4A 1DQWA 3B9EA 4S3CA 3LCXA 3HQ1A 1J0KA 1G69A 3QY7A 5AC8A 1E4MM 3WLLA 1KBIA 2NVDA 3U48A 2OOFA 3ANYA 3LPGA 4W5ZA 2QW5A 3SCPA 3AU2A 3SY8A 3AWOA 2BASA 4LUJA 4JICA 4UOQA 5D09A 4ZO7A 3GTIA 3N04A 1JUEA 4S3EA 3FGCB 1S3TC 2ZDRA 4JTRA 2XGZA 4JTKA 2DZPA 4NZ4A 3THCA 2W61A 3ZJ8A 3W0KA 3U0HA 1O7AA 3IGHX 5ABFA 4NKCA 4DBEA 1TO3A 4C6FA 1VFMA 4RE2A 1K8CA 4YMZA 3TH6A 2CLLA 3RYSA 1GPFA 3GW3A 3GNDA 1W5PA 3QBUA 2ZICA 3T0AA 3GIPA 5DX7A 3TROA 4N02A 3QTGA 1P0DA 2CW6A 4NZJA 1YDOA 5A2AA 4LQ1A 1F05A 4KRZA 1LORA 2Z2AA 2V5DA 2B0MA 1W1ZA 4S3GA 1P43A 3L2LA 3EMZA 3UXDA 2PDCA 5KMYA 2AL1A 3B03A 1R3VA 3W1NA 1BVNP 1NJJA 4ZZ9A 4MAZA 3ZFHA 5CC7A 4PUNA 3I7QA 2JEPA 1AFSA 5FEXA 1THFD 2ONEA 3WENA 1VS1A 2OT1A 1O12A 2OODA 5EMMA 5EKYA 3RO8A 1V7AA 1U5VA 3H6OA 3OLGA 3LOTA 4L56A 1DJIA 1W32A 3S3GA 4XAYA 2WC7A 3MKCA 3CAKA 3PVFA 3K46A 1UR2A 3MT1A 2V3GA 4G1KA 1ZFJA 3ALFA 3HQOA 4OT7A 1V6TA 1F5ZA 3PTQA 3UWYA 3DDMA 1E5JA 4R9XA 4B3LA 3HJZA 3PJWA 1JD9A 1JNDA 3VIKA 2BOEX 5CBIA 4JYFA 3WUGA 4DZ5A 3BVJA 1C92A 2DH2A 2PZNA 3T05A 4YVXA 3S9YA 2R6OA 2WHMA 4NQ1A 3S47A 1N82A 4UFJA 4AZCA 3TCEA 2J7CA 2ZUNA 5CEWA 4PRTA 4M8UA 1S5MA 2X1IA 1TKKA 1X7FA 3N11A 3VD4A 4GNJA 1NQKA 3FN9A 1XJBA 1XIIA 3ALGA 4DVOA 3N9SA 4LEFA 4NYYA 4R27A 1OCNA 3BG5A 5HMSA 1ZGDA 1F7BA 3AZSA 1ZALA 2FVLA 1KBKA 2PU0A 3V5FA 1Q8JA 1ZB5A 1ZJBA 3VIGA 4D1IA 4WDXA 2IQ0A 2AMXA 4QE4A 4PODA 3AS3A 2NW0A 4IM4A 3FVMA 4N6EA 1YE4A 2P53A 2R1NA 3MUZ1 4WGHA 2VZSA 1EH9A 3A23A 1FWFC 3BG9A 1UOZA 1MFUA 4FXSA 5DN1A 2Y62A 5I77A 3FOKA 4PN2A 5EB8A 1CGVA 3AHVA 1AJ2A 3LLFA 3PZ9A 7TIMA 1ZCCA 1X1OA 1UR8A 2WYSA 3VZXA 2C0HA 1NWRA 2NT1A 3K4WA 4GCAA 2INZA 2NLYA 5HMEA 1KD0A 3QV9A 1KNWA 1VPQA 2VFDA 3IK4A 3VA8A 2BWGA 1B3VA 5E09A 4GUIA 5HMDA 3WDIA 3GXFA 3VPLA 4CD6A 2P10A 2GGEA 1W9VA 1B4EA 3PBUA 4DF0A 2QIWA 1W9UA 4B92A 1AW5A 2NT0A 6REQB 1MQQA 3MUXA 4F0MA 1CGTA 4IL0A 4JIIX 4M7SA 1KV8A 4IQLA 4BHYA 1ONEA 4CQAA 3V0TA 3E5BA 2PRLA 4B15A 4YCPA 3BAJA 3LCIA 2GGGA 4A35A 4DPPA 1FOBA 1XLDA 3PUDA 3JZUA 3PFRA 3CV1A 3PANA 3OIHA 4JTGA 1FX6A 3SDOA 1A5SA 4CCEA 3PWIA 2Y7GA 3DGRA 2DZUA 4TR9A 1PB0A 4AG0A 3PSWA 2Y5EA 1HJWA 2WZEA 1QHOA 3GHRA 5C7VA 2TAAA 3IEBA 3AS1A 1RPKA 4FF5A 3S2JA 4YTTA 3ISIX 3QVQA 4JFVA 2D24A 3LTSA 4W9TA 1Z32X 1J6PA 1BQCA 5I09A 1TRDA 5LNSA 5FF3A 3FKKA 2NWSA 3DUGA 1VFFA 4JTSA 2Z7KA 4H9MA 1H7XA 1FWHC 3CYVA 3ZMRA 1ENUA 3ERPA 1BEUA 1UH3A 4IIHA 5KITA 3TJLA 2ZZ4A 4UQDA 2XIMA 3ECQA 5HULA 1UD8A 2V5BA 3QLLA 3TEVA 3AUJA 4GQRA 3NOEA 2Z2BA 4DLMA 3OLDA 1S39A 