4HZ7A

Crystal structure of bglb with glucose
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-glucosidase
publication title Structural insights into the substrate recognition properties of beta-glucosidase.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 173
structure length 441
sequence length 441
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hz7A00
2WVTA 1E3ZA 4WK9A 1UWIA 4JKLA 4URIA 1XHGA 2CESA 1WCGA 2YDQA 1KR1A 2WANA 3SCWA 2JEQA 2ZXQA 2F8QA 2ZE0A 2DIJA 1CTNA 4P8UA 3WQVA 2W5FA 3BSHA 3SUVA 2XSBA 1HF6A 4AZ6A 1LG2A 3VD5A 3AIRA 1TG7A 3CZ8A 3BC9A 4MNMA 3VNYA 1E6PA 1HL9A 1ZL1A 3AS0A 4EAMA 3ARYA 5BCAA 3O6AA 3CUHA 2VX7A 2VQUA 1CPUA 3AMCA 3ZSTA 4TXEA 3WNMA 3OLDA 1SFSA 2YL9A 3LPGA 2F61A 4A3HA 1QW8A 4Z2JA 1UOKA 2BV9A 2NW0A 4H8HA 1GOIA 1NP2A 4P7OA 4EANA 4U5IA 1V0LA 2YA0A 1E6SM 1VRXA 1E40A 4H7VA 3N13A 2YDRA 2XFYA 1W9DM 4W7WA 3PZTA 3AMLA 1ODZA 1OGSA 4J27A 2WPGA 2E0PA 2YL8A 5C70A 2W4XA 3W27A 5GNYA 2WM0A 4XZWA 4RE3A 1W3JA 4A4AA 1MVYA 3N9KA 2XIBA 1VAHA 2WW5A 3WF2A 4UOQA 1WKYA 1OT2A 1XYFA 5BRPA 2EPOA 4E8CA 2DPEA 3N15A 4X9YA 1GVIA 4M29A 2NT1A 1E55A 1PIGA 3DYOA 3RMEA 3WH9A 2JF6A 1BG4A 1M01A 4Y7EA 4FLOA 2WC7A 3BCFA 1V3IA 3IAPA 4U31A 1JNDA 2PBGA 4N0RA 4N42A 4D6EA 4CVWA 1FP8A 5CSUA 4HTYA 2WYSA 4CCCA 4DWSA 1EH9A 5A6KA 1R85A 1MW0A 3PZQA 4F9JA 3ZJKA 2BHUA 3APGA 1HJWA 5FL0A 4C7FA 1XH0A 2D22A 4DWSB 1SMDA 1K9EA 3VIPA 1MQRA 3W53A 1E15A 1SMAA 4AIOA 3AIWA 2EXOA 2J78A 4WIWA 1WNOA 3U7BA 1ISWA 1V6UA 3WH6A 1NH6A 1UD6A 1GOKA 2WNWA 4PUEA 1K9TA 1E9LA 4J7RA 1KWGA 1JI2A 1VF8A 3U5UA 1HP5A 2BY3A 3BAWA 1E71M 2FH6A 1JYWA 2QMKA 5I23A 4W7VA 1WZMA 1KXVA 2CCRA 2XFFA 4F66A 3AIUA 4PMQA 1E73M 2DT1A 2VTFA 4UFHA 3RCNA 4Z2LA 2WSKA 4P7NA 1GVYA 1BSIA 1H11A 4PTWA 2EBNA 2ZXBA 4JCMA 4LPCA 1H0IA 3KL3A 3ZO9A 5AYBA 4TVDA 1OSEA 1UR2A 4JHZA 4HZ6A 3AMGA 3AISA 4P8WA 2JF7A 1G9HA 2BHZA 1EOMA 2PB1A 4LXFA 1KFWA 3AXXA 1G0CA 3RM8A 3ALGA 5AYIA 5CSYA 2QHAA 4D6HA 3L4YA 2EPNA 4F79A 3WDJA 1G01A 4IUGA 5C71A 3VPLA 1CNVA 2BY0A 1OGGA 1WE5A 5DT5A 2W91A 1W91A 1GOMA 2J25A 2X0YA 3WELA 3W6LA 4LYPA 4CU8A 1C7SA 3VDCA 3SCPA 2BVDA 1UA7A 2NT0A 3NSNA 1E4IA 1GJUA 1QVBA 1MFVA 5ECUA 2E9BA 3W4RA 4AZCB 1KGUA 1QBBA 3L4VA 1M04A 4Q7NA 4D6IA 2OYKA 4AY1A 5A2BA 1BFNA 1C91A 4UQ9A 4UTFA 3I3DA 4MB4A 2OLHA 5D9MA 2ZXAA 5A6MA 4NI3A 1JF5A 2D24A 3PZOA 3IAQA 2V3EA 5EBAA 2PWGA 4P8XA 3WSUA 1GHRA 4HZ8A 2ZUNA 4W88A 1IV8A 2EO7A 2J7DA 2XVKA 5E9AA 1B90A 2RGLA 3SEPA 5BXPA 1UZ1A 2X05A 4W5UA 3SCVA 1W3KA 3CO4A 1FFRA 2J7BA 3SUWA 1UUQA 1B0IA 4HP5A 5AY7A 2WXDM 3GYCA 2J79A 4KRUA 4X0VA 3VDBA 1DWFM 1V3HA 3SCQA 1UH2A 1O7AA 5FD0A 1E1FA 3ZQ9A 3PN8A 1OB0A 3D5HA 1ZJBA 3ECQA 3VX1A 1VB9A 4OUEA 3AOFA 1Y7VA 4WKAA 1HKIA 4JFWA 3RILA 1HXJA 1TR1A 2A3BA 1E4LA 1GHSA 2O9TA 5BRQA 3WF3A 3J7HA 1JGIA 1QNSA 5GNXA 4UFKA 4LX4A 4HMEA 1XV8A 3U5YA 3AHZA 3OA5A 5CLTA 3N04A 3F4VA 3M7SA 1C90A 3WMSA 2CNCA 4FMVA 1TA3A 2WMIA 3M07A 3NUKA 1KWKA 2JIWA 2EPLX 2HISA 3BAXA 4D6GA 2WBKA 1TA3B 3A4XA 3VD4A 3QOMA 2WMIB 3ARRA 1E72M 1NQ6A 5D8WA 4MTVA 4RL3A 1SYTA 5EFFA 4AZ7A 3BAKA 3CUJA 4PN2A 4HPHA 2ESCA 2VJXA 1CXEA 1JZ3A 1DP0A 5BXTA 3PZ9A 1J0YA 1HL8A 4Z2GA 1V6VA 1ISZA 3G6LA 4CU7A 3CTTA 2UY5A 1GNXA 5A1AA 1WDSA 2G3IA 4M24A 3EYPA 3KL5A 5A6JA 3TA9A 2J7CA 4PUDA 2ZWZA 4OIFA 5FOOA 2AMGA 5I77A 3DC0A 4E8DA 3W24A 1HIZA 2YOCA 2QPUA 3KZSA 1H41A 4H04A 4M80A 1JZ5A 2EPKX 3W37A 4IISA 2ZUVA 4MJ2A 4JAWA 1MW3A 3WUEA 2MANA 3L4XA 1D2KA 1XH1A 4E4PA 2UY2A 1OINA 4NRRA 3T2PA 1BF2A 1HNYA 1NOFA 5AC4A 4OZOA 3B9DA 3ZT7A 2DSUA 2UWFA 3SIMA 5JBDA 4XB3A 5DEZA 5BROA 3EBVA 3AYSA 4D6CA 4TTUA 2OWCA 3SCNA 1OIMA 5A8PA 2FGLA 4MNJA 3N11A 3WBAA 4KH2A 2BXYA 1QHPA 2WZIA 3L2MA 2VCAA 3OGSA 1Z32X 1GQIA 4U3CA 4CVUA 1L0PA 1FHDA 4PMRA 1VBRA 4W87A 1BG9A 1V3LA 3WY1A 3AROA 3EDKA 3GZAA 3BAJA 4BQ5A 2E9MA 2E8ZA 4W84A 2GJRA 3OG2A 2D3LA 3AXIA 5CQ1A 3WQ5A 2W61A 1C93A 4MNLA 1EIBA 3ZJ6A 1I1XA 2FHCA 1W1VA 3PHAA 2HVMA 4EKJA 3ARVA 1FA2A 3CGTA 4CD6A 1UD4A 3WL1A 1J0HA 3POCA 1H49A 3WEZA 2DSVA 2VZTA 1QHZA 1V03A 2Z1KA 4HZ7A 4MPKA 3ALFA 3ZSSA 3VIJA 3ARQA 4TX6A 3WIJA 1JG9A 2XG9A 3A3HA 2YL6A 1JXKA 4NRSA 2Z1SA 3MMDA 3WDPP 1OGBA 1VFUA 4R5EA 2GFTA 1V0NA 4GKLA 2VMFA 1BYCA 3DHPA 1RD6A 3W81A 3E1F1 3GNOA 4ATDA 1E4NA 2VT0A 3AIVA 2VURA 2GK1A 2JALA 5A2AA 4U2ZA 4W8BA 1ZBKA 3SUUA 3VIOA 1E0VA 3TONA 4UQEA 2VVNA 3UR7A 3O9NA 2FHBA 2GK1B 3VU2A 3WNPA 4PTXA 4WSJA 2YIHA 5ABHA 4JHOA 5A6AA 2PC8A 2D0HA 2DSWA 3FNDA 3BLPX 3VGHA 3WH8A 5IFTA 1B31A 2GJXA 3CHFA 2O9OA 1JYXA 3MANA 3SCOA 3UCQA 4AZIA 2WHMA 3AMDA 3AICA 2CKRA 1E70M 1M03A 2WWDA 4MJ4A 2DSKA 5BXSA 3DECA 4F9DA 2VUYA 2Y8KA 2GJXB 1JAKA 3ZT6A 1R87A 1UKQA 4ZXLA 1JDCA 4HA4A 3VIFA 1BQCA 4AISA 1W9XA 4JL2A 3UG3A 4PMZA 1RP8A 2YL5A 3AZSA 4UFLA 1E0WA 2DIEA 3VO0A 2Y5EA 3QHNA 2V3FA 1FH8A 3SURA 3HJEA 1PIFA 3ZT5A 4C7DA 1NWTA 3AYRA 2FH8A 1AVAA 3OLEA 3CHEA 2VX4A 3GXDA 1HVXA 3BCDA 3WD1A 4FLQA 3VTRA 3RJXA 4YHGA 3NSXA 3PZGA 1MW2A 3WEOA 3WD4A 3OLGA 4MB1A 3NSMA 1U30A 2DEPA 1EGZA 4DUVA 2UY3A 4PMVA 4PMNA 4UQCA 1W3HA 2OWXA 3AMKA 2X0HA 1QW9A 3WUBA 3WKZA 2W63A 2BFGA 3OZPA 4W7UA 4ZEPA 3CZJA 5BYWA 4PTVA 3WH7A 5ABEA 2JE8A 4ZE5A 3VM7A 