1UJPA

Crystal structure of tryptophan synthase a-subunit from thermus thermophilus hb8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
271
structure length
243
Chain Sequence
MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDGPVIQRASELALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSVEVKDLVRRIKARTALPVAVGFGVSGKATAAQAAVADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Stabilization mechanism of the tryptophan synthase alpha-subunit from Thermus thermophilus HB8: X-ray crystallographic analysis and calorimetry.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 92
structure length 243
sequence length 271
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ujpA00
1EIXA 2O7SA 1TTIA 2ZRXA 3K30A 3PC0A 3CLMA 3ELFA 4LT9A 1VZWA 3EX4A 3NM1A 4LVAA 1O5XA 5DCBA 3W72A 5HWNA 3UXDA 3C2FA 2RDTA 4DBEA 1ZAJA 4ZQCA 5D30A 2VFEA 5AYXA 4O50A 3NXFA 5DBUA 2A85A 4M6QA 5IBXA 3QC3A 3T7VA 3PULA 2E5BA 1PCKA 4K7YA 3HGRA 1ZCOA 1ML1A 4FXRA 1GVSA 2C14A 1WV2A 2Y85A 3EXTA 5K9XA 2AAMA 2ZZ7A 3MI6A 3W2KA 2I1OA 3E49A 1SFLA 2FPVA 3TQVA 3W2JA 4X9SA 2G95A 2DORA 1XUUA 1SW3A 4GJ1A 4IGHA 5LSMA 3W1NA 5D2TA 2WKJA 2GQ8A 2Y89A 5F1UA 4L4MA 3S5YA 1HL2A 1IIGA 1W5MA 4LRSA 2P10A 3RF9A 1B4KA 1GJPA 3C61A 2YX0A 3DHFA 1W8SA 1B57A 1QOPA 3BV4A 2CLOA 2DZUA 3GNDA 1LLZA 5G1YA 5G2HA 2WV8A 3LTSA 1GOXA 2R94A 2YSWA 4D2JA 2C13A 3NQGA 3RLVA 1I45A 3O63A 3UNDA 4AXKA 5A5WA 3M5XA 5LNWA 4KFNA 3L68A 3CEPA 1N8FA 3TU9A 4Z1CA 4UMAA 5D33A 1ICQA 3STCA 5CPLA 3LHUA 3ZWTA 1LOQA 2E77A 4O4VA 4BK9A 5AC8A 3W1XA 1FBAA 3T44A 2WQPA 3EWUA 4QQ3A 3QJAA 3G0SA 4XUGA 3N19B 3TDFA 1D9EA 5F2LA 3STFA 4QAIA 1W3IA 3VE7A 2FTPA 3NPXA 3DU0A 1TO3A 4JTFA 1G7VA 3NZRA 1A50A 2QJHA 2G97A 1BWKA 2FQIA 3S0CA 1H7XA 3PB2A 5HJLA 5EBUA 4MLJA 4UTTA 2B7QA 2WNQA 5FEXA 2NWSA 5HULA 1FX6A 1F7BA 1T0OA 4ADTA 3KAOA 2V2HA 4DXVA 5H2ZA 2X1TA 2HSAA 3RFAA 4Z1AA 3MJYA 4LNYA 4WOZA 1LRTA 5HMSA 2E6YA 1TV8A 1IXOA 3FYOA 1FUYA 1ME8A 2ISVA 3PM6A 2IQTA 3S1WA 1TPWA 3INPA 4Z0JA 2DZVA 3GKAA 4LVDA 1YXDA 5E1QA 4DQWA 4CQ8A 4UNLA 5SWUA 2GVGA 3P62A 3S5ZA 4OT7A 2JBMA 3I7SA 2QF7A 1W37A 5BMWA 2QCGA 3EXSA 3W7CA 3LB0A 5HNRA 1KM0A 1QMLA 3B05A 4RXFA 5CGQA 3W86A 2NUYA 2YCEA 3NL6A 2V2CA 4PL1A 4O1DA 4AEOA 3G1DA 4XWUA 3LV6A 1YTKA 3TAKA 3LCHA 4K8HA 4UC5A 2A7PA 4LVGA 4GUFA 2V82A 3IVUA 3TKFA 3W7JA 4QNWA 1DL3A 3LOTA 4IMGA 5DCDA 1TV7A 1TRIA 4K37A 1BWLA 4GUJA 1O4UA 2E1DA 3UPBA 2JGYA 3HPXA 3O1NA 2FPTA 3N2MA 3G8EA 1I4NA 4JIQA 3LLDA 2H8ZA 1N7KA 2CZ5A 4O1BA 4GRSA 2NXGA 1EUNA 4FIQA 1DVJA 3P82A 3HPZA 4LC8A 3G3MA 1OF8A 3W74A 2ZRVA 4UR7A 3HGOA 1GVFA 3NQ8A 5I3GA 1KTCA 2RH9A 3C0JA 1TJRA 3M44A 1QPNA 1LOSA 2WO5A 3I7RA 4RR4A 3BLFA 3IGSA 3PS7A 3UD6A 2YFNA 1G4TA 1IXPA 2WJZA 3EB2A 1TPB1 3UXAA 2NLIA 4UTUA 3QMRA 2ZZ6A 4MLRA 4N4QA 5TBOA 1RR2A 4MY9A 3YPIA 1B4EA 2QCFA 4JTSA 2CLIA 3GVGA 3LCXA 4E0CA 3UWYA 4DPPA 2ZRZA 1K03A 1OG0A 1SZEA 4NXKA 4FIRA 3CEUA 4MVAA 5AHFA 2Z2UA 3IV3A 3PSVA 4M7SA 1TJPA 3GLCA 4P2VA 3W2UA 3GX9A 2GJLA 1SQ7A 1OFQA 3P8IA 3L9CA 3ZR4A 3GXPA 4CNOA 1VS1A 4H6KA 4KWVA 2BTMA 3C56A 4MPQA 4PL2A 4A22A 1XXXA 4ZVJA 4I7UA 1JUKA 4OWGA 1Z44A 4R53A 4Y8FA 3TCEA 3PF3A 2TPSA 1F2JA 4OV4A 4E38A 5HWMA 1WXJA 1JQVA 3W2LA 4JX6A 2HS8A 4JTTA 4KKXA 5EMUA 2V30A 4UXDA 3G1XA 3TMQA 1G7UA 3F1QA 3W7GA 5FEZA 4K38A 4UCGA 5DXXA 3W1AA 1PHWA 2CLKA 5LGXA 3WFAA 1ZALA 2Q3OA 3T78A 2PC4A 5G2WA 1AK5A 3NOEA 5T26A 4A21A 3PG9A 3T40A 1SW7A 1WX0A 3DZ1A 3OVPA 3R12A 4OHQA 1X8FA 3EX3A 5CG7A 1DHPA 3W75A 2C1HA 3NPVA 4O52A 4UIOA 2DU2A 1BEUA 3TE9A 3PWAA 5EKYA 1G67A 1OFDA 1KLZA 3M41A 4UFKA 5LKYA 4N9BA 4Q32A 4X3ZA 4MJMA 1GTEA 3U6WA 4WX2A 5C54A 1VHNA 2J6XA 1ZENA 2UV8G 5GVJA 2ZZ2A 1KV8A 2Y7EA 4MZ1A 4Z1DA 3HGJA 3M6YA 1NF0A 3R89A 1QR7A 4IX2A 2PE4A 5LGZA 2PCQA 1RV8A 4JYDA 4BWLC 3GXTA 3PUDA 3V75A 4HSOA 4ZL1A 1FWSA 4O11A 3O15A 1B3OA 1A5AA 4Y6GA 2QJIA 1W0MA 2Q8LA 1JCJA 3TW6A 2QCCA 3N73A 1GVOA 2NV2A 3BARA 1LBLA 2JK2A 1YXCA 3MWAA 3G1HA 3GDTA 3HMJG 4UFLA 4JX5A 3KHJA 4A2SA 1UB3A 3G0XA 1Y0EA 2BWGA 4CLMA 3HB9A 5G2IA 4UTIA 2J9XA 4QIUA 3ABSA 1XDMA 1YDOA 1JUBA 3N2XA 3W1RA 3CWOX 3G1SA 5F4XA 2J9ZA 4TX9A 1LBMA 3W1MA 1NVMA 1K3UA 3R5EA 3B04A 4FNTA 4K7VA 4N2YA 3NM3A 3SW6A 2VXNA 1EA0A 4JYEA 1S5TA 2CZEA 4POCA 1K7EA 2ABBA 1TTPA 3NDOA 1P5BA 3LXAA 3PB0A 3UWZA 1UJPA 3NL2A 4EF8A 4GFSA 3KFTA 3KVKA 2HTMA 1YTDA 1VH7A 3A5VA 2CZFA 4N4PA 4JYFA 3CTLA 4O1CA 4ZQRA 1SPQA 3M5YA 5AC7A 1JQXA 1AW5A 3HG5A 3FYPA 5G4WA 1DBTA 3L0GA 3VFLA 2DZPA 1FWWA 4NJGA 3W83A 4O13A 4WUIA 1GT8A 4IQLA 3W07A 2BLEA 2GOUA 1XBXA 3IVTA 3KRUA 4JY9A 3NO5A 4LS2A 3WK1A 5FEPA 4S2BA 4FF7A 2QR6A 1HO1A 4JTEA 3NQDA 2F84A 2GVLA 4IMCA 3G18A 3C6CA 4XKYB 1YPFA 3FFSA 3A24A 3HF3A 3QYQA 2Y6ZA 1TMHA 1PV8A 1VYPX 1XL9A 3EX2A 4CQAA 5F2MA 5D04C 3LHZA 2OX1A 1H63A 3GYEA 3W2MA 1LCOA 3GR8A 4LRTA 3MMTA 1MEHA 4O0ZA 2QAPA 4JXCA 1A5CA 5K9CA 2ZBTA 4QNEA 3MI2A 8TIMA 3TC6A 4LS1A 2Z0IA 1ONRA 2A1YA 1G4EA 3BLIA 5EYWA 3IIPA 4IPIA 2VEIA 1TPDA 5EL1A 1EP1A 2EAWA 5FESA 3P84A 4NJHA 5C2XA 5BRBA 3A5FA 5D2YA 1FXQA 4HNUA 1TPEA 4IWWA 4DF1A 3W7RA 1FXPA 3C2EA 1OX6A 3W88A 4MJZA 1SO6A 3MBFA 1SZFA 3GKFA 4CCEA 2XN0A 4I7WA 3MYOA 1UASA 4ZQOA 1UCWA 1ZHAA 4FEZA 3DI0A 