4NAEB

Pcrb from geobacillus kaustophilus, with bound g1p
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
227
structure length
215
Chain Sequence
b'MEEIRAWRHVFKLDPIDDERLERLCESGTDAVIVGDNVLDLLARIRRFSVPCALEVTDVLTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQYGDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYSGVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALATVAAVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase
total genus 76
structure length 215
sequence length 227
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 4naeB00
3VKDA 4NAEB 3W00A 2F6UA 3VZXA 3VZYA 2F6XA 3W02A 3VKCA 4NAFB 3VKAA 4NAEA 4JEJA 3VKBA 4NAFA 4MM1A 1VIZA 3VK5A 3W01A 3VZZA
chains in the Genus database with same CATH superfamily
3DKJA 1IIHA 1RD5A 4R3UA 3W00A 3RYSA 4DO6A 4YYFA 3NURA 2FDSA 5G5IA 3WEMA 1AZ1A 3NQGA 4PODA 2AQVA 4KCVA 1WAUA 3WL0A 2J77A 4EACA 5A6LA 4UTWA 4DO5A 2BVYA 1UZ1A 3LHYA 1UW9A 3AROA 2VZTA 4GA8A 4A05A 3UJRA 1ALDA 2V5LA 3B9EA 1BVZA 1U5JA 3MSGA 4S38A 5I0DA 1LRNA 1NWUA 4N42A 3WMLA 1DQUA 4RXFA 3NQBA 5M3WA 1W9XA 3HBLA 4W4QA 1LT8A 2VEIA 4YNGA 4U4MA 2EXOA 3ONCA 3UWZA 1GG0A 4JAWA 4H6QA 3R0KA 3PHAA 3TQ0A 1ZS2A 1HX0A 3PZQA 1Q85A 3AIWA 4FXFA 2EPHA 1XDLA 3VU2A 3ANYA 3NXLA 1CXLA 4ZL1A 1XKJA 1X1OA 3CH0A 3BCJA 1BXCA 2ZZ6A 1VQTA 2J88A 2BV9A 4LALA 3XISA 3EA3A 4MGGA 1XGEA 3WH9A 1WDPA 1VENA 2BZNA 1NARA 3PAOA 4TIMA 4F3HA 1KLYA 1H1YA 3ZVIA 1OINA 3L4XA 3G8RA 4Z2HA 1ME8A 4NJIA 2V63A 3P6LA 1UWTA 1BYDA 3QOKA 4X0VA 3STPA 4NJKA 3T7VA 3MI6A 1FHLA 2QCLA 1TQJA 4TX6A 3KOWA 3DFSA 2CXGA 2ZTKA 4MNLA 4M5PA 3ZT6A 3BG9A 1UWSA 4AIEA 1XIBA 2PLMA 4N9DA 1VRXA 1Q6EA 3EB2A 1W32A 1TE1A 2PZ0A 4DM2A 3EWCA 4JN8A 4B2DA 2V5BA 4F0SA 3L4TA 4CNSA 4UOQA 2FKPA 3CASA 3UESA 4D1JA 3M0HA 5EMJA 4DWSD 4PFMA 3SQSA 1FBAA 4OUEA 2HPIA 3UXKA 4OKDA 3GNNA 4UCFA 4HMEA 5I23A 3NM1A 1K3UA 3LXAA 4DF1A 2EG8A 1K6WA 1F8MA 4IMDA 2E77A 3WH7A 1RBAA 1FH7A 4HA0A 4JIEA 4JTUA 3SCOA 1WAWA 3WQ4A 5LA1A 3PWIA 1OZQA 4KWVA 1XF0A 5CC3A 3QSRA 4HA3A 3IGXA 3WMBA 3UWYA 1ZCCA 2NUXA 1GNXA 2IMRA 3NQ8A 3Q65A 4QHRA 1EJTC 2PA6A 3ALGA 4CKQA 3GVWA 5D02A 1XQLA 2PDYA 3PULA 2E67A 4HB7A 1A5MC 1XYFA 3VTRA 3GAKA 4UB9A 3TMLA 4AZ6A 3USZA 4L80A 1GZJA 3NM3A 1QNQA 1TVNA 4J28A 4B5SA 5CPSA 1W5MA 3RILA 3E49A 3CV1A 4O57A 2NXHA 3S6OA 1HF6A 1W8SA 2QJNA 3NO3A 4XBSA 4MJ4A 3BAKA 1VFUA 2CERA 3EKLA 3RGTA 1QNRA 3A3HA 4O17A 3EB4A 3DYOA 1YBQB 4E8DA 3VD7A 3GUWA 3IJQA 4A3QA 2D0GA 4WY0B 1F07A 2DZXA 4PB3A 1J93A 3BMVA 4O1AA 4ECLA 1VCGA 4WGXA 1H4PA 3SUUA 1QPQA 1PPIA 3WNMA 5F1VA 3V4BA 5DMLA 4AEOA 3MBFA 3EX6A 1W9DM 5EMMA 3IK2A 1Q6LA 2INZA 1YDNA 4MWAC 2VUNA 3VD5A 4K3ZA 3SGZA 2AKZA 1JPKA 2YCLA 2ZDRA 3B04A 2OYLA 3NQVA 4P8VA 1H7RA 2XSBA 3EX4A 4NYUA 1JZ2A 3UQNA 1RP9A 3LPOA 1E9LA 1ZAHA 3SZ8A 4MZ1A 1JGMA 1OY0A 1VEPA 4Z1BA 2G5WA 4KWOA 3GYEA 3RU8X 4F79A 4X61A 3VDCA 1S2TA 1XPYA 4KIRA 2R1NA 2OSWA 3VOGA 1J5SA 2J62A 2PU0A 3N19B 5A8PA 3MUY1 1B2YA 4PMVA 3S6DA 2R94A 2Z27A 1QASA 5CJMA 1UJPA 4CVUA 4W88A 3EXTA 3SN1A 2VEPA 1XIDA 3ZR5A 3PY2A 1O5XA 3G77A 2E6FA 1TV3A 1E0UA 1I8JA 1CECA 2HE5A 1D9EA 2GK1A 1V6VA 2J8GA 3TZNA 1LT7A 4M29A 1HKKA 3NWRA 3TN4A 2TODA 5I3GA 3MQTA 3A3XA 4N7QA 2FVKA 2WC7A 4HTYA 4MUPA 2DT1A 3H4XA 4HP5A 4URIA 4PTNA 1R3YA 1SZNA 2VL4A 4NZFA 3VI2A 3WLPA 2FHFA 3BLOA 5I02A 5BCAA 3LD5A 2BP1A 1SPQA 1FCVA 3SGUA 2OB3A 2WMKA 2G3JA 3LCGA 4AVFA 2WANA 1YNQA 3LCHA 4JYDA 4DJED 2VDIA 3GNPA 3IK4A 5I6SA 1AK5A 5C9WA 1TCDA 4Q8VA 5IHSA 1HKMA 5CBJA 4FR1A 1LLZA 3FSUA 3C0SA 3WLHA 4B90A 1RD6A 3FYYA 3L2LA 1U83A 4LUTA 4DZAA 5IRPA 3NQCA 3RJYA 1UASA 2PGRA 3MCOA 4MKVA 2XDFA 3S9IA 3EWWA 3P62A 4AXNA 1GYMA 2NQ9A 3W29A 2XGIA 1SO6A 3B9OA 3LV6A 1P0DA 2J8FA 2YCEA 3BW4A 1FWSA 4GXMA 2J79A 3A5VA 4ZXLA 2V68A 3IIPA 2P0IA 4BJHA 1PHQA 1A5AA 1PE1A 1P0BA 3M07A 2ZC1A 1XDJA 4BEUA 3GU9A 3ARPA 5HPOA 1SVDA 5DLCA 5HATA 2VT0A 3N12A 3WBYA 5DCDA 3CUZA 2VQUA 3GR7A 4A8RA 3EAUA 5HINA 5D33A 4O1CA 3H2CA 4P7RA 4PE8A 3VIKA 3BGAA 5FAGA 3SUWA 3EOLA 1DP0A 3SEPA 4DUVA 5AC7A 5A6SA 4NL1A 3S1UA 4NY2A 1JDCA 2YBUA 1SO3A 2FGBA 3D46A 3UJFA 1GKPA 3LS9A 1VEOA 1S5MA 3IGSA 3S2NA 3AYTA 4R7WA 1PKNA 4JFTA 4V27A 4P7LA 3K46A 3AWOA 1TJPA 4BF5A 2B7OA 2QJIA 1BAGA 4KFPA 1LOLA 6REQA 3GHRA 3VCNA 3UG3A 2YFNA 4UFLA 3DENA 3LQGA 3ABRA 4ORMA 1H09A 3L5MA 1EC8A 2O56A 3BANA 3N2TA 3QV7A 5EBUA 2KZHA 3P14A 4AB4A 2Y24A 4PMOA 4L4MA 3KZPA 1IT7A 3S6TA 4AH7A 3G1AA 1OFPA 2HISA 3PBUA 2CESA 4AX7A 5HOSA 4WX2A 2C7FA 3VC5A 2CPUA 4XO6A 1E51A 1S2UA 2J9XA 2YKKA 4Q22A 1V6UA 1OD8A 4KKXA 2CETA 3Q2DA 5IFTA 1B3VA 4K6AA 3B8WA 8XIAA 1WNOA 3C2OA 1TPC1 4K8HA 3M0KA 4L9ZA 3WK0A 2V6AA 3C56A 4PCTA 3GU1A 5BW6A 1YPXA 1XLLA 4TO8A 5TBOA 3BWWA 1V6XA 4GYKA 1RALA 3M0VA 2FVMA 3WD4A 1KCXA 1Q66A 1WX0A 3LYEA 2ESCA 3PTKA 5I3HA 3QOMA 4I5UA 4PH6A 4P7QA 2ZZ7A 1MI3A 3SURA 2CLMA 1XYLA 4AC7C 3S47A 1J5TA 1GOMA 4ADTA 2G3FA 3OODA 4ATDA 2OEJA 3FNDA 3BXWA 4J9JA 3GHUA 2G0WA 1UD3A 4WIWA 1H7OA 2VVSA 4OT7A 1DYSA 4RW5A 2WPBA 4TVUA 1L6WA 3GK0A 3WNPA 1AA1B 4DVOA 1VLWA 3WUBA 1YADA 5JXQA 1YDOA 1OCQA 4WF7A 2YCLB 3T44A 4TVCA 5LZLA 4IPNB 1SMAA 5CLWA 3ENLA 5AHNA 2OCZA 1SYTA 3D3AA 2GQ9A 1QRQA 3MUZ1 3GKFA 1PKLA 