1UJPA

Crystal structure of tryptophan synthase a-subunit from thermus thermophilus hb8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
271
structure length
243
Chain Sequence
MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDGPVIQRASELALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSVEVKDLVRRIKARTALPVAVGFGVSGKATAAQAAVADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization mechanism of the tryptophan synthase alpha-subunit from Thermus thermophilus HB8: X-ray crystallographic analysis and calorimetry.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 92
structure length 243
sequence length 271
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ujpA00
5F1UA 3KFTA 4XTIA 3VKJA 2CLFA 3BG9A 1B4EA 2QCCA 4UTHA 2H8XA 3PUDA 2CLKA 4AEOA 5F2IA 1KA9F 3EXTA 3P5ZA 1XXXA 5LNSA 4TX9A 2DORA 4UTUA 2CLOA 4KFPA 4RK8A 3PBUA 4UTTA 4HSNA 3ZFHA 4D2JA 3O07A 1GVSA 1DBTA 4JTFA 3TXZA 1SQ7A 3ABRA 3LCWA 4JX4A 1H5YA 2VC6A 3HGSA 4O52A 4FEZA 4MZ8A 2NWRA 2V82A 4MZYA 4O28A 5U4NA 3GR7A 1TQXA 5H2ZA 1P0KA 4QM1A 3PUEA 3GX9A 4IUOA 3MP4A 3HG2A 5D05A 4C1LA 3SR7A 1JUEA 4GXMA 4JTHA 3FLUA 4Z08A 5FF0A 1TPVA 5CPNA 3TJXA 1FUYA 3NL5A 3A22A 3NQDA 1QMLA 4PFMA 4NXSA 1C9DA 5D02A 2OCZA 3W1UA 6TIMA 4LU0A 3W2LA 1RPXA 1F73A 1SSGA 3QEZA 3C2EA 1OABA 1KV5A 4GUGA 1SR9A 1ML1A 4GUJA 2QDGA 1TTQA 1SFLA 1A5AA 1I2PA 2HS6A 3LDVA 4IX2A 1L6SA 3HGOA 3A23A 4JTJA 4MPQA 3W2JA 3W1RA 1RZMA 3IVUA 1DJQA 1JRCA 1AL8A 3DXIA 4CQ9A 1NEYA 2O7SA 4M7SA 1QWGA 2Y7GA 2VFHA 4OHQA 5HJLA 5DBUA 4GFSA 4UNLA 3EKZA 3W7JA 3WK0A 1GPWA 1PS9A 3CEPA 3KVJA 1OX5A 3W7QA 5GVJA 1OFBA 1ME8A 3C0JA 2YSWA 2XN1A 3JRKA 3SFKA 4JNMA 4NVTA 3BW4A 4E38A 2ZZ5A 5DLCA 5LHFA 2TYSA 4CCCA 2Y6ZA 1W5MA 3NQGA 2ABAA 2W79A 5G1TA 3HG3A 1EUNA 3DBPA 1GYNA 1O5KA 1VH7A 2DZUA 2Y89A 4HNNA 4JTSA 3C6CA 2F84A 4HIBA 4UNKA 1WBHA 1IGSA 3TQVA 5EPDA 3K30A 3QJAA 5CPLA 4PL1A 1P1XA 3GXNA 3FYPA 3KVLA 4ZQRA 3I6RA 4JTTA 4DF1A 4NJJA 4O0ZA 3IGUA 1YTDA 4DXVA 1LLWA 1R47A 3TFCA 1GT8A 1SZGA 1GVOA 3THAA 1RR2A 2GOUA 3G1XA 1JQVA 3WK3A 5K2ZA 3PS7A 2HS8A 5E93A 3A9IA 3UD6A 3S1XA 1W0MA 4TO8A 3MP5A 2WJZA 4P61A 4W9TA 5AHLA 2NUYA 5EL1A 3T4CA 1TV5A 4EWND 3W75A 4IQLA 3A5FA 3LHYA 3N14A 3U6WA 3GKFA 4GRSA 2NX1A 3LXAA 4WZHA 2OMAA 2XN2A 3PULA 3NYZA 3U2OA 3TAKA 5DELA 4AHPA 4K8HA 1Q6LA 4AH7A 4CNPA 3O15A 1H60A 2H8ZA 1OX4A 1NF0A 3UWWA 4IWWA 3B04A 1DORA 2WSRA 3HBLA 5HUOA 1OHLA 1F6PA 2E09A 3PC0A 1LOSA 1QPNA 3W3OA 3MMTA 3G1FA 1I2NA 2Z1BA 4JN6A 1OFPA 5C55A 3S5ZA 2QCLA 1TTIA 3VI2A 1SZEA 3LXBA 2ISSA 1GTHA 3VFLA 1WDWA 4K36A 5CKSA 2VXNA 3LI0A 3M5YA 2CZEA 3MBFA 5MHBA 3PG8A 1R30A 2RDWA 3ATYA 5F2LA 2R94A 3PAJA 3W1QA 1SZFA 5AC8A 4LVAA 1XBZA 4XBKA 3UY7A 1W3IA 2FB3A 2A0NA 1K7XA 5EBUA 2QCHA 4MJMA 1D3GA 2J6XA 2CFFA 2HTMA 1TMHA 3N2XA 3DI0A 1UBSA 1I2QA 4OWGA 3W7NA 3RFAA 2WKJA 2QCEA 4FX7A 1M5WA 1AK5A 2BTMA 4FNUA 3TIMA 1PCKA 3CHVA 3NQMA 3P61A 5F4SA 3CWOX 1YXDA 4IX0A 3HPSA 3WK1A 5HR6A 3L5MA 5D33A 1Q3NA 2ZRVA 4JDBA 4NJKA 4N9CA 2ZTJA 4RX0A 3O8AA 2DZXA 1Q6QA 2R8WA 2EPHA 3V1PA 2NX9A 4BK9A 4JYFA 4PODA 3IGSA 3NQ2A 4O54A 1EIXA 3E9AA 4O1BA 1YXYA 3HJZA 3NQCA 1LBMA 4FNPA 3EX1A 2FJKA 1GEQA 2Y61A 1YYAA 3N73A 4NUWA 1OK4A 3R8RA 5D2XA 3RLUA 4RJEA 1SPQA 5LZLA 1GVFA 5G2WA 4XQ6A 5HULA 1IXPA 4NNCA 3EXRA 1H1YA 1VZWA 5HWJA 3G24A 3B06A 1OX6A 5G5IA 3FKKA 3O16A 4Y8FA 3W7MA 3LXCA 1KFBA 4M6VA 3I7QA 3GKAA 4FNSA 3WJYA 1VGAA 1QO5A 4WUIA 3W1TA 4I9AA 4L4MA 5CZ0A 5KTLA 1B4KA 5FF4A 1KM5A 5L9FA 5AHMA 1LROA 4O1CA 1VC4A 4MY8A 4JX5A 3TX9A 4ZZ9A 2YXGA 1Z44A 4HNTA 5IBXA 3SIZA 4R34A 5I3HA 5D37A 4LC8A 5BMWA 3W2UA 4N9EA 1X1ZA 1XFBA 2XFWA 4N6EA 4A2RA 2ZA1A 1KV8A 1FY6A 2BXVA 1TPEA 3JS3A 1T0OA 3KHJA 3DFOA 1TSIA 1PE1A 4WY0F 3LRMA 3STFA 5HQEA 3OA3A 1X6UA 5FEWA 4UCGA 1L9WA 2V0TA 3C8FA 4RR4A 2WPBA 1NFBA 3DFQA 4XZ9A 2ALDA 3NPUA 3THQA 5I3FA 1GG0A 2A21A 2GJNA 1O95A 2VFDA 5DCDA 5F4WA 1IF2A 3USBA 2RKXA 2VFEA 2C1HA 3A5VA 4Z1CA 2FFCA 4CLMA 4IJBA 3W74A 4LW7A 3NQAA 3UYCA 4JS3A 4GWEA 3M0ZA 3TMLA 4K39A 4PTNA 4Q33A 1X8FA 4IPIA 3ZWSA 3G22A 2X30A 2YDAA 5SWUA 4KWWA 3TQ0A 2YCEA 4LV4A 3HQ1A 2C13A 1P5BA 4OV9A 1KLZA 4FNRA 1K7FA 3GDLA 1OYAA 3SSJA 3DFSA 5K9DA 3KAOA 3EB2A 3MYOA 1VHNA 1DOSA 2A5HA 5AHIA 1JRBA 4WOQA 2WNQA 2WSYA 3B8DA 4JXCA 3MHFA 2PURA 2EAWA 3I65A 1KM3A 2DU2A 1C29A 3TUUA 3G3DA 1JCXA 3ABOA 1Q6OA 2QCNA 4NJIA 3W7OA 1TTPA 1K03A 5CZSA 3HMJG 2CZFA 4O8RA 1EP1A 4MY9A 1TPUA 2RHGA 2ZQ0A 1OF8A 3E12A 4RV8A 3TK7A 3C2FA 3G1HA 1H50A 1GVRA 3HGRA 3G1VA 4FX6M 4IMEA 3BVJA 2ABBA 3SZ8A 3DH7A 1W3NA 3IGXA 3LHWA 1KLYA 3LCIA 4BFAA 4QJ1A 3GIYA 3E0IA 3Q94A 5AYZA 1FBAA 1I4NA 1GWJA 4AB4A 1SU5A 5LNRA 1TPC1 4NZFA 1EUAA 4YCPA 1YADA 3D0CA 1A5CA 4GUHA 3PBVA 2JKEA 4ALDA 2WNNA 4QSHA 5EY5A 5CSSA 4YWIA 5T26A 1VCGA 3LOTA 2BZNA 2ATMA 2C3ZA 2GVLA 2C15A 2OZ0A 2Y7DA 1GJPA 1M7OA 1DL3A 5D32A 3T55A 2ZTKA 4AVFA 1ME7A 4ZQCA 1G7VA 1PVNA 3SECA 1D9EA 1HFBA 2QF7A 1ICPA 4LNYA 3KVKA 2CLMA 3IIPA 3N3MA 2XN0A 3L5AA 2V2CA 2R91A 5AHNA 3O05A 3W84A 3G1YA 4Y90A 3G1AA 4M5PA 3IIVA 1BWLA 4RXGA 1FXQA 4O18A 5K9CA 3GVGA 1WXJA 4ZMGA 3A21A 4ML9A 3NXFA 3L66A 1XL9A 4LUJA 1O60A 4CCDA 1VLIA 1QFEA 2VEIA 3NA8A 4Z1DA 2ZZ1A 2TRSA 3PVFA 1KBJA 