4NAEB

Pcrb from geobacillus kaustophilus, with bound g1p
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
227
structure length
215
Chain Sequence
MEEIRAWRHVFKLDPIDDERLERLCESGTDAVIVGDNVLDLLARIRRFSVPCALEVTDVLTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQYGDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALATVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
total genus 76
structure length 215
sequence length 227
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 4naeB00
4NAFB 3VZXA 4NAEA 3VKBA 3VZZA 4NAFA 4MM1A 2F6UA 1VIZA 3VKAA 3W01A 3VK5A 3W02A 3VZYA 4JEJA 3W00A 3VKDA 2F6XA 3VKCA 4NAEB
chains in the Genus database with same CATH superfamily
2ACQA 2WNWA 5I5RA 4TX6A 2WKLA 2CFFA 1SM9A 6REQB 5DQPA 3AROA 3VNJA 2QPUA 4JFTA 4U33A 1E0VA 1XISA 1B3WA 4J3SA 1JPHA 5CSRA 4CCCA 1YNQA 3ZOAA 4D1JA 2HRWA 3HPAA 4Q4QA 3HURA 1PTDA 4YWSA 1S5VA 1L6YA 2WVSA 5FJTA 4K68A 2CXGA 2PDFA 1VR6A 4PCTA 1J01A 4LBUA 3BWWA 3A47A 2YA0A 1VPQA 2W92A 4ZTYA 3Q67A 1JZ6A 3AISA 3WBEA 5DXYA 2DSWA 3W02A 2PDYA 1HIZA 2VC9A 2XN0A 3CQIA 5BWFA 1HP5A 3SR7A 3LCFA 2ALRA 5HOSA 1KC7A 1WDWA 2KAUC 1ML1A 4ZA0A 2NXGA 4WXZA 3EPNA 3QHNA 1WE5A 1QATA 3N2OA 1F4HA 5A8PA 2VQTA 1LLOA 3SCWA 4HD5A 4YTSA 8RUCA 4CD4A 4H3DA 5KZMA 2WCGA 1QNRA 4GRSA 4X0VA 3N1AA 4CNOA 2YB4A 4O14A 3W1RA 1GOQA 1D8WA 2OEJA 3W7JA 2WNZA 4PBFA 2CLOA 3CO8A 4PE8A 1E6ZA 1CGUA 1QO2A 4Y9AA 2VR5A 3WLKX 3IPWA 2HNHA 3DFTA 3PHAA 3IIVA 4RNHA 3U4FA 4JN8A 3NL5A 4FXRA 3O15A 1UP3A 2PDXA 4QGCA 4J3VA 4H6RA 2CU0A 2X42A 1TJ1A 3UWYA 4A35A 1BYCA 1E5JA 4CN1A 3BH4A 3QGKC 2OQYA 1YW1A 3TJIA 1EGMA 2G4JA 1GVQA 4AIBA 3QEZA 1KV5A 3ECQA 1LM1A 3CUXA 3T9PA 1F3XA 2W0UA 4ZFCA 5F2IA 2Q71A 3QKEA 1KLZA 3DUGA 4JS3A 3A4JA 3AIVA 1AH4A 1X6UA 1WZMA 3GFYA 2PDPA 3BW4A 4X3ZA 4FLRA 1XQLA 2B0MA 4P7LA 1S38A 2PZ0A 4P7OA 1ISYA 2XIMA 3N12A 1LG1A 4PFHA 4G7EA 4GZEA 3S5SA 3MZNA 4C6OA 1S2AA 4XSMA 5FEZA 2NVAA 4KGLA 3S1UA 1BEUA 2OYKA 3W73A 3KRUA 4UR7A 3R12A 2Z7GA 2PWGA 2ISFA 1VHNA 1EJSC 3VD7A 2QUMA 1OX4B 1UD8A 1WV2A 2Y8VA 4AZBA 1MEWA 5IDZA 3FXGA 1YMYA 1KV8A 2DVUA 4AWUA 1FWIC 1UWQA 5D03A 3S2JA 3BG9A 4IL2A 4LEFA 1QPOA 2YCIX 4BKNA 4ZOCA 1NIUA 2TRSA 3T0BA 5XIAA 1G4SA 2YL5A 1VJSA 3NVDA 4P8UA 3MCOA 2G95A 3W70A 3PNUA 1E5NA 4ACZA 3TIMA 5F4SA 4NASA 4DRSA 3SIMA 3G1RA 3SCQA 4LVBA 4A05A 3UP8A 2AKMA 2OKTA 4NL1A 1FOBA 3M5VA 3XIMA 4GIYA 5A6BD 3W7EA 3LPOA 5U4NA 4L61A 3ES7A 1GTHA 1MNSA 4HPXA 5FAJA 3VC6A 4XBKA 4ADTA 4IFKB 4R3UA 3NQBA 5TAOA 1XBVA 3B9AA 3WEOA 2ISWA 3I3BA 3S2CA 2OO6A 3T55A 1Y5VA 4YJ5A 1PZ3A 1H50A 5F1UA 2J4GA 3WH6A 3EB2A 2X2YA 1MW2A 3LSBA 3B03A 3BGAA 3V1HA 2QJHA 3PPHA 4PMOA 5HNRA 1XYCA 2GOKA 2R82A 4D72A 1GKRA 1NQKA 1YLVA 3VABA 3TXZA 3MVIA 2YXGA 1P0EA 4Y8FA 1TWZA 4PMXA 2NVCA 5F2GA 3LMZA 5J5DA 4YS1A 2VRQA 3G1HA 1CGYA 3H2FA 5EMJA 3UWWA 4KGJA 1W1VA 1XLJA 2ASHA 4UTWA 4QG8A 5DMYA 2VUNA 3R0DA 4QXIA 1DJHA 3G5EA 3UVIA 1PX3A 1AZ2A 2Y5SA 1UKTA 1G7VA 1BQCA 2RUSA 1M5WA 2WHMA 3N9KA 4NJGA 1V0KA 1VBUA 2VWTA 3L0KA 5E93A 1E40A 1MSSA 2OJPA 3GO2A 2J13A 5LIUX 1TPFA 1IXOA 5BXSA 3L4UA 2H90A 4NF7A 1PCWA 1O95A 1W5QA 1XL9A 2CESA 3A3HA 4A3HA 4NJIA 1X1ZA 3OZOA 4NQ1A 2V5LA 3NQ2A 3TVAA 2DZVA 2PDJA 3WEZA 1ITXA 4AX6A 2FLIA 3B0PA 4QLJA 3UA3A 1VAHA 1FBAA 1X6LA 4QJ4B 1QASA 3DC8A 2YW4A 1YKWA 1PKNA 3HO8A 3NTYA 5HNTA 2HK1A 1XGZA 5C5YA 1E55A 1SUXA 5G4HC 3OGVA 4QNWA 2F61A 4B16A 4RE0A 4NAEB 3L0NA 3NR0A 2QCNA 3K2GA 4PTNA 1LRQA 5K4ZA 3TEVA 3GS6A 5MF5A 4PUEA 3KTCA 4DO6A 3VFCA 4FZIA 4EKJA 5HWNA 1Q6LA 3KXQA 1KXHA 3T4CA 2ISSA 3IARA 1WOAA 3NNTA 2H8ZA 4LUSB 2R1KA 2VX4A 4DNHA 5I77A 1JYWA 1B57A 1WP6A 4PB4A 3WD3A 2HDJA 1TWWA 4P8WA 3LU2A 4KMQA 1POKA 4CCDA 1CT5A 1GOXA 1E3XA 2Y24A 5BW6A 2OZTA 3KHJA 4JEJA 4BI6A 3AZTA 4GI4A 2I9EA 3QV6A 4YCPA 1WBHA 1XLGA 4RV3A 1K8XA 4AD0A 3SY5A 3CHFA 1TE6A 4OBRA 3QMRA 3VM7A 3UJEA 1E9LA 4WJXA 3RR4A 2XIQA 4QAIA 3F03K 4Y2WA 4Q6JA 3BLKA 3FA3A 3EPOA 2XWEA 4H8VA 3COTA 1KRCC 1OFEA 3KS6A 4JKLA 4QG9A 3DESA 3B8WA 5HJXA 4AHOA 2ZUNA 4XIAA 2W91A 5AECA 3HGJA 1XCWA 2YJQA 2XGZA 3GWQA 1B30A 4JIRA 2YXOA 4H83A 1F6PA 4AU0A 4IT1A 4OOZA 7XIMA 3IACA 1HJWA 2OYMA 3ARSA 3PBYA 4PN2A 1XYZA 4I9TA 3F1QA 4O16A 3SSJA 4HNCA 4XZ9A 3VMPA 4F0LA 3WENA 3LTSA 3CTTA 2OR2A 2X40A 3ARUA 3WBYA 3R10A 1UPMB 3NQEA 2E7FA 1BG4A 4GQ0A 4KIEA 3O6CA 3M0ZA 3NM1A 3VDGA 3HJZA 6TAAA 1R85A 1UP0A 3TWAA 4V15A 2X30A 4RK8A 3AO0A 2ICSA 1H1ZA 4DAIA 4K1GA 2L5HA 3IAPA 5KSWA 2WHJA 1JPIA 4LUYA 1V08A 1SO4A 2AAAA 4GYJA 3NPVA 3L4ZA 2D2HA 2Z2AA 1NM9A 2CBIA 2VM8A 3OG3A 4I8YA 5DBTA 4EXBA 1XYFA 5LNSA 2H6RA 3JR2A 1MEHA 2GVLA 2YGYA 2FFCA 5KINA 4J3TA 2G0WA 2BXVA 1ELSA 3MP3A 3EKGA 2QVHA 4O28A 3VKAA 3W1AA 1Q65A 3ZVHA 3W76A 4ATDA 3N4FA 3CL7A 1IWBA 4HSNA 1V0NA 4EAYA 3B8UA 1C93A 1DJIA 4G5DA 3WDQA 5D33A 1FCBA 1XSKA 4WSKA 1E9YB 4I6VA 1KFJA 2IKGA 4XSLA 4LCSA 1HJSA 5H8PA 2G5WA 2JEPA 1MUWA 5AZ1A 1BWKA 3AAMA 4O19A 3W2MA 1GPWA 3PBWA 3GE7A 1OADA 5IHRA 3AJ7A 4DUXA 1PVNA 3RM9A 4PMNA 1BSIA 2NV2A 2G97A 1CB7B 5AYIA 1A3HA 1YE6A 3GNPA 3TAKA 2V67A 3CYVA 4W7UA 4I3GA 1LQ2A 2YDSA 4M56A 5GVJA 2D2JA 2X1RA 5C2XA 5C9UA 2YBVA 5I3IA 3BG5A 1Z41A 4ZOAA 3W3OA 4FX7A 2RHGA 1PIGA 3ZFHA 