4HZ7A

Crystal structure of bglb with glucose
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords beta-glucosidase
total genus 173
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz7A00
3WY1A 1V6XA 2J7HA 1MW1A 1O6IA 3GYCA 5A6KA 2WLZA 5CQ1A 5A8PA 3ECQA 1KB3A 1TG7A 4B16A 4CCEA 4DWSB 1KXQA 1WZKA 2ZX5A 4JKMA 1XYZA 3SCRA 3ZR6A 5IFPA 4MB1A 1BFNA 1NOWA 4U5KA 4FK9A 1Q6FA 3AXXA 3CUFA 5GNXA 3T0DA 1LL4A 1NARA 2ZUWA 4X0NA 3VIHA 5E09A 2CYGA 1Q4NX 4EK7A 3WQ4A 4PBGA 4J27A 4M82A 4U2YA 3CUIA 1Q6CA 3AIRA 4DUWA 3F5JA 1JIBA 3L4XA 1CGYA 2ZOXA 3VUPA 3KL3A 3LPGA 3QOMA 1HP4A 1XSKA 1JZ2A 4WJXA 1I1WA 3WNLA 3L2MA 2E8YA 3W25A 4D6JA 2X2YA 4E2OA 1N82A 4TUFA 1NWRA 2V3DA 2DSZA 1OIFA 1XD1A 3AHXA 3AZRA 5A6AA 2CKSA 4FF5A 5IXEA 3M46A 3A4XA 5IFTA 1JF5A 1PAMA 4AD2A 5D8WA 4QCEA 2DH3A 2XSAA 2QHAA 3ARSA 1ZU8A 3OB8A 4LX4A 3A4AA 1K6AA 1GJUA 3RMEA 4YN5A 3QOKA 5GQBA 1HP5A 3ZJKA 4UOZA 2BS9A 1FFQA 4P7NA 1MFVA 4CKQA 1CLVA 1V3HA 2PBOA 1E0XA 1LG1A 3WELA 3GXFA 1MWOA 2WMIB 2XIBA 3SUUA 5DF0A 3LPFA 2WSPA 2YDQA 1HJXA 2VURA 1UD2A 4TVDA 4NF7A 3L4YA 4BF7A 1QI0A 1QBAA 4P8XA 4AIOA 4U2ZA 1U30A 3UR7A 4A3YA 2JF7A 3BAKA 4W86A 2GDVA 1E73M 3MUIA 5D9NA 4JFUA 3F5KA 2CNCA 4OBSA 3A47A 3VNYA 3FY1A 3TTYA 3KE0A 1VEPA 1E9LA 3CZLA 1UKTA 1H49A 4Z2KA 1UR0A 2XGIA 1X6LA 3CHFA 1YQ2A 2V3GA 4W7WA 1BVZA 1E5NA 2J7EA 4PUDA 4TOQA 4PTMA 4WSKA 1JDAA 1M01A 2WZIA 1XCXA 3RM8A 1CENA 2VRJA 4JFSA 1OGGA 1V6YA 3GH7A 1CLXA 2NW0A 1HKKA 1UA3A 1W9UA 1OSEA 1ESWA 4UQCA 3K1DA 1FH7A 3VIOA 4ZEPA 3FW6A 1IZKA 3ZQ9A 3WMCA 2A3EA 8CGTA 2OYLA 4KGLA 1GORA 2WCAA 1ZBVA 1PBGA 4J3UA 3W4RA 1ISZA 5CLWA 1E55A 4WKAA 1GHSA 1C8QA 1I75A 1M03A 5GNZA 5TD4A 1KQYA 1UR2A 4FLOA 1H0IA 4KMQA 3RILA 4LYQA 3SUVA 1VENA 2FHBA 3AIUA 3BLPX 5HNNA 1IT0A 3WDHA 2PWDA 4CVWA 3WD3A 3N9KA 4GI9A 3W82A 1TZ7A 3L4ZA 3BLKA 1MYRA 2E0PA 2D22A 4H2CA 1KFWA 5E0CA 2WKLA 4F8XA 4UZSA 1XHGA 1HNYA 4J3VA 3WBEA 3K4AA 2VI0A 3MU7A 1QHPA 4ZE4A 2E8ZA 1TMQA 2EO7A 1E40A 1R85A 5M17A 3VKKA 3WN6A 1HJUA 3ZJ7A 2WVVB 1MQQA 3WF0A 1NP0A 3W37A 4UQ9A 5JUVA 1PEZA 4M81A 2XTKA 1R86A 2D0FA 2X0YA 3DYPA 2BXYA 1HVQA 1ZBCA 4J28A 3GNOA 3VIMA 3VINA 1VF8A 1HKJA 2J7DA 1XH0A 3IAPA 3IANA 5JBFA 3W53A 2YL9A 1E15A 5E6YA 1TA3A 4HZ6A 3S6TA 1G5AA 1IZJA 3A6OA 4F9JA 1FHLA 1OIMA 4GPNA 4A3HA 5I3DA 5F7UA 2D1ZA 3OG2A 3ZJ8A 1E1EA 2C7FA 5BROA 1UZ4A 4UQBA 1E70M 1JD9A 2ZXQA 1CEOA 1JZ8A 4AMCA 3WQ8A 1CTNA 4Z2GA 5A6MA 1JD7A 1RP9A 2VQUA 3AIEA 3TA9A 3VM7A 4E8CA 1YHTA 4JKLA 3CIVA 3TTSA 4W8BA 2WBGA 3EDEA 4YHEA 3WH9A 1JYXA 2FDMA 4PMQA 1AQMA 1H41A 1XSJA 5DFAA 5FL1A 3VX1A 1D2KA 1UKOA 2G3MA 4AZBA 3UESA 1ECEA 4PMOA 3TTQA 2B31A 1GOIA 4ATDA 2J78A 1EO5A 4PMRA 5ABFB 2WK2A 1EDQA 4S3KA 2BFGA 1XSIA 2GSJA 1ZL1A 3F5LA 3WNOA 1MQRA 2G3IA 4W5ZA 4TTUA 5DT7A 1OM0A 3ARYA 3AS2A 2FHFA 4W87A 2YOCA 2FH6A 2WZEA 5A8MA 1E4LA 4ATLA 4PMVA 4M1RA 2WWCA 4KWUA 2EPNA 4DM1A 1GONA 4BQ3A 2XHYA 3MMDA 1QNPA 3WIJA 5FIPA 4OJYA 2VMFA 1CXEA 2BY1A 1GOWA 1UWRA 2HVMA 4H04A 3VIJA 1W1VA 2J4GA 3WL1A 2AOSA 3GXMA 3ARTA 2YL8A 2G41A 5DO8A 2DSWA 3MV01 5A69A 2W66A 2G3JA 4LGXA 2PWFA 3ZT7A 5D8ZA 1HXJA 2WHMA 2DT3A 1VFFA 3SCVA 4CU8A 2PI6A 2VCAA 3N17A 2GJXB 4AIUA 4L4OA 4HZ7A 2VZSA 3B9DA 1HKMA 4J3WA 5EBAA 1HT6A 4GXPA 3VIFA 2J79A 2DQXA 3UG5A 1JZ4A 3QR3A 5M03A 4XV0A 2OWWA 4Q22A 1XYFA 3BCDA 3VGDA 4LYPA 2DSVA 2XWDA 4W5UA 4GQQA 3ZR5A 1Z32X 4WF7A 3G6LA 2OSYA 3PZVA 2BV9A 2XM1A 3BMVA 3BAYA 1E0WA 3OLGA 2WSKA 2Y2WA 2VOTA 2UY5A 1QI3A 1B3ZA 4JFTA 3VD5A 4TX6A 2O9RA 1EGZA 4Q7NA 1BG9A 1NOUA 5I0DA 1BYAA 1E6QM 3SCOA 5HXMA 2D3LA 1PX8A 1B3XA 3GTNA 5E70A 4JCLA 3GXIA 1CWYA 3DECA 1JYVA 1BHGA 2C8NA 1VEMA 2J74A 2CBUA 3GBDA 4LYRA 4ML4A 3VTRA 1GPFA 2ZWZA 4TTGA 3WQ5A 1OINA 3B9EA 2WCGA 3SURA 1A47A 1WB0A 3CUGA 3VIIA 3PZTA 1NP2A 3ZT6A 2W67A 4DWSA 1GNXA 5I5RA 3WF2A 1J0JA 3L2LA 3U7VA 1H11A 1JAKA 3AIBA 3MO4A 1JF6A 3ALGA 3WQVA 3THDA 4PN2A 1B1YA 2GK1A 3IK2A 1VBRA 3CUJA 1TE1A 1XCWA 2Q8XA 4JL1A 1KBBA 4W7UA 1UQYA 1MXGA 4H7VA 3WENA 4AZGA 3VIGA 4M80A 1E0VA 3WDRA 3ARPA 5LA1A 4UTFA 2FH8A 2ZICA 3HN3A 1OB0A 2D3NA 4MPKA 2X1IA 4QP0A 2WMJA 1GQKA 4AC1X 2CKRA 3BGAA 1CGWA 2W92A 2OSXA 4PCSA 2NSXA 1NWTA 1ZJAA 1FH9A 5CSYA 1QI2A 1WPCA 3PZNA 1BYCA 6TAAA 5A6BD 3VDAA 3AMKA 4E8DA 3CLWA 2AMGA 1VJZA 5BRQA 2D0GA 3RJYA 3T09A 2W5FA 4QLLA 4PRWA 1XC6A 1DWFM 3N1AA 4HU8A 1R8LA 4CGTA 1UUQA 1JNEA 1CGXA 2WBKA 4HOWA 4AY1A 1DWHM 3MUY1 1QI4A 1KR0A 1SFSA 1WZLA 3AYRA 1RPKA 4Z2LA 1UYQA 1E6ZA 4MJ2A 1UWTA 1TUXA 4FMVA 2ZX9A 3WF4A 2NT0A 4D1IA 4RE2A 4PCTA 4CD7A 3OGVA 4IPNB 4UQDA 2UY4A 4U5IA 2BY2A 3CHCA 3WH7A 1BF2A 3AMCA 2QMKA 2QV4A 2WMIA 3AQUA 1SR0A 2WAGA 1PJ9A 3W81A 3VGGA 5A94A 4LPCA 1PZ2A 4PEEA 4AYSA 4MAVA 3NIYA 4C7GA 5EFDA 5A2AA 1ISYA 1NWSA 2GJRA 4D71A 1G94A 2WVTA 2QMJA 3KZSA 4IM4A 5FOOA 2IXVA 2CETA 4AISA 1EH9A 2IUZA 1M7XA 4R5EA 4QAWA 4JFWA 1LG2A 4MDOA 1DWAM 3M6DA 2RGMA 3WSUA 2EQDA 3VD9A 1BVNP 1AQHA 3MS8A 5DEZA 4DM2A 2G8ZA 3RCNA 1PPIA 4DUVA 2WXDM 3E1F1 4PMNA 3CZKA 4OOUA 4M56A 3UETA 3W24A 4BQ2A 4BZYA 2VVSA 4KGJA 1K9EA 5E6ZA 1V6UA 4LXFA 1C8XA 2V38A 5HPCA 3NJ3A 3UERA 2QPUA 2J8GA 1MW3A 1HJWA 1UD6A 1QHOA 1VFUA 1U2YA 1FHDA 1ISVA 