1V02A 1Y5WA 4QG8A 4MDPA 4Q8QA 3DC0A 3NZQA 2XIMA 2Y7FA 3F4VA 4MADA 4CQAA 3OJGA 2XG9A 3WYZA 4FHAA 3W70A 1ZLPA 4IPJA 4KS0A 5BWAA 3W9ZA 5FA5A 5I09A 2Z25A 5CJ5A 3VIGA 4IT1A 2NXGA 2B7NA 4NNCA 1JCYA 4YL2A 2INEA 1OFAA 1XLAA 2ZX9A 5CPMA 3HTWA 1MXDA 4JQAA 1MFVA 3CAVA 3DFOA 3PANA 2FHBA 5CGTA 3AYRA 3TTOA 2QCMA 2GK1B 4TV6A 1XUUA 3UY7A 4NZCA 3SCQA 4GVHA 3WQVA 4L4OA 4Q4PA 5HK4A 5BWFA 4LS0A 5TAOA 1JEZA 4O1BA 4E4FA 3WDIA 4OU1A 1EP3A 2ZX7A 3UY8A 3THUA 3AC0A 1VJIA 4Q8MA 3CUXA 2VDGA 1WYIA 1JUKA 5EMKA 3MDUA 1W1B1 1KKOA 3KBJA 3GXTA 1KR0A 3KBWA 4GYPA 1VH7A 1W2VA 2GUUA 1JPIA 4W84A 3I7QA 3PBWA 1DJNA 1GG1A 1DJWA 4CQ9A 5HAOA 2PDLA 4LVAA 1LROA 3TLQA 3NQEA 3V36A 2Q8LA 3PTDA 4O28A 4D6GA 2FQIA 5A3HA 4N0RA 3CNYA 4P7NA 2DIKA 5T9CE 2C15A 1FWNA 3OGVA 4ZFCA 2ZCGA 4KEVA 3V18A 2QGHA 1WCGA 3H23A 3DFHA 4GO8A 1ICSA 3QV6A 2BSLA 1Y0EA 3LI0A 1DQXA 5IOBA 2NUYA 1EOMA 2BHYA 5I77A 2NWSA 3CUHA 4Y90A 4S3DA 4YTTA 4M82A 5M2FX 4ICNA 1C93A 3WFLA 4X3ZA 2FJKA 4D6EA 1J0YA 4LAUA 1SJDA 4B91A 1MDLA 1FCUA 3KE0A 2Z2BA 2ZRYA 4A3UA 1Q6RA 1SZGA 5FKYA 3VOHA 4IMAA 5EMYA 1X39A 1RBLA 1XFBA 4MY1A 1XSIA 5HJLA 1U1UA 1DKWA 2VRJA 3KFTA 1RP8A 3GH4A 1X7IA 3E6EA 4ATLA 3C3NA 2TSYA 1J6OA 2NVDA 3STEA 4Z2KA 5KITA 3HG2A 2WSRA 1E70M 3VM5A 2IQDA 3BV7A 3EKGA 1PEZA 1LG1A 1EB3A 2VXNA 4RZ6A 5A94A 1X97A 4O19A 2PSNA 1AG1O 3ZVHA 4IP4A 2VKZG 4DYEA 1TV4A 1YEYA 2OZTA 2OU4A 3KRSA 1F05A 3G1SA 3ZT7A 1MRQA 3R10A 2P88A 2J7BA 4C6CA 1XSKA 3O05A 6REQB 5IBXC 1EC9A 4IICA 1K9TA 3PVFA 3A4JA 3IGUA 1ITUA 5AHFA 1XIMA 4BI7A 5LKYA 1NP0A 4IF2A 1E71M 1A5LC 2QJHA 3WJYA 3EGJA 1SW7A 4Y6GA 1A5OC 3HZ3A 3CQJA 4MUZA 3I6RA 3T6CA 1MQRA 2C1GA 3H2AA 1SMDA 2GUYA 3P60A 4HMCA 2QDHA 4BR1A 5I03A 2BXZA 3TC6A 4WLCA 2HK1A 1E43A 3E02A 4JYEA 1HUVA 3DDMA 5BMXA 3IIXA 1VBUA 3N6QA 4PUMA 2OG9A 1GOWA 2RUSA 4FLSA 1CI1A 3BSGA 1CWYA 2VEGA 2FH8A 4GQ0A 1HP4A 4JTQA 3THAA 1M6JA 3MTWA 1TUXA 1CGUA 2VFFA 2HROA 1CGYA 1TPH1 1EL3A 4A29A 4I9JA 3M7WA 5BMWA 4F0RA 1FFQA 3C2YA 4F2BA 3WNKA 4LV9A 4QDMA 1WOBA 3QTGA 2BHZA 4X9SA 3UNDA 1BHGA 2NZLA 2PP1A 1IZKA 3TQKA 4MLJA 1P0EA 1ISYA 2O9TA 3PZOA 1V3MA 1RZMA 2H9AA 2GUBA 4C6DA 3KS6A 1UBPC 3M5VA 4WCJA 3LUTA 1YTEA 1KRMA 4IJCA 3W7CA 1QI5A 4QP0A 3CIVA 1US2A 5E70A 2ABBA 4E4UA 3OLIA 1V3KA 5F4SA 2NW0A 1P7TA 2RHGA 3AMGA 4J3ZA 2X16A 4Y7EA 5C5YA 3UPMA 3ATZA 1DJHA 3KP0A 2PDFA 3CV6A 4R9OA 3IUDA 4LB3A 1ZSXA 3VKBA 3WL1A 4LRSA 3HGOA 3A24A 2FVLA 1UROA 2ATSA 5ECVA 5D9NA 4DXVA 4L9XA 1XLHA 3MKKA 1QOXA 2VFIA 1G4EA 5BU9A 1A5SA 1D3CA 4XK2A 2EKGA 8XIMA 3FY1A 3WQGA 3TQPA 1RR2A 2HS8A 4E2BA 3WLSA 2WZHA 1TR1A 1UBSA 4UTLA 3CPRA 4K2SA 3L65A 3DZ1A 4X2RA 4H9ZA 1ITXA 3I65A 3LNMA 1OYBA 4D8AA 3ITGA 4S39A 2E68A 4D6DA 4JBRA 1G1YA 1HZYA 4DWDA 2ACQA 1RK6A 2CLLA 4Q8PA 6XIMA 1KFBA 4NYYA 3UJ2A 3WCZA 1OGSA 4PB5A 3H54A 4JX4A 3F5KA 1GKRA 2BLEA 2BBFA 2DT3A 2INFA 3OW1A 4JL1A 4M24A 3KCJA 1EUNA 3H2MA 2DSZA 1L6FA 2P53A 1CT5A 4FMVA 2FPTA 4WUIA 4J35A 1TJ2A 3SI9A 4LBSA 2DFAA 3TFXA 1XG4A 3DIPA 4PBFA 2IXUA 1H61A 3WH8A 4R85A 5MKGA 1R2TA 2H6RA 1IGWA 1XYZA 1MNZA 2D0HA 3C2VA 3VAVA 3R0UA 3I6TA 4PUDA 2HNEA 4C6MA 3I7SA 4ALDA 1KTBA 3GUGA 5AC8A 3B0VC 1TX2A 1ZBCA 1ZB5A 4RZ5A 1EZWA 3RITA 5SWUA 1N7KA 3CZLA 3KXQA 4HSOA 1GQJA 1BG9A 3KM8A 4PTVA 1F9CA 3HV9A 4K1WA 1LBLA 1UD4A 3QRHA 3N4AA 1OZMA 2CWXA 4FNTA 4UBPC 3QHNA 3WELA 5HQLA 3TONA 7REQA 1VYPX 1OYCA 2GVYA 3R0DA 1E6NA 2G4FA 3L2MA 4JD4A 1PZ2A 4AD3A 3DG6A 1O5KA 2X40A 4H7ZA 3W87A 5JU6A 4NZ1A 1C9DA 4MLRA 1B3XA 1O66A 3OVGA 1LQ2A 2PLKA 2G95A 4I7WA 1A5CA 4QEEA 4GI6A 5HBFA 3KZSA 2QCHA 3VIFA 1JGIA 2DW7A 3FXGA 3RCNA 5AY7A 2A2IA 5ENLA 3M0YA 5H1WA 3QKZA 1MVYA 3ZVHB 4XZ9A 3MVTA 4IG2A 1S5WA 2ACRA 3S9ZA 1MW1A 3T81A 3IAPA 4Y9MA 4XZBA 2C79A 3P3BA 2FMOA 4W8BA 3LSBA 1XKYA 2C0AA 4AW7A 4XZWA 3LENA 4CU7A 4HPGA 1VIWA 1RCXB 3HGJA 4O14A 4Q8TA 4MKNA 4LS1A 5A5WA 4Q4QA 1QOPA 2Y5EA 4PB4A 1MQPA 2XISA 3ECQA 3UA3A 4B5NA 4GQRA 3R4IA 1XWYA 3RUBL 3S46A 4XAPA 3DHDA 1V0NA 2J7FA 2V8ZA 1EDQA 4M6QA 1Q2RA 3PBMA 4Z42C 4IJRA 4IIGA 5XIAA 2BGSA 3W37A 1XD1A 2F8QA 2XVNA 1LWHA 3G1RA 3M41A 2IW0A 1W9BM 3LHVA 3A12A 4DO7A 2XFYA 2C18A 3VKAA 3S1XA 1B3WA 1UR2A 2E40A 4M3PA 2BODX 2XVGA 3UXIA 2PDKA 2X0SA 3L0GA 4HZMA 1S2WA 2G3IA 1MW3A 1IHIA 5FEXA 4BQ5A 3OLDA 3BCFA 4FAMA 2QUTA 2ZFAA 5AFDA 2PDHA 1POKA 4O12A 3HQPA 4MTVA 3STFA 5FF7A 1EXBA 3UCQA 1ME9A 4S2CA 3W3OA 4FZIA 1QWGA 4US6A 1F7BA 4W7UA 2JK2A 1QTWA 3QMRA 3SCWA 3TYCA 2FTPA 2H9AB 5LIWX 2XN2A 1XD0A 4CVWA 2ACUA 1T5AA 3INPA 3GFXA 2H3BA 4DNHA 3BSHA 3EMCA 1UR1A 4PCSA 4RKAA 3PNUA 3ABSA 3WKZA 1KWKA 2ZDSA 1XYAA 4UOJA 1AZ2A 1RSCA 1DJYA 2Y1HA 2W3ZA 1OBAA 1E0TA 1F4HA 5F2LA 2DT2A 3MHFA 4D6JA 1K7EA 1SR9A 4KH2A 2D24A 1OCJA 1QPOA 1VGAA 1FRBA 2VX6A 5CSSA 4MFDA 1TA3A 2AGKA 3TC3A 1NSJA 1TG7A 3L4WA 4UTFA 2EG7A 1HJVA 1KTNA 4MYXA 2V3FA 4WDUA 4LAZA 2TRSA 2Z1BA 4EXBA 3MMWA 4HK7A 4KEUA 2PP0A 2CHRA 2EO7A 3U48A 2ZZ4A 4RZ4A 1AW1A 3VE7A 1DWAM 1XL9A 1LOQA 3GX9A 2PLJA 1QOQA 1UA3A 2XZ9A 3TYZA 2YXGA 2DVTA 3W1LA 3WMCA 1H3GA 3NSXA 1SUXA 3ABZA 3DFQA 2DV0A 1Q65A 2Z2UA 3W7HA 4B3LA 3VVGA 5ABEA 3LLFA 4M56A 4A8LA 1K8XA 1TIMA 4A3RA 1R87A 2PGWA 2BHUA 2QVHA 1QXLA 4JY9A 2GJLA 1EJVC 3R2GA 3B0UX 2FFIA 3UWWA 5A69A 