4HZ7A

Crystal structure of bglb with glucose
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords beta-glucosidase
total genus 173
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz7A00
2WBGA 4LYRA 5CZKA 4Z2GA 1HVXA 1KGWA 4JZ5A 3F5KA 1GHSA 2JALA 3U57A 4PYSA 3EDFA 1E6NA 4CD5A 1HJSA 2E3ZA 2BVDA 2XGBA 4R27A 4AD1A 2GVYA 4PMYA 3VM5A 3WDHA 1O6IA 3THDA 1UUQA 4Z2HA 1JYXA 4W7VA 4H8UA 2PB1A 4JCMA 2WZHA 1EO5A 5I79A 1JNEA 5AYBA 3W6LA 3NSNA 4FF5A 1XHGA 2OYKA 3BAWA 2E9BA 3DYOA 1V6VA 4GQQA 1FP8A 1BYBA 3MUY1 1AVAA 2VMFA 5M03A 1UD5A 2VX6A 1KQYA 1HP4A 1UD2A 3WF1A 1GVIA 3MSGA 4LGXA 1WZAA 1LG2A 3GXFA 3AS2A 1JDAA 2WMKA 4DWSD 4IPNB 4S3JA 1UR4A 2FGLA 3N13A 1ISWA 1EDTA 5FCZA 5KZ6A 3DC0A 3U5YA 2DSZA 5C8BB 4UFLA 4CCCA 2X2YA 3EDDA 1CNVA 5A95A 3WNMA 2DT0A 4DWSC 4W8AA 4AD3A 1UWRA 1CXFA 4QLLA 1E6SM 4HOZA 4UQAA 1NARA 4W85A 1EGZA 2WZIA 1BSIA 1CXHA 3UCQA 4URIA 3AMLA 3ALGA 3PTMA 3OG2A 3SUUA 2PBGA 1UKOA 3WF2A 5FL1A 1BVNP 1JI1A 1V6WA 1G5AA 3T2QA 1FH8A 4OJYA 1B31A 4P8XA 5GNXA 1OM0A 2Z1KA 2CETA 2EJ1A 1BPLB 1W1PA 4E8DA 1CLVA 3KE0A 1JDCA 4PMRA 4PN2A 1VB9A 1TCMA 3ZR6A 1C93A 1GPFA 5I0DA 5D4YA 3TTOA 3WELA 2XFRA 1E4IA 2CESA 1V0NA 4YHEA 4H8HA 4PCSA 1J0IA 4WJXA 4H04A 1R87A 2VQUA 2GUYA 5KEZA 2Z1SA 1E6RA 4MNKA 1VBRA 4CD8A 1E5NA 4PMZA 4C7GA 3OZOA 5BCAA 5I77A 3MMUA 1EQPA 2W63A 1A47A 2J7EA 1GOOA 1BYDA 4P7NA 3UG4A 4U2YA 3E1F1 1BG9A 1BLIA 1OWQA 1XCXA 2VO5A 5GNYA 2VRKA 3WH6A 5CPQA 8CGTA 3J7HA 1H3GA 3W37A 3VU2A 4DWSA 3AMKA 1WZLA 1XSJA 5BRQA 5CSYA 3OB8A 1UOKA 3W4RA 2WVVA 3U7VA 2BY1A 4QAWA 3RM8A 2Y2WA 3OZPA 5IHSA 2QF8A 4UOJA 5CLTA 1GUVA 3GNPA 1WDQA 3BLKA 3GH5A 1TMQA 1QNPA 1EOKA 3ARYA 3AZRA 3ZT5A 4F9DA 1MQPA 3TA9A 1WE5A 1US2A 3PTKA 2W91A 4H8VA 1V03A 4CCDA 2ZIDA 2J78A 2FGZA 4PTWA 2ZXQA 4AD5A 4D1IA 2ZICA 2PWHA 2QMKA 2ZX9A 3DYPA 2YLLA 1CGYA 2D3NA 2WWCA 1WO2A 4WSJA 1GCYA 1I75A 5DMYA 3WF3A 1AQHA 3F5LA 1QBAA 1U2YA 1LF1A 2D22A 4JKMA 4UFJA 3IANA 3QOMA 4Z2KA 3VX1A 1PJ9A 4OOUA 2QMJA 4F9JA 2GDVA 5F7UA 2BV9A 1PBGA 1VBUA 5D9MA 2GJXB 1NP2A 4LYPA 4QP0A 4U3CA 1QNRA 3RILA 3WUFA 2J74A 1BYCA 4AZGA 2CEQA 3MV11 1LL6A 3I3EA 2QV4A 2GFTA 1KXVA 3L4TA 3PBGA 3FNDA 1W2PA 2ZUTA 2G3MA 2J8FA 2XVGA 1OT2A 1C8XA 3JUGA 2XWEA 3GXMA 1BYAA 1I1XA 4LPCA 4W7WA 2XVNA 2WVSA 2DGAA 1Q6EA 1UHVA 1NWTA 3VMNA 1C3FA 4HA3A 3VDCA 3CZKA 1G0CA 1PIGA 1LWHA 1J01A 1VJZA 2JEPA 3NJ3A 1QNQA 1DHKA 2BVTA 4MAZA 4GPNA 3WNNA 4UZSA 1NOFA 4DUXA 2FH8A 2WMIA 4P8WA 5A6JA 3T0BA 3AS1A 1QI5A 3WD2A 4YHGA 1PEZA 1CEOA 4OOZA 1GQJA 4MAVA 2XIIA 1J0YA 1GW1A 2YIHA 5IFTA 1QW9A 1E4LA 4AW7A 4EKJA 2V38A 1QHZA 4KRUA 3VIFA 1KFWA 5A8MA 1CGWA 4TOQA 3GBEA 4E2OA 4M81A 2AAAA 4TVCA 1ODUA 1GONA 1UD6A 3M7SA 5JUVA 2DPEA 5CGTA 1W3KA 3L4ZA 2EPLX 2O9OA 5FIPA 5FL0A 3FHQA 3U7BA 4JFSA 2G4FA 2OWCA 5HOSA 1VEMA 1V0LA 1M7XA 5BRPA 2CNCA 3WDIA 4MTVA 1KXTA 5TD4A 1H2JA 1W9PA 3RO8A 2WHJA 2WLYA 1MW2A 1MFVA 4F8XA 3A6OA 3BAXA 1RD6A 2VC9A 1FFRA 5BYWA 1GOKA 2WM0A 3SUSA 2MANA 1R86A 3PZVA 3II1A 3ARQA 3WBAA 3QHMA 2XFYA 5IXEA 1JZ5A 4CCEA 2PF0A 3CMJA 4W87A 4DM1A 4PMNA 1HP5A 3F4VA 3VIPA 1MYRA 2CHNA 4W8BA 1HKKA 5IDIA 1E1EA 3N04A 3VILA 4RE3A 3W27A 3AMGA 3UEQA 1ITXA 3SCNA 2WMHA 4HTYA 3IJ9A 3T09A 1TE1A 1E72M 3ZT6A 1OSEA 5FKYA 3WL0A 4KGJA 3WF0A 2J8GA 1BGAA 4NI3A 2CBUA 3K4AA 2BHYA 2XJ7A 2G41A 1Y7VA 2PWDA 1BG4A 4JL2A 2QPUA 4J3TA 3ZJ6A 1W1YA 3AYSA 1M04A 4PBGA 4M80A 4W7UA 2D20A 2XGIA 4M24A 1J10A 1ZJAA 3T08A 3UR8A 5A6AA 1W3HA 3AIEA 4AIOA 1NOWA 2WCAA 1TUXA 1BAGA 3CZGA 4LQ1A 4WKAA 3RDKA 1EHNA 1F4HA 3SCUA 3I3BA 2Y5EA 1CECA 3AISA 1V3HA 1B1YA 1ODZA 3CO4A 1YHTA 3K8LA 4R5EA 4LYQA 4OZOA 1S46A 1GOIA 4AZ7A 3AHYA 2CBIA 3PZIA 1KR1A 4PMDA 4JKLA 1GOQA 1PZ3A 4AEFA 1W9DM 4NF7A 3BAJA 1JF5A 2DIEA 5GQBA 4Q7NA 2XVPA 3AOFA 4M1RA 1E9LA 4A4AA 3LPGA 4NRSA 1CLXA 2WHMA 1TVNA 2DT1A 5C71A 1IZJA 3HJEA 5A6LA 2D2OA 4XV0A 2EPKX 3L2MA 5LA2A 5AC4A 4A3HA 3FAWA 3WF4A 2OWXA 2VRQA 4AZ6A 1W3JA 2VR4A 2NW0A 4HOXA 4CKQA 2FH6A 3B8SA 4TXEA 4FLRA 3PZTA 3PZGA 1HKIA 3SCWA 4UFMA 3SCTA 2V5DA 1K9TA 1V3LA 2GJRA 3GM8A 3UETA 3WUGA 1UKPA 2ZX7A 1JXJA 3HMCA 3WH7A 3WDQA 5CSUA 7CGTA 2WXDM 1ZBVA 3OLEA 2PBOA 1NH6A 2CKRA 2UY4A 3CHCA 1OB0A 2ZWYA 3BC9A 1V0KA 3VIHA 3EYPA 4D6IA 2XHYA 1K6AA 1UZ4A 3W53A 3FW6A 3OGSA 5BXRA 5DO8A 4AD4A 7A3HA 5LYRA 4KH2A 4DM2A 2D0FA 2V5CA 3MU7A 3IJ8A 2CCRA 1Q6CA 4D6HA 4JFUA 1WDRA 4KWUA 2DH2A 4UQEA 5A69A 4PMXA 2NT0A 3BSGA 3WUBA 4Z2LA 3VTRA 4UOQA 1G1YA 1NWUA 2QLYA 4ATLA 3AYRA 4P8UA 1F4AA 1CXKA 1NP0A 3WL1A 5M3WA 1NM9A 2UY3A 1SFSA 3LPFA 2WMJA 3VD9A 3L2LA 1HX0A 2ZUNA 3AICA 1OGGA 4MDOA 4FLOA 1H0GA 4MJ4A 5E6YA 2VZVA 1WDSA 4HU0A 4CD7A 4AIUA 1FH7A 2ZX8A 3AIBA 1QI0A 4MDPA 4IPLA 1B3XA 1ISYA 2UWFA 1UH3A 2BHZA 2ZXBA 3NDYA 3B9AA 3OGVA 1JI2A 1CXLA 2YA2A 4AMCA 1W1TA 1VFMA 1IV8A 2E0PA 1K9FA 4CD6A 1J0KA 3VDAA 3MSDA 3SCQA 1LG1A 1E40A 2DH3A 1JYWA 5D8WA 5A8OA 3VGHA 2WAGA 1BTCA 1OIFA 2J4GA 4DUVA 1EQCA 1MFUA 4W89A 2G8ZA 3PZNA 1E55A 2J7HA 2VVNA 1W9BM 4FLSA 3G6MA 3GXDA 3IAPA 3NCOA 4UQ9A 3ARVA 5LA0A 3VIJA 3GH7A 1JYVA 3LPPA 3MUIA 3HU7A 1KWGA 5D9PA 4OUEA 3AHVA 1OCQA 2Y24A 2UY5A 4L4PA 1KWKA 4D6FA 2J25A 2D3LA 4ZEPA 2VVSA 2WW5A 