1TSIA 3GW3A 4BY3A 1NQ6A 3VO0A 3ZO9A 3EWUA 2OEKA 1PYFA 1UWAA 3P6LA 1X8FA 4QX4A 1J96A 1F3EA 1VFHA 2FTYA 2XIBA 1FH7A 4A3RA 2H3BA 1WZKA 4N2YA 1BYAA 4ATWA 3AYRA 3PTMA 3L4XA 5KZEA 1BAGA 1IT7A 2CZFA 1JYXA 1RA5A 1F7BA 3NSXA 1MQRA 2D0HA 2YDRA 3WEMA 4PUNA 5DMNA 3TYDA 1JYNA 4J5NA 2VKZG 4GISA 2WHKA 3DFPA 3TJXA 2I9UA 3LQGA 3KZSA 1DJNA 4KCTA 2VDHA 2YKKA 1IEQA 4G1KA 1MDRA 3G1FA 1F8IA 3UPWA 2A7RA 1CDGA 5D9NA 4ZO8A 4HMCA 1AA1B 3F2BA 2V30A 5ABFA 4V2XA 4US5A 3R89A 4R33A 1M7PA 5G4WA 1PL9A 4F4RA 7A3HA 2Z26A 5CZJA 1UHVA 3O3RA 4AW7A 5KITA 4G7FA 2DQWA 3WLIA 2UY4A 3UR5A 3W7DA 4LC6A 3VC5A 5A3HA 1RZMA 3PY2A 4FI4A 1QI5A 3IGUA 1WZAA 4A2SA 4UFKA 3NPUA 3P2VA 5FCZA 3HPZA 3LXCA 3C6CA 3W1QA 3MP4A 1SMDA 5D9OA 4XBJA 1RP8A 2DJXA 5HMDA 1R3RA 1XG4A 1MFUA 3T8QA 1REQA 3PTQA 5CZKA 3F2CA 5JIWA 2EBNA 1YHTA 4CVUA 1FDYA 1KR1A 7REQA 2VO5A 3IJ7A 3VDCA 2DT1A 5C9ZA 4IIEA 3STCA 2VFIA 1MO0A 2VD9A 3NQ7A 1K9EA 2D20A 3B0XA 2V5KA 3GKFA 4FHAA 3N19B 1GVFA 3HG3A 3CQHA 4ZODA 2ZZ1A 2V81A 1DWIM 3TNBA 3VD4A 1J0YA 3VM5A 5HINA 3AUOA 1UZHA 3FVDA 3O2LA 2BODX 3R0UA 4Z2LA 5LXEA 4BF7A 5CBIA 3GH5A 3MI2A 2Q02A 1RJRA 4WGXA 1IF2A 1I0DA 4QSHA 1Z89A 1DL3A 1R9XA 2BX7A 3PB2A 1EIXA 4U3AA 1RAKA 3NQFA 3W85A 5A2BA 3EXSA 4Q7NA 2OCZA 1JRBA 1EDQA 1Q6OA 3CJPA 1CLXA 1LWJA 3AS3A 3OEXA 2J9XA 1G5AA 4R9OA 4GNKB 1B1YA 5A1AA 4C1NB 2VX5A 4NI3A 4PTWA 1P6WA 1JF5A 4AWTA 3N17A 4M82A 2YPIA 3QV9A 4ERAA 1HQTA 1Q8AA 5GNZA 4JEQA 2E6DA 4C6BA 3SO7A 4LW7A 1ADSA 1H09A 4PUKA 4M7TA 4HU4A 2NT1A 3EZ4A 4AH7A 5K9CA 1H62A 1LQAA 1TQJA 2YSWA 1M7OA 2PTWA 3ABOA 3T78A 4YMZA 3E96A 1TYGA 3W2LA 4Z2JA 4IPNB 1E71M 4DIAA 3GNOA 1HGWA 1I2NA 5AC7A 4JKMA 3W1XA 4IMCA 2ZRWA 4WXYA 1F9CA 3G2GA 4F66A 1W9VA 3DYPA 3LB0A 4JIEA 5FF2A 4UQDA 3WDJA 1A0DA 3E0WA 3AUJA 3DFYA 2IPJA 2I16A 1IT8A 1OHLA 5JBDA 4PUJA 4JTUA 1VYSX 1W1YA 2NQZA 4G1NA 4HTBA 1RPKA 5ECVA 3M07A 3MDUA 4J3ZA 3NCOA 1VH7A 2IKJA 1TPUA 3ZM8A 2ZIDA 2OX4A 1GONA 2D73A 4GYFA 5C9XA 2EO7A 3M7WA 4UTHA 1FWEC 1YIXA 1J10A 2WSRA 3DX5A 3ALGA 4KEUA 1HJUA 1P7TA 4IP5A 1HJVA 4IFOA 2C0HA 1YXCA 3PK7A 1MWOA 1K9TA 2NUWA 4GUIA 1H60A 4Z42C 5L6UA 3N2BA 1RJPA 3URQA 4B5TA 2ACRA 1WX0A 3FHAA 4HT3A 4TU1A 3QQ1A 1F3WA 3SUWA 4XKMA 2GL5A 1RBOB 3TYBA 1X38A 4H7CA 4AXNA 3I4KA 1TJPA 3AU2A 1EJWC 1OC7A 2VJXA 1XLCA 3A9BA 1EYWA 3ITCA 3K4WA 1AD4A 2EKCA 5AVHA 3BSMA 4W93A 1XD0A 2OGJA 3AWNA 1EHNA 1JZ2A 4HNNA 4DO5A 4WLCA 3JU2A 4HJFA 3MBDA 2V5JA 3S9IA 4OZOA 3G77A 1KQZA 3VNKA 1TA3B 4PEEA 2QJMA 2JKEA 2XM1A 1R3SA 4X60A 4D1IA 3CT2A 3L7RA 4RKAA 4O57A 1ISXA 1YDVA 1H41A 1ISZA 1K6AA 2BY2A 1H1YA 2KZHA 1QW9A 1UWSA 5DY2A 1LRTA 2QS8A 4I7UA 1SZEA 5J5RA 3EYPA 1F4AA 2EPNA 4HU8A 2JF6A 2EPHA 1KM6A 3B40A 1H2JA 2QEZA 4KRTA 3QKZA 1CW2A 1EX5A 2A4AA 5CPLA 4CU7A 5AHNA 3T0AA 3LHUA 4NRSA 1JDEA 4OECA 3W2NA 2DZWA 1VS1A 1NEYA 1SZRA 5HPOA 2XH2A 3QMTA 3KL0A 2QDEA 3DI1A 2V0TA 2ZRVA 2VEMA 4POCA 3TCEA 4D6CA 3TAOA 2E67A 1VFTA 4LJ3A 1VFFA 3G0XA 3T1GA 1HN1A 4ROPA 1W9BM 5LA2A 4XWUA 2D1ZA 3DCPA 1BYDA 3H22A 2ZZ5A 1W17A 1NSJA 2Z1XA 2FMNA 1K8ZA 3GDKA 4S39A 1E6NA 2XH4A 4O17A 1Q13A 1R9YA 3W38A 2VELA 1XP3A 4M7SA 3R79A 2ZUSA 2W27A 1MRAA 3GIQA 1QDSA 1TR9A 4Z17A 2WC7A 3A23A 1GZGA 3KBJA 2POZA 3M16A 2ZBTA 1I0BA 4ZQNA 4OJYA 4LB3A 5D04C 4IHCA 3M0IA 4BQ4A 3GTFA 4E4UA 5KZDA 3OBKA 2ZUMA 2C18A 2AL2B 3GVRA 5FJPA 3NXLA 1EBHA 4QM1A 3V5OA 4XZLX 4AD4A 5CSYA 1NWRA 2J9YA 2FVMA 4C65A 4IG2B 2O92A 1THFD 2WLYA 1DYSA 3WO8A 1J0ZA 3R8HA 1MZRA 4G8TA 3VIPA 3MUXA 4FLOA 2OMAA 4NYUA 3U6WA 4HZ6A 2XGIA 3QOKA 4G56A 3RPTA 2DZSA 1IWAA 3TZNA 1UQYA 4FSAA 1FWNA 2V5CA 4G6CA 3SJ3A 4HCHA 1RPXA 2IW0A 4OV9A 4UMCA 2H8XA 1W91A 2INEA 4HHPA 3NO5A 3WBXA 1JIBA 2ZVRA 4JY9A 2C6QA 2XDFA 1NAL1 3BUVA 4INFA 4PTVA 5EFFA 4DZIA 3ARQA 3RU6A 1JCXA 4Z1CA 1CGWA 4PBGA 1KCZA 4GZ7A 1HX0A 3GVGA 1V6UA 3HGRA 4GINA 3WJZA 3JRKA 4S3JA 3U3HA 2F6UA 3LX9A 1EGZA 2B4GA 4GABA 4B2DD 4AWEA 3EX3A 8CGTA 1GYNA 1TX0A 1PJ9A 3E0LA 4KERA 2QDHA 1UC5A 2PWVA 5H8MA 1PO9A 2NQLA 3UG8A 1JQXA 2HXTA 1HKKA 1XCFA 4HGXA 1PB0A 3QOMA 2OLAA 4KRZA 4DYEA 3B9DA 1FKWA 2DUZA 1IIHA 3BGJA 2YL8A 1KBLA 1K77A 1OYCA 2WKGA 3CHDA 2GJPA 3CM4A 3FDKA 2YZ5A 2D0GA 2Z6JA 4DJEA 4DNMA 3GG1A 4BQ3A 4AD1A 4JTEA 1A0CA 1E43A 2P3EA 3CZ8A 4FR1A 3CEUA 1WXYA 1TPH1 5CEWA 1JD7A 3CWHA 1OFAA 1HKJA 3MSDA 2R24A 1XLHA 1NWTA 1CXIA 3HQPA 4F79A 1SJCA 5DX7A 2Q8ZA 2JALA 1NTHA 3G1XA 4MJMA 1XIJA 4HHMA 3P60A 4BJHA 5B7ZA 3KBWA 4XUGA 4W87A 4AZ6A 3BO9A 2GLKA 2PSNA 1KCKA 5DLCA 3M44A 1ZBVA 4JYFA 3T0DA 2CBUA 4GKLA 3IIOA 2YDAA 3FK4A 1UOZA 3GHTA 1AJZA 3NQCA 1LOQA 3PBVA 3LI1A 2FGBA 4YHGA 1RLCL 1KFCA 3ZYZA 4AVFA 3EA2A 5CPNA 3N13A 5AB3A 1KBIA 3NEHA 4HB7A 4BR1A 2CW6A 2VR2A 1Q6QA 4HTYA 2GJNA 2FDSA 3GW0A 2DSZA 4GGBA 3AQUA 1XI3A 2F8QA 4GUFA 3P3BA 3C3UA 3Q65A 3PFRA 3QLLA 1C7TA 2ACSA 4N9BA 4DYKA 4JTCA 2J77A 4S3BA 1TRDA 1OK4A 2EJ1A 4BF5A 3XINA 1WKEA 3KUMA 2DP3A 5JVLA 1TPWA 2FMOA 5LIWX 4QLLA 3H23A 3P7YA 5CGMA 4QE4A 2OVLA 3L5AA 1RH9A 1UQZA 1E0TA 3PB0A 4B91A 3MMUA 1S5WA 2AAMA 1K1DA 2O9TA 1XYBA 1W31A 2J74A 3W1TA 4AWSA 2Z24A 4O4WA 4TMCA 1DE6A 2EF9A 4Q8QA 4QR6A 5MKGA 2YA1A 1KGWA 1UUQA 1T7LA 1GG0A 5CCZA 2CLLA 3NPWA 1EEXA 2WLZA 2Y5EA 3E12A 2D2OA 1OJXA 4IJRA 