4HZ7A

Crystal structure of bglb with glucose
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 173
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz7A00
2QF8A 3TTQA 4QCFA 1J0ZA 1MFVA 3OZPA 1CIUA 3AS3A 5HNNA 3W82A 1OD8A 2AMGA 4P8VA 1G0CA 4AD4A 1OM0A 1PPIA 2WC3A 4GI6A 4J7RA 1QI0A 4UFJA 3VX1A 4AYSA 4XZWA 3GZAA 2JEPA 4YN5A 1D7FA 1ESWA 4W8BA 2XUCA 3KZSA 4GXPA 3B9AA 4OZOA 3VNYA 5A2CA 4URIA 4IISA 1FH7A 1YHTA 4LYPA 2MANA 1QOXA 3W28A 3O2LA 5CJ5A 4E8DA 3UEQA 1DEDA 1SYTA 1HXJA 1HX0A 1JDDA 3AISA 3II1A 3IANA 2XVGA 1ISVA 4OBSA 4W8AA 4JZ5A 3WELA 1G01A 2VZUA 1AQ0A 3CUHA 5HOSA 4XX6A 1A47A 3ZT5A 3T2PA 3W0KA 4HTYA 1X1NA 1W3HA 1E6XM 5DT5A 4JIEA 4AZ6A 3UERA 1KR0A 1X6LA 4NZCA 1KQZA 5M17A 2OWWA 1B3XA 3PZOA 3CLWA 1CNVA 1PZ3A 4PTWA 1JFHA 4AZCB 2BV9A 1RP8A 5A3HA 3M07A 5E6ZA 4PEEA 4OOUA 1R7OA 3AI0A 3N13A 5A69A 1NP2A 2DH2A 4UOZA 4AC1X 5CSUA 1IV8A 4BZYA 3OLEA 1V3KA 3N17A 4J3TA 3UR7A 3O9NA 4GIAA 5I77A 3OGRA 2CESA 1GHRA 2VCAA 1UQYA 5LYRA 2DT0A 4JHOA 1H49A 1E4NA 2QPSA 4P7NA 5DFAA 4MPKA 1KR1A 1UWTA 3AHTA 3PZQA 1BVNP 1GVIA 3L4YA 2DIJA 1TVPA 4WSKA 3A47A 1JI1A 1B3ZA 1WDQA 3DHUA 2VURA 3AHYA 3WDHA 1JD7A 3RMEA 3ARRA 7TAAA 5BROA 1PX8A 4CGTA 3N9KA 2FHBA 4M80A 4AZGA 1H1NA 4U5KA 5A2BA 3VUPA 1E1EA 1H5VA 4PBGA 1DWHM 2D24A 4BQ2A 3IK2A 1O6IA 3MV11 2WK2A 1TMQA 1C8XA 3TP4A 3NDZA 4UTFA 1MQPA 5BXSA 2GFTA 4BQ4A 1W3KA 3BH4A 2BHZA 4D6GA 3MU7A 1OGBA 1J9YA 2BY3A 1FA2A 5D4YA 2XVPA 3WF4A 1R87A 1WZKA 2CIPA 5AC5A 2ZX8A 1SMAA 2CBIA 5ABFA 1W9BM 2YLLA 1E9LA 4W88A 1E6NA 1MW2A 2IUZA 2XGBA 2UWFA 1MWOA 3ARVA 5EB8A 3CMGA 3SCRA 2VCBA 1HJXA 5E0FA 1PJ9A 2XPKA 1VB9A 3S2CA 2O9PA 1E15A 1VEMA 2X8RA 1VEPA 1ODZA 2D1ZA 3PZVA 3L4ZA 1HNYA 1UR2A 1J0JA 1W9PA 3TOPA 3CO4A 1OD0A 3VGGA 4P8WA 2WSPA 4GO8A 2VZOA 1E0WA 3WY1A 4MJ4A 4AZIA 1C8QA 3UG3A 2YLAA 1YQ2A 1BYDA 3S6TA 3SCSA 3GXDA 5I24A 5AY7A 5A95A 5BYWA 1HL9A 2VMFA 4MAVA 5GNXA 2J7HA 4XV0A 2D3LA 4R27A 1D3CA 1E6SM 2BHYA 1LG1A 2PBGA 3HN3A 4Z2KA 1Q6EA 3EDDA 3W26A 3APGA 2CETA 3ARZA 1J18A 2W66A 4UQ9A 1UH3A 1HT6A 3WUGA 5HPCA 1V3HA 2EPOA 4MNMA 1EOKA 1VF8A 3VIHA 2GVYA 3EMCA 4OBRA 1QPKA 4MB5A 1F4HA 3MUY1 3VMOA 1CXKA 1H3GA 2YOCA 1QHPA 4Q7NA 3W6MA 2ZUNA 3WNPA 5I3DA 4Z2GA 4JCLA 4H7VA 4UFHA 1EHNA 1E0XA 3OB8A 1GVYA 1PX3A 3VX0A 2GJPA 1BFNA 1GOWA 2VI0A 2ZOXA 5ABGA 1UH2A 4Z2IA 3WEZA 5A1AA 1CDGA 4D6EA 2WB5A 3MKKA 3CUGA 4J3WA 3OG2A 2YBUA 4ZFMA 1E43A 1G94A 1M04A 3T2QA 4GQRA 2WVVB 3AMLA 4P8UA 4PMNA 2WXDM 1JF6A 1WAWA 1TE1A 2VVSA 3KL3A 3O6AA 3PZTA 4H04A 4CN1A 2VX4A 1KBKA 3CUFA 2A3BA 3QGVA 3QOMA 3EDJA 4UOJA 1UWRA 5A6BA 4ZENA 3QHOA 4DM2A 3N11A 1B0IA 3VD9A 4OIFA 1L8NA 2F61A 4ATWA 5KEZA 2D3NA 2CITA 2WWCA 3NSXA 4HMEA 3AMGA 2EPMX 3RILA 1I1XA 1K9TA 1LJYA 2OSXA 1WDRA 4OOZA 3NSNA 1E4LA 1GW1A 3WENA 2CYGA 3W29A 3AIWA 3VDCA 5BXRA 2DIEA 5IDIA 3RJYA 3MMDA 4NF7A 1DWAM 3KE0A 1JL8A 1UR1A 4PN2A 4CD8A 2ESCA 2XTKA 3A4AA 4B3LA 4L4PA 2BS9A 2PWFA 3VILA 2V5CA 1HN1A 3LPGA 2XWEA 4HMCA 1K9EA 4MDOA 5I78A 1ITCA 1W2PA 1QHZA 1OT2A 3AXIA 9CGTA 2WC7A 4W5ZA 2QLYA 5A6SA 3WQVA 2GK1A 2GJXB 4MB1A 2BY1A 4D6JA 1C3FA 2W92A 2ZXAA 3RJXA 1EIBA 3SIMA 3MMWA 1K6AA 2X2YA 2Y8KA 4RE2A 2OSWA 1QHOA 1OIMA 3WQ6A 4PTXA 4X0NA 3W25A 1DWIM 1XD1A 2DGAA 4HPHA 4HA3A 2CKSA 2J78A 3AMCA 3ZOAA 4ATDA 1EDGA 1GHSA 2YA0A 4BF7A 2Q8XA 4W7VA 1KCKA 1JZ4A 3GXMA 4AXNA 5BRPA 1KXTA 4Z2JA 2E40A 4DWSC 2FGZA 4CN6A 2FDMA 3WDJA 1UR9A 2WW5A 4AWEA 5FIPA 3GXIA 2B31A 4D6DA 5A94A 2J4GA 3K8KA 1E5JA 2PI6A 1HF6A 3NIYA 1W3LA 1W9VA 1E3ZA 2YKKA 3N15A 1WCGA 1I1WA 1MW1A 5CPSA 4WJXA 1PBGA 2UY4A 3K4DA 2V3DA 1XD0A 1UWUA 1ZU8A 4GKLA 4DWSA 4KGLA 1XHGA 2TAAA 3EDKA 1OT1A 2IXUA 4BQ5A 4MB4A 3M46A 2D23A 2YJQA 4D6FA 2XVLA 1VJZA 2CCRA 1H41A 1UKPA 1TA3B 2CHNA 1UZ4A 4CD7A 1NWUA 1VIWA 3AHZA 2OWXA 1JG9A 2RGMA 3DC0A 3AIRA 1TFVA 3THCA 1DP0A 1V02A 1U2YA 3AIUA 3KL5A 3DECA 3WD2A 1JD9A 1AQMA 5HDRA 3U7VA 3UETA 3T08A 3AIQA 1UOKA 3WUEA 1VFMA 1EDQA 3G6MA 2VL4A 2WMIA 2X1IA 3WN6A 3CHEA 3PBGA 2O92A 3PZIA 3L4UA 2XM1A 3AICA 1FFQA 1H09A 3HU7A 3K1DA 4WIWA 4MDPA 4HU0A 8A3HA 1UA3A 2NT1A 4UFLA 4AY1A 4ACZA 1W1TA 2WZEA 1JNEA 3I3BA 1BAGA 1MW0A 4F8XA 2VRKA 3CH9A 5IHRA 4TX6A 2BY2A 2YIHA 4X0VA 2O9OA 4UCFA 1V3IA 1JYXA 3WMBA 4W93A 3MS8A 4ZXLA 5EFDA 3VNZA 1W3JA 2J62A 3W53A 2G3NA 4H41A 3SCQA 1M53A 4W87A 1WZAA 2EQDA 3CZJA 2XFYA 1FHLA 2FHCA 1UQZA 4UFMA 3A4XA 1FH8A 4P7QA 3VIMA 3VGDA 5CG0A 2WVUA 3VPLA 4CU7A 4PMOA 1XCXA 1OGGA 3ARXA 2EPKX 3POCA 1QNRA 4CKQA 1R86A 3M7SA 4AIEA 4AIOA 2CBUA 3IAPA 2XYLA 1CXFA 1E72M 3L4XA 5DT7A 1UR8A 2WHJA 1W1YA 5A6MA 1DWGM 1UUQA 1W91A 3CHFA 1UD3A 4UFIA 3GXFA 4EE9A 5A8PA 3L4WA 3CIVA 4IPNB 1V6XA 1JZ3A 1UD2A 1M01A 2A3CA 3QR3A 3QHMA 2UY2A 3AIVA 1J10A 3N04A 4W86A 5JBFA 1GOOA 2J79A 1EQPA 4D71A 2HVMA 3W27A 1EO5A 2EXOA 4GQQA 4MNJA 4DUWA 1GCYA 1WO2A 1XH0A 4XZBA 3CUJA 3VGHA 2BXZA 3WD4A 3LPPA 2VVNA 1P6WA 4FLRA 4AD5A 3LPOA 3SCTA 1OB0A 4AZCA 2EBNA 1ZJAA 4H8UA 4LXFA 1SFSA 1WKYA 1XYFA 2QHAA 3BMVA 1UG6A 4CU6A 5LA2A 4H2CA 1UD5A 2J7CA 3AZSA 1OBAA 3LMYA 3TTYA 3VD5A 5I5RA 1QBBA 1DWJM 1JXJA 1US3A 3DYPA 1HJWA 3ZMRA 2WZIA 2CNCA 3B9DA 4CCDA 2QMKA 4UQDA 2ZXDA 2VX6A 4QAWA 