3DBPA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 6-nh2-ump
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
b'KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal Structure of Human Orotidine 5'-Monophosphate Decarboxylase Complexed with 6-NH2-UMP
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dbpA00
5EA9A 3NQ7A 4RK8A 1GTHA 3MHFA 3QPYA 4HNTA 4MFEA 4DPPA 1KFLA 4HSOA 1FWWA 1XBYA 2RFGA 1G69A 4WY0B 3UY7A 4IMGA 1KM6A 3N2MA 3KRSA 1A50A 3EXTA 2Z2UA 3ANYA 4MYXA 3UWYA 3TNOA 4CNNA 5DN1A 1OK4A 1TYGA 3W7LA 4UR8A 5KZEA 1W0MA 2UV8G 5K4XA 3G8EA 4YXGA 2ZA1A 2OCZA 3LM7A 3P8JA 3WJZA 3TK7A 1X8FA 3BLEA 4OHQA 1W5NA 3ABRA 1OF8A 3LHVA 3GB6A 3CEUA 2ZRWA 4RXGA 1L2UA 2CLEA 4YMZA 4RLIA 3LCGA 1KBIA 2QCDB 3FJLA 3C61A 1KM0A 3NG3A 1AK5A 3U6WA 1JR1A 3H55A 3W1UA 4UTHA 5F1VA 4DBDA 3Q94A 3O16A 2C6QA 5GVJA 2NLIA 4LUJA 3L5LA 3B06A 4E0CA 5A8GA 4OV9A 1HG3A 2PRHA 3EKZA 1K7FA 3M1ZA 2OZ0A 2VEKA 3QFEA 3B03A 3N3MA 1YPFA 3T55A 5HQEA 3EWYA 4UUIA 3M5ZA 4IX0A 4UFJA 4QQ3A 4N6EA 4JN6A 2Y89A 2H8ZA 3LV5A 3DAQA 1RR2A 3OVQA 1SW3A 3ATZA 4K8EA 1ONRA 1RV8A 3UZJA 4MKNA 4Z0SA 3NVTA 2YPIA 4WUIA 4OE7A 1LROA 5LHEA 3LTYA 5I3FA 2G95A 4UMCA 1Z41A 3EB2A 3SZ8A 3DI1A 3S1VA 3W7CA 4DF1A 5AHLA 1UBSA 3RFAA 2JKAA 3W7DA 2NX1A 1H7WA 1HO1A 3ABQA 3MJYA 3WK2A 5DBTA 4KFOA 4FB7A 3BLIA 2X1SA 1KTNA 1OYAA 2YSWA 3G0UA 3A21A 4ZQPA 5HULA 1GEQA 1GYLA 1RD5A 3FLUA 5KSWA 4WD0A 2NUXA 2W6RA 4I9AA 2V8ZA 3AO0A 3GIYA 3IGXA 3PS7A 1VR6A 2HS6A 5C5YA 3CPRA 5E1QA 1CW2A 3WK0A 4IMFA 2VFEA 1L6YA 1VGAA 3I65A 4EF8A 1SZFA 2QCHA 1Q45A 3L5MA 4NNBA 2YCEA 3IVTA 3KVKA 1KFKA 3K30A 4KWVA 4JYFA 5G2HA 4FO4A 1GVRA 1JULA 5AFDA 1B3OA 2ZA3A 3W23A 4P2VA 1C8VA 1NSJA 2Q3RA 3SY5A 3QJAA 3PG9A 3EWBX 5HNRA 4BWLC 4CNOA 1P4CA 3VNDA 4MVAA 4MYAA 4A21A 4X22A 2Z1BA 2WSRA 2TPSA 3DFTA 3LHZA 3SGUA 3QEZA 4DF0A 3TXZA 4ZVJA 5KTLA 1O5XA 2B4GA 1K3UA 2A85A 4FNSA 3TE9A 1YTEA 2A5HA 2RDWA 1Z48A 3WJYA 3P81A 2F84A 1IIGA 3M16A 3GAYA 4EVZA 4XKYA 3THAA 1THFD 3NPUA 1OK6A 4JY9A 5CZSA 2A21A 5A5WA 2YX0A 3OHIA 3R5EA 1QOPA 1KA9F 4QNWA 1G4PA 1IXPA 5LZLA 2PE4A 3HJZA 1TO3A 1W5PA 2C0AA 4MJMA 3TJXA 3GXTA 3P60A 1ZAHA 4UCGA 4MZ8A 4B5NA 1F76A 3W07A 3P61A 5H2ZA 5D33A 4WXYA 1C9DA 1SFJA 3OG3A 1TREA 5DY3A 2E6YA 4KFPA 3NQCA 3RU6A 1OX4B 1K8XA 1YDOA 4Z1CA 2X30A 5TBOA 1UCWA 1FWRA 3NM3A 4XTIA 3CT7A 3NL6A 1FDJA 2BWGA 2CLFA 3DH7A 5K2ZA 3B0UX 1VH7A 2YW4A 1A53A 1JCMP 3NQMA 4WY0A 3QQ1A 1CX9A 