1R2RA 2V5JA 1QR7A 2PGWA 3M43A 4IGSA 2J75A 2WMGA 2HVMA 3QPEA 3ARYA 4ES4A 1IEQA 4PMDA 1OC6A 3GK0A 3H8AA 4JGDA 2CPUA 1PVNA 5M1TA 4LTSA 4O57A 1VGAA 4ML4A 4UTMA 3UG3A 4UFKA 1XYFA 2D22A 3T44A 1J79A 1LZOA 3OVQA 4YVVA 3O8AA 1WOBA 3SCWA 5PTDA 4LVBA 2WMHA 5GPRA 2WQDA 1KLZA 1BRLB 2A1YA 2CLFA 3VMNA 4F2UA 4RE3A 5AN7A 3CASA 3TLLA 4BQ4A 1XLLA 3CZLA 5FESA 3STPA 3QZEA 3DZ1A 3LCFA 3ITYA 4XD5A 3P80A 4GUJA 3HPXA 2GJXB 3EWBX 3NGJA 2WC3A 4DNHA 1Q66A 1C8QA 4HMCA 4RDZA 4J27A 4X9YA 1L8NA 4UCFA 1OFDA 3QH2A 3L4UA 3KL3A 4ZO9A 4LVAA 3G3MA 3H2FA 5CPMA 4HYVA 4IGNA 4TX9A 5B7ZA 1RP9A 3DFHA 1M5WA 3BXWA 2C79A 3CZJA 3NQ6A 1CZ1A 1V0LA 1ZHAA 3ZYZA 5EFDA 1IT0A 2GVLA 3VGBA 2RUSA 3R58A 3ARTA 3SIMA 5BXRA 4HHMA 1QI0A 3GR7A 1M7XA 3DIPA 1JZ2A 5JU6A 4R5EA 3UD6A 2EPLX 4K7YA 4PCFA 3Q67A 2OGYA 1RD6A 3HA1A 1QPNA 2OX1A 3GH4A 2XH0A 3E2VA 2VC5A 4PMNA 3LZ3A 3W87A 1BPLB 4PR4A 2BHYA 2ZUMA 1P6WA 3C2VA 2E28A 3M16A 4Q8TA 6A3HA 3VIPA 3HM7A 4Q8QA 2D2GA 2E7FA 3LRKA 3MO7A 4W85A 1C7SA 3BG3A 1F3XA 2O7SA 4QEEA 4DIAA 5G1MA 1SM9A 1EX5A 1A0CA 3RU6A 3SCQA 3BGAA 3TYUA 1WDDA 4IMDA 3P2VA 2ZX9A 1UH4A 2OKOA 1A5LC 3GC5A 2OQYA 4JHMA 4L4LA 3WQ4A 3LSBA 2ACQA 2GJNA 1TREA 3TSMA 4IQDA 3I6EA 3UBPC 3E2SA 3IACA 4WEVX 2OWXA 4LANA 5AZ0A 4EIVA 2J6XA 5CGMA 1QW9A 1KM5A 3GG7A 3HU7A 5K4XA 2B7PA 4L4OA 4UR7A 4PMYA 2W5FA 4S3FA 2GVGA 4DLFA 1WKDA 1SO3A 3C4UA 5BWFA 4B9YA 5G4EA 3C61A 4R9OA 4LUYA 5JBDA 1CXHA 4HHHA 2OO6A 4AMAA 3WL1A 1U83A 1ADOA 4GIYA 1QK0A 3VOFA 2VRJA 1JCJA 1W3JA 1F73A 2YDAA 2OO0A 5CPQA 3LRLA 4AW7A 3L9CA 2BBFA 2F6XA 2F6KA 4PMVA 3OTRA 4F0HA 4LVDA 4AY8A 2V68A 4J9JA 3N4AA 2AGTA 3WK2A 2NX9A 1L6YA 4XD4A 4Y2WA 2BSLA 4W5UA 4IFKA 2XUCA 3G6LA 2VEKA 1YMYA 4AB4A 3GX9A 1O5KA 1YBQA 1N8IA 1UA7A 4RW5A 1Z9AA 3ARPA 1Z89A 4O1CA 5BOEA 3W76A 3HN3A 1TPWA 5HXMA 4RZ5A 1GVFA 4B2DA 3HZ3A 4HMNA 2R91A 1TVNA 3UZWA 3SN1A 1XQLA 1IYXA 3KFTA 2B7QA 1LF1A 4QQUA 4HPHA 2DIJA 4RW3A 1TR9A 3BTNA 1OGBA 3T4CA 3GXDA 3P8JA 1Q7QA 2IKHA 1RLDA 1JYXA 4J1OA 3QR1A 2E5DA 4H9UA 2FGLA 2YBUA 5FF2A 3NL2A 3BUVA 2D0GA 3EWDA 3RCNA 1EJUC 1GOWA 1JGMA 1MW1A 3LBOA 4KWOA 5DMLA 2AQVA 5I79A 1HKJA 2GOUA 5LIKX 3STEA 3WDPP 3EWXA 4UFIA 5LNUA 2E8ZA 4AY7A 3GAKA 1PCWA 2XGIA 4M3PA 5AYYA 1U33A 1Q6DA 1V0MA 1QPOA 1TUFA 2YZRA 3VUSA 2VM8A 4LSBA 3CEUA 4QGCA 3CMGA 1VBUA 3A9IA 2NVCA 1P7TB 2VEPA 3SEPA 3ZSTA 4OV9A 3LZ5A 4DJED 2VHLA 2V2HA 2UV8G 4JFUA 5TAOA 2Z4GA 3L4XA 3WG6A 3ZOAA 3B8SA 4WSKA 4XSLA 4O0QA 4KEVA 3PY2A 4DBUA 1JYWA 2PWHA 4UTKA 1VEPA 3EKLA 1KWGA 1DBTA 4ZEPA 