2GDQA 3UBPC 1UIOA 2RAGA 1PTGA 4UOZA 1SFJA 2BY3A 2NVDA 2J75A 1VYPX 1L6GA 5CJ5A 2ZUUA 4JYDA 3L65A 3AZRA 2VCAA 4NXKA 2FZBA 4LVDA 2CEQA 4E2VA 2WZEA 4L7ZA 1C8QA 3K1GA 4U5IA 4LFYA 5EFDA 4JX5A 2G41A 3CZKA 1FUYA 2ZX6A 4B90A 4J27A 1CXEA 4DO4A 2BZNA 1XD1A 1RUSA 4PMYA 1XLLA 3S1XA 3QVQA 3M0KA 2UY5A 4WSHA 1XLEA 4EXAA 3GXFA 3M6YA 4EPEC 4XB3A 2IPFA 3PFMA 2J7BA 2WYSA 1BD0A 2G3MA 1VKFA 2POTA 4DI8A 3REQA 4HCLA 1BXCA 5F2LA 2RJHA 1YDNA 3FJ6A 1G6CA 4N4QA 3OP2A 3P5ZA 4XAFA 2VEPA 4HOWA 2UWFA 1W1A1 3AIRA 3WQOA 3T05A 1ZALA 3AHYA 4UTWC 1U22A 1XIIA 2ZA2A 1IT0A 1IR2A 2F9RA 4RZBA 4BHYA 3IJ9A 4ZTXA 3STPA 3APTA 2WWCA 3H7RA 4PTMA 1W5PA 4MAVA 3NQGA 5DRIA 4HZMA 3KCLA 4NIRA 4A3QA 3LCGA 3A64A 2NX9A 1Q6EA 1ZNNA 4IFRA 1XBYA 1LUCB 1UD3A 1GOIA 1CNVA 3G24A 1C8YA 4CLMA 2VFDA 1WXJA 4YVPA 4P5UA 4O1FA 4CKQA 2UZ9A 3U48A 4C6JA 2IKHA 4JAWA 3DERA 1QBAA 3WF2A 3NQDA 2CETA 3KAOA 9CGTA 1JZ3A 1AW1A 4KWSA 4QQ3A 1WUFA 2RH9A 3WQDA 3R1ZA 2OZ8A 1VPYA 4CU6A 2VDIA 5EA9A 3BW2A 1U1UA 1LOSA 2J66A 5IRPA 3L0GA 4YYCA 3A12A 4AD2A 3LHVA 3G8RA 1BWLA 4JTGA 1X97A 3MO4A 5F7UA 4EX4A 2O7SA 1UD6A 3ONCA 5FESA 3HJEA 2YIHA 3ZJKA 3CAVA 3LCLA 3WNOA 1G69A 2W63A 1A47A 4Q3MA 3BAJA 3CHVA 1SO5A 1KXTA 2PWFA 4QFUA 2O9OA 4MKSA 1OFQA 2QIWA 1Q3NA 1OCBA 2YCLA 3AI0A 1GW1A 1UYQA 4Q8TA 2BOEX 3C56A 4HSHA 4RE3A 2BHUA 4IPJA 1E9IA 1KB3A 1PDZA 3VGBA 3HF3A 1HW6A 4HK5A 2HCVA 2J25A 4HMDA 5CGQA 4H2CA 1G94A 1NFGA 5TD4A 3HOJA 4EIVA 4MGGA 2PZNA 4JTRA 1EDGA 3ARYA 4ZFMA 2E4TA 3WK2A 3PPCA 4O13A 3NO3A 3TXVA 3VOJA 4RW3A 3EWZA 4TUFA 2OKOA 3M0YA 3N15A 9XIMA 3WLOA 3FCPA 1AW5A 4PULA 3PJUA 2WMIB 4QJ1A 3VIJA 4O18A 4FLSA 1UKPA 4FNSA 1TFVA 2C3ZA 3GBEA 3W2JA 4AXKA 5GQBA 3LGEA 1GPFA 2DZAA 3MWCA 1T0OA 3PAOA 1ISWA 1CECA 1G9HA 2WM0A 1AODA 2WJDA 2WJFA 2VT0A 1NFBA 3GNRA 3S8HA 4GZIA 1FVPA 5FJOA 1VJIA 2QAPA 1PE1A 4DJDC 5BXPA 3VFLA 3G1VA 4HHHA 4UMBA 1S1RA 1X39A 2QCDA 3BAIA 5D2TA 1OX6A 4DO7A 5JXQA 1DIEA 1AFSA 3IV3A 2OSYA 3KWXA 5JU6A 2QCMA 3RO6A 5GNYA 2VGIA 3C2YA 4G9PA 3SN0A 2JQXA 3U2CA 3TE9A 3S4TA 4C6QA 5K4XA 5ABGA 5FF0A 3G3DA 1DWAM 4AIUA 3K13A 1UIPA 2XU2A 3GNXA 2A7PA 3ALFA 4CD6A 3ANVA 2OX1A 1X6NA 1NOFA 1TB3A 1VENA 2C14A 4MJ2A 1SJDA 2QZRA 3TTEA 5A6KA 4JX6A 2ANUA 3M7SA 3CUGA 4E8GA 5FAGA 1SPQA 2ZWZA 1CENA 1W3LA 1FWWA 3EEGA 4GY7A 2V3FA 4FX6M 4LY4A 3OA5A 2XWDA 2GZXA 2FVKA 4C6MA 3CUIA 1ZPTA 3E02A 3VOGA 3ZIZA 2YCEA 4K37A 1T5AA 3IEBA 3FEQA 1YEYA 4FMVA 2PDUA 3NQ6A 1E1FA 2AGTA 2GJXB 3LYEA 4A6GA 4Z2KA 4ZO6A 3MSGA 2A2IA 3RLGA 1ADOA 2HBVA 1EWEA 2BGNE 3KL3A 3NGFA 1M9HA 1XC6A 2ZX8A 2HE5A 1HFBA 1WDSA 5FJRA 3IGSA 3UXDA 3C2FA 3LNPA 3HBLA 4HKPA 2OZ3A 1GKPA 1JDAA 1V79A 3UESA 1ZCOA 4JN7A 3F4WA 1LDCA 3W7CA 1OZMA 4YXGA 4HBKA 5CJMA 3AZSA 1HL8A 2WMHA 4XISA 1ZUAX 5EPDA 3UR7A 3SCPA 3N4EA 4S3KA 1RP9A 4WX2A 4Q8NA 1ZJAA 3FYPA 1SFSA 3PZ9A 1WBJA 4NJHA 2EPLX 2VZOA 2E9BA 4PSPA 4AF0B 5A6JA 2GWGA 2XUCA 2XVPA 3S46A 5JMUA 1SSDA 4NNCA 1I2RA 1KM1A 5D9MA 3K30A 1LL7A 1A5MC 1IEIA 1KFBA 1GHSA 4H9VA 3UFYA 2PDLA 4LYRA 1HL9A 2OSXA 1I6NA 3T44A 3FW6A 3W7MA 3W86A 2O4MA 3D6NA 1XPYA 2PU0A 3LQLA 1B0IA 2DDXA 4D2JA 1FWRA 1GVOA 3NEVA 4D6FA 3TROA 3RILA 3TFCA 4DBDA 5A6BA 2WPGA 3UYIA 1EL3A 3WDRA 1TWSA 4GKTA 4QP0A 3CUHA 2GQ9A 1UD5A 1FCUA 1HKWA 1FWGC 4TO8A 3BL3A 4S38A 1RXOB 3N2TA 5CLWA 5FF3A 1V5XA 1F07A 3PZOA 4NX0A 3U2ZA 1Q4WA 1U30A 1PZ0A 3CYJA 1IV8A 6REQA 1KRAC 5ABTA 2PDQA 3KRSA 4C1KA 3BC9A 4LB4A 3WJWA 3KM8A 1UBSA 4NRRA 5F4WA 2FH8A 2YW3A 1H49A 1E4MM 4Q7BA 4CN6A 3ITTA 4TIMA 1MZHA 3NZ1A 1QUMA 1KFKA 5DY3A 4H8NA 4L4LA 3JS3A 1K6WA 4EVZA 1FTXA 1CEOA 4ERIA 2B7QA 4D9PA 1XINA 3R25A 2RKXA 2HPMA 3N4AA 2HROA 2PC4A 1N8IA 4UR8A 4CQCA 4PCPA 4F40A 4XZBA 2B7PA 1XDLA 4MOZA 2RDWA 3TTQA 4XVDA 3SN4A 3W7LA 1MRQA 2YA2A 3DBPA 4NI8A 2A6NA 3G0UA 4RNFA 4X2PA 3VZYA 4KRUA 4DF0A 3PNZA 8XIAA 4UNIA 1VLIA 5CLTA 3UXLA 3WD2A 3CAQA 1W37A 1M3UA 3AYTA 1Q6GA 3PS7A 3MSYA 1VHCA 4UMAA 4OT7A 3IAQA 2VX7A 2J7DA 4M24A 4HP5A 3BE7A 4Q7IA 3O6DA 3OGRA 2J24A 2PGWA 2BHZA 1DBTA 1SFTA 2A85A 3WD4A 2A5HA 4JYEA 1NF0A 1YNYA 4PB3A 5E70A 3TSBA 1H3GA 3L4TA 1XIHA 3M0HA 5AYXA 2TPSA 5TIMA 2ABBA 1KGXA 5DXXA 5L9FA 4KWVA 4YL2A 2W79A 3CV1A 4EXQA 4ICCX 4GIRA 1JF6A 4NNAA 3TSDA 3BJFA 4RZ5A 2Q3OA 3WNPA 4LQ1A 1KFWA 3TK7A 3P8JA 4JTJA 5CC6A 4JTKA 2Z2BA 3DHPA 4H7ZA 4MKNA 1LP6A 3VNYA 2J6XA 3EX4A 3LK6A 1DQWA 3LN3A 5AHFA 3I65A 2C13A 1EWDA 4KT2A 3POCA 2W4XA 5I78A 5DEZA 1S39A 2R91A 3CB8A 3W0KA 3WQGA 3OVPA 3THUA 1QTWA 4B9YA 3MKKA 1HZYA 4CNPA 1DIOA 1OX4A 3AHZA 4AZGA 3VNDA 1DVJA 1LT7A 4FEZA 1FWCC 1XLIA 3MT1A 5XINA 1HG3A 4AD5A 1XLMA 3EOSA 2HTMA 4GHRA 2DSKA 2VFFA 4UZSA 3SZ8A 4AX7A 1E15A 4UC5A 3C0QA 4GWEA 1EC8A 1ZTVA 3PWGA 3GK0A 2X0YA 2VGGA 4WHBA 4EPBC 1NP2A 2VNCA 5G1YA 1O68A 1CGXA 3F4VA 2JIWA 2R94A 1H7RA 4OUEA 3DFQA 3RM4A 2X1TA 2ZRUA 1BPLB 1UMLA 3SQSA 1KKRA 3E0FA 3BPWA 3OHIA 1VC4A 2ZZ6A 1KCLA 4PFMA 1FRBA 3GLCA 3TW6A 1X1NA 4MYXA 3S1WA 1KXVA 3MCMA 3SRKA 2CPUA 1E6QM 2XFRA 4XTDA 2Z2UA 3SCSA 3LLDA 4LF1A 4W86A 1XLBA 4P7QA 5A6SA 1V3MA 4G2DA 3IUIA 3PZUA 4LS1A 2FHFA 2NQJA 2O56A 3VPLA 2WSQA 4IPIA 3ZJ6A 3WLJA 1MEIA 3JZEA 4RNIA 1T40A 4D6JA 5HWMA 1ZBCA 3DFOA 2VEFA 2XM2A 3G3MA 3I6TA 3LBMA 3PJWA 2V63A 3AALA 4ACZB 