5C71A 3WIJA 1V0NA 4CD5A 1BGGA 3B9EA 2Y8VA 1B90A 1V6VA 3WNLA 1KGWA 1BLIA 1PZ2A 1ZB5A 5GPRA 2OLHA 4D6IA 2VZSA 3BGAA 1E70M 4HA4A 1NWTA 2BHUA 2C7FA 3SUWA 1CGWA 2BNJA 1R85A 5E09A 5FD0A 3T2OA 1KBBA 3MUIA 1BSIA 2WCGA 4MB3A 4W84A 3VGEA 2C0HA 4HZ8A 4AZHA 4CD4A 2ZX7A 1EOMA 3EYPA 4J3SA 4JKMA 2ZUTA 2WBGA 4QLKA 1XH2A 2QPUA 3AYSA 3VD3A 2GDVA 2PF0A 1LG2A 2J47A 1XYZA 5D9PA 4GPNA 1LWHA 1CLVA 3LPFA 1XSKA 3WF1A 4FF5A 3CZ8A 2BY0A 1VFFA 2BVYA 3DYMA 4ZEPA 3T0DA 3KEHA 1HP4A 1LQ0A 3U5YA 4PMUA 5DF0A 4KWUA 1V6YA 3OA5A 3VOCA 3GTNA 4AIUA 1XGZA 2WMGA 2ZIDA 2YDSA 3QHNA 4F9JA 1E5NA 2FH6A 2WMHA 2ZX6A 3CZLA 1JZ2A 2CBVA 2DH3A 3OZOA 2CPUA 3MV01 3ZIZA 1KWGA 2G8ZA 6A3HA 2W63A 2J25A 2GUYA 1UYQA 3WMCA 1JGIA 5C70A 4AISA 4CN4A 3GDBA 1UKOA 2JIWA 3OGVA 1MVYA 5M3WA 3DHPA 1W9XA 5JUVA 4JHZA 1LF1A 1BPLB 2PWHA 4D72A 4M1RA 4AEFA 4UQCA 2VCCA 4PMVA 1PEZA 1U30A 3WBAA 1CXLA 4AD2A 4PTVA 5A6BD 2GSJA 5LA1A 3PTQA 1MW3A 1NOUA 1EDTA 1GONA 1BQCA 2GJRA 4U31A 1GOIA 3KL0A 2WWDA 1B3VA 2WANA 1UD4A 1CENA 5I2UA 1QW9A 2WVVA 3GBDA 4PMDA 2NT0A 2DSKA 3NJ3A 2WCAA 1IT0A 5FOOA 3PZ9A 1MXDA 4U3AA 3PTKA 2G41A 4QP0A 4HZ6A 1W32A 4GZEA 3E1F1 4DUXA 4PCTA 2DSUA 1QI2A 3SUVA 3BAJA 2WVTA 2ZWZA 5M03A 4UNIA 5CGTA 3RO8A 1CXIA 4PMXA 3ARPA 4QLJA 3WD0A 4WKFA 4BA0A 1GZJA 1DHKA 1J12A 1JYVA 5GNYA 1H11A 2G4FA 8CGTA 2X0HA 4M82A 1CLXA 5AYBA 3U57A 3FAXA 1E3XA 1GORA 3WEMA 1WPCA 4A3YA 1VFUA 3IJ9A 2J7FA 3VMNA 2J7DA 1HIZA 4B9ZA 4MTVA 4RE4A 1ZL1A 3G6LA 3I3DA 1W1PA 3A3HA 1JXKA 1W9UA 4C7DA 1NWRA 2X09A 2YL8A 2YA1A 2WVSA 4JFVA 4TVCA 1ZBVA 3WMSA 1EGZA 3K8LA 2ZUSA 1TZ7A 2GDUA 4AZBA 4GI8A 3SURA 2Y5EA 1OGSA 2J7EA 3NCOA 5F7UA 1EHAA 4GINA 1B9ZA 4UZUA 6CGTA 1CXHA 3BAIA 2GJXA 3ALGA 5HXMA 4PUEA 3BLPX 1Q6CA 3PTMA 1GQJA 4FLOA 2JIEA 5A6AA 1OCQA 3ECQA 1UWQA 5BRQA 1JZ5A 3ZR6A 4JFSA 1B31A 3FXYA 4W7WA 2O9TA 4ZE5A 2D22A 4NI3A 4FMVA 2J74A 3F5JA 4C7FA 1CGUA 2ZUWA 1FH9A 3BAXA 3SUTA 3UESA 4EANA 3D5HA 1RD6A 1ISXA 1FP8A 2EPLX 2XG9A 3WF2A 1Q4NX 4JFUA 3L2LA 3W81A 3U7BA 5TD4A 4TOQA 1KXHA 4J3VA 3WQ4A 4DWSD 1C90A 1EQCA 3BC9A 3N12A 1EH9A 1UKTA 2W91A 1B1YA 1GOKA 2XGIA 4LX4A 1WB0A 4D1IA 1CEOA 3AOFA 1ZBKA 4PUDA 4UQEA 4AD1A 1WE5A 4JKLA 5CLWA 2CBJA 2VT0A 3N1AA 1HVXA 4YPJA 2BVTA 1OWQA 5A6JA 3MUZ1 1UA7A 4RL3A 2VX5A 2CXGA 5CLTA 2EPNA 2Y24A 5IHSA 4KRTA 3MSDA 4AD3A 3SCVA 3ARTA 4HZ7A 3WSUA 1J0HA 3POHA 4U2YA 4M29A 2XSBA 3CZKA 3AYRA 1VEOA 1J0IA 4M56A 3K46A 1EXPA 1V0LA 1D2KA 2YA2A 1TA3A 3M6DA 3RIKA 3WD1A 2Y4SA 5JIPA 2AAAA 4BCEA 5I6SA 2VZVA 4HU8A 3EDFA 5ABEA 1UR4A 2V3EA 1W2VA 1HL8A 1KXVA 3WDIA 4OJYA 4CD6A 3RCNA 2E9MA 2X05A 1E73M 4XUYA 4LPCA 3T0AA 4LGXA 2VR5A 3CTTA 1CECA 2BXYA 1N82A 1VRXA 1ITXA 3AXHA 3WNOA 2PB1A 3SCNA 2EJ1A 3AMDA 1R7AA 3ZT6A 2E0PA 3OLIA 1UZ1A 4CCCA 2XFRA 3ARSA 3VGBA 1C91A 2FGLA 2A3EA 5ABHA 3WD3A 1E40A 2J7BA 4Y7EA 1E4MM 2WHMA 1IZKA 4D6HA 1AQHA 4UQAA 2QV4A 1UWIA 2UY3A 3AZTA 1J0YA 4OUEA 3K4AA 3T09A 1F4AA 1MYRA 2BFGA 4TX8A 4UOQA 2WSKA 1V6UA 3F5KA 1C92A 1C8YA 3MSGA 3ALFA 3CUIA 4P7OA 4E4PA 1ODUA 5HBFA 3VM5A 3ZSSA 1LL7A 1GOQA 1IZJA 3UCQA 1QNOA 4A3HA 1XV8A 1ZBWA 3WNKA 3ZQ9A 3VGFA 2CERA 4UQBA 5C8BB 3WF0A 1WNOA 4J3XA 1L0PA 1ISWA 1QNQA 4HPGA 2VTFA 1CTNA 1NWSA 2XFFA 1E0VA 4W8LA 2JFEX 3VO0A 1WZLA 3RDKA 2DT2A 1HKMA 1K9FA 3TONA 2EEXA 1LLOA 4JFWA 1CYGA 3BSHA 3BMWA 4N42A 1JAEA 3QOKA 4IM4A 2VZTA 1KWKA 5A8QA 3BCFA 1CGXA 4QCEA 1VFOA 5DO8A 3A4WA 5FKYA 1PIFA 5FCZA 2D20A 2JE8A 5D8ZA 1C93A 2F2HA 1WZMA 3AJ7A 1V3MA 4CCEA 2DPEA 4ACYA 3MUAA 3WH6A 5IFPA 5JBEA 3SCWA 2WLYA 2Z1KA 5CQ1A 3WF3A 5BWFA 1QNPA 2YL5A 4WF7A 4PYSA 1E1FA 4JCMA 3TTSA 5EFFA 4NRRA 4MNLA 3IJ7A 3VDHA 4M8UA 2ZXQA 2ZXBA 4ZXOA 2WKLA 5D9MA 3PHAA 3RM9A 2JEQA 2ZUVA 3NUKA 2NSXA 1LWJA 3ARQA 3VIFA 4BQ3A 3FHQA 1MXGA 1BVZA 2JF6A 3L4VA 3OGSA 4IPLA 1GQKA 2VQUA 3PZMA 1E6RA 1GQLA 3IJ8A 3ARWA 4KGJA 1JZ6A 4P7RA 1U33A 2W62A 4V27A 2XIBA 1J11A 1OIFA 2F8QA 3WDRA 1PX4A 3WH7A 3ZR5A 1XCWA 5GQBA 3FHAA 2G3MA 2WC4A 1ZBCA 2DT1A 1CWYA 5E0CA 1H2JA 4FLQA 1B2YA 1V0MA 4WK9A 4WSJA 4KMQA 3RM8A 3WBEA 2J77A 3EBVA 1XSIA 3TTOA 3VKKA 1TCMA 3WQ5A 3FN9A 4PMQA 1UH4A 2OYMA 3VIOA 3AQUA 1KQYA 3GH5A 3VU2A 1NH6A 2XVNA 3AMKA 1KGUA 1HVQA 4M24A 1NOFA 2DT3A 3GH7A 3VIJA 1W9DM 4Q22A 3AHXA 1BGAA 4B9YA 1BG4A 1CZ1A 1RH9A 3VDAA 1V6WA 5JIWA 3GNPA 3GM8A 3VTRA 2OWCA 1UKQA 3PZNA 3MMUA 1CGYA 4UZSA 2X0YA 4F79A 1DWFM 2VO5A 4ZE4A 1LL6A 1E6PA 3GBEA 5AC4A 1WDPA 1AVAA 3ZM8A 1Q6FA 3CZGA 4PTMA 1E71M 5IFTA 2Z1SA 3UG5A 2A3HA 2A3AA 3OBAA 5CPQA 4S3KA 2DSWA 5FL0A 4PMRA 1LL4A 1JDCA 3DYOA 2W5FA 4IUGA 4W7UA 3WL1A 1H4PA 2W67A 3AROA 3K8MA 3AHVA 3FY1A 4RE3A 5BXTA 4PRWA 1UD6A 1M7XA 2VNCA 3WFLA 4XB3A 1KGXA 3GNOA 2CKRA 3AIEA 4EAMA 3WL0A 3SCPA 5EMYA 1Z32X 2J7GA 1G5AA 4X9YA 4UFKA 1J0KA 1FHDA 4JKKA 3F5LA 3OLGA 5CGMA 1HP5A 4J3UA 1JYWA 1H0IA 2FH8A 2D0HA 2ZX5A 5LA0A 1UKSA 1FP9A 4D6CA 3BLKA 1TUXA 3WDQA 5FL1A 4GI9A 1O7AA 3VM7A 1HKIA 3KWXA 1X6NA 1CBGA 4B16A 2WNWA 2ZX9A 3WH5A 1W1VA 2WHLA 1Q6GA 1NM9A 5E9AA 1QW8A 1NARA 3GYCA 2V38A 1JZ7A 2CHOA 2DQXA 4E2OA 2C8NA 1KB3A 1VENA 5BCAA 1TVNA 3AZRA 1ISZA 4UR9A 2JALA 4YHGA 2DDXA 3EMZA 4F9DA 2WM0A 1ZJBA 4BS0A 5I0DA 2ZWYA 4PMYA 2VRJA 