5E93A 4C1LA 3QPYA 4UFMA 2FJKA 4Z08A 5DBTA 5L9FA 3GDKA 3E9AA 4JDYA 4KFOA 4EOUA 2AGKA 3NQ2A 4LC6A 1X7FA 3EEGA 5DY3A 1IXNA 3UWQA 1D3HA 2W79A 3M0ZA 3L65A 2V0TA 4GXMA 5D38A 1H51A 4S2CA 2O7QA 4IMEA 3WJWA 1KFEA 4TU1A 4J9JA 5FEWA 3MHGA 5HWJA 5AN7A 5IM51 5F1VA 5D09A 3BW2A 3M47A 3NGJA 1JRCA 5HR6A 3ATZA 4H4IA 2ZFAA 2Y7DA 1NF7A 1TQJA 3OBKA 2A4AA 3EWYA 5E0KA 5TIMA 4JTKA 1F74A 1KLYA 1G69A 1Z41A 4ORIA 3CWNA 1VLWA 2NUWA 5KSWA 4JR5A 5EY5A 3G3DA 4LUIA 1C9DA 1ZFJA 3FJLA 4IXXA 4HIBA 4HT3A 3UPWA 3O6CA 3LGEA 4WJEA 4LV4A 2QCMA 3R2GA 1EPXA 3ABOA 5ABTA 3L2IA 3L0NA 1VYSX 3BW3A 4QITA 3RMJA 3GAKA 4CNNA 2QCHA 3BVJA 1SZGA 2ISWA 4JTUA 1GVQA 2EPHA 2YGYA 2QDGA 1A53A 1YXYA 3Q37A 4IMDA 3M5ZA 4XBKA 3FLUA 1ZY9A 5KTLA 4FHAA 4O53A 4XTIA 2P1FA 4AH7A 1SUXA 4NZJA 1OHLA 1LLWA 4UNKA 3NQ6A 3KVMA 4IOTA 4FX6M 2NXHA 1JCMP 2R14A 4BI7A 3GIYA 4FB7A 4WY0F 4OE7A 2OJPA 5D32A 2P0OA 2HMCA 1W5QA 4HPJA 5CZSA 1I2PA 3W22A 3U8GA 2C18A 3FOKA 1T99A 1YYAA 4DEFA 3TSMA 3NG3A 2EGZA 1KFCA 2QCDB 2CLLA 3DGRA 5CKSA 4OQVA 4XKYA 1MZHA 4GUIA 1VJIA 5DY2A 2QUVA 3SGUA 2FB3A 1XC4A 1K02A 1J2WA 2ZRUA 3BGGA 3EX6A 3C2VA 3HIJA 3DKLA 4HNVA 1ZJIA 5K2ZA 2RFGA 3B4UA 3C4UA 3SJ3A 1FCUA 1I2QA 1X6UA 3C52A 1IIHA 4JNMA 4JTIA 5DN1A 5FF0A 4K36A 2CLFA 3KVJA 1M5WA 4H3DA 5IBXC 1TB3A 3JR2A 3LHYA 3W85A 3O07A 1JCLA 2VFFA 2HS6A 1VCGA 2GVJA 2CU0A 1F05A 1WBHA 3LCLA 1VCFA 4LWWA 4O18A 2CWNA 5C55A 4UMBA 1F5ZA 1WOBA 4ICNA 2A5HA 4LY8A 4M7TA 2RHGA 2Y61A 2VFHA 1LYXA 3TUUA 1DORA 2RDUA 4Q4KA 1HUVA 4NNAA 1XFBA 3G1YA 1WYIA 3LERA 3TH6A 2YYTA 5F4WA 4NX5A 4JTJA 3MO7A 2FPYA 2A0NA 1IXQA 4YCOA 1KFJA 3TQ0A 1DQXA 2TYSA 1P0NA 4IMFA 1KV5A 1MO0A 1SZNA 4U28A 3GAYA 3B0VC 3W1PA 4MFDA 4K39A 4JN6A 3ZFHA 3PVFA 2DZSA 3STGA 4DO6A 1WA3A 4NNCA 4MY8A 4ONVA 1PS9A 3L0KA 3VE9A 4YWIA 4IJBA 4LOCA 4EWND 4HN4A 4MYXA 3KRZA 1RVGA 3LRMA 2DJLA 1LROA 3S9YA 1X1ZA 3EX1A 3W73A 4O19A 3OVQA 4R7JA 4K8EA 2WPBA 3QMSA 3LX9A 4TMBA 3B0UX 4O54A 3NQMA 3B8DA 1SSDA 2A6LA 2ZRYA 2X1RA 4RJEA 2Y62A 1M7OA 1CI1A 4XZ9A 1QPQA 3W7HA 2Z6JA 1KW1A 2B7OA 3W70A 2I14A 4RK8A 2WSYA 4RV8A 3CB8A 2QUTA 3NR0A 2NX1A 1QCWA 1VR6A 3ABQA 5CZJA 4LTSA 1JUEA 5A8GA 1K8ZA 1QFEA 2VFDA 4O28A 4BWLA 3EWZA 1UUMA 2YYUA 3P5YA 1A5SA 1LBFA 4UTTC 2H6RA 4QSHA 1LTDA 3OHIA 4X22A 3SZ8A 2B4GA 3WJZA 4FO4A 1GPWA 3CIXA 4DELA 3EKZA 1ZAHA 3M7WA 4ORMA 5BNKA 1VCVA 3N34A 5AFDA 4PODA 3TJXA 1SU5A 1TPC1 4Y9AA 5AHLA 5I3HA 5F2IA 5CSSA 3RNDA 1DV7A 4YMZA 3UWVA 3LLFA 2R8WA 2W0UA 1WBJA 3G24A 3S8HA 3QH2A 2J88A 2FDSA 2TRSA 2F7FA 3TC7A 2ATMA 3BW4A 3IRDA 2ABAA 3O6DA 1W5NA 1VGAA 4MYAA 3SIZA 1N55A 1GVRA 2C3ZA 1H7OA 3C2RA 2X1SA 1W3NA 1MEWA 2VENA 4ZMGA 1L6YA 3HG4A 3Q2DA 1OFAA 4BI6A 4O17A 2QCDA 3NL5A 3LXCA 3O05A 3IVSA 1EP2A 1DJNA 1H1YA 3GDLA 2DZXA 4NNBA 1XBVA 4BR1A 3CIWA 3QW3A 3R8RA 1LDCA 5K4ZA 2DZWA 3OG3A 4AWSA 4DPQA 3T55A 3FA5A 5LNUA 4LV9A 1GQNA 3P67A 4LW7A 2J24A 2G96A 2J9YA 2WSQA 3I68A 4MZYA 3MI3A 3HGSA 4O1AA 1OK6A 1ADOA 1LRQA 2TSYA 1KFLA 2OT1A 3DAQA 3L5AA 4YCPA 4YXGA 5F2GA 4E2DA 1D3GA 1S5WA 1ICSA 3Q94A 3SY5A 4N02A 1I8JA 1PIIA 2QUUA 3DFPA 5DXYA 5EPDA 5D05A 1KA9F 2AQWA 3WJYA 1MXSA 3CU2A 3TXVA 1YLVA 4O12A 1K8YA 3PUOA 1H61A 3DFTA 2ZTJA 2E6DA 5I3IA 2NX3A 4JICA 4B5NA 3GR7A 1S5VA 5KZEA 4YLWA 3SSJA 1VRDA 1H7RA 3P80A 2PRHA 2YW4A 4PH6A 3W71A 3MHFA 2FLIA 2WNNA 4QISA 3ABRA 5FF7A 3NZ1A 5CPNA 4N9DA 3TJLA 1OFOA 2VEMA 3EXRA 4PA8A 1DJQA 1L9WA 1OYBA 2B7PA 1TCDA 1P4CA 2WOQA 3DFNA 4UFJA 2Y70A 2ZZ3A 3W7EA 1THFD 2PURA 5TQLA 1Q6QA 3PSWA 2QKFA 1CW2A 1OF6A 1G4PA 1ICPA 1OJXA 3WJSA 5G4EA 3C3NA 3MBDA 3GXNA 4O8RA 3E96A 4XTDA 3USBA 1TPVA 3N3MA 5KITA 4OV9A 3WJXA 3IGUA 3NVTA 3S6DA 1HTIA 1EEPA 1IGSA 1WAUA 3G22A 3GB6A 3UYCA 4UR8A 2R91A 4S1FA 2OCZA 1VC4A 3DH7A 1TPH1 4AB4A 2RDWA 4AHPA 3OVRA 1QAPA 4FNUA 5LHFA 2VFGA 5LNVA 4JGDA 3LRLA 2FB2A 2ZTKA 3LHVA 4AF0B 1I2RA 1SSGA 2ZRWA 4GUHA 4QJ1A 4CQ9A 2H3BA 4WQ6A 2D73A 1KM3A 3IIVA 3E02A 5BW6A 3QPZA 3P8JA 1SW0A 4IXHA 2QCLA 1V5XA 5KMYA 3LCIA 3PBVA 3W87A 3RU6A 1EP3A 3TNOA 3IIZA 4RZ4A 1AG1O 2OT0A 5DELA 2W6RA 3TK7A 3NQEA 3EWBX 4FNPA 2ZA2A 4O57A 3LI0A 3S1XA 1ME7A 2YZRA 4WOQA 1QWGA 4NJKA 3W23A 3LHWA 4ZQPA 3W7PA 4RZ6A 2A7RA 3CT7A 3PBUA 2QCEA 3DKJA 4JY8A 1LRNA 3S1VA 4A29A 3NPWA 5D02A 2V9DA 1NSJA 1GWJA 3FIGA 3LBMA 3L66A 2EF9A 5HUPA 4Y90A 3QFEA 3W7NA 4DO4A 4EF9A 3BPWA 3G0UA 4JS3A 1F6KA 4IUOA 1JVNA 1LOLA 5CZTA 5CPOA 1RZMA 4TR9A 1OX4B 3PBYA 1AW1A 1YADA 2ZA3A 3F4WA 5U7SA 3G8RA 5I3JA 3MUXA 1HFBA 2C0AA 5CZ0A 4JTGA 5DLCA 2NWRA 4U4MA 7TIMA 1EX5A 1KTBA 1CX9A 2NXIA 5K7JA 3F4NA 1FDYA 1HG3A 2JKAA 1C29A 4TMCA 1LZOA 3BK0A 1RPXA 2ZZ4A 4NT0A 3M16A 5AB3A 1V7YA 1KBJA 2V5BA 3UY7A 2Y7FA 2ZZ5A 2OMAA 2CLEA 1Q6OA 4DBDA 3KVLA 4O14A 3OEXA 1YDVA 2B7NA 2VC6A 3UZ5A 3SI9A 4R34A 1W5OA 4PC8A 1FY6A 1LP6A 3W84A 2CLMA 2VKZG 3FKKA 4CCDA 4JD4A 1JCXA 1UBSA 3IGXA 2ATSA 1HO4A 3NQVA 1TTJA 4FXSA 1VYRA 1QPRA 2YR1A 3NQAA 2NV1A 2QJGA 4ZQNA 1OFPA 3HO8A 4JIPA 5AYZA 2RKXA 3W2NA 3S5NA 1ZNNA 5D2VA 1SO4A 3UWWA 5LNRA 3TR2A 3ATYA 4PCFA 2Y63A 3DHDA 3HPSA 1KM1A 3V1PA 1AL7A 2V8ZA 4DF0A 3DENA 2QDHA 4UUIA 3T4CA 5DCEA 1Q6RA 4R33A 1FQ0A 1WOAA 3LM7A 5I3FA 4UTJA 1E51A 3DI1A 3W1QA 2DZTA 3TIMA 4C1KA 4GC4A 1W31A 1EWDA 2J27A 1QO2A 4UTKA 1K7XA 1Z42A 