4NAEB

Pcrb from geobacillus kaustophilus, with bound g1p
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
227
structure length
215
Chain Sequence
MEEIRAWRHVFKLDPIDDERLERLCESGTDAVIVGDNVLDLLARIRRFSVPCALEVTDVLTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQYGDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALATVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 76
structure length 215
sequence length 227
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 4naeB00
4NAEB 3VKCA 3W01A 1VIZA 3VK5A 3VZXA 4JEJA 3VKDA 4NAFA 3VKBA 4MM1A 3W02A 3W00A 2F6UA 4NAFB 2F6XA 4NAEA 3VZYA 3VKAA 3VZZA
chains in the Genus database with same CATH superfamily
3GTXA 1GOMA 1YEYA 4XBKA 2PTDA 3UNDA 3QGKC 3I3BA 1TMHA 3IVSA 3KRBA 1FWEC 4UFHA 2ZC8A 3IS4A 4LF1A 4EP8C 2Y8KA 5MF5A 1GOWA 4TIMA 1XFCA 4G9PA 1ZUAX 3B9OA 4RNIA 1AD1A 2ZIDA 4GUGA 1PX8A 5A1AA 4QJ4B 2XWDA 3H54A 3NQ2A 3RM8A 3WLMA 1DJIA 1JNDA 1XLIA 4B5SA 5IM51 5EGRA 3W00A 2G5WA 1LG2A 4LAOA 1ZAHA 4HNUA 2EPKX 4XZWA 2X16A 5IBXA 3S6TA 2QKFA 4NUWA 3DFQA 1U1UA 4TTGA 1XKJA 1UPMB 2ZDRA 1VS1A 3DYMA 3MKKA 4N4PA 2VZOA 3UXIA 3V7PA 1EGMA 1VLIA 1W3IA 3VC6A 3W2NA 2Q6ZA 2JF6A 4LAMA 1NDWA 3ABSA 1CLVA 1WYIA 2RDTA 2UV8G 3NVTA 1Z89A 4AVFA 3FA4A 3FYPA 1E55A 3QKZA 4GQBA 1UH2A 3T0CA 5AZ0A 2HS8A 2RKXA 1ZS2A 3BH4A 4MWAE 3LLXA 1OYAA 4LVDA 2E3ZA 3W2KA 1RJQA 1DJHA 2ACSA 4ZSTA 1K9TA 3DC0A 3H2EA 3CYJA 3JW7A 5CGTA 3NM1A 4PA8A 4JN6A 2W5FA 5G2WA 3MDWA 4XO6A 1TKKA 3K1DA 3WDPP 3E5BA 4NP7A 1NSJA 3SUSA 2QGHA 4HA3A 3BAYA 3RLVA 4JTGA 3NQFA 3K46A 5DY2A 5A6KA 1RLDA 3LTSA 4LJ3A 3SCSA 3KHJA 1K8YA 1W5NA 1VENA 4MF4A 1ALDA 4R9XA 4R27A 3KRZA 3A3WA 4AFYA 4ZXLA 4D6GA 2BS9A 1YTDA 1JUEA 4IP7A 4W4QA 3NGJA 1S5WA 4JTQA 1XH1A 2WSRA 4GKTA 1IT0A 4WUIA 3OVGA 1ZZMA 4DJED 1VFSA 3DC8A 1OC6A 2WLYA 2NX3A 4NJGA 3IV3A 3V0SA 2R94A 5FOOA 4Z0JA 4ZE4A 1IEWA 3KRUA 1N8WA 4PBFA 3LS9A 3W83A 3KOYA 2CESA 3GUGA 4OFCA 2UBPC 1TELA 1XYMA 3DXIA 2E9BA 3WDJA 2F6KA 3TTOA 3ZR5A 1CI1A 3FHAA 4BI6A 1GONA 4IGSA 5BOEA 3FS2A 4ZB2A 3STFA 4TV6A 3GVRA 2J66A 2XZ9A 2WQDA 4YWIA 1P6BA 2RDXA 2QVNA 3K1GA 1DTUA 4MHBA 2PGEA 2NQ5A 2PP3A 2WW5A 2HQAA 4GNKB 4V28A 3BPWA 5EFDA 4HA4A 3OIXA 3RITA 3MMWA 2FB3A 4Y2WA 1UJPA 1VFHA 3S6OA 4JY9A 2HBVA 3UZ5A 3GNNA 4ES4A 3R8RA 4A3YA 1K8CA 2TSYA 4D6EA 3VI2A 4XVDA 1MW1A 1EDQA 3HPFA 4CQCA 4QQUA 3ZR6A 2G41A 2OTDA 1XW8A 5A94A 3AXIA 1EGVA 4MAVA 3W3OA 2VC6A 2GYIA 4TTUA 5E0FA 1XYLA 4ZR8A 1V0LA 2GJXB 5CGMA 1M65A 1TR9A 1JFXA 4C65A 5HMEA 2WMHA 1JZ7A 1FFRA 1E0WA 4Q7IA 5E1QA 3G8RA 1Q6LA 4GNVA 2NWSA 3KCOA 2HROA 4W86A 7TAAA 2Y88A 3NDZA 4B9ZA 2A3AA 1TV5A 2WYSA 4ERAA 1GPFA 3C0JA 1TG7A 4KRTA 1GG0A 3IIXA 2CKRA 4QE1A 3HQ1A 1D3HA 1UWIA 2J47A 2E9MA 3GO2A 3H6OA 3QY7A 1KLZA 4MOZA 2OVLA 2DUZA 3U2EA 5H8PA 1WDRA 1E15A 3RX4A 1RJPA 3LRKA 3WX7A 1CENA 3STPA 1DWAM 3G1FA 1DHPA 3POCA 3GZAA 4IISA 3WO8A 1I2OA 1FKWA 4HNTA 3L4WA 4V27A 1V3LA 3GIYA 4QFUA 4JR5A 3MCOA 2ZX9A 3ALGA 4NNAA 2YA0A 3P93A 4UMAA 1FWHC 3FVDA 2CLFA 4KS0A 1DIOA 4D1IA 2IKHA 3SQSA 1ZAJA 1TRIA 4AMCA 2P0OA 3VNZA 3VIJA 1TE6A 1AQMA 5C9UA 2PE4A 4QAIA 4HOXA 4FI4A 2XIJA 3CWOX 5KZ6A 5LIUX 1JZ6A 3TFCA 2H9AA 4XD4A 4MKNA 3V5OA 2W91A 5FESA 3U7BA 3VIPA 3GXPA 2H90A 2CLHA 1PVNA 4G6CA 4KEUA 4FLRA 1W5OA 1Q6OA 2OOGA 4LF2A 5I2UA 4A4AA 4IGMA 1PSCA 3K8MA 3SY5A 3C5QA 3EDEA 4WZHA 1Q8AA 5FIPA 5GNXA 2EG6A 1W1IE 2ZRUA 4IUGA 1M01A 1FHLA 4W7VA 2PDJA 2WZHA 5ABTA 2TODA 4D8LA 3BMVA 5CBBA 1XLAA 4FZIA 3OYXA 4PCPA 3W2JA 1GNXA 3VOGA 2HVMA 3RMEA 4PMJA 3T09A 1J10A 3C2YA 5I07A 4DUOA 2V82A 3O1NA 2RHGA 3T55A 3W7RA 4JTSA 2PGFA 3MS8A 3WF0A 3OO2A 4JTDA 1ODZA 3GK0A 2XDFA 2W6RA 4M6VA 1BHGA 2VXNA 2ZTKA 2QUTA 3GVWA 4QM1A 4LCQA 1OWQA 5T26A 3B9NA 3EWBX 3VKDA 3WQCA 3AWNA 2OGYA 4S2CA 3BAJA 5CPTA 1E72M 4F2BA 2GJLA 2NQHA 4IQJA 4ZODA 2FDMA 3TWBA 3APYA 3W25A 1ZJAA 2J7GA 3FXYA 2VOMA 5JXQA 1R87A 5BCAA 1QPRA 1EBHA 4HCHA 3BWWA 3IUIA 4P7OA 2XVNA 4GY1A 1KFLA 4LWWA 2YFNA 4MB5A 3V1PA 1XGZA 4W7WA 4I3GA 5CG0A 3AFBA 3WQDA 4JPGA 1ADOA 3VIOA 2H3DA 3EA1A 1ZRQA 4DO6A 2D22A 3N12A 5CBIA 3UYIA 1UWUA 2H9AB 5LKYA 5FJIA 2PC8A 1SW7A 5AN7A 2ISWA 2WJDA 3M64A 3AJXA 4WSJA 1S2VA 3K2GA 3TQVA 2XIMA 3EGJA 3LTYA 3KUMA 3VNIA 2PGWA 4LEQA 4Q8WA 4OVXA 1RPXA 2I9EA 2OXNA 1S38A 1I2PA 5HK4A 4JKMA 1G7VA 4BQ4A 4I6KA 1B1YA 1XRSA 1ZBKA 1GZGA 3S2LA 1N2VA 2BBFA 1A0DA 3F5LA 3U5UA 4AQLA 2CZDA 2Z25A 4GZ7A 5HBFA 3QEZA 5E9AA 1KTCA 4O50A 3GXMA 1IV8A 3F4NA 2OWXA 3GE7A 5D8WA 4GI8A 1FTXA 1WDPA 1ISYA 4M51A 4DWSB 5ABFB 3N11A 4RPPA 1MUMA 2CFFA 3T2OA 1T0OA 3S46A 5TQLA 1WE5A 5D2YA 1DQUA 4J27A 2XFYA 1BGAA 4BF9A 2B7OA 2P1FA 4BY3A 1KFWA 3HPSA 1UD2A 3CEUA 5HXMA 1XH2A 1J2BA 2ZX5A 2PWEA 3PTMA 2FZ8A 1DORA 3UPWA 4K38A 1CB7B 3AXHA 4U5KA 1AUSL 4UQBA 3ARSA 5A6TC 1AQFA 4NZ1A 1YADA 1A50A 1T5AA 3CWHA 3SUVA 3C2VA 3R7MA 2REQA 3PWAA 2GOKA 4NJIA 3HMCA 4ZSUA 1LLZA 4EPDC 2ZE3A 2WVTA 3EEGA 3LQGA 2F38A 1Z8AA 1UP0A 3VKBA 2KX9A 1EP1A 1ISXA 1WZKA 4HSNA 1MNZA 3ERPA 2WJEA 3GYCA 1GQLA 4I8YA 4NG3A 1Q85A 2NQLA 4LBSA 2Y61A 2WZMA 5ECUA 4NJHA 2QR6A 1GYLA 2V8ZA 1IEXA 2DORA 1QI4A 4HBKA 3QPEA 1EH9A 1Q13A 4JD4A 2XFWA 2JGYA 4FOJA 5FEPA 1P0NA 1H1YA 3KLLA 3IARA 4NXKA 