4V2XA 2XSAA 3AFBA 1HJUA 2CEQA 1NQ6A 1QI4A 3OLDA 1WDSA 1Q6DA 1CGTA 4GZIA 1HJSA 3W24A 4EK7A 2W61A 3F4VA 4TTUA 1CXEA 4JL2A 5ABFB 1E6QM 4S3JA 4LYRA 4TUFA 1UHVA 3CGTA 3THDA 1MQRA 2XVKA 3ARYA 4H8VA 4U33A 4D1JA 1BTCA 4WKHA 3W37A 2FHFA 3ZJKA 3VVGA 3W6LA 4JFTA 2D2OA 3VIGA 2WLZA 4L4OA 4Z2HA 1E6ZA 4W5UA 3MANA 1JFXA 2DEPA 2J75A 1GPFA 3NSMA 1KXQA 3A6OA 3PN8A 5A8MA 4U2ZA 1US2A 5HPOA 4HOZA 2XM2A 4LQ1A 2PWDA 1GQIA 4E8CA 4NSBA 2V5DA 2RGLA 2W4XA 1FFRA 5JBDA 3U5UA 1RPKA 4P8XA 1V08A 4TVDA 1S46A 4QFUA 1MFUA 3BSGA 2HISA 1EA9C 2V3FA 2WBKA 2VR4A 3GH4A 3ARUA 1E56A 4AZ5A 1FOBA 3VIPA 2G3JA 3VINA 1WP6A 3L2MA 1SMDA 3WQ8A 4CUCA 3CHDA 1JDAA 1HKJA 2E9BA 1C7SA 2VOTA 4KRUA 1BF2A 4R5EA 5A8OA 3WFZA 3J7HA 1B30A 2YL6A 4PMZA 2ZUUA 2WMKA 1CPUA 3ZJ6A 5A6KA 3HJEA 5DEZA 3WNMA 2Y2WA 3I3EA 5CZKA 3SUSA 2OYKA 4Z2LA 3VD7A 3BAKA 2PWEA 7A3HA 4P7LA 2YL9A 1XH1A 5DMYA 2YDRA 1H0GA 1QBAA 3VD4A 1UR0A 3AXXA 4HMDA 1OSEA 2PWGA 5BXPA 1TR1A 3EMQA 4PCSA 2XWDA 5ECUA 1G1YA 4AD0A 2PBOA 1PAMA 4GO9A 1UD8A 4HP5A 5D9NA 2OYLA 3ZO9A 4PSPA 5M5DA 4B3KA 3B8SA 2E3ZA 2ZE0A 4AZ7A 7CGTA 1JAKA 4MJ2A 3N18A 1BYBA 3BAWA 1GJWA 3WUBA 1XSJA 1QI5A 5I23A 1XC6A 1NOWA 1JNDA 5E70A 1QVBA 1HKKA 2YDQA 1Y7VA 4JL1A 5E6YA 5CPTA 2JF7A 3UR8A 1AMYA 1XRVA 1A3HA 1VBRA 4B15A 4CVWA 3W4RA 2YBTA 3RPMA 1BG9A 1CGVA 3VIKA 1BYCA 1ECEA 3CZEA 3L4TA 4J28A 5GNZA 4AMCA 1KFWA 3FW6A 3ZSTA 1PIGA 2QMJA 3IAQA 2WHKA 4J27A 2O9RA 1SR0A 2E4TA 2VUYA 1VBUA 1V0KA 2VRQA 3SEPA 5D8WA 3BAYA 4CVUA 4QDMA 2V3GA 4HOXA 3SCUA 4PSRA 4KH2A 2ZICA 1K9DA 1HJQA 3WQWA 4OKDA 2VC9A 3RM4A 2GK1B 4FK9A 1MQQA 1RP9A 2NW0A 1GJUA 2OSYA 2IXVA 3BCDA 3ZT7A 4HOWA 1E4IA 4NRSA 4F66A 2D0FA 4TXEA 4W89A 4HA1A 3AS2A 1ISYA 2WMJA 3CMJA 2E8ZA 1OINA 1B3YA 2E8YA 4N0RA 1ZS2A 1JIBA 3WEOA 1G9HA 3W38A 4FLSA 2WPGA 5EBAA 3WH9A 3FAWA 3FNDA 5A6LA 1V3LA 2J8GA 2UY5A 3NYDA 3TA9A 4H8HA 5CSYA 2VX7A 3CBWA 3NDYA 2WKGA 1HJVA 2D0GA 3D3AA 3AS1A 4U3CA 3WDPP 2ZUMA 1E55A 1TG7A 1UWSA 1EO7A 1I75A 3GNRA 5A2AA 1JI2A 5A8NA 3UG4A 2WMFA 4DUVA 1BYAA 4ML4A 6TAAA 1QNSA 4A4AA 3PZGA 4MAZA 3AS0A 3VDBA 1JYNA 5AYIA 4TVUA 1R8LA 3ZJ8A 2E9LA 2WYSA 4K68A 2DSZA 4DWSB 4LYQA 1VJSA 3WNNA 1JZ8A 1GUVA 2DSVA 1GNXA 1M03A 3SUUA 4U5IA 3MO4A 4DM1A 1V3JA 3SCOA 1GOMA 2WZHA 3AIBA 3T0BA 1NP0A 2VJXA 4WLCA 1BHGA 3VIIA 2WCSA 2AOSA 4MNKA 3PZUA 4TTGA 3CPUA 3EDEA 4MADA 4WKAA 1B3WA 4JAWA 4W85A 2VQTA 4CU8A 2XJ7A 5I79A 4M81A 3CHCA 4QLLA 3WKZA 3WH8A 2WMIB 4ATLA 1DTUA 3WUFA 4AEEA 4C7GA 3JUGA 3OIHA 3HMCA 4V28A 1KCLA 4AW7A 2XIIA 2J8FA 1V03A 4ACZB 5CXPA 4YHEA 1V02E 1J01A 5IXEA 2BVDA 2XHYA 3ZJ7A 3BXWA 4EKJA 5KZ6A 4GZJA 2PC8A 1QI3A 1VAHA 2G3IA 5D9OA 3VMPA 1C7TA 1JF5A 2WAGA 2EO7A
chains in the Genus database with same CATH superfamily
1R3RA 1MFVA 3T55A 2CLEA 1CIUA 5HNNA 1OD8A 3LYEA 2WNNA 2XIJA 4H6RA 2YGYA 1IEWA 4UWMA 5CZTA 2CU0A 1PPIA 1DORA 3EEZA 4GI6A 3W7OA 1YDNA 4C6BA 1G4EA 7TIMA 2JEPA 4IIDA 3NZGA 1O12A 3MDUA 4W8BA 2PTWA 4H9MA 5DX7A 3UZ5A 2GUUA 2MANA 5AFDA 3V75A 3N25A 1IGWA 1DEDA 3NQFA 2PZNA 1HXJA 2G96A 3LX9A 3VCNA 3W2UA 4XAFA 3VI2A 2ISVA 3TJ4A 2VFHA 2XVGA 2B7PA 3QR1A 3FFSA 2PLMA 3NOEA 3HQ1A 1XS2A 4OECA 2ZQ0A 4JZ5A 2CLHA 1G01A 3V4BA 1UJQA 5BOOA 3APYA 3CHVA 3W0KA 4O8AA 1W3HA 4N6EA 4AZ6A 3UERA 5I3IA 4NZCA 4WR3A 1KQZA 4G7EA 5M17A 3LHYA 3H12A 5T8GA 4LC8A 3CLWA 1CNVA 1PZ3A 4HNNA 7XIMA 1TPDA 4FOJA 3WQGA 4PTWA 3SY1A 3B0PA 4HCHA 3M4HA 5A3HA 5LGXA 2OB3A 3N19B 4AC1X 1R2TA 3FA5A 2YB1A 3QY8A 3UR7A 1R2SA 1MDRA 3OVQA 4X61A 4JHOA 1H49A 1E4NA 2Z6IA 1BQGA 1U22A 1KR1A 1QASA 4ZQNA 3PZQA 1K6WA 1BVNP 3FJ4A 5FJPA 3TWAA 3SDOA 1LTDA 1TVPA 8TIMA 4RXGA 3KBMA 3G8EA 1JI1A 3LV6A 4JY8A 5HULA 2DW6A 6TIMA 3AHYA 3LHTA 1POJA 1XLAA 3FJ6A 3SFKA 3WLNA 5F4WA 3N9KA 4I3GA 2ZZ7A 4M80A 1UASA 2FLIA 1FWAC 1WXYA 3VUPA 1E1EA 5CCZA 2GJNA 1H5VA 4DJFA 4PE8A 4WJEA 2D24A 3WMLA 3ABZA 2WK2A 1K1DA 3GC5A 3INPA 3S5OA 1KBLA 4UTFA 1MQPA 5BXSA 2GFTA 4BQ4A 3OP2A 4FXFA 2Z1XA 3P81A 5D4YA 2XVPA 5LIXX 3WF4A 3AWNA 3C8FA 4QROA 2X40A 1WZKA 2CIPA 1K02A 1SMAA 1OABA 1A5CA 3SQMA 4QBXA 4N9EA 4HYWA 1MWOA 3TOYA 5EB8A 2RH9A 1PJ9A 4Q3MA 4QJ3B 2O9PA 1XYMA 1VEMA 2P76A 1ODZA 3LUTA 2BOFX 2D1ZA 3TX9A 1UR2A 3GUGA 4BWLC 3VGGA 4XZLX 4GO8A 4RPQA 1TX0A 1Z48A 2Z1BA 5CPOA 3GR8A 2VZOA 4MJ4A 2C3ZA 3UG3A 2YLAA 3QSTA 4RR4A 3GX9A 2Q71A 4XD5A 3STCA 2WPBA 3LN3A 5AY7A 2GWGA 3GR7A 2C71A 3LU2A 2Q3OA 4HQVA 5GNXA 4L6OA 4HPNA 2BHYA 3EDDA 4DF2A 1V3HA 1VF8A 3BG5A 3LTYA 3EMCA 1Z3NA 4A05A 1QPKA 1F4HA 3JW7A 3FV9A 2XZ9A 1RALA 2Z1WA 1B54A 4QTGA 4K2SA 1XUZA 1QHPA 2A1YA 2P5NA 4PEKA 3W7DA 1W6TA 1E9IA 3WNPA 2VFEA 3EWXA 4X2PA 4JTDA 1NF7A 4IMAA 4UFHA 1DIKA 1GVYA 2CHRA 4I9MA 1BFNA 2ZOXA 1KM3A 1B9BA 3LY0A 3SAZA 4J3WA 4FNQA 4OWGA 4YL2A 1G94A 1M04A 1Z69A 2DZPA 2C1IA 3GKAA 5A6TC 1FCUA 4TV6A 1S5VA 1JF6A 3TAKA 1ME9A 4PB4A 1H60A 4R7OA 4H04A 3P8IA 3O3RA 1KM1A 5A6BA 3EDJA 4OIFA 2HS6A 4MZ8A 2F61A 1IIGA 4ATWA 5KEZA 3W07A 3Q37A 3T4CA 5E93A 3GG0A 3AMGA 1I1XA 1LJYA 4Y90A 4OOZA 1T7LA 5TNVA 3NSNA 3LB0A 3A22A 3MVIA 3ITCA 1K77A 5J04A 3WLJA 4B5UA 1MXSA 1TJ2A 2BS9A 3B03A 3OHMB 3V3WA 3ZR4A 3LPGA 5CGQA 1GK8A 2FQIA 3QLDA 3CK5A 4W5ZA 1KM2A 3WQVA 2PDPA 