1UKPA 3ARSA 1EDQA 4UNIA 1KGXA 3CZGA 2DH3A 2XVLA 2PWEA 4WKFA 1E5NA 4TVUA 5JUVA 5IHRA 3GXIA 2V38A 1Q6DA 1QI5A 1X6NA 2YLLA 1WAWA 3BMVA 3OGVA 2W62A 3L4WA 1RP9A 2WHLA 2VC9A 5CJ5A 1J18A 3QHMA 1KXTA 4NZCA 1J0KA 4JL1A 4HMCA 1UR4A 4OOZA 2CEQA 1WDQA 4ML4A 4KWUA 1P6WA 2OWWA 1KCLA 4H8UA 3K1DA 2QF8A 3W25A 1CZ1A 2UY4A 3PBGA 4UQDA 3F5LA 1HJVA 3I3EA 4DUWA 2XGBA 3WDRA 4QDMA 3QGVA 2BNJA 1GJWA 8CGTA 4CD7A 1CIUA 4Z2HA 1J0IA 2ZUSA 1WPCA 4MAVA 1VFOA 3VGDA 2ZX6A 3RM4A 2CBIA 2G4FA 1I75A 1JD9A 1ZS2A 3L4UA 1JNEA 2IXUA 2WLYA 1J01A 1NOUA 5FKYA 2Y24A 1CXLA 5DF0A 3F5JA 4TTGA 1ZJAA 5BWFA 2X1IA 3PZVA 5FCZA 2G3MA 2VZSA 1SR0A 4BCEA 4GZJA 4LYQA 3SCSA 3VX0A 1C8XA 4YPJA 5FL1A 2J7HA 1XSKA 4P7RA 1E4MM 5JBFA 1QI3A 1CXKA 2WMFA 3WNKA 3W0KA 1IT0A 1B3XA 3WL0A 5IFPA 2V3GA 3THDA 7CGTA 2OSXA 4GZIA 3GH7A 4H41A 3VIKA 2A3AA 2FDMA 3N17A 1VIWA 1JF6A 2VOTA 1HJSA 5LYRA 1JAEA 1ZBWA 1KCKA 4WJXA 1YHTA 4AZBA 5E6YA 1HKKA 1UKTA 2VCBA 1H09A 2DT3A 3AFBA 1E6XM 2WMKA 5JBEA 3W82A 1UG6A 5JIPA 1L8NA 2ZX7A 5GNZA 4AEFA 4BF7A 2WZEA 1QNOA 5D9NA 4CD4A 1AQHA 3ARZA 3VINA 3WN6A 1PJ9A 1GCYA 4W85A 4CCEA 4ZXOA 1H0GA 2PF0A 4PCTA 2J8FA 2JIEA 1LL6A 3WDIA 3LPOA 3NCOA 1KQYA 2IUZA 5KEZA 1V6YA 3CLWA 1XH2A 4HA3A 1BAGA 2E9LA 3UERA 4RE4A 3WQWA 2W66A 4P8VA 4M82A 2VRKA 2CERA 4OJYA 2WVUA 3MU7A 3HMCA 4GINA 2GVYA 1B30A 4AC1X 1NP0A 4M56A 2F2HA 2XGIA 1Q4NX 2ZUWA 4AIUA 3EDEA 1GQLA 3VDHA 4UCFA 3TP4A 2WB5A 5CPTA 4P7LA 4XV0A 1HKJA 4AZHA 1QI2A 2ZX9A 2V3DA 3GXMA 2YJQA 1B3ZA 4HOXA 1MW1A 3PZNA 3W38A 3A4WA 3IK2A 3W26A 3EMZA 1CXFA 2XFRA 3VGEA 1XGZA 3AS2A 4GI6A 1RH9A 4S3JA 2G8ZA 4GO9A 1UR8A 2WCSA 1LL7A 1K9DA 1NOWA 1ISYA 2E8YA 2G3NA 4J3XA 4BA0A 4V2XA 1HVQA 3CZEA 3MUAA 3BXWA 1ZB5A 2ZOXA 4UFIA 1US2A 1UR0A 1BYAA 3AJ7A 2J7EA 3AHXA 1AMYA 3ZMRA 3MSGA 3N1AA 4CUCA 4UR9A 1ODUA 5CPQA 3D3AA 3VGFA 4MNKA 3BSGA 1KBBA 1ISVA 4UZUA 1UH4A 4D6JA 3ZJ7A 2WCGA 4HMDA 4GIAA 4QLKA 2VZOA 1QBAA 1H4PA 1DWIM 5I5RA 3GDBA 3UG4A 5DO8A 4W8AA 4YN5A 2EPMX 2VX5A 4HPGA 3S2CA 4B9ZA 1MQQA 4OOUA 2O9PA 3UR8A 5IXEA 5A6SA 2O92A 2WBGA 5A6BD 2E4TA 1V0KA 2FHFA 1U2YA 1JD7A 1UYQA 5HNNA 4CGTA 4M1RA 4BZYA 1CGUA 4ATWA 2CYGA 1UA3A 2VL4A 2V5DA 1QI4A 1JZ7A 3B9EA 2XVGA 4AW7A 2BY2A 4JKMA 1TCMA 4D71A 4OKDA 4AMCA 1NWSA 2J7FA 1X6LA 5CG0A 4J3SA 2OSWA 3W28A 3TTOA 1O6IA 3FN9A 1FHLA 1XSIA 2XM1A 3WH5A 1UWSA 2D0FA 5A3HA 3AZTA 1B3YA 3CHDA 1A3HA 1UR1A 3FW6A 4GQRA 4TOQA 3K4AA 2YKKA 4HU0A 3KL0A 1B1YA 4U2YA 3WFZA 1ZBCA 1UZ4A 1C8QA 1DWHM 4MDOA 2AAAA 2OYMA 1R7OA 1UD5A 3MS8A 2D0GA 1J0JA 4YHEA 5I6SA 3LPPA 1G94A 5FIPA 1UWQA 4TX8A 5AC5A 1XC6A 1LF1A 3EMQA 1A47A 1VFMA 1VEOA 4EK7A 3KE0A 3ZR6A 4AZ5A 5F7UA 1EDTA 2D1ZA 1PX4A 6A3HA 2VI0A 1QI0A 3TTQA 1IZJA 3G6MA 4AD4A 1WZKA 2Q8XA 1GOOA 3VM5A 3L4ZA 5I78A 2GSJA 2WC3A 4F8XA 2W92A 3VGBA 1TUXA 1LQ0A 1J11A 3VGGA 1VJSA 4CU6A 1QHOA 4AD1A 3MV01 1PEZA 1W1YA 2WVSA 3WDHA 1ECEA 3L4TA 4IPNB 4MAZA 4W5ZA 2JEPA 2XUCA 3GNRA 2CETA 3ZR5A 4HA1A 5A8MA 3EDFA 5CGTA 3PTMA 4LQ1A 4W93A 3OGRA 4MB5A 4LGXA 1B3WA 2J74A 1E5JA 3MMUA 1JYNA 3QHOA 4CCDA 1DHKA 4P7QA 1EXPA 3ARUA 2DSZA 1EO5A 2D3NA 5CZKA 5E09A 2QPSA 1NM9A 3PZIA 3ARWA 3F5KA 2DDXA 4FK9A 2ZUUA 1DEDA 3T08A 4Z2KA 1XRVA 3WUGA 4AZGA 2WKLA 4CN1A 1LWHA 4Q22A 1PX3A 3RO8A 3WENA 4ATLA 1QPKA 1VEPA 1XYZA 3PZUA 1NWRA 4AIEA 1TMQA 2D2OA 2ZX8A 1WO2A 4QCEA 4DWSC 1U33A 4QAWA 4BQ4A 1OT1A 3W29A 2PWFA 2WKGA 5E6ZA 1DWAM 3MUIA 1B2YA 2VQTA 1GZJA 2VO5A 4PMOA 3VILA 2X09A 2CBVA 6CGTA 2EJ1A 1W3LA 2QV4A 1V0MA 3ZIZA 1PPIA 3N12A 4J3TA 3RPMA 4D1JA 1H5VA 1FH7A 4PSPA 4QP0A 4EE9A 2PWDA 3T2OA 1F4HA 1W9VA 3FAWA 1CGTA 1KXHA 3VOCA 1MXGA 3ARPA 1C92A 3TTSA 3RJYA 2OSYA 4PSRA 1EDGA 2QMJA 1PBGA 5HBFA 4LYRA 4W86A 3WF0A 5M3WA 5M03A 3AI0A 3A47A 4C7GA 3U7VA 4E2OA 5M17A 2XYLA 4XUYA 1V6WA 3CBWA 1UD3A 2XHYA 2XVPA 5CXPA 1VEMA 2J62A 2BVYA 1E1EA 2AOSA 5ABGA 3N18A 3KWXA 4W89A 5LA2A 3PTKA 1E6ZA 4AXNA 3NYDA 5C8BB 3FXYA 1WZAA 3AHTA 1CGWA 4BQ3A 4M8UA 1EHNA 5D4YA 1OCQA 3ZM8A 1FH9A 4L4OA 3OZOA 4X0NA 2WCAA 1V02A 3OLIA 1CXIA 5DMYA 1W32A 2BHYA 3AS1A 3ARXA 3LMYA 3OBAA 3AHVA 4PMXA 1V6XA 3PTQA 2CXGA 3IANA 1JFXA 1KXQA 5D9PA 3WF4A 5D8ZA 5LA1A 2E40A 1UWRA 2WHJA 2VRJA 3FHAA 2WWCA 1C7TA 5A95A 5A8NA 2CIPA 7TAAA 1TVNA 4GO8A 1FP9A 1PAMA 4QLLA 3OB8A 1RPKA 3B8SA 1KBKA 1E3XA 5A8QA 5ABFA 7A3HA 3NJ3A 3ZJ8A 1MQPA 1QNPA 2GDUA 2WAGA 1ZU8A 1W1PA 1Q6EA 1CLXA 2CITA 4PEEA 1WDPA 5ABFB 3WQ6A 3GBDA 4KRTA 3A6OA 3TOPA 4B16A 1TFVA 5BXRA 1OM0A 3O2LA 3CUFA 1ISXA 1XSJA 1OBAA 4CD5A 2YBUA 1EQPA 3I3BA 4H2CA 4PRWA 2X8RA 4DWSD 5GQBA 2TAAA 4JFSA 2A3EA 2Y8VA 3UETA 4GQQA 3VIGA 1H2JA 4XX6A 1W9UA 2W67A 3RM9A 3AIQA 1LWJA 1JZ8A 2ZX5A 3BH4A 3B9AA 4L4PA 1E0XA 3AIEA 3VDAA 1UHVA 1GORA 5M5DA 4PTMA 3HU7A 1JXJA 1C8YA 3BMWA 1BGAA 4UQBA 2CBJA 1C3FA 1W2VA 3AZRA 2X2YA 3ARTA 8A3HA 5HOSA 1CENA 1W1TA 1JZ4A 3BAYA 2J47A 2ZUTA 2DQXA 1DWGM 1ITCA 3M46A 3VNZA 1D7FA 5A69A 3II1A 3GH4A 3CPUA 1QNQA 3GNPA 3FAXA 3MSDA 3POHA 1WZLA 4TUFA 5HPOA 1FOBA 1HN1A 1CGVA 2ZICA 5EFDA 2XSAA 1GQKA 2CHOA 4AD5A 3CIVA 1B3VA 2ZXDA 3WQ8A 3UEQA 1OIFA 3CZLA 4JFUA 4AYSA 3VMNA 4FLRA 4FLSA 4AD2A 4JFVA 3NIYA 5I79A 3WDQA 1J0ZA 4GI9A 4NF7A 4ZE4A 2A3CA 4QFUA 1XD1A 1JDDA 1G1YA 