3G3DA 4JL1A 1J5SA 1EP1A 1DIEA 4J40A 1HXJA 2HVNA 4QQ3A 2HBXA 4O10A 4X9SA 3G1SA 4AZ6A 3P84A 2PDUA 3AHZA 1ME9A 3WLIA 3S2LA 1ONWA 3N1AA 3VNLA 2XH2A 3GTHA 4CNNA 1H5VA 2WKGA 3KM8A 5JXQA 1RR2A 2POTA 2E8YA 4U2YA 4B5WA 3ZR6A 2CZDA 4Z1DA 5TF0A 4KEUA 1J96A 5HANA 5XINA 1OFBA 4GIEA 2J7GA 3IGSA 4HNNA 1PX3A 3V7PA 3PJTA 2WNWA 2XJ7A 3SRKA 3WYZA 3O6DA 3M1ZA 2C71A 4GZIA 1TJ0A 2XGBA 3E0IA 3VKBA 5ABEA 3IV8A 5DFAA 1EPVA 2R14A 1W37A 1YTDA 1JCLA 3ZWTA 5DANA 3NFUA 4LRTA 4MHBA 3ATYA 3AQUA 4C6DA 4KIEA 2E1WA 4QDWA 1QHZA 1K4HA 3L0NA 4IGMA 3ABSA 1MSSA 3CHDA 4ORIA 1R7OA 4FLRA 1PIGA 2DVUA 5GVJA 4MY8A 4MOZA 2Y7EA 1PZ3A 1XS2A 1XFBA 2MUCA 3BOLA 1M7OA 1E6RA 4GYKA 2PZ0A 1N8WA 3RO6A 4RDVA 5BOFA 2QUVA 4G56A 2VURA 3OQEA 3VNKA 5LNVA 4DJEC 3QW3A 1HZYA 1A5UA 5I3IA 1T5AA 1HL8A 5I3GA 4GMEA 3UQNA 2E6DA 4B3KA 4GZJA 3STGA 1R7AA 5DMNA 3NAVA 4KQNA 4Q4OA 3UXLA 1DHPA 2VDHA 4IIDA 5CBBA 3T78A 5I02A 1WXJA 2VZOA 3H2EA 4H8NA 1H7WA 2WBGA 1M68A 4Z1YA 1BLIA 5AECA 1QI4A 4ZOCA 5ABFB 3T2OA 1TVPA 2A5HA 2VWTA 1UW9A 1RY8A 4ICNA 4JX5A 1CB7B 1I9CB 3QHOA 1SPQA 1PE1A 2Z7GA 2JIWA 2PDNA 1ISXA 3QC3A 4DF1A 4QAWA 1BYCA 1FXQA 2PDQA 1XX1A 3OVPA 4YNGA 3SN4A 4O13A 1EO5A 2WKJA 4WY0F 1KFJA 4BY3A 5CC3A 1RHCA 3CU2A 4M19A 5DY3A 3VNIA 1ZUAX 3OPSA 1XXXA 3MVIA 3N2CA 1XKJA 3BDKA 1QO2A 3BGGA 4KFOA 2VYOA 1FHDA 2BZNA 2ZVIA 3NYDA 4NRSA 3E0WA 3VMOA 2XM2A 3NQFA 2YDQA 1H1NA 1C91A 2HE8A 3KBVA 3K8LA 1PWLA 3W7JA 5BXPA 1SUXA 1BD0A 5EMKA 1WZMA 1XIFA 2VR4A 2XVNA 3E2QA 4YIWA 3URNA 1ALDA 2GUUA 2X1RA 2BGQA 2XN2A 3ZLFA 4AF0A 4A05A 1KXQA 1T8QA 4Q33A 3VGHA 1KM4A 2A3HA 3TW7A 2JE8A 3BURA 4CEUC 1HKKA 5G1YA 1VF8A 2DZXA 1C29A 1VZWA 3KOFA 1H7NA 3B9DA 3M6YA 3FXYA 4GXPA 5LKYA 1H3GA 4AZCB 3VAVA 4UNLA 1RJRA 1X8FA 4XKYA 1TV3A 1QJWA 1W1A1 2D2JA 4ZQNA 3F4DA 4UTIA 2X7VA 4FI4A 1UQYA 2AL2A 3A22A 4UTWC 3C0SA 1JXKA 5DXXA 1ICPA 3K1DA 2PDFA 3R43A 3V1PA 3W1RA 3TQVA 3TJXA 3TE9A 2PU1A 2PMQA 1H62A 2DW7A 4OGZA 4DQWA 2Y61A 4JKKA 4BF7A 2FZBA 4GC3A 4TV5A 3LBMA 1JZ7A 3B06A 4GNVA 4FNSA 2VEGA 2VJXA 3LXBA 3AXHA 4W7WA 5HPOA 1FHUA 5D9MA 2RH9A 3BJFA 1O60A 3CMJA 2KAUC 1B30A 3VINA 4L4PA 1GG1A 2PDYA 1KCZA 1V3KA 2PDIA 4KS0A 5XIMA 4DF2A 1S38A 3NPWA 1Y0EA 1YPXA 1XH0A 3AZTA 1OYCA 4M24A 3W2NA 2QMJA 3CH0A 1VEMA 1D7FA 1GEHA 1K8XA 1T7LA 5AYBA 1WUEA 3UYCA 3PBMA 1OF6A 5EMLA 3B0XA 2J7FA 4BZYA 4F0KA 3GVWA 5CPTA 4GZEA 3HMJG 2IXUA 5I2UA 3VD3A 1EGMA 1RPXA 2J9YA 2P76A 3OYZA 3FYOA 1K9DA 3C8FA 3RDKA 4UQ9A 3COTA 3KEHA 4KFPA 4UOJA 3S5YA 1ADDA 1K4GA 1H7OA 3ELFA 