The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
227
|
structure length |
215
|
Chain Sequence |
MEEIRAWRHVFKLDPIDDERLERLCESGTDAVIVGDNVLDLLARIRRFSVPCALEVTDVLTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQYGDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALATVAAVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| source organism |
Geobacillus kaustophilus
|
| molecule keywords |
Heptaprenylglyceryl phosphate synthase
|
| total genus |
76
|
| structure length |
215
|
| sequence length |
227
|
| ec nomenclature |
ec
2.5.1.n9: Heptaprenylglyceryl phosphate synthase. |
| pdb deposition date | 2013-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF01884 | PcrB | PcrB family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Barrel | TIM Barrel | FMN-linked oxidoreductases |