2W92A 4N4PA 2DEPA 4Q4SA 1J9YA 1P1MA 2EQDA 2GDVA 1B30A 1KXVA 4DQWA 1BYAA 5E93A 1D3GA 1I0BA 3PZTA 4NXKA 3H2FA 1LLWA 4ZQPA 2YR1A 7PTDA 1YDYA 3MUCA 1WDRA 2FTWA 3RLGA 3VILA 1QO2A 4KGJA 3CIWA 4DLMA 2XM2A 1S46A 3QSTA 4JXCA 3PN8A 2ZRWA 3W7RA 3LA4A 1MW2A 5MKGB 1JZ8A 5C8BB 3EX1A 4UZSA 4XZLX 4AYGA 3THDA 3G1DA 3POCA 1PCKA 1GPWA 4DI9A 2VFDA 3PAJA 4I6VA 1EZ2A 3NA8A 1VLIA 1IF2A 1BYBA 1OYAA 5I07A 4O1EA 1CGVA 3FA4A 5F2IA 4RNHA 1M7XA 1R8LA 2V38A 3W1AA 4AZ7A 5A8QA 3QVQA 3R6IA 1UPPA 3VXGA 4EXQA 2IQ0A 3H7VA 3K2GA 4ADUA 3Q67A 4H6EA 3L2IA 1PCWA 3W23A 2X0YA 3FA3A 2F84A 1KV5A 3I3DA 1GVRA 1QPNA 3W1RA 4LH8A 1HKJA 3KTXA 4UWMA 3PFRA 5DT5A 3T55A 7REQB 3E0LA 1ENUA 3QY8A 2P8BA 4KMQA 2RAGA 4M6UA 3AIUA 4GE8A 4LOCA 1W3TA 3FDGA 4O1DA 3UXLA 4A6GA 1GKQA 4QJ5B 4NP7A 1V02E 2OODA 1TZ9A 4TUFA 1SFLA 4UR7A 3A3WA 3UWQA 1S3HA 3VKCA 3ELFA 4LS2A 4W7WA 4GBUA 4UQAA 4G7EA 2YX0A 4GGBA 2RDXA 1U1HA 2WC4A 4GKLA 3OG3A 4REQA 3T4WA 5CC6A 1AJ0A 5AZ0A 4DPQA 3W7NA 3IIZA 3B9NA 3UWEA 4IG2B 5TNVA 1W5NA 2ABAA 5AYZA 1XINA 3W7IA 4EXAA 4W89A 1C8QA 3F4DA 5KSWA 4XUYA 5HXMA 5KINA 1PSCA 3MCMA 4OIFA 1DV7A 3GZAA 2JE8A 1PTGA 3FCPA 1H1NA 4GX8A 2WLZA 3TEVA 1QNSA 3UD6A 1P6BA 5C70A 3MUXA 2O92A 2VGIA 1DWIM 3D47A 4CNTA 4DWSA 4AY8A 4M19A 3R43A 3VNYA 2X1RA 4GH1A 2PWHA 3AZSA 4IMEA 4J3TA 3CQ0A 3ZR6A 2GOUA 4CNOA 2IKHA 3T08A 4IP7A 1QW9A 2WWDA 3BG5A 1OGGA 3W7MA 5IFPA 2DPEA 3RLVA 4GISA 5HWNA 3P81A 4G1KA 5FD0A 3W88A 1B3YA 2ZRXA 2CLPA 3GDTA 4JIHA 1WB0A 4LB4A 2F6UA 1WE5A 4XKYA 2OZ0A 3PUDA 2XIBA 3VGGA 2ZVRA 1GYLA 2X2GA 3W2MA 5LXEA 1WXZA 3CAKA 4X22A 1GOOA 1VS1A 2PDQA 3H4GA 1XSJA 4NU7A 3VIPA 2NV2A 3BLKA 2PWDA 4G7FA 4B5WA 1XQKA 4F9JA 1TV5A 5CSRA 4JFSA 3VMOA 3UWVA 1QHZA 3WQ5A 3UJEA 9RUBA 7CGTA 1B5TA 4LAMA 1FWRA 3WH5A 3WLOA 1CNVA 3DEQA 1OIMA 2SFPA 2E5DA 5CZTA 4JNMA 3MSDA 4O52A 1Q2SA 3FN9A 1V4YA 3TOYA 3GYCA 1SM9A 2QUVA 4NVTA 2ADAA 1UD8A 5DEZA 3KHJA 2WXDM 1KXHA 3DYMA 4FXJA 3GFYA 4Q4OA 4C6NA 1ZNNA 4J3UA 3LSCA 4ZOEA 3BLIA 2YW4A 1KBBA 4FOKA 1XH1A 2FPVA 4LX4A 4GYJA 5HQMA 2VVNA 3TK7A 4DAIA 4H83A 2CZDA 1TA3B 1XDMA 1G67A 2GVEA 5K9DA 2OJPA 3C2FA 2E1WA 3PR2A 2FZDA 3NDYA 2GLKA 5C9XA 2F2HA 2OSYA 1BXNA 1OFDA 5HPCA 1GORA 5AKQA 3T8QA 3A9IA 1UKOA 1XCFA 2H8XA 3S2LA 4DYJA 1RCOB 1JYWA 2HCVA 1QUMA 2AL2A 4AVOA 3WENA 1XLGA 1Y5VA 4GUGA 2CHOA 2Y2WA 1OF8A 3WBEA 1OD0A 3UZXA 3I3BA 2YDSA 1ICQA 4Q33A 1LYXA 3KP1A 1BYCA 3UR5A 2JGYA 1M01A 2X1UA 2FIQA 4XV0A 3FA5A 3FGCA 3LHZA 1E9YB 4U2YA 2E28A 5HMSA 3SECA 2XWDA 5A2CA 4D71A 1WKDA 5CPQA 4L4LA 2Z1SA 4QAIA 1QVBA 5AVNA 2DORA 5LNRA 2WKGA 1VKFA 5HUPA 4D6IA 3RIKA 3TYUA 1FA2A 3M7SA 1CX9A 1C7TA 4OTKA 3FXYA 3RM9A 4DJDA 2DGAA 3NQDA 1X98A 2ISWA 2Q01A 2QVNA 5JQ9A 4HHPA 1HJSA 4MB4A 5FI8A 3WFZA 2ZUNA 4OECA 3V3WA 5G2HA 4B5UA 1X7FA 3RCYA 3KOXA 4I7VA 4B3ZA 3ZS4A 3TAOA 1UP0A 4LEFA 1T7LA 3H55A 1N8IA 3SFKA 2NQHA 1A4LA 3VUPA 4AX6A 3LBCA 1JVNA 1KGWA 3GU2A 4LY4A 1GQKA 1DWJM 1PVNA 4K38A 3KDNA 5G1TA 4CUCA 2QULA 3GNOA 1P48A 1W3JA 3FIGA 3GXMA 1AL8A 3N04A 4HVXA 1KM4A 4PMYA 3W1NA 1A50A 4FR6A 3UG4A 1Z44A 1Q4NX 4QE1A 5KMYA 3QBUA 1S2VA 3LBMA 4J27A 3VYLA 5MF5A 3VIMA 3APTA 8A3HA 1RXOB 4JTKA 3PP7A 2F9RA 1L2UA 1NY1A 3EOEA 3MB9A 4V2XA 4YTRA 2XVKA 1J0HA 5DCBA 1W1PA 4JN7A 2J7DA 1N55A 3O8AA 1F2JA 2PTXA 3PJUA 1WBHA 1ZPTA 4DUWA 4F2UA 2AMGA 1EYEA 5C7VA 4E8GA 1ZY9A 3OB8A 1H11A 4XBJA 3WUEA 3CO4A 3ATYA 3URBA 4WSKA 4FLRA 6CGTA 2XH2A 1CGTA 4ZOCA 4O8AA 1NDWA 2WSQA 4G7EB 2BY1A 5CZ0A 4GBDA 3C3UA 3TCEA 2IQTA 4ACZA 1J79A 1JCLA 4RV8A 2O4MA 4REQB 1QHPA 1UC5A 1XLBA 3PPCA 4W8AA 3WJZA 1SJBA 4H4IA 4DRSA 5HNRA 1FDJA 3EMZA 4IQJA 3QN3A 1JCMP 1BQCA 1VBHA 3W7EA 3SCVA 4QQUA 1A0CA 1WO2A 4O50A 3AZTA 1XLKA 3IVSA 2PDIA 1UMYA 1NU5A 1MYRA 2HPMA 1EJSC 3BW2A 1C9WA 2Z29A 1NQKA 4L1WA 4WKAA 3R13A 1BF2A 1JDDA 4M1BA 1H41A 5GPRA 3EWZA 5JIWA 3TP4A 2PMQA 3WX7A 2FLIA 3A5FA 3PUEA 3QZEA 3P8IA 4DWSB 3QQWA 2WNQA 5KZDA 2B7PA 3K8LA 4QEHA 1E0VA 5FF0A 5HR7A 3SCPA 5GNYA 1EQCA 3NGFA 2BOFX 3SM0A 2WVUA 5EFDA 1J2WA 4NHVA 3WY1A 3AIVA 4C5YA 2PBOA 3P0WA 4H6RA 3IJ8A 1VCVA 3K4WA 4O10A 2KX9A 1IZJA 2QT3A 1ADSA 4XKYB 3RK8A 2VCAA 3O2LA 2X2YA 2PURA 3M0JA 4IL2A 2BY0A 2IPJA 1UP2A 1DHPA 1PS9A 3XINA 1SW0A 1H50A 4D1IA 4OQVA 3TUUA 3LGEA 2YGYA 4H7CA 3B06A 2RDTA 4KERA 4DBEA 4XD4A 4D72A 3N2XA 3MSYA 3NSMA 1JULA 2GWNA 4JZ5A 4J1OA 3KEHA 4M1RA 3GDBA 1JPDX 3H4WA 1U2YA 1KRBC 2YFOA 3M1ZA 2QAPA 2GSEA 3G1XA 1A3XA 4BF7A 2NQJA 3UXDA 1I2QA 3A9BA 5FCZA 5CZJA 4AFYA 4PMUA 2NT1A 3W53A 1UCWA 2W91A 5A6TC 2E8ZA 4Z0JA 3WN6A 3L4ZA 3SR7A 2OEKA 2MUCA 1EOKA 1PYFA 4N6EA 1MDRA 3FKRA 4KFOA 2P76A 1J10A 3BL3A 3OVRA 2BXYA 4XTDA 3VMPA 3PZUA 3TJ4A 4AWEA 3WQEA 1BEUA 2D0FA 4S3JA 3ITLA 1QT1A 4AD5A 5BNKA 4QSHA 1YW1A 3TYEA 1C8VA 5ABHA 2YW3A 4H2CA 2UY3A 1E55A 1F3XA 3THCA 4MB3A 1PYMA 4CN4A 4D8ZA 3AIEA 2VGGA 1PIIA 1NJJA 4GY1A 2NX3A 4XIAA 1PTAA 2AL2B 2Q8ZA 3LLXA 4PMZA 4WK9A 3RO6A 4UC5A 1TWSA 1PZ1A 3SCNA 3GDMA 2P0OA 3GIQA 4H01A 2XFFA 4WQ6A 3S5SA 7TAAA 2R1KA 3R11A 5AHEA 4HD5A 2V30A 1OGBA 3EPNA 2FZBA 3TIMA 1EJXC 4KQNA 5DQPA 1NWRA 3S2CA 1E6QM 4QG9A 2BY3A 5JH2A 4C6FA 3LLDA 3OU8A 2ZA2A 2V67A 4WOZA 3NZPA 4PRRA 1KQYA 5E5CA 2W4XA 3VX0A 4P61A 4HCDA 4LU0A 4MWAA 3KOZA 3KCOA 4Y9PA 