3ZJ7A 3T40A 1NU5A 3WL0A 4DHGA 2JKEA 2A4AA 1JI2A 1DIOA 3AZRA 3KS6A 4I8YA 3HG4A 4Q8WA 2A2IA 5FL1A 3EXTA 2NQ5A 2VMFA 5DBUA 1JYNA 3CAVA 3WLOA 3AHXA 4JTIA 4EVZA 3O05A 3E0LA 4E3TA 3PF3A 3UPBA 1G1YA 3KE0A 5K9XA 4RXFA 4WKFA 4OIFA 4IGHA 2WHLA 3A64A 1Q2RA 1ITXA 1SGJA 5I3HA 3S42A 3S2NA 5A1AA 3ITCA 1K6WA 3ZVHA 2ACUA 3WQEA 3WY1A 5I3DA 1NF0A 1EDGA 1MUMA 5A6LA 4C6KA 3O7UA 4B5NA 3N29A 5MF5A 3RK8A 5K4ZA 1I0DA 1GQIA 3DGBA 3QSTA 1UIOA 4I6VA 1KRMA 4IP5A 3OG3A 3SUSA 4H7VA 2H8ZA 4A2RA 1HTIA 4Z2LA 2PE4A 4LPCA 1YLVA 1QK2A 3W00A 2UY3A 2V81A 4P2VA 4UUIA 3GG8A 4DO6A 3FK4A 2GGJA 2EKGA 5FJTA 2Z6IA 3D3FA 4GGBA 1OFOA 5T8GA 1GHSA 4MVAA 4WD0A 4DBDA 1UZDA 4JD4A 4ZO6A 4GY0A 3VOGA 2I5QA 4QTGA 1GJUA 3HGSA 5GQBA 1FVPA 3OGVA 1CLXA 3VKAA 1HJUA 3S6DA 2ZE3A 5A6AA 3RR1A 2FH8A 1LOSA 1XBYA 1XRFA 4R33A 2R1KA 2ZC1A 1OQFA 1MMFA 1JDAA 1SW7A 5HPCA 1X98A 4BS0A 3T2PA 3D5HA 4AU0A 5KZ6A 3NM3A 3IJIA 3WFLA 4O54A 2Z29A 3K8MA 4B2DD 3C52A 1I2OA 2DZAA 1XG4A 1L6FA 3VDCA 3GBDA 5E9XA 5LSMA 2PRMA 3R0KA 4QISA 2VQUA 1W91A 2D23A 2OT0A 3BOXA 3AS0A 1NOUA 3GC2A 2O56A 2ZZ3A 4UC5A 1XIHA 4UR8A 1R5YA 3TNOA 5BU6A 5HQEA 1E51A 1H2JA 2WZIA 4Z2HA 2QVNA 2XZ7A 2E3ZA 3EOLA 3CGTA 5TIMA 3A9BA 5DBTA 3UYIA 4HIBA 3GDRA 1D8CA 4HZ8A 2F8QA 3K13A 4FNQA 2WCGA 4M1RA 2X1TA 2DPEA 4IF2A 2VGFA 1R3WA 4RUBA 3CV6A 4FLQA 3S5ZA 5A6BA 1US0A 2DZBA 1GVQA 4F40A 4CKQA 4NHVA 4WDWA 3T0CA 1EPXA 3MYPA 1TSIA 5BRPA 3GG1A 5D2YA 4WJXA 3MPGA 3BWWA 1Y5WA 4L4MA 2O9OA 4ML9A 4XD6A 1K9FA 4NJJA 1VB9A 4B5XA 1E56A 3QRHA 4I7WA 4LU0A 4Q8UA 4L1WA 4H4IA 3CS2A 3MV01 4OV4A 4CNTA 4Q32A 9XIMA 3KL5A 3PK7A 5DRIA 1B0IA 4MG4A 4KMQA 3EA3A 1OX6A 1JRBA 1VFSA 2O4MA 5I06A 3DFTA 4CQDA 1JYVA 2A21A 3LEPA 4E4FA 1PAMA 4ZFCA 4GHRA 3GB6A 4PTWA 4Q4KA 4FS9A 2VEIA 4TVUA 4V1YA 4C6OA 2OELA 3LPPA 1QNVA 2ICSA 2O7QA 4W93A 1K7FA 1V79A 3IUDA 2OX4A 3VCRA 2G3IA 1FCVA 5LA0A 1E3ZA 1SW0A 1BQGA 3MMDA 3DENA 3VCCA 4KH2A 3T0DA 2QCMA 3GFXA 2X42A 2ZXAA 1TX0A 3ITOA 1OGGA 3E9AA 3LHTA 1NP0A 4DO7A 4ALDA 2ZIDA 1OYAA 3QV8A 3ZT7A 3S5SA 4TVDA 3VKCA 1HQTA 3NURA 4NVTA 1UR3M 1GVEA 1E6PA 3EPMA 3ITXA 3GXIA 3SFKA 1BWVA 4M6QA 2HNHA 1TV7A 3FXGA 2VI0A 1KR1A 3I6TA 5D33A 1OX4A 4LALA 1Q4WA 3V1HA 3O63A 3VX0A 1F61A 4XBJA 2WM0A 3AMCA 3DYPA 3LXCA 5A8NA 1S2AA 2EXOA 2UY2A 1JDDA 4DM2A 4H8VA 5A3HA 4ZB2A 4Y8EA 1RJPA 1AW2A 2BY1A 5CC5A 4FALA 5G4WA 3GZ3A 3E49A 1IF2A 2FDMA 2CZFA 3VC6A 3KP0A 3U3HA 1IR1A 5HINA 1TELA 2VX7A 5BU9A 4AWEA 1ZAJA 2QLYA 1YKWA 1Q2SA 3TAKA 4L64A 3VGEA 2W3ZA 4ZOEA 3GDBA 3N6JA 1K8ZA 