5AHMA 1H61A 4JTUA 1XL9A 2HSAA 4O4VA 4WX2A 2V81A 1JCLA 3NL2A 4Q32A 4C1LA 1NEYA 5KZMA 1VLIA 2ISSA 4XBSA 1OFDA 2VFFA 2RH9A 1A5SA 3MI3A 5C2XA 4C1KA 1TTIA 3N14A 4LNYA 3SSJA 5G1TA 4JTHA 1HFBA 1A5CA 1QPQA 1UASA 1MXSA 2HS8A 1ZJIA 3GAKA 3KXQA 1WQ5A 3DI0A 4JX5A 1VQTA 4LT9A 2HMCA 2E5CA 4QJ1A 1S5WA 3H53A 3IIXA 3TA6A 3W22A 3DFNA 3B0VC 1GVFA 2GOUA 3GDRA 1WAUA 2FPYA 2LLEA 2RKXA 3DHDA 4LVAA 2QCDA 3MWAA 4BWLA 4N9CA 3DU0A 2WNZA 1I8JA 1W37A 4TO8A 3BG3A 4ONVA 4GXMA 1J2WA 1M7OA 2NXIA 5BRBA 4O1BA 3L2IA 1OFAA 5DY2A 2ZRYA 3SFKA 1LOLA 4FX7A 1UUMA 3UWQA 4HSNA 3W88A 3T4CA 3EXSA 5D2WA 5LNWA 2XN2A 3FYPA 1XDMA 5EMUA 4LS0A 4WZHA 2Q8ZA 1F5ZA 1O5KA 2Q8LA 3R13A 1N7KA 1W1ZA 5EKYA 3S8HA 3WFAA 2EPHA 3NQAA 3G18A 1LM1A 3W7RA 1EX5A 1XDLA 4PA8A 4EF9A 2E68A 2NV1A 2NX9A 4O0ZA 2NUYA 2VFHA 2B7QA 1EWDA 2WJZA 2VELA 1WYIA 3GYEA 2DJXA 1EP1A 3R12A 3WJSA 2DP3A 1R46A 1PHWA 1YTDA 3GZ3A 3BK0A 3TAKA 1PHQA 4GWEA 5LNRA 3G1XA 1JCXA 1E51A 4FXRA 3W7MA 3OVRA 4PH6A 4NNAA 4I7VA 4AF0A 5G1YA 4M19A 1K8ZA 3M47A 2GJNA 2V2HA 1QPNA 2NXHA 3L9CA 3OA3A 1RQEA 1YXDA 3KAOA 2J9YA 5LNSA 3LERA 4P61A 2EHHA 4FIQA 4JXCA 3W1XA 1PCWA 4PC8A 2WSQA 3LDVA 5DXXA 3TQ0A 3ZFHA 2TRSA 1TCDA 3G3DA 3TFCA 2ZRZA 2BZNA 3FKKA 4N6FA 3UWWA 2PRLA 2PURA 2ATMA 3OEXA 3QW3A 4UTJA 3VFLA 3N34A 1FCUA 1KBJA 5BNKA 4GRSA 2ZRUA 1GPWA 1F2JA 1LCOA 3QMTA 2BXVA 5LGZA 5TIMA 2JKPA 3HMJG 4IXXA 3M0ZA 2ZZ6A 2BTMA 3V75A 1VLWA 3NEVA 1TJRA 6ALDA 4R53A 2PCQA 4UMBA 3O8AA 5CPMA 1Z44A 3I7QA 2B7PA 3LOTA 3E96A 2RHGA 1P5BA 4IOTA 3STCA 5EYWA 4LWWA 1ZFJA 3NO5A 3MHUA 3N19B 4X2RA 3S1UA 2DZVA 1F6PA 3W7OA 4BK9A 2VENA 2QF7A 2FJKA 4S1FA 3DXIA 3TROA 4UTLA 1SW7A 1W5OA 2E77A 4JTSA 4UNKA 1OX4A 1H51A 2BX7A 4QAIA 4IXHA 3R89A 1DOSA 3C52A 3P82A 3N2XA 4WXZA 3W71A 3QPZA 4IMEA 5BOOA 2DZPA 4WOZA 2GVJA 4NZJA 4AHOA 2B7OA 3IRDA 3GNNA 3P80A 2VEIA 2J9ZA 3TAOA 4LS2A 1Q6RA 3OVPA 3UD6A 3GR8A 3UNDA 2ISWA 1ICPA 3PC0A 2OMAA 1D3GA 4DELA 3TUUA 4FX6M 3GNDA 5FEPA 1DHPA 1WOBA 1XBVA 5HUOA 5LKYA 4CNPA 3F1QA 3MUXA 1LORA 4ZQNA 4MJZA 4O1AA 1X7FA 3A5FA 4XWUA 1JUKA 3QSRA 3KVJA 1GQNA 4QITA 3C4UA 3ZWTA 1WXJA 4K6AA 2QCMA 3CM4A 3O63A 3CHVA 5G2IA 3NPXA 1EP2A 4N2YA 3NZ1A 1RPXA 5IBXC 3HBLA 1D9EA 4Y90A 4UTKA 3NQEA 1DKWA 1WX0A 3L0GA 3NNTA 4OQVA 1H7XA 3E9AA 5LHFA 3W1PA 4BI7A 4MLJA 2NUWA 4AHQA 3TCEA 2J24A 1XBXA 3PF3A 2YR1A 3C56A 1F7BA 3HQ1A 4NJHA 4H6KA 3LCIA 2A6NA 1H63A 5CSSA 2J27A 2ZA2A 1YXCA 3MHGA 2QJIA 1LBMA 2V2CA 3MP3A 