4P7QA 1I1WA 4IM4A 4UZUA 1EO7A 4EAMA 1C90A 4UFKA 1SMDA 5JIPA 4CN6A 3AIVA 1GQLA 1TA3B 5ABEA 3MANA 2XYLA 4AZHA 2D1ZA 2A3BA 5I23A 1E0XA 3IJ7A 2XIBA 1WNOA 1CXEA 4JHOA 3WD3A 3CHFA 2WZEA 1QW8A 4QCEA 1ZJBA 2VQTA 1XRVA 1EA9C 4W5UA 4LXFA 2WC3A 4DWSB 1D3CA 3QOKA 4B3LA 1UKSA 4MNLA 1W1VA 4E4PA 1KGXA 3BSHA 4ATWA 2V3FA 3WDRA 1OD8A 2CPUA 2WSKA 4WKHA 2HISA 2YDQA 3VX0A 1E6ZA 1ZB5A 3M07A 1QVBA 4P7OA 1K9EA 5D9NA 3K8KA 4CUCA 3WEOA 3OLGA 2Y8KA 1HJXA 1SR0A 1W32A 4HMDA 3FN9A 3W25A 2ZUWA 1MW0A 5EMYA 1QHPA 1HF6A 3T2PA 1V3KA 2X05A 3WD1A 1WDPA 1IZKA 5HBFA 1PZ2A 3GNOA 1UD4A 3PZ9A 3WNOA 5A6SA 2DSKA 3CIVA 2WB5A 1PPIA 1JGIA 2V3DA 4B16A 4N42A 1DWIM 4B15A 1H49A 1VENA 5A2AA 5ABFB 3PHAA 1OT1A 5A2CA 3W0KA 1JXKA 4ZXLA 2ESCA 3ARSA 1GNXA 1ZBKA 3T0DA 2W4XA 2DEPA 3SEPA 2DSUA 2JIEA 3RM4A 4H41A 1QI4A 4D1JA 2QPSA 3FXYA 4HP5A 1A3HA 2JEQA 3WQ8A 2X8RA 4C7FA 1GVYA 1Q6FA 2W66A 3VD7A 3M6DA 1B30A 1CGVA 4AD0A 1UR8A 2JF7A 2WHLA 5ABFA 4J3VA 1R7AA 4ACZB 3AHZA 1W9UA 2W92A 4E8CA 3EMZA 4D71A 4KRTA 4MPKA 3BH4A 3EBVA 2JF6A 2X1IA 1TZ7A 4P8VA 4PUDA 4S3KA 5CLWA 5BROA 1CZ1A 2J47A 5CG0A 4U5IA 1JNDA 5DT7A 3RJYA 2YL8A 2CBJA 4ACZA 5A8QA 2NSXA 1K9DA 2AMGA 1JYNA 1E73M 4JFTA 9CGTA 3ECQA 1R7OA 3M46A 1KR0A 1J18A 2VURA 3SUTA 1QNOA 2YDRA 4QDMA 3TONA 1UH4A 2Y4SA 1AQMA 4U31A 3WEMA 2VT0A 1UWTA 1ECEA 3CZ8A 5BWFA 3DECA 4U33A 1VFUA 4WK9A 3RCNA 4D6GA 1E15A 5DEZA 1RPKA 3OIHA 5E0CA 2CERA 1X6LA 5BXSA 2YL9A 2DSWA 2YLAA 5A2BA 4M8UA 5GNZA 4J3WA 2D0HA 4BCEA 1SMAA 1CGXA 1KB3A 1FOBA 3A3HA 3K1DA 3ARZA 1UA7A 1UR2A 4NZCA 1KCKA 1GJUA 2EXOA 3ZR5A 4MNJA 2WVTA 4PSPA 3N15A 1V0MA 4PMQA 5DT5A 1H5VA 1GQIA 3AMCA 4MB3A 3WKZA 2F61A 1HXJA 1V6YA 2J77A 4QLKA 3CUHA 1DEDA 2WMFA 4MB4A 1OBAA 4HZ7A 1AQ0A 3VD5A 2EO7A 1HKMA 3AIQA 1BGGA 4CU7A 4BQ4A 1VEPA 4M82A 3ARRA 4GO9A 3VD4A 4PCTA 5FD0A 4GKLA 4WSKA 4UQCA 4UQDA 3SCSA 1V6UA 3SCOA 4YN5A 1HIZA 2WLZA 1NQ6A 1UR1A 2WVUA 4RE2A 3PZOA 1JD9A 1UWQA 2OYMA 4B9ZA 3SCPA 5HXMA 1R8LA 4HOWA 2Y8VA 1VJSA 1CXIA 2WKGA 5E70A 4D6DA 2BY2A 1Q4NX 4QLJA 1BFNA 2PWEA 1L0PA 4OIFA 1UQYA 5JBFA 2PC8A 4U2ZA 3ALFA 3AZTA 1JZ6A 1GZJA 5A1AA 3TTYA 3DHUA 4ML4A 1HL8A 1RH9A 3VM7A 5I24A 1UKTA 1KCLA 1E6XM 1NOUA 2J62A 3AXHA 4J3UA 3ZJ8A 3AS0A 1LJYA 1V3MA 3W24A 2XM2A 3BMVA 2DDXA 3K8MA 1J0JA 5E09A 3RPMA 3AHXA 2BY3A 3BXWA 1D2KA 3CUIA 4WIWA 4GI9A 2D23A 1HJQA 1HVQA 1W9XA 4AXNA 3N11A 1WP6A 2EPMX 2XVLA 4ZFMA 4AWEA 4FMVA 3KWXA 2OSYA 1ZBWA 2WCGA 4P7LA 5A6BD 1LQ0A 1JFHA 1EDGA 2WVVB 1B3ZA 1V08A 4X0NA 3GZAA 3PN8A 3MUAA 3WQVA 3TTQA 3CZEA 3VIGA 1B3WA 4X0VA 3FY1A 1PX8A 1MVYA 4BQ5A 3WD0A 1B3VA 2VL4A 4GIAA 3CZLA 3EDJA 2JE8A 3G6LA 3N12A 5M17A 3QHOA 2XFFA 2VNCA 2DT3A 2OSXA 4TTUA 3POCA 2BXYA 1QI2A 5A6MA 4UTFA 1LL4A 4BA0A 3VMOA 4ATDA 2G3NA 2XSAA 4K68A 1M03A 3L4YA 3VGBA 3WQ5A 4OBRA 3VKKA 1CIUA 3WDPP 1CENA 1PIFA 3A4AA 1UKQA 2C8NA 1HT6A 2WANA 3QHNA 1J11A 1OINA 6TAAA 5GPRA 5IHRA 3ZSSA 1O7AA 1E0VA 2A3HA 3AFBA 1XH0A 3QR3A 3OLDA 4MB5A 4QFUA 1C8YA 1KGUA 1PAMA 3VGDA 4AEEA 4EK7A 1FP9A 2O9PA 4J3XA 1C8QA 2FHCA 1BF2A 1VIWA 4F66A 3W38A 5I78A 1B0IA 1UWSA 1HJVA 4CVWA 1VEOA 1L8NA 4CN1A 4D6JA 2ZUMA 1US3A 3CPUA 3L4UA 2YL6A 2BXZA 5CXPA 2ZUVA 1JZ7A 1P6WA 2DT2A 3FHAA 1GOMA 2ZE0A 4TVUA 5CPTA 1TA3A 3WSUA 2Q8XA 2J7BA 3NYDA 2EQDA 4HPHA 2YA0A 2IXUA 1UA3A 4GINA 3THCA 5JBDA 1ZU8A 3WNKA 3BMWA 4V27A 5HDRA 3WD4A 1HNYA 4B3KA 4FK9A 1JAKA 3ZSTA 1E0WA 2X0HA 5A6BA 1KBKA 1XSIA 1HKJA 5BXPA 2ZX6A 1QHOA 5EFDA 3AROA 3VDHA 2CBVA 1CDGA 1UWIA 2VX7A 1SYTA 1XH2A 3SURA 2GDUA 4KMQA 5HPOA 2XPKA 4TX8A 3T2OA 2E9MA 3W28A 1MWOA 4TUFA 2EBNA 1KBBA 1UD8A 3W29A 3SUVA 3L4WA 3MKKA 4BQ2A 5A3HA 4TTGA 1BQCA 1C7SA 3GYCA 3CBWA 4XZBA 4JAWA 2VCAA 1RP8A 4WLCA 3ZQ9A 3AHTA 3LMYA 3KL3A 3ARTA 3WNLA 3MS8A 5DF0A 5FOOA 1JZ2A 5E6ZA 4TVDA 4CU8A 2VUYA 3IK2A 3EMQA 3TTSA 4AISA 2FHFA 4AYSA 1AMYA 1E3ZA 3BAIA 3VIMA 5AYIA 4HMEA 1E71M 1ZBCA 2ZUUA 1PX3A 1C91A 5E0FA 3ZM8A 1E43A 3APGA 3PZMA 2ZX5A 2XVKA 1Q6DA 4HMCA 3WBEA 2WC7A 3PTQA 2OLHA 2VI0A 3NSXA 4W5ZA 1HL9A 3O9NA 3BCDA 3WNPA 3GNRA 5C70A 4PMVA 2WMIB 1V6XA 3VNYA 2XTKA 2VZOA 2W62A 3EDKA 3L4XA 1H1NA 5IFPA 3PZUA 3CZJA 1ITCA 4HU8A 4KGLA 3KL5A 3WENA 4MJ2A 4HZ6A 3A47A 3K4DA 4D6CA 2XSBA 4BS0A 1XYFA 3VVGA 5CQ1A 2YOCA 4GI6A 2YJQA 4NRRA 2CHOA 3BLPX 2W61A 4MNMA 3WH9A 2VX4A 4PTXA 1QBBA 3VINA 2G3IA 2OSWA 3GTNA 4OKDA 1DWHM 3W81A 2JFEX 2J7GA 3UG5A 1IT0A 1E1FA 3BAKA 1Q6GA 4JKKA 5EFFA 5ABGA 1E56A 1EH9A 1TVPA 1LLOA 3KEHA 4PUEA 2W5FA 3RJXA 1E4MM 1VAHA 5JBEA 1H0IA 3VMPA 1KXQA 1XD1A 3BGAA 3SUWA 4V28A 4Z2JA 4JFVA 3AI0A 4ACYA 3WQWA 2J75A 5AY7A 1WAWA 3VGGA 4WF7A 1MQQA 1W9VA 3W6MA 4ZE4A 3WEZA 1JL8A 3NIYA 1GJWA 1W3LA 2X09A 2B31A 2J79A 1JZ4A 2VX5A 3AXXA 3BCFA 5CPSA 1QNSA 2J7CA 1ISZA 4IISA 2BVYA 1CTNA 1QPKA 1V02A 1QI3A 1JZ8A 7TAAA 5I5RA 3TP4A 1DP0A 1UZ1A 3U5UA 1J0ZA 2QHAA 4PTVA 3VD3A 1UYQA 2V3GA 2WMGA 4EE9A 1E6PA 4OBSA 4W93A 2FDMA 5I2UA 4Q22A 2BNJA 4C7DA 3D3AA 2BFGA 1YQ2A 4UNIA 3ZO9A 3MUZ1 2ZUSA 1CBGA 1OGSA 3KL0A 3FAXA 4EANA 1XV8A 2ZOXA 3NDZA 4UFIA 3VPLA 4AZCA 3WMBA 3B9EA 1DWJM 2EPOA 4AY1A 3AIRA 4HPGA 4JCLA 3GBDA 3WMSA 4W8LA 4D6EA 4AC1X 3POHA 1B9ZA 1ZS2A 3BAYA 3VGEA 1MW3A 1V3IA 