2PWHA 4JZ5A 1UWUA 3CUGA 1GPFA 4DM2A 1TZ7A 2YDSA 3EDJA 4AD3A 4PCSA 3SCUA 2VZUA 1CYGA 2XWDA 4ZENA 1LLOA 2C8NA 3GH5A 4AEEA 4PMDA 4A3YA 4WKHA 5TD4A 2XVNA 2VR5A 3GXFA 2D20A 2C0HA 1MFUA 2RGMA 4HOWA 5A2CA 2WZHA 2BXZA 4UZSA 2O9RA 4XZBA 4B3KA 1CBGA 4B9YA 1UD8A 1HJUA 2XJ7A 2YLAA 1E56A 5HDRA 4OBRA 3VD9A 1CXHA 1GOWA 3WF1A 2C7FA 3EMCA 2ZIDA 3RDKA 5IHSA 3VVGA 4AZCA 2VX6A 3T0BA 1BYDA 3IJ7A 1KR0A 1KGWA 1OD0A 1UR9A 4NSBA 1JYVA 4PMYA 4MDPA 1S46A 4ACYA 4J3VA 4MB3A 1EOKA 4V28A 2WSPA 1UQYA 5CGMA 1QOXA 3VMPA 2WHKA 1V08A 3FHQA 1PZ3A 3VD7A 1VJZA 1CWYA 5CPSA 1M7XA 1VFFA 1EA9C 2PBOA 5I24A 1AQ0A 1GONA 1UQZA 1G5AA 4UOZA 1HP4A 1M53A 2G3JA 3BLKA 2XM2A 1W9PA 2WVVA 1MXDA 4D6DA 2J77A 2BS9A 4CKQA 4UFJA 3RIKA 4J3WA 1UWTA 3WFLA 4D72A 1DWJM 3T09A 4IM4A 4PYSA 4B15A 2WVVB 2DH2A 2XPKA 2Y4SA 3CH9A 1XCXA 3FY1A 1JI1A 1BPLB 1W9BM 1DTUA 1QNRA 3OIHA 5A6LA 1Q6FA 4GPNA 3CUIA 4DM1A 1KQZA 4W8LA 1HT6A 2WC4A 1BVNP 1H3GA 3K4DA 4WF7A 4PBGA 4HOZA 2JFEX 4MADA 2WMGA 4ACZA 2ZUMA 1PX8A 3MUY1 2VR4A 3WEMA 1JZ6A 1LG1A 2GDVA 1CECA 4S3KA 1JDAA 4J28A 1BHGA 2EEXA 4AWEA 4ACZB 3SCTA 3K8KA 4M81A 1IZKA 3AHYA 2J75A 4QLJA 3CHCA 3K8LA 4R27A 1BYBA 1ITXA 3MV11 3VUPA 3THCA 3ZOAA 3GM8A 1V3JA 3T2QA 3VIMA 2G41A 3GTNA 3WMCA 1AQMA 4B3LA 1CGYA 2A3HA 3IJ8A 3SUSA 1K6AA 5I2UA 3WNOA 4OBSA 3WBEA 1JIBA 4PMUA 1I1WA 2YA2A 2PI6A 4U33A 1CLVA 3VKKA 4U5KA 3VMOA 2IXVA 5IDIA 4ZFMA 5A6BA 1EO7A 3EDDA 3WUFA 2NSXA 1UH3A 1WB0A 3L2LA 1EQCA 2CBUA 1LJYA 4RE2A 5D9OA 1GOQA 1K9FA 3KEHA 1BLIA 3AXHA 4CN4A 3VIHA 3WMBA 4WLCA 5E0CA 3T0DA 3BGAA 4JCLA 5E70A 2Y2WA 1GQJA 5HPCA 3UG5A 1XD0A 4JKKA 5A8OA 1VBUA 2VNCA 4D6FA 2CHNA 1N82A 1TVPA 3VD3A 5CLWA 2WK2A 3AS3A 3CZKA 1B9ZA 4DUXA 1F4AA 2YBTA 4GZEA 2WMJA 1UKOA 1CEOA 2BY1A 1HJXA 3DYMA 2DT0A 1V02E 2J4GA 4UOJA 2FGZA 1TE1A 4Z2IA 2D23A 2EQDA 1E43A 9CGTA 3WD0A 2VZVA 4HU8A 1HKMA 3MMWA 5I3DA 5LA0A 1R86A 2J8GA 1MWOA 4FF5A 3DYPA 1FFQA 5HXMA 4GXPA 3AIBA 2XIIA 3PZMA 1YQ2A 2VVSA 3DHUA 2VRQA 2CPUA 3MUZ1 3VIIA 3NDYA 5EB8A 4KMQA 1LL4A 3WNLA 4KGJA 2V5CA 2BVTA 1BVZA 3AQUA 3SCRA 4GI8A 2YA1A 1V3MA 1XCWA 1HJQA 1MYRA 1JL8A 3WNNA 2OYLA 1WDRA 3T0AA 1CGXA 3W6MA 1JZ2A 1VENA 5EMYA 4J3UA 3TTYA 3QOKA 1WP6A 5DT7A 1J10A 2CKSA 3IJ9A 3MKKA 2E3ZA 4U3AA 1PZ2A 1US3A 4K68A 4QCFA 4IPLA 2QLYA 4AD0A 1W2PA 1GW1A 5A94A 3K8MA 2GJPA 1R8LA 3WD2A 5GPRA 1E6NA 5E0FA 4UFMA 1V3KA 1OWQA 1GUVA 1ESWA 3WD3A 3WQ4A 3K46A 1EHAA 1Q6GA 2GUYA 3QR3A 6TAAA 5KZ6A 5DFAA 4D1IA 4CD8A 3CMJA 1Q6CA 1J12A 2WLZA 1KB3A 3HN3A 2ZWYA 3BAIA 3NDZA 1X1NA 3LPFA 4BS0A 3SUTA 2XWEA 2B31A 3M6DA 1JFHA 4KGLA 1D3CA 2VCCA 2J7GA 3MO4A 3CMGA 2XTKA 3A4AA 4WSKA 3JUGA 1BGGA 4V27A 3S6TA 4JIEA 1J9YA 5JIWA 5I0DA 1BTCA 4TVCA 3UESA 4CN6A 1E6QM 2WMHA 1NARA 1E6RA 1OD8A 3U57A 4JFTA 1UD2A 1ZBVA 4BQ2A 4H8VA 1CDGA 1HX0A 1R7AA 4UQAA 1NWUA 2DT2A 1UKSA 2DGAA 3GBEA 1H1NA
chains in the Genus database with same CATH superfamily
2QPXA 4LUIA 1F05A 4WK9A 5D32A 4JKLA 1XHGA 1WCGA 1EYEA 1LUCB 3GXTA 2Y6ZA 1S1RA 2DIJA 2XDFA 3LSCA 5CAHA 1EC7A 1HF6A 1LG2A 3BARA 1WYIA 1TG7A 1HKVA 1EC8A 2JKAA 4JN6A 1ZL1A 2WJFA 4HKPA 4EAMA 1XUZA 3O6AA 4HA0A 1CPUA 3AMCA 4NJIA 2J9XA 1S5VA 3ZSTA 1FQ0A 3LPGA 4L5ZA 4BWLA 4Y9OA 3LSBA 2BV9A 1GOIA 1QU4A 4LVFA 4JTCA 1GPWA 1ZQ5A 1V0LA 2YA0A 1A5MC 1VRXA 1E40A 2NLYA 5DCBA 1W9DM 4DPQA 4HSHA 3TJIA 5HQMA 4DPPA 5GNYA 1QO2A 1L6YA 1Q85A 2GVEA 4XZWA 4CNSA 4MWAE 4YXGA 3UQNA 1WKYA 1OT2A 1XYFA 5MKGA 2DPEA 1DJGA 1PIGA 1EPXA 1W5PA 3KM8A 1VFHA 4Z1CA 1FBAA 3KTCA 1L6SA 1UMLA 2FYMA 2JF6A 1BG4A 3BL3A 3T0CA 1PDYA 4A2RA 4QAIA 4PE8A 3G3MA 1L2UA 4R85A 3OVQA 4ZQCA 4G5DA 3IAPA 3CQKA 3O0FA 4N0RA 4N42A 1F07A 3N2TA 1ZRQA 4HTYA 2C3ZA 5EPDA 2P88A 1BKHA 3PZQA 5AYYA 4F9JA 2BHUA 2ZVIA 3LM3A 5FL0A 1XH0A 4DWSB 4V33A 2IW0A 4XO6A 1K9EA 1E15A 3NYZA 3C8NA 4LB4A 1WNOA 3U7BA 1ISWA 4PUEA 4S3FA 3LHUA 1E9LA 3TU9A 3PBWA 4GD0A 4HYRA 3U5UA 1TTQA 3NQAA 2FH6A 3HGSA 4O4VA 1JYWA 2QDEA 3GD6A 2CC0A 3BTNA 3U2OA 1S3TC 3N2CA 2VDHA 4OV4A 4AU0A 1KXVA 1B9BA 2YCKX 4F66A 4YYCA 1E73M 2VTFA 3RCNA 3VDGA 3DAQA 2A1YA 4DUOA 4P7NA 1GVYA 2Z1VA 1H11A 4WEVX 2G37A 2EBNA 3DFNA 1H0IA 1V79A 2GQAA 3ZO9A 5K7JA 1OSEA 4HZ6A 4LF2A 2ON3A 3AMGA 1LTDA 2ZZ1A 5H1WA 1HKWA 4OFCA 4KEUA 1ZGDA 4DZ5A 3L4YA 3GDRA 2OR2A 3WDJA 2Y88A 2OODA 5C71A 1CNVA 2A0NA 1ZJHA 4M1BA 4PB4A 2BGNE 1F8IA 1I2RA 1GOMA 3WELA 2PDYA 4LYPA 3SCPA 3LRLA 1UA7A 2NT0A 3NSNA 4IJCA 4JOMA 1GJUA 3GS6A 5FACA 4FALA 2DZUA 1GVRA 2HMCA 1X38A 3QZEA 3W4RA 4AZCB 1OYBA 4QS6A 1A0DA 3MUCA 5BMWA 2JGYA 1M04A 3URAA 3TAKA 4O14A 3QSRA 4MLJA 5A2BA 4R7JA 2HV5A 4YS1A 4GY0A 1JCNA 3B4UA 3I3DA 3BVJA 2ZXAA 3HA1A 4QSHA 5A6MA 5HJXA 1OF8A 3JS3A 2OGJA 3PZOA 3IAQA 3GUWA 1GHRA 3JW7A 2ZUNA 1XP3A 3VNKA 2EO7A 1FXPA 3CB8A 5BXPA 1UZ1A 1VC4A 2X05A 3SCVA 4L6DA 3N2MA 1W3KA 1VPYA 3CO4A 4C1NA 1HTIA 1FFRA 2J7BA 3STEA 3S8HA 1XLFA 4O28A 2J79A 4KRUA 1DWFM 1I0DA 1AZ1A 3RR4A 1UH2A 2H3DA 3SQLA 4NNCA 1ZFJA 4ZFCA 4DY1A 4HBKA 3D5HA 1ZJBA 1TKKA 1S2VA 5PTDA 3RFAA 1Y7VA 2HSAA 4ZL1A 2XH4A 4PTDA 2QCLA 3VI2A 2GSEA 8RUCA 2OOFA 1OJXA 2NSOA 3WQCA 2A3BA 2QW5A 4GBUA 4NNBA 3KHJA 5DCDA 2V5JA 2O9TA 1IIGA 3K4WA 1XLDA 2POTA 3M5VA 1QNSA 2J6VA 2XIQA 1VPXA 4HMEA 1YKWA 