4MSSA 2YYTA 1Q6DA 3UZZA 1PWLA 5KINA 3D3FA 3AXKA 2RUSA 1C9DA 1XS2A 4L64A 4UNIA 1SQ7A 4CD6A 1R2RA 4ATLA 1M9HA 1FWJC 3WF2A 1K6AA 1XLMA 4IH3A 3SY8A 1BTMA 3GB6A 3W6LA 2ZUUA 1FWIC 3WJZA 2FIQA 1B3YA 2WAGA 4CU7A 3GR8A 5BW6A 3MQTA 2Y63A 4UCFA 3D5HA 1UIOA 1QI0A 3NYZA 1XUZA 3JR2A 4IUOA 4B3ZA 4KWVA 1OC5A 1A5LC 5I77A 3I3EA 3LBMA 3PTQA 3S5YA 2QCCA 4O0QA 2UY2A 3W75A 4B5UA 4RPQA 4EACA 4J5NA 1XQKA 2FVKA 3VM7A 2REQB 1ENUA 1MZRA 4NYYA 3W86A 2QJHA 4PMDA 3G1DA 4J3WA 4DBWA 2VUNA 3CQKA 3XISA 3GTFA 4CN4A 1RVGA 5ECVA 3AS0A 3UESA 3PG8A 4DYJA 3WLLA 4HOWA 1VQTA 1VYPX 2EPLX 4LAKA 1B9BA 4PUWA 3QHOA 1UP2A 1I2NA 4O17A 2W3ZA 7PTDA 2PLMA 3A22A 3EXTA 1L2QA 1NP0A 3USBA 1IYXA 3U9IA 3UPMA 1LRNA 4HNOA 4PUDA 3VPLA 1Z44A 5CAHA 3QQWA 1SUXA 1NDVA 4N4QA 3OA3A 4P61A 2J75A 1TJPA 2NQJA 1VBRA 2FTPA 5FA5A 1VFMA 3CUGA 1UUQA 4QXIA 3EX4A 4QE5A 2C1HA 4IT1A 1E6RA 3IJLA 2B7PA 5K7JA 1K7EA 4P7NA 4Q3MA 2QQ6A 2R8WA 3SI9A 4YCPA 3QF0A 1VZWA 4UTJA 3LGGA 2OLSA 2NX9A 1XCWA 4HNLA 4JIIX 1E4IA 1GK8A 2I56A 2F6UA 3VIMA 4NKCA 4P8XA 3R6IA 1VHNA 1TTQA 3AMCA 5IOBA 7REQB 2J13A 4IIEA 1C90A 3QKEA 1B4EA 3W1NA 4JBRA 2XYLA 3QYSA 4YPJA 5M2FX 5G1MA 2YCIX 1DWHM 2DZVA 1XPGA 5AVHA 2NZLA 1OD0A 5K9XA 4LC6A 2J7EA 2CW6A 2J77A 2OODA 2VGBA 4OTKA 1BKSA 4XAPA 4KPLA 2HK1A 1R7AA 1KXHA 2YDAA 3BLOA 3HJEA 3K4DA 3M0YA 6XIMA 2FGBA 1G0CA 4HK6A 5HQEA 1LUCA 1IXOA 1LQAA 3W7MA 4EXBA 3N19B 5C2XA 2ZTJA 1TMLA 2WBKA 2GK1A 4YN5A 2J74A 4TX6A 3QHMA 1VPYA 3FKKA 1FWTA 5D2WA 1FWFC 4E4FA 2ZRWA 3LI1A 4M56A 3W70A 2XPKA 4WLCA 2C8NA 3ABOA 3NL5A 1JGMA 1OCBA 1Q63A 4PTVA 3CB8A 1W5PA 3UR7A 2VX6A 4AYGA 2GJNA 3IVTA 1EO7A 4JTLA 2D73A 4QROA 4OKDA 3PZOA 4M1RA 2WB5A 4DF2A 1E9LA 2QIIA 3DIPA 3R89A 3WUEA 1CWYA 5CPLA 1MZHA 3PTKA 1PUDA 2HRWA 1M04A 4HKPA 1PDYA 1EZ2A 1KKOA 1RK6A 2I17A 4PULA 2CXGA 2VT0A 3HPZA 4Q7BA 4GXMA 4PRRA 4ZOAA 3I4EA 3HN3A 3ISIX 3N3MA 1LBLA 4XVEA 2XVGA 1ME9A 5ABEA 3FJ4A 1XF0A 1KCKA 3M46A 1DWJM 2HE5A 3UZWA 3C2RA 2GDUA 3MUZ1 3QJAA 1OCNA 3IJ6A 1JDFA 4C7DA 4PBGA 2V6AA 2HXTA 1DQWA 2FJKA 2CLOA 4TQTA 1KM3A 1JFHA 4JFSA 1H41A 3E6EA 2BXVA 2QS8A 3SSJA 4ZL1A 5IDIA 3AJ7A 2EBNA 2QJIA 1T99A 3IIOA 3KOXA 4JKLA 1V3MA 4S3KA 3UJRA 3NYDA 3RCYA 4RDWA 3CQHA 3SEPA 1G01A 4GABA 3M7WA 4GH1A 1RH9A 5SWUA 4P5UA 4LYKA 3B0VC 3F03K 1LUCB 5CPQA 3PZTA 1UA3A 4WSKA 1X38A 1UZ1A 1O12A 1V6XA 2BNJA 1FDZA 2DUXA 4H9ZA 4PTWA 2XIQA 5GVJA 1A4LA 4MZ1A 4Q6XA 3SFWA 3FJ6A 3R4IA 2HVOA 4HZ7A 1FCVA 1BWKA 1F4HA 2YCEA 1GCYA 2C1IA 4UOZA 7TIMA 2AAMA 2GUUA 3UWQA 2BFGA 5I3DA 4PUNA 3DFNA 1OVDA 3NZGA 5HNUA 1PL9A 1OK4A 1QWGA 2EHHA 2E9LA 3N4FA 4CQDA 1GVQA 2VR5A 3DFHA 1XIGA 3A5FA 3CWNA 4F0MA 2QCFA 4XISA 3GTHA 3CZJA 2WKLA 3T0DA 4EXAA 3ES8A 3VILA 2VC9A 4I5RA 1XLKA 1GVSA 4AG0A 1Q66A 4F66A 3UPBA 2OG9A 4NZCA 3U3HA 3NZRA 1J8VA 3LLDA 3NSNA 2PDFA 3RJXA 4JHOA 1XIBA 2O9OA 4R88A 3HM7A 4RW5A 2DQWA 1NOWA 1TJ0A 4JX6A 3ZT6A 1M5WA 2J7CA 1HGWA 3NEVA 3T4CA 4PR4A 4HZ6A 1JNEA 5HNTA 1W1VA 4DJFD 3FVMA 1W9VA 2RJGA 1KA9F 3U8GA 3THQA 4ASTA 5G4HC 5KETA 1TV7A 3ATYA 2G37A 4UXDA 3R5EA 3H12A 4IX2A 1XLDA 2WMJA 4NT0A 3GW0A 3L23A 1UQZA 4UNKA 3O9NA 3L5AA 5D30A 3AHYA 1DE5A 3VOHA 4PC8A 3EPMA 3AZSA 1WOAA 1FCUA 3RM9A 3B4YA 3GU9A 1LM1A 2RDUA 4RK8A 3H2NA 3WL0A 4PCNA 2ALRA 1GQIA 5CAKA 2E4TA 1UD8A 1Z69A 1TJRA 2YYUA 3EAUA 4R85A 3H4GA 2Z1KA 4PZVA 1U22A 4WVXA 4JNMA 4PMYA 4MB3A 5LXXA 3LZ3A 1E0UA 3G6MA 3ELFA 2E1DA 2GVYA 4D6HA 3TH6A 3ZJ8A 4TX9A 4FMVA 3ARRA 2W27A 4HMCA 4WDXA 5JBFA 4BK9A 4IMGA 2FH6A 3ZMRA 4DNMA 1PWMA 5A95A 4M6QA 2RDWA 3E5PA 4DAFA 4XBJA 1TE1A 3W7QA 1Z32X 1NTHA 2W0UA 2IQDA 1AW5A 3LBOA 2J7DA 2WK2A 2YXXA 4JTRA 4QG8A 4PUJA 1UKPA 2HEJA 4S3EA 3PC0A 1C8QA 4K37A 3FCPA 3N9SA 4AEFA 3UCQA 1XH0A 1HW6A 4CEXC 3W85A 3VIGA 2VD9A 1QNRA 3DX5A 3TNOA 2VYOA 1QPNA 3O7UA 2E6YA 4FHAA 1HJXA 3TYAA 4L4LA 1MEHA 5AHIA 1EP3A 3PZMA 1XGDA 2D2GA 3B9DA 1HP5A 3IJ7A 1B4KA 1LJYA 4MNKA 1RK5A 1PKMA 3LXAA 3HG5A 3DOPA 3L66A 2WMGA 3TZNA 3KS5A 3WF4A 3RCNA 4R34A 3ZQ9A 3GFXA 2YDSA 4IMFA 3C0SA 2GQ9A 4ZFCA 3LNMA 1GQNA 1QK0A 1A3HA 2Y6ZA 2CEQA 1EXPA 2BY1A 3T07A 2BGQA 2P3EA 1LBFA 1L6SA 2ISVA 4JEQA 1DBTA 4MFEA 3EKGA 3GHRA 1LL6A 2QJNA 1YXDA 4GGHA 2PRMA 3TYZA 1VPQA 2BTMA 1BVZA 5D9PA 3W74A 3ZJ7A 4WIWA 2HDJA 2V3EA 1RA0A 1A5OC 1C93A 2POTA 4OECA 5K3VA 3WMLA 1RCXB 4Z2IA 3PP7A 3BLEA 5C6MA 3EWYA 3U2ZA 1HKVA 5LXEA 2GZXA 2YCLA 4F0LA 4PCSA 1AW1A 3MTWA 2WHJA 1KO0A 2E5DA 3UCCA 1JL8A 2JALA 3OZMA 5BXRA 1FKXA 4EAMA 3PTDA 5FEXA 2WMIB 2FTWA 4MIMA 3CPRA 4KW2A 4R53A 1HXJA 3NPWA 1OGBA 4RV3A 4E38A 2AMXA 2PDBA 2QJMA 3FY1A 2CCRA 1MEIA 2Y8VA 3WLSA 1KFJA 4BI5A 2V81A 4WJXA 3W2LA 3ITXA 5AYIA 4FAMA 4K3ZA 4QISA 5IXEA 3AS2A 2YCKX 4FB7A 4NNCA 1VBHA 3GHSA 3O07A 4US6A 1PZ3A 2Y5SA 2JK2A 8XIAA 1IE7C 2PPGA 4QG9A 3B8TA 3L2IA 2DZTA 5GJMA 3BG5A 2GPTA 2XGZA 3TONA 3L5LA 2I9UA 2J8FA 3S1WA 3L4VA 4LUJA 4C1NA 5U7SA 5I3FA 4L56A 2F61A 4O28A 3HZ3A 4LV9A 5I03A 3W1PA 3L68A 1IR2A 3GNXA 3WH7A 1MFUA 1W91A 2ZA2A 3REQB 3SO7A 3WLOA 1GJUA 4BF5A 1RP8A 5DRCA 3VXGA 4GIRA 2X1TA 1TWZA 8RUCA 1NFGA 1O5RA 2GVGA 3OGVA 5TBOA 3WQ6A 3EOUA 3KOWA 1IXNA 3VDBA 1V51A 1VFLA 2C13A 4GQRA 2C1GA 1MI3A 4J3UA 1KGWA 2ZX8A 4DZIA 1JPIA 4Q4SA 4LH8A 2DZXA 5CZJA 5RUBA 