3M46A 1OX5A 4HYVA 3BZJA 1KCXA 1M6JA 1OC5A 3GUWA 1WYIA 5G5IA 4FPSA 1ICQA 2ZX7A 1ME9A 3PPGA 1QOQA 4V27A 5D02A 3DHUA 1ZJIA 3BAWA 4Y8EA 3H2AA 3P74A 3OVGA 3RUBL 2DIKA 1UWIA 1TV3A 3C3NA 3H2EA 3HV9A 2HISA 4RXGA 2Y85A 4MADA 3VI2A 5EMMA 4PRRA 1ZP4A 2OWWA 4QBXA 4HVXA 3FIGA 4Z1YA 3OZYA 1FDJA 2IQDA 1K7XA 1JULA 3ZVIA 4XAPA 2Z1BA 1H5YA 5CH9A 3VIFA 1POJA 4XV0A 2FHCA 2WAGA 1D2KA 4ROQA 2V6AA 1BHGA 4L65A 1A5SA 1RK6A 1GG1A 4U10A 4QRNA 5FI8A 4LAMA 1FHVA 3GTHA 1WDQA 4JTIA 4Q8UA 2FVLA 1SMAA 4UIOA 4W84A 3BOXA 3GR8A 4GK8A 3GHRA 1E56A 2ESCA 3B4UA 1CXHA 1PBGA 4PTDA 3GDMA 1GQKA 1JI2A 2DUAA 3AMLA 2Y7DA 3SRDA 1T41A 4RW5A 1RQEA 3P81A 1PIFA 3TN5A 4PR4A 2CZ5A 3C52A 3HPFA 3LUTA 3PZIA 3IIPA 3WLQA 3KL5A 1W9PA 3GQYA 3T09A 1XWYA 4GCXA 3NDZA 1V8EA 1JXJA 2VFGA 2GGEA 3ME3A 1W3JA 4O53A 4F0SA 3QF0A 1FDZA 4PMQA 1F2JA 1WAUA 4JY8A 1OFOA 1XG3A 2IUZA 3B05A 1EFZA 5CZ0A 5F1VA 1EUAA 2WQPA 4CEUC 1RVKA 4WRHA 5RUBA 2ACUA 1L6SA 1C8VA 4YLWA 2VGBA 1GORA 1RY0A 2ZRXA 1XXXA 1DORA 3WFAA 3ZLFA 2R1NA 5AYZA 1Q66A 3QYQA 4MTVA 2GVGA 3R5EA 2JEQA 5HWJA 5I7GA 1EP3A 3O07A 1Y7VA 3B0VC 1UWTA 3CZEA 2O4QA 1LRNA 1XR2A 4MAZA 3AHVA 2EPOA 3N3MA 4AB4A 4CGTA 1Q2SA 2Z1WA 1JAEA 4IISA 1GQLA 2ZXQA 3WQEA 1X96A 1IIGA 4LS2A 4FF7A 3WCZA 3BAYA 2E6AA 5LHFA 1DXIA 3O6YX 1KRBC 4HYWA 3UWZA 3EOUA 3TA6A 1XRFA 3FKRA 1TE1A 4FP1A 3UR2A 4GD0A 1IXPA 3ZSTA 3G1AA 2PDGA 1UD2A 2PGRA 1E0WA 2E8ZA 3DG6A 4B3LA 3WNKA 1S5TA 3U7VA 5CPMA 2W67A 3UA4A 1E4LA 5EL1A 1P5BA 2PS2A 4DUVA 4Z1BA 1ZZMA 3AICA 4DF2A 3CNYA 1JJKA 3VVGA 3W28A 7PTDA 3RO8A 3V1PA 3VOHA 2XN2A 2QUTA 3W7IA 2BXYA 3MQTA 4PMDA 1CZ1A 1IYXA 1TELA 2A6LA 2DT2A 4JQ2A 2CHNA 1DP0A 4MZYA 3CV2A 2XPKA 1A5KC 4GCAA 3OO2A 3RGTA 1VF8A 4L6HA 4DJEC 3V0TA 3UY7A 3VD5A 4WEVX 5BU9A 3BCDA 3V0UA 1OG0A 1KR0A 1FFQA 2NZLA 1U5HA 1V3HA 2VGFA 1ADDA 1XM3A 4O0KA 4QDMA 3AS1A 2E09A 2VWSA 3GG0A 2PD5A 4KFNA 1MQPA 2J7EA 3STEA 1ENUA 1P1XA 4W7WA 4PODA 3UNTA 3GVVA 5JBFA 1JDDA 5E9AA 3GG8A 1AL8A 3TYEA 3HM7A 3ZT5A 3ZT7A 2VTFA 1AD1A 3W25A 4YVXA 1EGVA 6XIMA 2E77A 4DWSB 2NQ5A 3P62A 3WFLA 3MUCA 3N6QA 1KRMA 4TVCA 4XZHA 3KFTA 3UG5A 4E2OA 3M43A 1XSIA 1EEPA 4ZQMA 3HN3A 1UJQA 2PLCA 2WVUA 3W1LA 1BF2A 3OA3A 4U31A 5FJJA 2PAJA 5C7HA 2FPVA 1P0KA 4A21A 3ID7A 4UOQA 4TX9A 3VGDA 4RDWA 2GVYA 3N25A 4ZB2A 2C0AA 1OWQA 2GGJA 4HMNA 4FXFA 3ZVHB 5D4YA 2I14A 4H9YA 3TYUA 3EDDA 3W7RA 3BDKA 4L1WA 4PA8A 3VKDA 1Q6RA 3C61A 4L64A 3PZQA 3RAOA 4O0QA 4URIA 3VOFA 3IJDA 1HJQA 2KX9A 3I4EA 1X7IA 3H8AA 4IGHA 3A4AA 3AWOA 1PIIA 1AK5A 4ZCWA 4L80A 4DM2A 2Y2WA 4REQA 1R3WA 3SEPA 4C6FA 1JRCA 1CLKA 4JQAA 1RCOB 3MUY1 2C91A 4IIBA 1NDZA 2DQXA 1TPDA 4NZCA 1WDRA 3HPXA 5E1QA 4B15A 2P5NA 4H19A 5CPOA 4ERGA 1N7KA 3OB8A 5AHIA 5EKYA 3T2PA 5CG7A 5IFTA 3MS8A 5I3JA 1ZS2A 3STFA 1ZL1A 4Z1DA 2OWCA 2G3IA 3EWWA 3HFTA 3U4AA 4TX8A 2WJZA 5E5CA 4GUJA 3B8IA 4X63A 4HNVA 1F6YA 1AUSL 3VNMA 1E6XM 2ZFAA 1ONWA 1SO3A 3PWAA 3QFWA 3CH0A 1SQ7A 2QVNA 4DVOA 1AQMA 3DEQA 4F2BA 5C54A 3R8GA 2VVNA 2UBPC 3TLQA 2PRHA 4AVOA 4HOXA 1RCQA 3USZA 1WUEA 1YRRA 5JH1A 1Z7AA 1KTCA 2NT0A 5CZTA 4DY1A 3CMFA 1JR1A 3C0SA 2B7NA 3GHUA 2YOCA 4BI5A 1UR9A 1XIFA 4PMVA 2OQHA 3SAZA 1FWDC 3B04A 1J0HA 1AH0A 5HAOA 4I9JA 1UCWA 1LL6A 4QE5A 3PTKA 2C1IA 5FF4A 2WHLA 3HPSA 2DIJA 2A3EA 1BLIA 6ENLA 1I9CB 1LG2A 3UXKA 2I56A 3VK5A 2PB1A 4DN1A 5EBUA 4UTLA 3BLLA 4XD4A 3VZXA 1Y65A 3FJNA 4LAUA 2AOSA 2V82A 5C0QA 1OFDA 1W1IE 4IP7A 3D3AA 2INZA 1W54A 3MHGA 3PBMA 3F4NA 3QV7A 2G3JA 4HNLA 1X7FA 3LXAA 1TTPA 1FCVA 2ZA1A 2DSUA 4UQBA 2ATSA 3F5KA 4KFOA 4HU3A 4TTGA 4LRTA 1UWRA 4J28A 2NV9A 4YVVA 1S2TA 1QNOA 3LGDA 2C19A 4NAFB 3QHMA 1MW1A 4C1NA 4S3FA 5I0DA 2X0SA 3P67A 4IIDA 3SGZA 4W8AA 3QN3A 1J5SA 1V7AA 4EE9A 5LSMA 3ITOA 1UZ1A 3I3DA 4ZQRA 4WQ6A 2JKPA 1IGSA 4M8UA 4WZHA 3IGHX 2E5CA 1D3CA 3C8FA 3DENA 4D6HA 1OB0A 4DLFA 5E6ZA 4GOAA 3QY8A 3NUKA 3S47A 3B97A 1O6IA 4C1LA 3EWBX 4DWSD 5I3DA 2XIJA 7ENLA 4F8XA 4JL1A 4WR3A 4DJFC 3VE7A 4GQQA 3EKLA 3MI3A 3M0LA 3WLNA 1J2WA 3GC2A 5FF7A 1B4EA 2A0NA 4Q8PA 4H2HA 1PKLA 1TJRA 4BEUA 4PCSA 3WH5A 3IV8A 2DIEA 3SGGA 4ALDA 4M1RA 4OU1A 1Q5MA 2YB1A 3H7UA 3DU0A 4E4PA 4OWGA 5IM51 3SGUA 4YN5A 4MG4A 1KTBA 3RXZA 2E9MA 4EAMA 3TOPA 2HVOA 1JDCA 3L4VA 1C90A 4F48A 3U57A 4LC8A 2ZDSA 4IMDA 4B2DA 3A13A 1XICA 1SW3A 2QCCA 5CAKA 2WBKA 3VTRA 1EP2A 3RK8A 3AXMA 2WC4A 3Q2DA 4Q8OA 3NURA 4CQBA 3IRDA 1BFNA 1YX1A 1K7FA 4JIQA 2FTWA 4EANA 2X7WA 4LH8A 3EOOA 4KWUA 2EHHA 4TV5A 3L23A 1NDWA 1W32A 4UQCA 3FYYA 1XFCA 1BRLB 1VB9A 1OF8A 3LPPA 3V75A 4HZ8A 3EDFA 2FGZA 3PG8A 1O1ZA 3O8AA 5BMXA 3GHSA 5DANA 1TV7A 4JQ4A 1V3JA 5I3GA 1WKFA 2WBGA 3QLDA 2D23A 1HL2A 1BF6A 4EOUA 3LCWA 1QO5A 2VRKA 1P7TB 3GAKA 1PWMA 3L9CA 4BFAA 3DGBA 1UH2A 3WH9A 1L9WA 1I1XA 4GFSA 4X0NA 4JIIX 5CBBA 3GR7A 5C70A 3BLIA 3WMCA 3TU9A 4XZMX 1Z8AA 3MKVA 3STGA 2X1UA 3TW7A 1NDVA 2X8RA 3JUGA 4JTQA 1EDTA 3HG2A 4W8BA 3UGVA 1LOLA 3SDOA 3T07A 3MUIA 1J0IA 1G0CA 4PSRA 1UKQA 1R47A 2J6VA 1YDYA 2P1FA 3G18A 4Q4PA 1KBBA 3N04A 5J04A 2VZTA 1LCOA 3NL2A 1KO0A 4ZGYA 8A3HA 1RD5A 1VBGA 5DN1A 1A5OC 4US5D 4PGLA 3MWAA 3QRHA 4AIEA 3BSGA 4M19A 3SN1A 1PHQA 2Y8UA 3DDMA 3VAVA 1US3A 2D3NA 4RDYA 3KOXA 4IOTA 4ADUA 2VP8A 3GU1A 2GK1A 4KH2A 4U2YA 1J6OA 