4J3SA 3SIMA 5M5DA 1RP9A 3CH9A 3DYMA 2IUZA 1H4PA 3WIJA 3ARPA 1UH2A 4LX4A 1G94A 2F8QA 3ARWA 2PWFA 2WCSA 2VZSA 2YKKA 2GSJA 3A4WA 1BHGA 2VZTA 4UFHA 5CGMA 4AZCB 3WN6A 2W67A 4JL1A 1XSKA 2J7FA 3TOPA 1B3YA 3CHEA 2ZXDA 3UR7A 1B2YA 4J7RA 2WC4A 1JF6A 1JG9A 2XM1A 1QOXA 1M53A 2WWDA 4RE4A 4V2XA 3PZQA 3VOCA 1XGZA 4F79A 4P7RA 2WPGA 4PEEA 4CGTA 3WH8A 1LL7A 4PTMA 2OYLA 3VDBA 5HNNA 1JDDA 4XB3A 1BVZA 2VCCA 4W88A 8A3HA 1JZ3A 2DQXA 3EDEA 2E9LA 4XUYA 1WKYA 3SCRA 2O9TA 3AXIA 3VIIA 3VIKA 4ZE5A 1CWYA 1DWFM 1DWGM 1WCGA 2JIWA 3WFZA 1X1NA 1TFVA 1EOMA 2VZUA 4J27A 4DUWA 5JIWA 1DTUA 1G01A 1XD0A 1G9HA 2YDSA 2ZXAA 5CJ5A 2C7FA 3W82A 4CU6A 4NSBA 1FA2A 4N0RA 4Z2IA 1XYZA 4FLQA 1B90A 2G3JA 2WSPA 1TR1A 4U5KA 3ZT7A 1VF8A 3AZSA 3WUEA 5A8PA 4GZJA 4GO8A 1LWJA 2O92A 3ARXA 3RMEA 3OLIA 1W2VA 1Z32X 2WK2A 2E4TA 1OGBA 2NT1A 3O2LA 3WFLA 4UOZA 2OWWA 1HN1A 5D9OA 3QGVA 3RM9A 5I3DA 3K46A 3ZJKA 2E40A 1XCWA 1H11A 1WZMA 5LA1A 2TAAA 3CLWA 3VNZA 2VJXA 1XH1A 1E5JA 3CUGA 4PMUA 3SCVA 1E6QM 3ARUA 3CUFA 1N82A 3RIKA 2EEXA 3WY1A 1NWSA 3N17A 2C0HA 3WDJA 3CMGA 1CPUA 2J7DA 3F5JA 4H2CA 4ZENA 1UD3A 3AJ7A 1ISVA 2WHKA 3B9DA 5A6KA 2YBUA 3GDBA 4M29A 3UG3A 3WQ4A 4UR9A 4HA4A 1FHLA 2YBTA 4AZBA 1D7FA 4YPJA 4UQBA 5I6SA 2EPNA 3AQUA 3VO0A 3EMCA 3GXIA 6A3HA 2F2HA 5A94A 1EIBA 3CTTA 2VR5A 4GZIA 2BY0A 3VIOA 1JAEA 4AZ5A 4CN4A 2PI6A 1JFXA 3AIWA 4PSRA 2DSVA 1MXGA 1EDQA 1CGUA 4AIEA 4B9YA 2WYSA 4XX6A 2GK1B 4IUGA 5BXTA 2XWDA 1MQRA 3ZMRA 4A3YA 5ECUA 4CD4A 3O6AA 1E70M 5DFAA 4W84A 1VFOA 2BHUA 2GJPA 2YA1A 3WQ6A 3CUJA 1KXHA 2FHBA 3D5HA 2XUCA 2CIPA 2RGLA 4JFWA 3T0AA 1J12A 4W86A 3VGFA 2V3EA 1U33A 1UQZA 2DIJA 4BF7A 5EB8A 4PRWA 3NSMA 2GK1A 3NUKA 1HJUA 1XC6A 3MMDA 4CVUA 2VCBA 2WNWA 5EBAA 3S2CA 4JHZA 1VFFA 1W91A 4HZ8A 2CXGA 1TG7A 4Y7EA 1ESWA 3HN3A 3AIUA 2VRJA 2WBKA 2ZWZA 1WB0A 3MV01 5E9AA 2A3AA 1V02E 3ZJ7A 2VOTA 1C7TA 2A3EA 3S6TA 4BQ3A 2PWGA 2X0YA 1V3JA 1GOWA 4QCFA 1M01A 1CYGA 3OGRA 3UESA 1ISXA 1VRXA 5HPCA 3DHPA 1CGTA 4WKFA 1MW1A 4U3AA 1GORA 1FHDA 1DWAM 1OD0A 2A3CA 5D8ZA 5ABHA 4GXPA 3CGTA 1J9YA 1E4NA 1GQKA 3AS3A 3N1AA 1C92A 4MB1A 6CGTA 4JIEA 4RL3A 1J0HA 4TX6A 1EXPA 1EHAA 2E8ZA 1U30A 1GHRA 1R85A 2O9RA 4AZIA 2CYGA 1E3XA 3W26A 4PMOA 1OIMA 1ZL1A 1NWRA 3ZIZA 2AOSA 4X9YA 3CHDA 3N18A 4XZWA 1UR0A 3I3DA 4GZEA 4ZXOA 2UY2A 3LPOA 3WMCA 2E8YA 2IXVA 1FH9A 4AD2A 2VTFA 3KZSA 3MMWA 2BS9A 2CKSA 1WPCA 1H09A 2XG9A 4MADA 4L4OA 5A8NA 4BZYA 3MO4A 3WH5A 3ZOAA 3OBAA 5AC5A 4GQRA 4GI8A 1PX4A 4M56A 3N9KA 1MXDA 1H41A 4HA1A 2WKLA 2GJXA 4J28A 1UG6A 3VUPA 1UR9A 3GH4A 2D24A 1HJWA 2D0GA 1UWUA 1X6NA 3OA5A 1JIBA 1WZKA 1JD7A 3L4VA 2YL5A 4D72A 2RGMA 3AMDA 3A4XA 2CITA 3UERA 1KQZA 4H7VA 4UCFA 3IAQA 1FFQA 2HVMA
chains in the Genus database with same CATH superfamily
4A8IA 5C5YA 4XZ9A 3BOLA 4LYRA 2ISWA 1KGWA 3GHSA 4DO6A 3F5KA 1GHSA 3OODA 2E3ZA 3FEMA 4O10A 3C0LA 2L5HA 4CCZA 3TYUA 3N4AA 2XGBA 3YPIA 1LP6A 4R27A 4E5TA 2GVYA 3VM5A 3NR0A 4R9OA 3WDHA 1UJPA 4JEJA 4HK5A 4W7VA 4LT9A 4KBXA 4HN4A 5AYBA 1S2WA 1SGJA 3HO8A 4L1GA 3UA3A 3KVLA 1EYEA 4HCLA 4XIMA 5M03A 3PSWA 2VX6A 1WKFA 4NT0A 1K70A 1GVIA 4MSSA 3MSGA 4A35A 1WZAA 3G8RA 2OX1A 3REQB 1GVFA 5DMMA 1D8CA 4K6AA 3PPHA 4C6NA 1OFEA 5EMLA 3N13A 1AJ0A 3SRDA 3DC0A 4RE0A 5C8BB 1NU5A 5LNUA 2X2YA 1CNVA 5CBIA 4W8AA 3TZNA 2ODOA 1X97A 2OR2A 2OLAA 1NARA 4W85A 3IIVA 3PTMA 4KWSA 3L7RA 1HFBA 1JI1A 2VGBA 5TF0A 1A5SA 1DXFA 1G5AA 3CLMA 3T2QA 3GXTA 1I6NA 2CETA 2P76A 3MVIA 1IQ8A 1JDCA 4PN2A 1VB9A 1TCMA 3V18A 1GPFA 1KO0A 5TQLA 3NZPA 5I0DA 2YFOA 2NX3A 1J96A 3EXTA 4H8HA 5K9XA 1YW1A 3CU2A 5KEZA 4XIAA 2Z1SA 2QEZA 1E5NA 3S46A 3CS2A 4GWEA 1MRAA 3MMUA 5CSRA 1L9WA 1A47A 2J7EA 1GOOA 4P7NA 2QIIA 1BG9A 1FXQA 2VO5A 5GNYA 3WH6A 3VOJA 2X16A 3Q2DA 3NNTA 3T9PA 3OPSA 4K7VA 3GC2A 2BGNE 3AMKA 1WZLA 2RJGA 2H3BA 1F6YA 4IPJA 4HYWA 4IQJA 3NWRA 3QMRA 2VGIA 3RM8A 3HF3A 2WPBA 3G77A 1EPXA 3RR1A 4H8NA 3KBJA 4A8NA 2GVJA 3JVAA 3TSDA 3KX6A 3ELFA 3VUSA 5H8PA 4UR7A 3ARYA 1S2TA 1BKHA 2YX0A 3B03A 3GRIA 1ONRA 4JX5A 2ZIDA 3SJ3A 3F1QA 1D7KA 2WOQA 1AZ1A 3LCLA 2ZICA 5J5RA 4C6FA 3BW4A 3PWAA 3NO3A 2YLLA 4O50A 4UNLA 2J9XA 1YBQA 4RZ5A 4WSJA 4GQGA 1LT7A 3G18A 2IPFA 5F4SA 5D32A 4NU7A 2JGQA 3AYVA 2D22A 4RW5A 4S3EA 3IANA 4RW3A 2QMJA 3H24A 2GDVA 1VBUA 1EA0A 3CIWA 5SWUA 4QP0A 3CPRA 3TKFA 4XAPA 3SQSA 4AZGA 3BK0A 4S3DA 3I3EA 3IARA 2WZTA 3W75A 2E67A 1KXVA 3CWOX 3VXGA 1YADA 4C60A 2PMQA 2XVGA 3C2VA 5LSMA 5F1VA 2JQXA 3GXMA 4IIBA 4W7WA 3W7PA 1YEYA 1NWTA 4WQ6A 1YTKA 4K38A 2D69A 1C3FA 4GH1A 3CEUA 2EF9A 3CZKA 3G1FA 2GQ9A 5ABTA 1QNQA 1DHKA 2BVTA 4MAZA 3NO5A 4GLEA 2DVTA 2FH8A 2OPJA 2FYMA 4Z1DA 4LB4A 5AHFA 1QI5A 4JNYA 1CEOA 1Q7ZA 3DI1A 2XIIA 1GW1A 2YIHA 3LYEA 4M0XA 1QW9A 1E4LA 4AW7A 4KRUA 3O8AA 1CGWA 4E2OA 3LLXA 2AAAA 1ODUA 4UTLA 4GK8A 3N14A 4A21A 2EPLX 2O9OA 4UTUA 4ICMA 5HOSA 7REQA 3LZ5A 2PD5A 4IP4A 4L6DA 1W9PA 3OVRA 1TIWA 4FNTA 4H4IA 3QR1A 3QSRA 2XH7A 4LY4A 2FMOA 3R5EA 1GOKA 3PPCA 2Z1BA 3SUSA 4E2BA 1YKWA 2MANA 3II1A 3ARQA 1OF8A 2GSEA 3QHMA 1AL8A 4E4UA 1KFLA 3A13A 1Q7MA 4B91A 4O15A 3VIPA 2J9ZA 2ANUA 1W1B1 1LLZA 4HMNA 3N04A 4Q8WA 3VILA 3PWGA 1W5PA 3SCNA 3ABQA 2WMHA 2WJFA 5KZDA 