4A3HA 2YCLB 1UOZA 3BV7A 1JJKA 2INFA 1FWNA 1EZWA 3B9AA 4E2OA 1JZ3A 4XZ9A 2PTZA 2R6OA 3LNPA 4OHQA 2OSYA 5JU6A 4AEEA 5DFAA 4IPNB 4HPJA 3W9ZA 4UFJA 3MW7A 4HHHA 3RU6A 1LT8A 1KM1A 4QE4A 1LP6A 1XYAA 4LW7A 4NAEA 1UQYA 4CGTA 2JIWA 3QW4B 5AYBA 3DYOA 5DLCA 1AH4A 2VDIA 3MHFA 1FA2A 4LVFA 1F3EA 2PEVA 5AC7A 3SQLA 3AU2A 4U10A 4X9YA 1VCVA 4JICA 4L6HA 4O1FA 3AROA 5B7YA 4UQDA 3PNUA 3JS3A 2VEGA 4Q8NA 2OO6A 4Q4QA 3FJNA 4F8XA 1CLXA 3H23A 1A5UA 1EX5A 1Q6FA 2HJPA 1REQA 1J93A 1IWPA 4GZEA 2UY3A 4PMRA 3E2QA 5IRPA 3AIUA 1R9YA 4O13A 2FHBA 3RFAA 4DXXA 2YPIA 4HU8A 3WQ4A 1TVLA 4G7FA 1RCOB 4Q6JA 3W07A 1EJXC 1O95A 1OGSA 5LGZA 4O8AA 3RIKA 3EWWA 3GLCA 3B3DA 3I7QA 2QCMA 5F2IA 2BDQA 4UZSA 2CXEA 2FZBA 1A5SA 4NSBA 3PJWA 3F1QA 4AY7A 3G0SA 2GGGA 3W1XA 1CXHA 1S5MA 2DW6A 4E8DA 4H8UA 4BKNA 4R7JA 4JTFA 4M6UA 3ARXA 1BQCA 1UR8A 2FPVA 2F84A 3L2MA 4JTJA 3T1GA 2QNEA 2ZE0A 1KRBC 3OZPA 2VZUA 1WO2A 3N9KA 2WQPA 5D8ZA 5CPSA 4BWLA 2ZOXA 3NIYA 4IPPA 4ZA0A 3F4VA 2PURA 3U2OA 3V36A 1KBJA 2EXOA 3GVQA 3LM3A 1ZB5A 1C7TA 2D3LA 3L5MA 1W3NA 3KCJA 3PHAA 4JCLA 4AF0A 4NAEB 3GUWA 4LRTA 1ADSA 1VD6A 3GD6A 1MRQA 1TWSA 3USZA 4R9OA 3LUTA 4Y6GA 4EVZA 3QTPA 1BSIA 1AFSA 1OG6A 2RH9A 1EKOA 3CQJA 5GNYA 1QTWA 1NEYA 1HN1A 1V4YA 2Y2WA 3SCOA 3IGSA 2DZUA 5JUVA 3GY1A 1ZBVA 2V2HA 4MNLA 1JZ8A 3LMZA 2Y89A 3W1QA 1Q7ZA 2OLAA 4MJMA 3MSRA 5EFFA 3NZPA 3GIPA 4FEZA 3ZR4A 3C8FA 4V1YA 3T2PA 4CQ8A 4A3QA 2DSWA 1DHKA 4S3CA 4HP5A 4FLQA 5CZKA 5CJMA 4F9DA 1IIGA 1KV8A 3VK5A 3KVMA 2XH4A 5FI8A 1PYMA 5FJOA 3EBVA 3H4XA 1RCQA 3W1AA 3W7CA 1XLLA 1ZTVA 5F4XA 2VZVA 3SM0A 1EP2A 4C7GA 1O6IA 4K7YA 2GVLA 1XCFA 3TYCA 4CCCA 3QC3A 5A8OA 5ENLA 3MP3A 2AKZA 2C71A 2G3IA 3TU9A 5BOFA 3VDGA 3G1HA 1LBMA 5I06A 4KBXA 1BF6A 1SVDA 2QCDA 4P8UA 1JCLA 2OR2A 2D0GA 1V3JA 3G8EA 1EYWA 3K5XA 3EDFA 3GC2A 3TR9A 2X41A 1XHGA 2G8ZA 2PBGA 3W7LA 4G7EA 4K1WA 2NT1A 2ZRVA 3QC0A 2OT1A 1E1FA 5DN1A 4LCSA 4MWAC 1XICA 5A6BD 3WBXA 1JQVA 1JI1A 4M6PA 1VRDA 3R25A 4AF0B 1TX0A 2XSBA 4G1KA 2G3MA 5HPOA 4GVFA 3I4KA 3UERA 4U3AA 4LT9A 4PH6A 2ON3A 3VVGA 1XX1A 3W7HA 7XIMA 2ZZ4A 1ZCCA 4UNLA 1F2JA 5TAOA 3IAQA 1JIBA 2WNWA 4AIOA 3GH5A 5FJRA 1NAL1 5LIKX 1KTNA 3GVGA 5G1YA 2W67A 4MPKA 1X1ZA 4D8ZA 3M47A 4HD5A 4QDPA 1WZMA 2I1OA 4FXFA 2F9RA 5I3JA 4L4PA 4O0ZA 4GUFA 1UKQA 2V30A 4LS1A 3URAA 2UY4A 4PN2A 2TPSA 4N2YA 4HN8A 1TWIA 3CHVA 1I75A 3STCA 1FBAA 2L5HA 4TU1A 1J6PA 1B2YA 4V2XA 4Q8VA 3L0GA 1HJWA 4HK7A 3WD3A 2PF0A 3WH6A 1SZGA 3OGRA 1E73M 3CM4A 1UR3M 4JFWA 3Q58A 2ZQ0A 5C8BB 3ARQA 3I10A 3LENA 5H91A 4YYFA 3FLUA 3RDKA 4MWAA 1KGUA 3V3WA 1SZFA 3QR0A 2ATMA 4NZJA 3U48A 3ZLHA 3M0HA 4N6FA 3HQPA 3KP0A 1SR9A 4AD1A 3DZ1A 4CNTA 5C55A 5BYWA 2ZWZA 1W2PA 2BZNA 4ZB0A 3I7RA 1ITUA 1I8JA 1TPUA 5AC8A 1DJZA 1WQ5A 2E09A 4HTYA 2JFEX 4C91A 1TVNA 4GJIA 1PTAA 2PTWA 4AD3A 5L9FA 4Y8FA 3XIMA 4DM2A 1Y65A 1Z6KA 4Q8PA 1V77A 2X40A 1TZ9A 3LRLA 4LRSA 3E0FA 4WKFA 3GXNA 1JF6A 5T9CE 4F40A 3QOKA 3HV9A 1QPKA 4GLEA 4K6AA 4E2DA 1TV2A 5MKGA 3AMDA 3MV11 1EWDA 1E56A 1ONXA 2V69A 4PSRA 5D2VA 5BRBA 2W79A 3HURA 3SGZA 1XPYA 2BV9A 3AO0A 3NXFA 3NSXA 1FP9A 2ZZ7A 2VGIA 1B3XA 3TYEA 2DZPA 4YS1A 3A23A 2WVVB 1VCFA 1EDGA 1YMYA 3TLLA 3WFZA 2G0WA 1EA9C 3L4UA 1JPMA 4I7VA 3AWOA 4IM4A 4DYKA 1EF3A 4W85A 3P82A 2BWGA 3RXZA 2QAFA 4I5XA 4E4UA 3FYOA 4UBPC 3V35A 1K8XA 4XBSA 3VUSA 2PWHA 4IFKA 1QNPA 1A5NC 2P53A 3F5JA 1EC8A 2DZWA 3TVAA 3SRFA 1EEPA 3SRHA 3LDVA 3N2CA 1C3FA 4I9AA 4LSBA 3MZNA 4MWAB 2X1UA 2DT2A 3QH2A 4L80A 3ENLA 1OFAA 2ZZ3A 4REQB 4PYSA 3DFSA 1ODUA 2DDXA 1W3TA 3QGAC 4FF5A 3VGDA 1NJJA 4F4RA 3M1ZA 3DBPA 4L9ZA 3UZYA 3VD5A 1OK6A 5AHFA 4UOQA 1R85A 3UWWA 2EG7A 5A69A 1J0KA 4GA8A 1FY6A 2PSNA 2ADAA 2QLYA 1V7AA 1PIGA 4DB7A 3ARYA 3NZ1A 3A3HA 3LHTA 2HVNA 1KXVA 1UR2A 3CL6A 5MKGB 3AZRA 5A6MA 3W29A 3AQUA 2GDVA 2X7WA 3M0LA 3S2JA 3LV6A 2OPJA 2G3FA 3B04A 4BQ3A 1SMDA 4DJEA 3EZ4A 2EQDA 1R3WA 4DBDA 1XJBA 3S3GA 3EB2A 3T7VA 7CGTA 3FEQA 3SJNA 5E5CA 1X6UA 5F2GA 1BXBA 2NXIA 2BVWA 2FGZA 4LFYA 3UWZA 4Q8OA 1K03A 4LC8A 4P2VA 2BLEA 1U1HA 4C6DA 2VFEA 1KM5A 1RQEA 2DY3A 1LQ2A 3TN4A 4XG1A 2EO7A 4HMDA 4IFKB 3GG0A 4GIEA 1XLGA 3EMQA 3KHDA 1EL3A 4ML4A 2P76A 3SDOA 1JRCA 3FYYA 3ONBA 4MUPA 2G4FA 3LHYA 4IXHA 1V6TA 3GR4A 4AIUA 1WOBA 1OINA 2VI0A 1S2CA 1XSIA 3CUZA 1MYRA 3TJLA 3BGGA 4XO7A 4UTWA 1A4MA 1E6PA 3DENA 2G3NA 1X8CA 1DJWA 3RRAA 3TZFA 3TMLA 3T4WA 1B3VA 2CLIA 1XIMA 1QI2A 4ZOEA 3C8NA 1R3VA 1AVAA 1MW2A 1Q5MA 3FJLA 4UB9A 1LLOA 1UBSA 3VIHA 4DWDA 3NQEA 2NQZA 1LROA 3R8HA 1RAKA 2QGYA 3NDOA 4UTKA 4EPKA 3SCPA 5A8MA 3W71A 4K8GA 3MDUA 3A6OA 4CD7A 1RUSA 1Q6EA 3UWVA 4XSMA 1W32A 1VYRA 3FA5A 2BB0A 1J5TA 2YL6A 3H2CA 5JBEA 3CHEA 3TTQA 3WUFA 1QW9A 3VE7A 4AW7A 3ZM8A 3UCDA 4GUIA 1EPVA 1ZP4A 4IIFA 1SGJA 1OG0A 3TJ4A 4F3HA 2BX7A 4JTAA 4OV9A 2MUCA 1DEDA 3VKAA 3T81A 5BROA 1K77A 3CC1A 3M9YA 1V5XA 3WQOA 1TCMA 3NQMA 1E4LA 4PODA 3P0XA 3WD0A 6REQA 5LZLA 1R9ZA 1OIMA 1X1OA 2QUVA 2PCEA 1TPWA 1WKDA 2I57A 3LPGA 3M5XA 4A35A 3CMFA 2HE8A 3G22A 1FHDA 4Q32A 1MXGA 5F2LA 3UWUA 1BSLA 1HTIA 3EB3A 5E9XA 3W1UA 1T96A 4JTEA 4ORMA 4J2PA 5FSEC 2AQOA 1NY1A 4KRUA 2CLMA 4EF9A 3MVTA 5FF2A 3ZXWA 3U6WA 3A9IA 2O9TA 3DFOA 1TZ7A 4Z42C 5C7VA 2VQUA 3QYQA 4AZBA 3KBWA 