2NV9A 2YX0A 3PZGA 4GISA 3FA5A 4IFKB 3EA1A 4V1XA 1FTXA 2KZHA 2I57A 3DG7A 1E73M 4Q4MA 5TD4A 5BYWA 1YBQB 1UD5A 4J2PA 2OB3A 2DW6A 1IHIA 3AXXA 4FR6A 2W63A 4G1NA 5FKYA 4HA4A 3MWCA 4D8ZA 2FTYA 4BKNA 1V6YA 2FZ9A 1C7TA 1YYAA 1UWUA 2A7NA 4DUOA 1CNVA 3OP2A 4S3KA 4RLIA 1WX0A 1VLWA 2JKPA 3SO7A 3LI0A 2YCLA 3T7VA 3RM4A 2E0PA 4HNCA 1XLMA 1HNYA 4ROQA 4TTUA 3I68A 4MKNA 5J04A 3LK6A 1HJVA 1L9WA 3G1YA 2V5KA 4WR3A 5K9CA 4CD4A 2GVJA 3AUOA 4HNUA 2O55A 1J4EA 1KC7A 5ENLA 2CESA 2PDGA 3TOYA 1UMYA 3M0KA 3WZ0E 1D3HA 1R30A 1GZGA 5DMMA 3BW3A 4MB3A 4AH7A 1AZ1A 1M7PA 1AJZA 2YJQA 4GQ0A 4MB1A 3EWCA 1FWWA 2QDHA 2CLIA 2GUYA 4XO6A 4HTYA 4PTVA 1OFAA 3RX3A 3WFZA 2FFCA 1VFHA 1UWRA 5FEZA 1HIZA 2OLAA 3GG0A 3UZXA 3WK1A 4Q6XA 1UR9A 1G9HA 1VIZA 3QY6A 3BAIA 3M7SA 3TA9A 3CJPA 1O95A 1J10A 2PTWA 4QG8A 5C2GA 4O17A 3LSCA 2R94A 3H22A 3WLRA 5TQLA 3UP8A 2ZZ6A 3W3OA 3C0JA 3CUIA 3OLIA 4MZYA 1DJHA 3TUUA 4MWAA 4K2SA 3CIWA 3SCSA 3DCPA 3E96A 2WNZA 4QM1A 3SRFA 2V2CA 1AD1A 4KERA 3QQWA 1DQXA 2CCRA 1IT7A 5C5YA 3UR7A 2R1PA 1DWAM 4G7FA 2YXOA 4Q7BA 1HFBA 2Q01A 4NJHA 4P7QA 1A49A 3LHUA 4R7WA 3BK0A 4AX6A 2HJPA 1NFPA 1ZTVA 3EDDA 1YTKA 4H6EA 2BG5A 4EOUA 2ZTJA 1TRIA 2PDMA 4Z1CA 4FLSA 4DN1A 5H8UA 1V02A 1XQKA 5D37A 1RCOB 2WOQA 1J11A 2BMBA 4HBKA 1VCVA 2ZUTA 2QCDB 4EWJA 2YIHA 3U6WA 3G8EA 4XZ9A 1VBGA 4HNOA 3C6CA 2QF8A 3U8GA 2ZZ1A 5A6MA 1W5OA 3EDKA 4TVCA 1NOWA 1EP3A 3BOFA 2I9EA 4X3ZA 3NQAA 4DM1A 3QOKA 2A6NA 4PFHA 4QSHA 2QCCA 5I23A 3OZYA 3IAQA 3WNLA 3N73A 1TWWA 1XLEA 2GGIA 4LS1A 3WH8A 1CECA 3D47A 4EX4A 3MSGA 1M41A 1EGZA 3TW6A 4Z2KA 2OSWA 2QEZA 4Q22A 5T91A 1RAKA 1E9YB 3WDRA 3GDLA 2QNEA 4GNKB 4A3RA 3A3WA 4D6EA 2YYUA 4A3YA 1CGXA 2EKCA 3RF9A 3L2MA 3DXIA 1OZMA 3I4KA 2PP1A 5CG0A 1J6OA 2J7DA 1J01A 3KWSA 1ZP3A 1Z6KA 2P3EA 1JCMP 3GDMA 3W7EA 2EF9A 1IZJA 1MW2A 4JDYA 1JZ6A 2A3CA 4J2MA 5EPDA 2DZTA 1FHVA 4RV3A 3MTWA 1RQHA 1RH9A 3WD4A 3IIZA 4RE0A 1LOLA 3UZYA 3G1DA 4HD5A 3RX2A 4MZ8A 4JQ2A 4GI9A 1WBJA 5K9DA 4GYJA 3GYEA 4O4VA 3W23A 2J66A 1PKNA 4ZCWA 2G8ZA 3I6RA 3W6MA 1US3A 2Q09A 2YA2A 1CGYA 4N42A 1CX9A 1EQCA 1AQFA 3EOUA 1WO2A 1GQNA 5IFPA 2GQ8A 3OGRA 3SGZA 4M6PA 1F3TA 5CJ5A 2RDUA 4GZ7A 1J9YA 4MAVA 4QBXA 3KBSA 1FRBA 2VOMA 4ZODA 3R12A 1LBLA 4M6UA 2PLJA 2GQ3A 5MKGA 1K1DA 2CZ5A 1XISA 5EBAA 3C2RA 3MA8A 1RZMA 3OBKA 3NQ2A 5J8LA 4F8XA 2Z1XA 3M5ZA 4WSJA 2G4JA 4A3UA 4AYSA 2FZMA 4IL2A 1V03A 1GW1A 1F9CA 2ZX7A 2GYIA 4AF0B 3H7RA 5HWJA 3INPA 2O0TA 5E0CA 2J74A 3WD0A 4BQ5A 2V69A 3G5EA 4KEZA 3LN3A 4LW7A 2V38A 2D1ZA 3VKDA 