5AC5A 4HZ8A 4JCMA 3OZOA 1G9HA 2BVTA 3FNDA 5D9OA 3OLIA 2QF8A 4EANA 4W8LA 4D1JA 1UHVA 3ARZA 2DEPA 2WW5A 5AYIA 1HL9A 1WDPA 2V3EA 3N15A 3AMGA 2EPOA 3MUZ1 3I3EA 1CDGA 1AMYA 1V3KA 3VMNA 2WMKA 4WKFA 2A3AA 2PF0A 6A3HA 5A8NA 1OWQA 3OLDA 5A6SA 3IJ7A 4UCFA 3AROA 2YIHA 1UD4A 1K9DA 2XVLA 3GBEA 4UZUA 3WMBA 3K8KA 3EYPA 1FP9A 4GKLA 4P7LA 3CZJA 4C7DA 1G01A 2OLHA 5DT5A 2VZOA 3GZAA 4HU0A 4R27A 1KQZA 3KL5A 3WUFA 1W3KA 2ZUMA 3U57A 1E3ZA 2XSBA 1D3CA 5A95A 1JDDA 1GHRA 4ZE5A 1S46A 1C7TA 5D4YA 5ABEA 1H1NA 2BY0A 3AS0A 1WZAA 1E4MM 4AW7A 4H8UA 1LF1A 4D6DA 3BSHA 1EDGA 3APGA 3POCA 2VX6A 2VZVA 2VVNA 3BH4A 4NSBA 3VD3A 3AICA 3S2CA 3PZIA 1Y7VA 3BAIA 4JIEA 1KGWA 4WKHA 4GZJA 4P8WA 1QNOA 4B9YA 1C8YA 1VFOA 2J7FA 4J3TA 1UD3A 4U31A 4B3KA 1W32A 2CESA 4YPJA 1MFUA 1BTCA 2D24A 1TVPA 4UFHA 2YJQA 3AMDA 4N42A 3FN9A 2BVYA 5BXRA 5AC4A 2X0HA 2Y4SA 3PTQA 3WF3A 3MSDA 2BVDA 1C90A 5ABHA 1V02E 2JEPA 4NI3A 3WMSA 4FLQA 2XVNA 5BXPA 2PB1A 1JYWA 3W29A 4UFIA 1UWSA 2EPMX 1V3IA 1OT1A 4ZENA 2CIPA 2C0HA 1KBKA 1LWJA 2VZTA 4CCCA 2HISA 3FAWA 4E4PA 4W89A 5EFFA 1V3LA 4D6IA 4AZ7A 3EMZA 3WKZA 1WDQA 2OSWA 3K46A 4CUCA 2XIIA 4MNLA 4C7FA 3SCUA 2J7GA 3M7SA 2O92A 1FH8A 1VBUA 3WDPP 2G3NA 5BYWA 5GPRA 4CU7A 4URIA 2Z1SA 4RE4A 4W8AA 2TAAA 1V02A 5JIWA 1C91A 3BMWA 1NOFA 4F79A 4OUEA 3MKKA 5A2BA 2JE8A 3DHPA 2VCBA 3RJXA 1H2JA 3WD0A 2VRKA 5C8BB 5DMYA 4JHOA 2E9LA 3IAQA 1XH1A 2ZIDA 1C7SA 1DHKA 4DUXA 3W38A 1E4NA 4AXNA 2YL5A 3TOPA 1HKIA 5CLTA 3OZPA 4AD0A 5HPOA 2BNJA 3WBAA 1M53A 3I3BA 2DH2A 5E0FA 5HBFA 2IXUA 1OGBA 1EOKA 4J3XA 4UFMA 4HA4A 4ZXOA 1ZB5A 3CPUA 5D9MA 4HA3A 3WQWA 1DTUA 2DGAA 3VDCA 1WKYA 2ZX8A 1CXKA 1GJWA 1E56A 4V28A 3ZSTA 3VVGA 3VMPA 1WE5A 3VGEA 2XGBA 3VGHA 5CJ5A 4TX8A 2F2HA 1UH2A 1VB9A 1GQIA 1R7OA 1UH4A 1HX0A 1JYNA 6CGTA 3D5HA 3DHUA 8A3HA 2WHJA 1TFVA 1DP0A 2GDUA 1UKQA 3WD2A 1J9YA 2PWEA 5KEZA 1GVIA 2DIEA 4UFKA 3WNMA 3AYSA 1E6PA 1GVYA 2ZUUA 3NUKA 4CD5A 4J7RA 1FP8A 3ZSSA 3DYOA 1JFHA 3VMOA 4AZ5A 1EA9C 1CZ1A 1QNRA 2NT1A 2V5DA 1RP8A 3L4WA 2WWDA 4Z2JA 3VD4A 1MW2A 4B3LA 4CVUA 4PTVA 2AAAA 2J7CA 4XUYA 3EBVA 1JGIA 3AZSA 1AQ0A 3I3DA 2YA2A 4BQ5A 3GXDA 2XWEA 3OBAA 4HTYA 2DSUA 3ZO9A 4P7RA 1UZ1A 4MNMA 1E6SM 1MW0A 2D0HA 3EMQA 3W6MA 1OD0A 5EB8A 4ACZA 3KEHA 2VX5A 2UWFA 3IJ9A 1CGUA 4GZEA 1B3VA 2YBTA 1WO2A 4IISA 1CYGA 5BXSA 3AIQA 4WIWA 1W1YA 3WDIA 2ZXAA 1KWKA 1W9BM 4L4PA 1CGVA 4OBRA 1JNDA 1J0IA 1L8NA 1V0MA 2Y24A 4ATWA 2XJ7A 1QBBA 2YLLA 3NSMA 3AMLA 1G0CA 1W3LA 4HPGA 3O9NA 4GO9A 4UOJA 2WCSA 4YHGA 1E1FA 3BSGA 5A8OA 4ACZB 2YLAA 1E43A 4OIFA 3WUGA 4AD5A 1WCGA 4UR9A 1U33A 2VCCA 4X9YA 4TVCA 2YBUA 1EO7A 1TA3B 3WNPA 4HMCA 4HA1A 1D7FA 3K4DA 1KGXA 1NH6A 3CBWA 2E40A 1JG9A 3PZOA 1OCQA 1QI5A 3BAJA 5IHSA 3WH6A 2W61A 3T0AA 2WB5A 5ABGA 4UFLA 1PX4A 2J77A 2ZXDA 1W9VA 3A3HA 3AS3A 2DT2A 2O9TA 2CERA 1JZ5A 4HMDA 1E5JA 2OWXA 1MVYA 1KR1A 2FGZA 2X05A 2G4FA 1H3GA 3T08A 1NM9A 1K9TA 3GNRA 4JKKA 2VNCA 2V5CA 1J11A 4MB5A 4PSPA 1Q6GA 1HF6A 3VGBA 1O7AA 4RE3A 3AIWA 4XX6A 3WL0A 1QOXA 4AZHA 1M04A 3WDQA 4EAMA 3SCPA 2F61A 3TONA 1WZMA 1J0HA 1JI2A 2W4XA 3PZ9A 3AHVA 3T2QA 1H09A 2A3BA 3N18A 1PIGA 3NYDA 2Y5EA 1DWGM 4GI8A 1XRVA 5FCZA 2GFTA 1EHAA 2ZXBA 5A6LA 3NDZA 3U5YA 1LJYA 4W93A 4V2XA 5A8QA 3ZT5A 1HJSA 3PN8A 2VX4A 4PMYA 3ZMRA 1V03A 1E6NA 3K8LA 3LPOA 3J7HA 1ODUA 5I6SA 2F8QA 3U5UA 2W62A 3WD4A 3QHMA 3EDFA 2D2OA 5CG0A 3VOCA 3N13A 2YDRA 4W88A 4GQRA 1W3HA 4KH2A 3QHNA 2XYLA 3A4WA 4P7QA 4UQEA 1HL8A 5CXPA 2FGLA 3TP4A 2W63A 4AEFA 4GZIA 3N12A 1VFMA 2BY3A 3KWXA 1KXTA 1WAWA 5JIPA 2XFFA 3VGFA 5BWFA 1J12A 5LYRA 3W27A 1CXHA 1OT2A 4B9ZA 4TVUA 1DEDA 2JIEA 1CBGA 1B9ZA 3DC0A 1JAEA 1GOMA 4ACYA 3AHZA 5M5DA 3PZGA 1GQLA 2UY2A 1MXDA 3ARRA 1PIFA 5BXTA 4F9DA 1KXHA 1UWUA 2EJ1A 2X09A 2VTFA 3D3AA 5CGMA 1J0ZA 1ZS2A 2WPGA 1J0YA 3AISA 4N0RA 4MB4A 1CXLA 1W2VA 2VZUA 4CU6A 3RM4A 1V0NA 4QDMA 2VC9A 4PYSA 4DWSC 3FXYA 2DPEA 1E6RA 1JL8A 1BGAA 3UG4A 4KRTA 4U3CA 4AZ6A 4AZIA 1OBAA 2OYMA 4D6FA 4PMUA 3GM8A 3AHYA 4GINA 4J3SA 3T2PA 3SUWA 2O9PA 4X0VA 1JZ6A 3EDDA 4UOQA 1W3JA 2WLYA 4MDPA 4MAZA 4M24A 2OYKA 4FLSA 3VILA 2CBIA 1C3FA 3WH8A 1JXJA 4QCFA 5ECUA 1B31A 1CXIA 4Z2HA 4B15A 3EDKA 5AYBA 2D23A 1GCYA 3WNKA 2XVGA 5I2UA 1UR9A 1DWJM 2J75A 5FD0A 2V3FA 5LA2A 2EEXA 1VRXA 2CXGA 3CZEA 1BG4A 4WSJA 1E72M 1JI1A 1CPUA 3BCFA 2WZHA 3QHOA 5LA0A 1B30A 4CCDA 4P8VA 2GK1B 2VT0A 3MV11 2BHYA 4CD8A 3GH5A 1GW1A 2YDSA 5CSUA 3DYMA 3WUEA 1R87A 1Q6DA 1W9DM 1V6WA 2E4TA 1SMDA 3WFZA 3EDJA 5FKYA 2WMHA 3ARXA 2WM0A 3KL0A 3HU7A 1H5VA 5A6JA 1EDTA 3W28A 4Y7EA 3SUTA 2VL4A 3GH4A 4PMZA 4U33A 2XPKA 2E9BA 1UKSA 1BYBA 4HOZA 1LQ0A 4AD4A 3O2LA 3SCSA 5BRPA 3UG3A 1EQCA 3HMCA 1JDCA 3SUSA 3LPPA 4OZOA 1B3YA 2QLYA 3OIHA 2YA1A 4BS0A 2BXZA 2DT1A 5E9AA 3AJ7A 3ZJ6A 2PWGA 3OLEA 1J0KA 3NSNA 1LL7A 3W0KA 4MTVA 3ZOAA 1KGUA 3WFLA 2J7BA 2VR5A 3LMYA 3BAXA 3M07A 3PHAA 1HJQA 1V0LA 3L4TA 1F4HA 3AHTA 2Y8KA 4UFJA 2UY3A 2XVKA 3PZMA 4HP5A 3AXIA 1B0IA 1VEOA 1ZBKA 3O6AA 1TR1A 1UR8A 4NRSA 4AZCB 2EXOA 4LQ1A 3K8MA 4K68A 1F4AA 3TTOA 3VDHA 1UQZA 1UWIA 3PZQA 1XH2A 3UR8A 1V0KA 3THCA 2CBVA 4P7OA 1E4IA 1UR4A 4H8HA 3SIMA 3PTMA 4UQAA 3WD1A 1E71M 4MNKA 5CPQA 1QPKA 