5DMNA 4CVUA 4H6EA 1EPXA 2CZVA 3GG1A 2Z6IA 2HS6A 1F6YA 3ZZ1A 2ZXDA 1ONWA 2D3NA 4ZO8A 5D33A 4FR1A 4MG4A 4IG2B 1P5BA 1K9FA 3LPPA 1O1HA 3MSYA 4AZIA 2H3BA 1SMAA 3QMTA 3NQCA 2ZZ6A 3ZVHA 3AYTA 1RR2A 4XZMX 3W72A 3VNMA 1BXNA 1EQPA 1DJYA 1TPDA 1VF8A 2QAPA 1L6YA 5HWNA 4FNSA 4B90A 5CC3A 3FEMA 3SR7A 2YCJA 4YMZA 1XLFA 3QOMA 1E70M 4B2DA 3LG3A 2HPIA 3TA6A 3CL8A 3SY1A 4JDBA 4JQ3A 4ICCX 2C7FA 4LYPA 3BK0A 3JVAA 4DPPA 4QDWA 1E6SM 2Y85A 3QFWA 1BG4A 2FZMA 4YVXA 2FMNA 2UZ9A 1YDNA 1O5XA 1QVBA 3B8SA 4MB4A 5TD4A 1EX1A 3R0UA 3F7JA 4QJ3B 1XRFA 2Z2UA 1BTCA 3N18A 4JHZA 1KLYA 4X0NA 3R58A 4FS9A 3A47A 3WH9A 2ZA1A 3D47A 4F48A 2CC0A 2AGTA 2PDPA 3GNPA 3PSVA 4M1BA 4LCRA 3DECA 1YKWA 2PDNA 3EWUA 1K7XA 2D2HA 2X1RA 3N17A 2O9RA 4DZ5A 4MDPA 3Q45A 1NIUA 3WNKA 4JTCA 3HPAA 5EMLA 1JCJA 6TIMA 3QY6A 3KBVA 3R13A 1KV5A 4NAFA 3QZ6A 2QUNA 4K8EA 4CUCA 4PMNA 2CBJA 3GQYA 5BWAA 1J2WA 1UCWA 1FWSA 2XM2A 3FSUA 3GAKA 4JQAA 1G4TA 3UW6A 1ME8A 2ZBTA 3QXBA 1EF2A 3VX1A 4WK9A 1NH6A 2AL2A 2NV9A 3RR1A 5A6LA 3G77A 4JX5A 3NQ8A 4Z1AA 2D0HA 1QWKA 4QAWA 1KFKA 3BZJA 2QMJA 4DF1A 1E43A 1DYSA 2GSHA 3DH7A 2V5KA 3S0CA 1EC9A 5REQA 1W9DM 2VX4A 1VBGA 3ZVHB 4C6EA 4UTTA 4Y96A 3NNTA 2IQ0A 1R5YA 4NHVA 2QW5A 3VZXA 1DTNA 3ABQA 3UR5A 3MV01 5G4WA 1WUEA 5HUOA 1OZQA 1XIFA 1RBAA 1BWLA 4RZ6A 3EXSA 4ATWA 1E0VA 2YW4A 3WQ8A 1CGYA 3MY9A 1VH7A 3ORWA 3VIFA 3RR4A 3GSMA 3QN3A 4QIUA 3BDKA 4P7LA 3NG3A 2JQXA 3P84A 4LAUA 5AHEA 4HU3A 1PZ1A 5M3WA 2X30A 3LX9A 1SJAA 4Z0SA 1X97A 1W1ZA 2BXYA 2DZBA 5EKYA 2GVJA 5CSYA 1TPB1 4X60A 3S2MA 3M6DA 1CGXA 1E3ZA 1B57A 5HWJA 3TCEA 3BLLA 5EBAA 2DJLA 2OEMA 4JEJA 2BHZA 2CITA 2J6XA 1QK2A 3L4XA 1JUBA 5EY5A 4DJDA 1HGYA 3W6MA 3VOFA 5KZMA 3LOTA 5JIPA 2A7PA 4LX4A 3O15A 3DHDA 4C5YA 3ZJKA 1H61A 4BJHA 1F6PA 5D03A 3CBWA 3VTRA 1BFNA 3GDBA 1A0CA 4DQWA 1S46A 4AD2A 1GQKA 2C14A 2V5JA 3UVAA 2ABAA 4IPIA 1C7SA 3C6CA 1TPH1 1VP5A 3KZSA 5E70A 3RLGA 2ZXBA 4H9MA 3PAOA 2DW7A 1YE6A 3HGJA 3G5EA 2W63A 3K4AA 1RV8A 2NV2A 4Q4OA 4AAJA 3FXGA 1UMLA 1IIHA 1IQ8A 1POKA 4CQAA 4X9SA 2FH8A 2O0TA 2ACUA 4DAIA 5BRPA 3HO8A 1E1CA 6A3HA 1QI5A 1CX9A 3AOFA 3PJTA 3ITGA 2Q8XA 3W38A 2QYGA 5JMUA 4IF2A 3CH9A 3WLTA 4UCGA 5D32A 2O4MA 3B9EA 4W8LA 2OZ0A 3O3RA 3POHA 3RO6A 3BW4A 2Y5EA 4G5DA 3SIMA 3EOSA 3CMJA 2Q8LA 5HNRA 2YJQA 1P1XA 3LTPA 4DRSA 1P7TB 2X0HA 1YDVA 3ITOA 4NF7A 5I3KA 3PJUA 1S2TA 1I6NA 3MI2A 1P43A 2VR2A 4ZEPA 1T6MA 2WM1A 2OZ8A 3GX9A 2PWVA 3OG3A 3QFEA 2Z7GA 4GD0A 1R47A 4UFIA 1KXQA 2FPYA 1IF2A 4KEZA 1TZZA 1Q6CA 3UYCA 4HNVA 4Q8MA 3U0HA 4HHPA 5C9XA 3OZOA 1MO0A 2XH7A 3EWCA 1Q4WA 1ISWA 5C7HA 4L1GA 3SUTA 5IBXC 4I7UA 3W76A 4GX9A 1EB3A 2POZA 3P0WA 5HMSA 2EF9A 4HPXA 3OYZA 1OF8A 4H9VA 2XVPA 5I24A 3ZT7A 2Q71A 3NWRA 1TMQA 1YQ2A 1M7PA 1ISZA 3WLQA 4Z1YA 2OMAA 4NL1A 4HPHA 2F6XA 3OVQA 3DFYA 4UOJA 4TOQA 1V0NA 2WVSA 3AUOA 3JZUA 3NURA 1PIIA 1XLBA 4EANA 1UR0A 3GXTA 1QASA 3WMCA 3ZO9A 4LBUA 1PIFA 1FWDC 3TSMA 4C60A 4XD3A 3L12A 3MP4A 5DQPA 1IEQA 4GI4A 5LSMA 3EKZA 4ADUA 2DEPA 3ZS4A 4QHRA 2YDRA 4IIDA 2WSKA 3GIQA 4LANA 3SB0A 4UIOA 3N04A 3B0UX 1UR1A 4JN8A 3LM7A 1U5VA 1ZALA 5DMLA 1J0IA 4FA3A 1D8CA 5AOUA 2NT0A 4A8LA 3N29A 3JRKA 3BUVA 6PTDA 3PWIA 4P8VA 1XG4A 4I5UA 4AISA 2QF7A 3WDQA 1HJUA 1MMFA 4D72A 1GOOA 1H7PA 1JULA 1Q65A 3LCGA 4UQ9A 2D2JA 3W81A 3VCNA 3VM5A 3VU2A 5BNKA 1OHLA 3WNPA 1FX6A 2VCBA 5AYZA 1AJZA 4LB4A 4HK5A 3NQGA 3RAOA 5AC5A 3A3XA 1GKPA 3J7HA 4AY8A 4FIRA 4H4IA 3F4DA 4F9JA 3RPTA 4H6QA 5BU9A 3EX2A 4YVVA 2OCZA 1H0GA 1H63A 3JZEA 2ZFAA 4H00A 1J79A 3NTYA 3TQPA 4IMCA 4R3UA 3THUA 3EDKA 4OWGA 2J9XA 2PWDA 3SRDA 5LYRA 4NX5A 5HWMA 4EXQA 1QW8A 3PUDA 1VIWA 3PUEA 4GI6A 1AODA 2BVYA 2E77A 2V3GA 3S1GA 1JYVA 3UXLA 1PKNA 1RD6A 1UC5A 3RPMA 3UG8A 2CHRA 2WKJA 4MY1A 2FVLA 3WG6A 1ONEA 5LA0A 1ZPTA 2E6FA 3LHVA 1PS9A 2E1WA 4F2TA 4ROPA 1QRQA 4D71A 1ZJBA 3KVKA 1BRLA 1HIZA 3BXWA 2DH2A 2YLAA 3RJYA 2B7QA 1JDDA 5HNNA 2RGMA 1JPKA 1UKSA 4L4MA 4YYCA 4RNFA 1G6CA 1I4NA 4AYSA 4C90A 4BEUA 3Q2DA 4GG9A 4A8IA 4GIAA 1J6OA 3CL7A 1V6VA 5C0QA 1LWJA 4M3PA 2ZX7A 4H7VA 2OELA 4UR8A 1F4AA 5HATA 3AXXA 4O1EA 2OEJA 2V9DA 1P4CA 1SO5A 1E3XA 4K2SA 2A3CA 4WY0A 1XYZA 3SN0A 2HTMA 3CXOA 4PEKA 1KFBA 1K4GA 4L1XA 3WMBA 4C6NA 4O4WA 1QMLA 4OOZA 1TUFA 3WQEA 3G3MA 2ICSA 3T8QA 4NJKA 3HTWA 4JL1A 4L1WA 5GJPA 2XVKA 4GK8A 3RK8A 1GT8A 4WKHA 4DIAA 2IPWA 3H2FA 1CPUA 3TTYA 1KGXA 1DXEA 4PFHA 1MW0A 2FGLA 1QFEA 3GTIA 1GEHA 3IIZA 2EKGA 3ZFHA 4ZQPA 4BCEA 1LLWA 4EWND 5H2ZA 2R1LA 5H8MA 2YA2A 4CCEA 4OUIA 1KD0A 2V2CA 3HA1A 3DKJA 4Q8UA 3BLIA 3NAVA 1LORA 1MFVA 4S3FA 5DF0A 5T91A 1HFBA 4XTDA 4HA1A 2Z1BA 4LB3A 3ITVA 1C9WA 3BV4A 4RXGA 4HVXA 4FR6A 3ARWA 3CAKA 2ALDA 3DAQA 2YZRA 1OFOA 4N02A 3B8DA 4M8UA 1L9WA 4FLOA 3TEVA 2HNHA 4B91A 1CYGA 1OFBA 1EQCA 2D24A 2PZ0A 2DP3A 3WL1A 4Y7EA 4AX6A 3BW2A 1ZBCA 4ZVJA 4WCJA 1P1MA 3WNOA 5A6SA 3P3BA 1H1NA 3INPA 4UZUA 4PRWA 3PUGA 4XZNX 5D09A 4JZ5A 4LNCA 3W23A 2NUWA 1UZDA 3AIVA 4DLFA 1Q3NA 2KAUC 4HTBA 3WYZA 1TWWA 3IGHX 4IJRA 1UWRA 3L4TA 3OHMB 4XAZA 4D6DA 2HNEA 3WD4A 3M0XA 2VEMA 1H51A 1MVYA 2NLYA 3EX1A 1OX4A 3TNBA 2ZUWA 1B0IA 1FP8A 1W56A 3W22A 3LCFA 5KTLA 1RLCL 2E5CA 5GNZA 2BVTA 1XLEA 3GS6A 3PPFA 1BYBA 5DCBA 2DZSA 1YYAA 4QRNA 1HUVA 