3DESA 1I6NA 5J8LA 1EIBA 3SIMA 3GIPA 1K6AA 3WLHA 2OSWA 4PTXA 1AJ0A 3R43A 3VNDA 1VHNA 3E6EA 4HHLA 2DGAA 2F2KA 2CKSA 3AMCA 3GR4A 1AD4A 2ABAA 3ZOAA 4XO7A 1EDGA 3R0KA 2OO6A 2VC6A 2ZADA 3W71A 2FVMA 4OFCA 1JZ4A 3ABOA 5L6UA 4Z2JA 1AW2A 3CWOX 2FGZA 3STGA 4CN6A 1AQFA 6XIAA 3VNIA 5FIPA 2A7PA 1XKYA 1C9WA 3TQVA 2HBXA 4D6DA 2J4GA 3P74A 1XIGA 3W7MA 2YKKA 1WCGA 3GW0A 4PBEA 5C54A 2NQZA 3S2JA 1XD0A 2DZVA 4KGLA 3VE9A 1OT1A 2IXUA 3N9SA 4BQ5A 4E2BA 2D23A 1A53A 1A49A 5FSEC 2Z7KA 1IWBA 1UKPA 1TA3B 1Z89A 5DN1A 2C0AA 1UW9A 1NWUA 3ANVA 2OWXA 1JG9A 2GL5A 1DP0A 1U2YA 3DECA 3WD2A 1QPQA 3U7VA 2IS7A 3LCWA 3T08A 3AIQA 1UOKA 4XD3A 1EDQA 3G6MA 4O52A 3T1GA 3KOWA 3PBGA 1ZTVA 4WDUA 5FF0A 3PZIA 5HMDA 1POKA 3OHIA 2VEGA 3VDGA 4JTLA 2AGTA 2YSWA 3TYEA 4NQ1A 1W1TA 3MHUA 4YTSA 2VRKA 2ZZ6A 4KESA 2YIHA 4UCFA 3YPIA 4NILA 4OV4A 3A3XA 3VNZA 2G3NA 3SCQA 1M53A 4IXXA 4N4PA 1QO5A 1WZAA 2FHCA 4IX0A 2FYMA 5CPMA 1ICQA 3VGDA 5CG0A 3HA1A 1A4LA 3ARXA 2EPKX 4GIYA 4RW5A 3KOXA 4LSBA 1EWEA 4CKQA 4NX0A 6REQA 5D2VA 4ECLA 4P5UA 1IF2A 1V6TA 5C55A 2GVGA 4L9YA 2TPSA 4GYJA 1E72M 2Y7GA 4G1KA 2WHJA 3JRKA 1W91A 4UFIA 3T4WA 4ROQA 3GXFA 3R89A 4JYDA 1LLZA 4IPNB 3QR3A 5C9UA 4I6VA 1SPQA 2G0WA 4W86A 2OG9A 5JBFA 1GOOA 2PURA 2J13A 4OV9A 2HVMA 1EO5A 1ZLPA 4PCFA 1PHQA 2J66A 1XH0A 3W88A 3CASA 3CUJA 3LPPA 1TPFA 2E1DA 1P6WA 3UP8A 1KBJA 4FLRA 3QXBA 2X16A 1O5RA 4AZCA 2WKJA 1ZJAA 5AYZA 4H8UA 3PK7A 2QHAA 3XINA 3BMVA 3CAKA 3SZ8A 5LA2A 4QR6A 2J7CA 1V79A 1N55A 1F3WA 1PZ1A 3VD5A 5I5RA 4E4FA 4AH7A 3FA4A 4DJFD 1RUSA 1US3A 3ZMRA 3E2VA 2FVKA 5C71A 3RITA 1JCLA 1BGGA 4WXZA 3A5VA 1K03A 4JDBA 3TSMA 4TO8A 2W9MA 1FCVA 3URQA 5GPRA 1IEVA 2VZSA 3BGAA 5I3HA 4H83A 1Z42A 3VFCA 2QW5A 4HA4A 5D37A 1XIBA 4H19A 1XI3A 3H21A 4F2BA 5FD0A 3T2OA 3W70A 1TCDA 1J79A 4EF8A 2TRSA 4HZ8A 2PDKA 2Q6ZA 1EBHA 3UQNA 2XH4A 3N9RA 3HURA 4F0LA 2WBGA 1VFTA 4QLKA 5LXXA 3EWCA 1MO0A 2E67A 4O54A 4A8NA 3CWHA 1DV7A 3OBKA 4LRTA 2VC7A 4RZ4A 2D69A 3LPFA 3R13A 3WF1A 3LTPA 2OX1A 1KRBC 4RKAA 2VWSA 1IYXA 1TSIA 3G5EA 4FF5A 2UBPC 3DYMA 1H7OA 4ZEPA 3OIXA 1HP4A 3EOEA 2E5DA 4A3UA 4PMUA 4FOKA 3VOCA 3GTNA 3IUHA 1PS9A 2YDSA 5XINA 5EU9A 3MHGA 4I5XA 4JTFA 1WXZA 4A8RA 2CBVA 1T8QA 3MV01 4JIRA 1NJJA 6A3HA 2INZA 1UYQA 3WMCA 2C19A 3LG3A 4DBSA 1TPH1 2QYGA 3TQKA 3EWBX 3CYVA 4L1WA 4GI4A 3DUGA 5B7ZA 4A22A 4XBKA 4NNBA 4AEFA 4UQCA 3HG4A 4PUJA 4PMVA 3EXRA 1OX4B 1I45A 5JH2A 5A6BD 1MW3A 1EDTA 1NF0A 2GJRA 4A3QA 1Z6KA 2B7QA 2Z0IA 4YVVA 1IXNA 5D2XA 1FWIC 2V5KA 2WVVA 1EC7A 3M1ZA 2HV5A 1RK5A 3IVUA 3R5EA 4UXDA 3WJZA 4DAFA 5AC6A 5FOOA 1MXDA 1H7NA 3OYXA 1P0NA 4E2DA 2HNHA 5FA5A 2O7SA 2ZWZA 4H8NA 5CGTA 4PMXA 3TA6A 4WKFA 3Q65A 1H1YA 4FXSA 3SY5A 4BA0A 1XG3A 3HGSA 2R8WA 1DHKA 1XGDA 1PKLA 4IG2A 3EEGA 3BJSA 8CGTA 1CLXA 3MCNA 1LT8A 3MC5A 1WPCA 4A3YA 3VMNA 1XWYA 1HIZA 2VFFA 2Z2UA 4H6KA 4LAOA 4RE4A 4B9ZA 4F0RA 5LNSA 3W1LA 3W23A 1JXKA 3W1PA 3ES8A 4C7DA 4HJWA 2YL8A 4YYCA 5EA9A 3NG3A 5AOUA 1ZBVA 5AZ0A 2ZUSA 5H91A 3SM0A 2Y5EA 1OGSA 4MGGA 4IMDA 1EHAA 1KV8A 3BAIA 3F4WA 3WQPA 3E38A 1VD6A 3BLPX 3MO7A 3KRBA 3T0CA 1GQJA 2FFCA 2ZE3A 3WLMA 1YTDA 3WFAA 1OCQA 2CXEA 1PTDA 5IDZA 1XBZA 4JFSA 1B31A 1HUVA 2Y88A 1J2WA 1Q6LA 4GA8A 4M7TA 2D22A 1OK4A 4C7FA 1CGUA 2ZUWA 1AMKA 1P1XA 4V1YA 2NUXA 3G0UA 3UESA 2QCHA 1RD6A 2P1FA 1ISXA 1W5OA 3WF2A 2QDDA 4JFUA 3R11A 3L2LA 1TV3A 5TD4A 3L7RA 1C90A 5T9BG 1EH9A 4U4MA 2EKGA 2DU2A 1QXLA 2EPHA 3FK4A 4D1IA 1E9ZB 1CEOA 2NQJA 3AOFA 1ZBKA 1ZENA 2PDXA 3H4GA 3ID7A 4UQEA 5CLWA 1WE5A 4GIRA 4EPDC 2CBJA 2QJJA 3QW3A 1ZSXA 3PFRA 3A4JA 4M5PA 5CJNA 2BVTA 3EPMA 2GQAA 3AYVA 2NUYA 1EP2A 3QBUA 3MUZ1 1UA7A 3DFNA 2Y24A 4YCPA 5IHSA 1GYLA 1AFSA 4AD3A 3SCVA 1J0HA 2VD8A 3BPWA 1LQ2A 2XSBA 1UWAA 4EPKA 2YA2A 2E77A 4MYXA 3RIKA 4H9YA 3U2EA 1VKFA 1DIOA 3KBSA 3UYCA 3TFCA 4Z1AA 1Q6RA 3C2VA 1UR4A 4GYFA 4R34A 1W2VA 4OJYA 1XX1A 4LCQA 3W3OA 3NO3A 4H7ZA 1OQFA 2GDQA 1TPUA 3UZYA 3ORWA 3WNOA 2DVUA 4Q4MA 3L5MA 1R7AA 4B5SA 1TJ0A 4JIIX 2XFRA 3VGBA 2GVEA 4GUIA 2FGLA 2A3EA 5ABHA 2IPJA 4JBRA 4KCVA 1E40A 3SIZA 3B3DA 2WHMA 1IZKA 3TYUA 4GUHA 1X1OA 3P6LA 1J5SA 3K4AA 1D8CA 1F4AA 5JMUA 3EXSA 2BOEX 4DELA 1EJUC 1P5BA 3K4WA 1MYRA 5EGRA 4LVFA 1ADDA 1JPKA 1C92A 4NU7A 5C7VA 4JTAA 3ALFA 3CUIA 3KDNA 4INFA 3ZSSA 3I7SA 3MKCA 2X7WA 4NHVA 3WNKA 1R3SA 4UQBA 2QEZA 4F48A 1L0PA 4JTGA 2PLKA 1TE6A 2VTFA 4MY8A 1NWSA 2XFFA 1F76A 2JFEX 3VO0A 1W8GA 4B5WA 2FJKA 3N2CA 4IFOA 1HKMA 4HK5A 1K9FA 3MJYA 1R47A 1V51A 2NVAA 2YCLA 4XWUA 5D02A 1DJZA 1CYGA 3BSHA 2XZ7A 3F2CA 2BODX 4IM4A 3W00A 1DXFA 5GJPA 1TELA 5A8QA 3BCFA 1CGXA 1VFOA 3GAYA 1PE1A 4GYPA 5T9CE 1F8MA 4N6FA 2HE5A 2NVDA 5FCZA 2JE8A 3BGGA 1ME8A 5XIAA 2ZC1A 5I3JA 3USBA 5KINA 4CCEA 3EX1A 2PMQA 5JBEA 4H7CA 1YE4A 3MQTA 3SCWA 5CAKA 5CQ1A 2C6QA 3LSBA 2WV8A 1J6PA 2YL5A 4LTSA 1WUEA 3TYBA 1QTWA 3QF0A 3IJ7A 2SFPA 4HMNA 3PY2A 2ZXBA 4ZXOA 2NX9A 3E74A 1U5VA 3NUKA 2NSXA 1LWJA 3KHJA 4JTJA 3M0IA 1GT8A 1BVZA 3DFQA 3NPWA 3QLLA 1MNZA 1JPMA 1J11A 3THAA 4LS2A 1PX4A 3WH7A 1XCWA 1V8EA 3FHAA 5IBXA 2OX4A 5E0CA 3GWQA 1AH3A 4M1BA 4Z1BA 1T8XA 4KMQA 3QH2A 3HF3A 2P3ZA 2NQ9A 1ITQA 3TTOA 1KM4A 3WQ5A 3DFHA 2F6KA 2JK2A 2QULA 