3LXAA 1NFBA 5DELA 5D32A 3NQVA 2YFOA 3I68A 1U5JA 2ZQ0A 1KM2A 3LI1A 3EWZA 3TC6A 5BMWA 4AWTA 3L0KA 2CFFA 3IIOA 5I3IA 1TMHA 2ZZ3A 3L68A 4N9DA 1XM3A 2XN1A 2TSYA 1LBFA 4JDYA 4HPXA 1J5TA 5AC8A 3UPBA 1QFEA 4O0KA 1GVSA 1QDSA 2JGQA 4RV8A 3G0SA 1MEWA 3NR0A 4Y9AA 3G1FA 5DCDA 3G0XA 4OGZA 3V1PA 1SO5A 4UFLA 4NQ1A 4NJIA 3HIJA 2GJLA 5D2TA 4N4PA 4XBKA 2V5BA 1TJPA 3QC3A 1ICSA 1DL3A 3W7IA 3MP5A 1VZWA 3NM1A 1W5QA 5BMXA 2V0TA 1B57A 1IXNA 3T40A 2CZEA 4KFNA 3W7PA 2V2DA 4I7UA 2ZTKA 4Q4KA 4O16A 1FDYA 3GLCA 2WQPA 3PULA 4DXVA 4ML9A 2A7NA 1WDWA 2QCEA 2RDUA 4CLMA 2ISVA 3NOEA 5G4WA 4TMBA 3GXPA 3W1AA 4IGHA 3LHUA 4UNLA 3TDFA 2E5BA 4H4IA 4ALDA 3W1MA 4JICA 4FEZA 3EX3A 4O50A 3PVFA 5MHBA 1LOSA 1KLZA 2CLLA 7TIMA 3PSVA 1ZENA 5G4EA 4XQ6A 1TIMA 2G5WA 2QUUA 3QF0A 3WK3A 3L67A 1K03A 4K39A 2AGKA 1NAL1 3FIGA 4H3DA 1AW5A 4NU7A 4Z1AA 3P7YA 1GVQA 1OFOA 4N9EA 3C0JA 1I2NA 4FNPA 2XN0A 4A2SA 1YDVA 3B0PA 3NYZA 4LY8A 2KZHA 2R14A 4O10A 3C3NA 3M41A 4BFAA 5CG7A 3LTPA 2ABAA 1H60A 1VHNA 4HHPA 4R7JA 5J5RA 4MPQA 1EUAA 1VYPX 3BGGA 5K7JA 3G22A 2VFDA 3BO9A 2OX1A 4A22A 1XC4A 4O18A 2E6FA 3G1YA 1FCBA 1EEPA 4AWSA 3NL5A 3H54A 4CQ9A 1AL7A 4BI5A 3LRLA 1KFBA 1K8YA 3P5ZA 1ME7A 3TC7A 4JTGA 4DEFA 2NWSA 5D04C 1H62A 1KLYA 3QSTA 4CQAA 3LTSA 1VCVA 4HKPA 3CWNA 5D05A 2H3DA 4ZQMA 3W2KA 1JRBA 1KTBA 5LSMA 1A5AA 3LHYA 3O06A 1I2RA 4JS3A 3BGJA 1TV7A 5CGQA 4POCA 2Y7GA 1GG0A 4M5PA 5LNUA 4Q33A 5AC7A 1UJPA 2QCFA 4HPJA 4PFMA 1LRTA 4EOUA 3W2JA 1IIHA 3CU2A 4S2CA 3C2EA 2VC6A 1NF7A 5EBUA 2YFNA 1SPQA 1N8FA 4IMDA 1R47A 3W76A 4JX4A 1LDCA 2QDHA 1EUNA 5AHFA 5FESA 1QO2A 3FS2A 2A6LA 2CZFA 4K36A 3WJWA 1EIXA 3GKFA 4M6VA 3CTLA 2CZDA 1VS1A 4MIMA 5DLCA 3O1NA 2FDSA 4WJEA 2E6DA 1F05A 4O17A 3QMSA 1OJXA 3JRKA 3GR7A 3PG8A 5FEZA 3S0CA 4PCFA 1SO4A 4UTUA 2DZSA 3LGEA 1W31A 1R2RA 3C2FA 1BEUA 1O95A 3IIVA 4A2RA 2ATSA 1GYNA 4QISA 1H7OA 3MBDA 3EXRA 1XUZA 3W2UA 3ZWSA 5IM51 1QMLA 1MZHA 1OFEA 4Y96A 1TPEA 1ZHAA 4JTLA 1LZOA 1EWEA 4K7YA 5FF0A 3LLDA 4UMAA 5EL1A 5CPNA 2WNQA 2VFGA 4FNUA 4NT0A 1L6SA 3C2RA 4MZ1A 2J88A 1Y0EA 2CLIA 3PAJA 1KM4A 4NUWA 2GVGA 5CZTA 2C18A 1DORA 3LXBA 4MFDA 4MOZA 3TW6A 2FTPA 4YLWA 3BG5A 4M6QA 5CPLA 2YZRA 3KRZA 3W1RA 3M9YA 2NXGA 1QR7A 4IPJA 1OX6A 4MUZA 1XBZA 4O12A 1ME9A 1NVMA 3FJ6A 5D38A 3W3OA 5AYZA 4JTIA 2PRMA 2JGYA 2ZDRA 3UQNA 3A24A 4DQWA 2Y7EA 3OBKA 1T96A 5F4WA 1UB3A 3LRKA 4UIOA 4ZZ9A 3LV6A 2JKEA 5HUPA 1T0OA 3B8DA 3STEA 1ZY9A 2WO5A 3BV4A 4CQ8A 4JNMA 