3AHZA 5CLTA 3AALA 4X2PA 2BVWA 2A5HA 5FF4A 4ZB2A 3M7SA 2AGKA 2CNCA 4FMVA 1YBQA 3CU2A 2V6AA 1JRBA 3M07A 4ZMGA 1KWKA 2EPLX 3DFTA 1OX5A 4UTKA 4QE1A 3VD4A 3QOMA 2WMIB 3ARRA 4JYEA 1NQ6A 4AXKA 3QKEA 1TV7A 5EFFA 1LLZA 4YMZA 1JDEA 3M0ZA 4L6OA 2VJXA 1FVPA 3OPSA 2ISVA 2EPHA 3GKAA 4L1GA 3FYPA 1HL8A 3RLVA 3FA3A 4CU7A 4L6HA 3CTTA 3LXAA 5A1AA 4RV3A 3NFUA 1O68A 3KL5A 2RKXA 4TIMA 3MPGA 5FOOA 5T9BG 4Y2WA 4ZVJA 2DQWA 5I77A 1GZ1A 4YYFA 2HEJA 1HIZA 1H41A 1YYAA 4H04A 1JZ5A 4KBXA 3LBCA 4IICA 2VWTA 3S42A 4JAWA 2EGZA 3T4CA 2MANA 2INZA 1XH1A 4NXSA 4FA3A 1RA0A 2W79A 3BLDA 5E9XA 4DX3A 1ZZMA 3S5NA 2INEA 3QXBA 4NZ3A 4RNJA 2PDJA 4XB3A 3E0FA 5DEZA 3EBVA 5BROA 3C0QA 4D6CA 4TV6A 4OECA 1OIMA 1SGJA 2YXXA 3SFKA 3N11A 3WBAA 1A5UA 1IZCA 2WZIA 1EP2A 4NKCA 3OGSA 1Z32X 4U3CA 4CVUA 5C0QA 2QYGA 3Q4DA 3LRMA 4W87A 4XD3A 3O0KA 3ES7A 3EDKA 4W84A 2GJRA 3W1XA 4GHRA 5CQ1A 5FJJA 4KF1A 2W61A 4MNLA 1EIBA 4X61A 5FEWA 4S2BA 3ZJ6A 4O11A 2QDGA 4NYUA 2FHCA 4UMAA 2Z7KA 3QW3A 3ARVA 3L12A 4OE7A 3WL1A 1YE6A 4GVFA 4NX5A 4CQDA 2YXGA 2HJPA 2VZTA 3ATZA 2MUCA 1QHZA 1O5XA 3RAOA 2PAJA 7REQA 4H6RA 3P62A 4PR4A 2POZA 4RKAA 1Z89A 2QV5A 2E68A 2V2HA 3UPMA 4GKLA 4Y90A 1BYCA 3DHPA 1C9WA 3W81A 3UJSA 3E1F1 3EAUA 1E4NA 2VT0A 1DJXA 3MP4A 2GK1A 3SUUA 1E0VA 2YCLB 4HJWA 2FKPA 2VVNA 1EA0A 3UR7A 3CM4A 3VU2A 3WNPA 3BJTA 3INPA 2YIHA 3FX4A 4JTTA 3UGRA 2PC8A 3FNDA 5FESA 3BLPX 3VGHA 4JIPA 4LCRA 5IFTA 1JCMP 3F4NA 1DKWA 2LLEA 3FEQA 3SCOA 3AMDA 3AICA 4XK2A 3M41A 1E70M 5BXSA 3DECA 2VUYA 1ZAIA 2Y8KA 1LLWA 3K13A 4FNQA 3BE7A 1AA1B 2CLKA 4JL2A 4MGGA 2DVUA 3GX9A 2YL5A 3AZSA 1T8XA 4GIRA 4UFLA 3W7GA 2V5KA 2GGGA 4WY0B 3PANA 5LIYX 2DFAA 2BASA 1SFTA 3HJEA 3UVAA 2PGRA 3VABA 1XIHA 1NWTA 1W56A 4WY0F 4YWSA 4IMAA 2XZ7A 5T9CE 1SJDA 4EPBC 3CHEA 2OELA 4H4IA 3GXDA 3EWBX 3VTRA 3GU9A 3GVRA 4IJRA 1OFDA 3AC0A 1OVDA 2CLEA 3TKFA 5JH2A 2CZVA 1MW2A 5JMUA 3WEOA 4FNSA 2OO0A 2OTDA 1M7OA 1TO3A 1TWIA 2UY3A 4PMVA 4PMNA 1SU5A 1P0NA 2I5QA 1OFEA 3AMKA 2ATMA 4ZEPA 3CZJA 1S2UA 4GJJA 5MKGB 4PTVA 3WH7A 2JE8A 1XF0A 2R6OA 4B2DA 1KTCA 1UKPA 3ARSA 4Z1YA 1EDQA 5REQB 3SADA 2XVLA 1H7WA 3TYUA 1SJBA 2GWNA 4AHPA 5BW6A 1BXCA 4B4FA 1WAWA 1RP9A 4G1KA 1DIKA 2OLSA 1J18A 1GTEA 3T0TA 4NZCA 4ML4A 2R24A 1P6WA 1YADA 5I03A 4H9MA 4YWIA 3TZNA 2HROA 2GGHA 2A7RA 3ID7A 3I3EA 4HSNA 2YGYA 3WLRA 2PDWA 3VCRA 4DBEA 4DUWA 3VC6A 2BNJA 8CGTA 2YBVA 4PUJA 4Z2HA 2ZYFA 5I00A 3L21A 3E2QA 3VGDA 1ZS2A 4N9EA 1J01A 3PG8A 1OYAA 1X98A 4RW3A 2Y24A 3G2GA 1K8CA 1TV2A 3F5JA 2GSHA 1ZJAA 4IPPA 4A8RA 5CZSA 2VZSA 1SR0A 1JGMA 4BCEA 4HB7A 4LYQA 1R3VA 3VX0A 2PDFA 2NQ9A 1DQUA 1XSKA 4P7RA 1Z44A 1E4MM 1CXKA 3CNYA 1TTIA 3M43A 3PB2A 1B3XA 4Q4PA 3T55A 3THDA 3NVDA 7CGTA 4YTQA 2CW6A 3U2EA 3VIKA 2FDMA 2ZZ6A 3TJLA 2X0SA 2VOTA 4M7SA 1JAEA 5CC7A 4ZR8A 1KCKA 4N6FA 1LZOA 3V0SA 2G3FA 1A0EA 4YTRA 3BUVA 1UKTA 2VCBA 1W8SA 3OBEA 1RAKA 4AFYA 2E6FA 4M6QA 3NQVA 2R9RA 5JIPA 4F3HA 3VOJA 2CLPA 2Z28A 4GYPC 3NOEA 1TPFA 4ZXOA 2VC7A 2J8FA 4GH3A 3LTSA 3WDIA 2BXVA 2NUXA 2VD9A 3LTYA 1KQYA 3L0KA 3NCOA 4F0RA 5KEZA 4RZ4A 3TQVA 2E9LA 2G96A 2CFFA 1VD6A 4DAIA 2W66A 3ANYA 4M82A 1F6PA 2VRKA 2CERA 3T81A 2RH9A 4GINA 4ICCX 2DUAA 4AC1X 2NVCA 4KEVA 1QUMA 2EAWA 3EDEA 4A3UA 1DE5A 1S39A 4XVDA 5F4XA 4YVPA 3H2MA 4S3DA 4CEUC 2NQJA 3P80A 3L66A 2XZ9A 3GXMA 3GO2A 1EUAA 1WKDA 3R43A 1MW1A 3GZ3A 1XQLA 3ERPA 3UWVA 3A4WA 3SI9A 3AU2A 1CXFA 1YNQA 3VGEA 3AS2A 3WJSA 1SZFA 3VNIA 1AW5A 1RH9A 4LF1A 2I14A 1N7KA 4GO9A 3C56A 1UR8A 3W07A 3R0DA 3DDMA 1WQ5A 4UIOA 3QFWA 4V2XA 4LUJA 3G1FA 3BXWA 2QCHA 1FDYA 3R2GA 4NZ5A 1CCWB 3IARA 2B7NA 4DLMA 3AHXA 3MSGA 4GVIA 1RQEA 4GE8A 4GWEA 8XIMA 3UT0A 3COTA 5CPQA 4HNTA 3VGFA 3RU8X 3V4BA 1KBBA 4HPXA 3STCA 1T40A 1KA9F 3ANUA 3GFXA 5DY3A 4NJGA 1DWIM 3MP3A 4IWWA 3VKCA 5I5RA 3OVRA 1I0BA 3GDBA 3UG4A 3UJRA 4LS1A 4NZ4A 4HPGA 3S2CA 4B9ZA 1MQQA 4L4MA 2QUUA 3H7UA 4LRSA 2GDQA 4Q7BA 4J2MA 1U1HA 1V0KA 3PF3A 3KBMA 2PDMA 1JD7A 3MKCA 4TR9A 1L9WA 1NFBA 4RDWA 4Y9MA 1JZ7A 3H21A 1M7PA 1FCUA 2F6UA 3N4FA 4OKDA 1NWSA 5C6MA 5CG0A 2V81A 2E5CA 4WSHA 4FNPA 4AAJA 2V8ZA 4JDBA 3QY8A 3WH5A 2X41A 3M64A 1XBZA 4HNNA 4KT2A 1B3YA 1SFLA 1AD1A 1VHCA 1OFPA 1UR1A 5M2FX 4TOQA 3K4AA 1VLIA 3H2CA 4LNCA 3TC7A 3E0IA 1BKSA 3FYYA 2AAAA 1W5OA 4HYVA 3B0XA 2BWGA 2BBFA 3NQDA 1FHUA 5FEZA 3HPFA 4YHEA 5I6SA 1UWQA 2QNEA 1XC6A 5BOEA 3W84A 1O66A 4GX8A 3KE0A 5FSDC 1YX1A 5AECA 1EDTA 1PX4A 3CK5A 3G6MA 4JEJA 3PP7A 4ORMA 1YDYA 4A2SA 1GOOA 1BRLA 3VM5A 4QJ3B 1LQ0A 1J11A 2GQ9A 4AB4A 3WDHA 2I9EA 4IZGA 4IPNB 2JEPA 5AC7A 2CETA 2Y0FA 1WXJA 5B7YA 6REQB 6ENLA 4W93A 4G7EB 3SGUA 4LGXA 4FSAA 2BP1A 2QIWA 1EO5A 3BLLA 3ISIX 1GVSA 3W86A 5HQEA 3I7SA 3F5KA 4HN8A 2IQDA 2D2JA 1D8WA 3T08A 1XRVA 2X42A 3EPOA 3LCWA 1PX3A 3WENA 1IEVA 1A5AA 3SRDA 3VNJA 5AYZA 4QCEA 4E2VA 1SQ7A 3EA2A 2WSYA 5E6ZA 1DWAM 2VGGA 3MUIA 4IMDA 2TSYA 1B2YA 1GZJA 3RUBL 1F3EA 2CBVA 2PCQA 1K77A 1AH3A 2QV4A 3IIVA 5EBUA 3RPMA 2OJPA 1U22A 1XRSA 4D1JA 3HGJA 1H5VA 4PSPA 4EE9A 2PWDA 4N9BA 3T2OA 1QWKA 1KXHA 3NL3A 3VOCA 3VNMA 1MXGA 2G50A 3ARPA 3GR7A 4DJEC 1JUKA 1Q2RA 4DNHA 4F2TA 3HURA 5M3WA 2Y8UA 3A47A 3U7VA 4E2OA 5M17A 2XYLA 1IEWA 1QDSA 2XVPA 2J62A 3FA5A 