3CMJA 5A1AA 2ESCA 3JUGA 1UKPA 2PBGA 4JFVA 2MANA 4ZFMA 3WNNA 1PX3A 1TCMA 3G6MA 1NWUA 1UOKA 3CZ8A 2VO5A 1SYTA 2CCRA 1GUVA 5I78A 3GDBA 4M29A 3VM5A 1H4PA 3SEPA 4Z2IA 2VX7A 2WMGA 3II1A 4U3AA 2WHKA 1WP6A 3VO0A 3CGTA 5HDRA 2WYSA 2CEQA 2O9OA 1X6NA 2EPKX 4CN1A 1ZBWA 2VQTA 1DWIM 1RD6A 1UR1A 4FLRA 3WQ6A 3U7BA 2X8RA 2W91A 3BC9A 3AIVA 1B90A 4AD3A 3L4UA 3AXHA 1HN1A 2XM2A 1BQCA 1BPLB 3RM9A 5CZKA 1QHZA 2ZE0A 7CGTA 2DDXA 3WEOA 1MQPA 1W9PA 1VAHA 2D20A 2RGLA 3AFBA 1IV8A 1ITCA 2WKGA 2YA0A 5JBDA 2WHLA 1US3A 4AZCA 4D6GA 3WDJA 2WNWA 1BGGA 4D6EA 4D6HA 1W1TA 3ARQA 3CUHA 1BAGA 4XB3A 2VRQA 1UG6A 1WDSA 2J62A 2ZUNA 1FFRA 2JIWA 3HJEA 1KCKA 4HMEA 2JEQA 4HPHA 1UH3A 2WVVA 2OWCA 4JHZA 3ALFA 4PUEA 1V3MA 3MUAA 1VJSA 3RO8A 5C71A 3IJ8A 2DIJA 2CBJA 2WANA 2WC4A 9CGTA 5A6BA 1KWGA 3ZIZA 5A3HA 3CO4A 5HOSA 2A3CA 3CZGA 2CPUA 3WH5A 1RH9A 1ISWA 4OOZA 2WVUA 1VIWA 4V27A 1XD0A 4EKJA 5CPTA 3NDYA 3VDBA 1NQ6A 2WMFA 1WDRA 1SMAA 1BLIA 4CD4A 4PMXA 4P8UA 2BHZA 5M3WA 4CN4A 3CHEA 1H0GA 3PBGA 3ZM8A 3FAXA 1AVAA 1P6WA 1FA2A 1QW9A 3CH9A 4IUGA 3BXWA 1W1PA 4JZ5A 1EIBA 1KXVA 3AZTA 3OGRA 1R7AA 2EBNA 4PTXA 4QFUA 1QVBA 1A3HA 1L0PA 2EPLX 4NRRA 1CIUA 2GUYA 4NZCA 4H8VA 1BYDA 1V6VA 1EQPA 3W6LA 4XZWA 1W9XA 1K9FA 3SCWA 3VNZA 2YKKA 1LWHA 4A4AA 3CMGA 5CGTA 4S3JA 3WF1A 1W2PA 3SCQA 1V08A 5JBEA 3PZUA 1TVNA 1BSIA 1US2A 1JZ3A 5FL0A 1B2YA 4MNJA 4H41A 5I77A 3FHQA 2XVPA 2ZUTA 1EXPA 4QLJA 2ZX6A 2JF6A 1HIZA 3W26A 2J25A 1GQJA 1ODZA 3RDKA 1Q6EA 4MJ4A 4BA0A 1UWQA 1V3JA 1OD8A 2CHNA 2A3HA 2ZUSA 4W7VA 3ARVA 3MANA 2XG9A 5GNYA 1CECA 4GO8A 3MMUA 7A3HA 1UD5A 1KCLA 1GZJA 4W84A 3MMWA 1QW8A 3OGSA 4QLKA 1ITXA 2GVYA 5I23A 2Y8VA 1LLOA 3NCOA 2WVSA 3CHDA 3RIKA 1W91A 5I24A 2FHCA 2J8FA 3MSGA 2DSKA 3VD7A 2Z1KA 2YL6A 4JL2A 2CITA 1CNVA 4AWEA 2XUCA 4D6CA 2XFYA 4BCEA 3NSXA 2ZWYA 4F66A 1C93A 4AIEA 1QNSA 5IDIA 2BHUA 1UD8A 2VJXA 1CGTA 2JALA 3ARWA 4IPLA 1E3XA 3SCTA 1FOBA 3ARUA 3UCQA 1ISXA 5IHRA 1UA7A 1B3WA 2ZX7A 4WLCA 4PSRA 1JXKA 4MADA 2GJXA 3PTKA 5C70A 5ABFA 2GJPA 2VUYA 4HOXA 3POHA 3VPLA 1J10A 5EMYA 4KRUA 3T2OA 4DWSD 4CN6A 1I1XA 4W85A 2CHOA 1CXFA 3N04A 3F4VA 4PTWA 3N11A 4EE9A 1QNQA 1GOOA 1HVXA 4D72A 3RPMA 2JFEX 3OA5A 4TXEA 3UEQA 4PMDA 5AY7A 1G1YA 4GIAA 3B9AA 4JAWA 3VIKA 3VX0A 5BCAA 2E9MA 2PC8A 3AI0A 3WEZA 1EHNA 3T0BA 2QPSA 2WC3A 2XFRA 1XGZA 1E6XM 1J18A 3BAWA 4GI6A 3GNPA 4BQ4A 5D9PA 4UNIA 1J01A 1WNOA 4CD6A 1HJVA 3WUBA 2WC7A 7TAAA 5KZ6A 3AOFA 1JZ7A 4MB3A 1XV8A 1C92A 2J47A 1GOKA 3WEMA 1OGSA 2PWHA 3CTTA 4AD1A 4XZBA 2E3ZA 3QGVA 1X1NA 3VIPA 3AS1A 1JFXA 3B8SA 2ZUVA 4RL3A 3SCNA 3VU2A 4WK9A 1PZ3A 3EMCA 2DT0A 4M8UA 4ZXLA 1LL6A 1ZJBA 1EOMA 5A2CA 1GOQA 2VR4A 5CPSA 3L4VA 4OKDA 3FHAA 5I79A 4AEEA
chains in the Genus database with same CATH superfamily
1V6XA 2J7HA 3GYCA 3IUIA 1OC7A 2WLZA 5CQ1A 4PMJA 4BFAA 5D03A 3W2JA 4BI5A 3NL3A 3G3DA 3CMFA 1WQ5A 1JCLA 3RCYA 2Z24A 3FLUA 4HHMA 1KXQA 4AX6A 5HNUA 3W23A 1XYZA 3SCRA 1Q6FA 1BF6A 4N9CA 3G1VA 5EKYA 2Y5JA 3V1HA 2ZUWA 3PM6A 4OWGA 5E09A 4ZGYA 3S5YA 2E5DA 7TIMA 1QO5A 3ICJA 4R9XA 3L4XA 1CGYA 3LPGA 4AF0B 1Q7QA 1JZ2A 3MHFA 1KV5A 4JN7A 3UA4A 2A79A 3CHVA 1NWRA 2DFAA 3H8AA 4MWAD 3UGRA 1OIFA 2CKSA 1XX1A 3R4IA 2H9AA 1EJXC 3QY6A 3EB3A 4DF0A 4GYFA 2C14A 1GT8A 4IMCA 1J4EA 2PLKA 2NVDA 2QHAA 5DCBA 5CZSA 3ARSA 3STCA 3EWXA 1ZU8A 3A4AA 1HP5A 3C5QA 3JW7A 1TZZA 1FFQA 4P7NA 3KXQA 4JQ1A 3UFYA 4ICMA 3S6DA 2XIBA 3TR9A 2HBXA 1HJXA 3TEVA 1N8FA 5AFDA 1QBAA 4AIOA 3UR7A 3N4EA 4AVFA 2AKMA 3MUXA 3L0KA 3DI0A 5AOUA 2PDPA 1E73M 3MUIA 3F5KA 3FY1A 3PUGA 3CZLA 5DRCA 3M0JA 1PV8A 4Z2KA 1I60A 1UR0A 3OP2A 1X6LA 3ZZ1A 2V3GA 4MIMA 4HMNA 1VFHA 1PTGA 2I5IA 4YWIA 4GYKA 4TOQA 4JTFA 1M01A 1RHCA 4QITA 3VFLA 2QCNA 2FDSA 2ZZ3A 1CENA 2GYIA 4IICA 1R46A 3GH7A 3RF9A 2VDHA 4FP1A 3T40A 3HBLA 1UA3A 3S6OA 1W9UA 5L6UA 3T9PA 4UQCA 4XSLA 4DPQA 3K1DA 3LZ3A 4PUJA 3FW6A 3PUEA 1IZKA 2RKXA 2A0NA 3QXBA 4FOKA 3B4YA 2R82A 4KW2A 1V4YA 4IX0A 4WKAA 4H83A 1C8QA 1M03A 2VEPA 2BGSA 4HN8A 1XG4A 1R3QA 2IKHA 3WLRA 3TYCA 1H0IA 4MUPA 4KMQA 3RILA 3SUVA 3C2EA 4LB3A 1LCOA 5BU6A 1IT0A 1R0MA 3N9KA 3HZ3A 1I4NA 3BLKA 3S9YA 4H2CA 3IVUA 4F8XA 1H7OA 3LHZA 2VI0A 2PRMA 2QCHA 2A4AA 4IMAA 1F73A 3VKKA 4GUFA 4WCJA 3WN6A 2OQYA 3RITA 4QS6A 3MI2A 1RBAA 1DQXA 3TYAA 1ZY9A 4DBWA 1R86A 1RZMA 1WOAA 9RUBA 4OUIA 3GNOA 3CIWA 4REQB 1NDYA 1HKJA 5TQLA 2PTZA 3TQ0A 4A29A 1XH0A 3R8GA 2QJJA 3GVWA 1VS1A 4ZODA 1AW1A 3B8WA 3RAOA 1E15A 3A9IA 2Y7EA 2BX7A 1XKYA 3MHUA 1TA3A 1KTCA 1XIBA 3T7VA 3FJLA 1FHLA 1OIMA 4XZMX 4A3HA 3RG6A 1DHPA 3CWOX 3OG2A 5BROA 1Q6RA 1E70M 1RBLA 4AMCA 3PBVA 2Z6JA 1JD7A 3QPZA 2VQUA 3TA9A 3MZNA 2GQ9A 3HGSA 4JKLA 1TPWA 2CLOA 3EDEA 4B5WA 3DCPA 2W79A 4ADSA 5CBJA 1YPFA 5FL1A 2WZMA 3UWYA 1JCMP 4UNKA 4M7SA 2REQB 4EF9A 1KFLA 4HKPA 1ECEA 5BZAA 1GOIA 4GQ0A 2WK2A 4LAKA 2ATSA 5I7GA 4TTUA 4LS1A 5DT7A 4ALDA 4R85A 2VUNA 3AS2A 3FIGA 2FHFA 4W87A 2FH6A 2YCEA 4ATLA 3EWCA 1JPMA 4PMVA 2R1LA 4H6RA 3P3BA 2EPNA 1GONA 4BQ3A 2XHYA 5MKGA 1MUMA 1W1ZA 3DC8A 4RLIA 4BWLC 2DJXA 1TIMA 1GOWA 3EA3A 1UWRA 3HQPA 4DYJA 4H04A 4O14A 4ZMGA 3WL1A 4IQDA 2VEKA 3RN6A 2J9YA 1UOZA 4DB7A 3L5AA 5I3IA 2G3JA 3GHUA 5D8ZA 1HXJA 