4HZ7A

Crystal structure of bglb with glucose
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 173
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz7A00
1TA3A 2EPOA 3AHXA 5E6ZA 3O2LA 3EDDA 2DSZA 2YA0A 1GQIA 1GUVA 1ZU8A 4H04A 3MUAA 1MW1A 3U7VA 4AMCA 4CU6A 1C92A 1EQCA 3VTRA 1QI5A 4F79A 1CEOA 2BY1A 1UZ4A 1ZBWA 2JEQA 4E2OA 5ABFB 1CPUA 1WZMA 3ZO9A 1XYZA 4PUEA 2BVDA 4X0VA 3BCFA 2X8RA 5CG0A 3T08A 3VOCA 1HP5A 5C8BB 5D8WA 3THDA 1WB0A 3NSMA 4W7WA 4AZBA 4GQQA 2CBJA 3AZRA 1CGTA 4CVUA 3CGTA 5I77A 3VO0A 3W4RA 1PZ2A 3W26A 1JDAA 2CEQA 1B2YA 4ZENA 5BWFA 3VX0A 1E70M 2C0HA 2JF7A 5E09A 1V3MA 1MXGA 1B9ZA 3CIVA 2WK2A 2GJPA 3EMCA 5GNXA 4HMCA 4L4PA 1XHGA 3ARUA 2DH2A 4CCEA 2ZXBA 3VM7A 1U33A 1JZ4A 1GJUA 4XX6A 2WPGA 4W8BA 2Y2WA 1KR0A 3CHDA 4WIWA 2XVLA 1A3HA 1XH0A 3MU7A 4W7UA 1BF2A 3QHMA 4WKFA 3ARWA 2A3HA 3BCDA 4GXPA 1OT1A 1GVYA 4U2YA 2VR5A 1V0MA 4W86A 3BAIA 4D1JA 4W5UA 1EO7A 1JI2A 2GFTA 1E1FA 2WVTA 4AY1A 3AS3A 4JCMA 4MPKA 3RIKA 2VX7A 3N17A 3I3BA 4UZSA 1FP9A 2ZXDA 4UFMA 3GNOA 1LLOA 1HF6A 3CHCA 5M17A 4B16A 5ABGA 3OLGA 4E8DA 2RGLA 4P8WA 3WNMA 1ECEA 3SCWA 3A47A 5CXPA 1QPKA 1E43A 1MW2A 1V6VA 1HNYA 4PN2A 3PTQA 4J3TA 5I0DA 2ZUMA 2OYLA 4U5KA 3PZVA 5BXSA 2FHCA 5GQBA 1W9VA 3WD3A 1D3CA 3CZEA 3VIOA 1RP8A 2ZOXA 1WO2A 1E6NA 2DGAA 2YBTA 3CHFA 3AYSA 2FH6A 3SCRA 4FLSA 1HJVA 2OSYA 1JZ3A 2WSPA 2WAGA 3ZJKA 1VJZA 3AQUA 4Z2GA 3F5LA 1KFWA 2GK1B 2QMJA 1UD6A 3N18A 3MUIA 3AIVA 3WMCA 3VMNA 4M24A 1JI1A 4GIAA 2ZIDA 3CUGA 2A3CA 2ZX6A 3AIEA 1GHRA 2G41A 3TOPA 1HJUA 3OGSA 1C90A 1CDGA 1BVNP 3EMQA 3U5YA 1UQYA 1EOKA 1TMQA 1UWTA 4WSJA 3ZJ8A 4LGXA 1TA3B 1W1PA 2BVYA 1WDSA 5ABHA 4P7NA 4HP5A 4AD2A 3VNZA 2ZWZA 4AISA 3BAYA 2ZXAA 1IT0A 4UOJA 3ZT7A 1OCQA 4N42A 3BXWA 4W8AA 1HN1A 1J01A 1GHSA 4P8UA 3KZSA 3SUTA 5HPOA 2J79A 4DM2A 1V6WA 2ZE0A 2XSAA 3PZTA 4XUYA 1KQZA 3CUJA 3E1F1 4ZE4A 3AXIA 3D3AA 4QLLA 2IUZA 1J0KA 4AIEA 1X1NA 3T2PA 1UWIA 3LPPA 1TUXA 3WUFA 4ACYA 5BXRA 3T09A 2D22A 5HOSA 2WZEA 2XIBA 4MAVA 1GPFA 1VF8A 5CZKA 2FGLA 1HVXA 2DSWA 2MANA 2V5CA 3W28A 5GNZA 1KWGA 2J25A 4Y7EA 4AWEA 4KMQA 2WZIA 1E3ZA 3WUGA 1Q6EA 3K1DA 4S3JA 2W62A 4ZEPA 2O9TA 5ABEA 1WAWA 3SIMA 1PEZA 5AC4A 2BHYA 4NF7A 2VO5A 4F8XA 1ISVA 2JF6A 3BLKA 4J3XA 1OIFA 1NP0A 2ZXQA 4TXEA 3ZT5A 1ODUA 3I3EA 4ACZA 2WHKA 4W93A 1NWUA 3FAXA 3W0KA 2GSJA 4QAWA 1V03A 1H0GA 5FD0A 1WZKA 3WQ4A 1Q6FA 3NCOA 2J7CA 2WMGA 1J18A 2QMKA 3VINA 3WD4A 1WP6A 3GH5A 3HU7A 4RE2A 4J3WA 3S6TA 3B9AA 1ISZA 3WIJA 1V6XA 4HU8A 2CKSA 3OG2A 3ZIZA 2V3DA 5A8PA 3W81A 2ZUTA 4PMZA 4AD4A 4GKLA 4HOXA 3AFBA 3LPGA 4AXNA 1VB9A 5M03A 1MQPA 4D6JA 2NW0A 2W67A 1W1TA 3GXFA 3RJXA 3VD4A 3VKKA 1LF1A 1DWFM 1KR1A 3RM8A 3TTSA 3VIMA 4PTXA 1W9UA 1BQCA 5E70A 1E9LA 7CGTA 2AMGA 1UR2A 3VIIA 4PTVA 4TUFA 4GO9A 3SEPA 2D2OA 3DYOA 4FF5A 1QHPA 1ISWA 2X05A 5D9NA 5FOOA 3SUWA 1OM0A 1H41A 1WPCA 4HA3A 2Y5EA 4WF7A 3K8MA 2ZUWA 2E40A 1E55A 4ATDA 3K8KA 1HL8A 1D7FA 1E0VA 3BAXA 4HZ7A 3WF3A 1JIBA 1LL4A 3EMZA 4OBRA 2E0PA 1KGXA 4AD5A 1JDDA 3NIYA 1H3GA 1E40A 2W4XA 1MQQA 1DWIM 2J4GA 3IAQA 2YJQA 1G1YA 1M01A 5I6SA 2QPSA 3CZLA 3AHTA 4CD7A 3L4VA 4E8CA 6TAAA 3AOFA 1JGIA 2D3NA 1AVAA 3WH5A 1Q6CA 2FH8A 3T0AA 2D20A 1U2YA 5GPRA 4A4AA 5JUVA 2YBUA 1QNPA 3VDBA 3WD2A 3L4ZA 1SFSA 1J10A 2F61A 1TZ7A 2PI6A 2V3EA 2VQUA 1F4HA 4V28A 2XGIA 3WMSA 1EXPA 1WZAA 3ARYA 4UCFA 4X0NA 2DT2A 5I5RA 1EHAA 5A8MA 5I3DA 1FFQA 3MUZ1 3VD7A 2AOSA 4J3SA 3AZSA 1DWGM 2Y8KA 3LPOA 2DPEA 3BSHA 1MXDA 4CD5A 2GDVA 4R5EA 1HKJA 4PMUA 1CXEA 3BSGA 1CBGA 2VRQA 2GVYA 1V6UA 3MMUA 1UKSA 5E0FA 2PBOA 3AXHA 1B3YA 3CUFA 4OKDA 4C7GA 2WCGA 5IFTA 1JDCA 3ZJ7A 4H41A 3WNOA 3VD9A 5D9PA 4JFTA 5I79A 1W1YA 2OLHA 2WVUA 3WBAA 1W3HA 1BG4A 4KH2A 1CZ1A 1JFXA 2GUYA 2J77A 2VRKA 1R86A 4U5IA 3TTYA 1C91A 1VEMA 1XH2A 4W5ZA 3GXDA 1PPIA 4PMRA 4ACZB 3EDKA 4U3AA 1E0XA 2PWDA 4XZWA 1J0HA 4BQ4A 2Z1KA 3WEOA 4GZJA 2HISA 3UG5A 3J7HA 2ZWYA 2V3FA 4U33A 1CWYA 4CD6A 2V5DA 3ZQ9A 1HX0A 4LXFA 1B3XA 1W91A 4LQ1A 4BCEA 1UKPA 4CD8A 2J7FA 5LA0A 3IJ9A 2F2HA 1UH2A 1V3IA 3EDJA 3WF1A 1E1EA 3VGBA 1WDPA 1H4PA 3TTQA 1CGXA 5JBDA 4JL1A 1CLVA 2WLZA 4JHZA 2DSUA 5LA1A 1LL7A 1QI2A 2GJXA 2EPLX 1BSIA 2NT0A 1EDQA 1JYNA 1BYDA 2CHNA 3WKZA 1OD8A 3KL0A 2VUYA 2JFEX 3ZM8A 3WFZA 2VRJA 1IZKA 1UWUA 1B3VA 1GVIA 5A6KA 3RCNA 2X2YA 4D6HA 1BYCA 5CPQA 2DT0A 3ZOAA 5FL0A 1M53A 1E15A 3CO4A 4DM1A 1CGUA 3AISA 3FAWA 4HTYA 3GDBA 1E71M 2VL4A 1N82A 1HJSA 1XSJA 2EBNA 1ISYA 5HBFA 1E6ZA 2XFRA 1HIZA 1X6NA 1KWKA 9CGTA 3WD1A 4ZFMA 2BHUA 3OBAA 1E4LA 3GBEA 4J27A 3AMGA 3CPUA 2CIPA 2CETA 1PJ9A 1XD1A 4PUDA 5LA2A 1OGGA 2ZUUA 2GDUA 1MFUA 2EPMX 3GTNA 4QP0A 3NUKA 3FHQA 3ARVA 3KL5A 2VCAA 2PWEA 3W24A 4GI9A 4FLOA 4W8LA 1JL8A 1XSIA 4OOZA 4B9YA 3WH8A 1IZJA 3W6MA 3MS8A 3DYPA 1VEPA 1IV8A 3DHUA 5CGTA 4P8XA 1L8NA 1DWAM 4J3UA 5BYWA 1H1NA 2WC7A 3N13A 2EJ1A 2EQDA 2PWHA 3OA5A 4TVDA 1UZ1A 2D0HA 2VVNA 2WVVA 1R8LA 2ESCA 4PMXA 1HJWA 3AROA 2BHZA 3SUSA 4LYRA 1J0IA 2RGMA 4PRWA 4W7VA 4H8HA 2ZUSA 5JBEA 4KRUA 4P7RA 3UCQA 3OLDA 1JAKA 3VU2A 1XD0A 2VJXA 3TP4A 3WDPP 1BYAA 5AYIA 2CBIA 1FA2A 5BRQA 2DDXA 2DSVA 2XM2A 2BXYA 3K46A 5CSYA 4NZCA 1GNXA 2VZOA 2GJRA 5IHSA 