4HYWA 3WO8A 5LKYA 3C3UA 4MY1A 1K02A 4GYKA 3SJ3A 4ROPA 3E9AA 3TFXA 3KBVA 5LA2A 3OODA 3PTKA 2Y89A 2ZRXA 1E6ZA 4RNIA 3HFTA 1C8VA 2P0IA 4M8UA 4A8IA 1UCWA 3FFSA 4IOTA 4KCWA 3VZZA 4C6FA 2R1LA 4N6EA 4L4OA 2Y70A 1CXIA 1DXIA 4GH1A 3HB9A 3OVPA 4PMXA 3M0HA 1V6XA 2CXGA 3IANA 1Q6LA 5D9PA 2C1GA 4GG9A 1RXOB 5D8ZA 3S5ZA 2WWCA 5A95A 2ZVRA 2CIPA 7TAAA 1BWKA 1FP9A 4NUWA 3KCLA 1E3XA 2PWUA 3DU0A 2CLHA 2ZZ7A 4RPQA 2ALRA 3KVMA 3ZJ8A 3OHMB 2QVHA 4IL2A 1DOSA 4PEEA 4LSBA 5ABFB 1CT5A 5M1TA 2Z6IA 3P2VA 4WHBA 3W74A 2V2DA 4XUGA 3URNA 2OZ3A 1TPUA 1RJPA 1XSJA 1OBAA 4BI7A 3G3DA 4HMNA 1EQPA 1ZENA 3I3BA 3LQLA 3Q94A 1F7BA 4I90A 2TAAA 3FJLA 1O5KA 3RR1A 4C1KA 4BR1A 2G95A 1RCQA 1H2JA 1XS2A 4K37A 4H9XA 4I8YA 3TXVA 3RM9A 1WBHA 3AIQA 3ZLFA 1A0CA 3LU2A 3AIEA 3DC8A 3I4KA 5CPLA 4LFYA 3BMWA 4LU0A 3IJIA 1OYCA 1W2VA 4LC8A 2X2YA 3ARTA 1CENA 9XIAA 4LRTA 3MHGA 4WR3A 4C6IA 3M46A 1ITCA 4H8NA 1G4EA 4FNRA 4ZA0A 1Q5MA 1QPQA 2CWXA 4L80A 3BMXA 1F61A 1M7JA 5D33A 3TWBA 1JCLA 2BOFX 1ADOA 4KWOA 4TUFA 3V16A 5HPOA 3N3MA 1CGVA 3KFTA 1U5HA 5I07A 1SZNA 2ZICA 4PBEA 1XIMA 3DKLA 3IVUA 4IPJA 2C6QA 1RQBA 1UP0A 3B8UA 2F6KA 4PCPA 1RQHA 4JFUA 3EB2A 4CNOA 4FLSA 4E8GA 4AD2A 4I5XA 5I79A 4NF7A 4ZE4A 2A3CA 3NZ1A 3FCPA 1P0DA 5EA9A 1UWUA 1GPFA 3M0YA 1KM3A 3M0IA 5XIMA 4PCSA 3F7JA 3HQNA 4DI9A 3SCUA 2XU2A 2XWDA 3IVTA 5G1MA 2PTXA 3R10A 3EKLA 3ZWSA 2PDHA 5TD4A 5D09A 1JR1A 2VR5A 3ICJA 3IK4A 2DY3A 1ME9A 2C0HA 1MFUA 2RGMA 4HOWA 3N29A 1F3WA 4XZBA 1P7TA 4B9YA 1AL8A 1UD8A 2I17A 3VD9A 5AHLA 1NFPA 3WF1A 2X7WA 5IHSA 1AFSA 3NG3A 1RUSA 3SN4A 1OC6A 1WBJA 3BICA 4PMYA 4KERA 1Z8AA 3U2ZA 2V69A 4ACYA 4J3VA 3HV8A 4MB3A 4QNWA 2FTWA 3W7CA 3B97A 1XIGA 5HNRA 5EL1A 3VD7A 3F2BA 2DW7A 1H7PA 4JTHA 1M7XA 1VFFA 4IGMA 2PBOA 1AQ0A 1LT7A 3W2UA 1A3XA 4GCAA 2GLKA 4FXJA 4N9CA 2XM2A 3BLKA 1XLLA 2WVVA 3TR9A 4MZ1A 3W7OA 2DW6A 4LAMA 1UWTA 4D72A 2IPJA 3K1GA 1MXSA 2CLFA 1BTMA 1ZY9A 2XPKA 3N34A 4GXWA 4ILSA 3RLGA 3FY1A 3R12A 1QNRA 3OIHA 5HMFA 1VIZA 4GPNA 1SPQA 1W54A 3CUIA 4DM1A 1CI1A 1YXYA 4W8LA 4XAPA 4MF4A 1CLKA 5AHIA 1V77A 4DJFC 1PV8A 4OWGA 1IXQA 1FWEC 4ZO6A 3G24A 4S3KA 1JDAA 3LRKA 2OVLA 3ABQA 2EEXA 1S5TA 4AWEA 3SN0A 2BTMA 3E49A 1W31A 2J75A 2A85A 2V63A 3W7MA 5KZMA 4KWWA 4H19A 4MYAA 1Q3NA 1V3JA 1XG3A 3IS4A 2G41A 3WMCA 1K7XA 3IJQA 1K6AA 5I2UA 2RFGA 3NA8A 4DJDC 3ORWA 3WBEA 1B54A 1EGVA 2YA2A 2Y7DA 3BPWA 3HGRA 1CLVA 1QASA 3VKKA 2NUYA 2OU4A 2QR6A 2YYUA 5F2GA 2CBUA 3S5YA 1A5OC 1MDRA 5D9OA 1FHVA 3PG9A 1F73A 1EWEA 3SIZA 3MJYA 4E3TA 4CN4A 5HWJA 5I06A 3T0DA 2A3LA 5TAOA 4HNOA 5T8GA 3MZ2A 5E70A 4HK6A 3IGSA 5E93A 5FJOA 1XXXA 3PWIA 2FVMA 4UNLA 3WK2A 3G1XA 1KD0A 3BDKA 3VD3A 2Z2BA 1B9ZA 1DYSA 2V30A 5C9RA 4GZEA 5C7VA 1UKOA 1E9IA 2V5LA 3JZEA 2B4GA 1T8QA 3OEXA 2J4GA 4UOJA 3MI3A 1BF6A 1G4PA 3FLUA 4NG3A 3DH7A 3CIWA 4HU8A 3MMWA 4UWMA 3ITOA 5A8GA 2J8GA 5LIUX 1H7RA 3GHTA 1FFQA 4Q33A 2VVSA 3DHUA 3PZMA 3UYCA 3W1QA 4IGSA 2WSRA 5EB8A 1DPMA 1LL4A 5HK4A 4TX9A 3GHRA 2V5CA 2BVTA 3RYSA 1T6MA 3AQUA 5AHNA 4I9TA 4JIRA 5A5WA 2OX4A 4YCPA 1JL8A 4G2DA 3BW4A 3G8RA 4KFOA 2PE4A 3TSBA 3WFAA 4O50A 1WDRA 4DF2A 3IACA 4NZFA 2BOEX 3C2YA 1AH0A 2ABBA 1V51A 5EMYA 3WYZA 3TTYA 3ITLA 3QOKA 1VKFA 1EUNA 4FO4A 1PL9A 3NZQA 4K68A 3KVKA 4AD0A 4C90A 1JCYA 3BQ6A 1R3SA 3SRHA 4I9JA 3LQGA 5EMUA 3LCGA 4ERAA 3GG8A 3DKJA 4GACA 1JPIA 4UTTC 4O1FA 3P60A 2GUYA 4O53A 1XCFA 4K1WA 4NU7A 3CMJA 2CWNA 1TX2A 1A49A 1J12A 1SZRA 2WOQA 3IRSA 1O5QA 2Y62A 3BAIA 1TSIA 1TPDA 2GZXA 1D3CA 2VCCA 1TPWA 3CL7A 4DWDA 3PBMA 3WJWA 5L9FA 2VEKA 2OOGA 4JIEA 1RALA 2VP8A 3UESA 4N4PA 5C9WA 1Q7MA 2OPJA 3WLPA 4JFTA 3ZYZA 4XSLA 2NZLA 4YJ5A 3T8LA 1ZBVA 1EF3A 4MM1A 1HX0A 4UQAA 2FJUB 1TELA 1NWUA 2DT2A 3BWWA 1TMHA 3GBEA 2QCDB 2WVTA 4URIA 9RUBA 2YDQA 3W6YA 4B5SA 2DZVA 2JEQA 3SCWA 2WNQA 1I2PA 2F8QA 2VDGA 2PODA 1CTNA 4P8UA 3WQVA 1ZAJA 3PVFA 4AZ6A 4OU1A 3N14A 3HFYA 3MVTA 2EJAA 3QN3A 3AIRA 1J93A 4Q7IA 3CZ8A 3FJNA 4N9DA 2PGFA 3VNYA 2Q8ZA 1E6PA 1J2BA 3AS0A 2WO5A 1Q6RA 4H9UA 4H6KA 2PTYA 3W7JA 2YL9A 2F61A 4A3HA 1QW8A 3UU0A 3UZZA 2NW0A 4H8HA 2P3EA 5G4WA 3UCDA 4P7OA 1AJ0A 3N13A 5FJRA 4W7WA 2XFYA 3S1XA 1GQNA 3AMLA 3NTYA 3WMLA 1GOXA 1WOBA 4J27A 2E0PA 5GJPA 2W4XA 3W27A 3PUDA 3EB3A 4E5TA 4RE3A 1W3JA 2OT1A 1UZDA 3N6HA 5CGQA 4UOQA 4UTUA 2EPOA 4Q4KA 1XRTA 1QPOA 2O7SA 3VE9A 4E8CA 3N15A 4M29A 2NT1A 1TPH1 3WQGA 4NX0A 1R3YA 2JK2A 4F0SA 4JX5A 3WH9A 3KWSA 3R7MA 2Z2AA 4H9ZA 3U2CA 5K2ZA 4FLOA 3WLKX 1T5AA 2ISDA 3QSTA 4NHVA 3BLEA 1OFRA 3ONCA 4NL1A 4CCCA 1R85A 3W2LA 1MW0A 4LS0A 3E74A 1ZJIA 2HQAA 3GNNA 3ZJKA 2VFEA 1HJWA 3VKBA 4V1YA 4IP4A 1VFTA 2PDLA 3VIPA 5D30A 1SMAA 3RHGA 3T1GA 3AIWA 2EXOA 2J78A 4WIWA 4ERGA 1QAPA 3LEPA 1V6UA 1NH6A 1UD6A 3PM6A 2GUBA 4J7RA 1KNWA 3B05A 4B90A 1KKOA 3BAWA 1J6OA 2BODX 5GJMA 4YU1A 4FEZA 2WSQA 1QOQA 5I23A 5E0KA 1WZMA 2GL5A 1OCNA 2CCRA 1A3WA 1KV8A 1YLVA 3OVGA 1C29A 2DT1A 2WSKA 3L67A 3CV6A 4Z2LA 3O06A 3SM0A 3MC5A 1BSIA 1R3QA 4F48A 4PTWA 4D9PA 2WKJA 4NVTA 3IJ6A 4JCMA 3BOXA 1TWZA 4TVDA 4IUOA 4JHZA 3TWAA 4TU1A 1XM3A 2JF7A 1JCTA 1G7UA 2QJMA 4YL2A 1TPVA 3ABSA 1KFWA 3AXXA 1G0CA 1AQFA 4QXIA 2REQA 4IIDA 2WNNA 1WE5A 1W91A 1ONEA 3W6LA 2J66A 1DQXA 1SUXA 2OKOA 