3VE9A 4B3LA 1OABA 4HA0A 1JI2A 2OQYA 4UUIA 1MDLA 5KMYA 3G1XA 4AZCA 2VFGA 1TRDA 3OVPA 5E09A 4QGCA 5FEZA 1MNSA 2ASHA 1FWAC 2C6QA 5D38A 4LBRA 2CLLA 1Z42A 1K4HA 3TR2A 3PM6A 5LIWX 1NWRA 3JU2A 1A5MC 1SU5A 3UXAA 4NZ5A 4E0CA 1A3XA 2PWFA 2VZSA 3MC5A 3VZYA 3PZQA 2D2OA 1HT6A 3S2NA 4B5VA 1RBLA 1QNSA 1S2WA 3CZKA 3DCPA 1DIKA 4B16A 3W02A 3CNYA 2YB1A 3WLPA 1US2A 1A3WA 4GYPC 3ITCA 4J3TA 4PTNA 3NQAA 4RUBA 3G1AA 1UD4A 3NQ6A 1FDYA 2WOQA 5I3HA 3U4AA 4IIBA 2VGGA 3LCXA 2VFDA 1R9XA 3R11A 4C6MA 1US0A 4ZB5A 2QEZA 4UMBA 3NUKA 4G8TA 5E6YA 2I16A 2CKSA 4O18A 2XG9A 3WELA 1ZJIA 5D02A 3MUAA 4HHLA 3MI6A 3SCNA 4CU6A 1GKRA 1UH3A 1V0KA 1UKTA 5CKSA 1OX4B 3CUJA 3T44A 3I6EA 2XFRA 1XIIA 3HGRA 1EIBA 3C61A 3LU2A 2NVAA 3WQVA 2YLLA 4QEEA 2A3BA 1FCQA 4KFOA 2YXOA 4OE7A 1JG9A 4WEVX 1HNYA 3A4JA 3GFZA 4GO9A 2E68A 3RG6A 1BYCA 1EJRC 2QDDA 2DU2A 5DCDA 4AZCB 1G69A 1IHIA 5KEZA 3H4WA 3KOFA 2V5CA 4CNPA 4RE0A 4IPLA 1NF0A 5JQ9A 3MA8A 1D8WA 1QO5A 4FXSA 2ZRZA 1DE6A 3E0LA 4GYPA 3A9BA 4W93A 3FAWA 1J0YA 4TV5A 5DRIA 4FX8A 1F3WA 3N14A 3DKLA 5DEZA 1ZGDA 1UOKA 3L65A 1XYCA 2IS7A 2VX7A 2NUYA 3T78A 2QCGA 4F0RA 2A21A 1JCMP 3FA3A 3FK4A 4UQCA 3PSWA 3IUDA 2GGHA 3TN3A 1UYQA 2PBOA 2PLJA 2V0TA 4HMEA 1WBHA 1I9CB 2PDKA 4HYVA 1VFOA 4GC3A 4JYFA 2WV8A 1WAWA 4CNNA 3N4AA 3SW6A 5A8NA 2WMKA 2QJGA 2NUXA 1E4MM 4V1XA 3B05A 9RUBA 3ME3A 3Q37A 4LUIA 1AD4A 2AQWA 2ISDA 4GUJA 1I1WA 3LYEA 2H6RA 1GGOA 1JAKA 1AQHA 1JGIA 3I3DA 1S5VA 5AC4A 1W54A 5LNUA 3PVFA 1V7YA 3N1AA 5FL0A 1CBGA 1BEUA 2BHUA 1CTNA 1DIDA 1XBYA 2QDEA 1Z7AA 2VX5A 3ZVIA 3N34A 3K4WA 4AIEA 1R3YA 2V63A 2YZ5A 1O1ZA 1TIWA 7ODCA 2ZUNA 1EFZA 1OJXA 2OWWA 4JTHA 1QBBA 4FK9A 1Q2RA 1W0MA 3QR3A 3OG2A 4MLRA 2I5GA 4RX0A 3R43A 3LEPA 4DVOA 1G4PA 3BANA 3AIQA 3BARA 3DESA 1SJBA 1E5NA 3N2MA 4LPCA 1HJQA 3BJTA 5EU9A 2PB1A 3ZIZA 3M16A 3QV8A 1ECQA 3WNNA 4LS2A 1W1YA 3U5YA 4JOMA 4YU1A 5A6JA 3NOYA 1HKMA 2ZA3A 2VFHA 4JX4A 3OJGA 3WLJA 2E40A 4IPJA 4YTUA 1E9ZB 3B06A 3N13A 3ARTA 4I8DA 4A21A 5I78A 2PDMA 1S5NA 2DT1A 2FYMA 2R14A 4OOUA 2X2GA 2QMKA 5C2CA 2FHCA 2WC7A 3IVUA 1TV8A 4KRZA 3MI3A 3L7RA 4GINA 5KITA 5GPRA 3HFYA 1T8QA 3CAQA 1UG6A 1CXFA 3OW1A 1YRRA 1OSEA 4W8AA 3M5ZA 3AHXA 1QNQA 3KWSA 5J8LA 3P74A 4HQVA 3RX3A 3RRXA 4IL0A 5LNRA 1QDSA 1TJ2A 2XN0A 4MZ8A 4Z2GA 5BOOA 4KERA 2WHKA 4NASA 3VO0A 4M80A 1X6NA 4O1AA 2O92A 1JR1A 4HCLA 5T9BG 5I6SA 1FWGC 3RILA 1O7AA 2FQIA 4ACZA 4M5PA 3W7DA 3BAKA 5H6HA 2R9RA 3VFCA 3ANYA 3M7SA 3S9ZA 3L4YA 5EMUA 4H8HA 3EPNA 3W37A 4QS6A 5AKQA 3VDHA 3EA3A 3LSBA 3GDMA 1D3CA 4DO5A 2VO5A 4QS5A 2PLCA 2QCHA 4FXRA 4JL2A 4XTIA 1KQZA 1YXYA 3QBUA 1WP6A 1MXSA 4NJJA 1YE4A 4QBXA 2WSPA 1WBJA 1RP9A 2Y70A 3NO1A 3S8HA 3A24A 4S39A 1PAMA 3CAVA 2QPSA 4GVIA 4U4MA 2FTYA 3TX9A 1MEWA 3PY2A 2INEA 4KIEA 1UH4A 4CLMA 3CT7A 1T7LA 2A3HA 4N9BA 1H11A 4CD4A 1J96A 2I14A 1W9XA 4CCDA 2V68A 5FCZA 4GFIA 2JEQA 3BC9A 3WF3A 3P5YA 2P88A 2ZC1A 5AVNA 3C86A 1HO4A 1R0MA 4C1LA 3G2GA 5I3IA 4FOUA 1SO6A 3H2MA 2P8BA 1XXXA 3FSTA 2VWTA 3V4BA 3R79A 2CZFA 3LI0A 3UQNA 1LOQA 1UIPA 5IHRA 3WQWA 5DX7A 1KFEA 1H7OA 3FGCA 4Z2JA 3SZ8A 3GW3A 4LUYA 3WQGA 8XIMA 4W5ZA 4KF1A 4H9XA 1LOLA 2JIEA 4LUSA 5HQLA 5EB8A 3W7JA 4MB1A 3WDRA 1W2VA 3URBA 1DV7A 4P7QA 3H53A 4B4HA 4HU4A 2PFHA 1YXCA 4J35A 1UJQA 4NILA 3CYVA 3GM8A 2HSAA 5CBJA 4OIFA 3MO4A 2NSOA 3WLNA 5FKYA 1D3GA 4GX8A 3THCA 1RZMA 4ICMA 5AB3A 1SW3A 1BYDA 1KRMA 4YCOA 2WC4A 4AU0A 1QUMA 1YX1A 1GG1A 1W1A1 3QMSA 1AL7A 2A5HA 4N9CA 2ZZ5A 3AS1A 2A2IA 3FW6A 3WQPA 2W62A 1H09A 3E1F1 2Y0FA 1TPEA 3WLRA 3DG6A 5FF7A 3TE9A 2OYKA 1LT7A 2BGSA 1JZ2A 5I79A 4GC4A 1VRXA 1IWAA 3WF1A 4XKYA 1G4EA 1M03A 4JTKA 3Q67A 1KR0A 3H8AA 4RKAA 3LZ5A 5DXXA 5DELA 1US3A 2AMGA 4A8NA 4ILSA 3G1SA 4Y90A 9CGTA 3PPHA 4PGLA 4HJWA 4WOZA 2VC7A 1XIDA 3BE7A 4DF0A 1SZRA 5D2XA 2NQ9A 3SSZA 4KIRA 5K4XA 1F8MA 4H9UA 4QSFA 1UWSA 2HMCA 1X7IA 2R1MA 1OBAA 3IANA 4BQ2A 3AICA 2WXDM 5A6BA 2X05A 5KZDA 3VGBA 2GVEA 2H8XA 3VD3A 2DQXA 2JKAA 3BJSA 4AWUA 4EX4A 5M5DA 3MKCA 1BXCA 2P8CA 1IT8A 1TPFA 3MUXA 3RUBL 3N15A 1DL3A 1TUXA 3EB4A 1JYWA 4U3CA 2LLEA 1H5VA 3A21A 5EPDA 1JZ5A 1WAUA 1THFD 3MMDA 4UTLA 4GRSA 3VCRA 4JFTA 4B5WA 1XFBA 3LQLA 2VOTA 3P8JA 3HB9A 1PHQA 2BSLA 3ES7A 1Q6RA 1V8EA 3NQVA 1SZNA 4QTGA 4QQ3A 1OIFA 4O10A 2GQ3A 1PJ9A 3GG7A 1JXKA 1TV4A 3HU7A 2ZRXA 1XP3A 1J01A 1XBXA 1ECEA 1SJCA 2A1YA 4YNGA 4QEHA 1HF6A 3BMXA 3WN6A 2XINA 4GI9A 5AFDA 3BSGA 1JPDX 3MZ2A 1VEOA 1ZQ5A 3IK4A 4DBEA 1GVYA 4RZBA 1POJA 4TX8A 1HJSA 1J4EA 1YPIA 2C3ZA 3BGJA 3E0VA 3V16A 3IGXA 5EBUA 4C6JA 2FZ9A 4IGHA 3DI0A 1R2TA 1BPLB 1O94A 3T0BA 4DXKA 2Q8ZA 3S9IA 1DVJA 1IZJA 3BSHA 1S2UA 4JFUA 2GLKA 4IMAA 4MWAD 4PMVA 1QHZA 2Q01A 4AVNA 1UR9A 2ISSA 3H2OA 4RDYA 3COTA 3AS3A 1Y0EA 2Y7FA 3UWEA 1EOMA 1C92A 3BG3A 1NM9A 3RGTA 1U30A 2GK1B 2IW0A 1OF6A 2O9PA 2G96A 1CEOA 4YTSA 3CUHA 3W1MA 2VURA 2XZ7A 4LTSA 2F8QA 4GQGA 3TYUA 3AMLA 3A4XA 2ZZ2A 4Z08A 1W3JA 1TTIA 4KCVA 3WEZA 2BP1A 2VEPA 3KM8A 3KE0A 1WDQA 5HMFA 3IRDA 4CNOA 2P5NA 4H9YA 2IUZA 1NWSA 5E0CA 3W87A 1VCGA 2GJRA 1KB3A 4BI7A 1YPXA 2YBTA 4UMCA 3CT2A 4L61A 6TAAA 3NPUA 2D1ZA 2NSXA 4IMDA 1R38A 3OLDA 1H3GA 1WUFA 1QO2A 2PWGA 3RX2A 1PDZA 4PMQA 4K39A 1A5KC 3N6QA 2QDHA 1IEIA 5C9ZA 