1CYGA 3NG3A 5BWAA 3PG8A 1ODUA 2Y85A 3R8RA 4EE9A 4K37A 2PCEA 4WXYA 1ZAIA 4UOZA 1NVMA 2AL2B 3S5NA 4DUXA 5XIAA 4XKMA 1FWBC 4H6QA 1S1PA 4IOTA 3VIMA 1VCGA 3VKKA 2C1GA 3RJXA 1KKOA 1XFCA 2HXUA 3O06A 4QG9A 5F1UA 2F6UA 2E40A 1EHNA 5TNVA 2OGJA 2XSXA 2WHKA 4N4QA 1KCLA 3WLSA 2ZC8A 3LGEA 3W7GA 3KTCA 1O94A 3A5FA 3KXQA 3MKKA 1AG1O 3O16A 2Y7DA 1A4LA 1FDZA 4UQBA 3WLHA 1PSCA 5L6UA 2LLEA 5IBXC 3BCJA 2OPJA 4IFOA 5I5RA 3MSDA 4HK6A 5T9BG 2Q8ZA 1EZ2A 1L0PA 2G37A 1XHGA 3GWQA 3KDOA 3RXZA 5I24A 1G0CA 1JF6A 3SY5A 1MZRA 3UJEA 1UD3A 3A6OA 3F4VA 1OSEA 1KFWA 1B3ZA 3QQ1A 4MTVA 1P0KA 4AYGA 4LUTA 5FJRA 1HKVA 1HJQA 2F2HA 3W02A 2PEVA 1IWAA 1RV8A 1JCXA 1S5TA 2PP0A 3A47A 2QCFA 1SFLA 3N17A 1FXPA 4HU3A 3KHDA 1OIMA 2FHCA 1DE5A 4JKMA 3WLMA 1FWCC 4GA8A 1S2UA 4FXJA 4Y9AA 2UZ9A 3AJXA 1MYRA 1CXFA 4J3VA 2WLYA 4A4AA 3YPIA 1XBXA 4HQVA 4DPQA 3TAOA 3I3BA 4CLMA 3OOQA 2JKAA 4JNMA 5KTLA 3QYQA 3P61A 3UESA 3H54A 2Q3RA 4EPKA 4AHPA 1XLJA 2EAWA 3WQVA 1MQPA 3C86A 4E8DA 3ZVHB 2X41A 3MV11 2EO7A 1W0MA 1LT7A 2BX7A 2E09A 3HO8A 5DY2A 3THAA 1XIDA 5HOSA 3QFEA 3SY1A 1JUBA 3IAPA 4LAKA 2YGYA 3GZAA 2J47A 1KRBC 1XYCA 2QJGA 1GVIA 4M82A 3AC0A 2F61A 4GXMA 1LP6A 2BS9A 3M4HA 3NZRA 2QUNA 3BLLA 1U22A 2FZDA 3WLNA 1P0NA 4C6PA 1U1JA 4UR9A 2DFAA 3T8QA 1WZLA 1E9LA 4JN6A 4WIWA 1WE5A 4NNBA 3CAWA 1DIKA 4DYJA 4P8VA 3VO0A 3W1LA 3KBMA 1KM6A 3TQKA 1MXSA 1NDZA 1X1ZA 2VEFA 1A5MC 4BWLA 1MEWA 2Z2UA 1E43A 3AOFA 1V4YA 2VUNA 4HHLA 4HZMA 1IE7C 1M53A 4N2YA 1UPMB 1H1YA 3A4XA 7REQB 3PHAA 2HWGA 1F8MA 3FCPA 1DHKA 2OZTA 1B90A 4LVGA 2A6LA 1FUYA 2E4TA 1BYAA 4FXRA 4JHOA 4D71A 4OE7A 3NXLA 5AHNA 1CGWA 5D38A 1FWEC 4Y90A 2Y8KA 3M9YA 4F79A 1ELSA 2ZRYA 6REQA 4ZB5A 4N0RA 3BQ5A 4DWDA 3NNTA 4GVHA 4MDOA 3WMLA 1FCUA 3M0IA 1Z44A 1J0IA 1OK6A 3B9OA 2FB2A 1HP4A 3NA8A 2QDDA 4B5SA 4XAZA 1Z48A 4LCRA 4AXKA 3JUGA 5EU9A 3SAZA 1XLGA 4AWTA 1B3YA 4B3ZA 4EWND 4NZ1A 5T9CE 3U2ZA 3UETA 1SZGA 1UB3A 1OC5A 1V6UA 2QPSA 1V3JA 4MPQA 2C91A 1LRTA 4O0ZA 2YW3A 2VCCA 1KBJA 1W1PA 2QGHA 2JALA 3N12A 2DY3A 2OKTA 1AQHA 2WO5A 3BICA 1DQUA 4DXVA 1SO6A 4O12A 3RILA 1I4NA 2DT3A 1KM3A 1ZENA 4EXAA 2AAMA 4UTHA 1Z3NA 2VFHA 1NOFA 5CZSA 3UVAA 3DHPA 1X96A 1F76A 5AKQA 3KP1A 4H7CA 2OWWA 5BMWA 2RGMA 4GC4A 3PPHA 3Q94A 3QPZA 4PMUA 4C5YA 4JYDA 2ZCGA 4C1KA 2J79A 1NARA 3V16A 2G3FA 4UCGA 2VFFA 4CVWA 5C70A 1LQ2A 5BRQA 3SGGA 3VDAA 4MIMA 3UWVA 6TIMA 4AQLA 1EEPA 1LQ0A 3DECA 1UZ1A 1L6WA 4X2PA 1DJYA 2PBGA 1CLVA 5BROA 4J3SA 4C6NA 1U30A 2W62A 2JK2A 2QUMA 3FHQA 5FSDC 3NL3A 3S83A 