4ECLA 1KRMA 2HS8A 4OHQA 1E72M 1ENUA 3HFTA 3WL0A 2J8GA 6XIAA 4NI3A 3TW6A 1Z89A 2G41A 4A22A 1Y7VA 1ZALA 4JL2A 2QPUA 4J3TA 3OO2A 2RUSA 1ELSA 2HDJA 2FB2A 1VPXA 3VKAA 4M80A 2FB3A 3NM1A 4M24A 3T08A 1ZJAA 2WCAA 5T9BG 4WKAA 1EHNA 4HCDA 2PU1A 4FHAA 1CECA 4XKYB 3AISA 4FR6A 4I7UA 1JPIA 1ICQA 3LK6A 3ZYZA 2CBIA 2AQVA 4DBSA 1KR1A 3R11A 4PMDA 3GR7A 4GIRA 4JKLA 3SI9A 2NUWA 4J1OA 4HJWA 1KA9F 2XVPA 3B0YA 3KWSA 2PU0A 2VEKA 4HK6A 2J27A 1RQHA 5G4EA 5C71A 5A6LA 4XV0A 3NFUA 5E0KA 2EPKX 3S5ZA 2VRQA 3S5OA 3W7IA 3MB9A 1W3JA 4HOXA 4CKQA 2FH6A 1EWEA 1A0CA 1HKIA 4KFNA 4UFMA 2V5DA 1K9TA 3UETA 4B4HA 4EF8A 1A5CA 3WDQA 5CSUA 4OE7A 4YTRA 2ZTKA 3FSTA 2PGFA 1XIJA 1XLGA 1X8FA 3FK4A 2G97A 1K6AA 1UZ4A 3PF3A 2HV5A 3G2GA 5DO8A 3GVRA 4AD4A 3B0UX 4J35A 1V8EA 2V5CA 3MU7A 4YTTA 4FX6M 1Q6CA 4D6HA 1FHVA 4HK7A 1XCFA 3BSGA 2PDJA 4PEKA 4Z2LA 4DO4A 4A8RA 4AF0A 3WLOA 1NWUA 4ATLA 2NXGA 3AYRA 4MWAA 5K9DA 2UY3A 2W27A 3P5ZA 3HPSA 8RUCA 3P80A 1KV8A 4FLOA 2PLCA 1H0GA 3TMLA 3VNMA 2VZVA 3ZVHB 3GO2A 1AG1O 4C91A 1QPNA 4AIUA 1FH7A 4DJDD 1YPFA 1JPDX 1VBJA 4MDPA 3BG3A 3GTFA 4IPLA 2UWFA 3GLCA 3DCPA 4MLJA 2ONEA 3L66A 1CXLA 1V93A 2E6AA 3C0QA 1H62A 2PTDA 3KTXA 3VDAA 3MSDA 4E38A 4FXRA 3O0KA 2XH0A 1LZOA 3UWQA 1RCOB 2PLMA 4FLSA 4PZVA 1W9BM 1L6GA 5BMWA 3NCOA 1J4EA 1IEWA 3C0SA 3VNLA 3MUIA 2YFNA 5J04A 3FYPA 2Z1XA 1KWGA 3AHVA 3QV9A 3MHUA 1GVRA 4DXVA 3GKAA 1KWKA 2R9RA 5LXXA 3LHUA 3FJNA 4S3FA 1I2RA 5FEZA 4I8YA 2VDHA 3EX3A 2XU2A 3MUXA 1DXIA 4DO7A 5B7YA 1PSCA 4NAFA 3WLHA 2XISA 4UZUA 1SZNA 4UFKA 2XH4A 1V4YA 1GQLA 3ANUA 4GOAA 2XZ7A 2D1ZA 4EX4A 1XLAA 3IGUA 2A3BA 5I23A 4LCSA 4JTSA 7XIMA 3GG7A 3RLUA 4CNNA 1CXEA 3WD3A 1L8PA 2H9AA 3CHFA 2WZEA 5G2IA 3T0TA 2YW4A 5F2MA 1A50A 3UZYA 3QSTA 2WC3A 4DWSB 1OYBA 1W17A 1UKSA 4MNLA 4E4PA 1KGXA 3KOWA 2QNEA 3WDRA 1OD8A 1F3TA 2YDQA 3K5XA 1E6ZA 1C9WA 1LLWA 3TW7A 1QVBA 5D9NA 2BWGA 1I0DA 3K8KA 1X98A 5AFDA 5CPLA 3WEOA 1TKKA 2OEJA 4C1LA 1HJXA 5BOOA 1PB0A 1Z48A 5D09A 1WBJA 1B57A 3C8NA 3ITGA 4OV9A 2QUUA 2DSKA 3PWIA 1EB3A 2WB5A 3HGRA 4HGXA 4ZQRA 4B16A 1JCLA 1DWIM 3G1VA 1KCZA 4H3DA 1U22A 3RUBL 5A2AA 5ABFB 3PHAA 1P1XA 1Z6KA 2WSYA 3W76A 1F6PA 2OZ3A 2W4XA 1DIKA 1QI4A 4H41A 3FXYA 4BI5A 3CYJA 5HQMA 2XIJA 3W7OA 1XLJA 1GVYA 1Q6FA 1LTDA 4DUOA 1UR8A 1DJNA 2JF7A 1I9CB 3H8AA 1Q45A 5ABFA 4NZFA 3QC3A 1PWLA 4EWJA 3EMZA 2NZLA 4JTGA 3KBWA 1LDCA 4UTIA 2C15A 3DHDA 4P61A 4MPKA 3BH4A 4Z08A 2JF6A 1TZ7A 3DGRA 5HULA 1KKOA 2DZSA 4GBUA 4JQAA 3JZEA 3W23A 5CLWA 1DIDA 2J47A 2JKEA 3C3NA 4RDYA 4U5IA 3JS3A 4HU3A 4KEZA 3GU9A 1JNDA 3RCYA 4JTUA 5DT7A 4MKVA 5CC7A 1K9DA 2AL1A 3TE9A 1OX5A 4BY3A 1SJCA 4DF2A 3PBUA 3RU6A 9CGTA 1W6TA 4DO5A 3R0UA 1J18A 1VH7A 3B3DA 4XKMA 4M6VA 3KCJA 4AHPA 1TZZA 2VT0A 4J5NA 1UWTA 3W02A 3DAQA 3ANYA 3W7CA 3CZ8A 5BWFA 2X2GA 4QQUA 3QYQA 1TMHA 4TIMA 3UXKA 2EKGA 1VYRA 4HNLA 5DEZA 3AUJA 1ZLPA 3QN3A 4AB4A 4WDXA 5E0CA 2PDXA 4I5XA 3SSZA 5BXSA 5CEWA 5A2BA 4GI4A 1XLDA 3M9YA 4JD4A 1A4LA 5CZTA 1U5HA 4AU0A 3GTXA 3A3HA 4JTAA 1UA7A 1KCKA 2QCDB 1JEZA 3HQOA 4LNYA 4GHRA 4UMBA 1OEPA 4ZQOA 5C9XA 5U4NA 4QDWA 5DT5A 2PDQA 3NZ1A 1H5VA 3AMCA 1V6YA 2DY3A 3SFKA 3BJFA 1DHPA 4X22A 2WMFA 3VD5A 3AIQA 3QFWA 4CU7A 3C5QA 3HBLA 2PDNA 1VEPA 1JPKA 3GVVA 4PCTA 2HMCA 1Z3NA 3WLJA 4UQDA 4IZGA 3MHGA 3MP5A 1V6UA 1HIZA 2WLZA 1UR1A 2V8ZA 4DBEA 3Q45A 2O7QA 3F2BA 3NZRA 4B9ZA 2BOEX 3OYXA 1GQNA 4HOWA 3K4WA 3E0WA 5AHNA 4OIFA 3GE7A 1RUSA 3M7WA 4US5D 1Q6OA 4ZMGA 1XI3A 1SQ7A 1X8CA 5A1AA 3TTYA 3DHUA 3OVGA 4E3TA 4F0HA 1E6XM 1NOUA 3AXHA 2E6YA 1LJYA 1V3MA 1Q7QA 3K8MA 3QV7A 5CAHA 3A5FA 4GI9A 1HJQA 4GY0A 3W83A 5JQ9A 1HVQA 1W9XA 3N11A 4IL0A 3GIPA 4ZFMA 4IIFA 4FMVA 3KWXA 2OSYA 2ZDSA 1EYWA 4P7LA 1EEXA 3WK2A 3WQCA 1MUWA 1JUEA 3WQVA 5HNRA 3DESA 3FY1A 3RR4A 4BQ5A 1WXJA 4A05A 3O07A 4KW2A 2DZPA 2CW6A 5M17A 3IJDA 3PP7A 3QHOA 2XFFA 1XL9A 5LIKX 4IFKB 4Y90A 2VXNA 3BANA 1QI2A 1WA3A 5T9CE 4ML9A 4BA0A 5F1UA 2G3NA 1C9DA 3LTPA 4K68A 2ZVRA 4D2JA 4AWSA 4QE5A 4CQBA 4MYAA 3AWNA 1CIUA 3RCMA 1AMKA 1PIFA 3A4AA 1BRLB 1P0NA 2HK0A 3W7QA 4PCFA 1A5UA 3AFBA 4MB5A 3EOLA 1C8YA 3LCIA 4EK7A 1IR2A 1FWDC 1DVJA 3P81A 3TK7A 3WO8A 4J3XA 4XD3A 5I78A 3KHDA 1HJVA 3E3HA 3WX7A 3IVUA 1O66A 3E02A 1S5VA 3C3UA 4CN1A 1H50A 4XTDA 1GZ1A 3GKFA 3IJ6A 3L4UA 2YL6A 5CXPA 2Y7FA 3LA4A 4ZCWA 2R24A 3FHAA 1GOMA 2ZE0A 4TVUA 5I07A 5CPTA 4CQCA 3NYDA 1GKPA 4JNZA 3LCHA 2ZRXA 2B7OA 1Q2SA 2YCLB 2ZCGA 4E0CA 4IMEA 4IJBA 3HG5A 3KBNA 5F4XA 1ME8A 3V75A 3BLLA 3CHVA 3G1XA 3UPMA 5HDRA 3MA8A 3B40A 1AW1A 3GNDA 5HNUA 4B5XA 1E0WA 2X0HA 3NQ8A 1KBKA 1XSIA 1HKJA 1XLMA 3HZ3A 2ZX6A 3AROA 5AZ0A 3VDHA 5C9ZA 4M1BA 1PKMA 2VX7A 4P2VA 1T96A 1W31A 3I4KA 2I56A 5HNTA 1T0OA 2E9MA 3KCLA 4YNGA 4TUFA 1GKQA 2KX9A 3W29A 3L4WA 2B81A 3MKKA 1YPXA 4DI8A 5A3HA 1BQCA 3PANA 1XBZA 1VPQA 4FXJA 1TV3A 5D2TA 2P1FA 1F6KA 2VCAA 2AAMA 4LUTB 3LMYA 3E5BA 4EXAA 3MS8A 3BW2A 4ZOAA 1W3TA 5FOOA 4F2UA 5E6ZA 1JZ2A 4HSHA 1AUSL 4CU8A 4LRTA 4PR4A 4AISA 2PF8A 4JTCA 3WQGA 4K1GA 3BAIA 3VIMA 3IACA 5AYIA 2GVEA 5I3JA 1D9EA 2HPMA 2ZUUA 2A7NA 3TYEA 1C91A 4LS0A 3TQ0A 3TV8A 3FGCB 1PXGA 2WC7A 5C2XA 5LHFA 3BCDA 1FWCC 3C61A 2WMIB 3VNYA 2VZOA 2QJIA 4IXXA 