2PLMA 1VFFA 2A2IA 2PSNA 5C2GA 2QVHA 4L4OA 4YTUA 1R3VA 2VZSA 3O07A 4DO6A 5C7HA 2XISA 4GUGA 2GL5A 4ZQPA 5M03A 3H7VA 3HGOA 3ONCA 5J8LA 3HPXA 5CEWA 1Q66A 4BF5A 1GG0A 2OWWA 3BW3A 3VGDA 2FPTA 1Z32X 3G6LA 3UPBA 2HS6A 1IEXA 4AG0A 3U9IA 1U83A 2BV9A 2RDTA 1P7TB 2X30A 2VOTA 5AC7A 1B3ZA 3WLIA 2X7VA 3FEMA 1XLHA 4Q8NA 4TX6A 3TN4A 3QW4B 1RXOB 2J8TA 3R58A 1B3XA 3GTNA 2PDIA 5AZ0A 3DECA 2PTDA 3KW3A 1VEMA 3GKFA 1GEQA 2J74A 3GBDA 3NYZA 3W7GA 4LYRA 4HK6A 1P43A 4J4KA 4ML4A 3LCIA 4D2JA 3D0CA 3WK3A 1PIIA 4TTGA 4ZZ9A 1OINA 2WCGA 4I5UA 4LEFA 1WB0A 2YYTA 3VIIA 4DWSA 1GNXA 2DVXA 4L5ZA 3ID7A 1H11A 1JAKA 3AIBA 2CZ5A 1ITUA 1ZGDA 1FWIC 3THDA 4H3DA 1G4EA 3ITVA 1VCGA 1KKRA 1VBRA 3BE7A 4UR7A 1XLIA 3PPHA 5I02A 2AQOA 1EIXA 2HZGA 1XPYA 4W7UA 2OZ3A 1UQYA 1MXGA 4R34A 4H7VA 3WENA 2AL2B 3KTCA 1KM6A 3VIGA 4H9TA 2INZA 3A13A 3H2FA 3N29A 1AJZA 1KA9F 1OB0A 2D3NA 1PVNA 2X1IA 2QW5A 4I5RA 3VYLA 1DVJA 2W92A 2OSXA 2NSXA 1EYWA 1NWTA 1FH9A 4AEOA 1R9YA 1QI2A 1WPCA 3P5YA 1PCKA 5ECVA 1OK4A 3E2RA 4IMEA 4JX4A 1F8IA 3RJYA 2HCVA 4QLLA 4WY0B 2HPIA 1XC6A 4QRNA 3N1AA 1P0EA 2C13A 1UUQA 3WLTA 5H8PA 4HOWA 2PUZA 2ZZ6A 3THQA 1DWHM 1QI4A 3AYRA 1RPKA 2NUWA 1RVGA 1SZNA 3WK2A 5D2XA 3FSUA 4RE2A 4HPXA 4JTJA 4PCTA 3OGVA 2UY4A 3WH7A 1BF2A 1BWVA 3AMCA 1FWFC 3H4XA 2QV4A 3AQUA 3QGAC 3KS6A 3W81A 1PZ2A 3AALA 4PEEA 4RK8A 3KFTA 3FKRA 4GACA 3BTNA 4C7GA 2GJRA 1EJWC 4ES4A 1G94A 2J27A 4IH3A 3DIPA 5FOOA 4LVAA 2CETA 1VFTA 3UCCA 1OFDA 3E0FA 4MDOA 5K2ZA 1FWRA 4IJBA 5DEZA 4GE8A 1PPIA 4DUVA 5HAOA 1R9XA 2G96A 2PEVA 3W73A 3UETA 3W24A 1FXPA 3G1YA 4BZYA 3ZWSA 1OF8A 3HIJA 2J8GA 1MW3A 3GG8A 5H2ZA 1U2YA 5AHFA 4CQ8A 1FHDA 5AC5A 3DFYA 1PSCA 1S2CA 2WNZA 4J9JA 1JRBA 2FZ9A 3L67A 3PVFA 4QM1A 4Q33A 3V0TA 3PG8A 1TB3A 3W02A 1W0MA 3I3EA 5HINA 3VA8A 1V3KA 1XINA 4WGXA 1EEXA 2WMKA 1XGEA 1A5AA 1TMHA 3ME3A 2A3AA 4LWWA 4WDTA 3GFXA 2Y62A 3KX6A 2GQ8A 4GK8A 5TIMA 1UD4A 1LYXA 2XVLA 3GBEA 3WMBA 3K8KA 4GKLA 4NYUA 3CZJA 1RPXA 2VZOA 1K1DA 4HU0A 1KQZA 1AJ0A 2ZYFA 2ZUMA 3SBFA 4HN4A 3U57A 3WUFA 2VXNA 1OCBA 5A95A 2Y8UA 1C7TA 4NIRA 5ABEA 4DBUA 2F84A 3KBNA 4Y9AA 1AW2A 4D6DA 3NFUA 1LBFA 1PDYA 2EGZA 4LNCA 3PS7A 1EDGA 4QE5A 3POCA 1MO0A 4BWLA 4L6HA 1RA5A 2ZE3A 3U6WA 1KO0A 1MEWA 3UZWA 3BH4A 3S3GA 1DXIA 3TC3A 2NV2A 3H2EA 5LKYA 1ADDA 1C8YA 1VFOA 3E0LA 4Y2WA 2JK2A 4IGHA 4U31A 2OVLA 1W32A 2Y89A 1MFUA 3SQSA 1BTCA 3NQ2A 2D24A 4TV5A 3TDFA 3A3WA 4C6FA 2G97A 5G2IA 2NQ9A 5BXRA 1O94A 3LCHA 1QR7A 3MSDA 1UZDA 2NLIA 4M5PA 1UC4A 2XH4A 1XLLA 4MY9A 4HZMA 1V3IA 5JQ9A 1KBKA 3DFTA 1E0TA 4RR4A 2HISA 1ZJIA 3FAWA 4W89A 4C6IA 1XI3A 5EFFA 1WKDA 3F4CA 1V3LA 2WKJA 3EMZA 1EUAA 4O10A 1XDMA 3G1SA 4CUCA 2XIIA 1TPC1 4C7FA 3FYOA 2O92A 4LUTB 3R2GA 1ONRA 3P5ZA 3GIQA 4O0ZA 2Z1SA 4RE4A 1V6TA 2TAAA 3T55A 1QFEA 3MVIA 3NQ7A 4Q7BA 4RV8A 5U4NA 5JIWA 3EX6A 4XUGA 4OT7A 2QQ6A 3NQEA 3DHPA 3W07A 1N8WA 3TROA 4OHQA 3BGJA 2FZBA 3CV1A 1XLCA 4O1BA 3WD0A 5DMNA 4N9EA 2IS7A 4CEUC 3E38A 3IAQA 1XH1A 2ZIDA 4Q8UA 1W5NA 3JS3A 4KBXA 4C6KA 4CQCA 3XISA 3W38A 1SUXA 3R6IA 1XDJA 3QPYA 1QOQA 5CLTA 1T8XA 1EZWA 1E51A 1EOKA 2AGKA 3UWQA 1YDYA 3GVRA 1I6NA 3CU2A 2ZX8A 1CXKA 1GJWA 3UZXA 1WE5A 1OADA 3VGEA 4F2TA 1UH2A 4FOUA 3DEQA 2V0TA 4V15A 1XKJA 4MLJA 4FNUA 4RV3A 1Q2RA 1TFVA 4XZ9A 2GDUA 3LB0A 1UKQA 3R8RA 3BV4A 4Q8TA 1J9YA 1TPDA 3LRMA 2DIEA 3WNMA 2X1SA 3AYSA 1GVYA 2ZUUA 2OQHA 3ZSSA 3UWEA 3SB0A 3ZLHA 4MF4A 4JX5A 3TLLA 4IG2B 2HPMA 3VD4A 3QBUA 4B3LA 2CLFA 1KFJA 3WZ0E 1FWBC 3AZSA 4BR1A 3O0FA 2GGJA 3I3DA 2B81A 3GXDA 4FNTA 2XWEA 4JHMA 3ZO9A 1MW0A 2D0HA 3IIOA 1UZHA 4WSHA 4K39A 5K3VA 4N6EA 1W5MA 3KEHA 3G22A 1OFBA 2UWFA 3KRUA 2XH7A 1CGUA 3QQ0A 3H55A 1CYGA 5BXSA 3AIQA 1W1YA 3CPGA 1EC8A 3NZRA 1TWWA 1W9BM 3QMTA 2QKFA 1V0MA 4ATWA 2XJ7A 2W6RA 3AMLA 1NFBA 4NAFA 4HPGA 3GHRA 4BY3A 3TQVA 4LV4A 2WCSA 4YHGA 1E1FA 3NL2A 3C86A 4Z42C 1RJPA 1F3TA 3TJ4A 3TJIA 1KRBC 4AD5A 3OBEA 3S46A 2YBUA 1EO7A 3GAKA 2VWTA 2PP3A 3K4DA 3GDTA 1KGXA 2D69A 3LDVA 5AHLA 1IWBA 1M3UA 1OCQA 1QI5A 1S3TC 1RQEA 3T0AA 5FJTA 2WB5A 3JZUA 4UFLA 1W9VA 1RY8A 3I6TA 2A7NA 2O9TA 1AD4A 1E5JA 4CNTA 3M0HA 2WO5A 4PCNA 1NM9A 3FXGA 1J2WA 2E1WA 4NU7A 3UPWA 2R14A 1QCWA 3O7UA 4O17A 1NU5A 3AIWA 2JBMA 3WL0A 3LHYA 2XFWA 3V35A 1BXCA 4AZHA 1J96A 2E77A 4CNSA 4CQ9A 1J0HA 1CX9A 3IARA 1RCQA 2A3BA 5SWUA 1GTEA 3C3NA 4EXAA 3SRHA 3MP4A 3W76A 4S2BA 1XRVA 2OEJA 2RDWA 2QPXA 3TKFA 5FAGA 2QIWA 4DO4A 1A5CA 3CYVA 3V0UA 3M16A 4JEJA 5K9DA 2BMBA 4KF1A 4JTCA 1PHQA 3NDZA 4V2XA 2IW0A 1HJSA 3PN8A 4LVDA 3R0KA 4GI4A 3L7RA 1V03A 4IL0A 4L80A 3K8LA 1ODUA 5GJPA 3WD4A 4RCXA 2D2OA 2QJIA 1QO2A 2YDRA 3CAWA 3LS9A 4YNGA 3B8UA 3P0WA 1AH0A 4V1YA 4ENLA 4HB7A 3S5SA 4P7QA 4UQEA 4Q8QA 2IPWA 4C1NB 2J13A 2XGZA 2W63A 3NGJA 4GZIA 3GHTA 3QTPA 5LYRA 3NTYA 1CXHA 2QGYA 2X0SA 4B9ZA 2TODA 2JIEA 4K7VA 3UVAA 1CBGA 3EOLA 2V63A 3E5PA 5M5DA 3ARRA 3UP8A 5BXTA 3I65A 3REQB 2KZHA 4F9DA 1QUMA 1OYAA 2EKGA 4H00A 5T9BG 4DJDA 1G69A 4FS9A 2E28A 1OX4B 3B8TA 2VTFA 3N25A 5CGMA 1ZS2A 3LI0A 3AISA 4MB4A 2I56A 2VZUA 4CU6A 4PUMA 2HVNA 3WMLA 1FWDC 3L0GA 4WRHA 1E6RA 4WHBA 2BXVA 4G6CA 4DO7A 4AZIA 2OYMA 1A5LC 4PMUA 4GINA 3SUWA 2Q8LA 1JZ6A 1W3JA 