3LPFA 4UZUA 1EIBA 4PSRA 1UOKA 1J11A 4KGJA 5HXMA 3MSGA 2WMFA 5IDIA 1WZLA 4CCCA 1EQPA 3APGA 1EGZA 1H2JA 2Y8VA 1SMDA 2W91A 4XZBA 1YQ2A 4ML4A 5C71A 4M56A 4D6DA 2D24A 3ZSTA 3QGVA 4DUVA 4AEEA 3MANA 5BRPA 3VIFA 1H49A 3GH4A 3A3HA 1K9FA 1HJXA 4PYSA 1JYVA 1R85A 3B8SA 1LL6A 4UQ9A 2W5FA 1JNDA 2QV4A 4JAWA 3WDQA 2FDMA 2J8GA 3W53A 4AEFA 5A3HA 2HVMA 3L4TA 1QNRA 2WNWA 3IJ7A 3MUY1 2CNCA 2CESA 2CITA 1UWQA 3GXMA 1CXIA 2GJXB 3OZOA 4Z2IA 5A1AA 3CTTA 4AZ6A 3NDYA 1G9HA 2WC4A 2XG9A 4CN1A 2G3JA 2PWGA 1W9DM 1BGGA 1V3HA 2A3BA 1VFUA 2C7FA 3WN6A 5CLWA 4TVUA 2Y4SA 2J78A 1XCWA 4CN4A 4QCEA 1OD0A 4LPCA 1O6IA 3W25A 1HL9A 8CGTA 1C7TA 2J8FA 3IAPA 3CH9A 2XIIA 3VUPA 5M3WA 1V0KA 1GW1A 2J7GA 1ITXA 1NWSA 3AZTA 1ZBKA 4B15A 1ZBVA 2X0YA 2X1IA 1DHKA 4UQAA 3WL0A 3GZAA 5GNYA 3DECA 2BNJA 4F9JA 2VCBA 3WBEA 3GH7A 3CZGA 2ZX9A 1VRXA 4CCDA 3MKKA 4D6CA 1PX4A 2UY5A 1OT2A 3F5JA 3KE0A 2YLAA 1UD4A 4OJYA 3DHPA 1W9XA 2YIHA 4HZ6A 7A3HA 3W37A 2EXOA 5FCZA 1U30A 3UR8A 2PBGA 5AC5A 4GINA 3ARQA 1B90A 4TTUA 3AIBA 1CTNA 1UKQA 2XM1A 2XVKA 4W87A 4PBGA 4JIEA 3WFLA 4PMOA 4B3KA 3N12A 1UHVA 3WQ5A 1XRVA 1V0NA 4X9YA 1RP9A 3THCA 1GJWA 2W92A 2WM0A 1W3LA 2WVVB 1PX3A 2XJ7A 1MWOA 3VGFA 4U2ZA 1HJQA 4D72A 1KBKA 4TX6A 2WVSA 3CMGA 1US2A 3RILA 5BCAA 1TVPA 4MB1A 2YL5A 7TAAA 1CXFA 1OSEA 1E73M 1PX8A 4KGLA 5LYRA 2Q8XA 2BS9A 2FHBA 2W66A 4AD1A 4UQCA 4D6GA 4YN5A 1GZJA 5I78A 1PAMA 2DSKA 3VIGA 3WNPA 1AQMA 1B0IA 4AZCA 1WDQA 4BQ5A 3FN9A 4XB3A 4GI8A 3PZ9A 3A6OA 3AIQA 4DWSD 1EHNA 3PZNA 1PBGA 1OINA 4RE4A 2WMIB 3FW6A 4M1RA 4JFSA 1JZ8A 1E5JA 2CPUA 1XH1A 1K9TA 4LX4A 3NDZA 4MDPA 3ARXA 4AZHA 4MNMA 1R7OA 3ARTA 4B9ZA 2A3EA 1NQ6A 3WDHA 2VVSA 4ZE5A 3OIHA 4ATLA 2CXGA 3VVGA 1E5NA 2XSBA 4J7RA 1ITCA 4NRSA 3VIKA 2C8NA 3VPLA 4BZYA 3N15A 1JD9A 1OGBA 4D6EA 1E0WA 2WCSA 2ZUVA 1UD3A 1FFRA 1BYBA 2ZX5A 4MNKA 3VGDA 1K9DA 1C8QA 1VIWA 4A3YA 5AY7A 3WDJA 1ZJBA 1GOWA 3WH6A 1BHGA 1UA3A 1LWJA 3AMKA 1GOQA 3FXYA 4D1IA 3WDRA 1UD5A 3MO4A 3FY1A 1GONA 5E6YA 3BC9A 3NJ3A 1MVYA 2DT3A 4MJ4A 5EBAA 4AC1X 1RD6A 5A8OA 4HMDA 1JD7A 1C93A 3KWXA 1EO5A 1HKMA 3VGGA 1KGUA 2O9OA 2WSKA 4EE9A 1JXKA 1G5AA 4OZOA 4GZEA 2WXDM 3AJ7A 2NT1A 2V38A 4PMDA 4OIFA 4CD4A 5D9MA 2WC3A 5KZ6A 2VI0A 2WWDA 4EK7A 1UR4A 4JKLA 1C7SA 3M7SA 1KCKA 4C7DA 2WMKA 2XPKA 1CENA 2VZTA 3LMYA 3ZT6A 5BXPA 1E4MM 1KXQA 5FKYA 3W82A 2PB1A 2D23A 1S46A 1GQLA 4W89A 5A6AA 4ZXOA 5BXTA 4Z2KA 3VX1A 3CZJA 1XYFA 1CGYA 1E6SM 4BS0A 2D0FA 3QHNA 3OLEA 3VIPA 2BXZA 3ZR5A 1UWSA 4HA4A 4PEEA 1W3JA 2O9PA 2VC9A 3O9NA 4NSBA 5A6MA 1WDRA 3WDIA 2VX5A 3AMDA 4UFJA 2ZX8A 1QI4A 3NYDA 1DP0A 2WKLA 3MMDA 3MV01 3PN8A 5IXEA 1HT6A 2PC8A 3U7BA 4D6IA 2VQTA 4ATWA 6CGTA 1M7XA 1US3A 1GOKA 4LYQA 4TX8A 2OYKA 1XSKA 3OGRA 2EPNA 1QBAA 1JF5A 1V02A 3WF0A 3AMCA 4Q7NA 1B31A 3ZR6A 1UA7A 1J9YA 3WNKA 3WUBA 3PZIA 1FHLA 3OZPA 3GXIA 3WUEA 4AZCB 5IHRA 2J75A 4Z2JA 1XCXA 3ALFA 4MB5A 1FH7A 4MB3A 1TR1A 2XWEA 3PTMA 2D0GA 4AD0A 4WK9A 4V2XA 3SCPA 1UD8A 5A6BD 4MNLA 2VT0A 2VMFA 2XVPA 4GPNA 4IPLA 1HP4A 3ZMRA 1JZ7A 1QNQA 5A6LA 1E6PA 3SURA 8A3HA 4U31A 5D4YA 3TTOA 1CXLA 1QW9A 1G0CA 5A94A 4EAMA 1OIMA 3OGVA 4WLCA 3VMOA 2YDSA 2J7EA 3RM9A 2G3MA 4MJ2A 1KGWA 3BGAA 1J0YA 1BTCA 1CGVA 2E8ZA 1H09A 2IXUA 4UNIA 1LJYA 1CLXA 4HOZA 2TAAA 1A47A 4Z2LA 2CYGA 2XFYA 5EFFA 2XWDA 4MADA 1HXJA 3PZMA 2WHMA 3AICA 2EO7A 5EMYA 5A6JA 1CECA 1MYRA 5A8QA 2DIJA 3W38A 3I3DA 4YHGA 2JEPA 1VBRA 1V3LA 1HKKA 3AS0A 3PHAA 2W61A 1GORA 1OB0A 3AIWA 3NSXA 4PMYA 1BAGA 1EDTA 4HPGA 4UFIA 1LWHA 5JIWA 2YL6A 1CXKA 3S2CA 4J28A 1SMAA 2DH3A 3RM4A 1J0JA 5C70A 3T2OA 3SCOA 4PTMA 4JKMA 1UR9A 4IPNB 3SCTA 3WMBA 4FK9A 5I23A 3VILA 5CSUA 4IM4A 4JKKA 1E4NA 5I24A 2QLYA 1PZ3A 3N11A 2AAAA 2XVGA 1BVZA 2X0HA 4JFUA 4P7OA 1B1YA 2YOCA 5CGMA 4WKAA 4AW7A 2CCRA 1EA9C 3SUUA 1V6YA 2VZSA 3RJYA 1DWJM 1JG9A 1M04A 3IJ8A 3K4DA 3WY1A 1K9EA 3CHEA 3L4XA 2G4FA 4S3KA 4JFVA 1UQZA 3SCQA 5EFDA 5DMYA 1W2VA 4WSKA 1W9PA 1UWRA 4YHEA 4TTGA 1PIGA 4UFKA 3SCNA 5F7UA 2UY2A 3PZUA 4PMVA 5DT7A 2G3NA 4CGTA 3RPMA 4ZXLA 3G6LA 3IK2A 5D8ZA 4PMNA 4R27A 3CUHA 1FH9A 2Z1SA 1ZBCA 1G01A 1TE1A 1BLIA 2OWCA 1YHTA 5KEZA 1TG7A 5JBFA 3ARRA 3AIRA 1KBBA 2QHAA 2WW5A 2CERA 1XGZA 3UG4A 2CBUA 1E6XM 4PCTA 4H8UA 1EDGA 2UY4A 5A2CA 1Q4NX 4KWUA 3CBWA 1X6LA 2W63A 1H11A 3DYMA 2V3GA 3WNNA 1TFVA 2WMIA 4CN6A 4M81A 3UESA 1D2KA 5A6SA 4H2CA 5CPSA 4UTFA 4MDOA 1UR8A 3G6MA 4CUCA 1CNVA 2VNCA 1BGAA 1H5VA 3TONA 3VDAA 4K68A 5HDRA 2XFFA 4H7VA 2DQXA 2XUCA 1DTUA 1W1VA 3VIHA 1Z32X 1I1WA 2UWFA 4Q22A 4W88A 3GYCA 3UERA 3WELA 1R87A 2YL9A 5EB8A 2XTKA 1R7AA 1W2PA 3UEQA 1QI3A 4DWSA 2XGBA 3GNPA 1JF6A 1H0IA 1I75A 4EANA 1NH6A 1LG2A 3AHYA 1VFMA 2JALA 1J12A 2UY3A 1FP8A 5I2UA 1FH8A 2JE8A 4NI3A 1V0LA 3OB8A 4HOWA 1MW3A 3MV11 4B3LA 1ESWA 3VMPA 4V27A 2D1ZA 2VURA 1VAHA 3T0BA 3VIJA 4U3CA 3W27A 2BVTA 1FOBA 2WWCA 4PCSA 3T0DA 1XV8A 3CLWA 3ARSA 1V08A 3WENA 5A69A 1QNSA 2DIEA 3A4XA 1QVBA 1B3ZA 3F4VA 3MSDA 4BA0A 1NM9A 4DUWA 2O9RA 4KRTA 3WD0A 1NOUA 1JYXA 1UH4A 3HJEA 2WBGA 3TA9A 3CZ8A 1GCYA 2WMJA 2ZUNA 2BY3A 5JIPA 2IXVA 1TVNA 3EYPA 1QOXA 4QLKA 1JFHA 3QHOA 2G3IA 3M07A 4QDMA 4UOQA 1V3KA 3BAWA 1V3JA 3DC0A 4GQRA 1QBBA 