4MIMA 2A7NA 3GNNA 5HQEA 3FKRA 4ML9A 1DKWA 4WXYA 3S42A 3TFCA 1W5PA 3NA8A 5KZMA 4AF0A 5D2XA 2E6FA 4A2RA 1XI3A 3CM4A 3TA6A 3QQ1A 2WNZA 3D0CA 1AW2A 4LVBA 2XFWA 1Q45A 3CQ0A 4UTWC 4O16A 3RLUA 3DXIA 3THQA 4Z1BA 3I65A 3LI1A 4ALDA 3DBPA 5K3VA 2BZNA 3KRSA 4GBUA 4BFAA 1TYGA 3N14A 2C6QA 4UFHA 2VEPA 3LBCA 1JCYA 2E6AA 5KINA 3IIXA 4WY0B 4UTHA 2V81A 3LCFA 4JEQA 4NJIA 5LZLA 1YPIA 2GPTA 4HNTA 1BTMA 3VKJA 6TIMA 4UFIA 3RK8A 3ZS4A 2CLHA 4I7VA 4AWTA 3QW4B 1QOQA 3L21A 3B0PA 4CNPA 2CFFA 5G5IA 3A23A 1O94A 2E68A 3UZJA 4YL2A 3W1TA 3QSTA 1SO5A 2I9EA 3M1ZA 3M43A 3EKLA 5G1TA 2Y7GA 5HR7A 2Y88A 3FS2A 4N6EA 4GE8A 4LUJA 3TW7A 3GDMA 5EA9A 2BX7A 4RCXA 1L6SA 4FX7A 1M6JA 5LHEA 3NPUA 4Q33A 1RQBA 3BGJA 3MP3A 3W7MA 3W76A 1ME9A 1MSSA 4FX8A 3ZWSA 3QEZA 4ADUA 1S3HA 1OX4A 1A5BA 1JULA 4MUZA 3HG2A 5D37A 2ZDRA 1GG0A 3OIXA 4OGZA 3LTPA 1LM1A 4HHPA 4E2BA 1SR9A 3NAVA 4TO8A 1KM6A 3TSDA 1JRBA 3H54A 4GUGA 1P1XA 1FCQA 1RD5A 1R2TA 4OU1A 4MKNA 3FJ6A 4CCCA 3PUEA 3BLEA 4M19A 4MOZA 1OK4A 3FEMA 1WQ5A 2C15A 2JKEA 1T8XA 5AYYA 1L6WA 4Z0SA 1H62A 3HQ1A 2E09A 2E5DA 2NX9A 5I3KA 3O8AA 2Q3RA 3HG3A 4UMCA 4O4WA 4RLIA 1K8XA 1EUAA 2C19A 4K6AA 1OABA 2JKPA 1PHQA 5D2WA 3O06A 3W7IA 2FFCA 1J5TA 1W56A 2ZA1A 3NNTA 4AMAA 5HUOA 4PTNA 3NQFA 3AJXA 3TXZA 1UUOA 2TMDA 3IIOA 1AMKA 1Q3NA 5FF2A 4G1KA 5FF3A 3THAA 5F4SA 2C16A 1O95A 1H7WA 3JRKA 3HOJA 1IF2A 1I2NA 3QF0A 3TAOA 1JR1A 4O10A 1GG1A 3I7QA 4ADSA 3UY8A 1VPXA 1QO5A 1AL8A 1QPOA 3S1UA 2CW6A 1QDSA 1F73A 2OZ0A 3LDVA 3WK2A 3UWUA 2V5LA 1EWEA 1SFJA 1BKSA 1M7PA 1OYCA 3MYPA 2BSLA 3MP5A 3KXQA 3MP4A 1VLIA 5FF4A 5AC6A 1TIMA 2BXVA 5CSRA 1F6PA 3NL3A 3W7LA 3TX9A 2YDAA 4UTLA 5AHMA 2ZCGA 4NVTA 3N9RA 4EIVA 1ALDA 2ZQ0A 1SO3A 2VELA 1XBZA 2PRLA 1KFKA 2GUUA 2WSRA 3B03A 1H5YA 3QRHA 4LU0A 1H60A 1DQWA 1KFBA 3TFXA 2ZZ1A 3LHTA 2XN2A 2VFIA 4WXZA 1XBYA 1R30A 3KOFA 1YTEA 4HNNA 4BI5A 1WDWA 3H53A 4QM1A 1XUZA 2YW3A 1GYLA 1GTHA 4LVFA 3TQKA 3UQNA 2PRMA 3QSRA 4MZ8A 1W3TA 3G1FA 4M6PA 4RKAA 2X1UA 3TROA 1K7FA 1OVDA 5K9DA 1DOSA 3EWXA 1Q6LA 2VEKA 3LRKA 3P5ZA 1YDNA 1O60A 3CPRA 1XCFA 2H3DA 3A21A 1NEYA 3BG3A 4WY0A 3C2OA 3VCRA 3P81A 4XQ6A 3QMTA 3C8FA 3PAJA 3P60A 1G4SA 2X2GA 3MHUA 1P0KA 2QEZA 1R2SA 1I2OA 4NUWA 2X16A 1H1ZA 3NYZA 3NQ7A 4NZFA 2A6NA 1FWTA 4HKPA 5C5YA 5CPMA 4ZQMA 5H91A 1PE1A 1TPUA 3VI2A 3G1AA 5AOUA 3O16A 4DF2A 3E12A 4RZ5A 3WK0A 5K4XA 3L5LA 3R13A 1FWRA 3SGZA 3W6YA 3AO0A 4AVFA 3LXBA 3PG8A 3MW7A 3GDRA 1XM3A 3W7OA 1X1OA 1FWNA 3BG9A 4AHQA 1GZGA 1OX5A 2GQAA 3P61A 2ALDA 4M6VA 1MEIA 1TQXA 1L2UA 1QNVA 4NQ1A 1PCWA 3W9ZA 3Q58A 5MHBA 1JJKA 3QM3A 3E0IA 4M5PA 5J5RA 5BMXA 3LCGA 4MFEA 3PY2A 4GNJA 1OFEA 2B0MA 5AHEA 2DP3A 3HJZA 3L5MA 4FNRA 4BF9A 1LORA 3W7DA 3W7KA 3B06A 4DO5A 4KFPA 5AHIA 2Z6IA 2Q8ZA 4GWEA 3ANYA 3OA3A 1OYAA 2VOMA 4RXGA 3STEA 3TMLA 4W9TA 1C8VA 1TTQA 4AWUA 3EWWA 1PVNA 5LNSA 3O6YX 4IPJA 4NXSA 1GEQA 3I6RA 1RQEA 1J4EA 4LS0A 5J5DA 4ZZ9A 4WD0A 4UTMA 1Z48A 4N6FA 1H7NA 1H7PA 4O15A 5KZDA 1TREA 3NEVA 1R46A 1B9BA 2A2IA 4NX0A 3A22A 4IX0A 1FCBA 2H8XA 4HSNA 1KM5A 2H90A 5L6UA 3BO9A 4A3UA 3W1LA 4N9EA 4OBTA 4NU7A 4Y96A 5C6MA 3P7YA 3VNDA 4XBSA 1VHCA 1VQTA 1EB3A 3LCWA 4HPXA 4O0KA 2NUXA 2X30A 1OFRA 2Z1BA 1FDJA 3JS3A 1F76A 1NAL1 3KX6A 1XKYA 5AHNA 1KTNA 6ALDA 2DJXA 3QQ0A 3QZEA 1H50A 1GYNA 2YXGA 2EHHA 4JDBA 3U2OA 1W1ZA 1TV5A 2XN1A 1OFBA 3LTYA 3SR7A 1O5KA 3A9IA 4FNSA 3H55A 1XDLA 2NZLA 1PL9A 2KZHA 5HINA 1RQHA 3TSBA 3W3OA 1KBIA 1JCNA 3WK3A 1NFBA 2ISSA 2YFOA 1W54A 4WZHA 4X2RA 3W7QA 3PBWA 5BOOA 4JX4A 1TSIA 4FNQA 3LV5A 4PEKA 2LLEA 3CHVA 4I9AA 1TRDA 2GQ9A 1R2RA 3NQCA 4PFMA 4JTHA 1G6CA 5D03A 1U5JA 5FI8A 1KM2A 3M5VA 3PR2A 5U4NA 4MY1A 3W1UA 4KWWA 2E5CA 3S5OA 1FCVA 2YPIA 4N9CA 4AAJA 2QAFA 4NJJA 2ZYFA 3GZ3A 3HBLA 1KM4A 3M9YA 1U83A 3F03K 3IEBA 2GJNA 2FIQA 2QCNA 4JTLA 2JGQA 4TIMA 3TV8A 1T96A 1R47A 3L67A 3DFSA 1FDZA 3DFQA 2G5WA 2V2DA 3GK0A 3CC1A 3SFKA 3BG5A 3N9SA 4EVZA 2A21A 4UTWA 2EKCA 3SECA 1TPFA 3DFOA 4AHOA 3G1VA 4L4LA 4P61A 2CZDA 4RX0A 1ZAIA 3P74A
chains in the Genus database with same CATH superfamily
1E3XA 2O7SA 1TTIA 3PHAA 4LYRA 1RY0A 1XRTA 1QNOA 5HWNA 1R3QA 1TV4A 1ZAJA 4ZQCA 1HGYA 4GK8A 4IL2A 4O50A 4M6QA 2VURA 3QC3A 4PUDA 3AWNA 4FSAA 1W2PA 1E0XA 1PCKA 2YCLB 1GVSA 1WV2A 1X98A 5K9XA 2ZZ7A 1POJA 3FA3A 2I1OA 1SFLA 3EMZA 5FJJA 4PULA 1XLAA 1E6RA 3T0DA 1CGVA 2OOFA 5CQ1A 5REQB 1L6FA 4ICCX 8A3HA 1VFOA 4US5A 1PKMA 4MWAE 4CN6A 3H22A 2D3LA 1A0CA 2PDMA 3W1NA 3ITXA 1EOMA 2P0IA 3VGEA 1YNQA 3GD6A 1QNSA 1S2TA 1IIGA 2Z00A 3SADA 1D8WA 2P10A 2R1LA 3C61A 4RNFA 5BCAA 3MQTA 3GNDA 2EG7A 5H8UA 5M2FX 1CXHA 3BMWA 4PMVA 5G1YA 4XG1A 4F4RA 5G2HA 2R94A 2YSWA 4D2JA 3NQGA 3RLVA 1JPIA 1H3GA 4KEVA 3ORWA 4JTAA 2O92A 3R0KA 1UMLA 1QI3A 4Z1CA 1JD7A 1ICQA 3RILA 2CHNA 2EBNA 1WDQA 3AI0A 4BK9A 3W1XA 4XUGA 3N19B 3WLOA 2BP1A 3D6NA 3T07A 1FWDC 4GYKA 3VE7A 3OODA 2FTPA 3DU0A 1B1YA 4Q8OA 2FQIA 1H7XA 3UG4A 2FKPA 3KOYA 4PN2A 1BHGA 5HPCA 3SSZA 1OT1A 5CEWA 1PIGA 4WJXA 1OM0A 3GH7A 4ADTA 3FVDA 5H2ZA 4DXVA 1GYMA 1OINA 5IHSA 3R94A 4H8NA 1TV8A 5HOSA 1FUYA 1ME8A 1R8LA 3SJNA 3S1WA 1TPWA 1VFSA 4S38A 4Z0JA 2DZVA 3GWQA 1YKWA 4DYJA 2PTWA 4UNLA 4MB4A 1UQYA 3G5EA 4PSRA 4EXBA 2WLZA 3DECA 1CT5A 4KCVA 5BMWA 4KEZA 