4AD4A 3KTSA 4B3KA 3P80A 1VHCA 3DEQA 3GHTA 2A79A 5D05A 3EX3A 3TN6A 5C9RA 1BF2A 5HR7A 2HPMA 4ZMGA 3B0YA 3LXCA 1J9YA 5C5YA 1L8PA 2CYGA 4GKLA 2PGRA 3VA8A 4J3VA 2OSXA 3W28A 1RJRA 3UXKA 2BMBA 1QXLA 2GGJA 4OUEA 1PV8A 1JPHA 2PDQA 1GW9A 2VM8A 4X0VA 2C0AA 3ABXA 2XUCA 4A05A 5CPOA 1UWTA 3PZ9A 3WK3A 2PDWA 4PB5A 1T41A 5EMYA 3AUJA 4O19A 3W1TA 2BOGX 3TQ0A 4KT2A 2Z28A 2WSYA 1EJ7L 2EPNA 3HQNA 1B9ZA 1P48A 1V3HA 3V0UA 3WD1A 4DUVA 3UBPC 3ARPA 1ONRA 1TJ1A 3OZYA 1AJ0A 3P6LA 4U2YA 1V02E 3C3NA 4I6VA 3QTGA 2ZADA 4ZENA 4L9XA 2AQVA 3KTXA 3M44A 2XIBA 1FXPA 3HG2A 3L9CA 3AU6A 5BMXA 2Y5JA 1E1EA 2WLZA 4QITA 1QI3A 4D6JA 2VUYA 5TNVA 1LF1A 4UTIA 3PWGA 1H49A 4DUXA 2KZHA 1JCNA 5HJXA 4J28A 4FO4A 3VD7A 4I7WA 4ACYA 5C71A 2JBMA 3B8WA 3O0KA 4DLMA 1S5TA 1UD3A 1Y5WA 2DGAA 1E51A 2DVUA 3W53A 1BVNP 1M6JA 2GJXA 3AMKA 4MPQA 1DJXA 1YNPA 2FVMA 3BW3A 3M6YA 2EGZA 1VEMA 2RGLA 2YL5A 3BL3A 4XX6A 2DSKA 4RNHA 1W1PA 1SO3A 3URNA 4ZGYA 1EJSC 2BOFX 3Q4DA 1XGEA 2ZYFA 2VEFA 5IFTA 2PUZA 1FH8A 3I6TA 3NVDA 2R91A 2X8RA 1UWQA 4Y9OA 1PKLA 3LXBA 4XQ6A 1VIZA 2QF8A 3VIIA 3R1ZA 3STGA 3F2CA 3N3TA 4JFVA 4NXSA 4X61A 1KBIA 5DY3A 4IMEA 1XIEA 1AZ1A 5C9WA 1Q8JA 1JEZA 2ZXQA 3BAIA 3BMWA 1MSSA 3OGSA 5DANA 3MYPA 3W84A 1OYCA 1W9BM 4PRTA 1UASA 1HVXA 3PUOA 1EGZA 2ZUSA 3LCIA 3SADA 4RW3A 3LB0A 1XISA 2QVHA 1C29A 1XIJA 4O0KA 4WQ6A 3P2VA 1G67A 4KFPA 2FPTA 3MCMA 3VZZA 3OEXA 1DPMA 1GVOA 4J3SA 4MYXA 2OKOA 3THAA 1HP4A 3MUY1 4H8VA 4ZE5A 2BG5A 1RD5A 2Z00A 1SFSA 5D9MA 4GNJA 4Q8QA 2CZEA 4K7VA 4XAFA 5EA9A 1B3OA 5EMKA 4N0RA 3KBJA 1E4NA 3OIHA 3WUGA 3BGAA 1XBZA 1TCDA 1WPCA 5XIAA 4FNPA 2NXGA 1EEXA 3W1RA 3NQ7A 1QT1A 3W7GA 4DY1A 1EJWC 3T08A 3TSBA 4RDVA 4WJEA 4JIHA 3CK5A 4DNHA 1W37A 5FJJA 3DFPA 3UT0A 5PTDA 2X42A 5LGXA 1FOBA 3O6CA 1PX3A 3T05A 5LHEA 1UC4A 4OGZA 3B8IA 4MVAA 3A13A 3CGTA 2A6NA 4HU0A 2WNNA 4TVDA 1UZ4A 2Z7KA 1G94A 5CJ5A 1UUOA 2CU0A 4IQEA 3GG8A 4NI3A 3THDA 2OO0A 5AECA 4C6QA 3G1YA 2VR4A 4GJ1A 1W9PA 4JDYA 1SM9A 4NRSA 1UD6A 4S2BA 1OFPA 1BD0A 3VC5A 1Z3NA 3QRHA 3VX0A 5C2GA 3AHTA 2IPFA 1UBPC 2W92A 3R2GA 3MBDA 1CGWA 2WBGA 5CZ0A 5A2AA 3HGOA 3GH4A 1HKIA 4DWSC 3Q94A 3WNMA 1R3SA 3CIVA 3PF3A 4LQ1A 4H04A 3MWCA 1U83A 2GUBA 1WDSA 4JIEA 3VMNA 2X1IA 2W4XA 1XC6A 2E8YA 4EK7A 1GYMA 4DI8A 1KQYA 3AYVA 1X98A 3PAJA 4PFMA 2OFJA 3KLKA 4W7UA 3TJXA 2J79A 1B31A 3W7EA 3AIRA 3LHZA 5D4YA 3P81A 4I90A 2CETA 1X96A 2WZEA 2C15A 1GHRA 3K30A 1PTGA 1ITQA 4HNNA 4WXYA 1LTDA 2NWRA 3LRMA 3FOKA 3GNDA 1H0IA 1ML1A 3KEHA 3CLMA 1H1ZA 1MUWA 1QOXA 4IFRA 3Q65A 1X1NA 4PUMA 4FLSA 4O4VA 4D8AA 1VJZA 3QMRA 1E71M 4MYAA 1K9DA 2YL9A 4LOCA 4GBUA 5CG7A 3GAYA 3FAXA 1UP3A 1BWVA 1S39A 4EE9A 3AHZA 4F0HA 4QNEA 3LGEA 4HIBA 2V5LA 2Z1VA 1WXYA 4IP5A 2OYMA 4QLKA 3NGFA 4TMCA 3PZIA 2EEXA 2X0SA 3GU2A 1DIEA 4BWLC 4OJYA 4ZXOA 4IICA 4MADA 5A8QA 3VGHA 3W88A 3VGFA 4AWEA 2VELA 5CC7A 2D23A 2YL8A 4DWSA 5ABFA 5I7GA 1ESWA 3WK0A 1J5SA 1E5JA 1UW9A 1YNYA 4IL2A 2V67A 1PZ0A 4B2DD 1Q7QA 1XQLA 1CB2A 2OZTA 2WJZA 3TTSA 5BWFA 2VL4A 2VRKA 2ZZ1A 3MMTA 3BQ5A 4GGBA 3BCDA 3H24A 2A3LA 4YWSA 2G50A 2ZX6A 1KKRA 3HGSA 1AH0A 2J24A 1XLJA 5FAGA 3GXFA 1W3KA 4Z1CA 4M19A 1YHTA 4C1NB 3OA5A 1FCBA 2GWGA 1LZOA 2PP1A 4ICNA 4KETA 5FJPA 2XN2A 1TREA 4YTTA 4QJ1A 3E74A 4CKQA 1V03A 3H7VA 5AHLA 3G24A 3IAPA 3GDTA 3SCRA 4X2RA 2FMOA 2ZCGA 2XH2A 4XD6A 3QR1A 1R6WA 4MGGA 3NEHA 4ZQNA 3F5KA 2JGQA 4A2SA 1FWWA 3AI0A 4E2BA 4WX2A 4CD5A 4N9DA 2PI6A 1TIMA 3LY0A 1G4SA 4MNJA 3TIMA 3GH7A 1OFRA 1PTDA 3GC4A 3NA8A 4US5D 3OLGA 2OX1A 3FFSA 5HOSA 4MKVA 4HHMA 2RJHA 4MTVA 1DWFM 5M1TA 4E4PA 1EO5A 2QV5A 1UHVA 2CHNA 3M5YA 4UFKA 1UB3A 4GACA 3FN9A 4KESA 4POCA 1A53A 2ABBA 1WDWA 2OX4A 2YDQA 5AY7A 1L6GA 2I5QA 3ID7A 3MO7A 3SQMA 2BOEX 3AYRA 4JIPA 3SIZA 3M07A 3BQ6A 2WZIA 4GZJA 4B92A 3SN1A 3VYLA 2QHAA 5HPCA 2EJAA 3UA4A 2J88A 4FX7A 3CIWA 4L9YA 3IACA 1XINA 3H26A 4PUUA 4DPQA 4NU7A 1IXQA 3GWQA 1IZKA 1FHUA 2QJJA 5JIWA 1KXTA 2W61A 1PXGA 1REQB 4Q7NA 1F6KA 3M4HA 2V5BA 5A3HA 1YTKA 4L6OA 3AYSA 3N6JA 3PPCA 3OBAA 3QLDA 4HT3A 5CSRA 1CDGA 3D3AA 3M0MA 2OLHA 5G4EA 3VKJA 3UG3A 2XIIA 4RDZA 3AMGA 1OB0A 1PB0A 3VKCA 1MRAA 2G95A 3IJIA 2Q3RA 1GORA 3TP4A 2B7NA 3W7OA 2PDXA 6ALDA 5LNWA 2Z0IA 3MJYA 3DI1A 1LRQA 4S3GA 4D1JA 2G97A 3KWXA 3L4ZA 2HWGA 4ZFMA 4LGXA 4DJDD 2HZGA 1I2QA 3C2FA 1WKEA 5A2CA 5M17A 3UVIA 4KH2A 4JIRA 4PEEA 3UR2A 1GEQA 4JNYA 3FDGA 1QCWA 3CLWA 1GOXA 3MKVA 2WSQA 4UFLA 3E3HA 4Y9MA 3W26A 4IQDA 1OEPA 1H7XA 1TQJA 2VC5A 4GYKA 2PODA 1D7KA 4NIRA 3ITYA 3WENA 3PN8A 4AVOA 3W4RA 4WDWA 3W7PA 1ICSA 5DO8A 3T42A 1IT7A 1CECA 3V5FA 3N2OA 3WJWA 2WPBA 2WCSA 2IPGA 5XIMA 3R8GA 4O57A 1KBBA 3ICJA 5I3GA 1U5JA 3BJFA 3OB8A 1EA0A 3W1LA 3T40A 3HG4A 4GY0A 1W3LA 2J27A 3U7VA 2VENA 1F3TA 1GOIA 2P3ZA 3UXDA 3GFYA 4NRRA 2ZVIA 3WDHA 4Z1BA 3UY7A 1RQBA 3PBWA 3K13A 2FFIA 4DHGA 2VFFA 1Q45A 1HKJA 1LWHA 2YW3A 3G3DA 4RZ4A 1AMKA 3C0QA 3TSDA 2E67A 3JUGA 3R10A 1D9EA 1HZYA 7REQA 3HQOA 4LY8A 2CWXA 1QHOA 4C1KA 1MUCA 1GQJA 4UTHA 1C8YA 4H19A 2FDSA 3WKZA 5DT7A 1M1BA 2C0HA 3CEPA 4A8RA 1H62A 2VCAA 1JRBA 2YBVA 1PBGA 5MHBA 4M7SA 4W88A 1C91A 2NVCA 4XZBA 4BQ5A 4RZ5A 1VPXA 2PDUA 2YA1A 1W31A 3GKFA 5KSWA 2XTKA 1A49A 3T6CA 4MM1A 3KBNA 2CHOA 3SCTA 2OQLA 