4O14A 2ZRZA 3AJ7A 3FIGA 2GSHA 3SI9A 4EXBA 1E6ZA 3GDTA 3H7UA 2WNNA 4GH1A 2PI6A 3DH7A 2CETA 4XISA 1XRVA 3FKRA 4M80A 3SUVA 2FYMA 1AK5A 3BAWA 4RDWA 1VFUA 1WP6A 4PCTA 1BRLA 3MCOA 3CLMA 3EB3A 4Q7IA 2W4XA 1AUSL 3CO4A 3W6YA 2I7GA 3NQGA 2ZVRA 3W2JA 1TTQA 5HBFA 2Y63A 3WJZA 4Y7EA 4OOZA 2D0HA 3MQTA 2WPGA 2BP1A 2J88A 4S3DA 3KX6A 1UD6A 3HMCA 4H04A 4CCCA 4QJ5B 4XZWA 1IQ8A 1FWIC 3GIQA 4FP1A 5CLWA 2D3NA 3S4TA 3SQSA 1OX4B 2GJXA 4Y9OA 4IIFA 1EL3A 1FWGC 4PL1A 3GDKA 4NY2A 5C8BB 4GQQA 4LJ3A 1KTNA 3WQ6A 1KXVA 4JEQA 4MYAA 2VRQA 1ZBWA 2J77A 2IPGA 4IH3A 1NQ6A 4M29A 3GXTA 1GG0A 3W1XA 4Y9MA 3OVRA 4ACYA 3DBNA 5JQ9A 5CPNA 2Y1HA 1EC9A 4E8CA 4P8UA 2YL5A 4QCFA 1K7XA 5A69A 4AHQA 2QAPA 2FHBA 4QIUA 1UR0A 3UNDA 1VPXA 2CBIA 4D6IA 3AICA 3VNJA 1OK4A 5FAGA 1XP3A 4KFNA 3KW3A 4MSSA 2C19A 1VPYA 4KWUA 1QDSA 1RA5A 4AIBA 1GZ1A 3NDZA 1YXYA 4B5UA 3ARZA 3BSMA 2J7BA 2J8GA 1RJQA 1LM1A 4FA3A 3V35A 2Y70A 4FNRA 3VNYA 1Q6CA 4J3WA 1QOPA 2BTMA 5GNXA 4DY1A 3WNKA 4WY0B 3QOMA 2VFGA 2GFTA 2PPGA 3R10A 4LYKA 4CEXC 3XINA 3O6AA 2XN0A 1GVOA 1RXOB 2VFIA 2P0IA 3UR8A 3FW6A 1PTAA 3SECA 3TYZA 1S5WA 4K36A 1XYMA 1XDMA 2EPOA 4C7FA 3TKFA 4PMQA 3RNDA 1TR1A 5C7HA 1R3SA 1TV5A 4I9MA 2NQLA 1JCNA 3EWZA 3C5QA 3R89A 4KETA 3WD3A 4QSFA 1R3TA 1X97A 1P5BA 3TZNA 2I14A 3CQ0A 4HGXA 2C15A 1JZ3A 2R82A 5DMYA 5K3VA 3TFCA 3P5ZA 3L66A 3U7VA 1W9DM 5EL1A 1BSLA 1ZBVA 3FA3A 1JGIA 1U5HA 2UY5A 1F6KA 1PX4A 3QQ0A 3B8WA 3NO3A 1QWKA 1A5NC 6PTDA 4R85A 4CQCA 4JIQA 3L12A 3N9RA 2WMFA 5FJOA 4W8BA 2CLMA 2ACRA 4YPJA 3DC8A 2TODA 2ISSA 2QV5A 1FP8A 3N2MA 1VCFA 4FF7A 4LWWA 1FWSA 1GW9A 1OABA 3W26A 1S2CA 5AY7A 3B0YA 3O0FA 4V33A 4JFWA 5B7YA 4UTJA 1W5MA 3BLOA 4XIMA 4ATDA 3SRDA 2G5WA 4H1ZA 3TLQA 2ZUSA 1VC4A 2QPXA 1I75A 3A3XA 4QLKA 5H6HA 3O9NA 1A5CA 2VZTA 1J2BA 1OCBA 3TVAA 4O15A 4L9YA 2ALRA 4DYKA 4Y6GA 3CK5A 3WO8A 1B1YA 4L80A 2A85A 4CN4A 2E67A 4UFMA 1QCWA 1YNYA 1YDYA 1LWIA 3MDWA 1TPVA 4JHZA 3L4YA 3AIVA 4H41A 3BZJA 2P88A 2DSVA 3W7KA 2A0NA 3IJ9A 4LV4A 1XF0A 3R94A 2WSRA 3MP3A 1LLZA 3TR9A 3C2YA 4WDUA 1XLBA 4PUEA 3II1A 5LIUX 4AWSA 1E0TA 2YYTA 3DHUA 4D72A 2VOTA 3FJLA 2BVWA 4EF8A 4K1GA 1TTIA 4PMZA 3QGVA 4IJCA 3H12A 5D9NA 2XPKA 1E3XA 3EX4A 1KCKA 2OYLA 1RBAA 5L9FA 4M51A 4FX6M 3OO2A 5EFFA 1FWNA 2ACSA 1ZRQA 4FIQA 5ABGA 3BAXA 2Z00A 3U5UA 3W9ZA 4LOCA 1R3QA 3NZQA 4G8TA 4OWGA 1T41A 2HS6A 1BG9A 3G18A 1XC6A 3CL8A 1FBAA 2X2GA 4H6RA 4UIOA 2E5CA 5DEZA 3URAA 2CBVA 5BXSA 2G95A 1EJRC 1BGAA 3B8TA 1ZLPA 1AJ0A 5KZEA 3JS3A 1RBOB 1ZSXA 4K8GA 4V2XA 5E5CA 