5HNRA 1J0KA 1KXQA 2DZAA 3BLDA 4HOZA 1ZZMA 1QMLA 3B05A 4ZSTA 2YCEA 3ARPA 4D71A 1ISXA 2V2CA 3GVRA 2BMBA 1OGSA 2CYGA 4JOMA 4GQ0A 3H2FA 4GCAA 3TAKA 3IJ8A 4K8HA 1W3HA 2Z1VA 2WMKA 4HHHA 3RLGA 3S3GA 4QNWA 3BZJA 4IMGA 4E4PA 4K37A 1BWLA 1WXZA 1KRMA 2IKJA 4GUJA 2E1DA 4NASA 2FPTA 4GZ7A 4AISA 1I4NA 1UIPA 1HP5A 1PIFA 3CZEA 2R24A 2NXGA 4FIQA 4ZO7A 2FMOA 3G3MA 1OF8A 1UUQA 2PZ0A 1DYSA 2EG8A 3NWRA 4MSSA 4CQCA 3M44A 1EXBA 3CNYA 2WPGA 4HZMA 3WZ0E 3AHXA 3IGSA 1EC9A 3TN6A 3UD6A 1QU4A 3HV9A 3VOJA 3A47A 4PB3A 2ZZ6A 3ZQ9A 1SGJA 3P0WA 4MY9A 3GVGA 4PCTA 3KL3A 4DPPA 3FXYA 1OG0A 1PTAA 1SZEA 4FIRA 1E1CA 4KGLA 2Z2UA 2FZ8A 4M7SA 5E0FA 1U1UA 3QVQA 4P2VA 2XGBA 1EH9A 5FJUA 3GX9A 1SQ7A 3L9CA 3ZR4A 1ZBVA 5BRPA 4KWVA 3VUPA 3L2MA 3CV2A 4Q8PA 4MPQA 2ZUTA 3VKDA 1XXXA 1JUKA 3TCEA 3PF3A 3LPFA 4E38A 1Z9AA 1HIZA 3UEQA 1XCXA 3W2LA 4JX6A 2ZUMA 4JTTA 4UXDA 4A6GA 4J3TA 4JFTA 3W7GA 1V3JA 4K38A 4UCGA 4H2HA 4Z2LA 5DXXA 5DF0A 5LGXA 1BWVA 3WFAA 2PWEA 2Q3OA 1BYAA 1AK5A 5T26A 3B9NA 1XHGA 1SW7A 3OVPA 4TX8A 4UQBA 3NVDA 1MFVA 1XYCA 1ZCCA 3LYEA 2G50A 3IPWA 2UY4A 4FA3A 4BQ4A 4BHYA 2X40A 1NOFA 3W81A 2WCGA 2BG5A 4QG6A 1I0BA 4MJMA 4NP7A 5A6BA 3VIIA 1GTEA 4LBRA 4HYVA 5C54A 2CBJA 2UV8G 2Y7EA 3QFWA 3M6YA 3R89A 3B8SA 3EB3A 1PPIA 3OZOA 3MPGA 4ERIA 1UD8A 1KBKA 1X96A 3V75A 3AYTA 4Z2IA 4DUWA 4S23A 3HPFA 1A5AA 1W0MA 1W9DM 1IR1A 4LFYA 2FVMA 2Q8LA 3N73A 1P7TB 1LBLA 2BFGA 3PZUA 3GDTA 2E8YA 1MNZA 4JX5A 3N2CA 3ARWA 4REQB 4CLMA 1EJSC 1UWIA 3BCDA 4FR6A 4QIUA 1XD1A 2D2GA 1YDOA 3W1RA 2O4MA 4TX9A 3VNLA 4IIFA 4XB3A 1RA0A 4N2YA 2PUZA 1DXIA 3VNMA 4JYEA 1S5TA 2CZEA 4POCA 3CQJA 1TTPA 5B80A 1U22A 4GFSA 2HTMA 1YTDA 2EO7A 2ZX7A 1GKQA 1BVWA 9RUBA 1QJWA 3A64A 1AW5A 4IFKA 2YDQA 5G4WA 1F61A 1K9EA 3KCOA 1XIMA 5EMMA 4NJGA 3V35A 4IQLA 4DZAA 3EPOA 1V3MA 4JY9A 3WK1A 1OD8A 1TV3A 2GVLA 3TYAA 3BOLA 2PDGA 4B91A 2CBVA 4DBUA 1XL9A 1HL9A 5LIXX 4AW7A 3WBXA 3ZJ7A 4O0ZA 1EYEA 2REQA 2ZBTA 3KS6A 3D46A 1DJYA 3BLIA 4IPIA 2VEIA 2DPEA 5EL1A 4ZSUA 2QQ6A 3KLKA 1XWYA 2OPJA 3FHAA 3MJMA 1S46A 1TPEA 4L6DA 1XJBA 1FXPA 5A69A 4EX4A 3ITVA 4Q8NA 3W88A 3AUOA 4GVGA 4MJZA 4H9MA 3MYOA 1UASA 3QBUA 4GA8A 1EJRC 1SJAA 3QC0A 2PDNA 3TOPA 3QPYA 4UFMA 4YJ5A 1NTHA 1DIDA 3DG7A 4TVUA 3RIKA 2FJKA 2A3EA 2WHLA 5CJNA 3VDCA 4E6MA 4C1NA 2AGKA 4FS9A 1QI2A 2OQLA 1X7FA 4PBEA 3WLPA 2INEA 3M0ZA 1KGUA 2ZWYA 5D38A 1W3JA 3UG3A 4IMEA 4TU1A 4YTUA 4A4AA 3VKAA 5F1VA 3K13A 3M47A 3ITCA 3S2JA 5HR6A 4AQLA 3N11A 3WQ8A 4KIRA 4B15A 5E0KA 4AZHA 3AWOA 3CWNA 1PZ1A 3RX2A 4JR5A 5JIPA 3G3DA 2E9BA 4IXXA 4HIBA 3UPWA 3VGBA 3LGEA 3O0KA 3AIBA 1EPXA 2DY3A 1GQKA 3CAQA 1VENA 4QAWA 5BRQA 3ENLA 3GAKA 2FHFA 1A5UA 4JTUA 1MDLA 4P8VA 5T8GA 3W00A 5AYIA 2BBFA 1A53A 1YXYA 3Q37A 2ZUSA 3BICA 4KQNA 3FLUA 1BG9A 4XTIA 4ROPA 3NQ6A 3EPNA 4ZFMA 3AMDA 3NCOA 2ACRA 1JDFA 3A3HA 4MWAD 2O9TA 1JYNA 1JCMP 1D7FA 3TZFA 3LMYA 4US6A 1NP2A 2AL2B 2Q02A 4B2DD 5CZSA 4I9TA 5DMLA 1Q6FA 3FOKA 1YYAA 2XVKA 1HKMA 2EGZA 3QPEA 4OQVA 2Q09A 3TEVA 4KRUA 1UROA 2I7GA 4PTWA 2QUVA 1K02A 1OWQA 4XD3A 4IFRA 5I7GA 2IUZA 1Z6KA 3HIJA 3M64A 1TMLA 2ONEA 2RFGA 3B4UA 1B3XA 2XSXA 1FCUA 1X6UA 1IIHA 1H41A 5BROA 4JTIA 3WH8A 2IPWA 2JALA 4WDWA 5FF0A 2CLFA 4LCSA 2OSYA 1MXGA 4C90A 1VCGA 2GVJA 2UY3A 5HQLA 4PRRA 4AD0A 5HBFA 3STPA 3WH9A 3H7RA 1F5ZA 2WC7A 3CAWA 3FYYA 3NO3A 3WLRA 3IS4A 2FHCA 5AKQA 1XYZA 5HMEA 2QXWA 4P7RA 2BXYA 3E2QA 1XFBA 1WYIA 1IXQA 3WBYA 3TQ0A 1DQXA 2TYSA 1P0NA 3IAQA 1M65A 4HPHA 3A6OA 2F8QA 4QDWA 1KV5A 1V4YA 1NJJA 5HANA 2YOCA 2O9OA 2I56A 4WF7A 4W8LA 3N6QA 1W3KA 2DZSA 2DSZA 2Y4SA 4JL2A 4L9XA 1HX0A 3VE9A 4IJBA 4HSHA 3O6AA 1TZ7A 4HN4A 1C3FA 4I9JA 4MDOA 1LLOA 4F66A 4R7JA 2WPBA 3LX9A 3L4WA 3DERA 4O54A 4GY7A 3B8DA 4PRTA 3U2CA 5AECA 4RJEA 5AYBA 1UZHA 1Z32X 1M7OA 1QPQA 3W7HA 2I14A 4BF5A 4RK8A 2QUTA 4DBWA 2WLYA 2NX1A 2X2YA 1QCWA 1TWSA 4E4UA 1VR6A 4G8TA 5CZJA 1EJUC 2BS9A 5A8GA 2BDQA 1QFEA 3AU6A 2VFDA 4WCJA 3EWZA 1HJVA 1DTNA 3H26A 2YYUA 3P5YA 4MAVA 4UTTC 2P3EA 1LTDA 4X22A 3WJZA 3T0CA 1LWIA 1ZJAA 2BVYA 5CBBA 1KQYA 4DUVA 1G5AA 4CD7A 3EOEA 3RNDA 3UZWA 4NAEB 4GHRA 2YL9A 3CK5A 1DV7A 4IPPA 2D23A 2R8WA 3K8MA 2W0UA 4GD0A 2ACUA 4H9ZA 5TF0A 2FDSA 1JL8A 2XUCA 4UCFA 1KNWA 2TRSA 3TC7A 3IRDA 4JQ2A 2PTYA 4MYAA 1N55A 1QNRA 2X1SA 1W3NA 2VZVA 3H12A 2HE5A 1OFAA 4BI6A 2QCDA 3O05A 3IVSA 5GJMA 5HMFA 3CIWA 4D8ZA 2EJ1A 1SFTA 1R9YA 5C2GA 1DJXA 3QTPA 2GK1A 1GQNA 2J24A 4S3EA 1IZJA 2G96A 2WSQA 3B4YA 1QI4A 2CCRA 2ALRA 3URQA 2OT1A 3BCJA 5FSEC 3DAQA 3CUHA 3V0UA 4E2DA 1FH8A 4G5DA 5BYWA 5E6YA 5IFPA 3SCUA 5D05A 3OBAA 1YE4A 1LT8A 1EEXA 2XTKA 5LIUX 1YLVA 3IJIA 4A8RA 3NURA 3CPUA 7CGTA 1V6VA 1L8NA 2NX3A 1JCTA 3LPGA 4PTMA 5KZEA 4QEHA 4DJDA 3P80A 4PB4A 4P8WA 3MHFA 3COTA 3WQEA 4JHOA 2DZBA 2VD9A 4F0KA 4N9DA 3TJLA 4MGGA 2VEMA 5FJRA 5H8MA 3FN9A 1V77A 1WCGA 1XIGA 3FK4A 4QTGA 2DT3A 1MUCA 1AJ2A 1TCDA 3UPMA 1H11A 4UFJA 1ITXA 5I06A 4LH8A 3A4XA 3WH7A 1THFD 1QATA 4NF7A 1Q6QA 1DIKA 1XRVA 3CTTA 1OJXA 1XLBA 1H0GA 4O8RA 3E96A 3K4WA 4ES4A 3UZZA 4GI6A 3ITLA 5KITA 3NVTA 2WWDA 1IGSA 3GB6A 3UF9A 1WAUA 3KWSA 3UYCA 3Q45A 1NH6A 2DIEA 1EBHA 1T41A 3GH5A 4RUBA 4CGTA 4AHPA 1A5OC 5LXEA 3D47A 3MUIA 4FNUA 5LHFA 2BGSA 3SCVA 1RH9A 4AF0B 4DI9A 5JBDA 1SSGA 