5K9DA 3Q2DA 3A9IA 2TMDA 1SUXA 3DKLA 1QO5A 3LBMA 4AH7A 1N55A 3O6YX 3SW6A 4UTIA 3TQKA 3W7JA 2GUUA 3QMRA 5D02A 4NJGA 3M6YA 1D3HA 4UFKA 3MYPA 1LLWA 4Z0JA 4AHPA 1KW1A 3QYQA 1SSGA 1XFBA 1KM3A 2C15A 3DFPA 4MZYA 5F4SA 1MEIA 4RXFA 4O28A 2A1YA 1GJPA 5D30A 1FDZA 4LVGA 2CZ5A 5AHEA 4AXKA 3FEMA 4XTDA 1K7EA 3R8RA 1RVGA 3NL3A 1W3NA 3TKFA 3NPVA 4WQ6A 4GC4A 4GUJA 4KWWA 5H91A 1IXQA 1ZNNA 3SIZA 1X6UA 1HO4A 3I7SA 3TIMA 3NQ6A 2O7SA 1VYRA 3M44A 2J9XA 4LOCA 2A4AA 3S1XA 1K02A 5HWJA 2EAWA 1JQVA 2QUTA 4MY9A 1OYBA 4UTTC 3SR7A 1Q6LA 1RZMA 4BI6A 4LU0A 2ZZ7A 3B05A 4S2BA 2X1UA 1TV5A 2E1DA 1JVNA 1OHLA 3LLFA 3CQ0A 2DZWA 3LRMA 3RLUA 4FHAA 4ZQCA 1UUOA 4O1CA 4FNQA 2ZRVA 3PUEA 1G6CA 4FF7A 3C6CA 2FFCA 1SQ7A 2C13A 1QPOA 3N9RA 1R2TA 3O15A 1KFEA 3CC1A 3PWAA 2EKCA 3LCFA 3DKJA 1PS9A 1C29A 3TSBA 3SI9A 5SWUA 5DBUA 5I3JA 3KVLA 3MI6A 2TYSA 5AN7A 4E2BA 4O4WA 4PTNA 1G7VA 2FB2A 1GZGA 3W2MA 3W75A 3O6DA 1TTQA 3HGRA 4QNEA 4UFHA 1GTEA 1TPC1 3G1HA 3WK1A 1P0KA 1JUEA 3NPWA 5FEXA 4O15A 2VFIA 3PBVA 1V5XA 1VPXA 2DU2A 4JR5A 1SZNA 2FLIA 3MYOA 3TSMA 1K7XA 2YYUA 3UPWA 3EX4A 1BWLA 3KVMA 4O53A 4BF9A 1OFRA 5HMSA 2ZFAA 1WBHA 3LBCA 5U4NA 1IF2A 5C54A 3C8FA 1S3HA 4Z1BA 2V30A 2H8XA 4XUGA 2Y61A 8TIMA 1DV7A 3P74A 2OJPA 1F6KA 2R8WA 1LOQA 1OABA 4GUIA 1XCFA 4U28A 4BR1A 2Y7DA 4RJEA 3VCRA 3IIPA 3MO7A 3L21A 3EWUA 5E93A 1DVJA 2XFWA 2WOQA 3MBFA 4AVFA 4L4LA 1AW2A 1H5YA 1ZCOA 3BG9A 4LRTA 1GT8A 5D2VA 3UZ5A 5I3GA 1G67A 4W9TA 1GWJA 1SW0A 3W1NA 3U8GA 1F73A 3S1WA 3LCXA 5FI8A 4JYDA 1H1ZA 2QJHA 1PL9A 4JY8A 4OWGA 3C2OA 4Y8FA 3QH2A 3DFQA 2Y70A 4JTFA 5F2IA 5I3KA 5HR6A 4ZQOA 4ADUA 1AW1A 2CU0A 4OU1A 3W86A 3LCHA 3M43A 3W7EA 2QR6A 1IXOA 3CB8A 1VYSX 3BVJA 4M7TA 4LC6A 1QPRA 3P5YA 4RZ5A 3PY2A 3UWZA 5LNVA 2OT1A 1KM1A 2P0OA 3FFSA 2JK2A 1MEHA 2QCCA 3HG5A 3IEBA 3JS3A 4PL1A 5ABTA 3S9YA 3W7KA 3W7GA 3BW3A 4IMCA 4MLRA 3IVUA 4TIMA 3W6YA 1I2OA 2QUVA 2DJLA 3W9ZA 1FUYA 4MY1A 3SJ3A 1F74A 4QSHA 4NX0A 2GQ9A 4NZFA 4HT3A 1SFLA 3PUDA 3HOJA 3STGA 2QEZA 1DQXA 1PV8A 1EP3A 4Z1DA 3CIWA 4CCDA 2Y63A 3PSWA 1KFJA 3NGJA 5K9CA 2V9DA 1T99A 2VKZG 1DJNA 1W3IA 3BPWA 1O60A 2NV2A 4WY0F 2Z0IA 5D37A 3QM3A 2QJGA 2QAPA 2YDAA 4JEQA 4K8HA 4YCOA 3TH6A 1G4TA 3DZ1A 1Q6QA 3SGZA 2R94A 3TV8A 3NQFA 3UXDA 4IX2A 4N4QA 3W83A 2VEPA 4HN4A 4UTWC 1T8XA 3HGSA 2W0UA 3NQ8A 3RF9A 3P84A 3R2GA 4AWUA 3G1AA 3HGOA 1H7RA 3E12A 5FF7A 2C1HA 4FIRA 3HPXA 1G4EA 4LVDA 2NZLA 2BSLA 5I3HA 1SSDA 4YL2A 4JIQA 2CLOA 