1FCQA 5EKYA 1VYSX 4EPDC 5TQLA 1ONEA 1DJZA 1Q4WA 1AMYA 1R7OA 2QZRA 4GH3A 5CC5A 2RKXA 5A8OA 3W7KA 5AYBA 1XJBA 2YB4A 4FX6M 1I2RA 2HBXA 4CQCA 3KVMA 3QZ6A 1JUBA 4ZO6A 3SBFA 1R7AA 3G3MA 2DZBA 3M0IA 1X96A 4UTJA 1K9DA 3QEZA 4DXKA 4S3EA 1KD0A 4BQ3A 4DPPA 1A0EA 2FGZA 3I3EA 4PMRA 2VX7A 4HZ7A 2Y70A 2ALDA 3GLCA 3MC5A 1DIDA 3G2GA 3DGBA 4PTDA 4AYSA 1G9HA 1UR8A 4UQEA 3W02A 3KCLA 2QDDA 3KW3A 2IS7A 4BZYA 1G94A 2CKSA 3SIZA 4TV5A 1W9UA 3VDBA 3D6NA 1PBGA 5H8PA 1L0PA 2JEQA 1NTHA 4D9PA 3GDLA 3FLUA 2Z7KA 4KCWA 2PBGA 3O16A 3E2RA 4PUJA 3F03K 1UQZA 1JCNA 3OYXA 2GDQA 4TOQA 4AMCA 1H62A 3OLEA 2WVSA 4L1GA 1Z6KA 2I14A 4MPQA 4HN4A 1EHNA 1UZHA 3VM7A 3W73A 1TZZA 3BZGA 1WUEA 1KCLA 2ZXBA 3CQKA 3GD6A 2QCDA 2WMIA 4S3KA 1OM0A 1Y8BA 4M80A 4YTSA 2Y88A 3PBYA 1WXYA 3AMCA 3AZRA 3MKVA 3L5AA 3S2JA 3R5EA 3AU6A 1FP9A 3UGRA 5DMMA 2FB3A 3E5PA 4GZIA 1H49A 3UJSA 1ISZA 1GW9A 1SZFA 3ES8A 1G4TA 2X0HA 3IWPA 1NOFA 2H90A 3V1PA 1J6PA 1KRAC 4I8YA 3LERA 1S5NA 3HIJA 3TLLA 4AZIA 5AB3A 2FDMA 3WQOA 1OG0A 4F0MA 4WRHA 3DN5A 1EO7A 3AQUA 3NG3A 1IEVA 3MSRA 2QCFA 2XM1A 1GPFA 4Z1YA 5REQA 1JXKA 1NFBA 5GJNA 5CBBA 2D3LA 2WAGA 3AAMA 3EWYA 4XVDA 5FJOA 2VC7A 2Y7GA 2W27A 2D69A 2WCSA 3UA4A 1KFCA 2GL5A 1EQPA 1T41A 2HVOA 5I78A 4QBXA 4RNIA 1RCQA 3QR1A 4BHYA 1L9WA 1BXBA 1WZAA 2W9MA 3FAXA 3SIMA 3T8LA 2IUZA 5FL0A 1XW8A 1R9YA 4QX4A 3OIHA 3M6YA 1QBBA 5M5DA 4IQEA 2VWTA 4ZO8A 4KESA 1ECEA 1AD4A 4MF4A 4QRNA 3OZYA 2V5KA 4Y8EA 3HQOA 1P6CA 2Q02A 1JAKA 2ZZ3A 2VURA 3OEXA 3TYBA 3NDZA 4GOAA 5T91A 2YB1A 3MPGA 1U30A 1KCKA 4UTUA 3S0CA 4INFA 1M3UA 1NAL1 1RQHA 4MY8A 1XBVA 3QF0A 3WQWA 3SAZA 1G01A 1ZBKA 4C5ZA 2R24A 1UMLA 3APGA 3GQYA 5LNVA 4GCXA 4OFCA 4JEJA 2G3MA 4FIQA 3P74A 3WDJA 4B9ZA 1O68A 3H22A 4L56A 3L68A 2BVTA 1LWIA 2CW6A 3WBWA 4AZ5A 1NH6A 2J7GA 4OOUA 1AH0A 4AD0A 2CZEA 3WJSA 3W2NA 3HMCA 5JBEA 4AVNA 4YYCA 5FJPA 3R12A 3GY1A 1UOKA 4GFSA 1X38A 1GZGA 3NCOA 3ICJA 2VFEA 1FWFC 4PMDA 3TXVA 2WNWA 3BV4A 5CPLA 4LFYA 3O0FA 3BOXA 3LY0A 2RJGA 2Y0FA 1UUOA 3TE9A 3HG5A 3ZO9A 5H2ZA 4W8LA 8RUCA 1JR1A 2VFHA 3UZWA 5C0QA 3H24A 3BE7A 3UVAA 4B3KA 5FSDC 5A8GA 2E6YA 3O6DA 3WLJA 1CXEA 2X1IA 8TIMA 2REQA 1G4PA 2GFTA 3RFAA 1PUDA 2C14A 1VR6A 4DM1A 3NTYA 3ZOAA 2QGYA 5D9MA 3QMTA 4NX5A 2PDJA 1GK8A 4MWAB 4Y96A 4US5D 4LJ3A 3URAA 4EP8C 4YN5A 2QXWA 2QJJA 4HYVA 2NV9A 5KETA 5EYWA 2O7SA 2HV5A 1B3ZA 4PMQA 5ABTA 2J25A 3KLKA 1KM5A 4OZOA 3VCRA 3EDDA 2EKCA 5DBUA 4DXXA 2PI6A 3FEMA 4NI3A 3TMQA 3WLLA 1EA0A 4NAEA 2ZA3A 4ZEPA 3ES7A 2VTFA 4L1XA 4ZTYA 4FB7A 2HS6A 3OZMA 3A22A 3ZWSA 4ZQCA 1KQZA 4E8CA 4PCPA 4KIEA 1EXPA 4FXRA 3W1TA 2EPKX 4PZVA 2ZUWA 3OP2A 4LF1A 2HZGA 3N34A 4DJFC 1W31A 2TPSA 3NPXA 4CGTA 2X41A 1V3HA 3QV8A 3NQ6A 2WJEA 2J7EA 5K3VA 5M17A 3NL5A 3VDHA 3GNRA 4B9YA 1YXDA 2NQZA 1I0DA 1ZAIA 1TV7A 9CGTA 4G56A 3OGRA 1C3FA 1FWWA 4MMWA 1F74A 4QXIA 3BURA 1AW2A 3NYZA 3SADA 1X1ZA 1DJQA 2CBJA 2WHMA 2OSXA 3GXNA 4BY3A 4GHRA 4LSBA 3I10A 4DZ5A 1N82A 2HWGA 4D2JA 2BXVA 4PULA 1TUFA 5AZ1A 3U8GA 2OLAA 5LA0A 4D6HA 3GB6A 4RL3A 5LNUA 3W0KA 2QCDB 2WMIB 1CIUA 2WMFA 2J47A 3MWCA 2HVNA 3U0HA 2E09A 4MFEA 2QIIA 1YPFA 3SJ3A 1DQWA 5G2WA 4LTSA 4JDBA 4DLFA 3AMLA 3MANA 2WKLA 3GC5A 3AICA 1Q6GA 4LANA 1SJAA 3SRFA 4YVPA 3TYDA 2DW6A 1HTIA 2OEMA 3T0AA 3QPYA 2H8ZA 1GEHA 1KFLA 2ZUSA 2ICSA 3TWBA 2OOGA 3B0XA 3HGRA 4AD1A 2CHNA 1SFJA 3QLLA 2AOSA 4PEEA 3KL3A 3QYQA 3R1ZA 4RDYA 2R8WA 4QNWA 5FF2A 4WDWA 1VBJA 3OVPA 3BLEA 4PRWA 3MP4A 1ODZA 4CNNA 2B0MA 3TZFA 1R30A 3A4AA 4UUIA 1QNPA 1E5NA 4NKCA 1AQHA 2I16A 5REQB 2GQ3A 3H7UA 4ZB5A 4H19A 1O5QA 4NIRA 1LG2A 2DSUA 1MZHA 2YIHA 3NO5A 5LNSA 3HFTA 3QXBA 2PODA 5DX7A 2D73A 2GGJA 3W7LA 4NXSA 2PEVA 4UR9A 1N8WA 2HXTA 3EX3A 2PTWA 1GWJA 1R5YA 3ZQ9A 4LV4A 3R89A 2DSVA 2Q3RA 3CEUA 4Z1AA 5CPTA 3PJWA 2YJQA 2OQHA 1Y5XA 1FH8A 1VHCA 4M7TA 4EK7A 3DU0A 4ZA0A 4NASA 4K8GA 1NDVA 5IBXA 3K1DA 5CAKA 1D7FA 1AVAA 1JIBA 3FX4A 3G6MA 2J66A 3BICA 2XSAA 1TTPA 3LHTA 3TSDA 4JTCA 1W3KA 4A21A 3DESA 2R1PA 1PL9A 2V5DA 3U2EA 5C6MA 2WK2A 4FO4A 3HG3A 4DO4A 3DBNA 2YCJA 2PAJA 1QI3A 2X1SA 4F0KA 5A8NA 5IDIA 1LCOA 3MHGA 1A4MA 5XINA 4LVGA 3VIHA 1R3TA 3VZXA 4CNUA 1XRVA 3T40A 3T0BA 4BQ2A 1J4EA 2VX5A 1XBZA 1GONA 2FYMA 3WEOA 2EJAA 4P5UA 5D38A 2R1MA 1M5WA 5DF0A 1BPLB 1C91A 1RJQA 3QR3A 5A8MA 3CYJA 2CEQA 1UC4A 3DKLA 3NPVA 1KKRA 4ZENA 3PUGA 2Z1KA 5JBFA 2QS8A 3NAVA 1H7WA 1CB2A 4UTKA 3OTRA 3ZJ6A 5ABGA 4BI6A 2A85A 3B8VA 3PC0A 2E4TA 3VNZA 1OFEA 4RX0A 3BAWA 2YCKX 5D2TA 4HNOA 2R82A 4WJ8A 1ZAJA 3W24A 1KM6A 3WD1A 2HBVA 3TH6A 1EWEA 3J7HA 1LL7A 3L21A 2E0PA 4DBWA 5EBAA 1G7VA 1NDZA 5DN1A 3ZXWA 3LCIA 5M1TA 1H7NA 2XH7A 4EPKA 3IGHX 4LNYA 4Z0SA 3MWAA 3PZVA 3S5NA 3CB3A 2REQB 3IJDA 1PDZA 5BOFA 1G4SA 3W7OA 3KBVA 4JHMA 3UW6A 1F76A 3WK1A 3UNTA 1IEIA 3N4FA 4QJ1A 3KOFA 3CPUA 1ESWA 1RUSA 3KWXA 3GC4A 4XG1A 5AC4A 3M0XA 4NAFA 5D9OA 3PBGA 3K30A 4R7JA 4UTIA 5CG7A 4XAGA 3LQLA 4JCMA 4RLIA 2RGMA 4K68A 1JI2A 3DYPA 3KAOA 4Q6XA 1XX1A 1VFFA 4JTHA 1JYVA 3O6CA 1TX0A 5EMLA 2GQ8A 1SFTA 4UOZA 4CU8A 3UR7A 1ZBWA 5HWJA 3P5YA 1SGJA 2CLIA 1H0IA 4Z2IA 3UR2A 4QTGA 1E15A 4NAEB 4E2VA 1NWSA 2O4QA 4W93A 3C86A 1GVIA 1TV8A 3FV9A 3PTMA 1FFRA 2QJGA 2QUNA 3CQHA 2QUMA 3GTHA 4OWGA 1E6RA 3VGDA 3P0XA 