4ZXOA 3MY9A 1KM3A 4GO8A 2OQHA 2V3GA 1RD6A 5KMYA 4NHVA 3W26A 3QV7A 2WKLA 4CNTA 1B90A 1FOBA 4UNIA 1TWWA 3NQEA 5GQBA 4FNPA 4WRHA 4O57A 4ACYA 5HQMA 1ME7A 3KL5A 3VCNA 4NJKA 3W23A 1BF6A 3GIQA 1U33A 2PWDA 1ZRQA 3PBUA 2QCEA 3OBEA 3NPWA 3WF2A 2TAAA 3B40A 3CO8A 1GOKA 3MVIA 3ZOAA 4KETA 1Q2RA 5CPSA 5HA7A 4XD4A 1SJBA 5CC5A 2BV9A 3WQVA 4KCTA 3W0KA 1V7AA 1HKVA 4L61A 5DQPA 1LOLA 4UQAA 3MDUA 2W62A 3XINA 2HPMA 3UCDA 4CUCA 5CH9A 1GKRA 1F6YA 3GHTA 2POZA 1IZCA 5CZ0A 4OBRA 5DLCA 2G0WA 4U4MA 4AVOA 3TJIA 3UXKA 1CX9A 3ZSSA 3TYEA 1DXFA 1FDYA 2PWGA 3ITYA 2QUMA 3M16A 1ZB5A 2Y7FA 2ZZ5A 3NSXA 1RJPA 4DBDA 3QZAA 4LYKA 2Z24A 2B7NA 3WD0A 3SI9A 2IKGA 4R34A 3RJXA 3GXMA 1A0EA 3M7SA 2BXZA 2WHKA 3IGXA 2VC5A 1JZ7A 1VYRA 3LSBA 4AZGA 1BQGA 3HO8A 2D69A 4GVFA 1MI3A 5AYZA 3PTMA 5TAOA 2HVOA 4JHMA 1ZNNA 1SO4A 5LNRA 3T2QA 4D6GA 1ECQA 2ACQA 2Y63A 2F6XA 4L9ZA 4AC1X 1KM1A 3V1PA 2V8ZA 2YBVA 2X09A 1EGMA 3SFWA 3S2LA 1XGEA 1XGZA 1Q6RA 3RO8A 2FTYA 5I3FA 1JZ4A 2KAUC 1F9CA 3ARUA 3OO2A 1JNEA 3OQ8A 4ZGYA 1FWIC 1US2A 1GK8A 2A7NA 3GNNA 4ML9A 1DKWA 1FRBA 3REQB 1L8PA 1V6UA 1QK2A 2PF0A 3NA8A 2VC9A 3FAWA 1XI3A 3G77A 3CM4A 2J7FA 2ZC8A 1B9ZA 3TA6A 3QQ1A 1Q45A 3EDEA 3LUTA 3EDJA 3DXIA 3BCFA 4W8AA 3LI1A 5K3VA 3R25A 1W1IE 2YCIX 1UD6A 4FF5A 4UFHA 2VEPA 3FDGA 2VCBA 2W4XA 4YVVA 4JHZA 2V81A 4NJIA 1B2YA 2D3NA 2GPTA 1BTMA 3ZJ8A 5IFTA 5KETA 3MSYA 4I7VA 4AWTA 3QW4B 1QOQA 3L21A 4GQRA 1KBBA 4LAMA 4YL2A 1SO5A 2PDUA 4MWAB 3VOIA 1J18A 4EK7A 4LUYA 2Y7GA 5HR7A 4GE8A 4LUJA 4HA1A 3APYA 5EA9A 3CXOA 4RCXA 3SGGA 5KEZA 5LHEA 4JIRA 3WQPA 4Q33A 4W8BA 3BGJA 3W76A 3NSNA 1MSSA 4ADUA 4FOKA 1S3HA 4KESA 2OQYA 5CPQA 1BFNA 1JULA 1XIDA 2DIKA 4E8GA 2GDQA 3OIXA 1CLVA 4OGZA 3GTFA 3LTPA 3NAVA 1KM6A 3H54A 3ZJKA 1P1XA 3TTQA 1E5NA 1R87A 3SN1A 2E7FA 3BLEA 2NV9A 4YVXA 5HJXA 4NL1A 1J01A 1L6WA 2NQZA 4NAFA 3R11A 3PNUA 1HJXA 4UMCA 3VD5A 4RLIA 1XH2A 1PZ2A 3TZNA 3CMFA 2C19A 4K6AA 1GOIA 3ZYZA 4IPNB 1OABA 4QE4A 3V16A 1JI2A 1UZ4A 4J40A 2ZA1A 4AMAA 5HUOA 4AIUA 1L6GA 1ONXA 1X7IA 1RUSA 2GFTA 5FF3A 1CGWA 1KR0A 2WVVB 1J93A 3JRKA 1IF2A 1I2NA 1VB9A 4HA3A 3TAOA 3V3WA 4PTDA 3GBEA 4O10A 3OQEA 3R6IA 3LA4A 3RCYA 2OFJA 4GIAA 1R86A 1F73A 4DYKA 1R7OA 1IEXA 1CLKA 1SFJA 1BKSA 1XR2A 4XO6A 3AJ7A 3H70A 3KXQA 3WD4A 1A4MA 1OT2A 3PTDA 2ZXQA 4M24A 1TIMA 1UPPA 9XIMA 4HYWA 4RNIA 3W7LA 1H4PA 2AL1A 1PBGA 4FOJA 2PRLA 2HXUA 1X38A 3WL0A 3B03A 4E4FA 1K9TA 5A6TC 1EKOA 4W5ZA 1H60A 1O66A 3MV01 2ZZ1A 1HJQA 3KOFA 4E8CA 4QM1A 4WDUA 4X60A 4KWUA 1AH3A 3C8NA 1HJWA 3QGVA 1JYVA 4RL3A 2PRMA 3UQNA 4YNGA 1IZKA 2VT0A 2X1UA 2PDBA 3GIPA 1VFLA 3TROA 1Z7AA 3FHQA 1E9YB 3FVMA 4YPJA 3CL8A 3IUHA 3LRKA 3GSMA 3I3DA 5DMNA 4L65A 1UWSA 3A21A 2VWSA 3VCRA 4LBUA 3FGCA 3MSRA 5CC7A 3PAJA 1WDPA 2X2GA 2QULA 1P0KA 4I5UA 4RDVA 1I2OA 2HK0A 1H1ZA 2E9LA 1YHTA 3BUVA 3AC0A 1FWTA 3TLLA 3H2MA 2ACSA 5C5YA 4ZQMA 1PE1A 4OECA 3O16A 4GY0A 3E12A 3I3BA 3VUSA 4K1WA 4AVFA 3UESA 2W5FA 2HXTA 1UC5A 2FGLA 3PBMA 1X1OA 1FWNA 4AHQA 4Y9OA 3AISA 3P61A 1QNVA 3MS8A 4AY7A 3NOYA 5MHBA 3RYSA 2W63A 3QM3A 3W53A 4DJEC 5FJPA 1UW9A 1PZ0A 4QEEA 2WMGA 3HJZA 4IFOA 3KEHA 2BODX 2WMIB 1M1BA 3W7DA 1MW0A 3T0TA 4B5UA 1DWIM 3ARRA 4H8UA 2Z6IA 3WLLA 1NP0A 4GWEA 3B8IA 2VD8A 3OA3A 1B5TA 4W9TA 3RHGA 1WKYA 1LL7A 1PVNA 1U5VA 2D0GA 2XFYA 4DNMA 4QS5A 4KWOA 1GEQA 4HU8A 3I6RA 2VZSA 2IQ0A 1QBAA 3PJXA 1AH4A 5J5DA 1S38A 1UP3A 2PMQA 1YW1A 1H7NA 4WKAA 5JH2A 3USZA 2DSKA 4O15A 1BD0A 3PZMA 3HTWA 4FR1A 5MKGB 5BOFA 1B9BA 4GQBA 1JG9A 1C93A 2A2IA 2OO0A 3OHMB 1KM5A 2VX6A 3BO9A 3RM4A 4NU7A 4LANA 3P7YA 4MG4A 3VNDA 2RGMA 4V1XA 3N29A 2NLYA 1OFRA 3LEPA 1EZWA 2E9MA 3UYIA 2OELA 4J3VA 1RBOB 6ALDA 1Y5WA 1H50A 1GYNA 4AD3A 3WQ4A 4OTKA 3U2OA 1W1ZA 1TV5A 1OFBA 3WD3A 3GQYA 1GORA 2ZVIA 1XDLA 2NZLA 1PL9A 4I90A 1TV2A 2XFRA 3M4HA 4W88A 1MDRA 3HU7A 2P50A 3W3OA 3M0JA 3PJTA 1W54A 4D8LA 3ZSTA 3W7QA 2OGYA 4JX4A 4FNQA 2ANUA 1OIFA 4JTDA 3CHVA 3WQDA 3GBDA 2XH0A 4JTHA 3RN6A 4YYCA 4FMVA 1G6CA 3SN0A 5LIWX 3CS2A 1FTXA 1V6YA 3PR2A 4MY1A 5A6MA 1OEPA 2X0HA 4XSLA 4RPPA 1W1PA 4N9CA 2ZYFA 4AD5A 1FWEC 3UCQA 1MNSA 1X6NA 2FDMA 1E43A 4B5TA 3V5OA 2ZUUA 1DJHA 3TV8A 3L67A 1FDZA 3DFQA 1MVYA 2V2DA 1FWAC 3GK0A 3BG5A 4EVZA 2A21A 4LALA 4ROQA 4UTWA 3AU2A 3SECA 4L4LA 4D72A 5CC3A 3LG3A 1UOZA 2PWVA 4PMOA 3P74A 1FVPA 4P7QA 1EIXA 2BGQA 3PC0A 3K30A 1TVNA 3CLMA 4LT9A 1VZWA 4K2SA 1ZP4A 2I5IA 2OB3A 1BGGA 3ARTA 2AQOA 3CAKA 3O7UA 3C2FA 4DBEA 4PTXA 5D30A 5A8OA 5CLWA 3FJNA 3NXFA 1CENA 1WUFA 3AIEA 3VOFA 4G7FA 3R8GA 3TLQA 3AIQA 4GYJA 4HNOA 4K7YA 4XZWA 3SRFA 2WKGA 1ML1A 4Q6JA 1O5RA 2VL4A 4OUIA 2CXEA 4PBFA 3MI6A 3E49A 1EZ2A 3W2JA 2G95A 3IJDA 5J04A 4B4HA 3CASA 1UA7A 1SW3A 4URIA 3P2VA 5FOOA 4G9PA 2WKJA 2GQ8A 4L4MA 3NYDA 3OW1A 3S5YA 4JQ3A 1HL2A 3TYCA 4C91A 3H4XA 1CDGA 3CYJA 1B4KA 2YX0A 3DHFA 1XLIA 2CLOA 3WNMA 2Q8XA 4RNHA 1E1CB 1LLZA 3BGAA 4JFSA 2IXVA 4TUFA 4PUKA 2VVSA 2C13A 4HZ7A 1W2VA 1I45A 4RPQA 3UNDA 1ADSA 2HCVA 3R79A 3LGDA 1N8FA 3QKEA 4UMAA 5D33A 3STCA 2BHYA 1LOQA 5HK4A 1NDVA 2AKZA 4O4VA 3N15A 4IIHA 4HOWA 5AC8A 4KCWA 4C7FA 3F4DA 2WQPA 3EWUA 2QV4A 2RJHA 1D9EA 5E6ZA 3NPXA 4MAZA 3GC4A 1TO3A 1G7VA 3EPMA 3UJEA 1A50A 2G97A 4LY4A 1T40A 3PB2A 3WDIA 3AMCA 4UTTA 2HV5A 5FEXA 3VIFA 