4ADUA 1WA3A 2RFGA 3OHIA 3N19B 1XDLA 5FF2A 5G4EA 2Z2UA 4EF9A 4XUGA 4WX2A 1L2UA 3C2VA 1TIMA 1SW0A 3S1VA 1LCOA 1E51A 1XCFA 3TMQA 5K7JA 3QPYA 3W87A 3TW6A 3M47A 4ONVA 3QW3A 4OQVA 2CWNA 4UR7A 3HF3A 3LB0A 1Q6RA 3INPA 2CW6A 3EWUA 3PWAA 4UTLA 3LV6A 2YFOA 3W7PA 5TBOA 5AYXA 1LOLA 1WX0A 3NL6A 5AYYA 3LHVA 4FO4A 4YL2A 1JCJA 4OU1A 2GPTA 3QPZA 3M5XA 3TSDA 3TKFA 3W70A 2NZLA 3G1SA 3PBYA 1XI3A 3ZS4A 2ZCGA 1FDZA 4O4VA 1SFJA 1ZY9A 3PB0A 2OJPA 3R5EA 3F4NA 4A2SA 1NVMA 1TREA 3GB6A 4DBDA 3FOKA 3L5LA 2GQ8A 5DCBA 4LVBA 1AL7A 2ISVA 4JX6A 4O57A 3HGJA 3S6DA 3YPIA 2H90A 1KM4A 2QEZA 3V75A 2CLIA 4JTKA 1W5OA 3NZ1A 1OFRA 5AOUA 1FXPA 4DF2A 2X16A 3GLCA 1A5BA 5CPMA 3I68A 3NZRA 3E96A 4O4WA 3UZ5A 3GNDA 3M44A 2GVJA 5C2XA 2H3BA 3IVSA 4Z0JA 2PRLA 4CNOA 1JCLA 4A29A 1QOQA 4U4MA 3EKLA 4FHAA 3T40A 1JR1A 5HNRA 3BV4A 2BWGA 3MJYA 4XTDA 3GXTA 4XKYB 1HO4A 3LM7A 3G18A 2H6RA 4K37A 4CQ8A 5J5RA 3W23A 4J9JA 5HWNA 2I1OA 2QUVA 4EOUA 3SJ3A 5FEXA 1W3TA 1S5TA 1TPWA 2HMCA 5CSRA 4JTLA 3TE9A 4UC5A 4EVZA 3CQ0A 2I9EA 2VENA 3W7DA 4CQAA 3L21A 4GE8A 3W2KA 1YPIA 2QCDB 1U83A 2YW4A 2A7RA 4UFMA 2V81A 3DFNA 4NX0A 1J4EA 2O7QA 5DY3A 5AN7A 2B0MA 1ZALA 1PCWA 2NV1A 1AW5A 1J2WA 4UMAA 4NT0A 3S42A 3VNDA 2A85A 1VCVA 1H7PA 3TA6A 5G1YA 3L65A 1THFD 3GAKA 2ZRUA 4YCOA 2KZHA 1H7OA 1JQXA 4O17A 4MUZA 1EP3A 4O13A 1F05A 3CM4A 1FDJA 3O6YX 3E02A 1TV8A 1OFDA 1FWRA 5KINA 4IMGA 3MI2A 1TQJA 3QMSA 3TH6A 3HG5A 4E0CA 3W7IA 2QUUA 2FQIA 3MP3A 2QAFA 4IXXA 1LDCA 5IM51 4M19A 3W72A 3RMJA 3PG9A 2E68A 2C0AA 2DJXA 4JYDA 3HO8A 4DPQA 4AAJA 1CW2A 3M5VA 2A2IA 2C16A 4QQ3A 2DZWA 4NZJA 1ICSA 4AMAA 3CU2A 3SGZA 2A6LA 2X1UA 3NQFA 4PEKA 4UUIA 3KXQA 1HL2A 5AHEA 3KVMA 5G2IA 3CPRA 2JGYA 1SO4A 2NUXA 4MYAA 2PRMA 3SW6A 4DEFA 1FWWA 3TC7A 3ATZA 1L6WA 3W7RA 2W6RA 4GJ1A 1KFEA 4M7TA 4AHOA 2DP3A 5KMYA 3LCXA 4TIMA 1GTEA 4TMBA 4JTGA 1ZAIA 2J9YA 3TQKA 3W07A 1RQEA 5CZTA 4EIVA 2G5WA 1LRNA 4B5NA 2QCMA 2E77A 2C6QA 3DENA 4IXHA 1UASA 4HHPA 4UTJA 4I7UA 5TIMA 2CZDA 1NF7A 4RXFA 4S2BA 4QIUA 3FKRA 3W1XA 1YTEA 3LCFA 1PIIA 3IV3A 3P7YA 4JR5A 1KTBA 1XBVA 3G3MA 1LRTA 2B7OA 4O53A 3C2OA 1SO5A 1UCWA 1GZGA 3W1MA 3AJXA 2B7QA 4NJHA 3PM6A 4ADSA 3PF3A 4Y6GA 4RLIA 5IBXC 4JEQA 3QM3A 2R14A 1OFOA 1W5NA 5D2VA 3S8HA 5BW6A 4MIMA 3CEUA 1QPOA 1WQ5A 2QCFA 3L67A 1GYLA 4X9SA 2GUUA 2TMDA 3OVRA 3UY8A 4O0KA 4BI7A 3W7GA 3SY5A 1NAL1 1IXNA 2E6DA 3GYEA 3H55A 4BR1A 1MEWA 1XKYA 2G97A 1OG0A 3NG3A 4GC4A 1QNVA 1HO1A 1EA0A 1SUXA 1HG3A 4WOZA 3QF0A 1Q45A 4BWLA 1YLVA 1W5PA 5F4XA 2QJHA 3EX4A 4LY8A 3QH2A 4UTMA 5LNWA 3B0PA 4DPPA 3HG4A 3PBWA 3R2GA 2C18A 3NGJA 5F2MA 3FJLA 4HSOA 4FXRA 3M9YA 4LS1A 3IVTA 2CLLA 3T78A 2Q8LA 2VEPA 4O15A 3OEXA 1WOBA 5HR7A 5D38A 5KZEA 1MSSA 2TSYA 2ZFAA 1PHQA 1JUBA 4MY1A 4WXZA 3NPVA 1M7PA 4O16A 2NUWA 4LWWA 1QPQA 1TPB1 3NQ7A 5ABTA 3ABSA 1KBIA 3ZR4A 4N02A 2NXHA 1DJNA 3S1WA 3QC3A 4HKPA 1AW1A 4N4PA 1RQHA 3N34A 4BF9A 3C4UA 3EWZA 3LBCA 2C19A 4TU1A 2ZRZA 4DQWA 1CX9A 4WXYA 6ALDA 3NOEA 5D09A 4KWVA 4ZQMA 3W7CA 1OF6A 2VOMA 1BEUA 3N9SA 1XBYA 1SO6A 3ZWTA 1JCMP 3TROA 2X2GA 1KTNA 4I7VA 2CLHA 2GQ9A 4UFIA 2OT1A 1XUZA 1RVGA 4JTIA 5K9XA 3Q58A 1SW7A 2UV8G 2FLIA 3QSTA 3MHUA 3I7RA 1H51A 1VYPX 3LRLA 4H6KA 1TTJA 2B4GA 3NL2A 4ZL1A 3LCHA 1W8SA 3TDFA 1H7RA 1CI1A 3ANYA 4UMBA 4UMCA 5H91A 4O19A 1O94A 2E1DA 2QCGA 1BKSA 3FEMA 2FTPA 3B03A 3P67A 1N8FA 3MI3A 4R53A 4NJGA 2Z6JA 1G69A 1M6JA 1R2SA 4KFOA 4IMFA 1PV8A 1TJRA 2YPIA 1SZNA 3M7WA 3W85A 1FDYA 4PL2A 1KFJA 2A1YA 3UWUA 1GG1A 3BW3A 5BNKA 1FWSA 1R2TA 4MFEA 3KRZA 4XKYA 2E5BA 3STCA 5DXYA 3ELFA 3UXDA 3W1NA 1PHWA 4DO5A 2FB2A 3GAYA 2VFFA 2W0UA 2ZYFA 3UWZA 2OX1A 3MWAA 3WJZA 3S5NA 2WQPA 1T99A 3NM3A 1VR6A 1OVDA 3MBDA 4MLRA 4PA8A 5HWMA 1IXOA 2Z0IA 3BLEA 1OFQA 2Y7FA 3R13A 1I2RA 3WJSA 4PC8A 1D3HA 3MYPA 4ADTA 1V7YA 3NQVA 4H3DA 2B7PA 4BI5A 2EGZA 4JICA 4H4IA 2V2HA 1UJPA 2J27A 4LVFA 2Y7EA 2ZBTA 5DCEA 3DKLA 4K7YA 3MHGA 3G1DA 2A6NA 3P8JA 4TR9A 1JVNA 1F5ZA 5K4ZA 1VPXA 1H7XA 1RQBA 3STEA 4CNNA 3QSRA 4AWSA 4WQ6A 3TR2A 1VLWA 2BSLA 1G67A 1L6YA 2FIQA 4UR8A 1ALDA 3B05A 3P5YA 4FNTA 1HTIA 4N2YA 1MEIA 1EEPA 1ZAHA 3UWYA 5CG7A 3KOFA 3DAQA 3IRDA 3HPZA 3H54A 2V5LA 2E6FA 5LGXA 3W2NA 1Z48A 4FF7A 3QYQA 4FB7A 2E6YA 1G4SA 1T8XA 1VYRA 4I7WA 1KFKA 4JY8A 2QR6A 4JYEA 2V5BA 3KRSA 1DQWA 1UB3A 5K3VA 4OE7A 2A7NA 5HINA 1H62A 2Y85A 5L6UA 1ZCOA 1I45A 3W73A 3LHUA 3CIXA 3QMRA 3PSWA 1OFEA 1VJIA 4NNAA 4M6QA 4UFJA 3M5ZA 3Q2DA 3WK2A 2V2DA 3NR0A 4O10A 4ORMA 3NVTA 4QISA 4LS2A 5FEPA 1TV7A 3T7VA 5AFDA 5F2GA 1OK6A 3CTLA 1LTDA 2VFGA 1TYGA 3LERA 3UWQA 3NO5A 2YR1A 1B57A 4YXGA 4NX5A 4UTKA 1OYCA 2NXGA 1FCBA 4DO4A 5DXXA 4OGZA 4KFNA 3CWNA 2OT0A 1TPH1 3W86A 3B4UA 3MO7A 4E2BA 4LTSA 4M6PA 5HUPA 3RU6A 3W7LA 1KFCA 4AWTA 4UTIA 1LBFA 1UUOA 3GR8A 3IIZA 2WNZA 3BGJA 1QPRA 5C6MA 3W7HA 2CU0A 5LKYA 5E0KA 3F4WA 1TCDA 4Z1AA 1H7WA 2VEMA 4MJZA 4NXKA 4NNBA 4IMCA 1N7KA 2JK2A 4HNUA 4AF0B 1VRDA 5U7SA 3P62A 2G96A 4GUIA 3BLFA 1KW1A 3RNDA 3W1AA 3M43A 3NQ8A 3QQ1A 7TIMA 1OX4B 2WSQA 5LHEA 1F2JA 2F7FA 1JCYA 3DU0A 3NPWA 4ZQOA 2DZTA 5KZMA 2RH9A 5I3JA 3W83A 3L0KA 3NAVA 3N9RA 3W71A 4UFKA 3MW7A 4A21A 3EWXA 3W7KA 3UNDA 3FYOA 3RK8A 1H1ZA 4YLWA 3W7EA 5I3KA 3OIXA 1ZAJA 5CGQA 2P10A 4A22A 3M6YA 3BO9A 3EEGA 