4N9CA 3BQ6A 5K7JA 3KVKA 1VHNA 1KM0A 4UFMA 3O1NA 4GVFA 5FIPA 1MUCA 4AAJA 4I9MA 2R1LA 4G2DA 2QPUA 3APYA 3HFYA 2VYOA 2DVXA 1K8ZA 3EDJA 4IP5A 3TNOA 2XIQA 4ICCX 1BRLA 2EAWA 3P67A 4GY0A 3CV2A 1JCJA 5CLTA 2Z26A 3VE9A 1BTCA 1LL4A 1HG3A 3LCFA 4TQTA 1V77A 3NDOA 3W1MA 1LRTA 4FP1A 1NFGA 1KXTA 2HQAA 3W1UA 4QISA 4DJDD 1W3NA 4DF0A 3PJTA 1FWHC 3WQ8A 4ZFMA 1Y65A 2Z4GA 3AXMA 3H2NA 1RY0A 4JY8A 4LUSA 2OO6A 2ZZ2A 3KL0A 1V3IA 1EGMA 3UYIA 5MHBA 4JTFA 3M9YA 2HSAA 1Q3NA 3CMJA 5FJRA 3AJXA 3RMJA 1I6NA 5BXSA 1S1RA 4H00A 4GQGA 2DIJA 4DJFD 2CBVA 2OVLA 2GSHA 4JPGA 1LTDA 3ORWA 4C6KA 3VD9A 1HFBA 3T4CA 4LPCA 4A8IA 1QMLA 3OG2A 4J4KA 2V2CA 5EY5A 3RU6A 5M03A 1Q7MA 1JNDA 1RPKA 4A3HA 4FX7A 2Z24A 4O8RA 2NXIA 5G4HC 3FJNA 3VDAA 1OC7A 5E0CA 1E6SM 4PN2A 4UQDA 1VPQA 2FFCA 3CYVA 3BAYA 4MWAE 3D3FA 3KTCA 3GRIA 4B16A 4U10A 2OLHA 2HVMA 3CWOX 1FY6A 2HEJA 4Q7NA 1QCWA 5C9UA 2VEKA 1U33A 1PO9A 3WLQA 4WGHA 4PBEA 4W7VA 4Z2JA 2J78A 4IIEA 5H8UA 4DX3A 2J74A 1F5ZA 3OA3A 4G9PA 3FW6A 4YVVA 4IMCA 4WDTA 3G18A 4PA8A 4JKKA 2VDHA 1DHKA 2XSXA 4K37A 1B1YA 1GVYA 1K02A 4I7UA 2AKMA 3G3DA 3FVDA 3G6LA 3DFYA 2D22A 1GVSA 4CD8A 3G22A 3GSMA 3IUIA 2DY3A 3PTQA 2J4GA 2ZXDA 4MIMA 2ZUUA 4TX9A 4ZODA 4CEUC 3EA1A 2DZWA 1XXXA 2OKOA 3TW9A 4ERAA 3NJ3A 3N17A 1QFEA 4QR6A 2WWCA 3QGVA 2PWEA 2VGFA 1JF5A 4CNPA 4IZGA 4L6DA 2V3EA 1TR9A 3B97A 5DRIA 4ZMGA 5A2BA 1BQGA 4JN6A 4K36A 1US3A 4TX8A 1IE7C 4D6CA 3NUKA 1BVWA 3CHDA 2PU1A 5HR6A 4M8UA 4CU6A 3RMEA 3AYVA 2ZOXA 4DUXA 3GIPA 1P1XA 3CHFA 3TU9A 4DEFA 3ZLFA 1GW1A 2VOMA 1JRCA 1Z9AA 3W38A 4LRTA 1XGZA 3AS1A 4WHBA 2E9MA 2FZ8A 4JTAA 4PSPA 2E9BA 4EX4A 1AMKA 5FOOA 3CHEA 3H12A 1TTQA 4EOUA 4WKFA 1V6WA 1YKWA 4IXXA 1REQA 3HB9A 2WVTA 3T05A 5CPOA 3MYOA 1HO4A 1XRFA 1XRTA 5C71A 3C52A 4W9TA 2UY4A 4FX8A 2WSYA 3LN3A 2A3CA 2BB0A 1EIXA 1K77A 2CLHA 3VKDA 1HL9A 3SUVA 1T6MA 1TV2A 5T9BG 3S4TA 4U28A 5D2XA 2BGNE 3HPSA 1IEXA 2BX7A 4R34A 2Z1XA 4JFVA 2CZVA 1RK5A 2VZVA 2VR5A 3SSJA 4CQDA 1YXYA 5TF0A 7ODCA 4RUBA 1GYNA 2QCEA 1HN1A 3GS6A 4IGSA 2PTYA 1GVOA 3ZMRA 4GUHA 3NIYA 4C7FA 1ZJBA 3A4WA 1KNWA 2PDXA 2WSPA 3BC9A 2OQYA 2NVCA 3CHCA 3VIOA 3GIYA 2EPOA 3LV5A 5D8ZA 1BSIA 1OADA 1YRRA 3PSVA 1BVNP 1OT1A 1RHCA 4HN8A 4PMXA 3PZGA 3K8MA 3AO0A 4NAFB 5FL1A 2XGBA 4JHZA 3RCMA 2DU2A 7TIMA 1LP6A 4MJ2A 2I5QA 3B05A 4XAZA 4OJYA 1XGDA 4XSMA 3VNJA 1JQVA 2Z6JA 1XLMA 4AF0A 2ATMA 4R9XA 3CAQA 3VC6A 4CD6A 3TN3A 2C3ZA 1UZDA 4RNFA 1IYXA 2YDRA 3W7QA 5G4WA 2YL9A 2AQOA 1CENA 3ID7A 5CKSA 4HHMA 1R46A 4S3GA 3CS2A 4IFKA 3AUOA 3HV8A 5EMUA 3IRSA 1TVPA 1R2RA 4AIBA 2PF8A 4XKMA 1H2JA 4EWJA 4GXWA 4QCFA 3C8FA 1NF7A 3F7JA 3VA8A 2CLKA 2CXEA 1L2QA 1JDFA 2V5CA 3W4RA 2C16A 1MNSA 4X63A 1KTCA 3IV8A 4R5EA 3TJIA 4JEQA 1BRLB 2IXVA 5HMEA 1AJ2A 2RDUA 5E6ZA 3ARUA 4MWAD 4RE2A 1DIOA 3IARA 9XIMA 4F2TA 3VPLA 3L4UA 2MANA 2OX1A 1CCWB 4H41A 1K70A 1VFSA 3T42A 1CXHA 3VABA 1IEWA 1S2AA 3CM4A 4LUSB 1XH0A 1HVXA 2YL8A 1OG6A 2P50A 3BLFA 2J9ZA 2V2DA 2VWSA 1J11A 4TTUA 3V35A 1XYCA 3BW3A 2ZRVA 1KO0A 4BI5A 1DTUA 3RDKA 4KF1A 3NQAA 4A35A 1XIHA 1Q13A 2XINA 4E2OA 4MPKA 2XJ7A 2NLIA 1H63A 4OHQA 3HG4A 4JTJA 1IXQA 4LW7A 2E25A 4AIUA 3HQNA 4AC1X 2BWGA 4TU1A 3B3DA 4FK9A 4WOQA 2CBIA 2E7FA 1F3WA 1OSEA 2VCCA 4ENLA 2VGBA 1F6KA 3BK0A 4A2SA 3KLLA 1RPXA 1XV8A 1TTIA 1PKMA 4AZGA 2D23A 3TWAA 3SN4A 3H53A 1W1YA 3S8HA 5AHIA 3MP3A 1TCMA 3BJTA 4CEXC 3QM3A 2DUZA 1IXNA 3BQ5A 1R3RA 1PTDA 2VC9A 2WLYA 2C8NA 1RA0A 1HT6A 2WKJA 1JYNA 2QF8A 4CN6A 4KRZA 5BOEA 5F7UA 1A47A 1IWBA 2WNZA 2CFFA 4BCEA 4XD5A 3ARSA 1TMHA 1R3QA 1WOAA 2TAAA 3RRAA 3UZ5A 3BAXA 1UD5A 4UNKA 4GVGA 3EDKA 4YHGA 4N02A 3C0QA 3QYSA 1C92A 1C8XA 1SSDA 2GGHA 1F6YA 3CT7A 2Y61A 4GKTA 4UTHA 4GIRA 1EPVA 3S5YA 3ABOA 3CK5A 4JX5A 5LIYX 5AYXA 4ZSTA 1XC4A 1EX1A 3POHA 3P8JA 3O9NA 2PPGA 1TPUA 5DT7A 1JCXA 2P1FA 3OQ8A 3U9IA 4O4VA 3PFMA 3EWBX 3KVJA 3SDOA 4KFNA 2PTDA 3RM4A 3SRDA 6ENLA 3N2BA 1K7FA 4JIQA 4QM1A 4UNLA 3NEVA 2F61A 1UZ4A 2GQAA 1UH4A 2DH3A 4IFRA 5B7YA 1BKHA 3AUJA 3CBWA 5EFFA 2BOGX 3GDKA 4WD0A 4JIIX 2QPXA 4GCAA 3N3TA 5D8WA 3M43A 3W07A 3VINA 1H60A 3ISIX 5U4NA 4A2RA 3ARVA 3HA1A 2H3DA 4IGNA 3QZAA 4YMZA 4UQ9A 2VFGA 1IWPA 1ZQ5A 2RH9A 2GSJA 3NYDA 5D32A 1RLDA 3LRLA 3V0UA 5D09A 1E0WA 3QC0A 3AS0A 4CCCA 1P6WA 2FHCA 1RA5A 1REQB 2ALRA 3GG0A 4HJFA 1UR4A 4GJJA 1BLIA 3MVIA 2FPYA 2CLFA 3UXAA 1W37A 2O9OA 2WZTA 4RE4A 1J0ZA 3CUGA 3TDFA 3GAYA 5C2GA 1ICPA 5DBTA 2A5HA 4H8HA 2Y89A 4NQ1A 1XIJA 4PR4A 4GY7A 3NXFA 2OZ8A 3CGTA 3ITYA 5CGMA 3M47A 1LORA 3IJIA 3EOOA 1FWCC 5LHFA 4QLLA 1UWAA 5HNUA 1R86A 1JQXA 3T9PA 4ADSA 3LBOA 4WKHA 4NZ3A 1IR1A 3I4EA 2BG5A 2VEFA 2VZSA 2QHAA 4YU1A 4DHGA 1FTXA 2E9LA 5I00A 3MU7A 1DXIA 5CBIA 2OR2A 1M04A 3ZSSA 1E3ZA 3RHGA 3VNDA 3PJXA 1OK6A 4JYFA 3BJSA 3WF1A 1GZ1A 2OO0A 4RZBA 4GO9A 4DN1A 4ZTXA 3UZJA 4S2BA 4XVEA 3W22A 3G24A 3R8HA 1UD2A 4C90A 5LYRA 4DJEC 5KZMA 3HOJA 2WJZA 4ZZ9A 4U33A 4W87A 4YCPA 4S3AA 2PZNA 2PGEA 3HM7A 4HNTA 3OBEA 4AF0B 3A13A 1KB3A 1YTKA 3U7VA 5D37A 3DHUA 1EIBA 4PSRA 3VZZA 4QIUA 4K39A 2I5IA 4EF9A 2WB5A 3MMDA 3HJZA 2P10A 2GJRA 3TV8A 3BMXA 2VO5A 1EPXA 4IFKB 4B92A 2QEZA 3TW6A 2Z28A 1D2KA 3RNDA 2CCRA 3B9DA 3AHVA 3OZOA 1XLEA 1BG4A 3FOKA 5GJPA 1HP5A 3U57A 3E3HA 4CQBA 2Y5JA 