2YLLA 4M82A 3U5UA 3SCVA 5M5DA 1E56A 1OBAA 4GO8A 5DF0A 2J74A 1WE5A 3EDEA 1C8XA 1BPLB 1HVQA 1Q6DA 1UR1A 1PIFA 3WF4A 1CYGA 1G94A 3WH9A 4CU7A 5A2AA 4C7FA 2X09A 1MQRA 1UH3A 4TOQA 3ALGA 4W85A 1JZ2A 3N9KA 5HNNA 1RPKA 4UQDA 1NWTA 2FHFA 1LG1A 1GQJA 5A95A 4QCFA 3M46A 2WHLA 1L0PA 4N0RA 3WH7A 3VM5A 4AD3A 2JIWA 3IANA 1JXJA 2DEPA 3L4WA 2XYLA 5FIPA 4D71A 2WANA 3PZOA 3ARPA 4HA1A 2OSWA 1UR0A 3MMWA 2CKRA 3A4WA 3D5HA 1UD2A 3FHAA 1NOFA 1CIUA 1SYTA 1UYQA 3POCA 4LYPA 2CHOA 2WKGA 5CPTA 3WQWA 4E4PA 2YDRA 3BAJA 4QLJA 4OBSA 4JL2A 3WQ8A 4UQBA 3RDKA 2OWWA 1UKTA 1WNOA 1AQ0A 3N1AA 3L2MA 4FLQA 4A3HA 2QF8A 1KQYA 4W84A 3W6LA 1JZ5A 1QW8A 4BF7A 4AYSA 2J47A 3AHVA 3BH4A 5AYBA 4EKJA 3M6DA 3VGEA 5FL1A 2QPUA 4PTWA 2J7BA 2WCAA 3JUGA 5DT5A 4F9DA 2VZUA 3QOKA 4HU0A 1GOOA 5TD4A 1QHOA 1Y7VA 2OSXA 4M29A 3FNDA 4WKHA 1GOIA 3QR3A 2VX6A 1NOWA 5D9OA 2E9LA 1BG9A 3VGHA 3L4UA 2FGZA 1KB3A 1V02E 1F4AA 4PMQA 3WEZA 1NARA 2VX4A 4DWSB 5A6BA 1LQ0A 4AZGA 1WKYA 4HZ8A 4JFWA 1AQHA 1C8YA 3AYRA 4IISA 4DUXA 3PTKA 4MNJA 1VENA 1UUQA 2YDQA 5IFPA 4L4OA 3B9DA 2BFGA 4JHOA 1QHZA 2WBKA 2E9BA 1WCGA 4FLRA 1RH9A 1DEDA 4UR9A 1J0ZA 4UFHA 4DWSC 5ECUA 2F8QA 1KXVA 3T2QA 3K8LA 3VNYA 4CU8A 4BQ3A 2D3LA 4F66A 1VFFA 3AI0A 2BY2A 4P8VA 3KEHA 2VOTA 2WLYA 3VDCA 3ZJ6A 1ZB5A 1ODZA 1P6WA 4AZ7A 1VBUA 2YKKA 3BAKA 3EBVA 2PF0A 2E4TA 3POHA 3ECQA 3II1A 4H8VA 2WYSA 3CUIA 4MAZA 4NRRA 2JIEA 4P7LA 1W9BM 1C3FA 3HMCA 1E4IA 5ABFA 2O92A 1ZS2A 4YPJA 3A4AA 1SR0A 4XV0A 4AZ5A 5BROA 3VDHA 2VR4A 3NSNA 1QI0A 1JNEA 3O6AA 1JAEA 3WQVA 5CLTA 2B31A 2YA2A 4IUGA 4FMVA 1MW0A 1NWRA 2WZHA 5CQ1A 3RO8A 4CKQA 2VCCA 5A2BA 1NP2A 2DT1A 3KL3A 3VD3A 3K4AA 1Q6GA 2BY0A 1OWQA 4JZ5A 2XHYA 4PSPA 1VFOA 3WF2A 1KCLA 1ZJAA 2WB5A 2VTFA 4RE3A 3CZKA 1FHDA 3WSUA 1UKOA 1W3KA 4UFLA 2Y24A 4AIOA 3GBDA 4BQ2A 1O7AA 3HN3A 4WJXA 2ZX7A 2E9MA 1CXHA 1VEOA 3SCUA 2J7HA 5DEZA 5DO8A 2BV9A 4UQEA 2VZVA 1K6AA 4JCLA 4MB4A 3CMJA 1BFNA 2EEXA 2PWFA 3OLIA 2G8ZA 3QOMA 4OOUA 2XVNA 3VD5A 1JYWA 3WNLA 3ARZA 3L4YA 4D6FA 3UETA 4GI6A 2J62A 4CVWA 3EDFA 4UOZA 1KXTA 3W29A 3AHZA 4HPHA 1DWHM 4MTVA 4AZIA 3PZGA 2YA1A 1ISXA 3SUVA 2YL8A 1W32A 3N04A 1GOMA 4P7QA 4OUEA 3PZQA 1E3XA 5A8NA 2ZICA 5HPCA 2WMHA 1TCMA 1E6RA 1E72M 3BMVA 1I1XA 4GZIA 1EOMA 3SCSA 1MFVA 2OYMA 3WL1A 1M03A 4QFUA 3AXXA 1VJSA 3ZSSA 1GQKA 1ZL1A 1OGSA 2CBVA 4AIUA 1AMYA 2NSXA 1B30A 1QNOA 1UG6A 2OWXA 6A3HA 1B3WA 2A3AA 3WEMA 3UG3A 4TVCA 3AMLA 2J7DA 3B9EA 3BLPX 3PBGA 3RMEA 3U57A 3UR7A 1XC6A 2EPKX 3AS1A 1JZ6A 3F5KA 1HKIA 1KXHA 2WHJA 4HMEA 5E0CA 2GK1A 3BMWA 3AIUA 5CJ5A 2E8YA 3AS2A 2E3ZA 5DFAA 4M8UA 3GM8A 4M80A 1EH9A 4URIA 3WQ6A 3L2LA 1E6QM 4Z2HA 3GNRA 1CGWA 4RL3A 5E9AA 4J3VA
chains in the Genus database with same CATH superfamily
4NVTA 2AAMA 3AHXA 4RDZA 4LBSA 2FTYA 4RZ5A 3MHUA 1GQIA 3E2SA 3RHGA 3PY2A 1UIOA 2PTZA 1PWLA 1RZMA 3VOGA 1YDVA 1PXGA 4HTBA 3MZNA 1C92A 1EQCA 3CT7A 1QI5A 2CZDA 2ZC1A 3I4EA 4F79A 3DX5A 1FWGC 1OK6A 2BY1A 1B9BA 1X1OA 2CC0A 2EJAA 4RJEA 3P8JA 3KCLA 4R88A 3NR0A 1XYZA 1EZ2A 1VJIA 3EB4A 4DYKA 4EWJA 5D8WA 4HHPA 1WB0A 4GQQA 1CGTA 4CVUA 3CGTA 1UZDA 1H1YA 1RD5A 3LB0A 1JDAA 1LUCA 1NU5A 3IVUA 1JQXA 3TDFA 2C0HA 1FDYA 1HW6A 3WLRA 3P6LA 2PEVA 1OZMA 3G5EA 3SIZA 1TV4A 2CLEA 5E09A 1V3MA 4UTLA 1B9ZA 4HT3A 1R9ZA 5AC8A 4IMDA 3EMCA 5GNXA 3WK2A 3D6NA 1XHGA 2J88A 4N9DA 3CPRA 2ZXBA 3V16A 4XX6A 4RXGA 3CHDA 2XVLA 3MU7A 4G9PA 3QHMA 4JTDA 4WKFA 2NQJA 2INEA 3BCDA 3E2VA 4GUGA 3OU8A 1IR1A 5EMUA 2VR5A 3E3HA 4D1JA 4W5UA 2GFTA 2WVTA 4AY1A 3AS3A 4JCMA 3CPGA 1F3XA 1GZ1A 2ZXDA 3GNOA 4O1AA 3C2YA 1LLOA 3TN3A 2RGLA 4P8WA 3FEQA 1ECEA 3BDKA 1QPKA 1R2SA 1Y5VA 1E9IA 5I0DA 2YZRA 4WCJA 1ICQA 3BLLA 1W31A 2FHCA 4C6LA 4Y9NA 1KRMA 2I56A 2ZOXA 2YBTA 3TC7A 4IHCA 3AYSA 3SCRA 1IWAA 2WSPA 1TPVA 3AQUA 3SY5A 1Q45A 3CV2A 5FA5A 1M65A 3MUIA 3AIVA 4ZCWA 4KCVA 1SW7A 1JI1A 4E4UA 4TO8A 2ZX6A 4Q4OA 3TOPA 4Z17A 3V0SA 3EMQA 3TN4A 4C6JA 3HPSA 3W7GA 1EOKA 4REQA 3ZJ8A 5LHFA 1WDSA 5ABHA 3NO5A 1F6KA 4P7NA 4HP5A 5TIMA 3W1PA 3VNZA 4AISA 1ONXA 2ZXAA 3BAYA 4GNVA 3BJFA 5AVHA 3ISIX 4N42A 4K8GA 1L6FA 2HV5A 2ZRZA 2CLOA 3F2BA 3ERPA 2DUAA 3S2MA 2C16A 3GG7A 1GHSA 2XU2A 3URAA 3SUTA 1UC5A 4WRHA 1V6WA 2ZE0A 3PZTA 4RZBA 3STFA 3QW4B 3KLKA 5B7YA 4HNOA 4XUYA 1KQZA 4IJCA 3TOYA 1J6PA 3RNDA 2ZDSA 3FJ6A 2IUZA 4AIEA 1R3SA 1W54A 3LPPA 1PDZA 2D22A 5HOSA 1JEZA 2ADAA 1FDJA 1VF8A 2Z27A 1HVXA 3W1MA 1YXDA 3MSYA 2V5CA 3W28A 1LUCB 3LGDA 4NIRA 4KMQA 3LV5A 3WUGA 3FA5A 4CCZA 2OCZA 4S3JA 1WAWA 4JR5A 2BHYA 3VK5A 3NPXA 5I3IA 1NP0A 2ZXQA 3LK6A 1ODUA 3HGRA 3I3EA 5FI8A 4RPQA 1KLZA 4ZOAA 3FAXA 4CEXC 2Z1XA 5I00A 2H8XA 2Y88A 2PODA 1RK5A 3QR0A 3RLGA 5JH1A 1V03A 3ZS4A 4FNTA 4YTRA 1TJRA 5FD0A 2AL2A 4IMFA 4C6DA 4TR9A 2QMKA 1XUUA 1KD0A 1GEHA 4YMZA 2GPTA 4J3WA 4C6MA 3P84A 4ERAA 3EOLA 4HU8A 4NX5A 1EC8A 5DCBA 2IQ0A 5M2FX 4OQVA 3W7EA 3BVJA 4ROQA 4GGHA 4AB4A 5K4XA 3UWUA 3HV9A 1MQPA 4C65A 3N2BA 2W67A 2F84A 1RY0A 3TW9A 4ADTA 1NDYA 1LF1A 1TJ2A 4UMCA 2G4JA 3C3UA 1ONRA 3TTSA 1W9UA 2NQZA 4UNLA 3V4BA 4Z42C 2VKZG 3U4AA 3OEXA 3ABZA 4PTVA 5IBXA 4GO9A 1TYGA 1F07A 1A5AA 4DJDA 1E9ZB 3V5FA 3P5YA 5C2XA 3MP5A 4J35A 5D9NA 3C8NA 5FOOA 