2WLYA 1EP3A 3W71A 3UZ5A 1F3XA 3VILA 1JXJA 2OG9A 4B15A 1KRAC 1GCYA 3C6CA 3ABZA 3P14A 1UR9A 1DWJM 1XBXA 2J75A 2CW6A 3WJXA 1FCBA 1EP2A 1T40A 3ANYA 1WX0A 1H5YA 2OOFA 1B30A 2QXWA 4CCDA 4XO6A 3LYEA 2BHYA 3GH5A 3DYMA 3BOFA 2VFHA 4KEVA 1W9DM 4X2PA 1V6WA 3WFZA 4LRSA 2V5BA 2R1NA 1EDTA 3QPEA 3G3MA 2VL4A 3GTXA 1UKSA 1Y8BA 1BYBA 3CLMA 2B7NA 3O2LA 5BRPA 4NZ4A 1EQCA 2HDJA 4JTRA 1IXQA 3LPPA 5FF7A 1YIXA 4KFNA 1IHIA 2YA1A 2BXZA 5AKQA 2ZFAA 1DJWA 1GQNA 3AJ7A 2VR2A 3ZJ6A 1E1CA 2OOGA 4B4FA 2PWGA 2UV8G 4FR6A 4BF9A 3OLEA 1VLWA 1KGUA 4PB5A 4J2PA 3WFLA 4Z1BA 1SJBA 3UZZA 3PHAA 3FYPA 5HATA 4O53A 3AHTA 1OX4A 5AZ1A 2UY3A 3PZMA 2IMRA 4GD0A 1TR1A 4LQ1A 3PWIA 1F4AA 1MZHA 3L66A 1KBIA 3PZQA 3UR8A 1V0KA 3THCA 2QJGA 1TPB1 2V67A 3GK0A 4ROQA 3F2CA 5IBXA 3JUGA 2EAWA 2MANA 3TW6A 2PA6A 3UWZA 2OJPA 3GTIA 3GDBA 2B0MA 3VM5A 5HR7A 1SQ7A 3SEPA 2GGGA 3GSMA 1F3EA 1R5YA 3II1A 2QUVA 2PCQA 3A23A 2CEQA 2QUNA 4QROA 1W54A 2OB3A 3M5XA 1DWIM 4AF0A 3WFAA 1UIOA 3L0NA 3WQ6A 2VEFA 3CS2A 1OABA 4L1XA 2QCDA 2VGBA 4DXVA 4AD3A 1QK2A 3L4UA 5C0QA 1BTMA 3DXIA 1BQCA 2VC7A 3NZGA 1LTDA 3SAZA 1MQPA 5K4XA 1VAHA 2D20A 3MB9A 1IV8A 1DOSA 1K4GA 3MW7A 3KAOA 4AZCA 4GIRA 2WNWA 4YU1A 1W1IE 1BGGA 4OE7A 1IYXA 3QYQA 3P7YA 1FFRA 5CZTA 1E0UA 5I00A 5I3HA 4LVFA 4XKYA 2WVVA 3JR2A 4YJ5A 5C71A 3WLSA 2WC4A 4GG9A 2EJAA 3QR0A 3TN3A 4PA8A 2YYUA 4GOAA 1FWSA 2IPGA 2ZRVA 3V16A 3CZGA 2CPUA 3WH5A 1ECQA 3MCOA 4LH8A 1ISWA 2R1KA 1XD0A 3W74A 4RJEA 5CPTA 1Z41A 2XN2A 4JICA 4CD4A 4ZOCA 4P8UA 2QGHA 4LT9A 1J2BA 3CHEA 3FAXA 1AVAA 1FWWA 1TX2A 5CGQA 3KTSA 1FA2A 1QW9A 3C2FA 5B7YA 4WZHA 5FJUA 3U2OA 3AJXA 4QFUA 3S47A 2EPLX 4NRRA 4IGMA 4F4RA 3SI9A 1CIUA 4Y8FA 1A5NC 2GUYA 4XZWA 2IKJA 1K9FA 2PD9A 1TTIA 3NDOA 4A4AA 4S3JA 1ZFJA 1JPIA 3WBYA 3RR1A 3N2BA 1DIDA 2IPJA 2Z1VA 1B2YA 2OMAA 2IQDA 3IRSA 2ZUTA 2JF6A 3STFA 3VZYA 3W26A 1GQJA 3RDKA 2ZUSA 2A3HA 5DELA 4W7VA 3LXCA 5IOBA 4GNKB 1PYMA 2ACUA 2XG9A 1F07A 4N9BA 3RMJA 3TN6A 1KCLA 3CQ0A 4W84A 3OGSA 4IIGA 3W2MA 1Q8JA 1ITXA 1DIOA 5C9UA 2Y8VA 3NCOA 4NY2A 4I90A 2QCFA 1KLYA 3VD7A 2YL6A 2OKTA 1J6PA 4JL2A 3RUBL 3BG3A 3L5LA 2ZZ4A 4KIRA 1CNVA 3KOZA 4F66A 1C93A 3USBA 2Y7FA 2QEZA 2Z7GA 3VNIA 2BHUA 3NQVA 1E3XA 2PGRA 4HNNA 4MWAC 4DY1A 1IEVA 3ARUA 4ZO6A 3UCQA 4J1OA 1Q63A 4X60A 2E5CA 2ZX7A 4WLCA 3OVGA 1XCFA 1GVFA 1AL8A 1A80A 5C70A 1WKFA 2H8XA 5EMMA 4ML9A 2VUYA 3W1NA 1OC6A 2CU0A 3POHA 3EEGA 1TR9A 3M1ZA 1TPH1 1P48A 2YW3A 5AECA 2I5QA 1XIMA 3T2OA 1XICA 2V2CA 1LM1A 3N34A 1QNQA 4ONVA 3RPMA 2OU4A 2JFEX 4TXEA 4LBRA 2JQXA 3UEQA 5AY7A 3M5VA 3G1AA 1ZAJA 4IWWA 3VX0A 5BCAA 2PC8A 3CL8A 4Z0SA 2WC3A 1B54A 4N2YA 3QEZA 3W1XA 2FIQA 3LM3A 5KTLA 4UNIA 4FNQA 2P10A 4GH3A 4PODA 1WYIA 3RX3A 3M41A 1XV8A 2J47A 2EKCA 1GOKA 2QVNA 3WEMA 4XVEA 4JIPA 3KDNA 2MUCA 1T0OA 3GU2A 3QGVA 4AHPA 3LLDA 1QXLA 2HJPA 4DJEC 4IFRA 4WK9A 2DT0A 3FYYA 4E38A 1QT1A 1LL6A 5JXQA 1ZJBA 1EOMA 1NY1A 3ZVHA 5LIKX 2VR4A 5H8UA 3L4VA 5I79A 3I7SA 4TO8A 1MW1A 1O6IA 4XD5A 1DQUA 3ITGA 5CKSA 3H12A 1ZP3A 1S2VA 1TG7A 3ZFHA 3LM7A 4DWSB 5IFPA 1BFNA 1Y5XA 3HPFA 3MYPA 4FK9A 4U5KA 1RJQA 3AXXA 3CUFA 3EKLA 1KTNA 4MM1A 1E9YB 2IQ0A 4NJIA 1P0KA 5GNXA 1FKWA 4X0NA 3VIHA 1L6FA 4UUIA 2CYGA 3SO7A 3O6YX 4EK7A 1UPMB 4M82A 4U2YA 3G1HA 3AIRA 1LBMA 3KS5A 3WNLA 4O8RA 2E8YA 3WQCA 2WQDA 2DSZA 2WJFA 4KCVA 3UW6A 4FF5A 1ONEA 3W7MA 3M46A 3A4XA 1JF5A 4Q6XA 5D8WA 1ME8A 4QCEA 4YWSA 3LUTA 2DH3A 3QJAA 4Z1CA 1GEHA 4HNTA 3CYJA 4AQLA 3OB8A 3MCMA 1K6AA 3T05A 4DYKA 5AYZA 3TZNA 1GJUA 4YCPA 1DPMA 3RMEA 3UYIA 3MMTA 3PWGA 4YN5A 4IFKA 1S5NA 2B4GA 2BS9A 3VKAA 3EOEA 2FFIA 4CKQA 3CH0A 4QS5A 3H24A 3DDMA 4POCA 1LG1A 3GXFA 1FDZA 2YW4A 4EPEC 3SY1A 2WSPA 4O52A 4XIMA 1UD2A 3L4YA 4NHVA 4BF7A 2G5WA 2YCKX 4P8XA 1I2QA 4U2ZA 4HSHA 1JVNA 3HTWA 1Z3NA 3HGJA 2X40A 2Z1BA 1V77A 4K6AA 1G4TA 3C0SA 2CNCA 3A47A 5MKGB 2E7FA 3TTYA 3KE0A 1VEPA 1E9LA 4LB4A 3OJGA 1VPQA 1UKTA 3WCZA 1H49A 3IJLA 5LNUA 3EAUA 4NQ1A 2V5LA 3UXLA 1JCTA 3BZJA 4HBKA 2GZXA 1VP5A 4JYDA 2RDXA 5E9XA 1CLXA 5D05A 1YXDA 2C15A 1MUCA 1OSEA 1XFBA 1PKMA 3E6EA 3B0VC 1FH7A 3B0YA 4LCSA 3VIOA 3SW6A 8CGTA 2OYLA 1EJSC 4XIAA 3T07A 1DJIA 1ZBVA 2FJUB 3QYSA 4ORIA 3KHDA 4J3UA 3VKCA 3VI2A 1E55A 4K2SA 3AUJA 4JGDA 3BJSA 3NM1A 4GJ1A 1X38A 4FLOA 4FPSA 3BJTA 4LNYA 5CJNA 1XGDA 2FHBA 3AIUA 4NZFA 5HNNA 4RZ4A 3GIYA 5DY2A 4GI9A 3RXZA 3UG8A 4ZSTA 3C4UA 1MYRA 3FJ4A 3G1FA 3E0WA 2WSQA 3LCXA 1X97A 4S3CA 2WKLA 1XYLA 1UW9A 4G7FA 1YBQA 2GVGA 1GOXA 3LG3A 2PDJA 3T8LA 5K7JA 3LCLA 2H3DA 2E8ZA 4JTKA 4PBFA 4Q8WA 1PS9A 3WF0A 1MZRA 2F7FA 3UZJA 3W37A 1PEZA 1ZHAA 4WY0A 3PSVA 1W3IA 2D0FA 3PPCA 5C9RA 3DYPA 2BXYA 5J04A 1ZBCA 3OPSA 5TBOA 1Y0EA 4JY9A 3VINA 1VF8A 3IJIA 1IR2A 7REQB 1CCWB 4DPPA 3AUOA 2DY3A 5JBFA 3W53A 2YL9A 1TTPA 3F03K 4I6KA 4FXFA 4FNPA 1IEIA 1SU5A 1G5AA 1JDEA 4RW3A 2Z6IA 2E6FA 1F9CA 4A2RA 3PWAA 4GCAA 1UZ4A 2GJNA 3WQ8A 4LW7A 2Z2UA 2PWUA 5A6MA 4PL1A 4AYGA 1RP9A 2XIMA 4IP5A 3VM7A 4E8CA 4GUJA 2GQAA 1C29A 4W8BA 1A5OC 4ZTYA 2C1HA 3KVJA 3WH9A 1JYXA 2C18A 3L68A 1XSJA 2GGIA 1JJKA 4ZQNA 3W1RA 1RK6A 4XBSA 1L6YA 5G2HA 2ZDSA 3IJQA 4PMOA 3TTQA 5F2GA 4XTIA 4JTGA 1UUOA 1EO5A 4PMRA 1EDQA 3VNKA 2OO6A 