5DY2A 3TW7A 4ZVJA 4QNEA 1LYXA 1VYSX 1ZHAA 3JR2A 4LUIA 2P0OA 4Y96A 2ZA3A 4FNQA 3W2MA 5EKYA 8TIMA 4PH6A 3WJXA 3P74A 1OYBA 1YDNA 4ZQNA 1FWNA 3DHDA 4PCFA 3P60A 3O6DA 5KITA 3L68A 2TPSA 2ISWA 1W1ZA 1S5VA 4OBTA 4XBSA 1SO3A 4MZ1A 5G4WA 4WY0A 2G95A 3F03K 1F74A 5DN1A 1IIGA 2ZZ7A 3UQNA 1V5XA 1N55A 5BMXA 1LM1A 4MLJA 4RCXA 3LLFA 3NNTA 4O1DA 3W22A 3UWVA 2PCQA 1ZFJA 2EHHA 2JKAA 5CZJA 3BLIA 2NLIA 3NQEA 3B0UX 2YGYA 4TMCA 3O6CA 5G2HA 1K02A 5A8GA 1UUMA 2E6AA 1TO3A 2BLEA 2YX0A 2J9XA 2J9ZA 3LCGA 3O1NA 4UFLA 4GBUA 5KZDA 3HB9A 1KFLA 5AB3A 3P8IA 4JTEA 1DVJA 3QZEA 3DKJA 1ZNNA 5LNUA 1YXCA 2JKPA 1OJXA 3QFEA 1GVQA 3C52A 4N9BA 2GVGA 1X1OA 1H61A 2V8ZA 1DV7A 3DFPA 4DF0A 3QMTA 3M41A 3S9YA 3A24A 1K8YA 3R12A 4FIRA 3GDTA 4MFDA 1BWKA 3G8RA 4O14A 2QAPA 5LSMA 4JD4A 1GQNA 2Y62A 1TRIA 2LLEA 2DZSA 1QAPA 1VS1A 2P1FA 3BGGA 4UTTC 3RF9A 3W1PA 3G0SA 4UIOA 4WD0A 2DZPA 3LI1A 1TB3A 4MYXA 4E2DA 5BOOA 4AWUA 5D2WA 1TRDA 3UZJA 4LS0A 1VCFA 4FIQA 3DGRA 3HIJA 3L9CA 3E49A 4IOTA 3G0UA 4P2VA 3FIGA 1O5XA 4CCEA 5EMUA 1JUKA 3RLVA 4O1AA 5EA9A 1P4CA 2Q3OA 1MEHA 1A50A 5D30A 1DKWA 3FA5A 4LC6A 3NM1A 4X2RA 1W31A 3GDMA 5LNVA 4G1KA 2HSAA 1AMKA 3C2RA 5FEZA 1RV8A 2I14A 4Q4KA 4MKNA 3R89A 4QAIA 3TAOA 3GK0A 4QNWA 5D2TA 1A53A 2ZZ4A 1G7UA 3G0XA 2NX3A 3DFTA 1ICQA 5D03A 4DBEA 1K8ZA 1AW2A 1Z42A 1K3UA 4IMDA 1LZOA 2CLEA 2EF9A 1H63A 1EB3A 1W5QA 5HMSA 3IIOA 2DJLA 4MOZA 3HOJA 4HNVA 4K8EA 3QW4B 2WO5A 4RZ4A 5C5YA 1RD5A 3TCEA 2EKCA 1ZJIA 1YDOA 3STGA 1FCUA 1VHCA 2C14A 2VFIA 5FESA 1ADOA 2QJIA 1YPFA 1B3OA 3BPWA 4RKAA 3BG5A 2Q8ZA 2YFNA 3LTPA 1BTMA 4FXSA 1S3HA 4UFHA 3PB2A 4UTWC 3UPWA 1I8JA 4RZ5A 4HPXA 3LV5A 1IIHA 1Z41A 1WOAA 3EX2A 1ME9A 2ATSA 3WJWA 2AGKA 1JCNA 1TPDA 3I7SA 1XM3A 3LLDA 2V9DA 3PSVA 1R46A 1Y0EA 3FFSA 4JGDA 5E1QA 2ZZ2A 4XWUA 1MZHA 4BWLC 1R2RA 1EPXA 3C61A 3KRUA 3GNNA 2ZRXA 4Q32A 3F1QA 1WYIA 1WAUA 3LGEA 4R33A 4N9DA 1MO0A 3OVPA 3S1UA 3OG3A 3LCLA 2Z6IA 3U8GA 1PL9A 4C1KA 3QRHA 1O4UA 4DO6A 4OV4A 5I3IA 4X3ZA 4Z1BA 1IXQA 4AF0A 1P0NA 3ABQA 5C54A 5DBTA 2A7PA 5A5WA 3T44A 1YTKA 3LTYA 4AHQA 1FX6A 2VEKA 5BRBA 3LTSA 3CC1A 4GNJA 3O63A 2NWSA 2Y63A 4LOCA 3C3NA 4A3UA 2GQAA 3TC6A 4GUFA 3CIWA 5FF7A 1EWEA 1GOXA 3TFXA 1OFAA 1TPFA 1X7FA 3UPBA 1JULA 1XBXA 3PR2A 1KM0A 3TU9A 5K4XA 2ZA2A 3C56A 2J88A 1KM1A 1YDVA 2YW3A 4LV9A 1B9BA 1FCVA 3SGUA 3TV8A 3LHZA 4L4LA 2RDTA 1JJKA 3S5YA 3SI9A 3GXPA 5FF3A 4POCA 1NSJA 4OT7A 2AQWA 2FPTA 2D73A 2RDUA 4HPJA 4Y9AA 3EWBX 4FX8A 4JTUA 3EXSA 1WBJA 2V30A 1XDMA 4NQ1A 3G8EA 1DHPA 3GDRA 1MXSA 3EX6A 1QDSA 1W54A 1QR7A 3BW2A 1HUVA 3TJLA 3BARA 2NXIA 3IIXA 2YZRA 4ICNA 1F7BA 5TQLA 1T96A 2QDHA 4EF8A 2WV8A 3NEVA 1J5TA 3KX6A 3IEBA 3LX9A 3BG3A 4JDYA 1U5JA 2GJLA 4X22A 2JBMA 2DZVA 3DZ1A 2BX7A 1LLZA 1K8XA 4K7VA 4O50A 5CPOA 1DQXA 3P81A 3DHFA 1H7NA 1XC4A 2YYTA 2X1TA 3UXAA 3MI6A 1XUUA 2ZZ6A 3CLMA 3BK0A 3MUXA 2X1SA 3OVQA 4WY0B 4YMZA 4LRSA 4LVDA 3M1ZA 3TXVA 2QCDA 4JIQA 1SW3A 2J24A 1EX5A 3EX3A 3H53A 5EYWA 1TJPA 2QKFA 4R7JA 2ZDRA 1S5WA 1I2OA 3TNOA 3NPXA 1FWTA 4LT9A 4ORIA 1ZENA 1KM2A 4IPJA 1G4EA 3L2IA 2ZZ3A 1QOPA 2QJGA 1LP6A 5I3GA 2ZRWA 3S5OA 1G4TA 5AHFA 3W88A 1AG1O 3W76A 2Y70A 4N4QA 1F76A 3NL3A 3W6YA 3EWWA 1A5SA 3FS2A 1EP2A 4KKXA 5KSWA 4RZ6A 2CZ5A 3M16A 2PC4A 1C8VA 3NDOA 4S1FA 3PY2A 3L0GA 3Q37A 4MVAA 2H3DA 2YYUA 4IGHA 3P80A 1K7EA 3N2MA 1QCWA 2PE4A 2E5DA 3NQ6A 4N6FA 4O12A 5AC7A 3S0CA 1W37A 2Q3RA 2VKZG 4K6AA 4UXDA 4HT3A 2JGQA 1LORA 1SSDA 3LHTA 2VELA 3LRKA 3GZ3A 3EWYA 1KTCA 2PRHA 3QQ0A 1F6KA 2E5CA 1G6CA 1ONRA 2FPVA 4AXKA 1VQTA 5J5DA 2NV2A 2ZRYA 3O06A 4QITA 1QO2A 3VCRA 2FPYA 1LBLA 3HPXA 3TSBA 3DI1A 2WOQA 3P84A 5D04C 5FI8A 4LVGA 4O11A 1KM6A 3FJ6A 1W56A 4NU7A 3WFAA 4UTWA 1FCQA 2AAMA 3VE7A 2FDSA 3GDKA 5F1VA 1WV2A 3PUOA 2IQTA 3L0NA 3W9ZA 4K38A 3OBKA 3P82A 1LOQA 3B0VC 4Z0SA 1FQ0A 4JY9A 3W1LA 4BI6A 3CT7A 2A4AA 3AO0A 4JIPA 4HN4A 4LRTA 5D2YA 2X1RA 5LGZA 4ZQPA 3TSMA 1G4PA 4WJEA 1LRQA 2QUTA 3CB8A 4U28A 2B7NA 3LBMA 4DELA 5AC6A 3VE9A 4S2CA 2Y88A 1EWDA
chains in the Genus database with same CATH superfamily
2VZTA 4KWUA 4S23A 1TVLA 3PUDA 4HJWA 2C1IA 2CLKA 4HU4A 3DFHA 4AEOA 1EQPA 3GH5A 5LNSA 4B4HA 4AG0A 2OELA 2HPIA 4D2JA 3CPUA 5A6JA 4IG2A 3ABRA 1MUCA 3RDKA 2QDDA 3HGSA 3ZLHA 2QIIA 4MZ8A 3VNKA 4MZYA 3CUIA 4O28A 3V16A 4IICA 3GX9A 1VFMA 4C1LA 4H9XA 2GSEA 5FF0A 1TPVA 3GHSA 3GVVA 3ZIZA 3A22A 3NGFA 4LSBA 4DI8A 1HVQA 4PFMA 4NXSA 1C9DA 1FWAC 5D02A 2VUNA 2PDQA 3W1UA 4GMEA 5I24A 2Y8VA 3DYOA 4WLCA 3MCNA 1DTNA 5A6AA 1OABA 4LBUA 4GUGA 4I8YA 3GHRA 2YBUA 4KERA 5D9MA 2QDGA 4EXBA 1OT1A 1SFLA 1PKYA 4RDVA 1S2AA 4DJDD 4W85A 4NI8A 3HGOA 4JTJA 3AHTA 1RZMA 3DC8A 2PLJA 1UIPA 1AH0A 4Z17A 4XVEA 3TYUA 4V1XA 4CQ9A 4M7SA 3WLRA 4QJ5B 3AIVA 4OHQA 4CNTA 4UNLA 1PS9A 3O0KA 3BJSA 3JRKA 1XIBA 4JNMA 4NVTA 1JDDA 1CNVA 5C8BB 3R6IA 1W5MA 3NQGA 4R88A 1PEZA 4ZE4A 2C71A 2BVYA 2W79A 4DBWA 1TFVA 2VX6A 2X0YA 4JTSA 2PLCA 3BZGA 4HIBA 4UNKA 2J66A 1WBHA 3CK5A 5EPDA 5CPLA 3M0YA 1P1XA 5FJPA 2R6OA 4QG9A 3BSHA 3SBFA 4BQ2A 3I6RA 4JTTA 4NJJA 1H41A 2Z25A 3N29A 1YTDA 1R3YA 3M64A 4YS1A 1S2UA 2PWEA 1SZGA 2CCRA 4FOJA 4M1BA 3THAA 1RR2A 2F2HA 4H7CA 2CXGA 3PS7A 3B97A 3IJ8A 1SMAA 5E93A 2PLMA 5DMYA 2PCEA 2Z1WA 2WM1A 2WJZA 3P3BA 