2JKAA 5HQLA 2A21A 4AZIA 1KM0A 2QYGA 1SW0A 2WW5A 3LV6A 5CC3A 1SW7A 3F7JA 1XW8A 2FPYA 3HQNA 1ZHAA 3ARPA 3PPFA 4F0KA 1O5KA 3W27A 3W75A 3EEZA 2QGYA 1YQ2A 1OQFA 4H9MA 1MI3A 4UFLA 1Q45A 4F0HA 3CIVA 3DBNA 3GKAA 5HMSA 2VC5A 1NOUA 1ME7A 4L1XA 3MZ2A 1M01A 4Y9OA 4C6KA 4K38A 1FWJC 1TQXA 4XD5A 3KRZA 2Q8LA 2NV1A 3S5NA 4DUWA 2AL2A 1DJWA 5F4XA 3BCFA 4K3ZA 2CZDA 3LCXA 1B3ZA 4O1DA 4JXCA 3BJTA 3CC1A 4IG2A 5H6HA 3QFEA 4OE7A 4FR6A 4C6LA 4C5ZA 1KQYA 4BCEA 3APYA 3W7NA 2CITA 1UROA 3EDEA 2CLHA 1FWFC 1RQBA 1R2RA 2E68A 2OG9A 3MU7A 4BK9A 3U0HA 3B0UX 2EQDA 3PJXA 4IXXA 5DT5A 2ZRYA 4CD8A 1TREA 1AVAA 3G0SA 3LA4A 4IIHA 5HMEA 3IUDA 4JDBA 1TG7A 5I03A 4RPQA 1FWBC 5IOBA 3VUSA 2OTDA 4NU7A 4MB5A 5J8LA 4FA3A 3W1PA 2PLMA 4JBRA 2WMJA 5B7YA 1M7XA 4IMFA 2BMBA 3P8IA 1KFEA 1GZJA 4X22A 1UW9A 4Y7EA 1J93A 1SSGA 1DJGA 2DVTA 3V7PA 3WMLA 2JFEX 1OT2A 4L4OA 4PYSA 3B9OA 4HSOA 2PCQA 4XD6A 1R9ZA 4O54A 3SI9A 1A49A 3WF1A 1FH9A 4JIHA 2UV8G 3THAA 1FHLA 2E40A 1OVDA 4IX0A 4IJCA 4WKHA 3WL1A 3S6TA 5GPRA 3E2SA 1V03A 4E38A 3A5FA 1M7JA 3IJLA 4UFIA 5E6YA 1J6PA 2CBJA 2OO0A 3BQ6A 1BTMA 2AMGA 1KWGA 4NT0A 5CJNA 1AL7A 3BANA 3W83A 1JNDA 4JOMA 4LNYA 4QE1A 4IUGA 1A3XA 1G01A 4W8LA 4MM1A 1UB3A 4GXMA 1AH3A 1U33A 5K2ZA 3W1UA 4OHQA 1KBKA 1NP0A 3CEPA 4NZFA 4NZJA 5CSSA 5I3KA 2WVVB 3R6IA 3F4CA 1H0GA 4NYYA 3PP7A 2PGEA 2Y70A 1JUKA 3L21A 1JNEA 3W87A 1BGGA 1O12A 4U4MA 4QITA 4HNTA 1V0LA 2VD8A 2GDVA 3SY8A 1W9DM 3VXGA 3UETA 3M5ZA 3M5XA 5BRBA 5BROA 4LANA 1H7NA 2NUYA 6CGTA 1TPVA 1UD4A 1HO1A 3PM6A 3QTPA 2IPGA 1US2A 6XIAA 3SCVA 2YBTA 3NVTA 1XFBA 3LHZA 1QFEA 3UQNA 1LWIA 1RCXB 3H26A 5AVNA 4WUIA 4WF7A 1J8VA 3K5XA 3WUEA 3FOKA 2OLSA 1Q7QA 3V36A 2BVDA 3GFXA 2WC3A 4DB7A 4AEFA 3BARA 3I7RA 1V0MA 5KTLA 4KWWA 1DQUA 5H8UA 2GSHA 4N9EA 4UZUA 1E3ZA 4MWAB 3FHQA 1EP1A 1QOXA 1XLKA 2Y63A 1KTNA 1ME8A 3BMVA 1H1NA 3A6OA 2TAAA 3DC0A 3URBA 4L9YA 2NSXA 1S46A 3UZWA 3W1MA 4O11A 1DTUA 3TTSA 4AIOA 3BZGA 1GCYA 2WZIA 3TP4A 3QW4B 2YFNA 2FJKA 1GJUA 1CGVA 1XRVA 4J3UA 4J2MA 1P43A 2FZDA 1HO4A 2PDNA 2DGAA 1PX8A 4WGHA 1VIZA 2FHBA 4DJDA 5A6MA 4D6EA 5K7JA 3DZ1A 1Q7ZA 3EX1A 2PDKA 3QPEA 1E4NA 2J62A 5KETA 1E1CB 2NXHA 1E6RA 4O1BA 4RR4A 1VRDA 2Y5JA 4S2BA 2J8GA 2QPXA 1O60A 4YYFA 2E5DA 4EK7A 2ZYFA 3NM3A 4CVWA 2V9DA 1ZBWA 4UQEA 4DWDA 1J5TA 1P4CA 5M5DA 3H54A 4MVAA 3FEMA 1MUMA 3ITXA 1AQFA 5D9PA 4A8LA 3IWPA 2X7VA 1G4PA 1Z69A 3U5UA 4Y6GA 1AW2A 3O6AA 4H8UA 1M1BA 4IMEA 2C15A 4LBRA 1TTIA 4FLQA 3T8LA 3GTXA 1M65A 2D0FA 4Z2IA 5MKGB 1J79A 2GVEA 2CWXA 5A94A 3O16A 1OIFA 4LCRA 4IGNA 2A3BA 4AQLA 1P48A 3QC0A 4K8HA 3THDA 3UWVA 3GY1A 5A6LA 3ITLA 3QW3A 4F0RA 4FS9A 1BKHA 3FAWA 4TOQA 1F74A 4HOZA 1GVRA 4ZQPA 1ODUA 4HZ7A 3A22A 2OELA 3LTPA 1H7XA 5FL1A 3RPMA 1FWHC 3LS9A 4R88A 3PULA 7TIMA 3M64A 2GVJA 4GX9A 3TLLA 4NILA 3QHOA 2GOUA 2VHLA 5A8NA 5EMUA 1R5YA 2PDBA 3RMJA 1QNPA 2XVLA 1JI1A 2XVGA 1LLZA 4JFUA 1GVYA 1P6CA 1DWJM 4UTTA 4QDPA 1K4GA 2QF7A 3ZR6A 1HP4A 5FJUA 4LAOA 4GH3A 1IZCA 4GUGA 3BMWA 4NSBA 3BURA 3QR3A 2BS9A 3E3HA 1XKJA 2TSYA 3VNLA 3DKLA 4XBSA 2ZE0A 1EX1A 1DJYA 1OM0A 3CZJA 4MZ8A 2GQ3A 3FLUA 2Y8KA 4GJIA 1EF3A 2QPSA 4AZ5A 3OZMA 4E6MA 3OQ8A 1OGBA 1RV8A 2XJ7A 4ZR8A 2YBUA 2V8ZA 3UG3A 3CMGA 4GXPA 2BFGA 3C0LA 3VIGA 1F5ZA 3BOLA 1EJXC 1GEQA 2YL9A 4GMEA 3TV8A 3VD9A 3PUEA 4L6DA 4RNJA 2QNEA 2R6OA 4LY8A 4UOJA 5ECUA 4IGMA 1ECQA 1VD6A 3CAWA 4M6PA 2BWGA 2HJPA 4L9ZA 2VCBA 1S3HA 1TCMA 4UR9A 3FX4A 1EOKA 4MWAD 1TR1A 2XG9A 3WMBA 1CIUA 4M6QA 2G50A 3RDKA 4IF2A 1EA0A 1PV8A 5BOOA 4D8LA 2VYOA 3OHMB 2HS8A 3UJ2A 1ZFJA 1A4MA 4CQ8A 5I02A 4L5ZA 3WJSA 2D69A 2WANA 1KNWA 2UY3A 4LX4A 1MFVA 3UU0A 1DJZA 2PTYA 1U2YA 1W8GA 1LBMA 4ZBCA 1VP5A 2QXWA 4EPDC 1P0DA 3G6MA 5K9XA 2AKZA 2WMIA 4PL2A 2IS7A 2VZUA 4FIRA 1VGAA 3TC3A 4D6DA 4XUYA 3GB6A 2E8YA 2ALDA 4GZJA 1OIMA 3OLGA 4HK6A 1VFUA 2VXNA 3RYSA 1XUUA 5GJPA 2R1MA 3NQ8A 3M5YA 3M0MA 4CCZA 4JIPA 1UZ4A 1C7SA 1G7UA 2PDWA 1IEXA 3ARVA 3FSTA 4GVIA 3TTOA 1KM3A 2CXEA 1ZCCA 3FSUA 1KFLA 3TYCA 3HMCA 2PBOA 4DXVA 4XVEA 3LPGA 2E3ZA 4UQAA 1XBXA 3AHTA 3CT7A 4WJEA 1YTDA 4QIUA 1W9UA 2EPMX 3UWUA 3L68A 4K1WA 3W71A 1IXNA 2YYUA 4MHBA 1ZY9A 3OLDA 4HN8A 3GXMA 3QPZA 1VFMA 2R9RA 4QCEA 2F38A 3TA9A 1BWVA 1J0KA 1QCWA 2REQA 3B8TA 2P50A 3MYOA 3CHEA 5DF0A 4O8AA 1YYAA 3RCNA 2V38A 2NUXA 1OC6A 1BG9A 4HA1A 5C6MA 1RQHA 2J78A 4MY1A 1UR1A 1ZQ5A 2W66A 3OOQA 2DZTA 3WUBA 1SJBA 2QCDB 1J18A 3OJGA 4GQBA 4JHMA 1X98A 2VL4A 3E0VA 5JH2A 3LM7A 4XTIA 3EMZA 4M1BA 3FJLA 3TR9A 3SUVA 3EA3A 3QBUA 4OQVA 4YHEA 4ZB5A 1WDPA 5AHLA 2J27A 2H9AB 1IGWA 3OW1A 4PUUA 3H2NA 2X2GA 3FDGA 2ISDA 4AISA 3K1DA 3I10A 2BVTA 4C6IA 1V3IA 3CIXA 1K8CA 5DO8A 2V5DA 4Z2GA 3H55A 3HQOA 3WF0A 5EYWA 3WNNA 2YCKX 3VD3A 2E28A 2OPJA 1EPVA 2QUNA 3EOEA 3W26A 2GJRA 2CHRA 3MVTA 4QS5A 2DUXA 1Z3NA 1Z48A 1HJXA 1Y8BA 2X09A 4I7WA 1T8QA 1H63A 5HDRA 5HA7A 4CQDA 3OU8A 1E73M 3W07A 2GSEA 2RJGA 4FALA 3GNNA 1TZZA 1TPEA 3BSHA 2CLPA 3AMCA 4GY1A 3GYEA 4N4PA 3GXTA 6ALDA 4C6NA 4NVTA 1NF7A 1QPNA 2FZNA 4LEQA 2Z1VA 5LNVA 2V69A 2WOQA 3RPDA 4ZL1A 3WBAA 3ARTA 3ZJ8A 1IZJA 1PKYA 4GUHA 2DZXA 3L2MA 5DCBA 3BLEA 4S3AA 4QG6A 3CPRA 4E3VA 1B54A 3T40A 4ZQCA 1M53A 4UTIA 2E9LA 1IEVA 2Z0IA 3SFWA 4LSBA 3AXHA 2PPGA 