1FX6A 3BSMA 1T0OA 3KAOA 3QZ6A 4I6VA 2G3NA 3RFAA 1QNQA 4WKHA 3WY1A 5HMSA 3QR3A 2E6YA 1SJDA 1CCWB 3E74A 2E25A 3OLIA 1GVYA 5EMYA 3EOUA 1V51A 4QDMA 2JBMA 3I7SA 4W4QA 4V15A 1MZRA 3LB0A 4MNLA 3H7UA 1KM0A 1OGBA 4J2MA 4EPBC 3QY6A 3DESA 5FAGA 5CGQA 1J12A 2XIOA 3KBMA 3R43A 4C7GA 3TQPA 4AEOA 1QHPA 4LAOA 3VKKA 3LCHA 3GNRA 3LK6A 2V82A 1RAKA 3EDKA 3W7JA 3GR4A 5XIAA 5DCDA 5IDIA 3E5BA 3UPBA 3WL1A 4I9MA 4XAGA 3N2MA 3G8EA 1R3RA 1Q5MA 2CZ5A 4O1BA 2XIQA 5JQ9A 1DVJA 2ZVRA 4GYPA 3VO0A 3W74A 2ZRVA 2PEVA 3CUXA 4MF4A 4KIEA 4ICMA 2PDQA 3RCNA 1KTCA 1F4AA 2WO5A 3EOLA 3AALA 4RR4A 3PS7A 3BZGA 1G4TA 1IXPA 2VX4A 1EDQA 1KWGA 4UTUA 2YZ5A 2AQVA 1DE6A 1R3SA 2QCFA 2QVHA 3ES8A 3N4AA 2ZRZA 2BY3A 2OKTA 1M7XA 1G01A 3N25A 3AXXA 3OIHA 1K03A 1CB2A 1TUXA 1XLFA 5AHFA 1AUSL 3GLCA 2VJXA 4AZ7A 4XAPA 3I4EA 2GJLA 8XIMA 5GPRA 3W82A 1VS1A 4H6KA 1XH1A 1IT7A 4R53A 4Y8FA 2UZ9A 1GKPA 3AHTA 1XYAA 2HS8A 5EMUA 5TNVA 4JQAA 1QBBA 5AY7A 3K8LA 3G1XA 4UBPC 3TMQA 1T8QA 2REQB 3CLWA 4IP7A 3AIWA 1BVZA 5FEZA 5D9MA 2A3CA 2O4QA 4JFUA 1AQ0A 3HPAA 4QROA 1ZALA 1AD1A 4HTBA 4L5ZA 1VD6A 3PG9A 2WANA 4OHQA 1QOXA 2PDXA 1HQTA 1SVDA 3PZVA 4AYSA 4P7OA 1DHPA 3W75A 4RE4A 2RGLA 1JD9A 5J8LA 4MB3A 4UTFA 1IGWA 2NVCA 3M41A 4UFKA 3D3AA 5CGTA 2CHOA 4KERA 5HPOA 2HVNA 4EXQA 4MTVA 4C1NB 1KV8A 4OJYA 4Z1DA 4B9ZA 4IIGA 5JBFA 4YU1A 5EFDA 1S1RA 1QR7A 4BEQA 1RV8A 1PX3A 4YYFA 2WQDA 2IQDA 4JYDA 4BWLC 3GXTA 3PUDA 1NWSA 2FYMA 4CNUA 4PMDA 3MZ2A 1FWSA 2Z2AA 3O15A 3QKZA 5H6HA 2QJIA 3TW6A 2QCCA 2NV2A 5BU6A 3BARA 5I78A 7A3HA 3VOHA 2PTXA 2JK2A 4PMJA 6XIMA 2G3FA 1EF2A 2J74A 4H83A 1OSEA 4ZBCA 4QLLA 1Y0EA 5G2IA 3VIOA 4UTIA 3MKVA 4IF2A 4I8YA 2G37A 1OCJA 3ABSA 4GX8A 3CWOX 1B3ZA 3G1SA 1BXCA 2VQTA 4M81A 1NVMA 2CEQA 3B04A 3KRBA 3NM3A 4ZENA 2R1PA 3WEMA 1Q63A 1YQ2A 3GNXA 4HMNA 2X1IA 1K7EA 2ABBA 3S2CA 5IXEA 1JPDX 1PYMA 3LXAA 3PB0A 3UCCA 1UJPA 5ABHA 3NL2A 5JVLA 3H2AA 5CCZA 1R0MA 2J7DA 1JZ8A 2CZFA 6PTDA 4B5SA 2QF8A 1XLHA 3KHDA 2HVMA 3QGKC 2NQHA 3MCNA 4NKCA 4O1CA 2EPMX 5D9NA 4AZ6A 5AC7A 4ZTXA 1JQXA 4OIFA 3FJ4A 5E9AA 3VFLA 3U7BA 1IT0A 3WF1A 1UPMB 1FWWA 2CETA 4JL1A 3ARQA 3EA3A 2GGIA 3PZOA 3W07A 2BLEA 4IQJA 1R6WA 3IVTA 3ARXA 3BAXA 4FF7A 2QR6A 4JTEA 1R3VA 2F84A 3GTHA 3OJGA 5ABEA 4BEUA 3HF3A 3QYQA 4JIEA 1E56A 3A3WA 3MDWA 1VYPX 4TOQA 4NZ3A 4PEEA 2ISFA 4ILSA 3W2MA 2XH7A 3GR8A 5RUBA 1MEHA 5AC4A 2V3DA 1A47A 1G4EA 3TVAA 3MKKA 3WN6A 3ARVA 3IIPA 3ZJ6A 2Q71A 1EP1A 3ISIX 2X0SA 4V1YA 5M3WA 4AX7A 3N6JA 4ATDA 3P84A 5C2XA 3THDA 2AMXA 1Q6GA 2VR2A 5D2YA 1XPYA 4DLFA 4HNUA 4IWWA 2QT3A 1XLJA 4DF1A 3EOSA 3W7RA 3SUVA 3GKFA 3PZTA 1PB0A 3R58A 4J28A 1EJ7L 1UCWA 4FEZA 4HD5A 1NOWA 3CUJA 3LNPA 3CHEA 4QBXA 4CNSA 1V93A 4IICA 4KMQA 2AMGA 4R9OA 1EDGA 3HQOA 1MFUA 1H5VA 1EFZA 4JDYA 2YA0A 4FZIA 2GL5A 2VQUA 3MU7A 4LC6A 3EEGA 5DY3A 3DG6A 1IXNA 2BOGX 2FVLA 4LAKA 1KGWA 4NYUA 2W79A 3UR5A 4S2CA 1KFEA 1XYBA 1M53A 3MHGA 5HWJA 2DT2A 2PBGA 3BW2A 3M0KA 5CPTA 3NGJA 2VX7A 2ZFAA 1Q7QA 5TIMA 4JIIX 3UG8A 1JEZA 1KLYA 2VWTA 2ISDA 4ORIA 1GNXA 1VLWA 3WF0A 3CUFA 4CQBA 1W91A 4LUIA 4XVEA 1ZFJA 3FJLA 4H9VA 4H04A 1JYWA 4HT3A 4XO7A 3O6CA 3PZIA 2E8ZA 5ABTA 4ACZA 3G6MA 4GI9A 1VYSX 3CZ8A 4OBSA 3RMJA 4WLCA 2QCHA 3S4TA 1GVQA 1XIBA 4AZCA 2YGYA 1K4HA 2QIIA 1P6WA 2FH6A 5KTLA 1ZY9A 3QOKA 4O53A 3AS3A 1AQHA 2P1FA 4NZJA 1OHLA 1LLWA 1XFCA 1E6SM 2CKRA 3KVMA 4LUTA 2NXHA 5FCZA 4GYFA 4BI7A 3GIYA 4QSFA 4FB7A 4HQVA 3UGVA 1PDZA 1J79A 2OJPA 2QUNA 1OGGA 3ZM8A 1W5QA 1IHIA 2J6VA 1T99A 3L4YA 1KFCA 2QCDB 1A3XA 5CKSA 1UZDA 3PTQA 1MZHA 7ENLA 2WM0A 2CLPA 3ONBA 4KH2A 5A8PA 3SIMA 1VJIA 4ATLA 5I02A 1J2WA 2ZRUA 3BGGA 2GGJA 1E72M 3C2VA 2GK1B 3DKLA 1ZJIA 2WWCA 5K2ZA 2QS8A 1GVIA 4FP1A 3TP4A 3SRHA 2PDPA 1I2QA 1LQAA 4JNMA 4QP0A 3URNA 5A6SA 1E4LA 3MUAA 5BOEA 5IBXC 3LHYA 1AODA 2XZ7A 1JCLA 3O07A 5I79A 1GW9A 3LCLA 3S47A 1VCFA 4LWWA 2Y0FA 1BXBA 3V18A 1WOBA 4UOJA 4CEXC 1GGOA 1UH2A 3CIVA 1UH3A 3T09A 3C86A 3W02A 4M7TA 2RHGA 2Y61A 2VFHA 5KZ6A 1LYXA 3TUUA 4AG0A 4TV6A 3U48A 1DORA 4Q4KA 1HUVA 1KGXA 2ON3A 3LERA 3TH6A 2YYTA 4JTJA 3MO7A 5ENLA 2FPYA 2A0NA 2DSVA 2VM8A 4YN5A 1NQ6A 5H1WA 3CH9A 4IMFA 3WYZA 4F9JA 1MO0A 1SZNA 1Y5XA 4U28A 2OYKA 4MFDA 4K39A 3ZFHA 3PVFA 3EZ4A 3IACA 1WA3A 4XBJA 1XLGA 2HBVA 3L0KA 4YWIA 4J3WA 1ECEA 3KRZA 4MNMA 2DJLA 1W9XA 5EMLA 1JI1A 4UQ9A 5G1MA 3W73A 2DV0A 4O19A 1Z69A 4S3JA 4IIEA 3V5FA 2GYIA 1R3TA 1FHDA 5I3DA 3GG7A 1MW2A 3KBWA 4E3VA 3GS6A 3EDFA 3QY8A 4HOXA 3WO8A 3U4FA 4XZ9A 3F2BA 3W70A 1XIHA 4C6JA 4J5NA 2ZIDA 3CB8A 2XVLA 1XD0A 1KRAC 1TX2A 3ABQA 4GZIA 3VCCA 2OYLA 3CV6A 1XG4A 2J7HA 2WMJA 2W61A 2WYSA 2YA2A 4X61A 2GJRA 3IJ6A 1J0HA 2H6RA 4QSHA 1DWJM 3OHIA 3SZ8A 2B4GA 2RJGA 4FO4A 3CIXA 4DELA 1DTUA 1ZAHA 3U2ZA 4GMEA 3N34A 5AFDA 4G7EA 4KRTA 1SU5A 1EL3A 4Y9AA 1HKIA 3V5CA 3AXHA 4Q8QA 3LLFA 4AU0A 1CPUA 3SQSA 2XHYA 1XQLA 2MNRA 2J88A 1NU5A 1HL8A 2F7FA 1ZL1A 1A5KC 2QDDA 2Z4GA 2ABAA 1WPCA 2OGJA 1VGAA 1ONEA 2RAGA 3UGRA 3OLGA 1H7OA 3C2RA 3R8HA 2VENA 2DQXA 1GUVA 1L6YA 3NO1A 3HG4A 4O17A 1PAMA 4AUBA 3VOGA 3LXCA 4QGCA 1DJWA 1EP2A 1UMYA 3GDLA 1V6XA 3QW3A 3OZYA 2PP1A 3A3XA 4DPQA 3DBNA 3FA5A 4LV9A 2R82A 2PGEA 5B7YA 2J8FA 2V67A 3GTIA 1PEZA 2IW0A 2J9YA 3I68A 4MZYA 4O1AA 3HGSA 1OK6A 1ADOA 