3FN9A 4I8YA 3B97A 4PMQA 3AQUA 3ATZA 3RU8X 2BGNE 2QGYA 3VU2A 4W9TA 1S2AA 2QDEA 1L8PA 1ZAIA 2XVNA 4QS6A 4B5TA 2VDIA 1HVQA 1RLDA 1NOFA 3W1TA 2AAMA 3SO7A 1BGAA 3NQEA 3IJ6A 3PBYA 2QJMA 1RH9A 3A12A 4JTIA 3VTRA 4L5ZA 4FS9A 4YXGA 3PZNA 3MMUA 4UZSA 3DEQA 3H4XA 3EXTA 1TJ1A 4BI7A 4NKCA 4AVOA 1AVAA 1GEQA 2P88A 3CZGA 1E71M 4S3KA 1K7FA 3NEHA 3GNXA 1LL4A 3TR2A 1JDCA 1Q8JA 4LVAA 5B80A 2VGBA 2Y1HA 4IIFA 1S5WA 3P80A 1W54A 1PHWA 3BW3A 3XIMA 2J88A 2OELA 5BXTA 1KBIA 3E0IA 4IWWA 4F3HA 1DQWA 1UD6A 2F6XA 2BG5A 1XFBA 3WFLA 3V16A 1UJPA 1Y0EA 3TC3A 3AIEA 1S2CA 1G5AA 2BOGX 4RNJA 4ZO9A 3W7KA 3RYSA 3PBWA 4RCXA 2G3FA 3F2DA 1P6BA 1FHDA 3KS6A 3S6DA 1E0UA 2D0HA 4YYFA 1R30A 3LHUA 1FP9A 1TUXA 5I3FA 4GI9A 1O7AA 3VM7A 4OUIA 3KWXA 1CBGA 1MZHA 2WNWA 3F4DA 3W7RA 1Q6GA 5E9AA 1QW8A 1NARA 3GYCA 3W86A 2C8NA 2H8XA 2E25A 4UR9A 4WDXA 4JN6A 3IGSA 1RY0A 3M5VA 2E28A 2AQOA 3XISA 4J35A 1TREA 5I3GA 1LROA 4O4VA 3LM7A 2CEQA 1XRSA 5D2YA 1CGTA 2Y7FA 4EK7A 2DY3A 4TTUA 1CXEA 1KC7A 3C8NA 5ABFB 2J6VA 3KVMA 4TUFA 3WJYA 2ISWA 2UZ9A 3TYAA 4EX4A 3CGTA 3ARYA 4U33A 4XK2A 2FZNA 5E1QA 3DFPA 1RBLA 4PUWA 1DXIA 2MNRA 1M7JA 4IPJA 5TF0A 1XYAA 3VOJA 1V77A 3DERA 4DO5A 4WY0B 3RRXA 2D2OA 1XPYA 4LF1A 2ZCGA 1WBHA 3MANA 5DELA 3RU6A 5A8MA 5I03A 4UTJA 2XM2A 4LQ1A 1CLKA 4IMEA 1GQIA 5FF3A 3T81A 3U2OA 3I6TA 1PL9A 3CXOA 3U5UA 2OEKA 3HGJA 1XYBA 3BW4A 4TVDA 3B8TA 1S46A 3BSGA 4R7JA 3HV9A 3GXNA 4V1XA 3KRZA 1A5OC 2WJDA 1FTXA 2XIOA 1E56A 5CKSA 5BMWA 3S1UA 4M51A 1FWGC 3L2MA 1SMDA 1MUWA 1C7SA 4KRUA 3V5FA 1EJ7L 2EJAA 1B30A 4PL2A 5CAHA 5A6KA 3CIWA 3DX5A 4O16A 2TMDA 3CUZA 1YBQA 3M0JA 3SUSA 1V4YA 3N3TA 3BAKA 3K2GA 4DYJA 3K13A 2GWNA 1CX9A 1H0GA 4JQ3A 3VD4A 1N8IA 3TW7A 3EMQA 3TC7A 3PULA 1Q63A 4GO9A 4NIRA 4HIBA 4PSPA 2YCEA 2HWGA 4O1BA 3HPZA 4B3KA 4JTEA 1RA5A 7CGTA 4MKNA 3N18A 1BYBA 3BAWA 1KFJA 1NU5A 3L66A 2R1LA 1XC6A 2I5GA 1JNDA 1VYSX 4BKNA 1EP1A 4BI5A 4JL1A 2R9RA 3GTIA 1L6YA 2OLSA 1RVKA 1U5JA 3W1NA 1VBRA 1W1A1 4B15A 4CVWA 3RPMA 2AGKA 3VIKA 3TZNA 1JCXA 4AMCA 1KFWA 3I6RA 1W5PA 3CU2A 1PIGA 4J3ZA 3IAQA 2DZTA 4J27A 4DWDA 1SR0A 4C6KA 1VBUA 5AHNA 2VRQA 3SEPA 3CYJA 3QR0A 4QDMA 2V3GA 3TK7A 4HOXA 2DW7A 2ZICA 1NDWA 3N73A 5DLCA 1O5XA 3DZ1A 4KETA 3E2SA 1V5XA 4FK9A 3NXFA 3TKFA 3G0SA 2VM8A 1U1HA 4IIEA 4TXEA 4W89A 2AQVA 4LY8A 4HA1A 2FIQA 5DMLA 3TLLA 4RDYA 2Z7GA 1FY6A 1ISYA 3KRUA 3WG6A 1EXBA 2KAUC 1LOQA 5K9XA 4RNIA 1VQTA 1MI3A 1JIBA 1VYRA 2XH0A 3LTSA 4FLSA 4IL2A 1S2UA 3ABXA 1YNYA 2EF9A 3KBNA 3BVJA 3JS3A 5CSYA 1VFHA 3CBWA 1LUCB 4JX5A 4N2YA 4ZB2A 1VYPX 3M6YA 2D0GA 3BG3A 3AS1A 3WDPP 1KRAC 1XRFA 3GZ3A 1UWSA 3LLDA 5A2AA 2WMFA 2I16A 3TNBA 1BYAA 1H1ZA 1Q13A 6ALDA 5AHMA 4GH1A 4A4AA 4AF0B 1QJWA 2IQDA 4MAZA 3EPNA 2V69A 2IQTA 5D33A 2I5QA 4HNCA 3EX4A 3SUUA 3OA3A 4L6DA 4U5IA 3MO4A 1WV2A 2DVXA 3LA4A 4CQ9A 2WZHA 4O0KA 4TQTA 3W7IA 3TCSA 3TH6A 3VIIA 4IFKA 2AOSA 4TTGA 3A23A 4JY9A 1M65A 3CPUA 4WKAA 3W7LA 3LCIA 4W85A 3G8RA 3TTEA 3A5FA 1F3XA 1BKHA 3JU2A 2VEKA 3HZ3A 4PBFA 2V63A 1TJRA 4Z1YA 2WMIB 4RXFA 3G3DA 4GNVA 1DTUA 3WUFA 3HG3A 4DBWA 2QIIA 1S2WA 2XIIA 4GX8A 3TQ0A 1V02E 1J01A 4HN8A 2BVDA 3KX6A 4NT0A 2PC8A 4KW2A 4A35A 4EWJA 1YDVA 4Q6JA 4HN4A 5D9OA 3VMPA 2PP3A 1PUDA 4DO4A 3L0NA 2QXWA 4FO4A 1J0ZA 1M6JA 3KRSA 3HTWA 3OZPA 4DB7A 3AS3A 5FJTA 4Q8NA 1LRQA 1BRLB 4ICNA 1EUNA 4HCDA 4WD0A 1NFGA 3UXIA 5H8UA 4PUUA 2FTWA 1D8WA 1G4SA 1SO4A 2WC3A 4UTTC 1HW6A 4CNOA 3GZAA 1EJTC 1YDYA 4CQDA 1ESWA 3BCJA 3KZSA 4GXPA 3B9AA 5EMKA 4OZOA 1G4TA 2NLIA 4JN8A 5I02A 4CNTA 5A2CA 4OBTA 1T5AA 5HK4A 1FH7A 1J93A 2HK1A 3CLMA 3KP0A 3O2LA 1UROA 3UEQA 3JZEA 1ZHAA 1HX0A 3MKVA 4S2BA 2PP1A 5DXXA 4O28A 4LV9A 1UPPA 2QCEA 3PFMA 2VEFA 1AQ0A 4XX6A 1A47A 3PG8A 3T2PA 1VPQA 4JYEA 1FRBA 4IQJA 4JIEA 4IL0A 4NAFB 1DJWA 1NFBA 1X6LA 3DG7A 3PR2A 3LCHA 4EACA 2DZBA 1JFHA 2PD9A 5E6ZA 1R7OA 3WLSA 1AL8A 4L64A 2DH2A 2NSOA 4UOZA 1IV8A 1XC4A 1GVRA 1V3KA 4JXCA 4J3TA 1FHUA 3O9NA 3QMRA 1MEHA 3OGRA 2Z6JA 1IE7C 4GE8A 1UQYA 4Z08A 2Y7DA 4IJCA 2QPSA 3KOZA 4QIUA 1RZMA 5MHBA 3AHTA 1GVIA 1SJDA 4QJ5B 4WSKA 1L2QA 1B3ZA 1WDQA 3DHUA 4C6FA 3THQA 4IH3A 1JD7A 4LVBA 3RMEA 3LQLA 3ARRA 7TAAA 3GSMA 5BROA 1PX8A 2R94A 1WXJA 1GVQA 4KT2A 2V2CA 3LSCA 3P60A 2Y5JA 3VABA 1B5TA 3T8QA 4PBGA 4BI6A 2D2HA 4I9TA 4O1AA 3UBPC 5FJOA 4OGZA 4Y96A 2PE4A 3LBOA 4GCAA 1A0EA 2B0MA 1W3KA 2BHZA 1J9YA 3H7UA 1IT7A 1WKEA 5FF7A 5C2XA 2REQA 5IRPA 5AC5A 2B7NA 4LRSA 1EC9A 2YLLA 2RHGA 4W88A 3CB8A 4REQB 5KZDA 2VWTA 3JR2A 1REQA 1U1JA 2ASHA 3CMGA 2R24A 5DMMA 3SCRA 3OW1A 2QIWA 5HANA 1HJXA 3RX3A 3PUDA 3PUEA 3S2CA 1XLLA 5HWMA 4L9XA 1KFKA 4EXAA 1W9PA 4TIMA 1TMHA 1SZGA 2XINA 4C6CA 2H8ZA 1EFZA 4LALA 2PF8A 1RCOB 3S6OA 3WY1A 2Z25A 3S6TA 1LBMA 3KBVA 3DU0A 1OFPA 1FXPA 4MAVA 1GZGA 3H54A 4TMCA 4XV0A 4R27A 2PBGA 3W26A 3W2KA 3APGA 2CETA 1MDLA 1FWFC 2H90A 1UH3A 4AX6A 1T99A 5HPCA 3VKDA 1AZ2A 4MNMA 3U0HA 3ZVHB 5BNKA 2GVYA 5EKYA 4R7WA 3M0ZA 3AC0A 1CXKA 3N4AA 1H3GA 2ZKMX 1I2OA 2YOCA 3FA3A 4PC8A 4Q7NA 3UWYA 4MYAA 2E5BA 4H7VA 4LUSA 1U1UA 1E0XA 3OB8A 1AK5A 1ZZMA 2ACSA 1PKYA 3NDOA 4TMBA 3B8UA 5ABGA 4WDTA 3IV3A 3OG2A 3IJQA 5LHEA 4ZFMA 1E43A 5G1YA 4AY7A 3T2QA 3AMLA 