4CU8A 1DVJA 2ISWA 4N4QA 4XD4A 4R7WA 2BVDA 3CV2A 3FIGA 2PRHA 5DXXA 1E4IA 3GFZA 5K9XA 5ECUA 2HNHA 4Z1AA 3EA3A 3ABRA 4LYKA 2ACQA 1QBBA 1U5VA 4Q7NA 3DI0A 5IM51 5I02A 3NNTA 1KFLA 3DX5A 2X1RA 3VA8A 4GYJA 2ZKMX 1BFNA 5D9MA 1R2TA 3A4JA 3T07A 2OZ0A 2ISFA 3M5ZA 4NI3A 1JF5A 1DXFA 1KFEA 5EBAA 2GOUA 5H6HA 2PWGA 4JY8A 4BHYA 3WSUA 4HZ8A 5H8UA 4MVAA 3P8JA 4W88A 1IV8A 3WZ0E 3NXLA 3SEPA 4FAMA 2X7VA 4CNUA 4JYFA 4W5UA 2FFCA 1EBHA 1UUQA 1E51A 4CQ9A 3GYCA 5G1YA 2DU2A 7TIMA 3KTSA 1OG6A 4S39A 5FD0A 1JDFA 9XIMA 1M3UA 4L56A 3ZQ9A 4XKYA 4S3CA 4POCA 1OB0A 3IIOA 1VB9A 4OUEA 3W87A 3S46A 1ZTVA 5I3HA 4WKAA 4JFWA 1NAL1 4LBSA 2A7PA 1IHIA 2NVAA 3PAJA 1XI3A 3J7HA 3V5FA 1XWYA 2XH0A 5GNXA 1XV8A 3U5YA 4C6KA 1XBXA 3F4VA 3PR2A 1C90A 3VOIA 2OEMA 1TA3A 5BU9A 2VKZG 1UB3A 4D8AA 4H3DA 3NUKA 2QZRA 3NO5A 3BAXA 4D6GA 4KCTA 1MO0A 1DBTA 3M0LA 1GYLA 1E72M 1YPIA 4MTVA 4AZ7A 4G9PA 2ZFAA 3CUJA 3OZMA 2KAUC 4BY3A 3IJDA 3PZ9A 1J4EA 2Q8LA 1J0YA 4JQ1A 3S6DA 1ISZA 2R8WA 3PNUA 3GSMA 1IF2A 4UTLA 4MZ8A 2EF9A 4M24A 3TA9A 2BG5A 1W8GA 2R91A 4ONVA 2ZWZA 4I7VA 1GYNA 1EJRC 4E8DA 5AVNA 2YOCA 4GQBA 1TJ0A 4M80A 2EPKX 3W37A 3CUZA 1EJTC 1MW3A 3WUEA 1TIWA 4NQ1A 3L4XA 5HUOA 2UY2A 4KETA 5CZJA 3QZ6A 3T2PA 4DI8A 1BF2A 5K9DA 1HNYA 1S5NA 4OZOA 1HZYA 4JYDA 3NAVA 2UWFA 3TYDA 3LENA 3RN6A 4HT3A 3L2IA 3EWCA 4TTUA 1XLIA 3SCNA 5T26A 4UB9A 2R1MA 3G5EA 3UXLA 4JY9A 3TA6A 1GW9A 4KH2A 2BXYA 4AF0B 3S2JA 2NQLA 4C60A 4YCOA 3L2MA 4A21A 1FHDA 2ICSA 3LD5A 2J27A 2PF8A 3RX3A 3W71A 1DV7A 1VBRA 1BG9A 1MZHA 3WY1A 1H7OA 1KLZA 4O10A 3AROA 4FX6M 3GZAA 4DJFA 4BQ5A 4US5A 2E8ZA 3OG2A 3AXIA 3STGA 4HCDA 1KM1A 4R53A 1C93A 1K8XA 1BEUA 4Z1BA 2QAPA 4O1DA 1W1VA 1FCVA 4MFEA 3A5VA 1UD4A 3SAZA 1J0HA 2P53A 3POCA 1H49A 4JGDA 2DSVA 2DZAA 4REQB 1Y5XA 1V03A 4DJDD 4HZ7A 3ALFA 3H8AA 2J88A 3WIJA 3A3HA 3L9CA 2Y1HA 1UPMB 3W7NA 1JXKA 3HO8A 2Z1SA 3MMDA 1EBGA 3WDPP 4DJDA 1EYWA 4R5EA 4XIAA 3E12A 3UG8A 1RD6A 4N7QA 4M51A 3AIVA 3W7LA 4DYJA 1W3TA 1PZ0A 4MHBA 3P0WA 4DZAA 1VPQA 3GRIA 2HE5A 3O9NA 2FHBA 3BJFA 4GJIA 1N8IA 1OC5A 4PTXA 5A6AA 5LNUA 1OFBA 4XZ9A 2VELA 1P0EA 1V8EA 3N9RA 3OTRA 4GUJA 2G5WA 2GJXA 4J9JA 1JYXA 4MYXA 2VWSA 2X1TA 3R8HA 4AZIA 3UCQA 2B0MA 3R11A 3B8IA 1R87A 4JTIA 5CJNA 1UKQA 4DHGA 4HA4A 4AISA 1W9XA 4Y9NA 4OUIA 3UG3A 1NSJA 4FIQA 3H54A 3VO0A 3R6IA 1SO3A 3QHNA 1FH8A 3SURA 1PIFA 4C7DA 1RLDA 3DHDA 2QJJA 5CAKA 3QLDA 1HO1A 1U83A 3TTEA 4NAEA 4IFKB 3VOFA 3AYRA 4JPGA 2FH8A 4JNMA 2VX4A 2H9AA 3RX2A 3WD1A 4FLQA 2ZDSA 1A5SA 4GISA 3NSXA 1CX9A 3PZGA 3WD4A 3HPSA 3NSMA 2VYOA 2X16A 1U30A 4DUVA 3LCFA 1EX5A 3B9OA 1W3HA 3E6EA 5CPNA 3FSUA 2X0HA 2BFGA 3KRUA 4W7UA 1NDWA 5BYWA 3OQEA 4ZE5A 4AWSA 4RPPA 3P0XA 2VXNA 1E1CA 2ZADA 4KCVA 3HOJA 3CZGA 2Z2UA 1ONRA 2QGHA 3EOUA 3ZXWA 2V38A 1Q6DA 4QX4A 4QBXA 5EYWA 4UTTA 4EX4A 4C5YA 3BMVA 4IGHA 2VC9A 5DMNA 3UPWA 1HFBA 1KV5A 1WDQA 3P14A 4FOKA 3C0LA 4JHMA 3S83A 1RV8A 2FDSA 3K1DA 3B8WA 3W25A 3WLOA 4HVXA 1F76A 2UY4A 1FY6A 3S0CA 1EP1A 4RZ5A 3F5LA 1UJQA 3LLFA 4OVXA 1GVOA 3WDRA 4QDMA 3QMSA 4UTHA 3QGVA 1RHCA 3H55A 3DI1A 4CD7A 4ZO7A 4NAFB 3TYAA 1DL3A 4CNPA 3BLOA 2CBIA 4FXRA 4Q6JA 1I75A 2R14A 3EX6A 4HU3A 3DHFA 3LX9A 3L4UA 1LRQA 3GKFA 2YSWA 1CXLA 3RPDA 3CQJA 3GU1A 4TTGA 2X1IA 3LDVA 2G3MA 4C6EA 2PDCA 4GVHA 3CAQA 3M1ZA 5FL1A 3CV7A 3O8AA 2ACUA 3RGTA 4E4UA 2WMFA 3WNKA 3W0KA 4O54A 1R2SA 2YCEA 2OSXA 5TNVA 2A3AA 5XIAA 1VIWA 4PRRA 3MI2A 2REQB 4AZBA 5E6YA 4ZO8A 3PPGA 1HKKA 2V68A 3R0UA 4NZJA 3DEQA 4E4FA 3TCSA 3AWNA 3NM1A 3PJXA 4EWND 3VNDA 2DT3A 3AFBA 2WMKA 1VZWA 3UZXA 1UJPA 1MUMA 5GNZA 2AQWA 4AEFA 4BF7A 3FGCA 2WZEA 2Y61A 3VZYA 4LCSA 3EXRA 1FX6A 3NXFA 4CD4A 3VINA 3WN6A 5K4ZA 4CCEA 1H0GA 5E5CA 3LPOA 2IUZA 1V6YA 4Q4SA 2ZZ5A 3HQOA 4RDVA 1BAGA 1J79A 1W17A 1J96A 2OZ8A 4RE4A 3H6OA 3QFEA 4OJYA 1GT8A 4FR6A 3UZWA 3HMCA 1GG0A 3PY2A 2F2HA 3AUJA 1KM2A 4AIUA 4MWAB 3TP4A 1G4TA 3TJXA 4R33A 1YNYA 3C2OA 4XV0A 2QDHA 2PDPA 2NV1A 1KBIA 1S2AA 2QJGA 3A3WA 4IG2B 3BOLA 1MEHA 2YJQA 2QEZA 1RY8A 3PZNA 1OEPA 3W26A 3TN5A 2XFRA 3EWZA 5AFDA 1XGZA 4GI6A 4S3JA 4CNNA 2G8ZA 5CC3A 2XSXA 1N55A 3ELFA 4GKTA 3DFOA 1LL7A 1K9DA 1NOWA 3HBLA 1ZSXA 3W22A 1HVQA 3MJMA 3MUAA 4FB7A 4LV4A 5I3IA 1UR0A 1BYAA 3R25A 4NY2A 2J7EA 3S5OA 4OT7A 1EJ7L 4CUCA 3GNDA 1OX4B 4EIVA 3B0PA 3D3AA 4LUSB 4R9XA 4MNKA 3G1RA 1XLAA 2EG6A 4UZUA 5I3GA 4D6JA 3W7QA 1M9HA 3C61A 4GIAA 4GQGA 2VZOA 1QBAA 1SFJA 3TEVA 1DJWA 5CZ0A 3UJEA 5DO8A 1U5JA 1O4UA 2ZA3A 1VLWA 3LGEA 2WZTA 3UR2A 2GOKA 5JQ9A 3KVJA 5IXEA 5FA5A 4M6VA 4KW2A 5A6BD 2E4TA 4MJZA 1KM5A 1UW9A 2OB3A 1UUOA 3MB9A 4A8LA 1UYQA 4CGTA 1TQXA 3QQ0A 4M1RA 3L23A 1GJPA 1QI4A 3E2SA 3C5QA 3H26A 4JTFA 1Z6KA 4D71A 1KFCA 1VYPX 2J7FA 4LAZA 1QTWA 3H2NA 3EWUA 1KBJA 3TTOA 1R0MA 1O6IA 3I6TA 2IPFA 1FHLA 2C14A 2XM1A 1UWSA 3AZTA 4NP7A 3CHDA 3QV9A 2YKKA 3LHWA 3WFZA 1UZ4A 1ZNNA 2AKZA 3IVSA 2VM8A 2Q09A 2OYMA 3H23A 3Q67A 1F3XA 3GTFA 1P0BA 1UASA 2PZ0A 3LPPA 4Z1DA 1G94A 5AC5A 4DO7A 4HHHA 1LF1A 4DYKA 1A47A 1VFMA 5LIXX 3ZR6A 4AZ5A 1KW1A 4CNTA 1DJYA 1RLCL 2Y7GA 6A3HA 1QI0A 3TTQA 1THFD 3IUHA 2Q8XA 3S9ZA 3BCJA 1TTPA 3L4ZA 4F8XA 3CO8A 5C55A 2AMXA 4IIEA 1TUXA 4O1BA 3CPRA 1FWRA 3TYZA 4IQJA 3VGGA 1VJSA 1R9YA 