3IV8A 3K8KA 3LMYA 1TE1A 4P61A 3UZWA 2BP1A 2NUYA 1A3HA 1GYMA 2HNHA 3U6WA 3GKFA 4PMJA 1MXDA 3W25A 2XN2A 3NYZA 1A4LA 4H19A 3UU0A 1HGWA 1Q6LA 4AH7A 4CNPA 1PKLA 4YTTA 3WBYA 4DWSC 3B04A 4C7DA 2VDHA 1F6PA 2W67A 4W8BA 2W61A 3AI0A 3AU6A 2VCBA 3G1FA 1I2NA 8XIMA 3AWNA 1OFPA 5C55A 4UQCA 4UQBA 1M3UA 1D3CA 3LXBA 5T9BG 5IXEA 2ISSA 3RRXA 3VFLA 4K36A 4L64A 1ESWA 2BVTA 2VXNA 3BC9A 3CLWA 3ATYA 3GY1A 4ZE5A 2PUZA 2OZTA 2YL6A 4LVAA 4XBKA 4PTMA 1HP4A 1W3IA 3RCYA 1K7XA 2QCHA 4MJMA 1D3GA 3T81A 3T0DA 4QHRA 1EOMA 4OWGA 1VFHA 3RFAA 4QFUA 3KTSA 4FX7A 2BTMA 4FNUA 3IJ6A 3MO4A 5F4SA 3CWOX 1UR2A 3I6EA 4P8UA 2FFIA 3L5MA 3OYZA 1F6YA 1KKRA 3WIJA 3T08A 2R8WA 3V1PA 4Q8TA 2NX9A 5I5RA 4EP8C 4JYFA 5E5CA 3KW3A 1J6PA 1YNPA 1DYSA 3K13A 1TMQA 3WEMA 1GHSA 2QNEA 3SCVA 1IQ8A 3EX1A 2Y61A 3N73A 4EWJA 4PMZA 4RDYA 4RJEA 3CNYA 4XVDA 5G2WA 2VX5A 3EXRA 2WVVA 1BYDA 3G24A 3ARPA 2VP8A 1EL3A 3MJMA 3BQ5A 2CXEA 3ABXA 2P76A 3UW6A 3LXCA 1T7LA 1JI1A 1R3QA 4FNSA 3WJYA 1E0XA 1QO5A 2RUSA 4L4MA 3M0VA 1EGMA 5L9FA 5AHMA 5HANA 1VBGA 4GCAA 3TX9A 4ZZ9A 2YXGA 4LAKA 3CQIA 2XFFA 4LC8A 4N9EA 1XFBA 2ZA1A 3VX1A 4YPJA 5LIYX 1FY6A 2X09A 3BQ6A 5A2CA 1TPEA 1IWPA 3KHJA 4TV6A 4A4AA 3E38A 4I6VA 2YLLA 1L9WA 1NFBA 4YIWA 4XZ9A 2ALDA 1E55A 4V27A 1A47A 1W1A1 1MWOA 3WD2A 2PTYA 1YRRA 3UETA 1JPKA 2HXUA 1YBQA 2FFCA 4IJBA 4XZMX 3W74A 2DZAA 3VPLA 2ISFA 1R3TA 1E15A 1WZAA 3CL7A 1LL4A 4KH2A 2OEKA 2YDAA 4EKJA 3UYIA 3H4XA 2C13A 1KLZA 2BODX 3GDLA 2HNEA 1AQFA 3R25A 2WB5A 1Y8BA 3WNPA 1WE5A 4JXCA 3I65A 3RU8X 4J28A 1NQKA 1IZCA 2QCNA 2VQUA 1TTPA 2Z28A 2G41A 3NTYA 2CZFA 4GK8A 4O8RA 1BSIA 4MY9A 2EBNA 2ZWZA 1HX0A 4PYSA 2OQLA 2WZIA 1Q8AA 3GIQA 3G1HA 1W2VA 3VK5A 1GVRA 3BAXA 3VFCA 2CERA 3G1VA 1E4LA 3W24A 2ABBA 1W3HA 3IGXA 1EJRC 2VEFA 4DJEA 3E0IA 1TR1A 7ODCA 4LCSA 2HZGA 4AB4A 1SU5A 4MAZA 1A3XA 4NZFA 4TVCA 1EDGA 2WJDA 3ALFA 4E2OA 3PBVA 3EB4A 1W1B1 2ODOA 1QNPA 4ALDA 2WNNA 4QSHA 5CSSA 4D6GA 1VCGA 1L6FA 1GZJA 1OD8A 1XGEA 3AJ7A 2D0FA 1FOBA 3T55A 3NQBA 5DMNA 4ZQCA 5AVHA 1D9EA 1J2BA 5T9CE 1MRQA 4NG3A 2CLMA 3BLKA 3L5AA 2V2CA 3CZ8A 2R91A 5AHNA 3O05A 1CGVA 2GGIA 5CC5A 3UBPC 1YQ2A 2A3LA 2OOFA 4G2DA 2G3NA 3IRSA 4ZO7A 4AZ6A 3WLJA 1O60A 3OQ8A 4GVFA 4CCDA 4Z1DA 3R0UA 1XYBA 1UD2A 4ADUA 2RFGA 4NZ5A 3OHIA 4HVXA 1G01A 4EF9A 2GZXA 1L2UA 2TODA 2WBKA 1QWKA 1QJWA 3M0JA 5K7JA 4F9DA 1RCOB 3TW6A 3M47A 4ONVA 4DJDA 1GW1A 4XB3A 4EXQA 3HF3A 3LB0A 3W29A 1VIZA 3INPA 3DOPA 5DT7A 4JFVA 4UTLA 2PWUA 3XINA 3BGAA 3W7PA 5A6SA 3NO3A 5TBOA 3WENA 4JNYA 1FVPA 4M82A 1F8MA 1JZ7A 3K46A 4FO4A 2XIIA 4JIIX 3W38A 5HJYA 6CGTA 2PDJA 2ZC1A 3J7HA 2ZCGA 2GJXA 2OJPA 5CAKA 2ZUWA 1EDTA 1TREA 4EPDC 3FOKA 3MV11 5DCBA 1O5RA 5AVNA 3WUBA 4LVBA 4JX6A 4O57A 4PBFA 1VENA 2YB4A 2ZXBA 3WNOA 4A8RA 2QEZA 1V6WA 2CLIA 2OOGA 5AOUA 4DF2A 4HGXA 3I68A 3R79A 5TD4A 4KCUA 2GVJA 3RCNA 2IPGA 2H3BA 1K9EA 3IVSA 1J0HA 4Z0JA 1EHNA 2PRLA 3TJIA 2DT2A 1QOQA 3T40A 1JR1A 5A8NA 5FSEC 3QYSA 2BWGA 3SO7A 4XTDA 3ARUA 1HO4A 4CU8A 2H6RA 4CQ8A 3W23A 1TJ2A 2WMFA 4J9JA 2I1OA 2DSKA 2XSBA 4EOUA 1W3TA 1TPWA 2X8RA 4DWDA 1D8WA 2OG9A 3URQA 4EVZA 3MV01 5EFFA 2I9EA 3T6CA 3W2KA 1NFPA 1YPIA 2VYOA 2A7RA 4XSMA 1WKYA 4WJ8A 4NX0A 1J4EA 5DY3A 5AN7A 2NV1A 1YE6A 4BS0A 1AW5A 2BB0A 4GYJA 2QS8A 4G7FA 3WDPP 5G1YA 1THFD 3GAKA 2ZRUA 4J3TA 3K4DA 4YCOA 5A2BA 1GUVA 1JQXA 2DIEA 2D24A 4O13A 4OOZA 3CM4A 1FDJA 4QQUA 3E02A 1TV8A 1OFDA 5KINA 1TQJA 2WJEA 2Z2BA 4I5RA 3HG5A 3WF0A 4AZHA 1F3EA 3QTPA 4E0CA 3W7IA 3VTRA 2QUUA 3OPSA 4IXXA 3PG9A 4ACYA 2WMIB 4DZ5A 4BEUA 2ZOXA 4XX6A 2WMKA 3HO8A 4JYDA 3TTQA 4AAJA 1CW2A 4MM1A 1XHGA 4EK7A 2DPEA 3KP1A 1RJRA 4QQ3A 3BL3A 3EMQA 2V3DA 2EPOA 4IJCA 3FSTA 3CU2A 3SGZA 3R58A 3NQFA 4PEKA 2WVUA 1ISWA 3AYTA 3ENLA 1XWYA 4GY0A 2PRMA 1X38A 3SW6A 1VPQA 4GJ1A 4M7TA 1UWRA 5CC6A 2I5QA 5CBJA 3B9DA 4F0KA 1HKWA 3V4BA 4GGBA 5FJUA 2GGHA 4E8DA 3W07A 3FX4A 2X05A 1ZSXA 2PEVA 3HJEA 4NYUA 2C6QA 4I7UA 3DCPA 1KRCC 3FKRA 2GLKA 4OKDA 3F7JA 1CXLA 2B7OA 3C2OA 1UCWA 1GZGA 3W1MA 1TX0A 2B7QA 3PF3A 4GX8A 4RLIA 5IBXC 3QM3A 5GJMA 1OFOA 1W5NA 3GNRA 3KZSA 4LAZA 2PDLA 3G77A 1QBAA 2FYMA 2Y8UA 4Z2JA 2TMDA 5EFDA 3UY8A 3PWGA 1F61A 2XFYA 3PZ9A 1MEWA 5DRCA 1XKYA 2G97A 1OG0A 1UZ4A 3NG3A 4GC4A 4IL0A 4MTVA 1Z9AA 2P50A 2BXZA 1SUXA 1FWIC 1RVKA 2XHYA 1J0ZA 4IISA 4QEEA 4A35A 4Q22A 3B0PA 2PDBA 4GABA 4L1GA 3R2GA 1B54A 3UZXA 4Q4PA 5F2MA 3ZVHA 1UZ1A 1MI3A 4JTAA 3RX4A 4DUWA 1UKSA 3OLDA 2FGZA 3KOYA 2CLLA 3PZVA 3CH0A 3T78A 2EKGA 1R87A 4DM2A 4PMXA 1IT8A 4Q8VA 4C5YA 3E5PA 1BGAA 3VIKA 2ZFAA 1ZP3A 5C7VA 3NPVA 4CNUA 3ZR4A 2D69A 3CZJA 4E3VA 3WNKA 2VI0A 4N4PA 3N34A 4BF9A 5AYIA 4B9ZA 4DQWA 2VZUA 1CX9A 4GQ0A 2I7GA 3M0IA 4MG4A 4PMQA 1U1HA 4NZ3A 1BEUA 4GKTA 1ECEA 2ZVIA 2UY3A 4PFHA 3PPFA 4UFIA 1XUZA 2J25A 1RVGA 2IMRA 5JBDA 4LB4A 3L7RA 4H8VA 3I7RA 1BVNP 3L23A 1TTJA 3NL2A 4ZL1A 3L4UA 3TDFA 3E0VA 3H23A 1CI1A 3BUVA 2INZA 1V3HA 3II1A 1O94A 1V77A 4LANA 3EPOA 4ERAA 1BKSA 4IM4A 1Q6DA 3P67A 1N8FA 1UC5A 4Q3MA 4DZIA 2QJNA 3TZNA 3MI3A 4NYYA 4RNHA 1G69A 1M6JA 1R2SA 4KFOA 2R1NA 1PV8A 5I3DA 1QNSA 4A3HA 2MUCA 3D46A 3NSMA 3TN4A 1XIGA 2O9OA 3EGJA 3UWUA 5T8GA 4XZBA 4U31A 3CASA 3UZZA 3LSCA 3V7PA 4MFEA 4XKYA 1YNQA 5FJTA 5CGMA 1V0LA 3STCA 3UXDA 1A5LC 