4Q4QA 1XP3A 1OCNA 4YXGA 1S2VA 5I00A 3WF3A 1ICSA 2ICSA 2VZOA 3WNOA 1QHZA 2P5NA 3NJ3A 1ELSA 1PIIA 2QUUA 3DFPA 1BRLA 5DXYA 1KA9F 3WJYA 2HJPA 4J2PA 3TXVA 2VDHA 1UJQA 1E73M 2YJQA 4JN7A 1E55A 1ISZA 1H61A 2NW0A 3AZRA 4F2UA 1O6IA 5C70A 2QHAA 1NY1A 3DFTA 1R7AA 3VIMA 2ZTJA 1SJCA 3RX4A 4JICA 4B5NA 3GR7A 5ABFA 4MUPA 4YLWA 1VRDA 2ESCA 2OX4A 2CNCA 2V6AA 1JGIA 3CV7A 5HNNA 1V3LA 3ABRA 5CPNA 4B3KA 1KRBC 1OFOA 2PDYA 1E4NA 3EXRA 1DJQA 1EJVC 3RCMA 1JGMA 2B7PA 6XIAA 1P4CA 2WOQA 3DFNA 1YE6A 4W7UA 2Y70A 2ZZ3A 4DJFA 2Y24A 2PLMA 3GU2A 1PUDA 3PSWA 1IV8A 4LPCA 1G4PA 1ICPA 4AD4A 4NYYA 4KEUA 5G4EA 4K3ZA 2YL5A 3C3NA 5A2BA 4PMZA 3A4JA 3GXFA 3IJ9A 3GUGA 5ECUA 4J3SA 3USBA 3PAOA 4OV9A 3S6DA 1SR0A 1NELA 1GOQA 1RJQA 4M82A 2AOSA 3E6EA 4UR8A 4S1FA 5LIYX 1VC4A 5A2CA 1BF2A 1TPH1 3BH4A 4IG2A 3BDKA 3OVRA 3WCZA 1QAPA 3BANA 4HU0A 2QV5A 3GU1A 5LNVA 2VUYA 1QWKA 2FB2A 2EPKX 1Q6CA 2ZTKA 2HBXA 3VKCA 3L4UA 2C0HA 4MWAC 1OZQA 3QV6A 2H3BA 4INFA 3AXKA 3IIVA 3E02A 3BMXA 5BW6A 5D8WA 1DIEA 1RK6A 1V5XA 3WELA 5H8PA 3VZZA 2V38A 3TNOA 1FWJC 3CQHA 2F2HA 3TK7A 2ZA2A 3LENA 3LI0A 4GOAA 3S1XA 5D9PA 3B0XA 4HJFA 3VD7A 1U1HA 4RZ6A 1EO5A 2IXUA 3PP7A 4U10A 1V0MA 2C7FA 3CT7A 3S1VA 3U5YA 1LRNA 3P93A 3HA1A 2V9DA 1NSJA 3GG0A 1YIXA 3R0DA 1N8IA 4QXIA 3FIGA 1UKOA 2EF9A 2J8GA 1KXTA 4DAFA 3W7NA 4CD4A 3DYMA 1MYRA 2PDKA 4E2VA 1ESWA 4QFUA 4BQ2A 4IUOA 4JN8A 5CZTA 2V5JA 2ZXDA 1TR9A 2I17A 1QXLA 4PSPA 4PMXA 5CJMA 1AW1A 4S3FA 3F4WA 3N9KA 3H24A 4KWSA 2C0AA 1EC8A 7TIMA 5CSUA 1EX5A 1HG3A 1F3WA 3BK0A 3DC8A 1XW8A 1V7YA 4YS1A 4NAFB 4A05A 4HZ6A 3I10A 2CLEA 1Q6OA 3B9AA 2HK1A 3KTSA 1JAEA 3SO7A 2F6UA 4RW5A 4PC8A 3U4AA 2IPJA 4CCDA 4CVUA 1EYWA 2WW5A 1WUEA 4WDTA 2ATSA 1HO4A 2J13A 3NQVA 4LJ3A 1TTJA 5JH1A 1QPRA 3NQAA 3PN8A 2QJGA 4PUEA 1QW8A 4ZQNA 5EU9A 3R10A 4ZOCA 1WDSA 5D2VA 5FL0A 3UWWA 2E0PA 1QUMA 1FHVA 3ZVIA 4HU4A 1VEMA 1VBUA 3T0BA 3LNMA 4CN1A 5CSYA 1O12A 1MXDA 1IEVA 1Q13A 1A4LA 2J75A 4PRWA 3DENA 1EQCA 3SAZA 2GDVA 3T4CA 1ZU8A 4J3XA 3WBWA 4ZOEA 1BVNP 3LM7A 2O9PA 2I5QA 1K4GA 4B5XA 2DZTA 3TTEA 1M01A 3H7VA 2J27A 1QO2A 4AZIA 1K7XA 4UTKA 1Z42A 2VGFA 2ZXAA 4KBXA 5HQEA 2R1KA 1O5QA 7PTDA 3SB0A 3MV11 3W6MA 2W67A 3TFCA 1W5PA 1UBPC 1HGWA 3URBA 4DN1A 4A2RA 3MTWA 2WNZA 1AW2A 4HP5A 2PWHA 3THQA 3VGDA 1B31A 4Z1BA 1UHVA 3DBPA 1O1ZA 1GZ1A 5CXPA 1BYDA 4GBUA 4BFAA 3RPMA 4D1JA 2QZRA 4C5ZA 4MJ2A 4CEUC 4UTHA 4JEQA 4HHMA 4HNTA 3QTGA 3FGCB 1PJ9A 4X2PA 2CLHA 3T0AA 1UKQA 3VTRA 2J47A 4CNPA 2CFFA 4LYQA 3FV9A 3KLLA 3UZJA 3OP2A 3W1TA 4GZEA 3QSTA 2VHLA 3SRKA 1E6NA 3LMZA 3EKLA 3JVAA 1V3IA 3H6OA 5G1TA 3S9IA 1U2YA 1C8QA 1PKYA 3E0FA 2WK2A 2BX7A 2YDSA 1L6SA 4FX7A 4F8XA 3NPUA 1AZ2A 4GXWA 4BQ5A 1E6PA 4GQQA 1ME9A 1LF1A 4LB4A 1XLCA 3WQ6A 3QEZA 1OX4A 4OOZA 2EPOA 1A80A 4MUZA 5D37A 1TELA 3ALGA 1GG0A 5FIPA 3RM9A 1LM1A 4E2BA 1SR9A 1BKHA 4W7WA 4W89A 3VINA 1R2TA 4OU1A 3FJ6A 3OTRA 4H6QA 3PUEA 4M19A 1OK4A 4HVXA 4H7VA 4Z0SA 1H62A 3HQ1A 2CC0A 3EOOA 3OLEA 2FHBA 2NX9A 4GG9A 1QK0A 5I3KA 2Q3RA 2XISA 4O4WA 4E3TA 1EUAA 2QMJA 3OOQA 3WEOA 2JKPA 4D9PA 3U9IA 1PHQA 3UJSA 5CAKA 3O06A 1CXEA 3G2GA 2FFCA 1R38A 1VFTA 4DY1A 1O68A 2GSEA 1EA9C 5FF2A 4G1KA 3THAA 1O1HA 3B8WA 1H09A 3HOJA 1GG1A 1XX1A 4XSMA 3PPCA 1KRCC 4ZXLA 3F2CA 1AL8A 1FP9A 2CW6A 2DSWA 3WK2A 2V5LA 1EWEA 2ZDSA 1M7PA 4J35A 1PX8A 1PSCA 2OTDA 5XIMA 4L1GA 5AC6A 1J11A 4MPKA 4JKMA 1VJSA 2BXVA 2GGGA 1A5MC 3NL3A 1IWPA 2Z1XA 3WUBA 2ZCGA 4EIVA 1WZLA 2VCAA 1XBZA 1KFKA 2WSRA 4FPSA 4MB1A 3UA3A 4DXXA 1FKXA 3GYCA 4WSJA 1E70M 1V0KA 4ZB2A 3RR1A 3AHYA 4J4KA 3VGGA 4O8AA 1E6ZA 1R30A 3GC5A 4HNNA 4BI5A 5I23A 1WDWA 1XRSA 1E3ZA 3B9DA 1JFXA 1AFSA 2YW3A 2P53A 1LT7A 3CHCA 1JZ6A 4HMDA 4MZ8A 3W28A 2BVTA 3G1FA 2PDWA 4LQ1A 5K9DA 4L6HA 1DOSA 4C6MA 3E2SA 3EWXA 1Q6LA 3NDZA 1M7JA 1O60A 1XCFA 2H3DA 1NEYA 1YDYA 4XAFA 4WY0A 4DWDA 2WJDA 4KGJA 2Z27A 2PDHA 2Z7GA 2XIBA 2Y8VA 1HF6A 4RDWA 4O0QA 3GRIA 4I8DA 1R2SA 1NFPA 2PCEA 1GONA 4KW2A 3BE7A 4V27A 3NYZA 3RUBL 3VNYA 3M46A 2ADAA 4JFVA 3ZLFA 5CPMA 1TPUA 3QGAC 3VFCA 5AOUA 3VKBA 4DF2A 3CB3A 5LA1A 1OQFA 9XIAA 7ODCA 2JEQA 3SQMA 5TD4A 4GKTA 3MW7A 3GDRA 1VKFA 2ZUWA 3VPLA 1OX5A 2GQAA 2ALDA 1MEIA 1UWTA 3Q58A 1JJKA 3WSUA 3KOWA 1EQPA 3AS0A 3UVIA 1J0YA 3LCGA 4MFEA 3PY2A 2B0MA 5AHEA 2ZE0A 2DP3A 5I0DA 3PZQA 1NWTA 2VR5A 1SMDA 4FNRA 2VOTA 3E0WA 1UR0A 3W7KA 4H8VA 2YXXA 3B8VA 3TMLA 1C8VA 1QW7A 2BY2A 4IJRA 4AWUA 3MWCA 3L4TA 3K2GA 2CBIA 3TTYA 5LNSA 4GH3A 2VZTA 3VDAA 1J4EA 3VIJA 1EBGA 1FFRA 4UTMA 1H7PA 4PFHA 3WLKX 1TREA 4NX0A 2H8XA 3EWDA 3UBPC 3PANA 1TE6A 1IYXA 5C6MA 3HURA 5FL1A 4C6DA 1UR2A 1MQPA 4Q8TA 1VHCA 1VQTA 4RE0A 4HPNA 3ERPA 1VPYA 1Q8JA 1A5NC 3KE0A 1XKYA 1KTNA 2V5KA 4TXEA 1UR8A 4F0MA 3QZEA 2BASA 4A35A 3TOYA 3KZPA 6REQA 3K4AA 3VD9A 1E1FA 2XN1A 3KL0A 3SR7A 2HNEA 2C1IA 2DUZA 4IISA 2WNWA 3L4VA 3TSBA 1KBIA 1MUWA 4G56A 4L1XA 4C65A 1JCNA 2ISSA 4XAYA 5AZ1A 2HDJA 3GHRA 4WZHA 3MA8A 4X2RA 3PJWA 3V36A 4L7ZA 1TSIA 4QX4A 2LLEA 4IP4A 4I9AA 1Y7VA 1TRDA 2GQ9A 3NQCA 4PFMA 1D3CA 1WO2A 4FALA 5E70A 1KR1A 3RX3A 1KM2A 4PUWA 5E0CA 3KS5A 2D24A 2Z7KA 1AJZA 3GE7A 2ZOXA 4UB9A 3WKZA 4F3HA 4EWJA 1FCVA 4ERAA 2QAFA 2ZXBA 2WJFA 1UKTA 2J78A 2GJNA 3K4DA 2Y5JA 5JU6A 1AMYA 3IARA 4S3GA 5HXMA 1PTDA 