4LWWA 4UTTA 1WPCA 4N9BA 1X97A 3IK4A 3DZ1A 1LRQA 3SSZA 2V2HA 1E55A 2Z7GA 1K8ZA 1MZHA 3NNTA 4KEMA 1V4YA 3BAXA 3BPWA 4HZ7A 1JIBA 2WOQA 1ZCOA 1I60A 2V5LA 3CWNA 1JDDA 3NIYA 4REQB 2W4XA 3V35A 1DWIM 5FF2A 4UMAA 3CM4A 5D37A 1K8CA 1JCJA 1EJXC 1A50A 4GQ0A 5I07A 1A0EA 1JGIA 4QJ3B 3WH5A 4GY1A 2FH8A 5F4WA 5BW6A 3QH2A 1GT8A 3KOZA 1LRNA 3GR7A 3WD2A 3DFSA 3O15A 3JVAA 1AMKA 4C1NA 2F61A 1TZ7A 2V3EA 4IPIA 2VQUA 2V9DA 5EKYA 3WMSA 1EXPA 1ZUAX 3GDTA 1SJAA 4X0NA 2R94A 1EHAA 2IPJA 5A8MA 5I3DA 3VD7A 2AOSA 5I02A 1A5LC 3M5XA 4IJBA 4Y96A 3VUSA 4DYJA 2GDVA 4R5EA 3P93A 3BSGA 1CBGA 2VRQA 1XGDA 3GTIA 1V6UA 1TB3A 4US6A 1BKSA 2VUNA 3GW3A 3GQYA 2OX1A 3M64A 2QJNA 4H41A 5D2XA 3VD9A 3DG7A 5D9PA 3GNDA 5K9DA 5T26A 5C6MA 1W3HA 4LAOA 1BG4A 4PBEA 4DB7A 1H7XA 1C91A 4B2DA 1S3TC 4JQ4A 2YR1A 2PWDA 4XZWA 1J0HA 2Z1KA 4IIFA 1Q8JA 3IIPA 4IL0A 4GUIA 1CWYA 7TIMA 2V5DA 1HX0A 2EG6A 4LXFA 2P3ZA 4RXFA 2AL2B 3H7RA 4QBXA 3P61A 2QQ6A 3TX9A 4G6CA 2GQAA 1LBLA 1Y65A 5HQMA 2J7FA 3IJ9A 1EKOA 2F2HA 3E0FA 4WJEA 5L6UA 1V3IA 4G1KA 4BWLC 1WDPA 1H4PA 4JL1A 2I17A 1J93A 3E0LA 1ZJHA 1LL7A 3W7OA 5DX7A 2GJXA 2NT0A 3IIXA 1EDQA 1BYDA 3PR2A 4G7EA 3NQMA 2A7PA 3VZZA 5HNUA 2ODOA 3LTSA 2BP1A 3ZM8A 1IZKA 1UWUA 3THQA 4JN8A 3VDGA 3M5YA 5HAOA 3OODA 5ENLA 2DT0A 3HG5A 5LXXA 3SW6A 9XIAA 1JCLA 4A35A 4XAPA 2QZRA 3W1NA 3CYJA 2QJHA 2HRWA 1WV2A 4RDWA 1E71M 2A79A 2VL4A 5E9XA 3W7PA 3VNMA 1JPHA 2C1HA 3B9OA 4H9ZA 5HBFA 1E6ZA 2PD5A 1KWKA 2YXOA 4ZFMA 1VRDA 1R2RA 2ICSA 4YVPA 4A3UA 5C2CA 1BXBA 1RBAA 2NVAA 4IPPA 4LS2A 4L65A 4JEQA 3DC8A 4B5WA 2V30A 4H7CA 2RDXA 2PE4A 3NYZA 2E6DA 2VCAA 2XZ7A 4E2DA 3A5FA 4GVHA 4QNWA 3EGJA 4L61A 3TJLA 4B9YA 3WH8A 1IZJA 4C1NB 3DHUA 4X9SA 1IF2A 3ME3A 4P8XA 5EY5A 1DWAM 3TIMA 3DDMA 5FESA 1THFD 3IPWA 2EJ1A 4XAFA 4L1XA 4DN1A 3W2JA 1YDYA 3PUDA 3WLKX 2OELA 4FS9A 1OFBA 2BHZA 2RGMA 3TYEA 1DIEA 2HNEA 1Q3NA 3UCQA 4Q3MA 3G1YA 1RPXA 1JAKA 1XD0A 2VJXA 3WDPP 1BYAA 3SFKA 2FJKA 4LAMA 2CBIA 3S1UA 1FA2A 4BEUA 2BXYA 1OCNA 1AW1A 4K8EA 1FBAA 4CQAA 2VM8A 3KRZA 3LI0A 4UUIA 1J11A 3M7WA 5HXMA 3MSGA 1G7UA 4H1ZA 3QW3A 1WZLA 3UR5A 2DV0A 3APGA 3GD6A 3WMLA 2V8ZA 1FX6A 1YQ2A 4HHLA 4ML4A 4D6DA 2D24A 3ZSTA 3EWBX 3QGVA 1A4LA 2X7WA 3MANA 3VIFA 4JYEA 4WXZA 1K9FA 1JYVA 1XXXA 5FF0A 1XINA 3B8SA 4HKPA 4L80A 4OT7A 3QM3A 3BK0A 1PTGA 1JNDA 3PWAA 4GX8A 2QV4A 3W53A 7PTDA 2WNWA 5LIWX 3MUY1 2PDWA 3W7IA 3CL7A 1WKFA 1GJPA 2GJXB 1G67A 3ZLFA 5A1AA 3RPDA 1JPIA 5J5DA 5RUBA 1G9HA 1OABA 2PWGA 1BGGA 3S46A 3N29A 3WLPA 3KDOA 5LNUA 4QCEA 1O6IA 1TPEA 3W25A 2W27A 5TBOA 2DW7A 5H8UA 1S5WA 4JEJA 1NVMA 4IWWA 1QK2A 2E25A 3RX3A 2X1IA 2ASHA 4UQAA 3ANVA 3TSDA 5FSEC 1D8WA 2I5QA 2OMAA 4O4VA 2ZX9A 1VRXA 3MKKA 1NFGA 4D6CA 1CB7B 1OT2A 2YLAA 3TAKA 2J24A 2ZZ7A 3HURA 4I7WA 4K7YA 1W9XA 3OW1A 4HZ6A 7A3HA 3W37A 5FCZA 3TV8A 5I3KA 4A8IA 1A5CA 2ZZ6A 1B90A 4TTUA 1PKYA 3EX6A 3AIBA 1UKQA 2H8ZA 3C2FA 1FRBA 3WFLA 4O54A 1FWTA 4PMOA 2FZNA 1V0NA 1VFSA 3CIXA 4X9YA 5KZDA 3UJ2A 1W3LA 1PX3A 1DPMA 2X1UA 3VGFA 4DBSA 3DENA 4TX6A 3W86A 3I6RA 3WLTA 3UWQA 2QDHA 4G7FA 3H21A 4PB4A 4PCNA 2Q02A 1OYCA 4J4KA 2YBVA 2Q8XA 4GABA 4LANA 3SN4A 3CK5A 5H91A 4AD1A 1SGJA 1U5JA 4KERA 4UQCA 4F0RA 3DEQA 3DN5A 1DIDA 4YN5A 4P5UA 1GZJA 4LH8A 3P60A 1PAMA 1PUDA 3WNPA 3B8UA 1AQMA 1Q2RA 4WXYA 3NVDA 1WDQA 1GKPA 3FN9A 3S8HA 4Q8WA 3PZ9A 4IPJA 2X1RA 1I2PA 3A6OA 3GNXA 3LCLA 1UMLA 3PZNA 4GY7A 1W1A1 1MNZA 2WMIB 3K5XA 2PTXA 1E5JA 2CPUA 4LX4A 5BOFA 1BXCA 1R7OA 2Z2AA 2A3EA 3TR9A 3BG3A 1TV5A 3LDVA 4JTJA 4GX9A 3Q37A 4NQ1A 1UUOA 4J7RA 3B8DA 3CTLA 3VIKA 2Y7GA 4I8YA 4EACA 3VPLA 4HSNA 3N15A 3ZLGA 3GDRA 3TLLA 3UWZA 4NJHA 1SUXA 3M0ZA 3M0IA 1E0WA 4ZR8A 1ITQA 2WCSA 2ZUVA 2VFDA 3EWYA 1FFRA 5FACA 3T40A 1MEIA 2GJNA 5AY7A 3E12A 4CQBA 4XAGA 1AA1B 3AMKA 4LUIA 4D1IA 4B5TA 4Y9MA 1PKLA 2ZZ2A 1EGVA 4UTJA 3MUCA 3FKRA 3FS2A 3UY7A 4GGBA 3EX3A 4KCTA 3RLHA 3W00A 1KGUA 4K1WA 4LS1A 4LCQA 5BU6A 3IJIA 3ABRA 1G5AA 3TNOA 1RCQA 4Q8QA 1DVJA 4I7UA 4WHBA 3BLDA 3CAQA 4KWWA 4O8RA 4HNNA 4JNMA 4JTEA 3MVTA 2FMNA 2D2HA 2VI0A 4EK7A 4R9OA 4JKLA 1SPQA 1C7SA 1EP2A 3GFXA 2WKJA 1KCKA 3SDOA 4PMJA 2VZTA 3LMYA 4JNYA 1E4MM 1AJ2A 1FWWA 3S4TA 1GVSA 3NO3A 4AY8A 2PB1A 2D23A 3UJRA 1S46A 3EWUA 4ZGYA 2AL1A 1EUNA 3REQA 3T6CA 1XYFA 2Y5JA 2DUXA 3KDNA 3OLEA 2UV8G 3QY8A 3KOFA 4PEEA 1W3JA 2VC9A 3DFHA 5A6MA 1WDRA 3WDIA 2XSXA 3MHFA 1XIMA 3QFWA 4QE1A 2Z1BA 3H2EA 1XYLA 1RA0A 4JTGA 3MV01 1HT6A 4B5SA 3S2LA 3W3OA 1RQEA 2PDLA 3L65A 4IMAA 1M7XA 1GOKA 1B4KA 1XSKA 5G4WA 1ZPTA 1P0NA 2PS2A 3L0KA 4FXJA 3WF0A 3GHRA 2BLEA 2OX4A 4Q7IA 3ZR6A 2XH4A 3ZXWA 2YZ5A 3RX4A 3OZPA 1XX1A 1IEIA 5D02A 4IX2A 3WQPA 4AEOA 4LJ3A 1U1HA 3ALFA 1A5MC 1FH7A 4MB3A 3LXBA 2XWEA 1F2JA 4AD0A 1JPMA 3B3DA 4NZ1A 2I57A 4LUJA 1HP4A 2QPXA 1K4GA 1BF6A 1YIXA 3SURA 8A3HA 4U31A 5D4YA 3TTOA 1O5KA 3H53A 1QW9A 1V6TA 1G0CA 4EAMA 3OGVA 1RV8A 3VMOA 4HN8A 2G3MA 2P0OA 1QRQA 1KGWA 4NNAA 1BTCA 2E8ZA 1LJYA 3DGBA 1LORA 2TAAA 2VHLA 1Y5WA 1CT5A 3SJ3A 4IGNA 4Q4KA 2YDAA 2ACSA 2EO7A 4GD0A 3RFAA 4DJFD 1CECA 2HPMA 5CZTA 4JXCA 1ZP4A 1V3LA 2J6XA 1GORA 1W37A 4LVAA 4PMYA 3DGRA 4HPGA 5CG7A 2YL6A 1UCWA 2ZRYA 3S2CA 3TN6A 4J28A 3RM4A 3DFPA 