2FB2A 3GAYA 4CCZA 1FKWA 2ZYFA 3UWZA 5CJMA 3WO8A 3NM3A 4MLRA 4PA8A 1IXOA 1WPCA 4W86A 2E3ZA 1OFQA 3RXZA 1UA3A 3R13A 2ZICA 3WJSA 2CBIA 1D3HA 1VD6A 2B7PA 5DF0A 4H9ZA 1IEQA 2V2HA 5REQA 2J27A 4LYQA 4AC1X 5DCEA 4K7YA 3KUMA 3MHGA 3TEVA 4TR9A 1JVNA 1F5ZA 1VPXA 3KL3A 2HBXA 1RQBA 4UBPC 3V35A 1BAGA 3UJRA 3TC3A 3QSRA 4W5UA 2O9TA 3TR2A 1VLWA 1MQRA 2FIQA 2V5JA 4IGMA 1IEVA 3QXBA 5EGRA 3IRDA 3H54A 2E6FA 4BQ3A 1DXEA 1JAEA 4RPPA 4YTSA 3E2QA 2RAGA 3QYQA 3GH4A 1RBLA 5C7HA 1KFKA 1TZ7A 3KRSA 1TMLA 2D20A 1UB3A 1K9DA 4CQBA 1I45A 2PAJA 3LHUA 3CIXA 3VZXA 1VJIA 1HKVA 4NNAA 5I0DA 4QISA 4LCRA 2DEPA 4NZ4A 3CTLA 1X6LA 1ADDA 1TYGA 1RH9A 3W4RA 1YHTA 1V0MA 1EQCA 2NXGA 4DO4A 3KDOA 3CWNA 3H7VA 2OT0A 4DAIA 1ZPTA 3MO7A 4E2BA 4LTSA 3WN6A 5HUPA 2EPKX 1ADSA 3CMJA 1CXHA 4J35A 3ZXWA 1AQMA 4XIAA 2PB1A 2REQB 5M1TA 4Z2LA 4S3JA 2QULA 3V0UA 1QPRA 5LXEA 3W7HA 4ZXLA 5E0KA 4AD2A 4DX3A 3F4WA 1TCDA 4AD4A 4IMCA 3E1F1 4A8LA 1ZU8A 4AF0B 1VRDA 3BLFA 3RNDA 3GFZA 4HMDA 1OZQA 4O0QA 1NWTA 1EO5A 3SCSA 3FV9A 4WSHA 2WSQA 5LHEA 1ZUAX 3DU0A 4ZQOA 4AUBA 3MKCA 2DZTA 2ICSA 4S3AA 5KZMA 2XGBA 3XIMA 3FXGA 5I3JA 3W83A 3L0KA 2IXUA 2O0TA 4AMCA 2DUAA 3O3RA 3OGRA 4L80A 3FYOA 4B5TA 3GUGA 1SJAA 1QI0A 3W7EA 4AU0A 3QY7A 1E56A 1U1JA 1ZAJA 2P10A 3BO9A 4ZVJA 1LYXA 1H0IA 1VYSX 3ZJ6A 4AWEA 2DH2A 3WBXA 3G6LA 3RMEA 5E0FA 4JBRA 2NLYA 5LIKX 3EOLA 3L4WA 4H9VA 2OR2A 4CEUC 2NSOA 1J10A 1F8IA 1BQCA 3DHDA 4KMQA 1FHLA 5KITA 4QE1A 1S5VA 4OBTA 5G4WA 2GWNA 4AEFA 4X61A 1IIGA 4AD0A 3NNTA 3WLTA 2VCCA 3RITA 3NOYA 3BMVA 3QHOA 1OM0A 1S2TA 3LY0A 1C92A 1PTGA 4JCLA 5CZJA 3BLIA 2NLIA 3M0LA 2YGYA 3K8LA 4TMCA 3O6CA 1R3VA 3QY6A 3KOZA 1ZGDA 4LAOA 1E4IA 3GVQA 4MDOA 4US5D 2YX0A 3LCGA 1GOOA 3O1NA 4QSFA 4QLLA 4W4QA 4ZSUA 1EXBA 3HB9A 1Z32X 3WQCA 1E0WA 1B31A 2PD5A 3DKJA 3F2BA 3A9BA 3QFEA 2YCLB 1H61A 2IUZA 2V8ZA 3H2AA 3U4FA 3QMTA 1I60A 1Y7VA 3S9YA 1Q7MA 3R12A 1XX1A 4JFWA 3G8RA 4JD4A 3CQHA 1GQNA 2BHYA 2LLEA 1CLKA 3QPEA 1J12A 1VS1A 2P1FA 3RF9A 3ITYA 3I3BA 2DZPA 1OZMA 3PJTA 3REQB 3HURA 4QE5A 2FJUB 2OX4A 3DIPA 1VCFA 2L5HA 4FIQA 1BYAA 1XSKA 3HIJA 1B90A 4P2VA 1IT0A 3MVTA 4GPNA 3UG3A 2PLKA 4E3TA 2Q3OA 1A50A 5D30A 4LC6A 4JNZA 3NM1A 4X2RA 5E0CA 5BZAA 1O12A 4CU6A 1AMKA 1PWLA 3C2RA 5FEZA 1RV8A 2I14A 1BRLB 1UR1A 3W82A 1LG1A 1V7AA 1SR0A 3TAOA 3GK0A 4GACA 2XZ9A 4UZSA 4JQ3A 1UR9A 3FK4A 2CHRA 4DBEA 3LBOA 3N4EA 1AFSA 3A3HA 2EF9A 1H63A 1W5QA 1Q2RA 2Z2AA 2Z4GA 1R3SA 3QW4B 3QQWA 1Q66A 2WO5A 3I3DA 3PNUA 1R0MA 3TCEA 3EOOA 3MUZ1 1FCUA 4FA3A 1JDCA 1B3OA 4W7WA 4O1FA 5B7ZA 4KCVA 2YA2A 4NAEB 2HVOA 5ABFA 1GPFA 2VRKA 2X1IA 4AYGA 5BXTA 4U2ZA 3PB2A 4UTWC 3UPWA 1X8CA 3BCJA 3LV5A 3TTYA 1IIHA 4H9MA 1FH8A 4X0NA 2ATSA 1VP5A 4MJ4A 1BWVA 2AGKA 2VT0A 3AUOA 3I7SA 3LLDA 5BCAA 5HPCA 1R46A 3MSDA 5TF0A 3FFSA 1Y65A 5IRPA 1I0DA 4ZTYA 1MZHA 5FJRA 1EPXA 2FMNA 3KRUA 4CD4A 1WYIA 2R1KA 1JYWA 4N9DA 5FCZA 1MO0A 4GA8A 5DQPA 4JOMA 3ID7A 3UERA 3VIJA 1W9XA 3U8GA 4C1KA 4B5VA 3QRHA 2I57A 4DO6A 3UZYA 4X3ZA 4WKHA 4M51A 2QGYA 1YTKA 2WZMA 2NT1A 3T0CA 2CLPA 1FX6A 3E2SA 3CC1A 3WQEA 4LOCA 1DEDA 3C3NA 4A3UA 3TC6A 4CKQA 3GUWA 1V6VA 2BXYA 4Q4SA 1KBBA 5HA7A 1X7FA 3UPBA 3WNNA 1PPIA 3TU9A 2I9UA 1TR9A 3CMGA 3C3UA 1V8EA 3AMCA 4L7ZA 4L4LA 1JJKA 1PB0A 3KL0A 4JQAA 4JTDA 2NQZA 2WZHA 3CZKA 3WF2A 3DG7A 4PN2A 2WAGA 3EXSA 3HMCA 3IS4A 4ERGA 3G8EA 4GIAA 3GDRA 4JL2A 2UZ9A 3FCPA 1W54A 3Q4DA 2IQDA 1HUVA 4ICNA 1F7BA 1E1FA 3C86A 5TQLA 4EF8A 5HJXA 3VDGA 5C0QA 3DC0A 4ZOAA 3LX9A 4GYPC 4MNLA 4JDYA 1MZRA 2VR5A 3D5HA 1U5JA 4X22A 1DIOA 2JBMA 3DZ1A 4LF1A 3WL1A 1K8XA 1JI2A 1LLOA 3R43A 1E6QM 3RILA 3K2GA 3P81A 3DHFA 4Y9OA 1XC4A 1Z6KA 3OYXA 4PE8A 3UXAA 1XUUA 2R1LA 2ZZ6A 2PDKA 3CLMA 3MUXA 4YMZA 4DNHA 5M3WA 3M1ZA 1AJZA 3U57A 1AODA 2QXWA 3WBEA 1FFQA 4KBXA 3EX3A 1N82A 2G3IA 2QKFA 2XSXA 1FRBA 3NPXA 1Q85A 1FWTA 4ORIA 1ZENA 1KM2A 4UZUA 3RRAA 1J11A 1OGBA 1XYLA 3EWDA 4HJFA 2Z29A 2QJGA 1E9YB 1LP6A 1RBOB 3UR2A 2ZRWA 1W17A 4A3QA 3N4AA 4HOWA 1GGOA 3W76A 4N4QA 1F76A 4XAFA 3W6YA 3EWWA 3KZPA 4H9TA 2IXVA 2CNCA 2DVXA 2PC4A 4W88A 1NIUA 3NDOA 4MB3A 2EG7A 1CZ1A 3WF4A 3P80A 1QCWA 4CU7A 2IS7A 3ARWA 3S0CA 4C60A 1MW0A 1W37A 2Q3RA 4G8TA 4UXDA 4HT3A 3LHTA 7CGTA 4C6KA 3QQ0A 1GEHA 1F6KA 3ICJA 2J62A 2E5CA 1ONRA 1MW1A 2YCLA 1XIJA 2FPVA 4AXKA 2AOSA 3S9IA 1TWDA 5A6TC 1V6YA 2H9AB 5DT5A 2FPYA 5BYWA 3HPXA 5D04C 3BCFA 3COTA 3GG1A 4JQ2A 3R0DA 4QJ4B 1MQPA 1BGGA 1QNQA 4GI6A 4IT1A 3N25A 4GD0A 3BANA 2AAMA 3AZSA 3EZ4A 4I90A 4DIAA 3AHXA 3MSGA 5BRQA 2XG9A 4GQQA 5F1VA 3K8MA 3L0NA 3P82A 4HTYA 4Z0SA 2WHJA 1UWUA 2A4AA 4JIPA 1MXGA 2QUTA 3CB8A 3A4WA 2B7NA 1WB0A 3KWSA 4S2CA 4UTFA 3KFTA 3VKJA 4HU3A 2XH7A 4DNMA 2D1ZA 5F2IA 4MWAA 5IFTA 1KA9F 1RHCA 1HJXA 3VIOA 1T5AA 2QV4A 1US3A 2YL8A 3PBUA 2PDNA 4H04A 4RK8A 1UYQA 3ZFHA 1BG4A 4F8XA 4XIMA 4JX4A 1H5YA 4OJYA 1CB7B 4F4RA 4O52A 2V82A 1BF6A 7A3HA 5U4NA 2ZX6A 1HF6A 3GR7A 5H2ZA 4QM1A 3PUEA 3DBNA 3HG2A 2WQDA 1MUMA 3MZNA 3MZ2A 3SR7A 3CT2A 4GXMA 3FLUA 4Z08A 1XD0A 3DERA 5CPNA 3TJXA 3NL5A 1KB3A 4K1GA 3WLQA 3CGTA 2OCZA 2V5CA 1WO2A 4LU0A 3W2LA 3V1HA 1RPXA 1SSGA 1ITUA 4AYSA 4R9XA 1KV5A 3BAJA 1FWBC 1X7IA 1UIOA 2F38A 1ML1A 4GUJA 1XRTA 1AJ2A 1OSEA 3KBNA 1I2PA 3WD4A 2DZBA 1CGXA 4LPCA 3CHCA 4GI9A 