4JHMA 4HYWA 3GYEA 3ALFA 2QCDB 1BAGA 2PMQA 4FX6M 4JTIA 3IEBA 2DSVA 2DT0A 2O55A 2VDHA 5F2MA 3HFTA 2WHMA 4WHBA 5IFPA 1QU4A 3OP2A 3UY8A 1ZY9A 2FZDA 3PFRA 4HB7A 5G2IA 3W7IA 4PTXA 1VJSA 4B15A 2PU1A 3C0LA 4G7EB 2X1SA 1W17A 4DYEA 3FKRA 1HJVA 4KEVA 3T0AA 4AHQA 1R3QA 2J9YA 3RO8A 1S2AA 1I0DA 3LV5A 1F9CA 2P50A 2ZWYA 4W89A 2R82A 4Y9PA 1F74A 1Q4NX 3N9RA 5DXYA 1MQPA 1YNQA 2G4JA 4O11A 4E2VA 3WFAA 3AAMA 4KCUA 4ZQRA 1LDCA 4PCTA 1R7OA 1NQKA 1LRTA 2QIWA 4NZ4A 1J0JA 3DFTA 4D9PA 1J18A 2DV0A 1MWOA 4O52A 2W66A 1CLKA 3EXRA 4FNQA 2ACRA 3IJ8A 1EUAA 1GZJA 1GUVA 2VFIA 4PCFA 4MJ2A 4GCAA 4KWOA 5LA1A 2WPGA 1K8ZA 4PUKA 3RCMA 4HSOA 4C6CA 3KX6A 3F2BA 3QM3A 3VNLA 4XWUA 1QPQA 4OZOA 1M7OA 4KFNA 2J7BA 4TO8A 4CU8A 5AC6A 1UR4A 4IFOA 1ZAIA 3NO3A 2XU2A 3UJ2A 2CPUA 1XDLA 3BG9A 3W0KA 4LEFA 3MVIA 3OOQA 1KTBA 4DJEC 1BVWA 3KDNA 4UTFA 1NFBA 4BEQA 4K36A 3DYPA 3PZNA 1CXEA 3KW3A 3ARZA 1TSIA 1TR1A 4GJJA 4PTMA 3G0UA 3IGUA 1PEZA 1Q6QA 3V18A 1RQHA 3DG7A 1WA3A 1JDEA 5FF4A 5GQBA 1W8SA 4Z2KA 3LBCA 3SBFA 3VUPA 4J40A 3N25A 2YSWA 3GBDA 1S3HA 2DZAA 3WFLA 2PC4A 2TYSA 2WVUA 1WKYA 3IWPA 3WD2A 1PE1A 3RMJA 3U2CA 1P6CA 1XLHA 1X8FA 4YIWA 3WCZA 1XR2A 3U57A 3GXIA 5AZ1A 3SCWA 1O68A 2HBXA 2ZXAA 5HUPA 3S5ZA 1N8IA 1W9UA 4S3AA 3KBSA 3WQ5A 6XIAA 1K70A 4IXXA 1MXDA 3H22A 2PF8A 4DZHA 2GWNA 1ELSA 4S38A 3W73A 4YHGA 3G1RA 3WY1A 5AHNA 1NQ6A 4DO4A 4UTUA 1K7FA 4J7RA 5CH9A 4LU0A 1N55A 4CVWA 4S1FA 4UTWC 1LYXA 4HMNA 1XCXA 1NOUA 1AQ0A 1P0EA 3RYSA 5J5DA 4YTQA 4FPSA 4D2JA 1RPKA 4WR3A 5LIYX 2E6AA 2OKTA 4Y9AA 1RALA 4CN6A 3DERA 3N4EA 2V38A 1ZU8A 1JD9A 3GTNA 3KL3A 1CIUA 2EKCA 1VAHA 5FJTA 2VVNA 4K68A 2PDLA 1E0TA 1I45A 4FIQA 1D7FA 3OTRA 1ME7A 3DG3A 1AG1O 4OBTA 1WXJA 4OT7A 3OVRA 4GVHA 3W7KA 4H7ZA 4H6RA 2CZ5A 2EG8A 3W24A 1GVIA 1GOKA 3WK2A 4MNMA 2QUUA 2XSAA 3QLLA 3ZYZA 2VKZG 4RLIA 3WMSA 4KGJA 4AD0A 2OJPA 3QSRA 1VGAA 2A7RA 4PUEA 2EAWA 2OZ3A 1U5HA 2CERA 4KGLA 4O1CA 1UKOA 4FNRA 1KNWA 2C91A 1E6QM 2CLEA 1PCKA 4QG6A 1W8GA 1XKYA 1ZCOA 4S3JA 5CLWA 3CH0A 1Y5XA 3VNYA 4UQAA 4QX4A 3VOCA 4Z2HA 4UFMA 4URIA 4Q33A 4AY1A 4EAYA 3PANA 1F76A 3EKLA 2Z24A 3QV9A 3KP1A 4AD5A 5TIMA 4GVGA 3LHUA 3TTEA 3WEMA 3BVJA 4JYEA 4P7RA 3N73A 1CCWB 3C2EA 1XWYA 1VR6A 4NZFA 3H7RA 1RY0A 3TC6A 2B4GA 5BU6A 3SCVA 3WSUA 3CTLA 5CCZA 4QLJA 1GTEA 1NARA 1Y8BA 3VFLA 1SSDA 1QHPA 3ZLGA 4TVCA 1Z41A 4LVGA 3NSMA 1BKHA 3WLHA 2Y8UA 4C6PA 4FXJA 3F4CA 4GYFA 1JF5A 2O4QA 1N8FA 5DCEA 3UR8A 2IMRA 3O6AA 3QQ0A 3SUUA 5C54A 4H1ZA 3A64A 3DUGA 1F07A 1V6WA 3LERA 4HZ8A 1SPQA 1PHWA 4AUBA 4HZMA 2GGEA 5CEWA 1B54A 4JGDA 4JY8A 5BXSA 1H50A 4WGXA 4ATDA 1KM6A 2DJXA 3H2AA 1KBKA 1OZMA 5ABHA 1FWRA 3S42A 3SRKA 1I0BA 2EJ1A 2AAAA 3SCQA 1FXQA 1TPVA 1A5AA 4H2HA 3D0CA 3UGRA 4ONVA 4L65A 1TB3A 2GQAA 1TPC1 3K8KA 1J11A 5D04C 2GL5A 5IDZA 4F0SA 4IZGA 1AW2A 2G3JA 3TW7A 5CXPA 4O16A 1BLIA 3O6DA 4RE4A 3CHFA 2DT3A 1SFJA 2Z2AA 5DBUA 3HPXA 3TK7A 1X6LA 3WIJA 2BVDA 1ITXA 2CNCA 3EYPA 1HG3A 4I9MA 1MDRA 1K3UA 2BXZA 5JBDA 1XDJA 2DVTA 5EMMA 3TOPA 4ZOBA 4S23A 2J25A 1EHNA 1EXBA 2F2KA 1DXFA 5FEWA 4J9JA 1GKQA 3NDYA 4R7WA 2WMIA 5AYYA 4HPNA 2Z1SA 3PPGA 2IKGA 4QNWA 3EA2A 1A80A 4V33A 2Z1XA 4E3TA 5K2ZA 2A4AA 4KWSA 3IJDA 3O06A 5I02A 3CO8A 1OFQA 2NXHA 4IQLA 1Q2SA 1VLWA 5IHSA 2VWSA 1RY8A 4JQ1A 4WDUA 3W2MA 4XUGA 3KVLA 5B80A 3M5VA 3K8LA 1M53A 3PB2A 2MANA 3EMZA 2P10A 3VNKA 5I5RA 3TDFA 2VDGA 3N2TA 3FIGA 4CEUC 2YXGA 5HQMA 4W5UA 4XV0A 3LPFA 4B4FA 3UF9A 2CWNA 2PZNA 4TUFA 4DN1A 4M0XA 3QZAA 3LCHA 3KFTA 2Y7DA 4EIVA 3VDCA 1O5QA 2OWCA 2Q3OA 3WJYA 3OU8A 1UWAA 3DGRA 1FUYA 4HYRA 2WCAA 3WQFA 2OT0A 5FACA 3URQA 3MCNA 2FJUB 4JQ4A 3MUIA 1T40A 5F7UA 2PTXA 4C6KA 1FFQA 2FFCA 2UY5A 4EF8A 5CJNA 4UTTC 1TA3A 2CBVA 3REQA 1VKFA 3UJFA 1EJUC 1UZHA 2E0PA 1O66A 3SAZA 3QPZA 3B8VA 2GUYA 1V3IA 3CZ8A 6REQB 3KRSA 1PX4A 4YL2A 5E93A 4AZGA 4ECLA 3E38A 3EOEA 5FL1A 1WXZA 3PG9A 4ZQOA 3SUWA 1YPFA 3O05A 3RPDA 1J12A 4M7TA 5H1WA 1E40A 1EJTC 3ZJ6A 3MBFA 3R0DA 3TJIA 1IR1A 2E8ZA 5CPNA 3SJ3A 1ZENA 4I9TA 4MKSA 4NYUA 5G2HA 3SECA 1KM4A 4CQ9A 5CZSA 3VIKA 4C7FA 1VBUA 2J8GA 1B3ZA 2C18A 3P8IA 4DJDC 1ZHAA 2H8ZA 4GIYA 3T0TA 3P67A 1P0BA 1O4UA 4O1DA 1EWEA 1P0DA 4RL3A 4D6FA 3ITLA 3NL6A 4EPEC 3C2OA 3W6YA 2PRHA 3W01A 4AB4A 3NO5A 5BMWA 1JVNA 2IQTA 1AMYA 1ZLPA 2QXWA 3GR7A 2EPHA 1WZLA 2QZRA 4ZO9A 4ADSA 2E25A 4TMBA 2F2HA 4J3ZA 1TQXA 3HOJA 3LPOA 4XAGA 1QATA 4M29A 1ZSXA 4GO8A 5FD0A 2Z4GA 5LNSA 4Y8EA 5LHFA 2DH3A 3KZPA 1E6ZA 2R1NA 1BG9A 3CZLA 4EPBC 1IGSA 1JYXA 4B5NA 2PD9A 2ACQA 1H5YA 9XIMA 3LMYA 1L0PA 3BZGA 3LN3A 3WJSA 3CPGA 3S47A 1UA7A 4F2UA 3CASA 2NV1A 1OD8A 3BAWA 3QVQA 1NFPA 3RHGA 3TXVA 1TA3B 4G2DA 1JD7A 1FRBA 3M0JA 2BY3A 3ABZA 1VYSX 4L5ZA 3PFMA 3H7UA 4UTMA 5LIXX 4GXWA 5D9NA 5JH2A 4KMQA 1OGGA 4AZHA 2XVLA 2VRJA 3VMOA 4XB3A 1GZ1A 1SYTA 4LALA 3CQIA 2XJ7A 4CCZA 3VNDA 5FSDC 3QQ1A 5L6UA 1GTHA 5B7ZA 2ZKMX 3GDLA 3LD5A 4LYQA 4QCEA 1DJGA 1G7UA 2WKGA 5U4NA 3CUFA 4LAZA 5HJLA 1YW1A 4X3ZA 1KCZA 3CPUA 1RHCA 3R0KA 2QT3A 1QOPA 4A29A 1E6NA 4R5EA 3EDDA 4NAFB 2GJPA 1AJ2A 4WF7A 3NOEA 1VEPA 2CBIA 4H83A 1F61A 1RSCA 3WH8A 1NOFA 4HSHA 4D6CA 2WJFA 3R94A 3UD6A 2BGNE 2VNCA 4D6IA 2AL2B 4LXFA 3LLFA 4A3UA 2D69A 3SCUA 4JTTA 1XI3A 4LUTA 4JTUA 