3F5LA 1H7PA 1XSIA 2F9RA 2GSJA 5E1QA 4L9ZA 3GYEA 3VOIA 1EWEA 3G8EA 3M0MA 3AWNA 3PTDA 4HNCA 3EEZA 2QCDB 1NIUA 4GJIA 4CLMA 4TU1A 3GXTA 4XAFA 3G1RA 4HHHA 1DJHA 4M1RA 3UZYA 2WWCA 1RSCA 1PDZA 3A9BA 3EX2A 1W37A 4DXKA 1X7FA 5HNTA 2HVMA 4IPJA 3VIJA 4OU1A 1W1VA 4FXRA 1IIGA 1OYCA 1P7TA 3WO8A 3GXMA 1PE1A 2OTDA 2YL8A 2G41A 1KRCC 2DSWA 3V1PA 2BLEA 5A69A 1ME9A 1V51A 2PC4A 2GVLA 5EGRA 4DJFC 4QEHA 2GJXB 4AIUA 5AHIA 4HTBA 1Q7MA 4XKMA 3A64A 1HKMA 1JUEA 3TK7A 1O66A 1JZ4A 3TXVA 4US6A 1UB3A 4CNPA 1JRCA 1XYFA 3E2QA 3EXTA 2ANUA 3R5EA 3JU2A 3OTRA 5BRBA 3SDOA 5G1TA 1E0WA 6TIMA 1U1JA 3GU1A 2OZ8A 2Y2WA 4GKTA 1QI3A 2PDXA 2E1DA 4LV9A 5AYYA 3USZA 4JFTA 5LGXA 3DERA 4LYKA 3VD5A 5C9WA 4LUSA 3EWWA 4M6QA 1BYAA 4Z17A 1E6QM 5LNVA 3R13A 5HXMA 2D3LA 1RAKA 1PX8A 3TQKA 5E70A 1JQXA 1IR1A 4OQVA 3GDRA 4GMEA 7PTDA 3MBFA 3VCCA 1MI3A 4GNJA 4HSOA 1M65A 4IJRA 1K8XA 3LGDA 4S23A 4K8HA 1LOSA 3VTRA 1GPFA 2VC5A 2ZWZA 5E93A 3WQ5A 3B9EA 2Q8ZA 2XZ7A 1QOPA 4FZIA 4O0KA 2HROA 1J0JA 3BV7A 3U7VA 3JRKA 5HULA 1PL9A 1JF6A 3EPNA 5DXXA 1JULA 2DZXA 1TKKA 4UTJA 1POKA 1B1YA 1YEYA 1XUZA 4XG1A 3TYBA 3KVKA 2GWNA 4IIHA 3CUJA 1K3UA 1A0DA 3RX2A 1XCWA 4JL1A 2PE4A 3MQTA 4NXKA 3F4DA 4AZGA 3VZZA 4JDYA 1E0VA 3ARPA 4MKVA 1ZSXA 5C55A 1IF2A 3HN3A 5J5DA 1VFLA 5DRIA 2WMJA 2QZRA 3S2MA 4HNLA 2IQTA 4GC4A 4AC1X 1QU4A 2CKRA 5FSEC 4AXKA 3BGAA 1CGWA 2IKGA 1BXBA 2P3ZA 1ZJAA 3NNTA 3OIXA 3ANVA 3RLUA 4HHPA 3PZNA 2HK1A 3KRZA 2AMGA 3A5VA 3FDKA 2ZRXA 4MOZA 1BQGA 1Q4WA 1R8LA 4G7EA 1T96A 3ES8A 1YRRA 1JNEA 4AY1A 3SRFA 1TV8A 1KR0A 4JDBA 1DXFA 1SFSA 1WZLA 4MYXA 4R7OA 4C65A 2ZX9A 1UP3A 2Z27A 4UQDA 3V5CA 4U5IA 1YBQB 4QEEA 4Z08A 2QMKA 2AL1A 4ZO8A 4AFYA 1SR0A 2WAGA 1FY6A 2DIKA 3MWCA 2RDUA 2VENA 4WUIA 1ZAIA 4AYSA 1XISA 5HNRA 4E2BA 4KCWA 4H7ZA 4Z1AA 4FX8A 3QVQA 3QQWA 1XLMA 4AISA 3WJZA 2IUZA 3ZXWA 3FFSA 2O56A 2VEGA 4QAWA 4JFWA 3TUUA 4KKXA 1DWAM 3GDMA 3MHGA 3LD5A 4LTSA 2IKIA 3U4FA 2NWRA 4PMNA 4AWTA 2ADAA 2BOFX 5H91A 3SIZA 2PWVA 2VVSA 4KGJA 3TR2A 2P5NA 4BKNA 3OHIA 4UNLA 5HPCA 2OCZA 1Z44A 4ZCWA 1E9ZB 1QHOA 1VFUA 4INFA 2J24A 2OT0A 2DZSA 1OX6A 3BW4A 2A6LA 1G9HA 2BVTA 3FNDA 4LC8A 1KM5A 4P61A 1R3RA 3W7DA 4D1JA 1N55A 1IXOA 2DEPA 5AYIA 4AC7C 5BOFA 1HL9A 3N15A 3MUZ1 3L65A 2Z7KA 2VFIA 2HXUA 3EWUA 2QDGA 4WKFA 1X1OA 1OWQA 3OLDA 3IJ7A 1K9DA 1N7KA 3EYPA 4RXFA 3K5XA 5DT5A 4R27A 2GJLA 3N2TA 1OJXA 5CC6A 2PTWA 3EKGA 1W3KA 1DQWA 2XSBA 5EMLA 4WQ6A 1D3CA 2PDFA 4L6DA 1S46A 3TSDA 1H1NA 3TU9A 3AS0A 1WZAA 4AW7A 1FWAC 3PNUA 4H8UA 3B0PA 1LF1A 1LLWA 4PFHA 3PY2A 4ERIA 2OO0A 4QJ5B 3O06A 3UJEA 1TQXA 4MWAE 4RX0A 4Z0JA 2FTPA 4GUIA 1PZ1A 3AICA 3S2CA 3GG7A 4RW5A 1Y7VA 4JIEA 4P8WA 1QNOA 1RA0A 1TO3A 5LNRA 4HCDA 4IXHA 2AQWA 4YVVA 1TVPA 4FNSA 2YJQA 4UFHA 5JU6A 1TRIA 2Z2AA 3FN9A 1T5AA 1SZEA 3PTQA 5I3GA 4HNOA 3WF3A 1C90A 2ZTKA 1V02E 2VGIA 5DN1A 3ATZA 3WMSA 6REQA 4PB3A 1UWSA 1AQFA 3WQGA 2EPMX 4CEXC 1OT1A 4ZENA 3AU6A 3CQHA 2C0HA 1LWJA 2QCCA 1XDLA 4LF1A 4E4PA 3JZEA 3WKZA 2OSWA 4H8NA 2CC0A 2YCIX 4QISA 1VCVA 3SSZA 3BANA 1SFLA 2J7GA 3M7SA 6ENLA 1EKOA 3KBVA 1VBUA 2G3NA 4A8RA 5GPRA 1LBLA 4W8AA 4HHLA 3B97A 5KSWA 1V02A 4IF2A 3IWPA 1JPKA 3P2VA 3SQLA 3BMWA 2TSYA 2QCLA 2JE8A 3UVIA 4JTLA 3OQEA 1TJRA 2OEKA 4L1GA 2VRKA 4C6OA 3P93A 4S3GA 3MSYA 1EUNA 4G5DA 1GWJA 1C7SA 1W5QA 1THFD 1TE6A 3PJTA 5CAKA 4D8AA 1PTDA 5HUOA 1E4NA 4AXNA 5C5YA 3E5BA 1NDWA 4MSSA 1HKIA 3OZPA 3CL6A 5HPOA 4Q8OA 4LUTA 3WBAA 5HBFA 3F2DA 2ZRWA 2IXUA 4J3XA 4HA4A 4ZXOA 2BBFA 4HA3A 2PDHA 1WKYA 3S1VA 3U2EA 1EJUC 4LU0A 3O8AA 2CLKA 3GLCA 2QIIA 4TX8A 1VB9A 1R7OA 2OGJA 3DFNA 3RLVA 3FS2A 3P84A 4QIUA 2PDYA 3AXMA 1I0DA 2C71A 4IJCA 1DP0A 1FDYA 1TWIA 3W7IA 2I14A 3NVTA 4CD5A 4YTQA 5LIWX 1BEUA 3DYOA 1JFHA 3VMOA 5C2CA 3B0XA 1EX5A 1CZ1A 1QNRA 2NT1A 4FALA 1A4LA 3CAKA 3H2NA 1MW2A 4JS3A 4DF2A 3M0ZA 4CVUA 1GKRA 2AAAA 3Q4DA 1AQ0A 1S5MA 4BQ5A 3P61A 4GFSA 1Z69A 4G1NA 4H9XA 1M6JA 4P7RA 4MNMA 1E6SM 2ONEA 2I17A 3MCNA 3DKJA 2PDMA 4HNVA 1WBHA 4ACZA 1YKWA 2VX5A 3SJNA 2ACSA 4A3QA 4GZEA 8TIMA 3TA6A 2VM8A 4WIWA 3ORWA 1KWKA 3TYZA 1J0IA 3LRLA 1JPDX 1PWMA 1ZCCA 1W3LA 1X8CA 1F2JA 3SRKA 2YB4A 3N6HA 4YYFA 4YVPA 3SY8A 4GVGA 1DKWA 5IDZA 4ACZB 1B3OA 2YLAA 4OIFA 3WUGA 4UR9A 4O1DA 3R25A 4X9YA 1ZENA 2FZMA 4Q4KA 1FX6A 2PLCA 4LS0A 3H7RA 4MPQA 2X2GA 1SO4A 4DNMA 4GZ7A 3CBWA 2E40A 2VGGA 1ADSA 1JG9A 3FVDA 3N14A 3GXNA 3PG9A 3N2OA 3LOTA 1V8EA 1WXYA 3WJSA 4KETA 3A3HA 2E09A 3KUMA 1MVYA 2FGZA 3IPWA 2G4FA 3LSBA 4XKYB 1H3GA 3MA8A 4LAMA 1K9TA 2VNCA 2V5CA 1DBTA 3QFEA 4WOZA 3OW1A 4OVXA 1O7AA 3GDLA 4RE3A 1WA3A 3WDQA 2WNNA 3N2MA 1RJRA 3TONA 4EPKA 3NQGA 2VELA 3G18A 4LANA 1M7JA 1L9WA 3T2QA 1X39A 3S5ZA 5D38A 3SADA 3AAMA 1DWGM 1YDOA 3WX7A 2DVTA 1BXNA 3UQNA 1HO1A 3SSJA 3ATYA 2ZXBA 4UTTC 2BODX 4B5UA 4IXXA 3PJUA 2HXTA 2GGEA 3U5YA 1LJYA 5A8QA 5HUPA 4UTKA 2VX4A 4PMYA 2CLHA 2ACRA 3GU9A 1VFSA 4O50A 4QNEA 1DXEA 2F8QA 3HPZA 2E6DA 3C0JA 3GR7A 3NPVA 3DUGA 3EDFA 5AHNA 5CG0A 2R24A 4KRZA 2DZPA 1I9CB 3QMSA 1W3HA 1KD0A 1ZRQA 3G24A 2XYLA 1WDDA 5D2VA 2PTYA 1R2SA 3FDGA 1HL8A 3LXBA 2FGLA 3ZLFA 1A5KC 3N12A 1QATA 2BY3A 3QF0A 3QKZA 1KXTA 2XFFA 3UF9A 1OT2A 2E25A 3DC0A 3G77A 4ACYA 