4ZSUA 4UMBA 3GNDA 5AC6A 1FHVA 2GYIA 3LRKA 4PTWA 1KBJA 1R85A 1RQEA 3B8IA 3BVJA 1V03A 3F5JA 4XAFA 5LIXX 2CNCA 3L12A 3CUIA 4AEEA 1VEMA 1R9XA 4LUYA 3KWSA 4OBTA 4WJEA 3IJ6A 4WVXA 3LOTA 5FEPA 1ONXA 4LQ1A 3B8DA 3WK3A 4ZQRA 3PZNA 2WPGA 3MUIA 4B5TA 4MAZA 3CAWA 3VIIA 3O6AA 2POTA 4LYPA 4HMDA 3XIMA 1AH4A 1V0LA 4YIWA 1O7AA 4HU3A 2ZXQA 3HPZA 4IH3A 2CLOA 4R7OA 4EF8A 4IPPA 1PWLA 2OWXA 2R14A 5CEWA 2Y63A 1Z3NA 3IUHA 3WLKX 4NI8A 4I8DA 2AL1A 3W76A 1ZBVA 2IKJA 2CBUA 1JXJA 1PDYA 2I57A 4IISA 3QGAC 3LG3A 1CLKA 1YIXA 1M65A 4DUOA 4H8NA 4AD4A 3GC2A 4NRSA 4WSJA 4O1FA 1KWGA 4IMFA 3AIRA 3TTYA 3W75A 1L6YA 1Z8AA 1UIPA 3K4AA 1LBFA 3EXSA 4HOZA 4UXDA 1LRQA 4LYQA 4F8XA 1ZHAA 2WQDA 4C7DA 4OBSA 6TAAA 4PUNA 5PTDA 1VIZA 4NZJA 4F0LA 3MT1A 1US0A 1M68A 2FH6A 3L9CA 1I60A 3V0SA 2YDQA 1UP3A 2P5NA 4UR8A 3C5QA 1QAPA 2J6XA 4Q8WA 4IWWA 1LJYA 4CLMA 1OK4A 4FNPA 3QHMA 3QJAA 2X7VA 3W2JA 4L61A 1FWTA 4WZHA 1HJXA 3DFPA 5C2CA 5AYIA 4S23A 1K03A 4GLEA 4MDOA 3JW7A 2I1OA 4C1KA 4NUWA 1FKXA 6A3HA 1TTJA 3N6HA 1K8YA 3MZ2A 2WZMA 3TR9A 3CV7A 5A6BA 4GNKB 1V5XA 3E74A 3OHIA 3AXKA 2QV4A 4I9TA 1W9VA 4S3BA 1XIEA 2PLCA 1WDWA 4WXZA 5C55A 3QQ1A 1FHUA 4JTIA 2WHJA 3W7GA 2PB1A 4GIAA 3P82A 1P43A 3AIQA 4C6JA 1ISXA 3EX2A 3N14A 4R53A 2EF9A 4PBGA 4HOWA 2KAUC 1S2CA 4B5XA 2J7CA 1XP3A 3FJ6A 1VD6A 3OHMB 1OCBA 2D2HA 1ZP3A 1CW2A 4KWUA 1R3SA 1TWWA 3E9AA 3R25A 4AZBA 2PCEA 1EDTA 3UPBA 2ZX5A 3FDKA 3LEPA 1ZL1A 2XH4A 1B31A 3QH2A 4PUWA 4IMGA 2YZ5A 4G8TA 2CZ5A 2XFWA 3T1GA 3KDOA 3USBA 1UYQA 2PDUA 1J01A 5BRBA 5ECUA 2NQ5A 1OX5A 2BGQA 1QI0A 4ORIA 4DAFA 3Q4DA 1TKKA 2JFEX 3PWGA 3F4CA 1W0MA 2IKIA 3W1QA 4L6HA 1EA9C 3EEZA 3VOCA 3MJYA 4PL2A 3TTQA 3TR2A 5GVJA 5BZAA 3QFWA 1I45A 1PJ9A 1JRBA 3UCCA 1W5PA 1P5BA 1UUQA 1BGAA 5I2UA 4Y9AA 4GUIA 1DOSA 3TTSA 3NR0A 3ZLHA 2XWEA 3W01A 1WDSA 4E3TA 1A3HA 4X2PA 2YBTA 4H7VA 1I2OA 2ACSA 4AHOA 5FJJA 3ZZ1A 1JD7A 1F4AA 3ARZA 4Y9OA 3ALFA 3PZMA 2ZXAA 4N6FA 3GXFA 1YPIA 1ZJIA 4XO7A 1CLVA 1Q5MA 2QV5A 1UKTA 3C61A 4HHHA 4NRRA 1RJRA 1EEXA 5HMDA 1HJUA 1G69A 3AHYA 4HYRA 1GOQA 2PE4A 4HBKA 4H2HA 2I17A 1E4MM 4AZCA 3B03A 1FUYA 3BARA 4QG6A 4ATWA 4RW3A 4E5TA 1UJQA 3ZYZA 4GRSA 4MOZA 3WQ6A 1UIOA 1CZ1A 4US5A 2Z7GA 2WMHA 5I3IA 4BEQA 2ZC8A 1YMYA 4K7VA 1XC6A 1DIEA 4DBDA 1GJUA 3MMUA 2P3EA 1NELA 3N2MA 2JALA 1J0KA 5G1MA 2BFGA 2E1DA 2HTMA 1HO1A 2Y7DA 2ZVIA 3VMNA 1WA3A 5A6KA 3ANUA 3SFWA 4L7ZA 1BGGA 3WZ0E 4GJIA 1W1TA 1FWBC 5E9XA 1QW8A 2F7FA 3VGBA 3NQFA 1PHWA 3COTA 3IANA 2PDBA 2WZIA 3I68A 1KGUA 3QC3A 1AQMA 1XISA 3Q58A 4H9MA 3BLDA 5DRCA 2YYUA 1O1ZA 3GE7A 4Y2WA 1R47A 3GDRA 5CC7A 1I2NA 3SN0A 4QLJA 1V0KA 5GJMA 1WZKA 1IZCA 3IJ7A 5HQEA 3KX6A 4WDXA 2V0TA 3T2QA 5J5DA 1V0MA 3ITVA 3FK4A 1EJUC 3KRUA 3WDHA 2RJHA 2GWGA 3W2KA 1JD9A 3NZRA 4QDWA 1RY8A 1U1JA 2VR2A 3N29A 4F66A 4MM1A 2DZUA 1GOXA 1V3JA 1EP2A 3AYSA 2Y8VA 4UIOA 4KW2A 3LM3A 1MXSA 1TPWA 3KHDA 1HL8A 5F1UA 3TSMA 2A7PA 1DTNA 1PZ3A 3RPDA 3PF3A 4BWLC 1VJSA 1V6YA 4N2YA 3GTIA 4W85A 2OKTA 1ZJAA 1YNPA 2V5JA 2VZUA 4JCLA 1TB3A 1JL8A 5EL1A 3HJEA 3WFAA 4Q6JA 1W3LA 4QE4A 3U5UA 3CL6A 2X30A 1XHGA 4PUUA 4CQ8A 3EWUA 4GIYA 1Z42A 4F48A 2ZIDA 3CO8A 3RF9A 5DY2A 3CB8A 3RXZA 3G0XA 3GG1A 5C54A 3B4YA 3SRKA 3PS7A 2YSWA 4FNQA 3N11A 3RX2A 3FS2A 2YPIA 1SJCA 4BKNA 1TJRA 4XUGA 1JZ7A 1E1EA 4LBUA 1CTNA 2VR4A 3VOJA 3AXXA 1R0MA 3KBNA 4MZYA 3AU2A 4GFIA 2E6DA 4XIMA 1WXJA 1V79A 3E5BA 1M7OA 2WJDA 1EBGA 1FXPA 3V5CA 1BFNA 2C1HA 4EIVA 1GCYA 1MO0A 3IIOA 5D2VA 2AAMA 2BVWA 3L5LA 1G0CA 1XLFA 4W86A 5GNXA 4GZEA 3HPAA 4C6BA 4B15A 4HSHA 4YHEA 4J3SA 2PFHA 3C6CA 4XD3A 4LYRA 2OELA 1XFCA 3O6YX 3NSNA 3UR8A 5F2GA 4DI8A 1GQIA 5FJTA 3ZM8A 3MUAA 1AODA 3DHFA 1YQ2A 4P8WA 2QPSA 2YZRA 5LA2A 1UWRA 3F4NA 4IUGA 3VCCA 3ITCA 3QKEA 1I1XA 1UKPA 4LVDA 4FXSA 3E38A 4WSHA 2DZPA 2EPMX 3EDFA 4FA3A 1MEIA 4Z2GA 1UWUA 2PWVA 3CU2A 4QS5A 3NL6A 3M6DA 3UWUA 1R9ZA 1AQFA 3W81A 3PBVA 2QCNA 1XCXA 2E5CA 3OIXA 4GABA 5AVHA 3IACA 3K5XA 3WF0A 3WG6A 1E1CA 1E3XA 2PDCA 4LGXA 5HANA 5A2AA 1J12A 5T26A 4U2ZA 5CAHA 1KBKA 2BS9A 1QNVA 3UP8A 1IGSA 1WQ5A 3S1GA 1E4IA 4ZB0A 3W83A 1JJKA 4ZQOA 3T2PA 3WJWA 3WLIA 4JICA 3VNLA 4IIFA 2YOCA 4HZ6A 4Z08A 2DVUA 3DFNA 1HJQA 3UU0A 4V1XA 4RE3A 2ZQ0A 5A1AA 5KTLA 4NZ4A 2PWFA 5FAJA 2YA2A 2EBNA 3JZEA 1QPRA 4JQ4A 3ZWTA 3LRMA 6XIAA 3RAOA 4EWND 3BOLA 5A6MA 3KS5A 3F1QA 4OUIA 2ZA1A 1IEQA 1X6UA 1KFKA 1QO5A 1JUEA 3UGVA 3H2OA 1OFBA 1WKYA 3RR4A 2QDGA 2Z1WA 2I9EA 3LMZA 2I56A 3IV3A 1C90A 3M0MA 4P8XA 2OYMA 2ISSA 2GJPA 4O0QA 1LWJA 4FF7A 3QMSA 4UTTC 2DZAA 2FZNA 3H7RA 1X1NA 1V8EA 5G4EA 4D6FA 1V3LA 4O0KA 3D5HA 4MG4A 1K7XA 1Q45A 4ILSA 2WBGA 1TMLA 4M51A 4HPNA 3VX1A 4XZMX 5EU9A 4AZCB 1XRSA 4LWWA 4NSBA 3N9KA 1TELA 4F9DA 2Y8KA 1W3IA 3P93A 3PUOA 1SU5A 4MJMA 1SZEA 3W6LA 5G1YA 3OA5A 4WY0F 4JKLA 1V7AA 4EVZA 4QITA 2BTMA 3AS3A 2OT0A 2X8RA 4IX2A 4C60A 4ERIA 2DH2A 4M81A 3BLLA 3SO7A 3O07A 1W6TA 5BROA 5LGZA 3NNTA 3G0UA 4MNJA 3GO2A 2XGZA 4C1NA 3PPGA 3B0YA 3AOFA 5C9RA 1TWIA 4GK8A 4YXGA 4K7YA 1CBGA 1Y7VA 4EPBC 6ALDA 2ZZ1A 3E12A 3M5ZA 3DHPA 2VHLA 4KBXA 3E96A 4GZJA 3W27A 4JHOA 3ZFHA 3O63A 2YXOA 3S2MA 3DERA 2Y85A 3WF3A 2L5HA 3UPWA 3RR1A 2DP3A 3NQMA 2UV8G 3FFSA 4L4PA 5E1QA 3PWAA 2Q09A 3P2VA 1CXKA 1PIFA 