3DDMA 4A3RA 2WXDM 3W85A 2HXUA 4ADTA 3PZTA 4CN1A 3WLPA 2VX4A 4G8TA 3T42A 3UZXA 4GD0A 2OKOA 3CUFA 3LENA 3R1ZA 1TV5A 2A3BA 1DPMA 4UOJA 1UWRA 4GOAA 4LU0A 3SN4A 4QISA 4QEHA 4CQCA 3K5XA 3NSXA 3B0VC 1SJCA 5FI8A 2I57A 1GKQA 2XISA 3NPXA 1TZZA 3H4WA 3S5NA 1DVJA 1E4LA 3TXZA 1EJWC 4EWND 3FSUA 2CYGA 1KA9F 3LERA 4MWAE 3BJFA 3FYPA 2JGYA 2V2DA 3E5PA 4PN2A 4M0XA 3A4AA 4S2CA 5LNUA 3ANUA 1F5ZA 3EB3A 3RGTA 5T91A 2V5CA 1HN1A 2XWEA 3EOOA 3O63A 5I78A 1ITCA 3AXIA 2PRLA 1OT2A 3LGGA 1YKWA 3AU2A 4RV8A 1FWTA 3TYCA 3T07A 2FZMA 2GJXB 3FSTA 4GZ7A 2BY1A 4H6QA 2W92A 3UJEA 2ZXAA 3GU2A 1E1CA 1FX6A 1Q85A 5J5DA 2X2YA 1EL3A 1QHOA 3DI0A 1DWIM 2J78A 4AMAA 3H55A 3PPGA 4GGHA 3W7PA 3QM3A 2PUZA 4A8LA 4ATDA 2O56A 3TFXA 1XBVA 1I4NA 2Q8XA 3PJTA 4WSHA 4W7VA 1KCKA 4MJZA 2D73A 3CQIA 1KXTA 2PDFA 3EWDA 1GZ1A 4DWSC 3M0KA 2X1TA 1DBTA 1K70A 3TVAA 4IQDA 4UCGA 5E9XA 1NDZA 4O0ZA 3THUA 2I9UA 1E5JA 4JOMA 2PI6A 2X0SA 3NIYA 2CZFA 1DIEA 3P8JA 3N15A 4MFDA 2C1GA 2OQYA 4UMCA 4WJXA 1PBGA 2UY4A 1Q45A 3K4DA 3BUVA 2V3DA 1UP3A 4GKLA 1ME7A 4XKYA 1TQXA 4WRHA 1ZUAX 1FKWA 1LZOA 3N4FA 3H26A 4D6FA 1VJZA 2CCRA 1H41A 4IMCA 3LXAA 1UZ4A 5LIKX 3V0SA 1ADOA 2RGMA 4YNGA 3THCA 4LH8A 3W2JA 1V02A 3W1AA 3QFEA 1PKNA 5HDRA 3UETA 4PRRA 4M6UA 2BB0A 5JXQA 2FZDA 5HMFA 2VL4A 4DI9A 6PTDA 4CQBA 2X1IA 2Y89A 3CHEA 4I6KA 2O92A 3L4UA 2XM1A 2V30A 1H09A 1RJPA 3K1DA 4HU0A 4JX6A 1UA3A 8A3HA 3CPGA 4AY1A 1KRCC 4ACZA 3LD5A 3H2NA 2WSQA 1JNEA 3I3BA 5AECA 3CH9A 4LJ3A 2QR6A 4H4IA 1TMLA 3RR4A 2O9OA 1JYXA 4ZOAA 2OFJA 3WK1A 3WMBA 3AUOA 3IK4A 3MS8A 4ZXLA 3UF9A 2CZ5A 2J62A 3UWVA 4O53A 1RHCA 4LUJA 2VGGA 2VOMA 1QRQA 5I3KA 4DQWA 2FZ9A 1PTGA 3CZJA 1FHLA 2P8BA 1UQZA 4UFMA 3ABSA 1VHCA 4NX5A 2WVUA 2NWSA 2VD9A 4PMOA 2OR2A 3EA2A 4AWTA 3K1GA 3LMZA 1D3GA 1F05A 3S83A 2OKTA 3LLXA 3M7SA 4AIEA 2QJNA 4IP4A 4D2JA 3GQYA 2YXXA 1SW3A 5M2FX 3UXDA 3IAPA 2ZTKA 1CXFA 3L4XA 3CWNA 1UR8A 2OZTA 1Y8BA 5A6MA 4LEFA 1UUQA 1HZYA 4B2DA 2R1NA 1EJVC 3GG8A 1NIUA 1V6XA 1JZ3A 1UD2A 2A3CA 1EUAA 5CZ0A 1J10A 2EG6A 2G4JA 1EJSC 2J9ZA 1EQPA 1W1B1 4AEOA 3BMXA 4R33A 3IIVA 3W27A 4Q8TA 4MNJA 3E9AA 1O4UA 2IKGA 3LRKA 2BXZA 2DUXA 3VNMA 2Z2BA 2JKPA 5D30A 3AALA 4ZO7A 4HHPA 4AQLA 4AD5A 5MKGA 3BARA 4CCZA 1HO1A 4NZJA 3UZWA 4TX9A 4DJEA 3PB2A 4H2CA 3AZSA 2ACQA 1W17A 4LUTB 3E0LA 3LMYA 3TTYA 4CEUC 1N8WA 1I2PA 4UUIA 2DP3A 2WZIA 3DXIA 3S0CA 5ABTA 1DE6A 4UQDA 3ITLA 4LAMA 3NOYA 3WIJA 4CD5A 4FALA 1C29A 1UCWA 1EGMA 2R1PA 1KKRA 1WKDA 3WNLA 1RSCA 4L80A 4TV5A 2WOQA 4U28A 1BKSA 1PB0A 1SO6A 4GC3A 4WXYA 2OZ3A 1EYEA 1A5AA 3CQJA 4C6DA 1RPXA 4GGBA 4DJFC 4CNPA 3QPYA 1A5SA 4WGHA 1R85A 2FB2A 1N7KA 1IXOA 5E09A 2ALDA 1GG1A 2QAFA 1GGOA 2WCGA 4MB3A 1OCNA 3G1XA 3VGEA 4AZHA 4ZQPA 4V15A 2E7FA 3NYZA 4XAYA 1TWSA 3EYPA 4J3SA 2ZUTA 4H00A 3WJWA 3EAUA 2HDJA 4JTSA 3N2MA 3W9ZA 2GDVA 2VEPA 3B40A 1EZWA 1X98A 1JR1A 3UPMA 3Q4DA 3WLQA 2J47A 4DBEA 4PCPA 3NFUA 3SQSA 4IP5A 1XSKA 3W22A 3V5OA 5F1VA 3CZ8A 2BVYA 2RFGA 4L4MA 4NUWA 3W02A 3GXPA 1EYWA 3KEHA 1UMLA 1LQ0A 3UCCA 3U5YA 3OA5A 1XIDA 1R9XA 1S39A 4O4WA 4C6NA 4ZR8A 3O06A 4MUPA 2PA6A 1E5NA 1Z8AA 1LRNA 2FH6A 3CZLA 4NXKA 3ZIZA 3S2MA 3A21A 2G97A 3C3NA 5AYYA 2W63A 6ENLA 3DENA 2FVLA 5C70A 1Q2RA 4AISA 1WAUA 4X63A 4ICMA 3MI6A 3OGVA 2BTMA 3DHPA 3OQ8A 1LWIA 5JUVA 1QMLA 3URBA 4D72A 3BZGA 3AXKA 3CTLA 4RJEA 3UNDA 3WBAA 5HMEA 3S9ZA 1CXLA 4LOCA 4JTHA 4EF9A 4AD2A 5DBTA 3KVJA 1L6SA 4PTVA 5LA1A 1IEXA 3PTQA 3MVTA 2FJUB 3UNTA 4WEVX 1UD4A 3G1HA 1QW9A 3RO6A 3P82A 4MWAA 5CZSA 4H9ZA 4QXIA 3FX4A 2RUSA 3KAOA 1W5NA 3QY6A 3ZLFA 1Q2SA 4GZEA 1QI2A 1Q5MA 3STEA 2W79A 3ARPA 4QLJA 4HNTA 2I5IA 3UXLA 1VCFA 4GG9A 1YMYA 1JYVA 5ECVA 3RLHA 4M82A 5HQMA 2Q01A 3OBEA 5IM51 4DY1A 3RN6A 3F1QA 3IJ9A 2J7FA 1J2BA 2RDWA 2J7DA 4POCA 4C1LA 4MTVA 2W27A 2WJZA 3NM1A 3G6LA 4GISA 4R9XA 4LF2A 2QDGA 3A3HA 1W9UA 4PODA 3EOSA 4ZSUA 2X09A 4JFVA 3GO2A 3K8LA 4R53A 1TZ7A 4ALDA 3M0LA 1YPIA 4GI8A 3SURA 3TDFA 4H3DA 4ZSTA 3NCOA 5F7UA 2NV2A 3PBUA 4C91A 1FXQA 6CGTA 3MWAA 5AC7A 3UGRA 3NZPA 1OK6A 3T78A 3PTMA 3KCLA 4K3ZA 3N6QA 1JPHA 1P48A 2JIEA 5A6AA 4XVEA 4NNCA 1NY1A 4QDWA 1SZFA 3DHFA 4X22A 3ZR6A 5H6HA 4W7WA 2Y70A 4ZE5A 3PVFA 4KWOA 1FH9A 4BEQA 4PB5A 4FX8A 4EANA 3D5HA 1AJ2A 1YXYA 5LXEA 2EPLX 1FHVA 2XG9A 4FX6M 3HGOA 4IZGA 3RLVA 2O0TA 1YTEA 3W81A 4GVHA 4NJIA 3GK0A 1EQCA 1GJPA 3L0KA 1UKTA 2W91A 3O1NA 2DUAA 4PFMA 3Q2DA 1B1YA 2PU1A 4AD1A 3WK2A 3N1AA 1HVXA 4S1FA 1F2JA 2RDUA 1NFPA 4O10A 1AZ1A 5A6JA 4JEQA 4DN1A 2X1SA 4RL3A 2VX5A 2CXGA 5CLTA 3GYEA 3EKZA 4A21A 3P5ZA 1QO2A 1IGSA 4M29A 2ON3A 4KCWA 4S23A 4EOUA 1VEOA 2CZDA 1MZRA 1J0IA 4M56A 3GE7A 1EXPA 5K9DA 2YCIX 1KFEA 3NWRA 5H1WA 2YCJA 1KTBA 2Y4SA 5JIPA 2F7FA 1XP3A 2BDQA 2PTYA 4L4LA 1XLMA 4HU8A 5ABEA 3EWUA 2V3EA 3RUBL 1KXVA 4UR7A 3FLUA 1T96A 2X05A 1QK0A 4LPCA 3SGUA 2E6DA 2Z24A 4LGXA 3IV8A 1CECA 5C2GA 3ENLA 3G0XA 2PB1A 3QV7A 3O05A 4MY1A 3S42A 1QR7A 2EJ1A 3AMDA 3ZT6A 2A5HA 3GFZA 1UZ1A 3OLIA 2JQXA 3ARSA 3GNDA 3KUMA 2HEJA 2GOKA 2OU4A 4EXBA 2IPWA 2H9AA 1E4MM 4D6HA 5G2IA 1MUCA 4PFHA 4UQAA 1UWIA 4QS5A 1NAL1 3TWBA 3BQ5A 4Z1DA 4DZIA 3IUDA 2ZZ4A 1FWHC 4HK6A 1P1MA 1V6UA 1XDLA 1IXPA 4Y9AA 3M43A 