4JTUA 3AHZA 3PZGA 1GQLA 1MXDA 2F38A 1PIFA 3NVDA 1DJYA 3LQLA 3IIXA 1AA1B 3G0XA 2EJ1A 4DYEA 2PDUA 2PRHA 2NX1A 1W1A1 2X09A 3D3AA 1D9EA 4V1XA 4N4QA 3EKZA 5ENLA 3DESA 4GWEA 3ENLA 1SJCA 4N0RA 5KITA 4HGXA 3VUSA 3P74A 5BOOA 4BI6A 1AG1O 1JL8A 4FF7A 2CLEA 2G3FA 3UG4A 4U3CA 2RFGA 4DJED 4Q4MA 2VDGA 3GM8A 1GW9A 3GHSA 4J3SA 2O9PA 5K4ZA 2PAJA 3BQ5A 4UOQA 4MAZA 1XUUA 4M24A 3SZ8A 1HO4A 4X3ZA 4NL1A 1QAPA 4Z2HA 1OFOA 5DY3A 1F6PA 2D23A 3TJXA 3UNTA 1FWEC 4Y6GA 5I2UA 4X9SA 2V3FA 1VRXA 1BG4A 5DXYA 3GRIA 4XD3A 2R1PA 1I2NA 1E72M 4GJJA 3L9CA 3VOJA 4X2RA 4QDPA 3T42A 5LA0A 4GVFA 4P8VA 4DJDC 1VZWA 1GVOA 4L65A 1FCQA 1GW1A 5CSUA 3WUEA 1U5VA 1Q6DA 3KRBA 3KVMA 2WMHA 3NQFA 2WM0A 3W28A 4HU3A 3SUTA 4IMGA 2P8BA 3EWBX 4HOZA 1LQ0A 3UG3A 1PHWA 3HMCA 3FGCA 3O0KA 4YYCA 1K7EA 4FXSA 1RCOB 3SGUA 1B3YA 1YE6A 1Z42A 3IK4A 3M47A 1U1UA 3W83A 4C6EA 3MTWA 3FOKA 5E9AA 1LQAA 1V93A 3RO6A 2PZNA 2POTA 3VE9A 1Q13A 3IIVA 1N8IA 3EOUA 4IIFA 2J7BA 1G7VA 3LMYA 1VH7A 3BAXA 3M07A 5H8MA 3WYZA 3L4TA 1S3HA 1U5HA 2FTWA 4EPBC 3REQA 3D3FA 1B0IA 1VEOA 1ZBKA 3O6AA 3SECA 1UR8A 4K68A 3UBPC 3TTOA 1TZ9A 1Q65A 1UWIA 2C6QA 3GVVA 1XH2A 4J40A 1TIWA 2HK0A 3IGHX 2B7OA 4UTLA 4RNFA 3WD1A 1SZFA 2PBGA 3MI3A 3VCNA 1XIDA 1RD5A 1VQTA 3V75A 1TCMA 3G6MA 3QZAA 1UOKA 3DFSA 2CCRA 4E4UA 3G0SA 3CM4A 4M29A 3TNOA 4HD5A 1F7BA 3V36A 3NEVA 3GG1A 4AX7A 4Z2IA 1NDZA 2VX7A 3TTEA 2PURA 4U3AA 1G4SA 5HDRA 2WYSA 1WDWA 4B5NA 1L2UA 2CZFA 2YXXA 2CLIA 4F0MA 1NFGA 2W91A 3KWSA 3T6CA 4GQGA 3AIVA 1PZ0A 3AXHA 1DIKA 2XM2A 5AVHA 4J5NA 5CZKA 3K30A 5D2WA 1XP3A 3WEOA 2RGLA 3P8IA 2GGHA 2Q3OA 3S1XA 1G4PA 4XB3A 3WG6A 3NZ1A 2J62A 2ZUNA 5LNSA 3RK8A 5HMFA 2XIOA 4HPHA 4JHZA 3MUAA 1VJSA 1E1CB 4GABA 4XD4A 2WQPA 1FKXA 3ZIZA 5A3HA 3ISIX 4MLRA 3QV7A 4NUWA 3B4UA 2QR6A 4OOZA 2WVUA 4V27A 1GGOA 2NV1A 3HJZA 3Q58A 4IOTA 1H7XA 1NQ6A 1WDRA 1XIHA 1SMAA 4REQA 3DFPA 4PMXA 2XH0A 5M3WA 3Q67A 5M1TA 1ENUA 3UT0A 3PBGA 3W2KA 3BO9A 4ZSUA 1UBSA 4LC6A 1P6WA 3CEUA 4PULA 3CH9A 3W1PA 3B9OA 4IUGA 1W1PA 4OECA 1DYSA 4HK5A 3E74A 3S8HA 1QVBA 3PUOA 1A3HA 5AB3A 2OT1A 1BYDA 3S1WA 1V6VA 3VNZA 5JH1A 2FVKA 1LWHA 2YKKA 5CGTA 1DL3A 4TMBA 1W2PA 2DW6A 1V08A 3PZUA 1BSIA 1US2A 1JZ3A 5HWJA 3AYTA 4MNJA 2GVEA 2CZEA 3FHQA 8RUCA 1EXPA 4QLJA 1TCDA 5JMUA 4BA0A 1Q6EA 4MJ4A 1OC5A 4IG2A 1V3JA 3QZEA 4MWAA 1VHCA 3MANA 4GO8A 3CAVA 4NAFB 3VOGA 1GZJA 3MMWA 4S38A 2GUBA 4LUSB 4FO4A 4RPQA 3M0LA 2ON3A 4QLKA 3KOFA 4S39A 3RGTA 4MHBA 3BWWA 5CSSA 4B5XA 2NWSA 2WVSA 3RIKA 5CCZA 3MSGA 2DSKA 2Z1KA 5LHEA 4D6CA 2XUCA 2XFYA 5G1YA 4DUOA 3E0VA 3UNDA 4BCEA 3NSXA 4PFMA 1U1HA 4AIEA 3VDGA 1CGTA 2JALA 4IPLA 4GX9A 1FOBA 5HA7A 1PB0A 4PSRA 4GX8A 1JXKA 1NEYA 3GD6A 2GJPA 3LGEA 2EHHA 2P76A 4DIAA 3E0IA 4A3UA 5FEPA 4CN6A 1EJTC 4W85A 5DBUA 2E67A 3M6YA 2NUYA 4IFOA 4PTWA 3N11A 4EE9A 5XIAA 3MYOA 3V0SA 3CK5A 3THAA 4LEQA 4PUKA 1ONWA 5I3FA 1D8CA 1EL3A 1EHNA 1HGWA 2QPSA 3BG5A 2O4MA 4TV6A 2XFRA 1XGZA 1E6XM 4GI6A 3OOQA 2PPGA 5D9PA 3TCSA 1YYAA 7TAAA 5KZ6A 3AOFA 1I8JA 5F2IA 1C92A 1GZGA 2NXGA 1ZZMA 3V18A 1MNSA 1IT8A 3ZS4A 4AD1A 1QW7A 3P60A 1UBPC 1JDFA 3LCGA 3N3MA 3VE7A 5AN7A 5HQEA 5EY5A 3W72A 5D2YA 3TW9A 4PEKA 2ZUVA 4MJMA 3AWOA 1A5SA 3VU2A 3URNA 1KBJA 3QV9A 3EMCA 3OYZA 2PDLA 3NOYA 1EP1A 2IPFA 4CCZA 2WNQA 3IGUA 1IGSA 3FHAA 1SGJA 4MFEA 3LV6A 5XIMA 4RKAA 4QJ4B 2BWGA 2ZZ5A 5A8PA 1AMKA 2AKZA 1KB3A 1YADA 4JQ2A 4B16A 3P6LA 1FRBA 4CCEA 2ZQ0A 2ZX5A 4JKMA 4JTSA 4F0HA 4DI8A 4MB1A 3ZWTA 3CC1A 1NOWA 2D2HA 5GVJA 5LXEA 1XL9A 1MRQA 3GFYA 3LHUA 1LL4A 2ZRYA 2QDEA 2F6UA 3LTPA 4C6CA 1WKEA 4N9DA 3AYVA 3NQDA 1Q4NX 4DLFA 4DWDA 2OXNA 3GNNA 4I7UA 5FEXA 4KEZA 4ZOAA 1R3YA 1QDSA 5MF5A 4R9OA 3VUPA 4JQ3A 3KL3A 1HP4A 1XSKA 2ZTJA 4IP4A 3GUGA 4WJXA 2FMOA 1EZ2A 2VFDA 1I1WA 3P80A 3W25A 4GC3A 4JY8A 3UXAA 4NILA 4TUFA 2V3DA 4IIBA 4C6DA 2OR2A 1SW3A 4WD0A 1A53A 1PAMA 4IT1A 5FESA 3OZYA 4AD2A 1W3NA 3W1MA 3EWYA 4KWVA 1DE6A 2YCLB 1O1ZA 1P1MA 3BZGA 2XSAA 3VC6A 4LX4A 1QTWA 5G4EA 1S38A 3CT2A 1T6MA 1F76A 1HZYA 4GRSA 2ZA3A 1V5XA 2FB2A 3ZJKA 1JCJA 4F0SA 4UOZA 4K8EA 1Z48A 5FJOA 1MFVA 4IP7A 3TMLA 1CLVA 2PBOA 4JTIA 4UWMA 1E0XA 4YMZA 3NQ6A 3MBDA 4UMAA 1LRNA 3WQFA 2ZA1A 3DHDA 3KBWA 5CPMA 5DF0A 4US5D 3VOHA 3KBSA 4AH7A 2VD8A 4LAOA 3TAOA 1QI0A 2G4JA 1TV7A 3K1GA 1U30A 2JF7A 3BAKA 2I16A 5MHBA 2GDVA 3RRXA 3S1UA 4ASTA 5D9NA 1REQA 4OFCA 4OBSA 5CH9A 4AUBA 1WOBA 1M41A 1S1RA 4JD4A 2X1RA 2JGQA 2XGIA 1J6OA 3CHFA 1YQ2A 4W7WA 3V5FA 3E9AA 1KV8A 3H22A 4PTMA 4WSKA 1GVQA 2WZIA 3LK6A 4PUNA 1Q45A 1AZ2A 1XCXA 4IFKB 3RM8A 2VRJA 5LHFA 1OK6A 4O1FA 4X61A 2NW0A 1HKKA 4MY1A 1P0NA 4K7YA 5BNKA 1OFAA 4JPGA 5F2MA 1ESWA 3ZQ9A 3WMCA 2A3EA 4PCFA 1GORA 1UC5A 2ISWA 2VDIA 3W4RA 4MFDA 1ISZA 1FCVA 2NX9A 1LLZA 3G2GA 3LHWA 4XQ6A 3SJ3A 5GNZA 1YLVA 2PDWA 5TD4A 1ZP4A 4M6VA 4JIQA 1QPRA 2BZNA 4IIDA 3EX4A 3BLPX 2GVJA 3QH2A 4CVWA 2W9MA 5FAJA 3L4ZA 2E0PA 3GW3A 4A2SA 2D22A 3BDKA 3SN4A 4UZSA 3OO2A 5EL1A 5CG7A 4W4QA 1XHGA 3UCDA 1TREA 4GLEA 4XISA 4QDWA 1HNYA 4CNNA 4J3VA 4HCHA 4ZO9A 3K4AA 2F6XA 3MU7A 4HVXA 1QHPA 5LSMA 5DQPA 4ZE4A 1TMQA 1EF2A 1E40A 1R85A 3H4GA 2TYSA 4WVXA 3O3RA 4GVIA 3ZJ7A 3A5FA 4YL2A 2XINA 2WVVB 1MQQA 1VIZA 