2ZKMX 4L6HA 3T2OA 1XBYA 1S39A 3HGOA 1UR9A 1P0DA 4A3QA 4O16A 2PP1A 1LYXA 3WMBA 5GVJA 3VILA 2NXHA 2XISA 5I24A 3R7MA 4JQ3A 2OGJA 3B0XA 2NUWA 3U0HA 4P7OA 1DIOA 3ABOA 3UR2A 3BJSA 3HPFA 5C9ZA 3KWSA 2VZSA 3CXOA 3DKJA 1M04A 4Z08A 2EHHA 4H9XA 3IJ8A 3WY1A 1OC6A 4S3KA 3SCQA 5DMYA 5FJJA 3LD5A 1W9PA 2E1WA 4YHEA 4TTGA 5XINA 2QAFA 1KRCC 2Y7FA 4UFKA 3SCNA 5KITA 1R3TA 3AJXA 4PMVA 1WXZA 2G3NA 3PAOA 4GUFA 3L67A 3RPMA 3REQB 1MRQA 4S3AA 4B4HA 3IK2A 5D8ZA 2WM1A 4TIMA 3TJIA 1G01A 4AG0A 1LQAA 1BLIA 4F0LA 1PCWA 1S5MA 4JTTA 5H1WA 3ARRA 1KBBA 3V3WA 2OGYA 3TE9A 2QV5A 4KEUA 3DUGA 1HKWA 1N8WA 4LT9A 3NG3A 2BASA 1H11A 1MI3A 2QGYA 2V3GA 3WNNA 3TNBA 4RLIA 1IEQA 3CS2A 3R0DA 1R3RA 4M81A 3LGEA 3UESA 1QPRA 3VC6A 4GMEA 3HV8A 1GYMA 3T8LA 3FVDA 3V0TA 4N02A 4R53A 2ZCGA 4R7JA 1JR1A 4MDOA 1UR8A 3G6MA 4F2BA 2BOGX 3BGGA 3GW0A 3SRHA 2VNCA 1TTQA 1UP3A 1TPUA 1TWWA 2XUCA 2DZUA 3CQIA 4ZTXA 3UEQA 1QI3A 1XC4A 3K2GA 4DWSA 1JUBA 2NLIA 1TPDA 3SFWA 1I75A 4JIHA 2B7QA 3IGSA 1YPIA 3NEVA 3QGAC 4GC4A 1FP8A 1FH8A 3M4HA 3N25A 1O94A 4AIBA 5TF0A 1IXOA 3AXKA 3NDOA 2OOGA 1XICA 5K4ZA 2OU4A 4X2RA 4C1LA 1XDJA 4H7ZA 3LHVA 2ISWA 2DIEA 4LEQA 1QVBA 4S3CA 1B3ZA 3F4VA 3MSDA 1PO9A 3TN5A 3LERA 3HJEA 2D69A 3TA9A 3GNNA 3G1SA 3QVQA 5JIPA 3MA8A 4NZ5A 3EX2A 1LOLA 1JFHA 3IS4A 3A21A 3WX7A 2JQXA 4QDMA 4UOQA 5F2IA 2JKEA 4HYRA 4DBEA 3VAVA 3MMTA 2YLLA 1AH4A 1SO3A 3M0VA 3CT2A 5DF0A 2Y63A 2P88A 4GVFA 3V1HA 4IIEA 3F2CA 3M41A 1M5WA 1DORA 2E5DA 4RNFA 1DJWA 4XO7A 5A2AA 5AN7A 4C7FA 4OWGA 1UH3A 1Q7ZA 1SFJA 3P0WA 4TOQA 3ALGA 3N9KA 4LFYA 3TLQA 4H6KA 4O0QA 3UZYA 4Z1AA 3ABXA 1ML1A 4N0RA 3WH7A 5DCDA 4AD3A 2JIWA 1REQA 2DP3A 2GWGA 4OV4A 3L4WA 5FIPA 1OHLA 4J2MA 3ARPA 1UR0A 3CJPA 1ADSA 3LLDA 1X7IA 2CKRA 3A4WA 3D5HA 4LVBA 3VC5A 1QTWA 4X63A 3POCA 1WQ5A 3PBMA 4JTAA 3RF9A 1V8EA 1RBLA 3OVGA 2H9AB 4OBSA 4JL2A 1FWBC 3RDKA 4FLQA 1KQYA 3I7RA 3UVIA 1BRLA 6PTDA 2WNQA 4BF7A 3BH4A 5AYBA 3ZR4A 3I7QA 3VGEA 2QPUA 4F9DA 4S23A 4YL2A 1Y7VA 3W75A 4FXSA 4WKHA 1J96A 4LC8A 1VHNA 4PMQA 2G96A 4O12A 1N55A 1EYWA 1Q8AA 1X8CA 4HJFA 3WEZA 5G4EA 4DWSB 3V75A 2QCNA 2Z6IA 4HZ8A 3BTNA 1K4HA 4JFWA 5K9CA 4LALA 3EAUA 4GH3A 5LGZA 5JVLA 4DUXA 3PTKA 1VCVA 1VENA 2J9ZA 3BMXA 1R2TA 3B9DA 2BFGA 4JHOA 5KMYA 4KQNA 1HFBA 2V63A 1WXYA 3R0UA 3W7DA 4PFMA 1DXFA 3VNYA 4CU8A 4YTTA 1VFFA 4MUZA 2BY2A 5AB3A 1CB2A 2WLYA 4AH7A 1PYMA 1KFLA 3OVRA 5KINA 3N3MA 1P6WA 5I3HA 4AZ7A 1VBUA 4A8NA 2PF0A 1K70A 4O14A 2PGWA 3POHA 3ECQA 4NYYA 5E5CA 2WYSA 5LXEA 2MUCA 3R89A 4FX6M 4NHVA 3HMCA 4PTDA 4FF7A 4O28A 4AZ5A 3L12A 4MMWA 4HCDA 1EPXA 2Z00A 3O6AA 2FZ9A 1KM3A 4DF1A 4IUGA 1GTEA 2ZZ3A 4QITA 4LUYA 3N6JA 3PG8A 4PB5A 4GH1A 3EEGA 4WD0A 3PBUA 4A29A 1KW1A 4LY8A 1ZJAA 1J5SA 3CZKA 1FHDA 1N8IA 4EIVA 3R10A 1XWYA 4UFLA 5I7GA 3M6YA 1RALA 3L23A 1O7AA 3HN3A 2EF9A 1HGWA 2IKHA 5DO8A 1T99A 1K6AA 3NQ6A 4MB4A 1QJWA 4JTCA 2G8ZA 3N2TA 4QJ4B 4EXQA 2Y5SA 3S1GA 1WYIA 3TYAA 5F1UA 2J62A 4ZQRA 1EIXA 4NJIA 2XH0A 3TROA 1DTNA 4FA3A 4FOUA 2YA1A 1HUVA 1ISXA 4K8HA 3SUVA 1W32A 3N04A 1F6PA 1S2AA 3B0YA 4S2CA 4A8RA 3H2FA 3NL5A 1YKWA 3E02A 1E6RA 1I1XA 2QEZA 1EOMA 3KX6A 3SCSA 3W07A 2OYMA 3WL1A 1M03A 1NAL1 4K38A 3R13A 1H7RA 4Y8FA 1IWBA 2J9YA 1I2RA 1GQKA 1ZL1A 1AMYA 2GVLA 2NSXA 1QNOA 4I6VA 2A3AA 3WEMA 3VCRA 4US5A 5HR6A 1Z41A 4TVCA 4DJDD 4ZZ9A 1PZ1A 3U4FA 3OBEA 3VNKA 4JTLA 3QZEA 2PLCA 3KRBA 4I6KA 4JQAA 1XC6A 3AS1A 1W1ZA 5G2HA 3WQDA 1VLWA 3F5KA 1HKIA 3PP7A 3UZWA 3GIYA 4HMEA 3QGKC 2V5KA 3W72A 5DMMA 4GRSA 5DFAA 3GM8A 3KLLA 4URIA 5MF5A 5HA7A 3L2LA 2Q01A 1E6QM 1SVDA 3DXIA 3GE7A 5DN1A 3G1HA 3AUJA 3C0SA 4Z2HA 2V2DA 2C1GA 1TA3A 3MI6A 2EPOA 3ITCA 3LQLA 4R7WA 2ZDRA 2G97A 5GJNA 3H2AA 1GUVA 3UW6A 1XRFA 2C91A 1MW1A 3U7VA 3C2RA 4H6RA 2OZ3A 3TQPA 1O66A 1H7OA 2Y62A 2AKZA 3BV7A 3JRKA 2ZA1A 2ZFAA 3USBA 1UZ4A 3MP4A 4A3RA 2O4MA 2GVJA 3PAJA 4LEFA 2BVDA 1KM0A 4WY0A 4Q4MA 4DJFC 1TREA 3VOCA 1RVKA 5DRIA 5C8BB 1NY1A 2B7PA 3PBWA 3WLMA 4GI4A 3NSMA 3EA2A 2CBJA 4ADSA 4XZNX 2X1SA 3FJLA 1NELA 4HIBA 1B2YA 4ZENA 4IIBA 2NV1A 3VX0A 1E70M 1ONWA 5CH9A 3CAWA 1V7AA 2YX0A 3FLUA 5CSSA 1UR3M 3W71A 1XG4A 3CIVA 4B2DD 3CLMA 1TPWA 3W85A 1ENUA 3GC5A 1ZNNA 1B4EA 3G2GA 3PTDA 3MKVA 4Y9OA 3AUOA 3VM7A 1JZ4A 3T07A 2WPGA 1XH0A 1BF2A 2B81A 3ARWA 4KW2A 3CV7A 1R47A 4R9XA 2R1PA 1V0MA 5FEPA 3BAIA 2VR2A 2VC7A 1JI2A 3KBNA 4MPKA 4GJIA 4A22A 1X1ZA 1FP9A 1IEXA 5D33A 3I4KA 1VPQA 1LROA 1V5XA 4RPPA 4B16A 1F8IA 1RJRA 3HOJA 3SCWA 1Q6QA 3NQ8A 4PN2A 3PTQA 4HA0A 4J3TA 3EOSA 2OYLA 4U5KA 2XINA 5GQBA 1PWMA 4KESA 3VIOA 2ZA2A 1JCXA 3F2DA 4C6FA 3BLEA 3FYPA 2OSYA 1JZ3A 2HS6A 2WAGA 1L6YA 1AL8A 3VNDA 1DJNA 1UJQA 3UNDA 4M24A 1V51A 4GIAA 1EJVC 2GGJA 1GHRA 1HJUA 3CAVA 1C90A 4FHAA 1CDGA 2Y8UA 1E51A 3TJ4A 1XM3A 4WSJA 4LGXA 3GC2A 1TA3B 1W1PA 2BVYA 2BXVA 5DANA 1H7NA 4AD2A 1FWSA 4AWUA 1J5TA 4FX7A 4IICA 4I90A 1ICSA 3O1NA 1OCQA 1KKOA 3GIQA 1QU4A 4NILA 3QV7A 3DBNA 4ZQCA 3NQAA 4P8UA 3R8RA 1W0MA 4FIRA 4N2YA 3UYCA 3VNJA 4FXRA 4JTFA 2E5CA 3FA4A 2CHRA 3D3AA 3PBYA 1X1NA 4WY0B 2NX9A 1TUXA 4AVNA 1VD6A 4C6QA 5BXRA 2ZYFA 4BFAA 3S42A 2WZEA 1AK5A 4MAVA 5FEZA 2MANA 2I5IA 5GNZA 1LTDA 2J25A 1VBJA 3UA4A 4Y7EA 