3ZR4A 4JTJA 2W79A 1O94A 2DZXA 3W87A 5CZJA 1FQ0A 1HTIA 3M5VA 3KOFA 2QAFA 2WKJA 3TSDA 3T78A 4CCEA 1YLVA 5DXYA 1S5VA 4O14A 4DO6A 4O13A 1TQJA 1HL2A 1LBLA 1MO0A 1YTKA 3PM6A 4DO5A 3G1VA 3UXAA 3MI2A 4N9BA 4WOQA 1KFCA 5U7SA 3NA8A 4NNCA 2GPTA 4O57A 3QW4B 1FWSA 3QRHA 3W85A 3PBYA 4AEOA 4RZ6A 4E38A 1I2PA 5IBXA 2YYTA 1VJIA 1WOAA 2FIQA 2CLMA 2ZZ1A 1XXXA 4U4MA 3DENA 4RKAA 3VE7A 4ZL1A 1R2SA 4JIPA 1RQHA 3D0CA 4LVBA 2G97A 3PBWA 2C16A 2FB3A 3EWXA 4JYEA 3NQGA 4NJKA 4TU1A 1KV8A 2CLKA 1Q3NA 3M5YA 3EWWA 3HO8A 4GFSA 1QAPA 2P1FA 3SECA 3CLMA 1FXQA 3TFXA 4O11A 3CWOX 3G1DA 2CWNA 1QCWA 2Y85A 2J6XA 4PL2A 5C55A 5LGXA 3S6DA 3EX6A 2DORA 4Y6GA 1I4NA 1OF6A 1TPDA 3PR2A 4ORIA 3LI0A 2WV8A 1YADA 4FX8A 5AB3A 1SR9A 1G7UA 4AF0B 4ICNA 3KX6A 1P0NA 3A5VA 4GUFA 2ZTJA 3NDOA 1TPB1 3S5YA 3GXNA 2A0NA 4UR7A 5FEWA 1OFPA 4OV4A 4UTMA 3YPIA 2H6RA 4RX0A 4GNJA 1FWTA 3LCWA 3CIXA 4UTWA 1ICQA 1TB3A 3G1SA 1PVNA 1FCQA 1SO6A 3I7RA 1KV5A 1FBAA 3TU9A 3M5XA 2X16A 4LC8A 4OT7A 4QIUA 3E49A 1TRDA 3UWVA 1DJQA 4LV4A 1BWKA 5K4ZA 5F2GA 1CI1A 1OX5A 1HUVA 5CKSA 4GBUA 4JTEA 1WA3A 5D09A 4FNRA 2ZYFA 4DBEA 1W3TA 1TSIA 2ZZ2A 4HNNA 1AL8A 2ZBTA 1W56A 1TQXA 3LB0A 4UXDA 4FXSA 3O05A 3ATYA 2NX3A 3L0NA 3KHJA 4MY8A 1RQBA 1JCJA 4O52A 4O19A 2Z6JA 6TIMA 2A7RA 1SU5A 1GVOA 4EIVA 2ABBA 2B0MA 2X2GA 3T44A 2QKFA 1ZAJA 1YPIA 4NXSA 1ALDA 3GDTA 3W7HA 4DO4A 1FCVA 1W54A 3W7QA 3M7WA 3P62A 4ZMGA 4O54A 4LTSA 4NXKA 5F4XA 2I14A 1VCGA 2GQAA 3QQ0A 4G1KA 2V5LA 3LHTA 3EX2A 5KMYA 3W73A 1YDNA 3ELFA 4JTKA 3I6RA 5F2LA 2NWRA 3EEGA 2V82A 2HTMA 3N9SA 2GQ8A 4NJJA 4LUIA 3W1QA 3W2LA 3KFTA 1B4EA 3T7VA 3FA5A 4JX6A 4N02A 3LX9A 1BTMA 2QCNA 3DBPA 1IGSA 3ABSA 1TPUA 3G3MA 5HJLA 3GX9A 4JGDA 1TPVA 5HR7A 4X9SA 4J9JA 4O8RA 3IGUA 4O1DA 3VE9A 2FPTA 4YCPA 3TMQA 2G96A 4PODA 2E6AA 5KINA 1AG1O 5F1UA 4ORMA 2Z6IA 4GJ1A 4RR4A 3S5ZA 3KRUA 3W84A 1TPH1 4UFIA 1NF0A 3Q58A 1I45A 5AYXA 3IIZA 3RMJA 2QCLA 3PB2A 3UWUA 2CW6A 3GDKA 1EA0A 1KTCA 3L5AA 1DQWA 4X3ZA 3USBA 1TPWA 4A3UA 1SO3A 4R34A 4I7WA 3W72A 2ZCGA 4A29A 5AC6A 1PCKA 4K7VA 1VC4A 2X1RA 5KZDA 4JDBA 2D73A 2Y6ZA 3F4NA 2OT0A 3TXVA 1QOQA 2C3ZA 3PBUA 5HINA 3RK8A 3S5NA 1XUUA 3FYOA 2QDGA 2O7QA 4KKXA 5F2MA 4AB4A 3TW7A 1OVDA 3A23A 3BW2A 3HF3A 1XKYA 1LYXA 4IWWA 1X1OA 2EGZA 1TRIA 1YYAA 1J4EA 2Y62A 1W5MA 3HG4A 1LLZA 1EB3A 2VEMA 3LXCA 3TJLA 2YXGA 4M6PA 3TQVA 2RDTA 2PC4A 1JQXA 4JTTA 1R30A 4LRSA 3CEPA 5E0KA 1M7PA 3MMTA 5K9XA 3FOKA 4IJBA 4TX9A 2DZUA 1ADOA 