3MSYA 4AD1A 1TPB1 4GOAA 3I7QA 4W5ZA 4ADSA 4M19A 3PTDA 3ZR5A 1Q7ZA 2Z24A 3CPGA 5FEXA 3TMQA 3GR8A 1XYMA 4H1ZA 2DJXA 1B3WA 4QJ5B 3VUSA 2J74A 4CCDA 1DHKA 1EXPA 3ARUA 5E09A 2QPSA 1NM9A 3LZ5A 3JR2A 4A35A 5C2GA 3W9ZA 4QEEA 1BSLA 2D69A 4AZGA 1LWHA 2OCZA 4Q22A 4ATLA 1VEPA 3BG3A 1XYZA 3PZUA 1NWRA 3PSVA 3L5MA 3Q2DA 5EMMA 3WLQA 2ZX8A 1WO2A 4DWSC 4EACA 2PU1A 4BQ4A 1OT1A 1VYRA 3W29A 2QCCA 5C9XA 5ABTA 2IKGA 1ZP3A 1BQGA 3W88A 3M7WA 2HBXA 2GQ8A 3VILA 1RK6A 5LNRA 2EJ1A 1BD0A 2L5HA 1VP5A 4O13A 1T41A 4TMCA 3GFYA 1FH7A 1EP3A 3LV6A 3WJZA 2HWGA 4IXXA 2TMDA 1KRCC 3LV5A 3RJYA 2ZRWA 5HBFA 1F74A 4P61A 3U48A 4W86A 4QG6A 3AI0A 1GVEA 4C7GA 1XFBA 1V6WA 2E7FA 2OEKA 3IIZA 2XN1A 1UD3A 3CBWA 1XYBA 4X3ZA 1VEMA 2BVYA 3PAOA 1E1EA 5CH9A 3KWXA 1IEXA 3JZUA 4I7WA 1EJVC 3GY1A 2FVKA 3NYDA 4MOZA 2OKTA 3R89A 5C8BB 1UP2A 3FXYA 1WZAA 4L1WA 3O07A 4FPSA 1CGWA 4AVFA 3I4EA 5D4YA 4XZLX 3GXNA 4NZ1A 1PCWA 2FGBA 4Q8VA 1SSDA 3C2RA 3OZOA 4LVAA 4MSSA 2WCAA 4X0NA 3OLIA 4AWTA 2BHYA 3WLJA 2A6NA 3LMYA 1LYXA 4ZOCA 3AHVA 1R2RA 3UVIA 3GC2A 4GCXA 4QM1A 4WXYA 1F8MA 4O0ZA 3WLMA 1KXQA 5LA1A 3FHAA 3LHZA 3P82A 4NAEB 4GO8A 1PAMA 1ZP4A 1RPKA 1VCGA 2H9AB 4YVVA 5EMJA 3NZRA 3W1LA 5A8QA 7A3HA 4C91A 3O7UA 3BOFA 4GUHA 1MQPA 2GDUA 2WAGA 1XKJA 1CLXA 3QQWA 3LHTA 4MIMA 2ANUA 2WQPA 3A6OA 3DCPA 4AX6A 1I8JA 3TOPA 4ENLA 3KW3A 1TFVA 4GC4A 5BXRA 4C6OA 3O2LA 4WVXA 3KXQA 1E1CB 1G69A 1AG1O 1GVFA 2C15A 2HS6A 1LM1A 1SO4A 1QXLA 5GQBA 2V0TA 1AMKA 4E2BA 3P84A 4DLFA 4NYYA 5C5YA 1WUEA 3S47A 4GQQA 2QUVA 4XX6A 1W9UA 2QS8A 4L4LA 1U1JA 4RK8A 4IXHA 1JZ8A 2FZ9A 4IX0A 1CW2A 3RNDA 3THQA 2XISA 4AWUA 3B9AA 3V0TA 4L4PA 1E0XA 3PPFA 1UHVA 1GORA 5M5DA 3RITA 3CTLA 3EWYA 3HU7A 1JXJA 4M6PA 1FCBA 5BZAA 1BGAA 2CBJA 1C3FA 4JTLA 3AZRA 3NQ6A 1AODA 2UV8G 1JZ4A 3BAYA 2J47A 3IGUA 3VZXA 4O17A 3VNZA 3ABOA 1D7FA 5A69A 3II1A 1X39A 4YVXA 3CPUA 1QNQA 3FAXA 4DF1A 2HRWA 4ZB0A 4HNVA 1ML1A 3RG6A 1P6BA 4OGZA 1GQKA 4I5RA 2CHOA 5AN7A 3F4DA 3WQ8A 1EIXA 1AW2A 1LT8A 3UEQA 3GIYA 3UNDA 5J5DA 3W02A 3ZVHA 4IIFA 1IEIA 3VMNA 4IFOA 3G0SA 3I6RA 3SRFA 4Q4OA 3OOQA 4JFVA 3NIYA 1J0ZA 3W1TA 5D05A 1EJUC 1XD1A 4A6GA 1JDDA 1G1YA 2PWHA 3G1DA 1X1ZA 2AAMA 3OQ8A 3GVQA 4JZ5A 3CUGA 1TZ7A 3CWHA 3A23A 2HVNA 4PTNA 1CYGA 1GWJA 4ZENA 3W7HA 3GH5A 2I1OA 2ZRYA 3UR5A 2XGZA 4I8DA 3CQ0A 2WZHA 3MBDA 2BXZA 4K3ZA 2O9RA 4B3KA 1CBGA 1TV5A 2XJ7A 1SJCA 2I5IA 3IGHX 1CXHA 1GOWA 2C7FA 3EMCA 2ZIDA 3RDKA 2P8CA 3HF3A 5BNKA 3VVGA 3TYCA 1I9CB 3TW6A 1QFEA 3C86A 1BYDA 1L6FA 1OD0A 4NSBA 1JYVA 4GUGA 1EOKA 3G1VA 1UQYA 2WHKA 3FHQA 1TIMA 1TPEA 5CPSA 4RNHA 2BSLA 1GTHA 1EA9C 4QG9A 4UTWC 2GVJA 1HP4A 1W9PA 4D6DA 2J77A 8TIMA 4CKQA 4LW7A 1YIXA 3UA4A 5KMYA 3MDUA 1VCFA 4EP8C 1FWGC 2RDWA 1JEZA 4B15A 4C65A 3TYBA 3VOGA 3CMFA 4S2CA 4LOCA 4JTGA 3SY1A 2NXGA 4DBDA 3CH9A 1C9DA 3MZNA 4LAUA 3EOOA 3EA1A 3H12A 5LXEA 1PHQA 3QV8A 5A6LA 4LUTB 1Q6FA 1TRIA 2HCVA 1TYGA 4RUBA 1KQZA 1HT6A 2WC4A 1P1MA 3U8GA 4AC7C 4PL1A 1H3GA 2FVLA 4WF7A 3WQFA 3R13A 4MADA 3KOYA 4KFPA 2NX9A 1PX8A 1UBSA 1ADDA 3M47A 4O1AA 3NQBA 2E1WA 1JZ6A 3E0LA 4ACZB 1P1XA 1IZKA 3AHYA 3CHCA 3L5LA 3NQCA 4H7CA 4JTRA 1TZ9A 3BANA 3QBUA 1NY1A 3WK0A 3LY0A 1QATA 3THCA 3ZOAA 1PS9A 5HJYA 3U0HA 3GM8A 3VIMA 3T2QA 2QF7A 3MHFA 1N2VA 4QDWA 3DENA 1B3OA 4S38A 3WNOA 4RNFA 5HWMA 1I1WA 3UJ2A 2NX1A 1O1ZA 4U5KA 4QROA 1EJXC 2PRMA 3EDDA 3G1YA 1EQCA 2OG9A 4XBSA 1S5WA 3KEHA 4YTUA 2F38A 1BLIA 3ZZ1A 3VKJA 4AMAA 1EKOA 3W3OA 4KQNA 2PTWA 1FKWA 3UG5A 1XD0A 2VNCA 1YTKA 1FWSA 4LT9A 2PDIA 1EGMA 2OGYA 3CZKA 4DUXA 3V5OA 2YBTA 2P3ZA 5FF3A 3ONBA 3AYTA 2FB2A 1HJXA 3NPWA 1V02E 1K4GA 3UWZA 3PULA 5HULA 2IQ0A 2VZVA 1HKMA 5D02A 4PEKA 5LA0A 5AZ0A 4GZ7A 3CB3A 3DYPA 3S6OA 2XIIA 2V67A 4Q8UA 1HG3A 3NDYA 4WUIA 2E6YA 3BURA 1H7XA 4M6UA 1V7YA 1H50A 1V3MA 4BI5A 3NQGA 1MYRA 2AGTA 5K9CA 3WNNA 3UZJA 2FB3A 4M3PA 3W6MA 4BK9A 4HHLA 4XKMA 1WP6A 5DT7A 1J10A 3MBFA 4LAKA 4XTDA 4U3AA 4QCFA 4OV9A 3TQPA 3WQPA 1TWSA 2C1IA 1MZRA 2JKPA 3IUIA 3TNBA 3P61A 4AEOA 5BRBA 3UWQA 4J1OA 2QKFA 2GJPA 2I9UA 2OMAA 1T7LA 5GPRA 1XGDA 1OWQA 3MHUA 4Z0SA 2Q01A 3K46A 4PMJA 3V5CA 5FF0A 2PDQA 5DFAA 4D1IA 4CD8A 1Q6CA 2VFDA 2ZWYA 3ITTA 3LPFA 4BS0A 3GAKA 5B80A 2XWEA 1RJQA 2KZHA 2J7GA 2WJZA 3A4AA 2EHHA 4IT1A 2NVDA 3WBYA 1S3HA 1BGGA 3CEUA 4DXXA 2G0WA 2QJIA 3QF0A 4RV8A 1I2NA 3PPHA 3M0MA 3U57A 1UD2A 1S2WA 4BQ2A 5K4XA 2HXTA 4PUWA 4C6BA 3GB6A 1UKSA 4JTJA 2C79A 1H1NA 5BWFA 1J5SA 5LNVA 1E3ZA 3GU2A 1PO9A 2YZRA 1EWDA 2YX0A 1KR1A 4P2VA 1R9ZA 3HJZA 1XIFA 3PK7A 3CT7A 1KRMA 2H8XA 2W0UA 1LORA 1PKYA 2ZE0A 1FUYA 3H53A 2PP0A 1XIBA 4KPLA 3BSHA 2XSBA 1MUCA 1P43A 3NO3A 1FWWA 4JEQA 1Q6OA 4MNMA 1Q8JA 1VBJA 3V3WA 1HL9A 1G67A 1GKPA 4IQLA 3ARYA 1KM6A 3URQA 3CUHA 2VX7A 3PBYA 1XBVA 4TXEA 3WNMA 3OLDA 3FJ6A 2BGSA 3W7PA 1UOKA 2HE8A 5G2IA 4FNUA 1IR1A 1PUDA 3UXKA 4EANA 2PTDA 1ONWA 3PZTA 4PODA 4U10A 3KBWA 2PURA 1OGSA 2WPGA 2H90A 5C70A 4Y96A 3CT2A 4DBUA 2WM0A 5LGXA 4I7UA 3H24A 3N9KA 2XIBA 1VAHA 2X2GA 2WW5A 4LAOA 4BI6A 4EXBA 2PDUA 1SSGA 5BRPA 4MKNA 1F2JA 3GUGA 4X9YA 4B2DD 1LDCA 2FPVA 2ZRZA 2V9DA 3DYOA 3I65A 3CWNA 3LERA 3RMEA 3CEPA 1BWVA 2WQDA 1M01A 4Y7EA 4Z42C 3BV4A 4UR7A 4GNVA 2WNZA 3BCFA 