4WR3A 2NZLA 4Q4QA 3P82A 2AMXA 2WZIA 2KX9A 4RR4A 2O9TA 5DMNA 1SZFA 3M0KA 1FWHC 3W83A 3URNA 5AC4A 3TVAA 2PRHA 3UP8A 4F8XA 1B5TA 4TXEA 2IS7A 2OOFA 3TSBA 3FV9A 1EYEA 1XDLA 4K36A 2WHKA 4W93A 3HB9A 1AW5A 1NWUA 4K2SA 2GSJA 2GWNA 4JTIA 3SJNA 4LUTA 2PDJA 2R1MA 1MSSA 2NQ5A 4QNEA 4IMEA 4M6QA 2WMGA 1J18A 1WP6A 3GH5A 3NQVA 3B9AA 3MY9A 3DH7A 1ISZA 3PFMA 1V6XA 1Q13A 4IP7A 1O12A 4IMGA 3RLUA 4FOKA 1DQXA 3OG2A 3G22A 3L68A 6XIAA 4S3EA 1PTDA 3ZIZA 2V67A 5HNRA 2V3DA 3W81A 4XKYB 3TEVA 2YW4A 4HOXA 3AFBA 1VB9A 5M03A 4N4PA 4ZB0A 4KBXA 5HMEA 2NW0A 1W1TA 3RJXA 2NSOA 1WA3A 1DWFM 1KR1A 3RM8A 5CAHA 1VFTA 2Z1VA 3FXGA 5KTLA 5E70A 1E9LA 3EX1A 5G2IA 1UR2A 3VIIA 4HPXA 3TYDA 1GVEA 3SI9A 1OM0A 3FVMA 3R8HA 4GFSA 4WF7A 5K3VA 4MM1A 2PDIA 4ATDA 4TMCA 4FNQA 3RK8A 2ACQA 1E0VA 3UVAA 4KT2A 1L2QA 4EPKA 4UNKA 1OF8A 4XO6A 4O13A 4OBRA 4WY0F 5BOOA 1QMLA 2E0PA 3A5VA 5CAKA 4AD5A 1S5VA 4RCXA 2WQDA 3P5ZA 1XG3A 2GGGA 4GYPA 3NQBA 3WLNA 4UXDA 1M01A 3I65A 3CZLA 6TAAA 5CBJA 3AOFA 3QJAA 5FJOA 5EMKA 1PB0A 3WJSA 2ZQ0A 3GKFA 5EGRA 1XYMA 4A4AA 4GIRA 5JUVA 3OYXA 3LM3A 3L4ZA 4XQ6A 1SFSA 1POKA 1RXOB 3EWCA 4V28A 5JMUA 3R2GA 3VKAA 5E0KA 4INFA 3NQEA 4PH6A 1OFDA 2FPTA 3LHUA 2Y70A 3R4IA 4JD4A 1OVDA 5I5RA 1TKKA 4DO4A 1FFQA 5U7SA 1W3IA 1TV2A 1JDFA 3W7HA 4J3SA 2CZEA 2DPEA 3UWWA 4BF9A 2Z6JA 3IIOA 4IJRA 4LNYA 3MMUA 1EF2A 5E0FA 3AXHA 3GXTA 1WKEA 2GUBA 2QUVA 2CLLA 5CJNA 4JFTA 5I79A 1W1YA 1NJJA 4MJZA 3RN6A 2Z1WA 4IMCA 2VRKA 3TTYA 5HR7A 1VEMA 3HPXA 5I03A 1PPIA 5DY2A 4DYEA 3U9IA 4MKVA 4U3AA 1AJ0A 2HK1A 4DWDA 3WEOA 4GZJA 1EJTC 5CKSA 4LUTB 4ES4A 3GS6A 4HNCA 2VC6A 3NL6A 4MSSA 1EBGA 3S6OA 2X1TA 1BTMA 1DXEA 3NPVA 3BL3A 2VDGA 3WYZA 2ONEA 2GJLA 1UH2A 1E1EA 3VGBA 3W70A 3HM7A 5JBDA 1FCVA 4PUUA 2PCEA 4JHZA 3MSRA 3PK7A 1QI2A 3WJYA 1BSIA 4LCSA 4AC7C 1I0BA 3IVTA 1XUZA 2JFEX 4W9TA 1VZWA 2VRJA 3HTWA 4DPPA 3JZUA 5A6KA 2VOMA 2PDKA 4JX6A 1AH0A 2OT0A 1RLCL 2BGNE 3ZOAA 2DZWA 1DBTA 1M53A 1DJGA 3CO4A 4ADUA 4DM1A 1F74A 2FZ8A 4S3DA 3W2KA 3VOIA 3IIVA 1N82A 3KCJA 2EBNA 2XFRA 1KTNA 2AQVA 2YFNA 2F6XA 2HXUA 2V0TA 3LSCA 5U4NA 3WK3A 4L6OA 1VR6A 2CLMA 4DJDC 3D0CA 3AMGA 2VD8A 3IARA 4EX4A 4ZA0A 2CETA 1XD1A 4PUDA 1Z7AA 1FCQA 2QUTA 4HK7A 4UTTC 1FCUA 3RX2A 2ZUUA 2GDUA 1MFUA 1RAKA 1X38A 1PVNA 3G24A 3ITLA 3B9NA 3HA1A 3NWRA 2R1NA 2DFAA 1DJHA 2OEMA 1H7WA 4DO6A 4XK2A 1JL8A 3H2CA 1R30A 4I8DA 3W6MA 3MS8A 5EL1A 3DYPA 3UXKA 5HJLA 3TH6A 4DXXA 8RUCA 3NTYA 3K30A 4J3UA 1VKFA 1H1NA 2Y85A 4B5XA 4GIEA 2WC7A 3N13A 2PWHA 1UZ1A 2HBXA 2VVNA 3AU6A 4C90A 1A5KC 3SECA 1YE4A 1JRCA 2WNZA 4EF8A 4LYRA 4W7VA 4H8HA 1O1ZA 4P7RA 4ILSA 4MY8A 3OLDA 4ENLA 3PF3A 1Y5XA 2XM2A 3K46A 2OODA 5CSYA 4NZCA 4FOJA 1TO3A 1H7PA 1GNXA 2GJRA 5CZSA 3B05A 1TV3A 1S38A 4IG2B 3NEHA 4UZUA 3QN3A 3LRLA 2PDXA 3RCMA 1UOKA 4WX2A 1A53A 1XFCA 1EJSC 3QV9A 2J27A 4O17A 4CCCA 1UIPA 2ABAA 3IJLA 1EGZA 4IIDA 1SMDA 3U2OA 5C71A 4DUVA 1W1IE 5BRPA 2CLKA 2HWGA 3E0IA 3A3HA 3BCJA 4PYSA 1R85A 4ICCX 3IEBA 1LL6A 3UCCA 4H83A 4HYWA 1YNYA 3M0XA 2O7SA 1VYRA 2FDMA 5A3HA 4IQLA 3A64A 3GFYA 3U2EA 2HTMA 2HVMA 4QS5A 2CITA 4DLFA 5HQLA 3WLHA 3GXMA 2QCCA 4YTQA 3OVPA 4KCUA 3CTTA 4AZ6A 2WC4A 3LBOA 1G7VA 4QTGA 5HQEA 1VFUA 1Q6RA 2PDPA 3PANA 1HGYA 3KTSA 3B40A 4TVUA 4MFEA 2INFA 1SO4A 2J78A 1XCWA 4C6EA 4CN4A 4KWVA 1HL9A 1OX5A 5IM51 1JQVA 2J8FA 3CH9A 3VUPA 2QCDB 3M0HA 2J7GA 1ITXA 1NWSA 4B15A 4HSOA 3UT0A 3S5ZA 3WL0A 3PPGA 2FYMA 2FTWA 1VS1A 4ZSTA 5GNYA 4JPGA 4XD4A 4F9JA 2GOKA 1BQGA 3G3MA 1E1CA 2VCBA 2Y7EA 1XLHA 3T0TA 1QWGA 4CCDA 4DLMA 3CZGA 1LLZA 1A3XA 2Z2UA 3DHPA 1U30A 2FB2A 3TUUA 3UF9A 4A6GA 4WGHA 3ZVIA 1WBJA 1FCBA 2OEJA 4GHRA 2DORA 4DJEA 4A21A 4G5DA 4I3GA 4MJMA 2RJGA 4UMBA 4W87A 4PBGA 1Z3NA 3BG9A 2Z0IA 3HMJG 2PUZA 1XRVA 3FDGA 1RP9A 1VBHA 1VCGA 1WDWA 1MWOA 3L2IA 4PA8A 2QDDA 3KOWA 2F2KA 2IPGA 3N9SA 3CMGA 1US2A 1KLYA 5BCAA 4MB1A 1K7EA 3UU0A 1XPGA 1SFLA 3G0XA 3FJ4A 1E73M 1ALDA 2BS9A 1I6NA 3QXBA 4D6GA 4MIMA 5D2VA 1A49A 2DSKA 3VIGA 2G0WA 1QT1A 1O1HA 1B0IA 4AZCA 1EGMA 4NZ4A 2EG8A 2Z4GA 4BQ5A 4XB3A 4GI8A 1O4UA 4DWSD 1EHNA 3S9IA 1PBGA 1OG6A 1VFLA 4M1RA 4JFSA 1XIFA 2WPBA 5CCZA 4GBDA 1IE7C 2YXXA 3CC1A 3QSRA 4B9ZA 2QJMA 3QQ0A 4H19A 5AKQA 3WDHA 3N34A 3TK7A 3LXCA 4ATLA 3PNUA 3K4WA 3URBA 2BX7A 5DELA 2XSBA 3AXMA 3VE9A 3LCXA 3RO6A 1XIGA 1Q6OA 1GOXA 4ZOEA 2C8NA 4MY9A 5CC5A 3QV6A 3DI0A 4DXKA 4GBUA 4D6EA 3NA8A 3O06A 4I9AA 1F3TA 1K9DA 5DBTA 4L9YA 1FWDC 5FEXA 3NL3A 3MCNA 4P61A 5HMSA 1IXPA 1LWJA 2QYGA 1J4EA 5FF7A 3HG3A 1XQKA 1XRTA 2I9EA 1O5XA 1UD5A 3CB3A 3FY1A 1GONA 5E6YA 1EEPA 2Z29A 2DT3A 1RD6A 5A8OA 4HMDA 3KWXA 4YJ5A 1M1BA 4OBTA 4XKMA 1EO5A 1HKMA 3TWAA 4FALA 2ZZ4A 1XFBA 1AD4A 3E9AA 4GVIA 5C0QA 2A7NA 4GZEA 4ZFCA 2WXDM 3AJ7A 2NT1A 4UCGA 3L5AA 1E1CB 3SGUA 4XUGA 4CD4A 1LZOA 3OQ8A 4I5XA 3G1VA 5HNTA 4JQ1A 2WWDA 1FXPA 3FSTA 3KP0A 3VCNA 4F40A 1ZENA 3QPYA 2WMKA 2XPKA 1CENA 3OYZA 3BE7A 1AW2A 4PL1A 1KXQA 1WAUA 3P8IA 2CLIA 4ZB5A 5FKYA 4LUSA 1GQLA 3GU1A 5A6AA 4E4FA 4ZXOA 4M0XA 5BXTA 5G5IA 4Z2KA 4I9JA 3CZJA 1U1JA 3NZPA 4R7OA 2D0FA 1P5BA 3QHNA 3H4XA 3G1AA 3VIPA 4CLMA 4HA4A 4NSBA 4LVFA 3GG1A 5L9FA 1QI4A 3NYDA 4BEQA 1ADOA 2J66A 1DP0A 