3H7RA 3TAOA 1KM0A 2HCVA 4HYRA 4D8ZA 4B2DD 4P7OA 4CEXC 5HBFA 1LL7A 1IZJA 4NJJA 1QNOA 4IGMA 4A3HA 1TTJA 2H9AB 1ZBWA 3BICA 1GEHA 5LIWX 2Z28A 4J3XA 4JIQA 4Q4SA 1KRMA 3D0CA 1E0VA 4S3GA 4N9BA 3NZQA 4WUIA 1F7BA 2G95A 5G1TA 1G6CA 2DT2A 3R94A 2QCMA 3S1XA 1P6CA 3NVTA 2EEXA 1LLOA 1TRDA 2WSYA 3F7JA 4UTWC 3SR7A 5GJNA 2ZA1A 3SB0A 2G37A 3OJGA 5EL1A 3QGAC 5F2GA 2GPTA 1RR2A 4HT3A 4DJED 3W75A 2NV1A 4M6VA 4B5NA 4NZ3A 1UOZA 3A4WA 1BSLA 1X7IA 4DRSA 1PIFA 5D8ZA 1C93A 5DRCA 4O15A 3CQHA 3QFWA 3RXZA 3C2RA 4XO6A 3MSRA 1RVGA 2HMCA 2DPEA 2IMRA 3GVQA 4ACYA 1TWZA 3MUAA 2ISDA 4DIAA 1I2RA 5E5CA 1P7TB 3B4UA 4PULA 3WF3A 2YDAA 4N7QA 3GD6A 1QK2A 2I56A 3V35A 5LGZA 4KIEA 4MNLA 3VDHA 1IT8A 1R3YA 4YLWA 4A2SA 4IOTA 2P10A 3VIFA 3G1AA 1DJGA 4FNSA 4X60A 1EGVA 1QOPA 2PGFA 2JF6A 2BVWA 3B4YA 1GQLA 2GVJA 3M9YA 4AHQA 4KGJA 1SVDA 1XIJA 4P7RA 4C1NA 1U33A 4V27A 1O5QA 3UY8A 2XIBA 2F8QA 1F3TA 1M7PA 4MVAA 2GQ8A 1XQLA 2PCQA 2ZDSA 3S4TA 1CWYA 4FLQA 3HO8A 4OVXA 4O1CA 4WSJA 4LFYA 1S5TA 3EBVA 4MZ1A 3UJFA 3ZWTA 3W7NA 1UH4A 2OYMA 3VIOA 3WLRA 1X8CA 5FAJA 1KQYA 5H8PA 3BANA 1NH6A 3GDTA 4HZMA 3AMKA 1KGUA 4E8GA 4J2MA 4J1OA 3TJLA 2DT3A 2PDHA 3GH7A 3VIJA 5BWAA 1ZAHA 3QV9A 1QT1A 1XIIA 1W9DM 1IR1A 4YTQA 4B9YA 3BE7A 1BG4A 1CZ1A 2A7NA 3GNPA 3O16A 3GM8A 5D03A 3TQPA 4F79A 2V68A 1LL6A 1E6PA 1DQUA 5CSSA 1AD1A 3MUCA 4IMGA 1TTPA 3ZM8A 1FBAA 4PTMA 1VH7A 3UG5A 3OBAA 5CPQA 2DSWA 3IS4A 3IARA 2DQWA 4AFYA 3HV8A 2VFGA 2W5FA 3DBNA 4IUGA 1FWEC 4GQ0A 4G7EB 2W67A 3AROA 3FOKA 4GVFA 3QTPA 3K8MA 3FY1A 2XH7A 2VGIA 3S5SA 1M7XA 2IW0A 2ACRA 4GUFA 3P62A 3GNOA 4PUNA 2CKRA 4RDWA 3WL0A 5LNVA 1Q7QA 4AWUA 4XZMX 3IRSA 2QAPA 3TW9A 1I2QA 1KTNA 2Q02A 4ZBCA 4LANA 3CEUA 2GSHA 4J3UA 3W7GA 3LV5A 5RUBA 1OC6A 3TNOA 2ZX5A 3Q58A 5LA0A 1UKSA 4D6CA 1YADA 1Q3NA 4MWAD 3BOLA 3PB0A 1X6NA 4OHQA 3WH5A 4Z42C 2WHLA 1UIOA 3U6WA 1QW7A 3L5AA 1R3VA 2V38A 2CHOA 2P8CA 4RUBA 1TVNA 3AZRA 4NY2A 4PL1A 1TZ9A 5HWJA 4J2PA 3GHTA 2XDFA 1XLCA 4IT1A 4BS0A 4IJBA 3ZLGA 1BWLA 4PMYA 2HTMA 2V5BA 4V2XA 1EJXC 1QI4A 1XJBA 3OLDA 1WDSA 3L68A 4MY9A 3HGRA 4KERA 4GZIA 1RBAA 2W61A 5EY5A 4AXKA 3THDA 5C5YA 4ML9A 3W73A 4D1JA 1JCMP 3ZWSA 4XKMA 1RY8A 4G6CA 4E2VA 1BTCA 3W37A 2FHFA 3ZFHA 1W37A 1BWKA 3GNNA 3W6LA 1WYIA 3STFA 4JFTA 4Y2WA 3LCXA 2PS2A 3TMQA 2FDSA 1EZ2A 1H5YA 1QWKA 2DFAA 4UTMA 4N9CA 2J75A 2QUNA 3PN8A 4U2ZA 5HPOA 4LAUA 3R2GA 4OTKA 2C16A 2PWDA 4C60A 4E8CA 3PSVA 4OT7A 3KBWA 1KD0A 3I4EA 2PEVA 1VJIA 1TKKA 2CW6A 4BFAA 3E12A 1N8FA 4XBSA 4QFUA 2VDHA 2HISA 3HB9A 3LZ3A 1EA9C 1XW8A 3C56A 2E6FA 2VR4A 5AC8A 4RLIA 3IACA 2HS8A 2VEMA 5K3VA 4JTTA 3VOGA 3WQ8A 2PC4A 4CUCA 2YR1A 1JDAA 4XZHA 5KTLA 4JNZA 1MRQA 3WFZA 3T9PA 3ZJ6A 3HPSA 4K8GA 5DEZA 1PSCA 1A4MA 4K7YA 3VNLA 3WNMA 2Y2WA 2RAGA 1A3XA 1DJHA 3WLLA 3IGXA 4IPPA 2PWEA 2YDRA 5G4WA 2R91A 1QBAA 3R4IA 5AHLA 1UR0A 3AXXA 4HMDA 1TR1A 2DZAA 2NX1A 1G1YA 3GVGA 4AD0A 1UD8A 1W3IA 4MPQA 1NDVA 2FZ8A 4O57A 4AZ7A 2POZA 1G67A 4G7FA 1W8SA 4IJRA 1ZNNA 2CZVA 1A5MC 3FCPA 1NOWA 4ZQMA 4D9PA 1HKKA 3HIJA 5D2TA 3WBYA 3N29A 1TYGA 3LHVA 4ADUA 3GHRA 1A3HA 1KLYA 1QAPA 2YBTA 2L5HA 1CGVA 3MJMA 3CAWA 3FW6A 1RAKA 4H9VA 3S5YA 2WHKA 3LEPA 3CM4A 3KTSA 3U4AA 2QJIA 5D8WA 1OYCA 4C65A 8XIAA 2NV9A 3N2OA 3NQGA 1K9DA 1O1ZA 2Z27A 4HGXA 2QUUA 4ZQRA 5FF2A 4GIEA 4N4QA 4QG6A 5FF4A 1MQQA 3LRLA 1JEZA 2NW0A 3QGKC 3KOYA 2PZ0A 3PPFA 5KITA 4E4UA 1ECQA 3M0VA 5FEPA 2D0FA 2PGRA 4NXSA 1Q6OA 3F4NA 2UV8G 5I09A 3U2CA 3H6OA 2WMJA 4I5UA 5AHIA 2E8ZA 4PZVA 1IWAA 3W7CA 4JNMA 2AL2A 2E8YA 3OO2A 2V2HA 1H7PA 1HKWA 2WPGA 1IHIA 2I9EA 3NQAA 2G50A 1ML1A 1V3LA 4H1ZA 1WDDA 1JUKA 3TA9A 1NDYA 3G1VA 3NDYA 4X9SA 3HG5A 5DRIA 3D3AA 4R3UA 2PPGA 1I75A 3QZEA 3BG9A 1ZCCA 3GNRA 3VOIA 4R85A 3LI1A 4ML4A 1OC7A 3AS0A 1JUBA 2DJLA 4XBJA 2WYSA 3VCCA 3WNNA 1VJSA 3KBJA 1JZ8A 2W0UA 1M03A 3BLLA 4KQNA 1VC4A 4QM1A 1B57A 2OCZA 4GYPC 4H01A 1GOMA 1YNPA 9RUBA 3G1SA 1PVNA 4WLCA 2OMAA 2PODA 3PZUA 2V5JA 1M1BA 3UXAA 3EDEA 1D3HA 3FJLA 3TUUA 2VQTA 3O0FA 3NA8A 3TC6A 3QQ1A 4K6AA 5I79A 3EOLA 4HSHA 7REQA 2FMOA 3CHCA 4QLLA 4F4RA 4ATLA 4JTCA 4Q7BA 4C7GA 3JUGA 3CH0A 3HMCA 4V28A 1KCLA 4B3ZA 3BLIA 3W84A 3PPCA 3EOUA 4YHEA 5IXEA 4S38A 4IIGA 3IVTA 4AYGA 3S1VA 4EKJA 2ZRWA 4GZJA 5GVJA 1OX6A 3GC4A 3TN6A 4RPPA 3W1RA 1J6OA 1JULA 3ERPA 4I90A 1HKVA 2ICSA 3BLOA 2AMGA 3VFLA 4P8VA 1G0CA 1ZP4A 2E6AA 3Q94A 4AD4A 2BWGA 1OM0A 5KZEA 3DH7A 4UFJA 2OGJA 4AYSA 4A2RA 4UMAA 3GIQA 5REQA 6REQB 3NURA 4UTUA 1NQKA 1PO9A 3E96A 1B3OA 4KEUA 2VFIA 3KW3A 2PDQA 4IISA 2PWUA 3I10A 4YJ5A 2E68A 3W28A 8XIMA 5CJ5A 5C6MA 4E8DA 3ITYA 1ZFJA 4UTTA 5SWUA 1QFEA 1V93A 1JDDA 4QAIA 3IANA 1AUSL 1ISVA 1BWVA 2ZRZA 5FJIA 4PTNA 3MT1A 1GQNA 5HOSA 3FGCA 3ZT5A 1Q7ZA 4HTYA 1X1NA 2W3ZA 4IQEA 4JN7A 1KR0A 3UZZA 3D46A 4GLEA 2OWWA 1EX1A 1RLCL 4AZCB 2BV9A 1RP8A 1UIPA 1Y5XA 3M07A 2DZUA 1VCVA 4OOUA 3AI0A 1HQTA 4QNEA 4M6PA 5A69A 1ZY9A 4LVGA 3W7HA 5CSUA 2XN1A 1KFLA 3FYOA 4I7VA 3N17A 3NVDA 1M9HA 1H63A 2P0IA 5I77A 2CESA 1GHRA 3FGCB 2VCAA 5K4XA 5LYRA 2DT0A 4YMZA 1L6GA 5HUPA 3G1FA 4W4QA 1EF3A 1UWTA 4PB3A 1JDEA 3MI3A 1W5MA 4LB4A 5T26A 1TTQA 3AO0A 3W87A 4IF2A 2DUZA 3PM6A 4ZB5A 4CGTA 3GAKA 2FHBA 