4C6PA 5I7GA 4FOJA 4GACA 3GTFA 1WZMA 5JH1A 7ENLA 3DUGA 4NNBA 3GW3A 4GD0A 2B7QA 5HNNA 4BS0A 1IQ8A 1W5QA 3K13A 4MB1A 3A4XA 4TVDA 4X60A 1OEPA 4LYKA 3BAJA 3IJ9A 2W79A 1VJZA 4UFHA 3GXPA 5IM51 1Q8AA 2GJXA 4XZNX 3CUJA 3TFCA 5GNZA 1UUMA 3TSBA 5CPNA 2F38A 2NWRA 3UETA 5B80A 3N2CA 3D0CA 2ISFA 4IGMA 3LGGA 4LUTB 3ZIZA 5CJNA 1XUZA 2YA0A 1TPVA 3TNBA 4QS6A 3C4UA 3IEBA 1DWHM 4H3DA 5DELA 1DXEA 3B40A 3GG7A 3WDQA 3F2DA 3KTSA 3WF2A 1Z32X 3CZKA 4JTSA 4HNUA 1FQ0A 3CQIA 1ZCOA 3T0CA 1NFPA 3WLRA 3JUGA 4YJ5A 5AOUA 1W17A 3BLPX 1CYGA 2GVJA 3AWNA 2JF6A 1F61A 5AC5A 1ZJHA 2ZX6A 2BY2A 4RV3A 1XLJA 2ZKMX 3L66A 4NF7A 3QY6A 1CEOA 3WO8A 4HU4A 3K8KA 4UTWC 2PCQA 4NJHA 3E0FA 1KW1A 1RLCL 1SO4A 3AMDA 1YXCA 4DJFA 3L23A 3LM7A 3ME3A 5CZKA 2CU0A 1GEQA 3CL8A 4KPLA 2G50A 2FTYA 1DIKA 1THFD 3R94A 1BTMA 3SUTA 5CZSA 5DXXA 1E72M 4S1FA 4GXPA 1B9BA 2V9DA 2WVVA 1M41A 4RK8A 2YLAA 5FF4A 1FWIC 5E0KA 3T78A 1Z48A 4QDPA 1E4LA 1C29A 2QAFA 2CZFA 3IRDA 4TTGA 4PFHA 4JFWA 1J0IA 1TFVA 2B4GA 1UH3A 4ONVA 2Y7EA 4E2DA 3AHXA 3GHSA 2YBVA 3GVQA 3L0NA 3UG8A 1K4HA 4GGHA 3MHUA 3BZJA 4HMNA 4JIRA 3LGDA 3CZJA 4MVAA 1RBOB 4U3CA 1EO5A 1FCBA 3Q37A 4FNRA 1QI2A 5F2MA 2XIIA 3OO2A 2VI0A 1GJWA 1RJPA 1TJ0A 2A6LA 2DJLA 1M7JA 1DE6A 1EHAA 1VP5A 3ONBA 1NOUA 2XN0A 1JZ6A 3MW7A 3W1XA 4IL0A 4U5IA 2A3BA 6TIMA 3L7RA 4B4HA 2C91A 1OF6A 3BAIA 1NQ6A 1H7PA 1OT2A 2G96A 3CC1A 3E0VA 3RJXA 2W67A 1FWGC 4HCLA 3EXRA 1DWGM 3TCSA 2GOKA 2XZ7A 1E1CB 4ROQA 3FSTA 3VNIA 5XIMA 2R9RA 3H21A 3M16A 4F4RA 4EPEC 3RPMA 4A4AA 3TVAA 2FZMA 1F3TA 4O18A 1G7UA 4ZGYA 4AY1A 4NNAA 3JS3A 1E6XM 3AJ7A 5H6HA 2X1TA 3W6MA 4Q4KA 2GGGA 4OGZA 2RDWA 4LUIA 3NGJA 2POZA 3II1A 3U2CA 3LHUA 4UFJA 1EJRC 2F2KA 1A53A 1R38A 2HDJA 3N13A 4U31A 4GC4A 1QJWA 3AHZA 3U5YA 3N73A 2ODOA 3GXDA 5DMYA 1IXOA 2VZOA 1EJWC 1J0JA 1RQBA 3ARYA 4ZQMA 5K9CA 1XICA 3C8NA 3CIXA 3NEHA 3REQA 1DBTA 3M5XA 1W56A 2GPTA 3S3GA 4LY8A 1MEHA 1POJA 1Q6FA 3W7DA 1XR2A 4H1ZA 4CCDA 1X6LA 1SSGA 3B8SA 4FEZA 1J2BA 1JCTA 2VEMA 3CHVA 3ITOA 4LUJA 2QNEA 4LVFA 5BRQA 3N9RA 4POCA 1O6IA 1GT8A 1YLVA 3VZYA 2DZSA 1JAEA 2IPFA 1NDYA 1N8FA 2OGYA 2ZYFA 1DWFM 1MMFA 3LTYA 3URNA 3DAQA 3VKJA 1TQXA 2VJXA 3CPGA 4ICMA 3W84A 3I6EA 1KM2A 2D2JA 2OT1A 4H9VA 2O9PA 5AYYA 2PGFA 4ML4A 4R33A 4E4PA 2HRWA 4XBKA 5FESA 1OC6A 2PDPA 1CPUA 4KRTA 2QW5A 4IXHA 4J5NA 4I5RA 2J8TA 3O7UA 4H04A 2NX9A 5D30A 3EB3A 2ASHA 4CD5A 3DECA 2JKEA 4IQLA 4C1NB 1CDGA 1Q7QA 3SJNA 3I7RA 2YA1A 4GINA 1KFEA 4HPXA 5FSEC 4GC3A 3EOUA 1BF6A 3EWXA 5CSUA 3CT2A 1C7SA 1EP1A 3LK6A 4W5UA 1XG3A 1GHRA 4WEVX 1QDSA 3H8AA 4AIOA 2VNCA 2PRLA 3MI2A 1MWOA 1MZRA 1KGXA 2NQLA 2A3HA 2NVAA 1EX5A 1QHOA 4MAVA 1IXPA 3R7MA 4F40A 4HPHA 4MY9A 2PDMA 2FJUB 4FI4A 4F0HA 1NF0A 1SW3A 5A95A 4W5ZA 3AXIA 2W66A 4AXKA 1TSIA 3QW3A 1S5TA 4M6VA 1H1ZA 3HMJG 1DJGA 3SUSA 2VD8A 3NZ1A 2YL6A 3V0TA 3NQ2A 4B4FA 2GJXB 4GI4A 2ZUVA 1OX4A 3SCRA 1E4NA 4A8NA 1WZLA 3VD3A 2ZTJA 4MNMA 2DQWA 4P7OA 3Q94A 1UG6A 3U7BA 4JL2A 5BU6A 2TYSA 3CEPA 1JDAA 5FEZA 2TMDA 1CGWA 4NJJA 2W63A 4WXYA 4AUBA 3QPEA 5T8GA 2Z2AA 4FNUA 4MKSA 4JDYA 3VFLA 4QE5A 3V75A 2PD5A 1VB9A 1GVQA 2CITA 3FYOA 3FHQA 2Y8UA 3JZUA 3CWNA 2Y5SA 3B8UA 1ISWA 1JZ5A 1ADDA 5E09A 2VQTA 1JYXA 1KM3A 4Q4MA 1FX6A 1K6AA 1E9IA 1DE5A 1R2SA 3DI0A 1ONRA 2VMFA 1MW0A 1GVEA 1D3HA 4IX0A 3P61A 4ZOAA 2BMBA 3T09A 1TVLA 1O4UA 4LCRA 3E2SA 4Q32A 1JFXA 1IIGA 4NT0A 2ZUTA 4HQVA 5KEZA 3B0PA 5J04A 2G37A 3ITTA 2WVVB 2OMAA 1GHSA 1AH3A 3WLMA 5BOOA 1SO5A 2NUWA 3PPFA 3TJXA 2PRHA 4H9TA 3BGGA 1RAKA 5HJXA 1GQLA 1PX8A 3LXCA 3CH9A 3GR8A 4HA4A 4GG9A 4J3VA 2XVPA 1E40A 4XAYA 3R8RA 2VC6A 3CZGA 1I1WA 5DFAA 4DELA 1DL3A 2WOQA 3CJPA 4DY1A 4AZHA 1FWAC 4ASTA 3DGRA 3BSMA 1Z69A 3KRZA 4NZ5A 4JTDA 2O9RA 4XWUA 1EF3A 1OFOA 1AUSL 2DSKA 3M5YA 2A21A 1EH9A 1J18A 2UY5A 5JIPA 4MHBA 4ZXOA 4YTUA 4GZ7A 3WNLA 4NX0A 1KLZA 1VC4A 4CN1A 1Z41A 2W5FA 3R79A 3AMKA 3RLUA 3TAKA 2DIEA 4DB7A 5LGXA 1M1BA 3U4AA 4FALA 5JMUA 1MUMA 4J2PA 3RM8A 1Q6OA 3S5OA 1TIWA 3GBEA 3LHWA 4UMCA 1Q6DA 4LBRA 1L6GA 1Q7ZA 4V33A 3BUVA 2JKPA 1NEYA 3MO7A 4HTBA 1OVDA 4G6CA 1OC5A 3EDEA 1OWQA 2Q71A 4RJEA 3I4KA 3P5ZA 1L8NA 4P8UA 2WNNA 4H9UA 3BTNA 5I3DA 3WDPP 5EPDA 4YWSA 3SGGA 3OGSA 1ECQA 3GH5A 4Z17A 4AD2A 4RDVA 3T0TA 4QJ4B 1E5JA 4C7GA 3NVTA 3W7JA 3EYPA 3OQEA 3WD3A 4O16A 1CLXA 5IHRA 3PB0A 1IV8A 3N3MA 2I9UA 1VYRA 4HU8A 4O13A 3VGFA 1D8CA 1JNEA 3ZR4A 4FSAA 3R58A 3C2RA 3TXZA 4XQ6A 4B2DD 2IPWA 4IPIA 3W1PA 4PUKA 1KC7A 5HNTA 3E0IA 3ANVA 3N9SA 1A3WA 2X09A 3TA6A 3REQB 1GUVA 3OZPA 3K4DA 2Y6ZA 3HPFA 3TW7A 3MYPA 1XYBA 5A6BD 2JIEA 2R6OA 4QCEA 4RDWA 1O95A 1ZGDA 4NJGA 3N2OA 4IGHA 3EEGA 1DEDA 2PC8A 5I5RA 3LB0A 1ZALA 2NSOA 4LCQA 2C13A 3NOYA 4AWTA 1KM1A 1XI3A 4AY7A 1T8XA 3B4UA 4FS9A 5LIKX 1M7PA 1P7TB 4GWEA 1OQFA 3W2LA 3HPXA 3LCXA 3WD0A 3GM8A 3JR2A 3MV11 4MZ8A 1KR1A 3DG3A 5FJIA 3RX4A 4ERGA 4GQQA 5D4YA 1JI1A 4J3XA 4RCXA 2ZRZA 3W82A 2I7GA 5H8MA 1ZRQA 1B0IA 1EGZA 1GQNA 4HSNA 4KEMA 1G6CA 3UVIA 5F4XA 2E3ZA 3QTPA 3H6OA 4GNJA 3SQLA 5H91A 3TQVA 5D05A 5KZ6A 1HQTA 4H6KA 5TD4A 3A47A 3FVMA 4NG3A 4HNNA 3NFUA 1BSLA 3WEZA 1CXFA 5HA7A 3TKFA 1RV8A 4EKJA 3ZJKA 2W62A 1O5RA 3JRKA 4B5VA 6PTDA 1UKQA 1WKEA 4OBRA 3B8TA 4TMCA 3WNOA 1JZ4A 5J8LA 1XPGA 