2JBMA 5DCEA 1LRNA 3UY8A 5EY5A 4DPQA 4RZ4A 3QZEA 3W1TA 1TTJA 1DBTA 3GKAA 1I2QA 5DCBA 3F4WA 1OYCA 1L6WA 3E02A 1TV8A 1ZAIA 2F7FA 3HG3A 3B4UA 5TQLA 1SZEA 3A22A 3O6CA 3RLVA 3THQA 5CSRA 4TR9A 3DHFA 4ADSA 1B9BA 2VOMA 5EPDA 1H7PA 5AYYA 1VHCA 4AAJA 1OG0A 2E5DA 4YWIA 3STFA 2A7PA 1WV2A 4HNUA 1MSSA 3F03K 5G5IA 3BLFA 1ML1A 4EWND 4D2JA 3ABOA 4K37A 1FY6A 2DZTA 2P10A 5KITA 3DFSA 4LVFA 4Z08A 1JCYA 5D03A 3NQDA 5D2XA 3HG2A 1TTPA 1FXPA 4GUHA 5J5DA 1JJKA 3MP4A 2WPBA 3RNDA 2I1OA 3UYCA 3C2VA 4R33A 1LRQA 1OFBA 1VCFA 3LHWA 1X1ZA 2CLHA 4GE8A 5HWMA 3HPSA 5FF2A 1YXYA 3NQ2A 3BW4A 4IPIA 3HPZA 1ZALA 5D2YA 3BARA 2WSYA 1H1YA 1G4SA 3NXFA 3U2OA 4QM1A 2YGYA 1QNVA 4ZQRA 3IGSA 3INPA 5CZ0A 1WBJA 1P1XA 1SZGA 3W2NA 4OBTA 1JUBA 4LW7A 4ADTA 4AMAA 1L9WA 2E09A 3NAVA 1GOXA 3L65A 5K3VA 1A5BA 1KM5A 1QWGA 4RCXA 1M6JA 3W7NA 2AAMA 1PIIA 2C14A 2Y7FA 3O07A 5AHIA 1B4KA 3PUOA 3W70A 1PE1A 2IQTA 2EF9A 3OIXA 3E0IA 5L9FA 5AOUA 4M7SA 5C6MA 3S5OA 4NX5A 1AMKA 1LTDA 1FWNA 4NVTA 2WNNA 3FKRA 3WJXA 4E2DA 3P8IA 3GVGA 3EKLA 1VRDA 3PB0A 1U83A 2YW3A 4XZ9A 5T26A 5HWNA 1LP6A 3NZRA 5AHNA 3L66A 3MW7A 2C19A 5FF3A 3G8RA 4JD4A 2H90A 3EX1A 2ZZ5A 5CPOA 4LV9A 4GUGA 3G24A 1TPFA 4UTTA 4PEKA 2QCGA 4K38A 4XKYB 3GDMA 3GK0A 3LCLA 4CCCA 1S5TA 3W74A 5L6UA 2X1TA 4L4MA 2ZRXA 2R91A 2BLEA 3AJXA 3VI2A 5BW6A 4DF2A 2Y88A 5FF4A 1ME8A 2AQWA 3IVSA 1W8SA 1OFQA 1H50A 3Q37A 2H3BA 2GVLA 2VXNA 2I9EA 1V7YA 3N73A 1FX6A 1Q6OA 2B7NA 4IUOA 4UC5A 3W1LA 3TR2A 4TMCA 1JRCA 1M5WA 4LS1A 3S42A 2FQIA 3JR2A 2A2IA 3B04A 4HNVA 3DGRA 5G2WA 3TX9A 3GDLA 4UFMA 4FNTA 1Z42A 3HGJA 1BKSA 3ZS4A 4IQLA 3HB9A 3TMLA 3DFOA 1XI3A 3VKJA 1GG1A 1EPXA 2Q3OA 1H7NA 1JCNA 4HIBA 1O4UA 2ALDA 3P67A 2FPVA 2ZZ4A 3IV3A
chains in the Genus database with same CATH superfamily
3DFHA 5EA9A 1VBHA 4OUEA 1GTHA 3M0LA 3CXOA 3QPYA 4QS5A 3OZMA 4HNTA 4DPPA 3APTA 1KFLA 2XGBA 1Q7MA 2ZUSA 3HMCA 3QGVA 1A50A 1YEYA 1YQ2A 3TQPA 4XBJA 3CT2A 1EJVC 4JEJA 4UZSA 1EJUC 2UY3A 2PU0A 3IARA 5DN1A 3VD4A 4UR8A 1W1A1 4NIRA 4FR6A 2VVSA 1ZBKA 3WJZA 1KBLA 3UT0A 2GYIA 1X8FA 2P76A 3BSMA 4OVXA 4OHQA 4XZNX 4B92A 1GQIA 3MKCA 3OP2A 4XK2A 3GNXA 5GQBA 5LIXX 3T1GA 4S38A 2QCDB 3C61A 4H00A 1PIGA 1JR1A 3REQA 4RNJA 5F1VA 2DUXA 5JVLA 4WGXA 4LEQA 3O16A 2C6QA 5GVJA 1KD0A 3UFYA 4I9MA 3L5LA 4YYFA 1P48A 2PRHA 3EKZA 3M1ZA 3WFZA 3CQJA 3B03A 3N3MA 4EP8C 3TA9A 1GZJA 4JHOA 4UUIA 1VFTA 3DG7A 4UFJA 4QQ3A 4N6EA 4JN6A 1Z7AA 2Y89A 1P0EA 3LV5A 3NO3A 