2WKLA 3S2NA 3PN8A 3GYEA 1XLBA 1OJXA 3FA3A 4ZQPA 1UJPA 6CGTA 4TX8A 3QKZA 2OYKA 1SZEA 1LT7A 2EPNA 1JF5A 2W79A 1W6TA 1V02A 1FY6A 2PURA 3AMCA 1J9YA 2F9RA 2EPHA 3OZYA 1MEHA 2BGQA 4AZCB 3N6HA 2J75A 4KCWA 4Z2JA 4LB4A 4F2UA 4LRTA 4R3UA 4MWAA 4WK9A 4V2XA 4DY1A 2VT0A 2VMFA 4NZ3A 3WZ0E 1JZ7A 3LHWA 1ZSXA 3LQGA 3SB0A 3G18A 1OC5A 1U1UA 3BZJA 5C9RA 4QSHA 5A94A 1OIMA 4RDYA 4BY3A 4K6AA 4MJ2A 8TIMA 3TCSA 1HZYA 3E5BA 4NU7A 1BWVA 4UNIA 2GOUA 1CLXA 1DV7A 4HOZA 3LY0A 4O57A 1RQBA 4F0HA 2JBMA 3LBCA 4HCHA 4PC8A 3VOJA 1I4NA 4DAFA 1QUMA 5A8QA 1FVPA 2DIJA 3MP3A 1XLJA 4NJJA 4YHGA 3UFYA 4C6OA 1VBRA 1HKKA 5KETA 1EPVA 1OB0A 3NSXA 3ZWSA 3RLVA 1EDTA 1KM2A 3R43A 1CXKA 1AH3A 1SMAA 2DH3A 1J0JA 4Q8TA 5F4SA 4JKMA 4IPNB 3NGFA 3HF3A 2E77A 4GYKA 1YX1A 3SCTA 4FK9A 5I23A 2P1FA 4IM4A 4JKKA 5JXQA 4JYFA 4LBUA 1E4NA 1PZ3A 4UWMA 2AAAA 2XVGA 4JFUA 4L4MA 5CGMA 4DF2A 4DI8A 4H9UA 1KCZA 6REQA 2CCRA 1OYBA 5AHNA 2TRSA 3E38A 4YCOA 5EBUA 4Y6GA 1K8XA 3RJYA 1DWJM 1JG9A 1DJIA 1VLIA 4YTSA 3K4DA 1K9EA 4QROA 1PV8A 2G4FA 3IACA 3WJXA 4JFVA 5HINA 1QDSA 5EFDA 1J2BA 2AGKA 2X0SA 1UWRA 1V79A 1PIGA 4Z1DA 4LUSB 3RU6A 5F7UA 3GXNA 2CFFA 1TTPA 3G6LA 3W74A 4PMNA 3CUHA 2Z1SA 1ZBCA 1NEYA 4AU0A 5KEZA 3LA4A 5EMLA 1M9HA 4LV4A 2CBUA 3GDKA 3GR4A 1PE1A 5CC7A 1TX0A 4ALDA 4JTKA 4TU1A 1XIBA 4AF0A 2W63A 5T9BG 3TXZA 3CUXA 3MKCA 3Q2DA 3EWZA 3MHGA 1MXSA 4H2CA 5CPSA 3UCDA 4US5D 1CNVA 1Q4WA 2Z26A 3DU0A 2Y1HA 1S2CA 3TONA 1AJZA 2PGEA 3VDAA 5HDRA 1A5NC 2XFFA 4H7VA 4E6MA 1UB3A 2DQXA 1NF0A 4PRTA 5J5RA 2UWFA 4MWAB 1RBOB 3B0UX 3AALA 2OQHA 2F6KA 1R87A 2YL9A 1W2PA 4Z0JA 1EBHA 1JCNA 4JTRA 1BWKA 2XGBA 1GVQA 2ON3A 5AHFA 2PDHA 3T55A 3AHYA 3VKBA 1J12A 3K13A 2JE8A 3OB8A 1MW3A 4AMAA 5DCEA 3W1TA 3W7CA 1QO2A 4B3LA 2ZRWA 2IMRA 3VMPA 1XKYA 3AAMA 1A5BA 1QOPA 1WBHA 3VIJA 2GGEA 4U3CA 1TZ9A 4FIQA 5H8PA 4IFRA 1X7FA 3T0DA 4OV9A 5KZMA 2VEIA 1IR2A 4LVGA 3WENA 2VEMA 1QNSA 3COTA 1JCYA 1OCBA 3W01A 1E0TA 4XIMA 1NM9A 4DUWA 1NOUA 3TTEA 1RQHA 1GCYA 1K3UA 2GZXA 2WMJA 3LHYA 3RRXA 2BY3A 2J9XA 2IXVA 1QOXA 1H1ZA 3QHOA 3EPNA 3G1FA 2X40A 2VDIA 4QS6A 3OZMA 4M82A 1E56A 1OBAA 2HNHA 4DVOA 4AVFA 2J74A 1WE5A 2XIQA 1NTHA 2R82A 4KEZA 4C5ZA 3BICA 2E67A 2R24A 1RHCA 5HULA 2FMOA 2X09A 2FIQA 5BZAA 3GK0A 4UQDA 5C2GA 2FHFA 1LG1A 1GQJA 1JJKA 5A95A 1W8GA 3M46A 2WHLA 1L0PA 4JTUA 4GIYA 1T7LA 1VFHA 3VM5A 3IANA 2CXEA 2DEPA 1GVRA 2WANA 1GW9A 3M16A 1UD2A 3QMRA 4PODA 2CHOA 2VFGA 3WQWA 3BAJA 3C0LA 4LS0A 3WQ8A 3L9CA 2BZNA 1S1RA 3LV6A 4AF0B 1WNOA 1AQ0A 5CSRA 4W84A 1JZ5A 4AYSA 4EKJA 2TMDA 5FL1A 4PTWA 1HTIA 1WDDA 1UMYA 2WCAA 4YS1A 1GOOA 2YCLA 1QHOA 2OSXA 1XPYA 1H63A 2NWSA 4R34A 1OX4A 2HJPA 1NOWA 5D9OA 2QF7A 2E9LA 1QW7A 3L4UA 3MI2A 1TWDA 4MFDA 1F4AA 2E68A 1OZQA 4ERGA 4O15A 3SY1A 2OFJA 1W3TA 1X8FA 4HPJA 1T40A 5A6TC 1C8YA 4PR4A 3GVWA 3GHTA 3HG2A 5IFPA 4L4OA 4ZO7A 4PZVA 3STPA 1QHZA 2WBKA 3P0XA 1WCGA 4ZOCA 2PCQA 4UFHA 1JCMP 4DWSC 5IRPA 4L4LA 5ECUA 2F8QA 2ZADA 3W7JA 3LS9A 4LRSA 2G37A 4KF1A 2X30A 3AI0A 4P8VA 3UWVA 3KEHA 4CNSA 3VDCA 5D32A 5I09A 3BAKA 4GVGA 3N4AA 1R3VA 4CEUC 5KZEA 4U28A 2DQWA 1W5OA 4H8VA 3WJWA 3HGJA 4MAZA 2JIEA 3OHIA 4P7LA 3DFTA 3GVRA 1E4IA 3HQPA 5ABFA 2AGTA 1KM5A 2DJLA 4X2PA 4YPJA 2EKGA 3A13A 2X7VA 4N9CA 1RLDA 2RHGA 4V1YA 3TXVA 1QI0A 4J9JA 3WQVA 1JAEA 4OECA 2D73A 5CLTA 5FJUA 1M68A 4Y9AA 2XIOA 4FMVA 4UTMA 4GCAA 1DL3A 1NWRA 2CWNA 4NJGA 1NP2A 2PDFA 2A0NA 3K4AA 4QISA 4ZODA 1OWQA 2QCGA 1VFOA 3WF2A 1ZQ5A 1S5NA 4BQ2A 3FFSA 3H2MA 3GAKA 4WJXA 3R8GA 2ZX7A 1CX9A 2E9MA 1VEOA 2CW6A 3MJMA 5CPLA 1TSIA 5DEZA 4OFCA 1HKVA 1D9EA 2ZA3A 3QFEA 4QM1A 1BFNA 2EEXA 2PWFA 4QHRA 2FKPA 3UXDA 4TQTA 4F0SA 4OOUA 2XVNA 1F73A 1JYWA 3WNLA 3UETA 4QAIA 4GI6A 2DZPA 4CQ9A 1KXTA 3W29A 3S5SA 1RJPA 3GKAA 3QKEA 3LYEA 1SW0A 3PZGA 1SM9A 1P6CA 3W87A 1EFZA 1LDCA 2YL8A 5LGXA 1U5VA 5DLCA 4IT1A 3I10A 3SADA 3S1WA 2C79A 4H00A 3S9YA 4OUEA 4BI5A 4K3ZA 4MLJA 4C1KA 2QUUA 4KETA 3PZQA 1E3XA 5A8NA 4Q4PA 3C2EA 1TCMA 2BWGA 3OQEA 5IDZA 5CEWA 2FZBA 3PULA 3Q4DA 4GUHA 2Q6ZA 1VHCA 4NKCA 1SJBA 2E09A 1VJSA 2YCLB 4I9TA 3DIPA 1NDZA 2OLAA 2OWXA 1BD0A 3GG0A 2NV9A 3AMLA 4AUBA 1FHUA 4XVDA 3PBGA 2HK0A 2VEGA 2Y6ZA 1OK4A 2EPKX 2PDNA 2FGBA 4WZHA 1JZ6A 1UC4A 5TAOA 4O8AA 4AY7A 3F4WA 2WHJA 2ZZ5A 2C19A 3BOLA 2PSNA 2GK1A 5CJ5A 3APYA 4M8UA 6XIMA 3DKLA 4L56A 3LN3A 3I68A 4QEHA 3LCFA 3V1PA 1G4TA 4CNOA 1IHIA 2QVNA 1F7BA 5E93A 2G50A 4JIQA 4E3VA 4K1GA 5E6ZA 3EDDA 3RYSA 4JDYA 4RK8A 3WQGA 1ZU8A 2DVTA 1DYSA 1L8PA 2I1OA 4B5NA 3TKFA 4CU6A 3GVGA 2ZRVA 3QRHA 2QJGA 3VTRA 1Z48A 4MYXA 1CEOA 4E2OA 5ABFB 3CV6A 4HSHA 1CPUA 1WZMA 3H70A 3ZO9A 3DFOA 4PUEA 4IZGA 1JULA 4X0VA 3BCFA 4UR7A 5CG0A 3T08A 2GSEA 3LRKA 4W7WA 1DJYA 4AZBA 5AC7A 3AZRA 2I7GA 3VO0A 4DEFA 3W4RA 4XTDA 3NXLA 1OFRA 3W26A 2HMCA 2CEQA 4GJJA 3B0VC 5BWFA 4XISA 1FWJC 2PU0A 1MXGA 3OHMB 1QFEA 1TR9A 2WK2A 3TCEA 3RPTA 5A8GA 4L4PA 1F6YA 3MT1A 3OBKA 3ARUA 4CCEA 1FHVA 4QE5A 1GGOA 4MGGA 4GNJA 2Y2WA 1IT7A 3ATYA 1OT1A 4S1FA 1VYSX 3KVKA 4LF1A 3G3DA 3BOFA 6ALDA 1IT8A 2NUXA 4RX0A 3RIKA 2SFPA 2OZ0A 1XBXA 3W22A 2VX7A 3N17A 3E2QA 8XIAA 1AFSA 3BURA 2CLHA 3I3BA 1ONEA 3GVVA 1KM6A 3UJFA 4ROPA 1YE6A 2CZ5A 