3TWBA 1DJQA 1DIKA 4FR1A 5CXPA 3PTQA 1KRMA 3DXIA 3NFUA 5H8UA 2O7SA 3VKAA 4V1YA 2VJXA 1Q2SA 3CTTA 1V3KA 2Y7GA 2XGIA 2XGZA 2A3HA 1OX5A 3KVJA 5JMUA 5KEZA 4FR6A 2P8CA 2YZ5A 1HKIA 4AZIA 3WQWA 3SFKA 5BWAA 4XUYA 2ZZ5A 5DLCA 4GO8A 4KCWA 4CCCA 2Y6ZA 3FAXA 1V4YA 5G1TA 1Q5MA 1QUMA 3DBPA 2G37A 3L12A 1VH7A 4HNNA 2F84A 2ZUUA 3WCZA 2BOEX 4MMWA 3QC0A 3TQVA 4ZBCA 3K30A 3QJAA 3GXNA 3FYPA 1PDZA 3KVLA 4MJ2A 4ZA0A 2Q09A 1JFHA 3RR4A 4IFOA 4DF1A 3BAYA 4O0ZA 4C6PA 2HJPA 3IGUA 3M6DA 1LLWA 3FVDA 1GT8A 3NIYA 1TELA 4Q7NA 3TOYA 4XZLX 1RLCL 5K2ZA 2WXDM 5I79A 1PIGA 5ABGA 3FHQA 4I9JA 4PBGA 3W27A 3UD6A 1ONWA 4JHZA 3UVIA 3S1XA 1W0MA 4H6QA 3LU2A 3QY8A 4L9ZA 3A5FA 3LHYA 1TJ1A 4D6IA 3N14A 3W26A 3AXXA 5C9ZA 1PX8A 1R7OA 4B5XA 1FWEC 1IGWA 3LXAA 3S47A 3PULA 3U2OA 2J7HA 4AHPA 2PTDA 3CXOA 4UCFA 2P3ZA 4TTGA 4L9XA 2VZVA 2OU4A 1UR4A 1JXKA 3SIMA 2RJGA 1DWJM 3SUTA 2E09A 1KXVA 1W9UA 4GNVA 3PC0A 2VR4A 3RM4A 3F2DA 3S5ZA 3BV7A 2QCLA 3VI2A 1SZEA 1GTHA 1WDWA 4HYWA 3RX3A 2JALA 4ZB0A 1W6TA 3MBFA 3PBGA 1TCMA 4XZHA 4PTVA 4KT2A 4PMDA 3H2CA 2R94A 3PAJA 1AD4A 3RCMA 3QV7A 4B91A 1XBZA 4B90A 4AZCA 3N2XA 1BKHA 1E0TA 4M3PA 2HE5A 4M24A 1WZLA 4X63A 4G56A 3NURA 3DX5A 2QCEA 3TIMA 1PCKA 4BF5A 3KCOA 1X96A 3NQMA 2UWFA 5HR6A 2CHNA 4N9CA 4RX0A 3O8AA 2DZXA 3IJQA 2OYKA 2I16A 4D72A 1Q6QA 3IPWA 1KRAC 1G9HA 2PWGA 1M7XA 1PWMA 4GBDA 1EIBA 3UF9A 3OZMA 2XSAA 3SCNA 2GSJA 1YXYA 2CWXA 1U5VA 4UOZA 3HJZA 1MVYA 5CQ1A 1W3KA 1BD0A 5E9XA 3KBMA 3L4TA 4B3LA 3WSUA 4PRTA 1GVFA 4XQ6A 1IXPA 4NNCA 1H1YA 3JZEA 5HWJA 4B15A 4YYCA 3CUFA 1OX6A 1EKOA 3FKKA 4U3AA 4Y8FA 3VD3A 3HFTA 3E0WA 2VL4A 3SADA 3KBVA 1VGAA 1WDQA 4EPKA 5KTLA 2PDGA 3LMZA 1GHRA 4O1CA 1VC4A 4J5NA 4JX5A 4C6MA 3ZMRA 1NDVA 4WSKA 1Z44A 4HNTA 4D9PA 3D3AA 3V5CA 4R34A 5D37A 4LAUA 1RP8A 1X1ZA 1VBHA 3VD4A 1KV8A 5C9UA 4NHVA 3JS3A 1O1ZA 3F4CA 3DFOA 1MRAA 6PTDA 2GK1B 4WY0F 3B8WA 3LRMA 1NELA 3QV8A 1X6UA 4Y9NA 4L5ZA 3DESA 2C8NA 2WPBA 3BLPX 5D9PA 2Z7GA 3ARVA 3VUPA 1IF2A 2QW5A 9XIMA 2VFEA 5A6LA 3FGCB 4Z1CA 3UG5A 3DHPA 4I5UA 4HNLA 2PBOA 2V3FA 3CZGA 4LW7A 4JS3A 2PMQA 4PTNA 4Q33A 3ZWSA 1OD0A 3G22A 4AX7A 3GDBA 2E7FA 1XLCA 1XIEA 1UH4A 4OV9A 1K7FA 2F9RA 3SSJA 5K9DA 1MFUA 3KAOA 1ZRQA 2PDYA 3WKZA 1DXFA 2R82A 3MYOA 4Y8EA 1PSCA 4LX4A 1VHNA 2A5HA 5BXSA 1EFZA 1JRBA 1XDJA 4H8UA 5M17A 4IUGA 5A8QA 3M0XA 5A6MA 1KM3A 2DU2A 1C29A 5CC7A 1JCXA 3ABOA 4IFKA 4NJIA 3W7OA 3CZLA 4ZOEA 3AS0A 3HN3A 1EP1A 1J6OA 5LXXA 3U7BA 2QPUA 3VC6A 2XPKA 3WH6A 2DY3A 3URNA 4RV3A 4IMEA 3BVJA 3SZ8A 4HP5A 3GIYA 3Q94A 1GWJA 4OTKA 3P93A 4TVDA 3S2MA 1ZQ5A 3N4FA 4KEUA 1TPC1 4E8GA 1EUAA 4IL2A 5G1MA 4RUBA 1YADA 3D0CA 1BVZA 4GUHA 1VFUA 2JKEA 5CPTA 3AMGA 4NILA 2NQ5A 3LK6A 2I56A 1PYFA 4YWIA 5T26A 2XWDA 3TLQA 3WQ8A 1T8QA 5D32A 2ZTKA 4UQAA 2Y5SA 1KRBC 2XIJA 1G7VA 3SECA 3WD0A 9RUBA 2BHZA 2QF7A 2IKGA 3USZA 1E9ZB 5ABFB 4Z2IA 2XN0A 3W53A 5BU6A 1KXQA 3W84A 4ZOBA 3G1YA 4IGNA 1BWLA 4MKVA 4RXGA 3TONA 1FXQA 5K9CA 2WYSA 3DECA 4KF1A 4ML9A 4LUJA 3MS8A 2HK1A 3MDWA 1DWIM 1VLIA 3NA8A 2ZZ1A 1UZDA 1P48A 3QGAC 4V2XA 3N19B 5FF2A 1OB0A 4KRUA 4AIEA 4XUGA 2GGJA 2W9MA 3BAIA 1DQUA 2VR2A 3SSZA 1LCOA 1XCFA 5CSYA 3QPYA 3W87A 2EJAA 2WNWA 3AIBA 3H26A 1KGWA 2A3CA 4Q4MA 4L6DA 3G6MA 2CW6A 3OQEA 1RD6A 3EWUA 5LIWX 1GOKA 3FA4A 2YFOA 1LOLA 3P6LA 1WX0A 3NL6A 1QRQA 4LEQA 1WXYA 4OU1A 1QXLA 3I3EA 3QPZA 3SY8A 1ZBCA 3M5XA 4PUKA 1GOWA 2VZOA 3TKFA 3G1SA 3PBYA 4GZIA 4H2CA 1SFJA 4BZYA 4JIEA 1ZY9A 4JFSA 3AXKA 3R5EA 3F4NA 3RGTA 3H6OA 4XD5A 1XQLA 4KS0A 2DIJA 1IV8A 3S2NA 1JIBA 1AL7A 1KBKA 3FN9A 1E40A 1P0BA 4JTKA 4S3BA 1V0KA 3SY1A 2VEGA 1FXPA 1XLFA 3EA1A 6TAAA 1A5BA 1VEOA 2PBGA 4O4WA 3UZ5A 3GNDA 5AECA 2OWXA 3BJTA 2O9RA 4DYJA 1E0UA 4Y9PA 4MWAE 3RJXA 4CNOA 4M6UA 1JCLA 4A29A 4GYFA 3GG7A 4FHAA 3S3GA 4QP0A 3GXTA 2YA0A 6ENLA 3WLMA 4JKMA 3LM7A 3G18A 3QGKC 4K37A 1LWIA 1US2A 1I9CB 3MUCA 2QUVA 2OLAA 1S5TA 1L6GA 1LQ0A 4JTLA 3VYLA 4AIUA 3PJXA 4GE8A 4JZ5A 1CGYA 1P7TB 2QCDB 4PRRA 1XH1A 3F5KA 2INEA 1UHVA 1UP0A 1ZALA 3K1GA 3ITLA 1J2WA 1UR0A 1TZ9A 4NT0A 4F0RA 1K6WA 1R9ZA 3L65A 1W1VA 3MA8A 3AFBA 2PGFA 1HL8A 4O17A 4MUZA 1EP3A 1A80A 1A0CA 1F05A 2NQHA 2YKKA 4WGXA 4QDWA 2NQLA 1A3WA 4DJED 1F4AA 1XP3A 3ARRA 2BGQA 5T91A 1ZBKA 2FQIA 3MP3A 2QAFA 3WEZA 5IM51 3PZOA 1MYRA 1ZBWA 4R7OA 3RMJA 4EXAA 2E68A 3VOCA 3BCDA 2DJXA 3QOKA 4GVGA 1YE4A 4WKAA 2A3AA 5AKQA 2C7FA 1DJZA 2E8YA 3OLGA 1FH9A 3KRBA 4HU0A 2PPGA 3KXQA 3EDJA 3FJNA 4ZB5A 1E6XM 1L8NA 4AISA 1DE5A 3KVMA 5G2IA 3E0FA 1SO4A 2NUXA 4MYAA 2J8FA 3LQLA 3SM0A 3ATZA 4GIYA 3W7RA 3M46A 7TAAA 2W6RA 4DJFA 2V67A 1F3WA 2DVTA 8A3HA 4QS6A 1GTEA 2PF0A 1QHZA 4M56A 5CZTA 3C8NA 3AS1A 2G3JA 4B5NA 1V6TA 3AIRA 4OZOA 3DGBA 1PO9A 4RE0A 5C9WA 1Y5WA 2CZDA 3AUJA 1TE6A 3N6QA 3W1XA 1YTEA 4LNCA 3KBSA 5E70A 3IV3A 3P7YA 4JR5A 4LBSA 3P2VA 4GC3A 1SO5A 1EBGA 3OGVA 3AJXA 5A8PA 3PM6A 1CLVA 4Y6GA 2WW5A 2R14A 5D2VA 3S8HA 4MIMA 5HMEA 1QPOA 1ISVA 4KWSA 3L67A 3I10A 1OY0A 2CBJA 2O92A 1XF0A 1XLIA 3VABA 3U2EA 2W27A 1NAL1 1IXNA 4HA1A 4JTRA 2ACUA 2E4TA 2DT0A 3MANA 2PDHA 3WMCA 4GZJA 4ACZB 3HQNA 1Q45A 1YLVA 1ISZA 4QROA 3VZYA 3HM7A 5IHRA 1JNEA 2A3BA 5LNWA 1QI3A 3AALA 4DPPA 4CD5A 1C93A 4O8AA 3CAVA 4GNKB 1HGYA 3FJLA 4HSOA 1RCXB 2C91A 4LS1A 