2EG8A 3BK0A 2R1PA 1VCFA 2XTKA 1AMYA 2FJUB 2OFJA 1W3HA 1OBAA 2ATMA 3R8RA 3L5LA 4FO4A 1CLVA 2I5GA 1PPIA 5LNRA 5I3HA 2PLKA 2ISVA 3KWSA 4GY0A 5G2WA 3H2CA 3KBSA 2PD9A 2NW0A 3UZJA 2WB5A 4FNRA 5M1TA 4NP7A 4LYQA 2ZE3A 1PS9A 3WMSA 1OCJA 4O1CA 3TJLA 4WY0A 5TF0A 4O1AA 4IUOA 1HKVA 3E2RA 4MFDA 4N02A 4LUTB 2C1GA 4LYPA 4ZQOA 5DCDA 5A6TC 5CPQA 1HTIA 3WQ5A 3EX6A 4YNGA 2QULA 4UTFA 3LDVA 3NO1A 3T7VA 3B8SA 2QJIA 3OVQA 4GBUA 4U2ZA 5E09A 4GFIA 2QJGA 4MPKA 1S1PA 4IJBA 1FFRA 3TC6A 3VA8A 1V6XA 3AIEA 1FH8A 3F2DA 3NIYA 1XHGA 2OZ0A 4WD0A 5M17A 5BOEA 1E70M 1U5VA 1RK5A 3S6DA 4ICMA 1GK8A 5I2UA 3UXAA 1DOSA 4K8GA 3WF3A 4B5VA 1LF1A 4ML9A 1A5AA 2BNJA 3WZ0E 2INFA 5HPCA 4DZAA 1V3LA 3C0JA 2XSAA 3T0TA 3A21A 1Q6DA 3TMLA 4H9XA 4KWOA 1O7AA 1QK0A 5B80A 3WYZA 3AXKA 1I8JA 3TX9A 4JFVA 3H70A 2ZXAA 3RLUA 1W1TA 3R94A 4Q22A 4EF8A 1ZU8A 4DBEA 3NG3A 3CGTA 5TQLA 2GPTA 3AXIA 3FNDA 2Y7FA 3N3TA 4UTMA 3UZXA 1MVYA 4EACA 1WXZA 4CNUA 1I75A 2Q01A 1VCVA 3N14A 4GI8A 2WJEA 1L6FA 1I2PA 3S83A 3WQ6A 3OQEA 5BCAA 3OLIA 3Q37A 2F2KA 2QCEA 4YWIA 1PSCA 1A80A 3ARXA 3LGGA 4YU1A 3PZVA 3H7VA 3CQ0A 1S2VA 2EG6A 4MIMA 3S1VA 4PB5A 4RUBA 4J2PA 1R8LA 2PRLA 1CYGA 3WN6A 4OVXA 5FOOA 3R43A 5D09A 3PR2A 4WJ8A 1X1OA 4NZ3A 4IXHA 2VR4A 4NKCA 2Y6ZA 3TSMA 3RLHA 3ERPA 3UWEA 5BXTA 1ALDA 3IK4A 4RE4A 4LF2A 2P53A 3MB9A 3GX9A 3GXIA 4GI9A 4MSSA 5AN7A 1BKSA 3ZR5A 3U8GA 3WLTA 3R2GA 2Z00A 4JICA 5D2XA 4QEHA 1FWAC 4UQ9A 1BGAA 2QUUA 3N6HA 4ML4A 1TV5A 1SZGA 2FB3A 2ZDRA 4DM1A 3LPFA 1TIWA 5LGXA 1V6VA 5HATA 3ZWTA 3EWDA 3H4XA 3KCJA 1C91A 4V33A 2QAFA 3ARZA 3OYXA 3VKBA 5ENLA 2X16A 1ECEA 1ZLPA 2WMGA 4A8IA 4I5XA 1RBLA 3O05A 4ZSUA 1UMYA 4GXWA 1OABA 4AAJA 2BOFX 1KM5A 2BB0A 3T4WA 1RJQA 9RUBA 3PAJA 3I7SA 2NQHA 3FN9A 1QBBA 2TMDA 4DAFA 3S9ZA 4MLJA 2CLFA 1XLAA 3HZ3A 3ZQ9A 2ZKMX 4JNMA 3W1NA 1B3YA 3H6OA 4XO6A 5E0KA 3AJXA 1E1EA 1W1B1 3SY1A 1GHRA 2XZ7A 5D38A 2J8FA 5D37A 2E0PA 3WH8A 5LXXA 4AZCA 3T81A 2P8CA 4D8ZA 2G3NA 3UJRA 1PCKA 2O9PA 4QJ5B 3CIWA 1JCTA 1FWTA 2WSKA 4IICA 3B3DA 1J4EA 5AC4A 3V16A 4UTKA 2VEKA 3UZYA 3WJXA 4DBWA 1TPC1 5LHEA 1JFXA 4HPGA 4MWAE 3BLOA 3EMQA 1XLDA 4XZIA 4B5UA 1YTEA 4MB1A 1R7OA 3P80A 3RX2A 4IMAA 4YTUA 1PWLA 3IGXA 3CTLA 3D46A 3P61A 3TYZA 4GIAA 3HA1A 2J88A 4IL0A 2NXIA 2GUUA 1RVGA 1TV2A 5JIPA 3UG4A 3MA8A 4EP8C 3I3EA 3YPIA 1EC9A 3A5VA 3W37A 4QTGA 1Q85A 1A5UA 3UY8A 4NNBA 2BLEA 1BSLA 2AQVA 3QZ6A 4K39A 4PCFA 3ABZA 2XVNA 1OINA 4ZZ9A 1QI3A 5KEZA 2I5QA 3QQ0A 1XH2A 2J47A 4JQ1A 3L67A 4U3CA 1M68A 4XKYA 3TJ4A 2C7FA 2X1SA 1PHWA 4E4FA 3UWQA 2WV8A 2XYLA 4AD3A 1UA7A 3EXTA 3Q45A 4A8NA 2YZRA 9XIAA 1O4UA 4GJJA 3KVKA 3VCRA 3IIZA 3PTDA 4AHPA 5C2GA 1KA9F 3KLLA 3V18A 1EHAA 3EWXA 3SRHA 4A3UA 2JE8A 2PFHA 3WUFA 1LWHA 4KCVA 5G2HA 2V3EA 2XN1A 4GA8A 4I7VA 1YPFA 4V1XA 1CTNA 3QMSA 5REQB 5E0FA 1MUCA 1HGYA 3BGGA 4A3YA 1OEPA 2ZXDA 3KBNA 3WBWA 2WQDA 3SUUA 4MNLA 4X9SA 2BY0A 4ACYA 3ZLHA 3UT0A 3WLPA 1DXFA 1KW1A 3NYZA 4JNZA 1NARA 1VEPA 3FV9A 3PANA 1CXLA 4EF9A 1W6TA 1I1WA 4HA0A 4AUBA 3SIZA 1CGTA 1UH3A 2CZEA 3BQ5A 1V51A 4UFHA 1DHKA 2OOFA 2O55A 4W88A 5FEPA 2ZUTA 4PUMA 3SUSA 3KP1A 3CHCA 3PZGA 2CERA 3W74A 1TKKA 1UA3A 2BBFA 3BLDA 1HF6A 3N2CA 3NYDA 1JZ4A 1JPDX 3FA4A 5BU6A 3LRKA 3WKZA 5BYWA 1HKMA 3KBMA 1NY1A 3EB4A 2ZICA 3ORWA 1VPXA 4FAMA 4FIQA 4N42A 3K8KA 3P93A 4FNPA 4C6DA 2QCHA 4O10A 5IBXC 2I5IA 4TV6A 3ABQA 1GNXA 3VDHA 3C2EA 1CPUA 2DSVA 3TN3A 3W6MA 5K3VA 4WSJA 3P84A 3N29A 4UNKA 5HR7A 1UR2A 4MFEA 3CK5A 4A4AA 4ZVJA 1A50A 4W7VA 2LLEA 4CEXC 3TH6A 2YLAA 3W7QA 1UOKA 4MNKA 3SJNA 1RD6A 3DGRA 2RDXA 3LERA 4C6EA 3BMXA 4XAGA 2CHOA 2VCCA 5MHBA 4R5EA 3W88A 2XINA 2VFEA 4MDOA 4R7OA 4MB4A 3MSRA 2WVTA 3DFSA 1W2VA 1QNQA 3T6CA 3CL6A 1ODZA 2J9ZA 4E8CA 2PGFA 1XGEA 3RJXA 4P8XA 1TIMA 3N73A 5I06A 4H9TA 3E9AA 4L56A 3AU6A 2YR1A 5H1WA 2XIIA 4RZ4A 5AZ0A 2ZADA 3KVMA 3FJ4A 2VVSA 1XH0A 3AYVA 2F6XA 1VBJA 4LAZA 4N9DA 1A5BA 3VX1A 1T96A 1DIDA 3WK1A 2B7OA 4BS0A 4YIWA 3AS2A 4AHQA 4WKFA 2ZXBA 1C9DA 2BY1A 3RITA 1GGOA 4DJFA 4AZ7A 1R38A 4IP4A 1Q8JA 2ZC8A 4DWSA 1JDFA 1EJTC 4WOZA 4JD4A 3WG6A 1V6TA 3LENA 5M3WA 1IR1A 1JCLA 4OTKA 3HFYA 3C5QA 2DY3A 3UEQA 3QPYA 3IJQA 4LALA 1W3NA 3TWBA 4LVAA 4N6FA 3H24A 3PUDA 2IKIA 1VEOA 4XQ6A 4ADSA 3LRLA 3WQFA 2PI6A 1XGDA 2YXXA 1XX1A 3V5CA 3ABRA 2VURA 1ICPA 1OCQA 1OCNA 3NQMA 4JDYA 1CXKA 3FA5A 3QY7A 2MANA 4TVDA 5E9XA 4O1EA 1P0NA 1BVWA 4GBDA 1FXQA 2EG7A 2X0HA 4JTDA 2PMQA 3GXPA 3TTYA 3NZRA 1MXDA 4Q4RA 3UGRA 5G1MA 1ZAJA 2X41A 3NA8A 1N82A 1ESWA 3AXXA 4UBPC 1ONEA 4B5XA 1B5TA 3EGJA 2OGYA 4FF5A 1C8XA 4BWLC 3KLKA 3ZS4A 4AVNA 1DE5A 3VU2A 3RJYA 4RZ6A 5AC6A 1ZAHA 3NQAA 1OK6A 2ZZ4A 4RCXA 2H3DA 1XIEA 3GTIA 1H7OA 5A2AA 4AEEA 2V3GA 1W3KA 2DW7A 1EJVC 2AQWA 2D24A 2HMCA 2V68A 2CIPA 4H41A 1XRTA 2CLIA 3IUHA 4BQ5A 1KM4A 4N7QA 2HVNA 2OXNA 3O0FA 1N8FA 1R3YA 5CC5A 1R3VA 3II1A 3UNDA 3W7PA 3HB9A 4REQB 3QXBA 4QISA 4GYKA 6PTDA 3RRXA 4Y9NA 2RDTA 5FEXA 1NU5A 4KPLA 1YBQB 2EAWA 1TPB1 4IPLA 1R6WA 2O7QA 1O5XA 2VOTA 5DELA 4FNQA 3N34A 1YADA 4B3KA 1JCNA 2OODA 1FA2A 2OB3A 3TFXA 2BASA 4AC7C 2CBVA 3MYPA 4GVFA 5A8OA 4AEOA 5LIYX 4MY9A 3KZPA 3H12A 2VOMA 4KCUA 4O8RA 1RR2A 1JYVA 4HK7A 3PBUA 1A53A 3W22A 3AIBA 4W5UA 1Q6FA 3W24A 2F2HA 