3W3OA 2ACQA 2OT1A 3L4XA 4I5RA 1VHCA 1ZZMA 3UVIA 4L9YA 3KL5A 5IDZA 1G67A 4DB7A 4ZQNA 4UXDA 4LEQA 1TSIA 1EJUC 3K4DA 2PS2A 3F03K 4XAYA 1H61A 1VQTA 1FX6A 1FWAC 1MDLA 6XIMA 4M6PA 2P53A 3CMFA 3N6HA 2W61A 3G22A 3PNUA 4RNHA 1XQLA 5C0QA 2D2GA 4IGHA 2OSWA 3HPAA 5DN1A 3VKBA 1K03A 3CV1A 2J7GA 1H63A 3ZVHA 3PAOA 4YMZA 1R3WA 2PGRA 1IGWA 1OJXA 3NPWA 1O5RA 5EPDA 5AC7A 1W8SA 5ABGA 3KEHA 2OG9A 4PUEA 5JBEA 3NGJA 1H0IA 3W7RA 2OEMA 3VMPA 4AEOA 4XTIA 4Z2JA 1NJJA 7ODCA 1PCWA 4MKNA 3LXCA 3NIYA 3W71A 1GJWA 1W3LA 3OEXA 3PK7A 4KF1A 2X09A 2VX5A 2QCFA 3AXXA 5AYXA 3BCFA 1QNSA 2OKTA 3LBOA 2J7CA 3SSJA 2BVYA 1V02A 1JZ8A 4E6MA 4Q4RA 1UZ1A 4RPPA 1J0ZA 3JU2A 2Z27A 4OFCA 2AL2A 2V3GA 4EE9A 1E6PA 1ZQ5A 3H26A 2FDMA 4N6EA 1P7TA 2BNJA 1EJWC 4DRSA 3ZO9A 3R6IA 1Y65A 1KV5A 3LGGA 3A9IA 2BGQA 1UWAA 4Q7BA 4KFOA 4X63A 2CFFA 4EANA 3NQ6A 2Q01A 1AA1B 1XIIA 2ZOXA 4JQ4A 3T78A 4Q8UA 3UA4A 4PRRA 2C1IA 4AZCA 4Q8MA 2UV8G 3PBYA 1DWJM 2EPOA 4AY1A 3G1RA 3AIRA 5BU9A 3WJZA 4D6EA 1TPVA 3POHA 3VGEA 2E1WA 1FWHC 1MW3A 1M9HA 1TO3A 1RP9A 3DYMA 1H4PA 2PDHA 1UPPA 3TXZA 2F8QA 2YKKA 2GSJA 2QW5A 3L65A 3VYLA 1FWFC 4DI9A 5DCBA 3S5NA 4UFHA 4QSHA 3A12A 2WZMA 1PTGA 3WN6A 3H2EA 3N25A 2W67A 3QQ0A 3MZNA 5D33A 4F2BA 2J6XA 3UR7A 3RHGA 3GXNA 3NGFA 4H6RA 3TCSA 3VOCA 3P60A 4CGTA 5TAOA 3LY0A 1LL7A 3VDBA 3PR2A 5EMJA 4XB3A 1RK6A 4QS5A 1QXLA 1E9YB 2HBVA 4PMJA 4OWGA 2QJMA 4AHQA 2VHLA 4XUYA 4N02A 3SCRA 2O9TA 4HSNA 3VIIA 4DELA 4B2DA 1OG6A 2PDUA 4ZE5A 3UJRA 1DWFM 1WCGA 2JIWA 1J6OA 4NI8A 4V1XA 3UJEA 5JIWA 1I2NA 1DTUA 2KAUC 4XD5A 1XGEA 4QG6A 1G9HA 2YDSA 3H55A 5HMDA 4JY9A 1O1HA 2C7FA 2HK1A 4F0KA 4NSBA 4KWOA 1FA2A 3OZMA 3TUUA 4N0RA 1Q65A 3HQNA 5C2GA 3TDFA 2RAGA 2GGJA 2G3JA 4UC5A 3L21A 3WUEA 5A8PA 4GO8A 1LWJA 1XIBA 4KIEA 3O2LA 3DX5A 1J2WA 5D9OA 2PAJA 3QGVA 4H9UA 2WKJA 3RM9A 2DZBA 3EAUA 3K46A 4GCXA 3QPZA 4WX2A 1F7BA 3A9BA 1BKSA 2PP1A 5FACA 1DORA 3VE7A 3CLWA 2VJXA 4JTLA 3MJMA 4NIRA 4OQVA 4I8DA 4POCA 3KTCA 4CLMA 3G1HA 3IWPA 1EP2A 2PLJA 2J88A 3N17A 4ADSA 4RNJA 4GA8A 4Q8NA 3CMGA 2PDPA 1WXYA 1ISVA 3QFEA 1NIUA 3G1YA 3B9DA 4ZBCA 3GDBA 2KZHA 3RG6A 3WJSA 2EG6A 4HA4A 3WK0A 2YBTA 4XAZA 5FAGA 2BOFX 3S4TA 3CAWA 1PZ1A 5I6SA 2VWTA 1A3XA 2NQZA 4GISA 3AQUA 3GXIA 3P2VA 6A3HA 3N34A 2DZWA 5A94A 4JYDA 3VIOA 4O53A 1L2QA 1EF3A 4AZ5A 1YDVA 3THQA 3QPEA 4CN4A 1EBHA 2PI6A 3LLFA 1JFXA 1VFSA 2QCMA 5CAKA 1MXGA 5J8LA 1VLWA 5BXTA 2XWDA 3MP3A 4A3YA 2ZVIA 3O6AA 2XN1A 4LB3A 1W1IE 3N19B 2ATMA 3P0XA 5KINA 2FHBA 1PZ0A 2CIPA 3BSMA 1K4GA 1J12A 3EA2A 2FVMA 1POKA 4A3RA 2DIJA 1TX0A 3LU2A 3CV7A 4HZMA 5EB8A 4PRWA 3TFXA 3ZZ1A 3WLLA 3NUKA 2VCBA 3HB9A 4LVFA 2GSHA 4JHZA 1VFFA 4HZ8A 2F6UA 2CXGA 4GX8A 3DEQA 4Z0SA 1WAUA 2V9DA 2VRJA 5E9AA 1V02E 3S6TA 4BQ3A 2YCLA 3GQYA 2GQ3A 4ZO6A 1GOWA 4HYRA 8XIAA 2FZBA 5HPCA 3DHPA 1MW1A 1LBFA 1P43A 2F38A 4U3AA 1EJXC 1SUXA 1K8XA 2A3CA 3HTWA 1MRQA 1E4NA 4XZNX 3L5AA 3QW3A 3C52A 3NZQA 4B92A 2ACSA 2Y61A 3MCMA 1P6CA 3KDNA 5FJTA 3LRMA 2JKPA 3KVJA 4ZQPA 2O9RA 4A3UA 2YYUA 4GACA 3E0VA 1ITQA 1O12A 1SFTA 3N2MA 4R7WA 1OCJA 3SRFA 1EXBA 1X6UA 3TSBA 4ZXOA 3IV3A 3SY5A 1FH9A 3H23A 2CKSA 4GRSA 6ENLA 4JTEA 2PTYA 4IIDA 4V33A 3P3BA 2HNEA 3OBAA 2CLKA 1PCKA 1VLIA 3TCEA 1P0EA 2FJKA 4JEQA 1J93A 4K7YA 2C3ZA 1H41A 2HXUA 4LU0A 3GH4A 4RNFA 4RXFA 1ZJHA 3LHWA 2YYTA 3EX6A 3DI0A 3Q4DA 3DU0A 3NQFA 3GAKA 3L4VA 4JTTA 4D72A 2OCZA 2CITA 2OQLA 1ECQA 1KQZA 1FFQA 4YYFA 3N4FA 4C6LA 3DFPA 4Z2GA 2WJDA 3B8IA 2JALA 1I2QA 1E6NA 4CD5A 3KRUA 4GH3A 3UY7A 1GJPA 1HJSA 3BV4A 1R3RA 4S38A 4B2DD 4AD1A 1FKWA 1O6IA 3THDA 1UUQA 1JYXA 3UW6A 1IWAA 4BWLC 3H22A 4JCMA 3V0UA 3UJFA 3GU2A 5I79A 2I57A 2HXTA 3BAWA 5BOFA 1V6VA 2R1NA 4XISA 4DF0A 1FP8A 1BYBA 2E09A 3HGJA 3CQ0A 5LGXA 2VMFA 5E9XA 4PTNA 1UD5A 3MO7A 5HWNA 1A5KC 1KQYA 1HP4A 3EWWA 5C7VA 2B7PA 4LY8A 3WF1A 1BF6A 5MHBA 1ADOA 3AS2A 2RJHA 4Q4KA 3Q67A 4S3JA 4DXXA 1ISWA 1EDTA 4AIBA 3R8GA 3VKDA 3U5YA 3A3XA 2DSZA 3QEZA 4B5WA 4JTHA 2FZDA 3MC5A 3WNMA 4AD3A 1UWRA 4G1NA 3S47A 1E6SM 4UQAA 5HMEA 3ABZA 1KM5A 3SN4A 3OVQA 4FSAA 4TMCA 1BSIA 3OG2A 4O57A 1HZYA 2PBGA 1UKOA 2FFCA 3WF2A 2Z2UA 1R30A 3S9IA 5FL1A 1BVNP 4X60A 1FH8A 4OJYA 1B31A 2AL2B 4LS2A 2Z1KA 4QR6A 1W8GA 4OVXA 1LWIA 3VAVA 3R12A 4IMGA 1BVWA 5DANA 4O13A 3ZR6A 3QRHA 5D4YA 3WELA 1E4IA 1V0NA 1EUNA 4IFRA 1KNWA 3F7JA 3QZAA 4H04A 3MDUA 2PDMA 4NAFB 4MNKA 4CD8A 1OCBA 4FX7A 4C7GA 3OZOA 4QQ3A 3OIXA 1KFCA 1K4HA 2QZRA 5I77A 1KM3A 2W63A 3W1PA 2DUAA 4XQ6A 3LX9A 4U2YA 1BLIA 3GFYA 1CB7B 5CPQA 4Q8TA 1G4SA 3W37A 3UJ2A 1SW0A 5K2ZA 3EPMA 4R7OA 3RITA 4JIHA 3U7VA 1Z7AA 2G5WA 3I7SA 1J5TA 1SO5A 2Y2WA 3OZPA 5IHSA 2X42A 1A5OC 2QF8A 5DELA 5CLTA 1GUVA 3SY8A 4O16A 3GH5A 3H7UA 1TMQA 2XN2A 1K1DA 1F2JA 3ZT5A 2Z6JA 4H01A 1S1RA 4O18A 4JTJA 2EAWA 1US2A 2W91A 2J78A 2FGZA 2ZXQA 4AD5A 2BX7A 2NSOA 1XIGA 5DXYA 3DFQA 2QMKA 2DP3A 4MVAA 2XH2A 3SGZA 3USBA 2Y88A 1WO2A 1TB3A 1TWWA 2X41A 4C5YA 2BDQA 3C86A 4LVDA 1U2YA 5DCEA 4H6EA 3MMTA 4Z2KA 2CLHA 2NV9A 3SM0A 3VX1A 1OF6A 3IRDA 4H7CA 1NF0A 3LI1A 5F7UA 2BV9A 5FJUA 5C6MA 3PUDA 4LYPA 3MVTA 4MG4A 3ITXA 4U3CA 5FEPA 1QNRA 2C6QA 3RILA 3WUFA 4AUBA 3XISA 3RPTA 3LSCA 3T55A 5DRIA 1BXBA 