1GEQA 1PEZA 3DEQA 1B54A 3PZMA 4HU8A 1KBBA 4ACZA 1JI1A 1ITCA 3CBWA 1HX0A 2HRWA 3G1HA 1X6NA 2D2HA 3IARA 5KEZA 3CIVA 2EGZA 2G3MA 4U3CA 3C8NA 1K7EA 1TUXA 2GQ9A 4N9BA 4FZIA 2VUYA 3FV9A 3EEGA 4ECLA 4C6JA 4Z2JA 1VHCA 1UWSA 1AA1B 2F7FA 3PZVA 1KB3A 4I7UA 4GKLA 1JAEA 4PTXA 2PDKA 1GOQA 5E6ZA 4I9AA 2YCIX 1XL9A 3WNPA 5H2ZA 3GXNA 3AXIA 4R7OA 2FJKA 1BTMA 3BGJA 1B31A 2OR2A 3GH5A 4A8IA 3F7JA 2P8BA 4NSBA 1UIPA 3REQB 1E9IA 4O1DA 1DTUA 4L6DA 4OOUA 4P5UA 1I1XA 5MKGB 1XRTA 2ASHA 1K03A 1ZCOA 3VGGA 3WKZA 4C91A 1YQ2A 4GQGA 2CC0A 1PX8A 3B8UA 5A6KA 5CAHA 3GNOA 5D04C 3M0JA 4TUFA 1QW8A 4Z1AA 2ADAA 1SFSA 4UNIA 3GHTA 3ME3A 4TIMA 3S1UA 3BLPX 2CHRA 3OVGA 1XIMA 4F48A 2ZOXA 3OHIA 2FIQA 1PL9A 4C60A 4Q7NA 1DPMA 3M0HA 3N6QA 3RR4A 3DHDA 4QJ3B 3ES8A 1YPFA 4GI6A 3EOOA 4GQBA 1R9XA 1QMLA 3BV7A 1J8VA 4IIEA 3WUBA 1E1CB 2VRKA 1YHTA 1DL3A 1ZNNA 2YCEA 5FA5A 5U4NA 2WC4A 1V02E 1W9BM 1D8WA 2VDGA 3KOYA 4ILSA 1R2SA 5GJPA 2NX1A 3V0UA 1EDQA 3UFYA 5F1VA 3WK3A 2YZ5A 4IMAA 1OWQA 4D6FA 2WMJA 3Q2DA 1LJYA 1KRCC 3W7RA 2Z25A 5FSEC 1V0KA 4DUVA 7ENLA 2OWCA 1NF7A 3TXVA 5C2XA 5J5RA 5IM51 3KL0A 3NTYA 4JFSA 3ZWSA 2VXNA 4O8RA 3W2UA 3R4IA 4JTJA 3VYLA 1RK5A 3AI0A 2IKJA 3VGDA 3H2CA 1V6XA 3BARA 1IWPA 3E0VA 4C6CA 4NT0A 3ZT5A 5HWNA 6CGTA 4CU8A 4XZNX 2YKKA 2J27A 2YR1A 1ISVA 1SQ7A 3RM8A 4BWLC 1EJSC 1V6VA 3I3EA 5AC6A 3TC7A 4MM1A 3VVGA 2JF7A 1TCMA 2DDXA 2XH7A 1BG4A 3PBWA 4LUTB 3L4WA 1SMDA 3BLFA 3DERA 1YEYA 3TC3A 4M6VA 5D9PA 2GVEA 2WANA 3C56A 2XYLA 1PJ9A 1F74A 1PXGA 2C3ZA 3IVUA 4NI8A 4Q8PA 4JX4A 2CITA 1TA3B 3T0TA 3PJUA 3WMSA 4YCOA 2ZXDA 3HG3A 3W71A 4AEEA 4D2JA 3CXOA 5FI8A 2NVAA 2XG9A 4MPKA 1IEXA 3PZUA 1OIFA 2ANUA 1E4NA 4DJEA 1ZP4A 5FJUA 1A4MA 2C0AA 5AYZA 3M5XA 4HMDA 4O11A 5A8OA 5IOBA 1WKEA 3S1XA 3VOHA 3IIOA 1SZNA 3NSMA 5AVNA 3OZMA 3CB3A 4GWEA 2FGBA 1UZHA 1I2NA 5LGZA 1YDNA 1JDCA 3EDJA 2OQLA 4QG6A 5HATA 3L4ZA 2B7OA 2RDTA 3W25A 1UP0A 3UT0A 3GVQA 1XWYA 1P6BA 2PTYA 3LD5A 1VHNA 1G4EA 1QI3A 3WN6A 1BXNA 1SFTA 2DORA 4EKJA 5HNNA 3ARSA 2V9DA 4AEFA 1OT2A 2XM1A 3NZPA 1UUMA 2OMAA 4AUBA 4IP4A 3MKVA 1OF8A 3UERA 3R1ZA 1SSGA 1W3IA 3UJFA 3R79A 4LYPA 2DSKA 1W3NA 5DLCA 1X39A 1KM1A 4K3ZA 1OG6A 4QCEA 5FJJA 3QC0A 4LS0A 3PC0A 2YDSA 2E1DA 2VX4A 3HPSA 2PAJA 3WSUA 1FWAC 4F4RA 3BCFA 1J18A 5JH2A 2YLAA 3GVGA 3CUGA 1CXIA 1PKLA 3PPGA 4B90A 3ARQA 3PSVA 4N9CA 1T40A 3DG3A 1R86A 3CAQA 4JBRA 1VRXA 3DOPA 2FGZA 1C93A 2PTZA 3H70A 1KFCA 3NVDA 1WYIA 1I8JA 2BHUA 2AGKA 2PWDA 4LH8A 4U31A 3O6YX 3SJNA 1LLOA 3QPYA 1MQRA 2NLIA </