2GSHA 5CAHA 3H8AA 4PRWA 2Q8LA 3OEXA 4FI4A 1FWHC 3APTA 3FHAA 2JF7A 5EMLA 3WDRA 1MSSA 2TSYA 4ECLA 4MY1A 3LUTA 1M7PA 4O16A 7REQB 1QPQA 1TPB1 1VFOA 3ABSA 2NXHA 3SCQA 4HKPA 1AW1A 4HNOA 3ZM8A 3LQGA 3LBCA 2C19A 1TZZA 2ANUA 6ALDA 4V15A 4ZQMA 4HYVA 4DHGA 4OVXA 3WH9A 1T41A 1JCMP 1K6AA 3VGEA 1XPYA 2RDXA 2DSWA 1OCBA 5EU9A 4ENLA 3SQMA 4I7VA 1L2QA 2OT1A 4F48A 2BY1A 3WLHA 4ROPA 1SW7A 3LA4A 2UV8G 2GDQA 3QSTA 2WCSA 1VYPX 2CIPA 4H6KA 1RK5A 5LYRA 4HCDA 4DXKA 3B4YA 2J7CA 3N04A 2QCGA 5HK4A 2FTPA 4R53A 1LG2A 3O9NA 4IMFA 2YPIA 1IHIA 4BA0A 1SZNA 1FDYA 2V5DA 1I6NA 1KFJA 4MWAC 3BW3A 1U22A 1FWSA 3GVWA 2YA1A 1R2TA 3PPCA 2J6VA 3M0MA 1C9WA 3WQPA 2FHBA 3KRZA 1UKOA 2PDPA 4D6CA 2WSPA 3W1NA 3B40A 5I09A 4DZAA 3B9NA 4DWSD 2OX1A 3MWAA 3VMNA 3S5NA 2WQPA 4KESA 1VR6A 4GYKA 5A6BD 3CUHA 3R10A 1U33A 4ROQA 1M65A 3BLEA 2Z24A 3VOJA 3S9ZA 3BICA 2Y7FA 1I2RA 1P6BA 4KRZA 3QR0A 1GOQA 1RAKA 1JXJA 1K77A 4HSHA 2FZDA 3WMSA 4BI5A 3A47A 1P0EA 4JKKA 1EJVC 5IHSA 3DKLA 2XIOA 2PGEA 1EJXC 2QV5A 5E09A 1E1EA 1H7XA 1YMYA 1FKXA 2HRWA 1AD1A 3EPMA 3K5XA 4FOKA 2BSLA 7PTDA 3C2YA 1G67A 4JL1A 2F2KA 1ALDA 3B05A 3CQKA 4FNTA 4UR8A 1HTIA 4FLQA 4N2YA 1EEPA 1ZAHA 2PDIA 1XRVA 2E67A 3HPZA 5LGXA 3W2NA 1Z48A 2ZDSA 5FD0A 2E6YA 1FFRA 1T8XA 4I7WA 4JY8A 2QR6A 3TTSA 4IJRA 3TA9A 3FAWA 2F6XA 4HZMA 2OYLA 5K3VA 3CYJA 2BDQA 3S1GA 4F2TA 1E4MM 3V18A 1JZ5A 3Q2DA 3TW9A 3IK2A 2FVLA 3NR0A 3VM5A 4LS2A 1VKFA 1UD6A 1TV7A 3T7VA 2GFTA 3W00A 4XD4A 1XYCA 1OK6A 1LTDA 1HL9A 3POCA 3UWQA 3ERPA 4US5A 4H6EA 1FCBA 3PUGA 4KFNA 1UWTA 3T0TA 2WHKA 3W86A 1XISA 5EMKA 1A0EA 3RU6A 4R27A 1PZ3A 1GQJA 1RY8A 1UQYA 2WNZA 3LZ5A 1E6PA 1XC6A 1TUFA 5C6MA 3IACA 2CU0A 2WMHA 1R9XA 1CXKA 1HZYA 3T42A 4JTCA 5H6HA 2Z1SA 4F0LA 4QG6A 2INFA 4NAFA 3P62A 2G96A 2P5NA 1KW1A 3HTWA 1XJBA 1DHKA 4H7VA 4V28A 3QQ1A 1Q63A 3VOGA 1I1XA 1F2JA 1WKEA 1Y5VA 5BRPA 1JCYA 3NPWA 3QR3A 1WXZA 2R9RA 4H1ZA 4HPNA 4UFKA 2VC7A 3MW7A 3EWXA 4RW3A 4L6HA 2OFJA 2P8BA 5I3KA 1QW8A 3M6YA 3GFYA 3TW7A 5JQ9A 4QNEA 2BGSA 1ZHAA 2PGRA 4CQCA 4Q8OA 4Y96A 4FNQA 3W2MA 3IAQA 1FWCC 1XGDA 8TIMA 1EO7A 4PH6A 3P74A 3LPFA 3UA3A 4ZQNA 1FWNA 3VOHA 2BVDA 3O6DA 3UGVA 2TPSA 5H8MA 3QLDA 1N8WA 1SFTA 2EQDA 1F74A 2FH8A 4MNJA 3VGFA 4IIBA 1LQ2A 1N55A 2DFAA 3LLFA 4J2PA 4O1DA 2J7BA 3UWVA 2QMKA 3NQEA 5GNZA 4JEJA 5G2HA 1K02A 1ZB5A 1GORA 1UUMA 2E6AA 3WH8A 1B1YA 4GBUA 2WLZA 4ASTA 1KFLA 2PDFA 5AB3A 5PTDA 1GK8A 2V38A 4N9BA 1X1OA 4GZEA 4AIBA 5I23A 1DV7A 4DF0A 4MB5A 3M41A 5CSUA 2DSUA 2FZBA 4MFDA 1A49A 4RZBA 3N6JA 1DJYA 2DZSA 4G5DA 3W1PA 1CGTA 2Z7KA 3IJIA 2FGLA 3LI1A 1UOZA 3BSGA 3WQGA 2VOTA 1XR2A 5BOOA 4AWUA 5D2WA 1TRDA 3BLLA 3UZJA 1Q6FA 1DIDA 2VNCA 4QLKA 5A8OA 4IOTA 2XJ7A 1OGGA 2A3EA 3GFXA 2OSWA 2ZUTA 3RLVA 4O1AA 4B3KA 1MEHA 1QHOA 4FPSA 3GTFA 5LNVA 4G1KA 5M2FX 2UY5A 3N2OA 3H2OA 3R89A 4QAIA 4QNWA 5D2TA 2ZZ4A 1EJWC 1G7UA 3RX2A 2NX3A 3FGCA 3KDNA 4PZVA 1ICQA 2WVVB 4Z42C 2PD9A 3MMWA 2PTWA 2X0SA 4LYPA 4F2UA 3EBVA 2RGMA 1Z42A 1DWFM 4K1WA 2J7EA 2RGLA 2CLEA 3VIHA 1EB3A 5HMSA 4Y7EA 1Q7ZA 3HOJA 1H11A 2XVNA 1RD5A 5DFAA 3IAPA 1ZJIA 1YDOA 3BAKA 2C14A 2VFIA 1ADOA 3BPWA 3VCCA 5FKYA 3LTPA 4PTWA 3O0FA 1S3HA 1ELSA 4PUNA 3VD9A 2FVKA 3DEQA 3MUIA 2J79A 3L4VA 2V68A 2W91A 1Z41A 4XAGA 1WP6A 3T1GA 1ME9A 3WJWA 2F8QA 1B3XA 1GJUA 4QCFA 3PSVA 4REQA 3VC5A 3SCPA 4UQDA 1FHVA 4AD5A 1R7AA 1EOKA 1R2RA 4XV0A 2EPMX 3C61A 5C71A 3GNNA 2ZRXA 3F1QA 3PANA 3S1UA 3AWOA 3FA3A 3URAA 1BRLA 1R3WA 1C8XA 3S5SA 5I3IA 3LG3A 2VGBA 4Z1BA 1IXQA 4PMVA 5A5WA 3T44A 2VM8A 3LTYA 3GW3A 1E3ZA 4B16A 4LY4A 5BRBA 1EJUC 4GNJA 2NWSA 1U1UA 1UKTA 3TYBA 3AZRA 2BASA 3CIWA 4AVOA 1B2YA 1TPFA 1TV2A 3EDKA 1XBXA 3PR2A 2YCIX 5K4XA 3APGA 1KM1A 3CUZA 1FCVA 3SGUA 3TYCA 3LHZA 4JN8A 3S5YA 1NSJA 3EPNA 4OT7A 4ATLA 2D73A 1VB9A 4Y9AA 2V3EA 3H2NA 2V30A 1XDMA 1DHPA 2ALRA 4D8ZA 3EX6A 3WG6A 2FZ9A 2PU0A 1CEOA 2NXIA 3IIXA 7XIMA 5A8MA 4HZ6A 3ARTA 1UMYA 3NEVA 3KX6A 1AZ2A 2GJLA 2DZVA 1QW9A 1MDLA 1W9DM 1LLZA 3ITCA 5H8PA 4KEZA 4E5TA 1DQXA 1NOWA 1H7NA 2WCAA 4GG9A 4DZHA 2VRJA 1IR2A 3BK0A 4OUIA 3TCSA 3TXVA 3OJGA 4GIRA 4JIQA 3CO8A 1QW7A 2J24A 3H53A 1X97A 5EYWA 4R7JA 4EANA 1I2OA 3TNOA 4LT9A 1GVEA 3QBUA 4MSSA 3RIKA 3DG3A 4HD5A 3DG6A 2P0IA 1G4EA 5I3GA 1NJJA 4TUFA 3S5OA 1UKPA 3UP8A 3W88A 2Y70A 4HBKA 1TWIA 3DDMA 2OVLA 4KKXA 5I06A 2ONEA 3VXGA 3ZLGA 4C7GA 2HISA 4H00A 1XFCA 1C8VA 4PUDA 4S1FA 1J01A 2FDMA 3KS6A 3L0GA 3Q37A 4MVAA 2H3DA 3IJDA 4B2DA 4IQJA 3M0KA 1WZKA 3QZ6A 2PE4A 5B80A 4GY1A 3NQ6A 4CNSA 2WWDA 4K6AA 2JGQA 1LORA 1SSDA 2VELA 3LRKA 4PB3A 2VQTA 3WFLA 3EWYA 1KTCA 4OOUA 4F79A 4NRRA 4NL1A 1VQTA 4J3XA 1QO2A 1RPKA 4YWSA 1P1MA 1R6WA 1JAKA 3TSBA 2Q6ZA 1EYWA 3VINA 5FI8A 4LVGA 1KM6A 2VD8A 2EPLX 4EACA 4PCSA 2X42A 1OT2A 2W3ZA 1GOIA 1R8LA 5LA1A 4GJIA 4H41A 2FDSA 1PTDA 1HJQA 4GI4A 3AIQA 4FZIA 3V0TA 3W9ZA 5I6SA 3B0VC 4IH3A 1JPHA 1VBUA 4JY9A 3T07A 3QHNA 4BI6A 1GQKA 3V36A 1B3YA 2DW7A 5LGZA 4HHMA 3TSMA 1G4PA 4WJEA 4DELA 5AC6A 4G1NA 1EWDA 4IP4A 3EMZA 3KTXA 4BF7A 3BG9A 2QCCA 1KBLA 5HNTA 1E43A 4H8NA 3TLLA 5FIPA 3VD7A 2QMJA 3UR8A 4JFTA 1YKWA 4S3DA 2D23A 3VIIA 2DORA 4H6RA 4EPBC 1E70M 1GVSA 4K8GA 1DBTA 4JTFA 3TXZA 1SQ7A 3A4AA 3LCWA 1K1DA 2WZTA 1AA1B 2VC6A 3AC0A 3PN8A 1HJVA 2C1GA 