2ZUTA 8TIMA 2G3MA 3AAMA 4L4LA 1UC4A 3PSVA 5KZEA 5DBUA 3PC0A 3STFA 3SW6A 1UHVA 3EX4A 4C1NB 4GJIA 4IX0A 4RV3A 3VDCA 1PIGA 1LWHA 4GYPA 2FMNA 1J01A 1VJZA 3FIGA 3NJ3A 4S3AA 2WMIA 3VCNA 1RQBA 3O6YX 3T0BA 4JGDA 3AS1A 1NDVA 3RPDA 5E5CA 1JCNA 1GQJA 1L6YA 4NZ5A 2BASA 2AMXA 4US6A 3VZXA 3NURA 2VFDA 4EAYA 1QHZA 2V30A 3BG9A 5A8MA 3H2FA 4TOQA 4Z17A 3GBEA 5DQPA 4AXKA 1OK6A 2ISSA 1GONA 4WZHA 1RA0A 3TZFA 2FZNA 2QGHA 4XZIA 5FIPA 1DJXA 2I7GA 2G4FA 2OWCA 1KLZA 2Z2BA 2E5DA 5CPNA 1KXTA 2WHJA 5BW6A 1MW2A 2VC9A 1BQGA 2X7WA 3PZVA 3M5XA 3WBAA 3T8LA 3N29A 1UR3M 5MKGB 4YWIA 3WLTA 2HSAA 3HPFA 1HP5A 3F4VA 3E0FA 1LCOA 4W8BA 1TYGA 5XINA 4YTQA 4S2BA 1EJ7L 1QR7A 4LV4A 4CNPA 3UEQA 4NYUA 1RJQA 3RAOA 4AHOA 1TE1A 3KCOA 5FKYA 4KGJA 2RHGA 1LRTA 3K4AA 2PWDA 1I45A 2XFWA 2JK2A 1QCWA 3O06A 3ZJ6A 1FBAA 3AYSA 1M04A 4W7UA 3O7UA 4UCGA 2VP8A 4DBDA 3UR8A 4A29A 5C55A 1FCBA 3IVTA 3FVDA 4WXZA 4AIOA 1NOWA 1TUXA 3C2RA 3CZGA 1MUCA 4LQ1A 4Q4MA 3RDKA 4B4FA 3SCUA 2QKFA 1WKDA 1OFOA 2Y5EA 5XIAA 1FY6A 1B1YA 3CO4A 4LVBA 3K8LA 1JULA 4LYQA 5EYWA 2VEMA 2OELA 3AHYA 3PZIA 2WJZA 1SZGA 2ICSA 1GOQA 1PZ3A 4N2YA 2QCLA 1XBVA 3QZ6A 2DIEA 1XUUA 5GQBA 2QCDA 1E9LA 1Q4WA 1PKLA 4I90A 2DW7A 4HT3A 1RXOB 3PUEA 2YPIA 4ZSUA 3R8HA 3HJEA 1TV2A 2D2OA 4QG8A 3ATYA 5LA2A 3L2MA 4AZ6A 4IJRA 5G2WA 2NW0A 5K9CA 3WK3A 4FLRA 1KM4A 3PZGA 4CQDA 2BG5A 3LG3A 6PTDA 2ZX7A 3H2MA 1JXJA 5T8GA 4O0ZA 2DQWA 5CC6A 7CGTA 1R2TA 1ZBVA 2OOFA 4GQBA 1K7XA 5AHLA 1X38A 1OB0A 1V0KA 4AH7A 2EKCA 3VIHA 3TU9A 3XIMA 4D6IA 2XHYA 4UTWC 3AXMA 3FW6A 2QAFA 2J13A 1X7IA 1TPDA 1PS9A 4CEXC 3U0HA 3LN3A 7A3HA 2PFHA 3KOYA 5LYRA 4R85A 3URNA 2CZEA 2ALRA 3SFWA 3IJ8A 5HK4A 3AYTA 1THFD 4JFUA 1WDRA 2DH2A 1MEIA 4UQEA 5A69A 2NT0A 1VCVA 4HJFA 3GIQA 3W1NA 2I1OA 4LYKA 4P8UA 1NP0A 3WL1A 2RDXA 4Y9NA 1NM9A 3VD9A 1S3TC 2VD9A 1YX1A 2ZRUA 3M0VA 4S1FA 4M7TA 4OBTA 3GDMA 4CD7A 2ZX8A 1A5AA 2NX9A 5D2YA 2PGWA 1NAL1 3VZYA 2BHZA 2ZXBA 1KTCA 3B9AA 3OGVA 2B7NA 3COTA 2INFA 1TPWA 3ZLHA 1J0KA 5MF5A 1FWRA 3TN3A 1EIXA 3VDGA 4DY1A 3E74A 1JYWA 4JQ3A 5A8OA 2CU0A 4ES4A 4D8LA 3VGHA 2WAGA 1BTCA 2J4GA 4LS1A 3T1GA 4DUVA 4FNSA 1X1ZA 2G8ZA 1E55A 3BQ6A 3G6MA 3RMJA 3IAPA 3LPPA 1K77A 1R3SA 4H9YA 4E2DA 1OCQA 4F0LA 2UY5A 3GTHA 4L4PA 1W1ZA 3TA6A 1TVLA 1VYSX 5FF4A 4E4FA 1AH3A 3GNXA 3EWCA 1LT8A 3NDOA 3BV7A 4ZEPA 3WBWA 2WW5A 4ZOCA 4EAMA 4Y96A 5HANA 5G5IA 1KFKA 3CAQA 3E0LA 4O0KA 1TA3B 2XYLA 3NQDA 2HRWA 4JXCA 1E0XA 1JDEA 3IJ7A 2XIBA 1YNYA 4JHOA 1FVPA 3TN5A 1CX9A 5KZMA 1XRVA 4LXFA 3Q58A 4ZO8A 2POTA 1VPYA 2CLOA 1EKOA 3M64A 2YXXA 4ATWA 5I03A 5G4WA 1XYAA 4OV4A 2CPUA 3S5YA 2CZDA 3VX0A 3G3MA 1REQA 3WBYA 2EJAA 1OX4A 4JYEA 1K9EA 4ZFCA 3DHFA 1MZRA 3U6WA 2W6RA 2R6OA 4ZB2A 4L65A 3OLGA 4RK8A 1S5TA 1W32A 4XAGA 4HMDA 3QMTA 5JMUA 1IR1A 2X05A 1QO5A 1PZ2A 1TJ0A 4HU4A 1XRFA 3GNOA 1UD4A 2P10A 4GXWA 1O4UA 5A6SA 2VFEA 3AU2A 4N42A 1H49A 2HVOA 4Q4OA 2G0WA 5HMFA 2QR6A 3MWAA 1UBPC 3IIOA 1JUKA 3ARSA 1GNXA 3IPWA 5DLCA 4LCRA 4PB3A 3IJIA 4WCJA 5FF2A 2JEQA 3WQ8A 4JN6A 1CW2A 2X8RA 4C7FA 4PODA 3G0UA 4Y2WA 1RBOB 1PE1A 3UYIA 4AD0A 4GFSA 3DC8A 4ACZB 3O6DA 3N2XA 3SADA 4YTUA 3U4FA 3QVQA 2FIQA 4DJEA 1AL7A 1DE6A 3PG9A 4GG9A 4K36A 4PUDA 3U2EA 5PTDA 4GX9A 3BOXA 3LOTA 1FUYA 4O28A 1VFTA 4GJJA 4XBSA 2Y5SA 2YL8A 2CBJA 1MXSA 4ACZA 4YIWA 5C9RA 1E9ZB 4FXSA 1SJAA 3LENA 1UZHA 4JFTA 2OQYA 3ECQA 4AX7A 3M46A 1XXXA 3WQDA 2CLIA 4QDMA 2Y4SA 4RDVA 4U31A 4FIRA 1TUFA 2WO5A 3W6YA 1P0BA 4YL2A 1ECEA 4O1BA 1SO4A 1I2OA 3DECA 1CI1A 4GBDA 2AQOA 4Q8PA 1VFUA 3AJXA 2HBXA 1E15A 3EWDA 4JICA 4AMAA 3OIHA 1RD5A 4XKYA 1VGAA 4BR1A 1GT8A 3N73A 5EMKA 4M8UA 2PTZA 3NQMA 2D0HA 1O60A 1IXQA 1CGXA 1FOBA 3ID7A 1IWPA 2ZBTA 3ARZA 1GJUA 1IT7A 4B5VA 2EXOA 3RRXA 1OC5A 2EHHA 4WHBA 2BMBA 2WVTA 4L64A 1FDYA 3LBMA 3WKZA 4QSFA 1HXJA 2PP3A 3FJ6A 1OBAA 1AQ0A 1P7TB 4O52A 5HJXA 3GDRA 1TIMA 3RGTA 1HKMA 5E1QA 4M3PA 3MTWA 4B5SA 2YCIX 2Z26A 4X9SA 4ADTA 2C13A 3ARRA 4H9VA 4GO9A 1ONEA 1W5QA 5GJMA 2R91A 2ACUA 4HNCA 2XSXA 3O6CA 1EEPA 1K7EA 1HO4A 2R1MA 1KFBA 3SCPA 5HXMA 1R8LA 4MJMA 4NP7A 5E70A 3CAVA 4LBSA 4D6DA 2BY2A 1BFNA 1L0PA 1QK2A 1XINA 5EBUA 1Q8AA 3BDKA 3AZTA 1GTHA 2W79A 3M0ZA 1JZ6A 1RH9A 3VM7A 5I24A 1YIXA 4NNAA 3W24A 2XM2A 3RXZA 4JNMA 3H2NA 3RPMA 3ZWTA 1MZHA 2BY3A 3CL8A 4DPPA 1D2KA 2ZRVA 2DZAA 4F4RA 1EBGA 2D23A 2OQHA 5EKYA 3RNDA 1BEUA 1N8WA 3VOIA 1WP6A 3B04A 1RLCL 4IMAA 1SVDA 3W86A 2RFGA 3BZJA 3A21A 2WCGA 1CCWB 1EDGA 3GZAA 4WJEA 4EIVA 2FLIA 3TTQA 3CZEA 3VIGA 4R3UA 4X0VA 3CO8A 3WD0A 3EKLA 3CZLA 3HG3A 1QK0A 3TWAA 1MMFA 4FOJA 3G6LA 4G6CA 3IEBA 2NLYA 3KAOA 1LQ2A 3S1VA 2VNCA 2PDGA 3ITOA 4NYYA 3GHUA 3UR2A 4TTUA 3S0CA 5D04C 3GWQA 4GGBA 3VFLA 2XSAA 2QYGA 3W1XA 3P74A 1K8CA 4ZTYA 3L67A 4V15A 3NVTA 4WGXA 2WANA 2VEIA 1EUAA 4S2CA 5GPRA 5FAJA 2ON3A 1XH0A 1XYCA 1E0UA 1XIDA 1PAMA 1Q6LA 2ZZ6A 3R0KA 3UZJA 1F07A 3N4EA 3Q37A 3CWHA 3N2BA 1BF2A 1VIWA 4F66A 1NELA 1XUZA 2R94A 4IUOA 2VYOA 5HQLA 5ENLA 1L8NA 2HROA 1A3WA 2ZKMX 1DKWA 1T6MA 3OQEA 2GPTA 3G1DA 4DVOA 1US3A 2G50A 2Z29A 4DEFA 2BXZA 1XLLA 1OC6A 1P6WA 3CB3A 2J8TA 1TA3A 2NUYA 2VEFA 2IPWA 3WSUA 2J7BA 2OKOA 4HPHA 1SO6A 4PCPA 3DG3A 1T7LA 1UA3A 3CXOA 