4MF4A 5D8WA 1RSCA 1QAPA 2BDQA 4B4FA 1RALA 1F6KA 2QQ6A 4UTTC 3DYOA 2VEIA 1UUOA 2A3AA 3RU8X 3WQWA 5FEWA 5E0CA 3C2RA 1Y0EA 3UR8A 3PUGA 4UTUA 4AMCA 2Q09A 4DELA 3O9NA 5JQ9A 3L12A 1ONRA 1PTAA 3FVMA 4LU0A 3KP0A 3CH9A 4ZSTA 4NAFA 4LOCA 3FGCA 4UUIA 2PDHA 1KGUA 4LYKA 4JTHA 1CWYA 1UUMA 3WDIA 2DV0A 1CCWB 3N6JA 4EPKA 3LXBA 3UCQA 1LBLA 3PZMA 3HGSA 4GYPA 3P5YA 4FB7A 1EO7A 1WA3A 3SURA 4DI9A 1FHDA 3MBFA 1KXQA 1G4TA 2DJLA 1K3UA 3GU2A 4R7WA 4GI6A 3CV7A 4GO8A 1UPPA 5T91A 2GDUA 3PZNA 1W3IA 1K9FA 3BCJA 2PF0A 3LD5A 3GYCA 3ES8A 6A3HA 2ZTJA 3IJ6A 1VLWA 3PN8A 1JUEA 4Q8WA 1DWGM 3ANUA 1XBZA 1O1HA 4RLIA 3B9EA 4KEMA 5D8ZA 3VNZA 1DJXA 1U83A 4J7RA 3BXWA 3KEHA 3URNA 3CASA 1XC4A 2Z1SA 3S1GA 2QDDA 1EJUC 4KBXA 1Z9AA 3U5YA 1SU5A 5FL0A 2Y1HA 1UH4A 1H51A 5HK4A 3VX0A 2FYMA 1T8XA 4HMEA 3CXOA 1UR4A 3WDPP 5HJLA 3Q94A 2Z1KA 4OBTA 2GYIA 4H6EA 4UB9A 3S2LA 4MUZA 2HEJA 2AL1A 2MUCA 4NUWA 2DT0A 3K46A 2PA6A 1Q7MA 2BV9A 3QGVA 1VFSA 3EDKA 3E5PA 1TVNA 4DPQA 1BRLA 3SUTA 1S3TC 2OSWA 2Z25A 3GH4A 2QF8A 4FOJA 3MUZ1 1OGSA 3NL3A 3I7QA 2D2GA 4D6IA 5D2YA 2P3ZA 4AC1X 3TONA 1J2BA 1L0PA 4FNUA 3DOPA 3MMWA 3T42A 1JD9A 4K7VA 4LVFA 4PMZA 1TMHA 4YTTA 2Y4SA 3DG3A 4J40A 3BV7A 1H11A 1OSEA 1VRXA 1K4HA 4PBEA 4A22A 1W1ZA 4PMJA 1C92A 3PF3A 3WX7A 5I23A 3NFUA 4JX4A 3CUZA 1OY0A 1W8SA 2Y88A 1XF0A 3ARWA 3GXNA 1R0MA 3T2OA 4OKDA 2PF8A 1E72M 4HCDA 1DHPA 1XIBA 2BGQA 3SFKA 1EQPA 3GDLA 3THCA 3DI0A 5CQ1A 1MXSA 1RA0A 3ATYA 1JFHA 4GC3A 4U5KA 5HR6A 4DBSA 2X1IA 1FP8A 4ORMA 3OVRA 3L2IA 3MHFA 2EKGA 4QCFA 1GVSA 3LTYA 1ZRQA 2C8NA 3VIKA 2QMJA 8TIMA 2IQ0A 2D3LA 3T0CA 4B9ZA 3W2KA 3BTNA 4QQUA 5LNWA 1R3TA 4E0CA 2J7FA 4LPCA 3B8VA 1L2UA 1XYAA 2ZRZA 4S3EA 3K8LA 2P0IA 4HPHA 2RFGA 1SGJA 4RJEA 2D22A 4XO7A 3LLXA 3A4WA 3RCYA 1ZSXA 5FA5A 2W9MA 3VCNA 3KTXA 1WAWA 5LZLA 2WXDM 3EKZA 4JN6A 4AMAA 4KS0A 1QT1A 4RDVA 2HV5A 3MUAA 1PKMA 3GFZA 7ODCA 1EC7A 1L2QA 2NWRA 5JUVA 1V3KA 1EF2A 3NQVA 3QQWA 1TMQA 1W5MA 4S3DA 1QMLA 3LZ3A 3H2OA 4QHRA 3UPBA 2QCLA 4JFWA 4P7RA 2QGHA 1B31A 4JTLA 4Y9MA 4ZOBA 3W53A 1FCQA 3DFNA 3GUGA 2QHAA 3VDAA 3DFHA 4G7EB 1J11A 5KZ6A 2G37A 3H4WA 4Z2HA 1H61A 2QKFA 2XFYA 1O94A 2Z7KA 4RXFA 3ICJA 4FOUA 2Y61A 2OYLA 4HN4A 2YLLA 2PC8A 3L5MA 4HNOA 4P61A 1GT8A 3TN4A 2FZMA 4IFKA 2GK1B 1GEHA 3ZMRA 2WSPA 3DYMA 4WDUA 1AZ1A 1D7FA 1CB2A 1K02A 2MNRA 1OD8A 4BI7A 2VX6A 2XIOA 3VIOA 2J8TA 4P7NA 1M04A 1LBFA 1DV7A 2Y89A 3UZZA 2C79A 2CCRA 1D9EA 3F5LA 1MMFA 1G67A 3GVQA 2V5BA 5C55A 4Z08A 1B9BA 1YPXA 1P6BA 4DZHA 1TX2A 3IRSA 4H01A 4AYGA 4ES4A 3S9YA 2HBXA 3PJTA 3VKKA 2A3CA 4R27A 4J3XA 2W3ZA 3HTWA 1MDLA 2PWEA 4RX0A 2Z4GA 4C60A 1V02E 4KW2A 4OIFA 4PRTA 1K7EA 3M0VA 4D8AA 3TW9A 3MKCA 3WLSA 2QCGA 4S2CA 2DFAA 3DECA 2A7NA 4F2UA 3WLRA 2V2HA 4B4HA 3IVUA 3MDWA 2QCFA 4MUPA 1ONXA 3WNMA 4HNUA 1GOMA 3QM3A 3WD1A 3WH7A 4F0MA 2ADAA 3AS0A 1OYAA 4OFCA 3UCCA 2B31A 3MW7A 5A8GA 2FIQA 3JVAA 1GZ1A 3OYZA 1SFLA 3GVWA 5LIKX 2IXVA 3TNOA 5DBUA 2BP1A 1V77A 5LA1A 3U2EA 3GBDA 4M0XA 1TMLA 2OOGA 5M2FX 4K6AA 3U9IA 3BV4A 1FX6A 3ZXWA 1K03A 3USBA 3AMDA 4ZE5A 1ZBKA 2WVVA 4H1ZA 3F4DA 1S2UA 3GRIA 5A69A 2XSBA 4R34A 3GD6A 2Y62A 3N11A 3LSCA 4NAEA 4JTAA 3W4RA 4I5RA 5EBAA 3GDRA 2XVKA 1TV4A 3A24A 3LI0A 3NDYA 3QC3A 3DHDA 5T9CE 4UNLA 3RN6A 1LORA 1JCYA 4LUSA 4LVGA 5HNUA 2WNQA 1WZLA 3MHUA 5DMLA 5CXPA 1ZP3A 4C6CA 3DH7A 3C8NA 2E1WA 1JEZA 2RGMA 4UTJA 3ZR4A 1QU4A 2BSLA 2IXUA 2GGHA 4M80A 1D3GA 3R58A 1PZ2A 1F61A 2J7GA 1GJPA 4GX8A 3NSNA 1VBHA 3LCIA 3IIXA 3CZGA 1QK2A 3G22A 4JR5A 4F2TA 4CQ9A 5FIPA 1UKOA 4H9UA 4OGZA 4C7GA 2VZSA 1KBJA 1JGIA 4MWAA 4CCEA 4AG0A 2DZPA 4HPJA 3KOZA 3LOTA 3VNIA 4HQVA 1YXYA 3H4GA 3P14A 1OFBA 3MV01 3S6OA 3HIJA 1WKYA 1QWKA 2WPBA 2HXUA 3D3FA 2A79A 5KMYA 4AZHA 3LLFA 3HGOA 1NELA 2GGGA 2ZZ7A 3KOFA 4C7FA 5I07A 3DXIA 2ZOXA 5AHEA 3NZPA 3O63A 1IWPA 2CYGA 5FSEC 1W0MA 5LIXX 1EZWA 1UR3M 2VC6A 3V4BA 2ZUVA 1AJ2A 3QSRA 1P0BA 3JW7A 1GQJA 2VEGA 1R86A 1FXPA 2PODA 1KLYA 1IHIA 1XDMA 2JIEA 3W6YA 4MMWA 4MKVA 3TQ0A 4QLKA 1YPIA 2G96A 1W5OA 4A8RA 1ISVA 3L2LA 1E1CA 3SCRA 4IIFA 2E6FA 5LYRA 1TCDA 1QI0A 4H00A 4KESA 3C2VA 3Q4DA 5D32A 1PXGA 4QS6A 4LNCA 5FSDC 2E6YA 2OQLA 3G1DA 4Z1AA 5BNKA 7CGTA 4Q6XA 3RR1A 2FQIA 1IQ8A 3BLPX 2BG5A 2W5FA 3MP5A 1K8YA 5D30A 1GQIA 3KOYA 1MXGA 4IX2A 4KQNA 3GDTA 1B90A 1T99A 1TUFA 3BW3A 1R2SA 3KDOA 4J9JA 3W7HA 1Z44A 4DQWA 5DMMA 4N0RA 3AC0A 1Z42A 5T9BG 1SO6A 3KW3A 3PC0A 4LV4A 2CLEA 3TQKA 5K9DA 4GPNA 4BEQA 3AIWA 3CBWA 2O0TA 4ZO9A 1XSJA 1PAMA 1HVQA 2JF7A 1BTCA 3M41A 2BXZA 3L4YA 3TQPA 4P8VA 2E5BA 3O06A 5BRPA 2HK0A 1UR8A 1D8CA 3NOEA 1V6WA 1YXDA 3J7HA 4IZGA 3EBVA 1YNPA 3W01A 3ZWSA 4K7YA 4KEZA 4DUOA 5HJYA 1AQHA 4MJZA 3WF4A 3WNLA 2P76A 1W5NA 2PP1A 5HQEA 2Z28A 3OLEA 3E1F1 4GC4A 8XIMA 1B3OA 1GOKA 1TZ7A 3FFSA 3NOYA 3W6LA 1XIMA 1H7PA 4JPGA 1TVLA 1LT8A 5I09A 1GUVA 2YL6A 3P0WA 4CNTA 1A4LA 1SJAA 3LMYA 3NGJA 3BVJA 1OF6A 2WMFA 5IFPA 5EU9A 1KM2A 2V2CA 4W4QA 3FS2A 1BVNP 3SECA 4F9JA 5DCEA 3CLWA 1D3HA 3PSWA 1JZ8A 5BWAA 4LBSA 3QR1A 3W00A 4Q4OA 3R7MA 3SQMA 5AYYA 3OPSA 2O9RA 4W89A 4H9ZA 2V2DA 4J35A 3LBCA 2DH3A 2GFTA 5SWUA 5H2ZA 3B9NA 4ILSA 4MNJA 4UXDA 4I9AA 4US6A 3TQVA 2DH2A 2Q8XA 1TJ0A 5HBFA 1WOBA 2QJNA 3M47A 5CAHA 3ISIX 