1AH3A 1I2RA 3IJQA 3XINA 1TV3A 4M81A 4DZAA 1F3XA 5DT5A 3L67A 3NQDA 3QY8A 5REQB 5FF0A 3W2UA 4U5IA 2ZDSA 3CS2A 2TRSA 2J4GA 4X22A 1DWIM 3CHCA 4S3BA 5FJUA 4R7OA 4GMEA 2VZTA 4YXGA 4PTDA 4GHRA 5CGQA 4AXKA 3B0XA 1V93A 3MSDA 3WDIA 3WUBA 1DJNA 3MMUA 1CXIA 5BZAA 3I7SA 3ARVA 3PR2A 5F1VA 1QR7A 4O8RA 3VOJA 1XSJA 3BICA 4FNUA 2WMFA 2BHYA 2PAJA 1DQXA 3DGBA 4Q8TA 1JDAA 1R86A 3OLEA 3A5VA 3CIXA 2YKKA 4R33A 1XYFA 5CSSA 4CD8A 4PB3A 4J2MA 2BASA 1JCYA 1BGGA 2YOCA 1B30A 4MJ4A 4KCWA 3RF9A 1YDYA 3BOLA 3NZQA 2OQHA 4A3RA 5BRQA 3G18A 3UWYA 2XWEA 4RCXA 3WBAA 1KCXA 3IJ9A 3PJXA 5I00A 3UP8A 2V3FA 3BSMA 1LG1A 1SZEA 4NQ1A 4DO7A 2DIEA 1OY0A 3V5CA 2C19A 4QSHA 1W1B1 3PBMA 1HQTA 1RXOB 3ATZA 4EKJA 3UJEA 4IJCA 1Y5VA 1L2UA 4GYJA 3MYOA 4QDMA 2XH0A 1SR0A 5AYXA 4JCMA 4DX3A 1QNOA 1FWCC 2OU4A 3C52A 4U2ZA 1GVEA 1ITCA 1KCLA 3S5OA 1IZCA 2P0IA 2V2DA 4PL1A 1GHSA 2VQTA 2JKPA 4ZZ9A 3TW9A 1JCTA 2Z29A 5KZEA 3S2CA 1VFFA 1NVMA 1WX0A 4LUTB 2ZRYA 1RBOB 4E5TA 1B90A 4BF7A 2YBUA 4XD5A 1E1CB 1EJVC 2A3EA 2D20A 2QCNA 2F7FA 1K9EA 2O7QA 2R1KA 3QZEA 4AXNA 1OT2A 1VC4A 3QPYA 4C6BA 1FHVA 4ALDA 1ZFJA 4NX0A 2BY0A 1HO1A 3P7YA 2WHLA 1IWBA 4ROQA 1NWUA 3ONCA 3MSGA 1PPIA 3C3UA 4E8GA 2NX1A 2Q09A 3IIPA 3W27A 3WEOA 3IPWA 4L4OA 1GW1A 1W3HA 3CU2A 2WNQA 1XDMA 1KWKA 2DSZA 3A12A 5A2BA 3GNOA 3GRIA 3RNDA 2AOSA 4XKMA 2D0FA 2WWDA 5HJYA 1Q6GA 3CV6A 4IIHA 3VCCA 3GC5A 3OBEA 3KS6A 4GISA 3E02A 1CW2A 3T9PA 2A6LA 3ANVA 5F1UA 2WZTA 4C6LA 2DVXA 4WGHA 3LCLA 4W84A 1CNVA 1K02A 1H4PA 1QNVA 2XFFA 1TTPA 1LWIA 3OPSA 4C6OA 2WWCA 1UROA 1NDYA 4AIBA 1ZBWA 4WOQA 4RE3A 4DI9A 3T8LA 3UFYA 4O14A 3CUXA 1M7XA 5DMMA 1MQRA 2NLIA 2WNZA 5C70A 4W9TA 3H21A 3L2LA 1XC4A 1W5MA 4H2CA 1HL2A 3S4TA 3P14A 5E0KA 3TFXA 3IUHA 4XSLA 3WLKX 1B3WA 1Z48A 2MNRA 3I65A 5CC5A 2QPUA 2VEIA 4DUWA 3KOZA 3ITTA 1L8NA 4IX0A 4B5XA 1EDTA 2GQ8A 2JF7A 2OOFA 4AWTA 2QV4A 3M0ZA 1XSKA 3FNDA 2QCLA 5JH1A 4MJZA 2PDCA 1P0KA 3TKFA 3ZSSA 2XGIA 2DFAA 2WVVA 2PTYA 3M0VA 1D2KA 4M82A 1N7KA 1EIXA 3MHUA 1OX6A 2ZVRA 1FWBC 3FHQA 3VD9A 4BFAA 4Y9NA 3R12A 2JEPA 3C4UA 1AA1B 2OB3A 1S3TC 3UEQA 3NL3A 3AIEA 4GOAA 1FQ0A 3AXMA 4IJBA 1WDDA 3O63A 1BYAA 3S1XA 5HAOA 4JIQA 3VOIA 4EOUA 4DJFC 3NXLA 4I9JA 3CUIA 3VD4A 3BO9A 5J5RA 5AHMA 1KFCA 4ML9A 4MY9A 5LNVA 1FH9A 2PDHA 4Q4RA 3S5NA 4BHYA 3TYBA 2PLKA 3QHNA 1V02A 4REQA 3VNJA 1JXJA 3G0XA 2V3DA 3NL2A 3TOYA 3G6LA 1ZP3A 1PYFA 4NNBA 2GSJA 4GH3A 3WBWA 1XRVA 4P8WA 5DMYA 3GZ3A 1V08A 3E96A 4KKXA 3BAXA 5HR6A 1XLCA 3TWAA 4WDTA 4AWSA 4GWEA 1VJIA 1AK5A 1ISVA 5F4SA 4DEFA 3P5ZA 2XHYA 3SGGA 4RR4A 4AHOA 4CQBA 4GCXA 3GNRA 3F4WA 2VP8A 4K8HA 4DBSA 1KR1A 3B40A 3S1UA 3VGEA 1YBQA 2IXUA 1A5CA 3OLIA 5I23A 1V0MA 3NCOA 1GJWA 4LNYA 1TVPA 3TYDA 2ATSA 2XISA 1UUMA 1BRLB 4UR7A 2GSEA 3UNTA 1XV8A 4ORIA 1Q7MA 1B5TA 3SGUA 2RFGA 3DHFA 1ICPA 1O60A 1Y7VA 3PBUA 3MUCA 1H7RA 2B81A 8A3HA 3BCJA 1OQFA 3AC0A 4LYRA 4LVAA 3KAOA 3UA3A 1U1JA 2HV5A 3M0IA 1R46A 3CAWA 3PB0A 3TLQA 4WY0B 4DJFA 8CGTA 5D2TA 4BS0A 3I68A 1QJWA 1GOQA 3EPOA 3KL0A 1HVQA 3NM3A 2Z6JA 1XBVA 3HIJA 3B97A 1WV2A 3LA4A 4XZHA 1WCGA 3NJ3A 3MP5A 4PMZA 3C56A 1NF7A 1NU5A 2FZNA 4RE2A 5HA7A 1F8IA 3EOLA 2PDYA 1P6WA 1WNOA 3KTCA 2FLIA 3I6RA 3B03A 4HPGA 5A5WA 3EMCA 1HX0A 1OX5A 5A8GA 4O53A 3RLHA 3IIVA 2BY2A 4JXCA 1LQ0A 2PRLA 1QOQA 1GYNA 2WCGA 3OODA 4GUHA 1EHAA 2A7NA 2Y62A 4GE8A 3PZUA 3L0NA 1R2SA 4PL2A 2PD5A 3PS7A 1CGTA 3H70A 4C6IA 2VVSA 1I60A 4QJ5B 1R8LA 3BCFA 4XIAA 3TAKA 1S1RA 2QULA 3CZGA 2B0MA 1PO9A 4GQQA 5D37A 1E0XA 3FX4A 1GVFA 2GGIA 1YBQB 4H7CA 3TA9A 4H8NA 1W1TA 3S83A 3O6YX 1GJPA 3EWZA 2GOUA 1XL9A 4F79A 3KDOA 4XZIA 3EX6A 2QPXA 2AKMA 3CV1A 4JQ2A 6ENLA 3E12A 2J78A 4FNTA 3S1VA 4YHEA 2Y7EA 1YDOA 4IIGA 3MHGA 5EYWA 3RN6A 3BTNA 1UPPA 1F5ZA 2HK0A 4AZ5A 2X2YA 2R24A 2A85A 2QUMA 4KWWA 4A6GA 1XG3A 1I1XA 1XYBA 2PA6A 3TXZA 4N6EA 1ZL1A 2Y4SA 4ZQMA 2PCQA 2RAGA 3O0FA 1QW7A 5G1TA 1A47A 1F05A 3LHWA 4E3VA 2Z26A 3TROA 4HOZA 3GU1A 1AL8A 2Z2BA 5HINA 4KCTA 4PMXA 3BOFA 2O7SA 5T8GA 3WBYA 2ZUMA 2V5DA 2JE8A 2I5IA 4HJFA 1JUKA 3MJMA 3L0KA 4HCDA 2IKJA 3VINA 4ERIA 4Q4MA 2Y1HA 4UWMA 4BZYA 5J04A 3NFUA 4WY0F 4FSAA 3VAVA 4C6FA 1IEVA 2YX0A 1TX2A 1YTEA 3PBVA 5BXPA 1EYEA 4QR6A 4NVTA 4O12A 5HDRA 1TTJA 1KC7A 4IWWA 2CLKA 4ZQCA 1QBAA 1CT5A 1NDZA 4U33A 3KBMA 5FF3A 3S5SA 3H55A 4WRHA 5A8PA 4LVBA 2OSWA 4FF7A 4GY7A 4LS0A 1H60A 3UGVA 1UMYA 3KVJA 1SFTA 3APTA 4W8BA 5M03A 3LCWA 1DP0A 3DN5A 3M43A 5JVLA 4V15A 4N7QA 3NPXA 4MZYA 2E5BA 1H7WA 2YIHA 2INZA 4NY2A 2HCVA 2DPEA 4J3XA 4HGXA 2X09A 3SFKA 4E6MA 2GFTA 1J0ZA 3CB3A 1SFLA 4X63A 4IG2A 4PB4A 5GJNA 1VFUA 3ANUA 4IP4A 4IHCA 1H7NA 2GDQA 3O8AA 2ZUTA 1JCXA 1ZNNA 4YLWA 2SFPA 3UETA 2Q02A 4H01A 1HKKA 1W6TA 4OU1A 4G56A 2EPMX 1W5QA 1OFDA 2WO5A 3PBYA 1G5AA 1ICQA 3QSTA 4BA0A 1NELA 3BLDA 3ARUA 2VJXA 3LK6A 1OADA 3IRSA 3UU0A 4JYDA 4O54A 3GDKA 2J8TA 1E9YB 2IPJA 1LL4A 3MPGA 5BXTA 3HV8A 3NPVA 4MDOA 4PE8A 1KBLA 1RA5A 2OGJA 3CJPA 1SW0A 3V75A 2J6VA 4WJ8A 1X7FA 3ZSTA 1XIHA 4YJ5A 4ADTA 3IV8A 5I09A 1EOKA 3TCSA 3TN5A 2C79A 2TAAA 3QV6A 2NW0A 1VB9A 1OC7A 3GXDA 1XRTA 1QPOA 1Z9AA 4J4KA 3WNLA 1V6YA 4O15A 1A5BA 2DUAA 3TUUA 1LOSA 4RXFA 3E2VA 3A4WA 2J7FA 3QGVA 1G9HA 2HISA 4O1BA 5H8UA 3N2XA 3PNZA