2YB1A 3BMWA 4HYVA 4UTMA 2OO0A 2ZADA 4B3KA 3QY8A 1JAKA 2DJXA 2HVNA 3ZSTA 1JQVA 1QDSA 4ERAA 5EFDA 4EPBC 1OY0A 1KCXA 3SURA 2GDUA 4KMQA 5HPOA 2XPKA 4TX8A 3UZXA 3UWEA 3W28A 4MKSA 1EJSC 5H8MA 4TTGA 1C7SA 4LUYA 3M5ZA 3PULA 9XIMA 3NO1A 3CBWA 3H4GA 5JH1A 4JAWA 3FDGA 1RP8A 4ILSA 3KL3A 3V5CA 3W2MA 2DV0A 4KETA 2OODA 1Y5VA 1FWGC 1O5KA 3TTSA 2FHFA 5D02A 4HMEA 2QGYA 5LNVA 3LCWA 4G56A 2OGJA 1KFJA 4B5NA 1Z44A 5CG7A 4C6PA 3APGA 3PZMA 2E28A 1Q85A 3WBEA 3PTQA 3NSXA 2OX4A 1HL9A 3DFHA 4MFDA 5C70A 3KOFA 2GQ8A 3CPGA 4JDBA 2P3EA 5CBBA 1GEQA 5H1WA 3QM3A 1H1NA 3PZUA 1ITCA 1P1MA 4MJ2A 1VKFA 3TROA 2GWGA 4HHPA 2V6AA 4DJDC 3A47A 4C6JA 2Y62A 4AC7C 3WYZA 2EG7A 4AYGA 1F3XA 3UYCA 3KLLA 1GWJA 3EOUA 2QUTA 1VCGA 4NRRA 1LYXA 1PIIA 2I14A 2YCKX 1VCFA 3WH9A 2CLLA 4PTXA 3TFCA 1AJ2A 1QBBA 3LM3A 1OFPA 4JTIA 3GTNA 1KM2A 4OKDA 3S2NA 3E2RA 4L7ZA 4R7JA 2I5QA 3BAKA 5LKYA 3V36A 1VJIA 3H12A 4UMCA 3B0VC 3QTGA 3NL6A 1EH9A 1LLOA 2W5FA 4M51A 3NAVA 1EJRC 1Y0EA 3C2OA 4V28A 3W85A 2X7VA 4JFVA 4ACYA 5AY7A 3VGGA 4I7WA 1MQQA 1A53A 4XSLA 1KM1A 1ZAHA 1JL8A 4DJDA 2DZTA 5CPSA 1ZP4A 4IISA 1AZ2A 3QQ1A 1QPKA 3AUOA 3D46A 1CT5A 4Z42C 3KVKA 3MI3A 1N8IA 3W88A 3TP4A 3U5UA 2QHAA 4NQ1A 4MPQA 4RJEA 5D03A 1UYQA 3CQHA 3PJXA 4Q22A 2AGTA 3SAZA 1X96A 4C7DA 3R10A 3D3AA 4L6HA 2BFGA 2ZUSA 2BLEA 1K6WA 5HWMA 1W5OA 3DBPA 4KS0A 4X2PA 5G1MA 4ZGYA 3VPLA 3WMBA 3B9EA 3VNDA 2YBVA 1H1ZA 4HPGA 4C6IA 3GBDA 3WK1A 3THUA 1RY0A 5CBJA 1W0MA 3SQMA 1B9ZA 2PTXA 1WBHA 1QMLA 4FIQA 2NQJA 1V3IA 4YS1A 3SIMA 1XLEA 2QJNA 2QJJA 1A49A 1JGMA 3WIJA 1PKNA 4XSMA 3RX2A 3M0JA 3OTRA 4LAOA 2PWFA 2WCSA 2VZSA 1BHGA 4AZCB 1PWMA 4R34A 2D2JA 1B3YA 3CHEA 4NZ1A 3LCGA 2PEVA 5I00A 4O1FA 4J7RA 1U1JA 1JG9A 3GVGA 1QOXA 2WWDA 3I6RA 4RE4A 4V2XA 3PZQA 2DUZA 1XGZA 2WPGA 1JUBA 3WH8A 4PTMA 3ENLA 5HNNA 2O4QA 3QBUA 3WZ0E 3C4UA 3HV8A 3V16A 4MWAC 1WKYA 3TJ4A 3AXIA 4GNVA 4H9MA 4A6GA 1CWYA 3IS4A 1DIEA 1VYPX 1I0BA 3LTSA 3WFZA 2VZUA 4J27A 4RZ6A 3S1GA 1G01A 2NV2A 1D3HA 3W1LA 4BJHA 5JU6A 5M2FX 5CJ5A 4D8AA 3MPGA 4BI7A 4CU6A 4QDPA 3PB0A 3R43A 3OOQA 5C54A 1XLCA 1YDYA 4FLQA 4IMFA 1B90A 2WSPA 4OUIA 3EWXA 1AD1A 4GY1A 3TIMA 3ZT7A 1GW9A 1XDJA 3LD5A 3ARXA 3WCZA 3RMEA 1YE6A 3OLIA 3W7MA 2WK2A 1V7AA 5FSDC 2E4TA 3WLMA 1OGBA 2NT1A 3WFLA 2OWWA 3U8GA 1H7NA 1SZFA 1XCWA 4PA8A 4MYXA 1DJQA 4L9ZA 4GNJA 5DX7A 1WZMA 3W22A 2TAAA 2ADAA 3VNZA 4TQTA 4XG1A 1XH1A 2I5IA 4WJ8A 1KBLA 1E6QM 3ARUA 3CK5A 3IGXA 1IXPA 3CUFA 3RIKA 3WJWA 1NWSA 1YTEA 2DVXA 1LBLA 2A7RA 3ITCA 2PODA 1IEIA 2J7DA 3F5JA 1UD3A 3AJ7A 3GG1A 4O12A 4A2RA 1K7FA 3UZWA 3H54A 4IG2A 4L56A 2TODA 3ES7A 3LBCA 5A6KA 2H90A 4EACA 4YWSA 1Q13A 3A22A 4UR9A 4XD6A 4F0SA 1FHLA 2QXWA 5H91A 3OZYA 1Y5XA 3ABRA 3W00A 4UQBA 3KHJA 4MHBA 4DJFA 2EPNA 3OP2A 1VBGA 2HCVA 4M7SA 2ZZ7A 3UBPC 1PV8A 1JAEA 1R3TA 1EP1A 4IXHA 4UMAA 3WLRA 4HHLA 4E3VA 3AIWA 3W73A 2DSVA 4GC4A 1BSLA 5FF3A 3DOPA 3RO6A 4IGNA 3U4AA 4AIEA 4NUWA 4IUGA 3ZMRA 1ZAIA 5BU6A 4KWWA 1ZFJA 3GDKA 5DFAA 1UMLA 4WOZA 4W84A 2GJPA 2YA1A 1KXHA 3QYSA 3WBXA 1PL9A 1B5TA 3UWVA 2PWVA 3EKZA 4LRSA 4BF7A 3CAKA 3DERA 4KESA 4QS6A 2GK1A 2H6RA 1TWZA 1OADA 3KP0A 1VFLA 3W70A 3MMDA 5FA5A 3KRBA 4W9TA 2WNWA 1WUEA 1W91A 2RDUA 3NVDA 3M16A 2C18A 2DW6A 1TG7A 4U4MA 2Y8UA 3NEHA 1ESWA 3AIUA 2WBKA 3MV01 1WB0A 2QJHA 1Z9AA 1UBSA 2A3EA 2QDHA 3E6EA 3W1RA 1IEXA 3VE9A 1G4PA 3B9OA 1V3JA 1O1ZA 1LBMA 1QJWA 1LUCA 1ISXA 3OA3A 4WKFA 4R53A 4IG2B 1R2SA 1WDWA 4GD0A 1DWAM 1G7UA 5D8ZA 4GXPA 4IICA 1GQKA 3H7VA 3AS3A 3RX3A 3M4HA 1SW3A 1FCUA 1HL2A 4RL3A 4JIEA 1JJKA 1EHAA 2I9UA 3FDKA 1XX1A 1U30A 1GHRA 1R85A 1FDZA 1DOSA 4EOUA 1E3XA 2J9YA 2FZ9A 1OIMA 1ZL1A 1NWRA 4NNBA 2AOSA 1A5BA 2PTWA 2UY2A 3LPOA 4PGLA 1U5VA 2Z6IA 2VTFA 7TIMA 2E5CA 2XIQA 3KZSA 3MMWA 3LLDA 1WPCA 2YCJA 3BICA 2XG9A 4H83A 5A8NA 4JR5A 4BZYA 3WH5A 3ZOAA 1QFEA 4ONVA 2PURA 1Q6QA 2FPTA 1MXDA 3TNOA 1U5JA 3OVPA 4XAFA 4ZTXA 1GKRA 3VUPA 4L9XA 1UR9A 3SR7A 1UUOA 3STCA 1KTBA 3OA5A 3UWWA 1DJGA 3TTEA 4HHMA 3QPYA 4F0MA 2VEPA 2YL5A 4IHCA 2RGMA 3A4XA 3UERA 4LAKA 4WOQA 3EWZA 1OABA 3D3FA 3P14A 2ZA2A 2HVMA 3GHTA 1HVXA 4JZ5A 3G5EA 3USZA 1KTNA 1OHLA 2G95A 2BVDA 3SO7A 3BO9A 1WQ5A 4PMYA 3GAYA 3K2GA 2PB1A 5AC8A 1EO5A 1JNEA 3W6LA 3NSNA 4FF5A 4GXMA 2OYKA 2E9BA 4DZ5A 1QW7A 4N9BA 3MUY1 2Z0IA 1M65A 2YZ5A 5CPMA 3EWBX 1UD2A 1V6TA 2OTDA 3T8QA 5D30A 3VI2A 3GXFA 1SW7A 4GIYA 1H51A 3Q65A 5CCZA 4UTTA 2WMKA 4DWSD 1FWJC 4IPNB 4HBKA 1AW2A 1UR4A 1GGOA 5KMYA 5FCZA 3APYA 4H7ZA 4WY0B 5AYZA 2C1GA 3DZ1A 2VOMA 4CCCA 1TMLA 3EDDA 1IZCA 5A95A 4DWSC 2DT0A 1CXFA 4QLLA 1FWEC 3ZLGA 4FA3A 2GVLA 2WZIA 1Q8JA 3M0KA 3TR9A 1CXHA 3AMLA 3ALGA 4ROQA 2PSNA 3UXIA 3HPZA 1M41A 4P8XA 5GNXA 1OM0A 3I68A 2H3DA 4JTFA 4LJ3A 3CM4A 2EJ1A 4O8AA 2WJEA 5LZLA 1S2AA 3LGDA 4PMRA 4EVZA 4KFPA 1C93A 3TTOA 4H9ZA 1J2BA 5A6TC 4YHEA 4RR4A 2ZA3A 4HKPA 3NXLA 1J0IA 4WJXA 1R87A 3KOZA 2GUYA 2R82A 4PMZA 3RF9A 3OG3A 2GJLA 5F4WA 4WRHA 5BCAA 1EQPA 1FWWA 4XZMX 3R58A 5ECVA 3E1F1 4C90A 2VRKA 5M1TA 3H2AA 5LIWX 3A64A 4ALDA 3IUIA 4C6KA 2QPXA 3H7RA 8CGTA 1M7OA 1H3GA 5I3GA 3MCNA 1ZCCA 1XSJA 5BRQA 3P5YA 1EZWA 4IF2A 5CSYA 2WVVA 5HR7A 3M5YA 1NFBA 1VBHA 3I4EA 3L5LA 1IEQA 