1US2A 1SW3A 3ATZA 1BF6A 3F2DA 4Z0SA 5CLWA 3NVTA 3H6OA 3WN6A 4OE7A 1LROA 4GIEA 3LTYA 3UZZA 4LSBA 5I3FA 2G95A 1CGXA 4UMCA 3UVIA 1LQ2A 1UKTA 3ES7A 4QCFA 2AKMA 1QI0A 3MB9A 4KFOA 4FB7A 3F7JA 5HULA 4AD0A 3T8QA 4AU0A 1HKIA 1RD5A 3SCNA 3WBEA 3OPSA 3MSDA 2W6RA 3PZ9A 3MZNA 4Q8QA 3AO0A 3BUVA 1VR6A 1E0UA 4UQEA 4AZCA 4IMFA 3BGAA 1HKWA 3I65A 4EF8A 2QCHA 3RX4A 2MNRA 2FVLA 3PWIA 1HVXA 4FO4A 4JN7A 3SDOA 5LXXA 1W2PA 1TKKA 4P2VA 4ZE5A 3SY5A 1S2CA 3IJQA 3N13A 1X6LA 3VNDA 3W81A 4MVAA 1CB2A 1JF5A 1JPIA 1E9ZB 4DF0A 3TXZA 4ZVJA 1IV8A 1NELA 1K3UA 3UYIA 3M16A 3GAYA 3ZT7A 2WWDA 7ENLA 3ZVIA 1PKLA 1EGVA 5CZSA 4OECA 1XINA 3BTNA 4JQ1A 4A8LA 4QDPA 2C1IA 1X97A 4N7QA 4C7GA 3WL1A 4QNWA 5LZLA 3S2CA 3HJZA 3PPCA 4MJMA 4C5ZA 2OFJA 5GJPA 3GXTA 3GTIA 2OOGA 3UCCA 1EQCA 2CWXA 4H9YA 4GD0A 3MMUA 4M3PA 3CZLA 5H2ZA 1WKYA 3VC5A 4W89A 1SFJA 4RNFA 1HGWA 2WC4A 3RU6A 1OX4B 1K8XA 1NDWA 1XW8A 5TBOA 6XIAA 3NM3A 4Q8PA 4IPLA 4XTIA 3UERA 2XGIA 4GY7A 3V0TA 1FDJA 1EJXC 1L0PA 1W1YA 3DH7A 4MM1A 1V51A 1VH7A 2YW4A 3VVGA 1H61A 2F6KA 4O4VA 2JFEX 4GQRA 1E70M 1S2VA 1UWSA 1KBKA 5C2XA 2VFFA 1EYWA 3MI3A 3AXKA 4C1KA 3AYRA 1ISYA 1HFBA 3H2OA 3LGDA 1AMYA 1HKJA 1UASA 4YJ5A 2Y8UA 3M7SA 4Y7EA 3M0HA 3TA6A 3DFNA 3ORWA 1MW3A 5LYRA 1WAUA 2LLEA 3WEMA 4GJJA 4LVAA 3MWAA 3SQLA 5JBEA 4S3EA 2F38A 4TO8A 3UJRA 2J7FA 4GXMA 4LAOA 1J2WA 4V28A 4JFTA 1CLKA 1SR0A 1OFAA 4L1WA 1DIOA 4ZB2A 3VGFA 3UP8A 4C6EA 3BMVA 1FA2A 3W88A 5D9NA 5D2WA 4B16A 1S1RA 3ZJ7A 4HPHA 3MMWA 3WNPA 3R13A 5EKYA 4MUPA 3WQEA 4ES4A 3LQGA 2W61A 2TAAA 4PA8A 4EF9A 4UNIA 3WUFA 4XIAA 1CGTA 3AIBA 4MMWA 4FSAA 1PWLA 3CL8A 1EP1A 2OWCA 1YTDA 5HMDA 1OD8A 4HP5A 2QXWA 2OELA 3AICA 1HJUA 3OW1A 5LNRA 4BQ4A 1XYZA 3BANA 2JQXA 3OVRA 3KL3A 5HOSA 1UPPA 4JFVA 2QYGA 4M19A 4HGXA 2GJNA 4S3DA 3L9CA 1O66A 4HJFA 3R0KA 4P61A 3T2OA 1X6NA 2G0WA 1F3WA 4FIQA 3NJ3A 3W1XA 4PC8A 1R7OA 2PLCA 3LDVA 1FWCC 4G7FA 1TG7A 4ZO6A 3GQYA 4Q8OA 1TCDA 1WXZA 2BZNA 3FKKA 3L4ZA 1TCMA 4HSHA 1JD7A 4EX4A 3WD4A 3RO6A 2XSXA 2ZRUA 4ZXOA 4MJ4A 2O9PA 4H8UA 4GI6A 1XLAA 2PDPA 1OZMA 1J11A 3K4AA 4DO7A 5BRQA 3SBFA 3OYXA 4IXXA 3M0ZA 4A6GA 2BODX 2OG9A 5AVNA 3VNMA 4R53A 3B0XA 1ISWA 3C0QA 1UD3A 3O8AA 2W92A 3IJ6A 1FWBC 2BVTA 3URBA 3I7QA 1WUFA 3XISA 1JGMA 2D2JA 1XKJA 4GXPA 7A3HA 2I7GA 2WLZA 3N19B 4X2RA 2EG7A 2V3FA 1F6PA 1W9DM 4ILSA 2E3ZA 1UD5A 2VENA 4RW5A 1NWTA 4UTLA 2HVNA 2Z2BA 4WK9A 2E77A 1DJWA 3OGRA 1HJXA 4IQDA 2BX7A 1DEDA 3CO4A 4NZ4A 