1ISVA 3F2CA 1HJWA 3G1HA 5E9AA 3T0DA 3MP5A 3MY9A 3HO8A 3TYAA 4Q8UA 4AWUA 4RXGA 2J9YA 1H5VA 1UQYA 4MJZA 4UFKA 1VFMA 1LDCA 4YTQA 4IHCA 1S5VA 1GOIA 1W5OA 2A4AA 2J6VA 2OXNA 3MCNA 5C2XA 1FWJC 2OGJA 3P80A 3MO4A 2C71A 2AGTA 1HGYA 5FACA 4HT3A 4C6QA 3WSUA 1QK0A 1GGOA 3STCA 3B9AA 3E2QA 1OX4B 4H8VA 1VFOA 4GYPC 1HL2A 2WCAA 1DVJA 4O15A 5DANA 2HK0A 3LZ5A 4QROA 3WH6A 2XH0A 4N9EA 1K1DA 3LTPA 2QMKA 3AALA 3O15A 3EZ4A 3SCSA 4K1GA 3PNZA 2A6NA 1ZUAX 4AMAA 2QYGA 2YXXA 2VOTA 3N25A 5EB8A 9XIAA 2A79A 1PIGA 1EJ7L 4ML9A 4MB5A 4KRUA 3LPFA 1TYGA 2OOFA 4E3VA 2IKGA 3EBVA 1V7YA 3WQPA 3VIJA 4YCOA 1E6PA 3CMGA 1W3HA 1OCNA 2YLLA 1U5HA 1I4NA 4PYSA 1QATA 2WHLA 1WUFA 4GUJA 3L4YA 5JBDA 2O55A 1V08A 4LAOA 1K4GA 1A49A 2X42A 2ISVA 2Z6IA 1PV8A 2QQ6A 3VDGA 3QHOA 1W2PA 2ZUMA 2OX4A 2XTKA 1BD0A 4ZO7A 1CB7B 4EANA 2ZX8A 1B4EA 4QJ3B 1YX1A 1F73A 1BWVA 5CCZA 4FNSA 1UA7A 3VGEA 2FMNA 4ZR8A 3NOEA 3CLMA 3VKKA 2NV1A 1OHLA 1A5NC 3U6WA 2VELA 3DI1A 1S1PA 1OB0A 2C1IA 1I75A 1WBJA 3UF9A 2VUYA 4C6EA 2RFGA 1EUAA 4HGXA 1R6WA 4C1LA 3IIVA 2QR6A 4I3GA 1EEPA 1MXGA 3EMQA 3GH7A 3ZSTA 1M9HA 2ANUA 1L8PA 4IIBA 2F6KA 3TOPA 4ROPA 3W25A 3TN5A 5D2WA 3ZJ7A 1V93A 1VBRA 1VRDA 1UR0A 3G1YA 3LCLA 1RVGA 3QFEA 1KXQA 3DCPA 3LCWA 4H8UA 3TX9A 3AIBA 3VD4A 4G1NA 3F4WA 3NZGA 2FB2A 2QIWA 4H9XA 3GG8A 1K8CA 2ZZ5A 4J2MA 1S38A 3BG3A 5JUVA 3WBXA 3SY8A 5G2IA 4I6KA 4KCUA 4IQDA 3UYCA 3VNMA 2EG6A 3E2VA 5CQ1A 3M4HA 2PDWA 1IT8A 2E5BA 3M0LA 2WYSA 4WJXA 2VENA 1JPHA 3W6YA 4FPSA 3IVTA 1EYWA 3EOSA 4BQ4A 3CLWA 3LI1A 3GTXA 1F8IA 3KVLA 4KWWA 2DUXA 5ABFA 1XLDA 1N2VA 1H7XA 2VC5A 4L64A 1Z7AA 4ZVJA 4D8LA 1PX4A 2C19A 1VF8A 1GTHA 3VNKA 1JG9A 3KBSA 1XIFA 1GJPA 1DJIA 2ZE0A 2GZXA 4HCHA 1W1ZA 1D7KA 3NPUA 4HYWA 3V16A 3UT0A 2BOEX 4A22A 2FGLA 3T2OA 2HJPA 3GVGA 2WM1A 4ZE5A 3S1WA 3MKCA 1H51A 4DBSA 5A6AA 3TC7A 2LLEA 3STGA 2Y62A 2PP3A 4LXFA 4HIBA 5LIUX 1F3EA 2V82A 2PDGA 2PS2A 4EAMA 4JS3A 1TO3A 5CGQA 3UEQA 3SCTA 4GUFA 3WLTA 1LL6A 3EA2A 1WV2A 3DXIA 3VUSA 3WLNA 4UNIA 3U2ZA 4XZHA 1ZFJA 4PTMA 1EF2A 2WHKA 4ZB2A 3SY1A 1JF6A 1B4KA 1LQ0A 5D9PA 1GVFA 7A3HA 3RO8A 4XISA 3GWQA 4IIDA 1IWAA 3M46A 4ZOBA 5EGRA 4DYKA 4PUEA 1K9EA 2AQWA 3OOQA 3N15A 3W26A 4C6OA 1UR9A 4DZIA 4UTMA 2G3NA 1W91A 4Q7BA 4UQBA 3MA8A 1BWLA 2WO5A 3G1FA 5HUOA 3W85A 3NL2A 4ACYA 4BK9A 5FJUA 1NM9A 1ML1A 3P7YA 5A6JA 3FJ4A 1TWDA 3QR0A 3WDRA 4HU0A 3SW6A 4XTIA 4FIRA 1J8VA 2CLEA 2XPKA 4C6IA 3V5FA 3PK7A 4L65A 3DBPA 3TROA 2DUAA 2MNRA 2ON3A 2JBMA 1HKVA 1VPYA 2PWUA 4PEKA 4NILA 2XN1A 2QUUA 3GTNA 5GQBA 3SQMA 3TN6A 3GW0A 5I79A 4GPNA 4HKPA 3W2UA 1HKIA 3QQ0A 3DFTA 1T99A 1ELSA 5C9ZA 4X0NA 1VAHA 4HK5A 4DIAA 2WV8A 4Q8NA 5CSYA 2Q8XA 3LPPA 3G5EA 3IPWA 4L9YA 4JX6A 4JTRA 1EWDA 2Z1VA 4DJEA 1OABA 4GI9A 3T07A 4LF2A 2W61A 1TE6A 3L67A 4JKMA 1C8YA 1HGWA 1X8CA 5I06A 1YTDA 1TRIA 2QKFA 1O1HA 4HHLA 4CCZA 1RVKA 1E73M 3DC8A 2GGEA 2Q3OA 3QW4B 1LQAA 1LUCA 3SSZA 2G97A 2ISDA 4U5KA 4QGCA 4MYAA 3H26A 3A23A 2XHYA 2JIWA 3GXIA 4N4QA 1I2PA 4LT9A 2ZWZA 4IIHA 4FF5A 3BO9A 2OTDA 3GVRA 1XYMA 2V3DA 3JU2A 2B81A 2HNHA 1QPKA 3VK5A 3U4FA 3CTTA 2BASA 1UR3M 2A7RA 2CWNA 1U5VA 4TR9A 2X05A 4O0ZA 5DCEA 3G0SA 2EPNA 3WK2A 4Z1CA 1YNYA 3ABXA 1L6SA 3GHTA 1F6PA 5L9FA 2CYGA 1A5KC 3CL7A 1WDDA 4G5DA 3N4EA 4V15A 4JR5A 3VO0A 1TRDA 3CWHA 2HXUA 1ME7A 1W9PA 2EEXA 2VP8A 1TPB1 3VGHA 2OWCA 3DX5A 2VRQA 3QY7A 4PL1A 5LHEA 3CXOA 3FKKA 3EKZA 3ARQA 5JVLA 1PX3A 1VFLA 2WJFA 4LVBA 4CD4A 1V51A 5U7SA 2C6QA 1NP2A 3BJFA 4AWSA 4V28A 3S9YA 3GFZA 2FZ9A 4IM4A 1FWEC 4JIPA 4GVIA 4PMNA 4DNMA 3S42A 4WR3A 4AQLA 2CIPA 5I24A 2EHHA 3BOFA 3K1GA 3MMTA 4JQ2A 3RLHA 2QCCA 4PRTA 4QSFA 5E6YA 1VZWA 2VX4A 2WW5A 3O0KA 1AJZA 2ZE3A 1XH2A 1A80A 2BDQA 1O60A 2QDEA 4R88A 2ONEA 3KRBA 4JTTA 4S3FA 4RPPA 1GOKA 1LM1A 5BYWA 2A3EA 5D04C 3WJXA 4MNKA 2DQXA 4AG0A 4OV4A 3CZ8A 5I3JA 4O11A 4M6PA 2WBKA 3RN6A 2YYTA 3KOYA 4P2VA 3QV9A 4C91A 1FOBA 2O0TA 4J40A 1SFSA 1HW6A 3MDWA 3EWDA 2ZWYA 3QLDA 3NQ7A 1LBMA 1FVPA 3QPZA 3AHTA 2PDNA 2NSXA 1A0DA 3WUGA 3M44A 4C65A 4PCNA 4AHQA 1CXIA 3W71A 2XU2A 3P84A 1V6TA 2UBPC 2YDAA 3G1VA 2W0UA 1A5BA 5ABFB 4AEFA 3GZ3A 1TZ7A 7XIMA 3C0LA 1T96A 4M0XA 1HIZA 3QGKC 3GKAA 2J27A 2DJXA 5D2YA 1YE6A 1DJXA 2IPGA 4XZIA 4IFOA 4HNVA 2WC3A 4Q8OA 4AU0A 3CZEA 2A7NA 3BPWA 1PZ0A 1H0GA 2E8YA 3LZ3A 4ZCWA 3W28A 3WUFA 5BXTA 4H9YA 3O3RA 1EC7A 1SR0A 4EAYA 3CUFA 3L4VA 3GR4A 1QI4A 2X7WA 5C7HA 2Z0IA 1OJXA 3PG9A 2OPJA 1T40A 1AW5A 5AHMA 1FDYA 2QLYA 4S3CA 1E6ZA 5B7ZA 3N1AA 3TTEA 1QW7A 2WMGA 4YWIA 3VOIA 2NX1A 4HNLA 4PC8A 2VM8A 3MJMA 1MSSA 4M7SA 2J13A 3PSWA 4O54A 1T0OA 3UG5A 1B54A 2YCIX 4AHPA 4UQCA 2JEPA 1GTEA 4GJ1A 4GNVA 3W86A 2E6AA 1LLOA 1QK2A 3KUMA 1Q6CA 4FLOA 3BH4A 3GVVA 4PTXA 1X6NA 4OV9A 2PUZA 3W72A 1XIIA 1NIUA 3NVDA 3AS2A 1KV8A 4X9YA 1OFQA 4TXEA 3FGCB 4IUOA 1UWQA 2HE8A 3W7PA 2JGQA 4YS1A 2VD9A 4A3YA 5K4ZA 2XYLA 3YPIA 3RPTA 1DXFA 1EGVA 4QAWA 4EE9A 1AFSA 2OWWA 1WKFA 3MI3A 1NWTA 4O53A 5K9XA 3RX3A 3SB0A 3TJLA 3PZIA 3IVUA 2G4JA 2XUCA 1QR7A 2D20A 2PWGA 1XIGA 4JQ3A 4HA1A 1YYAA 1LZOA 1FDZA 2OLSA 4XX6A 4Q3MA 2PD9A 4RPQA 1TREA 4DZHA 3TA9A 3OBKA 3WQFA 3GBDA 5CH9A 1T8QA 3OBAA 2BVDA 1HXJA 1PXGA 3PB2A 1IT0A 1OX6A 1SQ7A 3OVQA 4RE0A 3WQDA 3H70A 1X8FA 1A5UA 1EBHA