2VEFA 1EC9A 3IV8A 4I9AA 4U31A 2PBGA 3F4CA 1IWPA 4D6EA 4CVWA 5FAJA 1FP8A 5CSUA 2WYSA 4DWSA 1LBFA 1EH9A 4C6JA 4XBJA 5F2IA 4KIRA 4C7FA 2FMOA 1MQRA 4BJHA 1KCZA 1RA5A 5CBJA 5FEPA 4IHCA 3WH6A 3G1AA 1GOKA 3L0GA 2HVOA 1K9TA 3MT1A 4AHQA 2I16A 3LXCA 4W9TA 1KWGA 1JI2A 1VF8A 2YXOA 1UC5A 2FZ8A 2Y7EA 4KEZA 2BY3A 1W1IE 1JUEA 4PCFA 3R5EA 1RK5A 4K38A 1RR2A 5C9ZA 2XFFA 4GUFA 4PMQA 4GJ1A 4UFHA 2CLMA 1IQ8A 4F0KA 3BO9A 4XO7A 2IKJA 5ECVA 3KCJA 3C2VA 3W01A 3L68A 5I7GA 5AYBA 2O56A 2DZSA 1UR2A 3H2OA 2C19A 4IIHA 4K36A 3UY7A 1DIOA 4JR5A 3SECA 1G9HA 3LCHA 3VK5A 1LCOA 2IKHA 2PB1A 4LXFA 3THUA 5J04A 3RM8A 3W70A 4D8LA 5HANA 3MI6A 3REQA 4HGXA 1G4SA 2QHAA 3T4WA 1R47A 1IWBA 4F79A 3FVDA 3UA3A 3H7RA 2OFJA 1UBPC 4JBRA 3VPLA 5KITA 5DT5A 3A24A 2Z27A 3OIXA 2W91A 2ZZ3A 1R3WA 5LZLA 4Q4RA 4FX7A 3B03A 1CB7B 1QVBA 1MFVA 1Q6QA 2A2IA 4Q3MA 3L4VA 2FLIA 3N9SA 2OYKA 1LRNA 4AY1A 1XIEA 4UQ9A 1C91A 3D3FA 2Z29A 2OLHA 1W1B1 4XG1A 3WLSA 2D24A 4Q4MA 2V3EA 2NX3A 4KCUA 5KTLA 4P8XA 5DQPA 3WLNA 2PP1A 3I6EA 3DZ1A 4F0MA 3PWGA 1YEYA 4AVNA 4GIEA 5G2HA 1XIIA 3SUWA 1B0IA 4MUZA 1JVNA 5AY7A 1P5BA 2WXDM 3VDBA 1YE4A 4C1NB 1PYMA 1V3HA 5HINA 3E0VA 3M4HA 1GKRA 5F1VA 3TOYA 1O7AA 1QMLA 3MTWA 4Z0JA 1E1FA 3PN8A 4Q8OA 5DANA 3VX1A 3P3BA 3V35A 1HKIA 3RILA 1HXJA 1TR1A 2DV0A 2WPBA 1E4LA 3A64A 2NV2A 3VAVA 1SW0A 4RJEA 1ITUA 5BRQA 3WF3A 4UFKA 4AYGA 3S9IA 1P6CA 1DJZA 3OA5A 4UC5A 2HDJA 4ADUA 3CAWA 1AJZA 4A3QA 1T0OA 5U7SA 1M6JA 3B3DA 3SBFA 2WMIA 3C0JA 4IPIA 2JIWA 2HISA 3ABXA 1G6CA 1YBQB 4LY8A 4E6MA 2XH7A 1RJRA 3PPCA 3A4XA 5BWAA 4D2JA 2IMRA 1XICA 5D8WA 4RL3A 3C2EA 3OP2A 4ES4A 3A22A 3GAYA 4HPHA 1A4LA 4JQAA 5I3FA 1YXDA 4DELA 1JZ3A 1DP0A 3E2VA 4R3UA 1QRQA 1XFCA 5SWUA 2JKEA 3E3HA 1WDSA 2G3IA 3IV3A 3VXGA 4K7YA 4PUDA 4Y9PA 1MI3A 3BSMA 2AMGA 3NQ2A 2BMBA 1DJHA 1HUVA 4JS3A 4O0QA 4IISA 4I3GA 3B0YA 4DN1A 2C91A 3BZGA 2PWVA 4QQUA 4N2YA 1D2KA 1TVLA 1AUSL 4UTWA 3TQ0A 1ELSA 4NXKA 3W00A 1NOFA 3W2NA 2DSUA 4WDTA 4QQ3A 2VEIA 1DIEA 5JBDA 4KESA 4IP7A 3B8DA 3AYSA 2FTPA 4WX2A 5TIMA 3F2DA 2OWCA 1Q66A 3A9IA 4JTKA 5HR6A 4QNEA 2FGLA 4G1NA 4L61A 1FWFC 5J5RA 3V36A 1QT1A 3NEHA 1PHWA 3HM7A 3CWOX 4QGCA 5CG7A 1H5YA 3VKAA 1V3LA 4LH8A 3MMTA 3I10A 1D8CA 3STFA 4DEFA 3VC5A 3BAJA 1JPMA 2E9MA 3EZ4A 5FJPA 1ZCCA 2C1HA 4AQLA 3BGGA 1HQTA 3WQ5A 1FWBC 1LRTA 3H2AA 4HJFA 1B5TA 1I1XA 5DELA 3QVQA 3FYOA 1OK6A 2TPSA 1D3HA 5FJTA 3V18A 4B4HA 2G4JA 4KS0A 2Z1KA 3W1MA 4O4WA 3ZSSA 3VIJA 3ARQA 4TX6A 5CZTA 3CLMA 3GC5A 1JG9A 1MNZA 2XINA 2Y5JA 4C1LA 1NTHA 3V0UA 3EOLA 4IX2A 4NRSA 1VFUA 7REQB 2DP3A 1V0NA 2E77A 2Z1WA 5LXXA 2YCLA 2VMFA 3JU2A 3M0VA 3GNOA 2NQHA 3BLFA 3RLHA 2OQYA 5HNUA 2JALA 4KFNA 4U2ZA 4W8BA 1ICQA 1N8FA 1ZBKA 4HNUA 3G8EA 1AL7A 4BKNA 4PRTA 4DAFA 2PEVA 1L2QA 4O1CA 2GK1B 1MEIA 4WSJA 5KZDA 4EF9A 5ABHA 2P0OA 1A80A 1N8WA 2DSWA 3ITXA 1JJKA 4IMGA 3CHFA 2A21A 3LMZA 3FS2A 4CQCA 1JULA 3MANA 4HNLA 2CKRA 3TFCA 1M03A 1GYMA 1I2OA 4F9DA 2YCJA 3QC0A 3ZT6A 4ZXLA 5G1TA 3VIFA 4WY0A 1ONXA 3O1NA 5H8MA 1E0WA 2V3FA 2E09A 2R1PA 5CBIA 2FQIA 1UPPA 2J13A 3IUDA 3NL2A 1WOAA 4GFIA 1OADA 2Q3OA 2YW4A 5AB3A 4R9OA 1AVAA 2ISSA 1HVXA 3TQKA 5LGZA 1FWJC 4UNKA 4QR6A 3JRKA 3LBMA 3CASA 3OLGA 4MB1A 6XIAA 2DEPA 1WXYA 1A5NC 1HGWA 3PUGA 1Y0EA 4LTSA 3SGGA 5TQLA 3LK6A 5REQA 3WUBA 3DFQA 3EX1A 1SR9A 2O0TA 4L7ZA 4X22A 1NQKA 3VM7A 4UNIA 3P74A 3UWYA 2DH3A 2PWEA 4JN8A 2ZCGA 3RF9A 4FX8A 4TVUA 5JUVA 3QRHA 5IHRA 2CZDA 3MYOA 4IF2A 3GXIA 1QI5A 1X6NA 5C2CA 3XINA 3TMLA 4GNJA 2X1UA 3EEZA 3BG9A 3OGVA 2ZRUA 4XAFA 4B91A 3CL6A 1KXTA 2XFWA 4JL1A 3QGAC 4LY4A 1UR4A 4OOZA 8XIAA 3TC3A 2CEQA 4KWUA 3UP8A 1W6TA 3W1UA 1BWLA 1NU5A 1FXQA 3NZGA 2OWWA 1RVGA 3W83A 1KCLA 4XWUA 5T91A 1XGEA 1CZ1A 1XLHA 2GVLA 3C4UA 2F7FA 4UQDA 1HJVA 2XGBA 1GJWA 2H3BA 1XDLA 1CIUA 1W5NA 1J0IA 1QK2A 5G5IA 2ZX6A 1JD9A 2R1KA 1XUUA 4GXMA 1JNEA 2IXUA 3QR1A 4B5TA 4YLWA 2WM1A 4GMEA 1F9CA 2E25A 1KM4A 3DBNA 3O05A 4FHAA 1OZMA 1DJQA 3PZVA 1RBLA 3E5BA 3PUEA 2ALDA 4GZJA 2NQZA 3N6JA 1PTDA 3SCSA 4O57A 4OQVA 1TUFA 4GI4A 1QW7A 4YPJA 5DMLA 4KWSA 1QI3A 1EZ2A 2GGJA 1Y65A 2PCEA 2BDQA 4O1EA 3WL0A 5IFPA 4GZIA 1VHNA 3GH7A 3DIPA 1JF6A 4J40A 5DBTA 4ZQMA 1ZBWA 3A9BA 4WOQA 3REQB 4WJXA 1PXGA 1YHTA 1NVMA 2OO6A 1BVWA 2ACSA 1TX0A 1AD4A 1H09A 1W5MA 1O1HA 4LUYA 2IKIA 4FOJA 1UZHA 5AC8A 2ZX7A 4Q32A 1XIDA 4ORIA 4GGHA 4UTIA 3AUOA 1MEWA 4LVDA 4PGLA 3KOZA 4AG0A 3YPIA 4W85A 3UGVA 2PF0A 4WQ6A 6TIMA 1TWDA 3TR2A 1POKA 4AH7A 4B5VA 3ES8A 1XH2A 4ZTXA 4HN4A 4L9ZA 4DBSA 4JTSA 3UERA 3UWUA 3WQWA 4P8VA 3MDWA 3MU7A 2GVYA 1GEHA 4BF5A 1B30A 5EU9A 1BXBA 2FFIA 2XGIA 2ZUWA 4GNKB 1GQLA 1DJNA 2WB5A 4G6CA 3M0JA 1HKJA 4GUIA 4LNYA 4S3GA 2NLIA 5C54A 1WXZA 1B3ZA 1FDZA 2QJHA 3EMZA 2VEMA 1RY0A 5HR7A 2X40A 5I3KA 3QPEA 2EKCA 3DBPA 2CZFA 3HG4A 2HPMA 2E8YA 3QLLA 1ISYA 2QCMA 4C6LA 2G3NA 3S1WA 4PC8A 1I45A 3CZEA 1ZB5A 2ZOXA 4UFIA 2YZ5A 4K7VA 1OABA 2Q02A 3AJ7A 3PBVA 4Y9AA 4JNYA 3NPUA 3N1AA 2PS2A 4UR9A 4A3RA 5CEWA 3BSGA 3TLQA 2GJLA 1ISVA 4E38A 2SFPA 3ZJ7A 2NXIA 2WCGA 1KKRA 1YRRA 1XLBA 2VFGA 5LIKX 3HIJA 2VFHA 4QE5A 4WCJA 5FJUA 4OOUA 2O9PA 3UR8A 4ZOBA 5A6SA 1OCBA 2WBGA 2DUZA 1TZZA 4C6QA 5H91A 3KAOA 2A7NA 1U2YA 3LGGA 2RHGA 1YW1A