4EWND 1POJA 1IZCA 4R7WA 4UQ9A 3GC2A 4M81A 2XTKA 3NQAA 4MVAA 1A5BA 4O4WA 1P6BA 3W7LA 2X0YA 4C1KA 4J28A 3VIMA 2VHLA 5G1MA 4KWSA 3IANA 1EJ7L 1I45A 3S6TA 1A3WA 2F2KA 3A6OA 1ZALA 3EB4A 4F9JA 1QMLA 5ABTA 4NNAA 2POZA 5F7UA 2D1ZA 1FVPA 3GDKA 4X63A 4L61A 1V7YA 2XN0A 3QC0A 1JZ8A 4O0QA 1L2QA 1CTNA 4FXJA 3FV9A 3CASA 4A8NA 3FA4A 1A0CA 1Q2SA 2I7GA 1YHTA 2D2GA 2JKAA 1JGMA 3CIVA 3PP7A 3TTSA 1SZGA 2WBGA 2FMNA 2FDMA 3CQJA 4PMQA 3APYA 4Y9NA 2DUZA 3VX1A 4RXGA 1D2KA 4EXQA 3Q65A 5IBXC 1W3TA 4WJEA 5FF3A 2NUXA 4IPIA 4AZBA 1R38A 2B31A 3WLMA 2J78A 1LRQA 4S3KA 2BFGA 3WNOA 1ZL1A 3CXOA 1MQRA 2G3IA 4W5ZA 1P1XA 4DZAA 3ARYA 1MUWA 2NV9A 3R11A 3W2NA 3FCPA 1M7PA 4E5TA 2BASA 4C91A 1O5KA 2X1UA 1YXYA 3OA3A 1W56A 1E4LA 4KWUA 2PZ0A 1AODA 2G37A 2ZRZA 2REQA 3MMDA 4G2DA 2VMFA 4ORMA 3G8RA 3UWWA 1US0A 2PGEA 2X7WA 5BMXA 1XIEA 3VABA 5KZDA 1B9BA 4CQAA 3UY8A 3HV9A 3L12A 4ERGA 3BLEA 3QR1A 1GVRA 2C0AA 3UXIA 4LGXA 1F6YA 2PWFA 3ZT7A 1O5XA 3VKDA 3SCVA 2PI6A 4DN1A 4HZ7A 3KZPA 4J3WA 1E9IA 1J8VA 1TWDA 5EBAA 4R33A 2J79A 4EXBA 1NF7A 4MZ1A 4DEFA 4Q22A 1NSJA 5CC5A 4LYPA 2XWDA 4W5UA 4GQQA 3ZR5A 2P50A 1LT7A 2YCLA 2OSYA 3PZVA 1A3XA 2AL2A 4O4VA 2XM1A 3BMVA 4NYYA 3N4AA 2WSKA 3EX1A 1Q5MA 3F7JA 1EGZA 4Q7NA 1GJPA 2HBVA 1BG9A 3RYSA 5I0DA 3CJPA 4PR4A 1KCXA 1RBOB 4JEQA 4RPPA 5PTDA 4HT3A 1PYFA 5CC3A 1CWYA 4TMCA 1I2PA 3S83A 1MSSA 1BHGA 1LUCA 1RLDA 3NL5A 3LENA 2PDQA 5LIXX 3S42A 4A21A 1H63A 4PTDA 3PANA 3QLLA 1A47A 3CUGA 4GVHA 5F2LA 5FJIA 2SFPA 3HGRA 1P5BA 2W67A 5HANA 3O16A 2FJKA 3L2LA 4JX6A 2CLMA 4UIOA 5AHMA 3ALGA 4QSHA 4I9AA 1OVDA 1DJNA 1SO5A 1FQ0A 3LLFA 4ZB0A 3CAQA 2ZKMX 3BMXA 1XLGA 2GK1A 3IK2A 3NQBA 3QMRA 1YTKA 3MKVA 2Q8XA 1KBBA 4MMWA 4LS2A 1XRFA 1Q6LA 1EC9A 3PB2A 1UMLA 5T9CE 2Z2BA 3B8VA 4UTFA 2FH8A 2ZICA 1FWHC 4MPKA 4PGLA 1EX1A 4QP0A 4B4HA 1GQKA 2Z28A 2TPSA 3ZYZA 4ZQOA 3PB0A 4PCSA 4DJEA 4A8IA 2P53A 2C3ZA 5LGZA 2WJEA 1TV2A 6TAAA 4S1FA 3WLJA 5A6BD 3AMKA 4E8DA 3CLWA 2JGYA 1K4HA 2V9DA 4I8DA 2FPYA 1VJZA 3T09A 2W5FA 1DWFM 3WQOA 4CGTA 1K8YA 4YLWA 1ZLPA 3OVQA 2CLPA 3M0KA 4FEZA 2NXHA 1MMFA 4GBDA 4RNHA 1UYQA 5LIYX 1E6ZA 4MJ2A 5FSDC 4FMVA 5J5RA 3U3HA 3MP3A 2NT0A 4D1IA 4CD7A 3TWAA 3CHCA 2BTMA 3QN3A 3DX5A 1PJ9A 3LGGA 3H6OA 3VGGA 4I8YA 5A94A 1X96A 4MAVA 2NVAA 4PH6A 1R2TA 2G95A 2DZBA 3NR0A 1ISYA 5EFDA 5A2AA 1VLIA 4D71A 1MRAA 2G50A 2WVTA 3URAA 1RV8A 3BOXA 2IXVA 1KBLA 4EACA 4DLMA 1M7XA 1SR9A 4R5EA 3HV8A 5C9ZA 2RGMA 3E2VA 3WSUA 3VD9A 3MS8A 2G8ZA 3S5NA 4G8TA 4NKCA 4OOUA 1ZPTA 4BQ2A 1K9EA 5E6ZA 4LXFA 1C8XA 3UXDA 4HJFA 2V38A 2LLEA 3BVJA 1DV7A 3URQA 1HJWA 3GVGA 1UD6A 2Y5SA 5EA9A 1NAL1 9XIMA 2EG7A 3I6RA 3ITTA 4JCMA 4LUYA 3OZOA 3C56A 5D9OA 3W2LA 1XFCA 4EANA 4K38A 4W8LA 4DBDA 1UHVA 3ARZA 2I5GA 4O1EA 5FI8A 1XXXA 3I4EA 1KFBA 2WW5A 3C3UA 3R1ZA 3AMGA 5DCEA 4F40A 2R1MA 4ZOEA 2YCJA 2FPVA 3FA3A 1CLKA 2PF0A 1B5TA 3CQKA 4HYVA 4UCFA 3SGZA 3AROA 1IXPA 5H6HA 2YIHA 4MKSA 4I7WA 1OZMA 1G01A 3G5EA 3LNPA 3O6CA 1MNZA 3HB9A 2FGBA 4S3BA 1E3ZA 3CTLA 1GYNA 2VP8A 2PFHA 4ZE5A 4H9ZA 5D4YA 4EP8C 1TJ1A 1VYSX 3VZXA 2BY0A 1O95A 3OG3A 1M68A 1TSIA 3BSHA 5HR6A 2X42A 4J2MA 4IMFA 2Z26A 2VX6A 2BOEX 1Z89A 2VZVA 1MEIA 2VVNA 3V5OA 3GE7A 4NSBA 3VD3A 3PFRA 3PZIA 3BLDA 4HCLA 3H2CA 3PBWA 3SQMA 4GZJA 3ZR4A 7REQA 2Q3RA 4B9YA 4ADTA 2J7FA 4J3TA 3LTYA 3IRDA 1UROA 1SSGA 1VPXA 4YPJA 4B3KA 4ZOBA 4LCQA 1ITQA 1SW7A 3AMDA 4A05A 1CB2A 4N42A 2BVYA 3E02A 5AC4A 1EF3A 2Y4SA 2BVDA 3EWDA 2DV0A 4MUZA 4NI3A 4FLQA 2XVNA 5BXPA 2PB1A 1JYWA 2VFGA 3W29A 4NJHA 5I03A 4UMBA 3TVAA 3NO5A 4AZ7A 2HNEA 5I06A 1O4UA 2ZRUA 1KM0A 4HNUA 2QJMA 1FH8A 3HF3A 3WDPP 1T7LA 1W8GA 1FTXA 4C1NA 4URIA 1P0BA 3IEBA 1R3SA 2H90A 4XWUA 2PU1A 1NOFA 4F79A 5A2BA 4MKNA 3IV8A 2VCBA 3WLLA 4F2UA 3LMZA 3N2CA 3M5ZA 4JHOA 5AVNA 2E9LA 3WK0A 4M7TA 3BLOA 2Y0FA 1DHKA 3PBYA 4WGHA 2YZ5A 3S2LA 3CEPA 3LNMA 1YX1A 3LERA 3TOPA 2FVLA 4O18A 4AD0A 3I3BA 4GQBA 4GYPC 4TQTA 1DORA 3C0QA 4UFMA 3KM8A 1ZB5A 1XPGA 4H6EA 5D9MA 4NZ5A 4C1LA 1DTUA 2DGAA 3W75A 3VDCA 3ZSTA 3I6EA 3VVGA 5HJXA 3VMPA 5IM51 4O1AA 3VGHA 4S2CA 2F2HA 1Q6QA 3C0LA 1UH4A 2NQJA 4AWUA 1HX0A 3M7WA 1JYNA 3BGGA 4C5YA 1FWTA 3D5HA 1CW2A 3B40A 4IGSA 3EB2A 3ITOA 2DJLA 3M0XA 4GXWA 2WHJA 4LSBA 4Q4PA 2PWEA 5KEZA 1GVIA 4UFKA 4AIBA 3NUKA 4J7RA 4WY0F 2FZDA 2A6NA 2Q09A 3FA5A 2PDKA 4OTKA 1NQKA 1EA9C 2FZNA 2V5DA 3VKJA 3GZ3A 2WWDA 3CB8A 3A4JA 4GYPA 4PTVA 2J7CA 4XUYA 1T41A 3TN5A 4HTYA 4KCUA 1UZ1A 4RDWA 3LXAA 4O13A 3W6MA 4KS0A 3QGKC 3ABRA 1QWGA 4M19A 4RDVA 1PWLA 1UR3M 1B3VA 3NG3A 2YBTA 4IISA 4ZBCA 4QSFA 3WDIA 4QTGA 4L4PA 4OBRA 1JNDA 1L8NA 2Y24A 3UWVA 4DI9A 3DAQA 1JEZA 3O9NA 4GO9A 5AHEA 2DUXA 1TUFA 1QPNA 3BARA 3BSGA 4UTWC 3GXPA 2Z1XA 4C6JA 2YGYA 1WCGA 3EGJA 2BSLA 4NAEA 1HL2A 2VCCA 4LVBA 4HA1A 3PSWA 1D7FA 2I57A 4N6FA 3HOJA 1W31A 5KMYA 1K6WA 1NH6A 2QF7A 5JH2A 4XSMA 1WBJA 4O1CA 3CV2A 5IHSA 1NDVA 2W27A 1PX4A 1XW8A 5A8GA 2UBPC 2YXOA 3AS3A 4OGZA 3OEXA 1JZ5A 2X05A 3P62A 3GNRA 4E2VA 3RU6A 2XH2A 1J11A 1VD6A 4MB5A 1BSLA 2CWXA 1KC7A 1FHUA 4Q4QA 3KRSA 1R30A 1BVWA 3UWUA 4XX6A 3EPMA 1QOXA 1M04A 2JKPA 4F0RA 2F61A 1S2UA 2E68A 3G0UA 3MSRA 2KAUC 2BDQA 2W4XA 1MDRA 3BSMA 3AHVA 3HQNA