3W6LA 3CC1A 3CGTA 4Y7EA 1XG3A 1Z89A 4Q3MA 2EKCA 3JZEA 1OADA 3DFOA 1E6QM 3VDGA 3BLPX 2ZICA 2ZRXA 4NY2A 3MUCA 3WUFA 3EX4A 3NM1A 3PNZA 1TE1A 1RCXB 3L12A 2NVDA 1D8CA 1U5HA 3UXDA 2GZXA 4RDZA 2OR2A 1DE5A 4R7OA 1J2BA 5DBUA 2A85A 1PWLA 5IBXA 3WFZA 1GW1A 3VNIA 3DHPA 4CD5A 4HZ8A 3PULA 2E5BA 3ME3A 2G3IA 3HGRA 2Y85A 2C14A 2VEGA 3EA1A 2AAMA 2FPVA 1E0VA 3CL6A 4S3BA 4NSBA 1IWBA 1P1MA 1CLXA 4XAZA 1YBQA 1US3A 4Y9PA 4DX3A 4HGXA 5A6AA 3TYDA 2Y89A 5F1UA 3LZ3A 2GJXA 1W5MA 3VDBA 2YIHA 3TTSA 4H7ZA 3RF9A 1GJPA 3C2YA 1W8SA 4XZMX 3IK4A 1WKFA 1QOPA 4DWSA 4UQDA 4A8NA 1BYBA 3GVWA 2WV8A 3LTSA 4W84A 1GOXA 3S1GA 3IAPA 3WQ5A 2Y5SA 4AXKA 5A5WA 5LNWA 3L68A 1FKWA 1V3HA 5CPLA 1WZAA 4F9DA 3LHUA 3V0TA 2E77A 3WF4A 2FFIA 1CXIA 2PDFA 4LYPA 2E28A 4ASTA 4ZR8A 4QQ3A 3QJAA 3G0SA 3UJ2A 2YA1A 3STFA 4QAIA 3KW3A 1W3IA 5E9XA 4MNKA 4N0RA 1Z3NA 5DRIA 4LAUA 2H9AA 3UZYA 1RK5A 3S0CA 1AZ1A 1WDRA 5HJLA 5EBUA 3TWAA 4H2CA 3R4IA 2B7QA 4HNLA 3F7JA 2NWSA 3H2CA 1KWKA 5HULA 1F7BA 3SCWA 3WDQA 2XWDA 2DQWA 2V2HA 2X1TA 3KDNA 4IT1A 4P8UA 3MJYA 4WOZA 2IPGA 1WE5A 3GXIA 2Z25A 1E6XM 4FLQA 3PM6A 3INPA 4LF1A 2XG9A 4O1EA 1LL6A 2PS2A 1Q8AA 3PTKA 2OU4A 3OZPA 3TTOA 4DQWA 5E1QA 4DJFD 4YTQA 4CQ8A 2B81A 3S5ZA 3F5JA 1EGVA 4LEQA 2V5DA 1W37A 2QCGA 3MZNA 2PI6A 2OWXA 4ZOAA 4TV5A 4RXFA 1J96A 2NUYA 4EP8C 4YWSA 4PL1A 1ZJHA 4O1DA 4XWUA 3Q65A 3LV6A 4C6IA 1J10A 2A7PA 3WLSA 4LVGA 2GUYA 1DL3A 3LGGA 4YHEA 1TV7A 5C2CA 2QW5A 1P6CA 1O4UA 1CTNA 3HPXA 4HB7A 1RP9A 3BJSA 4JIQA 3LLDA 2H8ZA 1N7KA 2JQXA 1YRRA 1EUNA 3P82A 4LC8A 1QASA 1AJ0A 4DLMA 3TR9A 1GVFA 3CWHA 2A3AA 5I3GA 3C0JA 4QLJA 3PFMA 3VOCA 3KTCA 3I7RA 4D6CA 3C0SA 4IZGA 4Q8VA 5HDRA 2YFNA 3EBVA 3WDPP 2WJZA 5C9XA 1TPB1 2O56A 4FLRA 3UXAA 2NLIA 1EX1A 2NT1A 2UBPC 3K46A 4N4QA 3RO6A 2YL6A 3GNOA 3YPIA 2YBUA 3PBGA 4JTSA 2PODA 1P43A 1E40A 1I0DA 3QY7A 2PPGA 4NXKA 3AHVA 3U0HA 4MVAA 2WVUA 5I03A 3PSVA 1TJPA 1C7TA 1BYCA 3W2UA 1ISWA 2PC8A 1OFQA 1R3WA 2FVKA 2PB1A 4GZJA 3GXPA 4GJIA 2OZTA 3C56A 4I5XA 4A22A 4ZVJA 4I7UA 4OWGA 1V8EA 3NZGA 2TPSA 1F2JA 3N2TA 3CYVA 2C1GA 3MSGA 1WXJA 3WMCA 5HWMA 1B0IA 3EYPA 4FLSA 4CN4A 2VUNA 4PTVA 1G7UA 1C90A 4EPDC 4XV0A 2PA6A 2VP8A 3DOPA 3W1AA 1PHWA 2CLKA 1ZS2A 2GQ3A 3W01A 1R85A 4D1IA 5JIWA 2Y5EA 3NOEA 4ERGA 4A21A 3VGHA 2HE8A 4KCUA 4CU8A 1X8FA 5CG7A 2UWFA 2FH8A 4O52A 3ICJA 2DU2A 4DZ5A 1JAKA 1XC6A 4AYGA 1G0CA 2FZMA 4ML4A 3TE9A 3PWAA 3WNPA 4AY1A 4Q4RA 3H2OA 3E0VA 3DYPA 3HZ3A 4F79A 4WX2A 4US5D 1VHNA 2J6XA 5GVJA 2D0FA 2Z28A 4M8UA 4U5IA 3WDRA 2PE4A 4IL0A 5LGZA 2PCQA 1KXHA 2EPLX 1REQB 4GI4A 4C6QA 1E0TA 4NRSA 2Z26A 4HSOA 3VGFA 4Y6GA 3HFYA 4HCDA 1JCJA 4ZFCA 2PSNA 4UWMA 5PTDA 3VIPA 1YXCA 4U31A 1UKSA 2ODOA 3HMJG 6ENLA 4S3DA 3KHJA 4A2SA 3BAWA 1UB3A 3GHUA 3DG3A 4U3CA 4PMYA 3WLQA 1WZKA 1ZTVA 3DN5A 3AUJA 3QV8A 3IRSA 2OKOA 1XDMA 1HJUA 3RGTA 1JUBA 3S2NA 4ACZB 4Q4SA 2J9ZA 1LBMA 2HRWA 2PGRA 4FNTA 3IJLA 1JNDA 3ALFA 3SW6A 4Q8WA 1EA0A 4LAZA 4JNYA 5T9BG 1P5BA 2CIPA 1C92A 3UWZA 4XZHA 3KUMA 1Q85A 3EMQA 3KVKA 1VH7A 3A5VA 4LUTB 4ZB5A 1Q65A 4HA4A 1A3WA 1J8VA 4ZQRA 4JTCA 1XINA 2VGBA 3M5YA 3VDHA 2GSHA 1DBTA 2WXDM 3TNBA 4AZ5A 3W83A 4WUIA 1GT8A 1QHOA 3VX1A 1XBXA 1WNOA 5D8ZA 5FEPA 4C6EA 3NQDA 4IMCA 5ABGA 3E38A 1RPKA 1YPFA 3FFSA 3A24A 3VIGA 3EAUA 4EPEC 2PD9A 3CQIA 4CQAA 4IGSA 5F2MA 1XISA 2ZX6A 3LHZA 2TODA 2OX1A 2VCCA 1H63A 3GYEA 3VNJA 4C60A 2YL8A 1MWOA 1UG6A 3BQ5A 1PDYA 4D6IA 3VNKA 4QNEA 1Q6DA 3MI2A 1GEHA 3B8UA 1NARA 4LS1A 1IEWA 4QLKA 3BSGA 1TPDA 3RRXA 2EAWA 1V6WA 5I2UA 1UZ1A 3HJEA 1N82A 1RVKA 4M1BA 4NJHA 1UD2A 1B3VA 1FXQA 2YDRA 3I6TA 3AMKA 2JE8A 4Q7NA 1JDEA 3FDKA 2BHZA 1W1YA 2WVTA 4AMCA 1BXNA 1CWYA 1SZFA 4NRRA 4I7WA 2D1ZA 1X1NA 5IRPA 4PYSA 3ITOA 1EHAA 1S39A 3KP0A 3ID7A 3RLHA 4GPNA 3SUTA 5AZ0A 5L9FA 4LF2A 3GDKA 3E9AA 4KFOA 3N17A 2PBOA 4EOUA 2R1NA 3NQ2A 2WSPA 3WEZA 4M1RA 5FJTA 2OWWA 2DVTA 3UWQA 1D3HA 2XPKA 1OD0A 3L65A 4HU3A 4GXMA 2X7VA 4M51A 2O7QA 3QOMA 3WJWA 2WMIA 4W85A 5FEWA 5AN7A 5IM51 5D09A 3BOXA 4H4IA 3TCSA 1HXJA 1NF7A 3OBKA 3WQFA 2A4AA 4JTKA 3LSCA 1F74A 2XYLA 2XWEA 4DBSA 2NUWA 5KSWA 2E1WA 3UNTA 4JPGA 4Q4OA 3QHOA 2OWCA 3D5HA 3ZR6A 4ZCWA 3ABOA 3SN4A 5MKGA 3L2IA 4HK7A 4AFYA 1P0DA 1KKRA 1XV8A 2W27A 3S46A 1MQRA 4BA0A 1SMAA 5EGRA 3T4WA 2QDGA 2OVLA 4XBKA 4PUNA 1A0DA 1F4HA 4G7EB 4FHAA 1JDCA 1U30A 4QJ3B 4EKJA 3OYXA 4AH7A 4UNKA 2WHJA 4IOTA 1F07A 4MDPA 4IJCA 3ABXA 3RAOA 3CPGA 3TJ4A 4WY0F 4W5UA 4S3CA 3GTXA 4GLEA 3WH6A 4J7RA 3R7MA 1KFWA 5D32A 3C0QA 2J66A 1RLCL 2P0OA 2HMCA 3UU0A 4HPJA 1I2PA 3LU2A 3U8GA 2C18A 1RHCA 3V1HA 3PWGA 4DEFA 3NG3A 4F0SA 3DGRA 2CLLA 4GISA 5A6BD 4XKYA 1Q2SA 4Z2KA 3DFHA 3PWIA 5DY2A 3SGUA 4QE5A 1XC4A 4JKKA 2WZHA 3EX6A 2OYMA 4HNVA 3SUUA 3C4UA 2PAJA 4PMQA 2XVPA 3SJ3A 2XDFA 4G2DA 3KVJA 3JR2A 2RDXA 2XSBA 3FA4A 2VFFA 2B31A 2PU0A 3I4KA 1F05A 4O18A 2HWGA 2CWNA 1BRLB 2G8ZA 3A12A 2DVXA 3W4RA 2PDIA 2QJJA 2WBGA 3R0UA 5CLTA 3VC5A 4FXJA 4Z17A 2MUCA 2QNEA 3PZGA 1K9FA 4RW3A 3V0SA 4F48A 3N12A 3O2LA 3AMLA 1S2AA 2HQAA 4V28A 3G1YA 3UERA 5C0QA 5ABFB 5DMMA 1JFHA 4YCOA 3T2OA 3ECQA 4WDXA 3B0VC 2VDGA 3W1PA 1FH7A 5A2AA 2ZX9A 4H9XA 3STGA 3M0YA 4NNCA 2J62A 4MY8A 6CGTA 4EWND 3S9YA 2CERA 3MCOA 4R88A 4K8EA 1Q7MA 3QMSA 3B0UX 4EE9A 3NQMA