4MPQA 4IMGA 3CPUA 2XSXA 1EJRC 1S2CA 1XCXA 2DW6A 2BHYA 1OYBA 5GNXA 5T26A 3VDBA 4JTTA 1PZ1A 5HNNA 3S2NA 3EOLA 3U2OA 3GG7A 1VZWA 1GWJA 1C9WA 3WQ4A 5CC7A 1RY8A 2HS6A 3UD6A 3M0JA 1EUNA 4JNYA 3UCDA 3INPA 3P82A 2JGYA 4RDZA 3W84A 1EA9C 1TO3A 5T8GA 3B8DA 5AHMA 4F3HA 5I3FA 4JKKA 3N2MA 1JGMA 3S5OA 2DVXA 1OD0A 4A2RA 1XIGA 2PRMA 2GSJA 1BQGA 4DLMA 5ABFB 3CQJA 5FACA 1OFRA 1UC4A 1GYLA 2XH7A 1XH1A 3WDHA 3H2MA 3ATZA 1DPMA 2HQAA 1GOWA 2IQTA 4S23A 4ASTA 4JGDA 4ZXOA 5FJIA 4L4PA 4EWND 3WFZA 4Q33A 1WDDA 1H4PA 1XV8A 1HKIA 5GJNA 4J3WA 4NY2A 4WY0F 3RMEA 3WQ8A 2JGQA 1O5RA 4DHGA 1REQB 3GDBA 2V3DA 2YDQA 7REQB 3AIQA 2PDCA 5C8BB 3S5YA 5I00A 4CD7A 1U1JA 1XUZA 1QW8A 3B4YA 1JL8A 5A95A 4JCLA 1PEZA 1R46A 4PH6A 3UXIA 1ZAIA 3KOWA 3QYSA 1AJ0A 1JQVA 3CLMA 4B5NA 3OIXA 4WDTA 3GC5A 3NJ3A 2DT3A 4Z0SA 3KE0A 1HVXA 4OOUA 2CLMA 5A6AA 5C7VA 2XFWA 4TXEA 3ZJ7A 3SCOA 4EWJA 3BLFA 3RG6A 2PCEA 4DJDD 3VCCA 4DPPA 2CWNA 3ABSA 1C29A 2WWDA 3WQCA 4GQRA 3SCUA 5G2IA 3K4DA 1JXKA 4FX8A 1EXPA 4LCQA 1W56A 4L1GA 4J1OA 3M1ZA 2WMKA 4PL1A 1EYEA 4X61A 2PTXA 4K8EA 5A8QA 4ECLA 4LV9A 4MB3A 1RBAA 2QT3A 4DWSC 3AYSA 4CNSA 1PYMA 3TKFA 4GH1A 4GGHA 2GQ8A 4L6OA 4Q8MA 2PWHA 5ABHA 1NOWA 3VUPA 5C9RA 3C2OA 1XDJA 4E2DA 4NZ4A 4BQ2A 2YX0A 1OG6A 5DT7A 2Z29A 3WLMA 1QRQA 1J12A 2H9AA 4NZ1A 1SVDA 3WQVA 2ODOA 1B9ZA 2PU1A 4LRSA 3NL6A 3IJ8A 1FHUA 4ZB0A 3ONBA 2QJJA 2BVWA 4JTSA 2G4FA 1JPKA 4H4IA 1UKSA 1VEMA 1MQQA 3DIPA 2REQB 3CWOX 4M3PA 5EY5A 2C1HA 3VKJA 3IS4A 4ZOEA 5I24A 1BXBA 3ZSSA 4MDPA 2P10A 1Q4NX 4C91A 4YTRA 1XYMA 2XHYA 3DAQA 1EXBA 4CD5A 1Y5WA 2HPIA 3MC5A 3LV5A 1UWUA 4H7VA 1DWFM 1G4EA 3EX2A 4O52A 3LY0A 3S3GA 3WL0A 2FKPA 2VUYA 3GH7A 2R14A 3QR0A 1QI2A 1TV8A 1V7YA 4I5UA 3VYLA 3GZ3A 1EQCA 1F8MA 4M6UA 3R0KA 3E5BA 5HMFA 4HHLA 5AFDA 3BAXA 3OTRA 4DX3A 3TC7A 3T08A 3NDOA 4D71A 4XZNX 4GE8A 3E49A 3WIJA 1QHPA 4AFYA 1XJBA 4XD3A 4J4KA 3QTGA 5EGRA 3RCMA 3ZT6A 1TA3A 4M51A 3EXRA 2JK2A 2EGZA 4BA0A 1Q63A 3FAXA 1R3QA 5LA0A 1K9DA 4DXXA 5HXMA 3EA1A 3W2UA 4MJ4A 1NJJA 4PCNA 1TZ9A 3CMJA 3LEPA 1WQ5A 5F2MA 3N9SA 4I9MA 3GM8A 2WNNA 4MLRA 1O66A 1GW9A 3O1NA 3L66A 1FWSA 1E51A 3KS5A 2G3FA 4XX6A 2P0OA 4LUTA 4ZE4A 5TBOA 4WDXA 3RIKA 1VCGA 3VIHA 3HU7A 4R7JA 3UVAA 1PX4A 1A3WA 2WZMA 4WCJA 5LKYA 1J9YA 3PZTA 1UJPA 1Z32X 1QW7A 3NZQA 2W62A 1I45A 2HE8A 1JG9A 4HA3A 4NHVA 4XG1A 2I57A 1LLWA 5C2CA 1QXLA 3SQLA 3GSMA 4O12A 3A9IA 3M0XA 1DEDA 4MY8A 3B0YA 2GWNA 2Z6IA 4UCGA 1AQ0A 3SW6A 4MNMA 2WO5A 3GIPA 1MW0A 4HU0A 5CBJA 1RLDA 4GVHA 1OFPA 4XAYA 5FD0A 1UP2A 4OBSA 3MMDA 1E9ZB 1Q2RA 3K8MA 1HXJA 4JCMA 1QR7A 5TNVA 4WY0B 4JL2A 5GJMA 4HYRA 2Y0FA 3TUUA 2ABAA 1UBPC 3A4XA 3V35A 2QUVA 3CZLA 2PP0A 3DKJA 4BZYA 4LAKA 3TR2A 3CU2A 1GKQA 2BVYA 3E2VA 5BXRA 4JQ3A 5CZSA 2CKSA 1VFOA 4IQEA 2ZVIA 4PMRA 5I6SA 1V93A 3MCNA 5XIMA 5EMYA 3WK0A 3C4UA 4HPNA 4U28A 3TMQA 4GYPC 2QV4A 4LT9A 4M5PA 1H7WA 4W9TA 3LM3A 1A5CA 4YCOA 2AMXA 2DPEA 1TUXA 3TOYA 5IDIA 1CXFA 4K2SA 1XLFA 2XFFA 3VIMA 1VYRA 3UZ5A 2NWSA 4UWMA 4Q4SA 2NLYA 5HQMA 1GJWA 5BRQA 3CQKA 3PSVA 3QV8A 2X05A 2WK2A 2CNCA 3ELFA 2UY2A 4YTQA 4B5WA 3UJFA 1YTKA 5A5WA 4RV8A 4XIMA 4PEKA 3D47A 4JFSA 4LGXA 2PP3A 2XGBA 1DXEA 4Q4KA 3HG5A 2EPKX 1BXNA 4GJ1A 1R87A 2J79A 1TWDA 5HUPA 4B92A 1U5JA 3NPXA 3SRFA 1QNVA 3OZPA 4KIRA 4S1FA 6TIMA 3W7KA 2DORA 2FB2A 4GG9A 3V0SA 3S2MA 2AGKA 3LG3A 1GVEA 3WLHA 5IBXA 3N18A 4CQAA 1EKOA 3H21A 1GVIA 2YFOA 1QJWA 3RM8A 2A3LA 2J7CA 1A5LC 2NLIA 2PURA 3AIUA 3N9RA 3MY9A 3E6EA 1DKWA 1WPCA 4LS0A 4BF9A 3BICA 3EAUA 1GOOA 4HIBA 3QY6A 1OZQA 3S42A 1SYTA 1ZB5A 1AG1O 4XZWA 3Q58A 5A2CA 4ENLA 1OGGA 4OV4A 2R1LA 4GO9A 3UF9A 3K4AA 1TWIA 4PRWA 1B3XA 4Y96A 4X9YA 4N6EA 4ONVA 1QNSA 2WSYA 4IQJA 1NVMA 3OBAA 2ZA3A 1MW3A 3N2XA 1P1MA 4ZEPA 1ZJHA 4H6QA 3LCHA 1V4YA 2XH0A 3WUGA 1PUDA 3TZFA 4DF1A 3VZZA 1DTNA 2VFHA 2XISA 3EPMA 3RRAA 1QPRA 2PDMA 3FXYA 4CNNA 1EBGA 4I8DA 2E1DA 3TCSA 4I6KA 3ITVA 3IVSA 3VGHA 4M81A 3VOCA 1F76A 2CKRA 3APGA 1ITUA 3KRBA 7TAAA 5G4EA 3EMCA 3MANA 1KKOA 4UCFA 3E38A 4IQLA 1NDYA 1W3TA 2IMRA 2VENA 1D7KA 4Q32A 3TDFA 4E8DA 2I7GA 3EWCA 5HANA 3KVJA 1WCGA 2QR6A 3W23A 3A3XA 3M4HA 2CZVA 1TTQA 2PEVA 2GGIA 3WQPA 2ONEA 1WNOA 1V02A 2G8ZA 1S5NA 3E74A 4O15A 4OUIA 4AZCB 1SR0A 2F6KA 2GJLA 3LHTA 1W1PA 1YDOA 1JPMA 5IXEA 5D05A 2BGSA 4C5YA 3QH2A 2R8WA 3I6EA 4QROA 4YPJA 3NSMA 1DWHM 1LL4A 3TYAA 1KD0A 4ICNA 4ZENA 1JVNA 2QV5A 3P0XA 3BOFA 4GQGA 5CGTA 3SM0A 4AYSA 2VI0A 4QAWA 3ZZ1A 3CS2A 1IZKA 4LTSA 1VIWA 2PLJA 3PWIA 2NX3A 2W6RA 4NXSA 3CL8A 3G1SA 4IM4A 4KETA 1Y5XA 4FNTA 3I68A 4IWWA 5PTDA 4WDWA 5AC5A 2RDUA 1W9XA 4BWLA 2IPWA 3AFBA 5G1TA 3GNDA 1JZ7A 3UYCA 1C3FA 4PTXA 3CWNA 3KHDA 3CUJA 4JTFA 1HNYA 2SFPA 4LUJA 3L4WA 5C9WA 4GACA 5CSUA 5REQA 3T2QA 2CLKA 1MNZA 4WIWA 2HVMA 3RFAA 5H91A 2NX1A 1B3VA 2GUYA 2YCJA 4L4MA 3LBOA 1TRIA 4LWWA 3EDJA 3R11A 2OEMA 2ZQ0A 1NWSA 3ZLGA 2NQ9A 2FZ9A 3JZUA 4XKYB 4DBUA 1R2TA 3RX4A 1EB3A 2TODA 2VQUA 3GZAA 4E3TA 3LHYA 1KWKA 4XK2A 4CUCA 3S5ZA 2C71A 5I79A 1BYBA 2ZC1A 4MZ1A 4B5SA 3UW6A 3I6RA 2ZUWA 3NZGA 5A8MA 2QLYA 3VGEA 2P8BA 2VZVA 2A3HA 2C16A 2ZWYA 1FQ0A 4R53A 1ITCA 1NFPA 3CO4A 3W7GA 1B2YA 1S2WA 4JHOA 4WKAA 2NSOA 4AY7A 2QW5A 2WKJA 3ARRA 2PDIA 1M41A 3BJSA 5AYBA