4QIUA 4X22A 3CHCA 5M17A 5ABGA 3EWXA 4E8DA 3AO0A 4DELA 4NY2A 3WNMA 3A47A 5CXPA 1E43A 1V6VA 4NG3A 1HNYA 3P14A 3HIJA 2GLKA 1TRIA 4XZ9A 4YVXA 2ZUMA 4NX0A 3PWIA 5BXSA 1YBQA 1W9VA 4HNVA 3WD3A 3CL6A 3CZEA 1WO2A 2FVKA 1E6NA 1IWPA 2DGAA 3R58A 2FH6A 1HJVA 1TJ1A 1YTKA 1Z42A 1SJDA 3O8AA 3LSBA 1VJZA 1HO1A 4Z2GA 4IGMA 3GLCA 4G7EB 3RR4A 3WQOA 1KFWA 3WCZA 2GK1B 2QMJA 1F9CA 3N18A 1MZRA 4DPQA 3VMNA 4PGLA 3O6DA 2ZIDA 4QXIA 3CUGA 2YFOA 2A3CA 3OGSA 2BMBA 3W84A 4Z1YA 3T1GA 3DFYA 1UQYA 1OY0A 3WLSA 3NPUA 1UWTA 1VC4A 4RNIA 2C0AA 1NSJA 2PTWA 1TJ0A 3LM7A 4Y8EA 3ZT7A 1GG1A 3LLFA 2R14A 3V18A 4A2SA 3GDMA 9XIMA 1J01A 2G95A 3MDWA 1RVGA 2PU1A 3KZSA 1LP6A 4QDPA 1DJZA 4XD5A 2J79A 4JICA 4OHQA 2XSAA 2EGZA 4DUOA 4ZTYA 4GXMA 3W88A 2ISDA 4MG4A 3E1F1 3AXIA 2NQHA 3M0LA 1J0KA 1UWIA 4ACYA 1D3GA 3E5PA 3W2LA 4A05A 3MCMA 3W9ZA 2XIBA 1KFKA 4Q7BA 1ZRQA 2DSWA 4MLRA 2PF8A 4RW3A 1KWGA 2IQDA 3P67A 4GWEA 2FTPA 1E3ZA 2W62A 1P7TA 4ZEPA 4GACA 5ABEA 3SIMA 3T9PA 1PEZA 3QMSA 4NF7A 1TVLA 2VO5A 2JF6A 3BLKA 4J3XA 1OIFA 2DZAA 2E5BA 4L7ZA 3R5EA 3FYYA 3ZT5A 1AD1A 3DHDA 3GR8A 1CI1A 1DOSA 3TZFA 3W1LA 5D2YA 1WUEA 2O56A 4QAWA 1PHWA 1WZKA 3DG3A 3UJEA 4OTKA 2J7CA 1XF0A 3VINA 3WD4A 3M9YA 3HU7A 3VYLA 5K2ZA 3WIJA 1D7KA 4Q8VA 2GDQA 1XYCA 4S3FA 2CKSA 4O53A 1SO5A 4HYVA 3QV8A 4NAFA 1I0DA 1SJCA 2DZBA 3O0KA 3R25A 2ZUTA 4DBWA 4GKLA 1VQTA 4AXNA 3NQ7A 3ZWTA 4KFOA 3VKKA 5D2WA 3LBMA 4PTXA 1BQCA 1YBQB 5AHLA 1QWKA 7CGTA 4XBJA 2NQ9A 4ZSUA 4LNCA 4MUPA 3SEPA 2D2OA 1T6MA 4FF5A 1QHPA 5AOUA 3WLLA 1ISWA 2X05A 1RCXB 2QCFA 3QY7A 3N2CA 3SUWA 2CLPA 2ZBTA 5AYYA 1A5UA 3FDKA 2ZUWA 2E40A 1WOAA 4MZYA 2XN1A 3VCCA 3K8KA 1HL8A 4DZAA 4IFKA 2ANUA 4PUMA 1LL4A 3EMZA 1XLLA 2PTYA 3S6DA 2OG9A 4IGSA 1KGXA 1XBZA 1S2UA 3WQFA 1H3GA 1E40A 1TV8A 1MQQA 5G1YA 3EA3A 2J4GA 2C71A 3IAQA 2TPSA 2YJQA 4POCA 4MY1A 2QPSA 4S38A 2D3NA 3MPGA 4DJED 4C5YA 1W17A 1Q6CA 3T0AA 4D2JA 2D20A 4WSHA 5CBBA 2FLIA 3HJZA 2R9RA 1XKJA 3STCA 2XGIA 3O05A 4J3ZA 1WZAA 3ARYA 4HMNA 4S3BA 4UCFA 4DZHA 2ZTJA 1AG1O 1P0EA 2NLYA 2GQ8A 4BK9A 3FCPA 1L6SA 1DWGM 2Y8KA 3H4WA 5JU6A 3LPOA 1MXDA 4CD5A 3NQGA 3EKGA 4IXXA 1EB3A 4PMUA 2C6QA 3W1RA 1YYAA 4C6PA 1ME7A 1UKSA 3PG9A 2PBOA 1SZNA 4OKDA 3EXSA 1P7TB 4B92A 2ISSA 2OLHA 2WVUA 3OOQA 3ZLHA 3WBAA 1Z89A 3T44A 2DIKA 2QCEA 3T7VA 1CZ1A 1JFXA 3RXZA 1R86A 3FOKA 4W5ZA 4M3PA 1RCOB 4MOZA 1B57A 3JZEA 3O0FA 5H6HA 4O19A 4ZB2A 4BQ4A 3P2VA 3BW2A 3UG5A 1VPYA 1XIIA 2ZWYA 2V3FA 2VGGA 1EJRC 3ZQ9A 3CO8A 3L66A 3C2OA 1XLFA 4LQ1A 4GQGA 3ITVA 1XL9A 4BCEA 3GTFA 4QG8A 2PDUA 4CD8A 5I3JA 4GNKB 3FYOA 5LA0A 3NOYA 1SO6A 3AC0A 3WF1A 5FEWA 1CGXA 2FPVA 1CLVA 2WLZA 4C91A 1F3WA 1K77A 4NAFB 5LA1A 2XH7A 4H4IA 4IQDA 4GXWA 3C5QA 4L1GA 2CHNA 1T96A 3WKZA 1OD8A 3B06A 3QYSA 2P0IA 3WFZA 1GVIA 3EXRA 3RCNA 3TQKA 2V2CA 4IH3A 2X2YA 3SN1A 3RGTA 1BYCA 3NO1A 4O4WA 2DUZA 4O11A 1E15A 2YPIA 2HROA 4HTYA 4B4FA 3PFRA 4K37A 3NXFA 1WKDA 4KEVA 3C0JA 3CAKA 2YCEA 3HFYA 4BF5A 1ISYA 1HIZA 2YW3A 1M7OA 3OBAA 1E4LA 3GBEA 4IFKB 2RAGA 1A0CA 1FWNA 1PJ9A 4WDWA 4HK5A 5FAJA 1OGGA 5EA9A 1ME8A 2EPMX 4QP0A 3NOEA 3ARVA 3ONBA 2PD9A 3H26A 1TPH1 3C6CA 3PJXA 3VI2A 3O3RA 4GI9A 1XR2A 4FLOA 4GG9A 4NXKA 3RU8X 1XSIA 1KM1A 4HZMA 5FF4A 3CHVA 3G8EA 1PKNA 2W9MA 5FJPA 1K8YA 1KTCA 4GYPC 1LM1A 2Q71A 1I2QA 1L8NA 5BMWA 3QLLA 4WDTA 5C7HA 3BLIA 5D38A 3RRAA 4XIAA 2PAJA 3OA5A 4R33A 2WVVA 1R8LA 4X61A 4PMXA 3HFTA 2QJIA 4F3HA 4HHHA 3WBYA 3S5NA 3W7KA 2ZUSA 3UPWA 2YSWA 4KRUA 3L5LA 3VABA 3LHZA 5AYIA 5BRQA 3G1XA 3AWNA 2DDXA 2DSVA 3B04A 3EXTA 2I16A 3W7NA 2VGIA 3DAQA 3V0UA 1GYNA 1EIBA 2O7QA 2RUSA 4PSRA 4MWAD 5G4HC 3UZXA 4H6QA 2WMFA 1GZGA 5IDIA 4B90A 1QXLA 1F61A 1AQFA 3B8IA 4DNHA 3S5YA 4E2BA 2Y8VA 2W91A 1IGSA 2GGHA 4J5NA 4R85A 1R3QA 4FI4A 4JTHA 3VE7A 4N4QA 3DOPA 3W1AA 3R94A 3D46A 4M6VA 5I06A 1UBSA 3HQNA 3UPBA 3WDQA 2J8GA 4YU1A 1LBFA 4E5TA 3KBVA 5B7ZA 3L4TA 5AVNA 3T4CA 3OTRA 3CV1A 2CESA 2JKPA 1UWQA 1CXIA 1R38A 1GVOA 2C15A 2D2JA 3OZOA 2VWTA 3P7YA 4QEEA 3R12A 1TELA 4F2TA 2Q09A 4I9MA 4Q32A 5TNVA 1EX5A 3SQMA 2WSYA 2PRLA 3PSWA 1V3HA 2A3BA 3WN6A 2XN2A 3Q67A 1IXNA 4IF2A 2Y4SA 3SZ8A 1PYFA 4GJ1A 2FDSA 3NL2A 3TC3A 2VFFA 8CGTA 3JW7A 2DU2A 3CMFA 1F8MA 2XIIA 2VDHA 3QSTA 1Q63A 5M3WA 1GW1A 4HNUA 2QNEA 3AZTA 3LRMA 1EJUC 4L64A 3EKZA 3RITA 5LNWA 2QIIA 3I6EA 2BNJA 3OG3A 3KTCA 3H6OA 4XSMA 1QPOA 4JGDA 3RAOA 3WG6A 1GWJA 2BG5A 3GH7A 4PUNA 3UQNA 4TV6A 3KBWA 4AAJA 1PX4A 2UY5A 3F5JA 5T9CE 4OJYA 3NQCA 2OZ8A 2YIHA 4L9ZA 4LV9A 1RUSA 3UR8A 2OJPA 3VA8A 3HO8A 1CCWB 4B5VA 2EAWA 3ARQA 1J79A 4LF2A 1CLKA 4JY8A 3UBPC 3O7UA 4X60A 2XM1A 2XVKA 2WZMA 2Y0FA 2ZC8A 1R0MA 1O5RA 1QOQA 4ORMA 2VELA 4HHMA 3THCA 1GJWA 4FX8A 2W92A 2WM0A 1MUMA 2WVVB 4DBUA 2XJ7A 3GDLA 2FVLA 3RILA 1TVPA 5C9XA 7TAAA 5HWJA 1OSEA 1GTHA 1PX8A 5LYRA 4PTNA 4WEVX 2FHBA 4LAUA 1MEWA 4UB9A 5CPMA 3NZ1A 3UZJA 1SR9A 1KBIA 5HJXA 4JDBA 3UD6A 5AZ1A 1SZGA 1KRAC 1UBPC 1PCKA 4RE4A 3IUIA 3FW6A 2A21A 1JZ8A 3SRDA 2WJDA 1XH1A 3DHFA 4M51A 5F4XA 2DZVA 3NDZA 4MDPA 2ZRUA 3EX4A 4AZHA 3IGUA 4MNMA 5MKGA 1TWIA 1NQ6A 3OIHA 3RG6A 5AHMA 2CXGA 3VVGA 3CEPA 4PL2A 4NRSA 3LZ5A 4BI7A 1LOQA 3V5OA 1JD9A 2PZNA 4JN7A 1OX6A