2NWRA 3QV9A 2QF8A 2OWWA 4IUOA 3MP4A 1JUEA 1Z89A 3R1ZA 3CUXA 3TQPA 3UFYA 1FUYA 3NQDA 3WDJA 1BVWA 3EA2A 5CEWA 5DMMA 4IQDA 5XINA 3ZSTA 2PGWA 6TIMA 3AAMA 4XBJA 2WPGA 3EOSA 2J7FA 4Z1YA 1F73A 4A6GA 3C2EA 1B30A 1SR9A 1TTQA 1O1HA 1J18A 1A5AA 2PFHA 3LDVA 4IX2A 1L6SA 1YNYA 4MPQA 3W2JA 3W1RA 2JF6A 3IVUA 1VBJA 3UXKA 2OLSA 1EPVA 3ABZA 3V3WA 4HZ8A 4KIEA 4G6CA 2AKMA 5A6BA 5XIMA 1E5JA 3EKZA 3W7JA 3WK0A 2OZ3A 3CEPA 3W7QA 4CN6A 1OFBA 4UOJA 3C0JA 2YSWA 3OP2A 2VX4A 3VDBA 3BW4A 4E38A 5LHFA 3S2JA 3FY1A 1IT7A 4WIWA 3PAOA 2ABAA 1EUNA 5C9RA 4W87A 1TV4A 1BFNA 2Z1KA 4PSRA 1VFSA 2Y89A 2IPWA 3RLHA 3ONBA 3SURA 3HFYA 1EXPA 2YDRA 3KM8A 1S2WA 4WSJA 1P0DA 4DXVA 1R47A 3OGSA 3TFCA 2YCKX 2R24A 3HQPA 3V0SA 2E1WA 4M1RA 2GOUA 3LGGA 1DPMA 1JQVA 2NQ9A 1AH4A 2GJPA 3WK3A 2EJ1A 4E4UA 5JH2A 1POJA 2HS8A 4M8UA 5CH9A 3MP5A 4LYRA 4W9TA 5AHLA 3GXIA 2PP3A 5EL1A 3T4CA 6REQA 1ZJHA 4EWND 4IQLA 4IHCA 1V51A 4P7NA 2NX1A 4F9JA 3ANVA 2OMAA 2WVSA 4DWSA 3WD1A 3VZZA 3PPGA 3TAKA 5DELA 4YN5A 1EJTC 4K8HA 2AQOA 3RO6A 3O15A 2DT1A 1OG6A 2E9BA 1H60A 1VRXA 3M4HA 1JNDA 2H8ZA 2Y0FA 1OX4A 1NF0A 5EBAA 3A13A 1KQZA 2WSRA 3HBLA 4DYKA 1EJ7L 4G7EB 1W8GA 3ZVHB 1HP5A 3JZUA 1OC6A 1QPNA 4ZCWA 2Z1BA 4JN6A 1TTIA 5LIUX 1FH7A 2GWGA 3TR9A 4C6LA 3LI0A 2OODA 2A79A 3QN3A 4IPPA 4RNJA 4K3ZA 2CZEA 5MHBA 2QJJA 1R30A 4BCEA 3UCCA 1SZFA 5AC8A 3GQYA 3UY7A 1XLJA 5ENLA 4QDPA 2A0NA 5EBUA 2J6XA 2CFFA 2HTMA 1UBSA 1H2JA 2QPSA 2XIMA 1I2QA 3W7NA 1BYBA 2WKJA 3VCNA 3B8UA 1AK5A 2HBVA 3AIUA 3CHVA 1XSIA 3B8VA 1DE6A 1YXDA 2F6KA 4IX0A 3WK1A 4IIHA 5DO8A 3SDOA 3ALGA 3ZJ7A 4BK9A 4PODA 1IEIA 3ITGA 3IGSA 1D2KA 2ISDA 1JPDX 4AY1A 1EIXA 3E9AA 4F0HA 4PUJA 4O1BA 4JQ4A 1N8IA 3FJ4A 1X39A 3AMDA 1LBMA 4N7QA 1BXBA 4FNPA 1E0VA 4ZTXA 2FJKA 3KP0A 1GEQA 1YYAA 3GBDA 1OK4A 3R8RA 4YU1A 4QBXA 1LJYA 1PJ9A 2V3GA 1SPQA 5LZLA 1XSJA 2ZIDA 2W66A 3MQTA 1NWRA 5A95A 1H5VA 1VZWA 3VDHA 1Z7AA 4D6FA 3O16A 5BXPA 4ZODA 3W7MA 5DX7A 3A4JA 3WLOA 3ZT5A 1QTWA 1KFBA 4FMVA 4BQ4A 4NIRA 5A94A 1KWGA 2VD9A 3GKAA 4Q8NA 1POKA 2Y2WA 4W7VA 1KM5A 3PWIA 4U5KA 4MY8A 1QBBA 1NTHA 3WF1A 2DW6A 5IBXA 5I3HA 9XIAA 5HXMA 5CGTA 4A2RA 2XFWA 2B81A 3PTKA 1C7TA 4MF4A 1OIMA 2BXVA 3BE7A 1KD0A 4HMCA 4QLJA 5E9AA 4CQDA 5FL1A 1CXIA 2Z1XA 5C9XA 1TSIA 3H4GA 4HQVA 1A5NC 3CUGA 5HQEA 3PTDA 3ITVA 4C6FA 4UCGA 3BTNA 2WLYA 3PZGA 1H3GA 1KO0A 4W93A 3NPUA 4TQTA 4PCPA 1GG0A 2A21A 2GJNA 1O95A 5DCDA 3PZUA 3B9AA 2PWFA 4HMNA 2C1HA 3ISIX 4CLMA 4B5SA 4P8XA 3VKKA 3EWCA 6A3HA 5LA2A 1JYVA 4RL3A 4GWEA 3OODA 3TMLA 3OOQA 3HPAA 2YIHA 4IPIA 3WH7A 3LN3A 2V69A 2GL5A 1IWBA 4GINA 5FAGA 2WMJA 5CPSA 4KWWA 3TQ0A 3HQ1A 2DVUA 1P5BA 4ZEPA 3VGGA 1HN1A 3PTMA 1OYAA 2XWEA 3DFSA 2V5KA 1E1CA 3UVAA 4D71A 2PODA 1DOSA 1REQB 4WOQA 4RDZA 2WNQA 3B8DA 3U4AA 2PURA 2EAWA 2OGYA 2XYLA 1Q6OA 5I07A 1W1TA 5CZSA 3S46A 1EA9C 1ODUA 2ZQ0A 4LEFA 4AZ7A 1DJXA 3UJSA 1LQAA 3TK7A 3C2FA 1H50A 3HGRA 3ZR6A 3BJFA 4FX6M 1W3NA 1XH0A 3LHWA 1JGIA 1KLYA 3LCIA 3A3WA 3PFRA 3MB9A 1CWYA 1I4NA 4ZENA 1TWZA 1A5MC 2UY4A 5MF5A 5LNRA 2I17A 2FZ8A 4YCPA 1A5CA 2PDWA 1ITCA 2PU1A 1TUXA 4GOAA 3GNOA 3W0KA 5EY5A 2BZNA 3EA3A 4RE2A 1CGWA 2HCVA 4NY2A 2C15A 2OZ0A 1C8QA 5HQLA 1GJPA 1DL3A 3BSMA 1BXCA 1J79A 1ODZA 3SCOA 1ME7A 4C6CA 1PVNA 2QUMA 4WRHA 1R38A 4M0XA 4LNYA 3G5EA 3RUBL 3GC5A 3VX0A 4QRNA 4MPKA 1YPXA 4UWMA 1J0JA 1VFFA 3IJLA 1D7KA 4Y90A 4YHGA 4DUVA 1QNRA 3GVGA 3IUIA 1WXJA 3UA4A 4DUOA 4DBSA 1RSCA 1HW6A 3VGHA 3FNDA 4HA3A 1V3LA 3PVFA 1KBJA 2VVSA 3QVQA 1UW9A 2XVLA 4PSPA 5G4EA 1KGXA 3NDYA 2Z2UA 3N1AA 4WX2A 3MMDA 2XH4A 3C2VA 1SW0A 3S1VA 3T09A 1EX1A 1E6ZA 1E51A 4ZXOA 3TMQA 4WCJA 1TKKA 4PUEA 3BLOA 3HQOA 1DJWA 2VWSA 4Q8QA 3BOLA 5HAOA 4GQBA 3QW3A 4OQVA 1GNXA 2ZUVA 1W9BM 1N2VA 3T0AA 5HBFA 1Q6GA 4TX8A 2WK2A 3R4IA 5AYXA 3BURA 8CGTA 1M1BA 4J3VA 3LHVA 4YL2A 1W9VA 1TG7A 4L65A 2GPTA 4ES4A 4QX4A 3TSDA 3UG8A 4CD6A 3GU1A 2NZLA 3ZS4A 1MDRA 4D1JA 4O4VA 4E4PA 3SRHA 3PB0A 3OIHA 3S2LA 2DT3A 2XISA 4RNFA 4A2SA 4D8AA 4DBDA 4PULA 2XZ7A 2XTKA 3L5LA 1GVIA 3BOFA 2GUYA 5G4HC 4C90A 4RE3A 2I5GA 3S6DA 3UWEA 3YPIA 2H90A 3V75A 1W5OA 1X1NA 1OFRA 2JQXA 2QZRA 2X16A 3GLCA 1S5NA 5CPMA 2PDXA 3E6EA 3TN3A 3M44A 5C2XA 3RO8A 4EPEC 3S4TA 3GWQA 1RY0A 2YXXA 3NUKA 5D8ZA 5JVLA 3EKLA 5HNRA 3BV4A 5GJPA 3MJYA 4XKYB 1NDZA 1IZKA 3GTHA 5J5RA 5HWNA 3GTNA 5FEXA 2QVNA 1JF6A 1EH9A 5CSRA 4GH3A 4GJJA 3TE9A 4UC5A 2P53A 3CQ0A 3OZOA 3W7DA 4C6NA 3BZJA 2NQJA 1NWSA 2C0HA 2CPUA 1U83A 2YW4A 1LWHA 4KETA 4Q6JA 2HROA 2J74A 2V81A 4H9YA 4JHMA 3APYA 3IANA 1V93A 3LPGA 3ZT6A 1PCWA 3RM8A 3ARSA 3W02A 3MKKA 4UMAA 3S42A 4B5WA 2A85A 1VCVA 2CESA 4AZBA 1H7PA 1Z8AA 3R0KA 1VEPA 4PMRA 3NJ3A 3CAWA 4DB7A 4ZFMA 3O6YX 1C3FA 2ZUMA 1FWRA 3KBJA 4IMGA 4DJEC 3GIPA 3QMSA 4GXPA 4WHBA 3UNTA 1TA3A 4HB7A 3PHAA 1LDCA 3P0WA 4M19A 2C0AA 1W1YA 3VKDA 3U2ZA 2CETA 2OZ8A 4IIEA 1Q8JA 1JYXA 3URBA 3M5VA 2C16A 3MUY1 2DZWA 4NZJA 3ES8A 1ICSA 1QK2A 2ZXQA 3PJUA 4AY7A 2X1UA 2ZKMX 3V5FA 3TJ4A 3ZQ9A 1HL2A 5AHEA 1PDYA 3CPRA 4DBUA 2JGYA 4ZGYA 4MUPA 1KXTA 4DEFA 1FWWA 4MNKA 4WKFA 4J3WA 1L6WA 1LL6A 4LFYA 1P7TA 3KOXA 1KFEA 4QJ3B 3LNMA 4RW5A 2DP3A 2OO0A 1O68A 5GQBA 3LCXA 3FEQA 5E6ZA 4TIMA 1LUCA 1QASA 1WZMA 2J9YA 3CB3A 3CAQA 1RQEA 3ITTA 2NSXA 1V3IA 2ZWYA