4LVDA 3MBFA 4FIQA 1H1NA 1O95A 4U5KA 5A2BA 1EX5A 2C14A 3H8AA 4S3CA 1DWHM 2YCKX 4BQ2A 7PTDA 3IK2A 1O6IA 3MP5A 4JQ4A 4KKXA 5EBUA 5FEWA 1ZGDA 4D6GA 2BY3A 1YTKA 3U8GA 3E02A 1R87A 4B4FA 3URNA 4LNCA 2CBIA 3LDVA 2Z00A 3FVMA 1W9BM 3A3WA 3P93A 3NXLA 1XLDA 3HPXA 1GVEA 2Y5SA 1E9LA 2FPVA 2XGBA 4EVZA 4LBUA 2UWFA 1Q7MA 3ARVA 3LHWA 4Y9NA 4XISA 3CL6A 2OEJA 5E0FA 2XPKA 4XIAA 4B91A 3QRHA 1XLEA 4S3FA 2X8RA 1VEPA 3PZVA 1HNYA 3TOPA 3CO4A 1JQXA 4P8WA 2WSPA 4YU1A 4ZOEA 2QCDA 1C8QA 3QQWA 1YQ2A 1BYDA 3GG1A 3O0KA 1DJIA 4TR9A 1O66A 2CLFA 1HL9A 4LNYA 1BF6A 2D3LA 1D3CA 1E6SM 3UJSA 4Q8MA 5I00A 1R3TA 3ARZA 3PWGA 2W66A 3TV8A 1HT6A 3NQBA 1YE6A 1JCYA 1EOKA 3MPGA 4UR8A 3VIHA 2Y0FA 2WNZA 1GKRA 4CLMA 2HJPA 3W6MA 2ZUNA 4QJ4B 1Q8AA 3H23A 1AG1O 5I3DA 3W2LA 4Z2GA 1EHNA 4C6LA 3M0YA 4L56A 4DJDC 1WA3A 5HR6A 3O6YX 2GSEA 5K2ZA 3W7JA 4ERAA 3HMJG 1UH2A 3WEZA 1P43A 1P0KA 5A1AA 1CDGA 4O1FA 3MKKA 1ENUA 3CUGA 4MG4A 4NJGA 4GUGA 2WVVB 4GQRA 3RAOA 4P8UA 1J8VA 4PMNA 3QMSA 1WAWA 2VVSA 3MMTA 3PUGA 3CQ0A 5TBOA 2PRHA 2LLEA 5AKQA 4QHRA 3QOMA 3FIGA 3KXQA 4F0MA 1RD5A 4ZENA 2HNEA 3I7QA 3PAJA 3KTCA 3N11A 3P5YA 3VD9A 1W31A 1L8NA 3LCGA 3GW3A 3A24A 3GY1A 3UPWA 3VNJA 2EPMX 3RILA 4IG2B 1K9TA 3BOXA 2OSXA 1XF0A 1VPXA 1WDRA 1R2RA 3MY9A 1GW1A 3WENA 3TZFA 3EX3A 4QE1A 1GKPA 2GGEA 4RW3A 4B92A 3OODA 4CNUA 1SGJA 3RJYA 3MMDA 1DWAM 2GJLA 3KE0A 3CT2A 5DMNA 2ESCA 3LS9A 4M6QA 3VILA 5C9WA 5CG7A 1OCBA 4HMCA 1K9EA 4MDOA 2GGHA 3C4UA 2ZFAA 1W2PA 1QHZA 3M0MA 2QLYA 3ABQA 1EBGA 2GK1A 4MB1A 1YNQA 1EA0A 4GFSA 2ZZ1A 3RNDA 4JD4A 4ZTXA 1LT7A 1I60A 1O1HA 2Y8KA 4RE2A 2EKCA 4XUGA 2YXOA 3SN0A 1OIMA 2NXIA 3WQ6A 3P67A 2PLJA 1KO0A 2OQLA 3OTRA 3W25A 4HPHA 2OTDA 4F0SA 1GHSA 4FHAA 2AKMA 1M7OA 4O1DA 4ZA0A 3H2MA 4AXNA 2Y61A 5BRPA 1OC5A 4LV4A 4FR6A 4WGXA 2Q09A 4NNAA 2FDMA 3WDJA 1UR9A 3DG6A 4AWEA 4RX0A 1S2TA 3FEMA 3NAVA 2B31A 3RRAA 5A94A 3SY8A 4Q8UA 1R38A 3M0XA 1HF6A 3CIXA 1W3LA 1E3ZA 1I1WA 4EPEC 2P3EA 2VGFA 5DY2A 1MW1A 3JZUA 4EIVA 3WLOA 3NL6A 3LGDA 2OPJA 3VKBA 1ZU8A 4DWSA 2TAAA 4LAZA 3EDKA 1FWNA 5EPDA 1PIIA 2OO0A 4MB4A 3M46A 2YJQA 4LS0A 2XVLA 4JQ2A 2A2IA 1ONWA 3KWSA 1VIWA 3B0YA 3AHZA 5BOFA 3TLQA 3DC0A 4GH3A 2XU2A 2AKZA 3B8WA 3AIUA 3KL5A 1OG0A 4YCOA 5DXYA 4BF5A 4H9XA 1T0OA 3WUEA 1H62A 1YPXA 1Z41A 1OCJA 2E09A 1FFQA 1K8XA 3CL7A 5HJLA 4K7VA 4UFLA 3SGGA 3VE7A 4JDYA 4R88A 4C90A 5F4SA 2C91A 4HNVA 4HHMA 4X0VA 3BTNA 4O11A 3W53A 4H41A 4W87A 4H9TA 2V5LA 2C15A 1D9EA 2EQDA 5ENLA 1I0DA 3A4XA 4P7QA 3VIMA 2GGJA 4KPLA 3QW4B 1TPC1 3UW6A 3VPLA 4CU7A 2FMNA 3S8HA 3PBVA 3POCA 2OXNA 3C2EA 4AIOA 4DEFA 3ELFA 3WQFA 3KLKA 2XYLA 3SADA 3KFTA 1SZEA 4O18A 1G7VA 3GVRA 1DWGM 1OFDA 3CHFA 3M0HA 1DOSA 4ZODA 3BZJA 4E3VA 1TVLA 4EE9A 2YBVA 3R25A 1M01A 4N9DA 2Y8UA 3QHMA 2YCLB 1A5BA 3M44A 4AU0A 2ZZ5A 4WCJA 2J79A 4D71A 5GJMA 1JCJA 3W01A 3T05A 2CLMA 3QSRA 2EXOA 2QDHA 1O68A 1SM9A 4DUWA 4XZBA 4L6HA 1DE5A 1JCTA 1Q4WA 3MWCA 1X96A 3G24A 4XQ6A 3WD4A 4IIHA 2VVNA 1QUMA 3U2ZA 3JVAA 1XICA 3UR2A 4DLFA 2EBNA 4AUBA 2VR2A 1SFSA 2CC0A 1WKYA 1XYFA 4ZGYA 3CT7A 3WLTA 1UG6A 4QG8A 4DBDA 4DXKA 5AVNA 1UD5A 4RZ5A 3MCOA 1OBAA 2PTXA 3GDRA 3BJTA 1JCNA 1DWJM 4Q4QA 2IKHA 2HPIA 1JJKA 1RQHA 3DYPA 1HJWA 2CNCA 3B9DA 4LC6A 2QMKA 3QTGA 2VX6A 3GC2A 4C6MA 4GUJA 2QJHA 3B8DA 3B9EA 1FCBA 2JGQA 3UWUA 1B90A 1GWJA 1V6VA 1BLIA 4WJ8A 3VYLA 1PZ2A 2X1RA 3VC5A 1ZB5A 1A5KC 1Z7AA 2OLHA 3S9YA 3GUWA 4D6IA 1GG0A 4KS0A 4L7ZA 4DYEA 5I07A 4GQBA 4DF1A 3REQA 1GTEA 3L9CA 2PDMA 3UFYA 1VLWA 3UWQA 4LW7A 3SUWA 3NL5A 4GVIA 2QCLA 1TPB1 1KBBA 4W84A 1FWDC 3WBXA 1L6FA 2C0HA 4Q8PA 3R0UA 3DFYA 4CD4A 1EOMA 4XSLA 4JKMA 3LGEA 5KETA 3DGBA 1XH2A 3REQB 2O55A 1SQ7A 5DCDA 5HA7A 4GC4A 4UMBA 4LWWA 1LQAA 3KTXA 1XYZA 4ZMGA 4WQ6A 4JTKA 5D9PA 1VGAA 1CLVA 5FJRA 4RV3A 3RF9A 3RLGA 3V1PA 3R8HA 2Y63A 3KVKA 4NJHA 2BY0A 1VFFA 1KFBA 2EG7A 1BXBA 3PWAA 1OFOA 4KWUA 1V6YA 5AYXA 1GOXA 3TE9A 1XGZA 2V8ZA 4B90A 3PPHA 3ITOA 1NEYA 3QYQA 1RQBA 1TWIA 2WMHA 2ZX6A 3LNMA 3V18A 1XR2A 3EA3A 5LSMA 2DH3A 1EEXA 3ATYA 4F2UA 4Q7IA 2G8ZA 1PWMA 2V67A 5BOEA 2J25A 2GUYA 3W7EA 2BSLA 2PWVA 4CN4A 3B05A 4UB9A 1MVYA 2FZBA 3W1MA 4JHZA 1LF1A 3NQ6A 4M1RA 5HINA 5D05A 3PP7A 2VCCA 1DXEA 1PEZA 1U30A 4FNUA 4FP1A 1G7UA 1BQCA 3FS2A 4U31A 4MF4A 2WWDA 3E2QA 2WANA 2QKFA 1CENA 4LT9A 3NTYA 4FNPA 1XLIA 5I2UA 3DOPA 3PNZA 3IRDA 1QPRA 2QGHA 4CQAA 4PMDA 3ZZ1A 2DSKA 3FEQA 2WCAA 1IT0A 3PZ9A 3FVDA 1SFJA 4C6IA 2FTYA 2G41A 3KS5A 5AHEA 4HZ6A 3E1F1 4DUXA 2DSUA 4I9AA 4I8DA 5M03A 4UNIA 3RO8A 1XQKA 3OVGA 3WD0A 4HU4A 3FKRA 2EG8A 3BLEA 1J12A 4UTKA 1DKWA 5AVHA 3ITGA 5GNYA 1H11A 4JHMA 1XBXA 2G4FA 3FJNA 5AYBA 3U57A 4MSSA 2TSYA 1B4EA 3WEMA 1AL7A 1WX0A 2X7VA 3OU8A 4YIWA 1CI1A 1ZL1A 3LBCA 4GY7A 3I3DA 4ZO6A 4XD4A 3NQ2A 3NEVA 1W1PA 3TN3A 4MOZA 1XL9A 1VBJA 2WVSA 1XIMA 3FDGA 4GJIA 3WMSA 1EGZA 4AZBA 2P50A 2J7EA 4O17A 2POTA 4YTTA 3L21A 3N2BA 1ZPTA 4QDPA 4DO6A 4UZUA 2A6LA 1CXHA 1VZWA 3N6HA 3ALGA 5HXMA 1BTMA 4PUEA 3I68A 1MUMA 2KX9A 3N14A 2YX0A 2PTZA 3R8RA 3A13A 2QCCA 5C9XA 3NO5A 2HVOA 5KSWA 4RDZA 2WSRA 4LCRA 2O9TA 3UWZA 4BR1A 1WOAA 4FMVA 2J74A 3F5JA 4K37A 1SUXA 1X1ZA 1UZHA 3ZS4A 1Q4NX 3DC8A 3MHFA