1PDYA 4HCHA 5AB3A 2PCEA 2REQA 1U1UA 3NEVA 3LTYA 1IE7C 2F2KA 1AODA 1WDQA 4QEEA 1XLBA 4F0RA 1PTDA 4RKAA 3AZRA 1P0DA 1MQPA 3UWZA 2F84A 1JQXA 3PTKA 1TRDA 4H8VA 2PCQA 4CCDA 2E68A 4GVHA 4WDTA 2P8BA 4R88A 3BGGA 2ZX9A 4JPGA 1FDJA 2BBFA 1I75A 1RAKA 4HHHA 3F5LA 4JTRA 4DJFD 4UFJA 1QPQA 3QOMA 3HJZA 1XBYA 1PJ9A 2GL5A 4OOUA 4ICCX 5MKGA 2PDIA 4LVGA 5DBTA 1I8JA 5D9MA 1DQUA 4AY7A 1XIMA 4MWAD 1TWIA 1Q66A 1H7XA 1KBIA 3F4DA 4PB5A 2IKIA 3MV11 1LL6A 3PVFA 4CQAA 2QJGA 3KBMA 4S3CA 1K02A 3FNDA 1W2PA 1OYAA 2PDBA 4QE1A 1OT2A 1XRSA 3MHFA 2A6NA 3JUGA 3MI2A 2WSRA 1BYAA 4LPCA 2DGAA 3EWYA 3XINA 1FWNA 3APTA 2O56A 5HA7A 3R13A 1RJRA 3R4IA 2GVGA 2DU2A 1G0CA 3O63A 2QUMA 3L0GA 5I3HA 1G69A 4GPNA 4XD4A 1NOFA 4NZ4A 3GUGA 4DUXA 2PDCA 3BJTA 4O1DA 4PB4A 1XG3A 4YHGA 1PEZA 2ZDRA 4OOZA 5D38A 1SPQA 4GFIA 2Z1VA 2DZXA 3G0SA 4N9CA 2V38A 3GSMA 5G4HC 4I6KA 3TAOA 4GGHA 2YR1A 4O54A 4HNOA 4M81A 1KKRA 4TVCA 2C0AA 9XIAA 3QXBA 3BTNA 2VDIA 3L4ZA 4JIQA 2JBMA 3FHQA 3U7BA 4GVIA 2ZZ2A 2CNCA 4PFMA 2ZE3A 4ENLA 4MTVA 3GG8A 2NQ5A 5TD4A 1ZP3A 3RO8A 1MFVA 1F3EA 1XW8A 3BAXA 3UT0A 1RD6A 2VENA 5BYWA 5H6HA 1IIGA 5TNVA 3IK4A 4GIEA 2SFPA 4HNNA 2Y0FA 2XFYA 5IXEA 1JZ5A 7ENLA 4CCEA 5A5WA 1M6JA 2P50A 5I3IA 4HPXA 3IUHA 3SBFA 4G7EA 3U9IA 1MYRA 2CHNA 4DPQA 5IDIA 3FCPA 2IQDA 1A5NC 4RE3A 4UUIA 3W27A 2Y7DA 5CSSA 2OT0A 3AMGA 1ITXA 4HTYA 4FOUA 1R47A 1OSEA 3WF0A 3BLOA 1BGAA 2PD9A 3WFAA 2BHYA 2XJ7A 1BG4A 4ZO7A 1RBLA 3PG8A 5D37A 2OMAA 2V2DA 4PBGA 3VFCA 5HINA 1NY1A 1SJBA 2D20A 4MWAB 4LNCA 2VR2A 1W3HA 3TLLA 3UCDA 1Q3NA 1UMYA 4JBRA 3M0HA 3I3BA 1H7OA 3ZFHA 1NVMA 4ZZ9A 3QY7A 4GY7A 1V3HA 1PTAA 3BE7A 1ODZA 4R5EA 3UXAA 4OZOA 1S46A 3SGGA 3GC4A 1JRCA 4Y9AA 4LAMA 4L6OA 1KC7A 4NVTA 1EJTC 1JF5A 3AOFA 4M1RA 1JCMP 2E7FA 3NQGA 4NRSA 2P5NA 2WHMA 2DT1A 4P5UA 3TNBA 4NHVA 3F2DA 5AC4A 1JDFA 1Q63A 3WF4A 2OWXA 3QF0A 2VR4A 4QEHA 1OK4A 3B8SA 4RX0A 2CLMA 3B8VA 4M5PA 2GJRA 5AVHA 3VA8A 3GM8A 1OFDA 3WUGA 2QDGA 3Q94A 5I09A 4NX0A 2Q8ZA 2NX1A 1WUFA 1R2RA 3OLEA 3SRKA 2PBOA 1NH6A 1O94A 2UY4A 1DE5A 3BC9A 1GEHA 3TYCA 4MLRA 4REQB 1UP3A 3GW0A 5K4XA 3W53A 1YXYA 5BXRA 3VKJA 4K2SA 3M44A 1YXCA 3P0WA 5EL1A 4KH2A 3IJQA 3R0DA 2Q02A 2YSWA 4UR8A 2PLKA 5EY5A 1UPMB 4PMXA 3W7DA 1IXNA 3VZZA 3WUBA 1TPEA 4RCXA 3KBSA 3VTRA 1YXDA 4UIOA 3EEGA 1R5YA 1EX1A 3N6JA 4DBWA 1CXKA 4G9PA 2VC7A 1M7JA 1ZSXA 3DDMA 2WMJA 3NOYA 3L12A 1OGGA 4L61A 3BURA 5HWJA 4MDOA 3ZWSA 4MZYA 3ONCA 1PYMA 4GYFA 4WY0F 3FXGA 3AIBA 1QI0A 3B0PA 2G37A 3HURA 1YTDA 4R33A 1ISYA 1WDDA 2GDQA 3URBA 1UH3A 1NSJA 2FFIA 3M0LA 3NDYA 1IT8A 1ZTVA 3CASA 2YA2A 1IV8A 2X40A 3DFYA 3MBFA 4CD6A 1XICA 4WXYA 3T40A 1DXEA 3GVWA 4XO6A 4GYPC 1OIFA 1EC7A 3TJIA 4W89A 2J7HA 3GXDA 4KCVA 4UQ9A 2HTMA 3HV9A 3HU7A 4OUEA 3VABA 1T99A 2Y24A 3CNYA 4IQLA 4LUTA 4D6FA 2J25A 4QJ1A 2D3LA 2DZUA 3B0XA 3I65A 2VM8A 4C6QA 1TQJA 1I1WA 4IM4A 3V0TA 2HEJA 1EO7A 3CJPA 1DYSA 1YRRA 1TJPA 1SMDA 2Q09A 4CN6A 1M5WA 5ABEA 3MANA 4AZHA 1U1HA 3TH6A 2UZ9A 3FJ4A 1PYFA 2PUZA 4KEVA 4QCEA 1ZJBA 2VQTA 3RN6A 3BCJA 4W5UA 4DJED 3S6OA 3BWWA 1A5LC 3BQ5A 1VC4A 3MI6A 3UY8A 1FHUA 3QOKA 3OYZA 7PTDA 5LNWA 3HFYA 3BSHA 2Z1WA 2V3FA 3PJUA 3CUXA 2WSKA 2X30A 2HISA 3M0YA 5HQEA 1ZB5A 3M07A 4P7OA 1SSDA 2I9EA 4CUCA 4ZB5A 2Y8KA 1SR0A 4O14A 3UVAA 5EMYA 3NQBA 3FVMA 1HF6A 1HKWA 3T7VA 1WDPA 1IZKA 1KRAC 4L4MA 3EPOA 2OVLA 3PZ9A 2F9RA 2H8ZA 1JGIA 2V3DA 3LMZA 1GYNA 3W1TA 3FA5A 2FGBA 4B15A 3H2OA 3EGJA 3WQFA 1HTIA 1VENA 3TC6A 5BMXA 3N3MA 3W0KA 2VFHA 5I06A 2ESCA 1AH0A 1V7YA 1ZBKA 1D3GA 3AALA 2DEPA 1OG0A 2DUXA 2MNRA 3RM4A 3CYVA 4D1JA 2J66A 2C91A 4US5A 4JN7A 4S39A 1A3HA 4O1CA 2W66A 3TVAA 1B30A 3T07A 1VS1A 1CGVA 4FS9A 4BF5A 2VELA 4HNUA 1R7AA 1LQAA 3TC3A 2W92A 1ZRQA 3MUCA 4D71A 1NFGA 1BWKA 3EBVA 3NM3A 3QLLA 2X1IA 3WLQA 3WLIA 5I3KA 4ZOEA 4S3KA 4LFYA 3CT7A 3MYPA 2EGZA 5CG0A 4JN8A 5AHMA 3BGJA 1ONWA 3GNNA 1SZEA 4EWND 4ZB0A 3PPFA 3IUDA 2A4AA 3RJYA 3TW9A 2IPGA 2AMGA 4INFA 1E73M 2OJPA 1R7OA 2XN0A 2OOGA 4NG3A 1QNOA 3SUTA 2YDRA 3TONA 1IYXA 3EXSA 2VFFA 4QX4A 2X0SA 4PUNA 2XDFA 3SECA 5BNKA 3W9ZA 1R38A 4D6GA 1PDZA 4LF2A 1N2VA 3T4CA 3B4YA 3OHIA 4K8GA 2CERA 3A4JA 1X6LA 1G4TA 4V1YA 4YCOA 5HATA 2YL9A 2V67A 3I7QA 3GIYA 2YLAA 4J3WA 4BCEA 1SMAA 4B5TA 1SZRA 1RALA 1KM6A 1QTWA 3K1DA 4NZCA 2FPYA 4IP7A 3ZR5A 3NL5A 3A5VA 3C6CA 4PSPA 1DJHA 1TPFA 1XM3A 4PMQA 1W3IA 4MB3A 2J77A 4QLKA 4G7EB 3CUHA 1XYBA 3ICJA 1JVNA 1M1BA 4MB4A 4HZ7A 3IGHX 2QT3A 1BGGA 1S2CA 4E2VA 1FTXA 1ZUAX 5CZSA 4M82A 1KFEA 2OEKA 5FD0A 1TV4A 4GKLA 4WSKA 3HIJA 2H8XA 5LIUX 4IX2A 3DUGA 3SCSA 2IQTA 5K4ZA 4JTQA 4YN5A 2WVUA 2X1TA 2CC0A 3PZOA 1UWQA 4MIMA 3E38A 4J9JA 4Y8FA 4Z1BA 4YU1A 2Y8VA 1VJSA 1CXIA 1G6CA 1Q4NX 3V4BA 2PWEA 4QE4A 4U10A 1MNSA 1UQYA 5JBFA 2PC8A 2GUUA 3D6NA 2V69A 3ALFA 2C71A 4WD0A 4LVAA 1R9YA 3NZGA 1GZJA 3OJGA 4ML4A 1HL8A 5AYYA 1UKTA 2J62A 1P6BA 3AS0A 4Y9OA 3BMVA 4DXKA 4ORIA 2DDXA 5E09A 1OC7A 1DBTA 3AHXA 4NKCA 1TZ9A 3CUIA 1QASA 4HTBA 4Y9MA 3NL3A 3SIZA 4WIWA 3TN4A 1WKEA 1TV8A 4AXNA 3LHYA 3NG3A 2QCGA 1Z8AA 2EPMX 2XVLA 4LWWA 1R9ZA 4FALA 3H2CA 1B3OA 1XS2A 1B4EA 3QH2A 2OZ0A 5A6BD 3THAA 1WXZA 2WVVB 1B3ZA 4X0NA 3STEA 3PN8A 3MUAA 3AO0A