3BJFA 3C52A 3P82A 1V6TA 4DBWA 3GH5A 1V6VA 1DJIA 2VWTA 3QZAA 3P80A 2VEIA 5FJRA 4UBPC 3TAOA 3UNDA 1R3VA 4NAEA 3TUUA 3RU8X 2FVKA 3GNDA 4Z2HA 4US5A 2WVSA 2GUBA 5LKYA 5HUOA 4BHYA 3F1QA 2OXNA 4O1AA 4IP4A 4W7UA 3QSRA 1GNXA 1VAHA 4QITA 1EA9C 4QEHA 1P0DA 1CWYA 2IKGA 3P6LA 5A6MA 4LCSA 3N9KA 4PUJA 1TMLA 3MSGA 1H3GA 1A49A 1D9EA 4Y90A 2JF7A 4UTKA 1KGXA 1BXCA 1DJZA 2ODOA 2POTA 3NQEA 1TV2A 3GYCA 1H7XA 3C86A 2W91A 4UOZA 1TZ7A 1AH0A 5CEWA 3DUGA 2NUWA 3UETA 1BVNP 1FHLA 1LL6A 1QNQA 4Q6JA 4HMEA 2J24A 5BYWA 1JEZA 2UBPC 2QF8A 3EA2A 3C56A 3KZSA 4I5RA 1AJ2A 2HBXA 5CSSA 3S9IA 1B3YA 2VNCA 5CBIA 2QJIA 1FWFC 2V2CA 3MP3A 1AQFA 2V6AA 5DELA 5D32A 4ZFCA 2ESCA 1G5AA 1F4HA 4AWTA 1V3HA 3U2EA 1GGOA 3CL7A 3S2MA 2OEMA 3L68A 3WMBA 4JDYA 4JFUA 4HPXA 3UPBA 1XV8A 4GGHA 1QFEA 4PMJA 1KGWA 4O0KA 1GVSA 1QDSA 1YDYA 2JGQA 4E6MA 3PZNA 4NASA 1XRFA 3OQEA 4V15A 3PJUA 4GVHA 1XLIA 2PDCA 3HIJA 5D2TA 2V5BA 3ZJ8A 2VMFA 3GU9A 3KTCA 2WMFA 5C71A 4AYGA 4W87A 3LK6A 2QPUA 2DT0A 4KFNA 1R8LA 3VDAA 4Q4KA 3E2RA 4DAFA 1FDYA 3AUJA 4MB3A 4H9XA 4E8CA 2A7NA 4UR9A 4CLMA 4GCXA 2ACRA 2PGEA 3CHDA 4TMBA 1R3QA 1D7FA 2A3BA 3N4FA 3EMZA 1EZ2A 4JQ4A 2J75A 3GH4A 4FEZA 5MHBA 1LOSA 4RE2A 3L4TA 2WK2A 1ZENA 3VD5A 4ZODA 5G4EA 4XQ6A 2PLJA 3E38A 1TX0A 3P0WA 4Q8TA 1S2TA 4XV0A 4N9EA 4CNTA 3C0JA 4FNPA 2XN0A 1MW1A 3FYYA 4HTYA 3SSZA 9XIAA 1H60A 1VHNA 4QTGA 5J5RA 1ZJHA 3GFYA 1XSIA 4MPQA 1G9HA 3QC0A 1U33A 4OZOA 1W1VA 4IUGA 3MSYA 2V5KA 2VFDA 3BO9A 5DRCA 1VENA 4LQ1A 2G3NA 3DHUA 1EEPA 3IS4A 2POZA 4KIEA 1E73M 3SAZA 3MMDA 1Y8BA 3TC7A 3VX0A 1ME7A 3AFBA 3OJGA 5DQPA 3R11A 1QVBA 2NQ5A 3AUOA 1VCVA 2VC9A 2H3DA 1JRBA 1ZBVA 1KTBA 5BXRA 2WMJA 1I1WA 3LHYA 1I2RA 2DT3A 4POCA 4CN1A 2PDUA 3PWGA 1GG0A 5LNUA 1JZ7A 1N2VA 1UJPA 4C6CA 1DQUA 4PFMA 4RW3A 3W2JA 3CU2A 1HW6A 2VC6A 4EXBA 1ZBCA 2XSBA 2IPWA 2QDHA 1WB0A 1Z69A 3EMCA 3RAOA 1PZ0A 1EUNA 1Q63A 5FESA 3WUBA 5REQB 5G1MA 1FP9A 1M7XA 3WJWA 4GISA 4M6VA 3CTLA 2CZDA 1OB0A 4DI8A 3O1NA 4JPGA 2E6DA 2PWGA 3ITLA 2O9TA 3SN1A 3QMSA 3PG8A 5FEZA 3PANA 1E5NA 1H4PA 4WKAA 5A69A 2HPIA 3C2FA 1BEUA 4A05A 2O4MA 3B8VA 1EDTA 1GKRA 3GBDA 1XUZA 5CSYA 3H4WA 4V33A 4IIBA 4MNJA 3O9NA 1OFEA 4Y96A 1TPEA 4JTLA 5A1AA 5FF0A 4TVDA 3R4IA 4GIAA 4UMAA 1OGBA 1WAWA 1WKEA 2VFGA 3AS0A 4FNUA 3PNUA 1QOXA 3WNMA 4PBFA 2PP1A 2WANA 3BAXA 2EG8A 3KRZA 2DVXA 3S4TA 1AH3A 1LQ0A 4O12A 1ME9A 1NVMA 3FJ6A 2PDWA 2PRMA 4HNCA 3OBKA 2Y7EA 1ZJAA 4BA0A 1UB3A 4UIOA 4AYSA 1JYNA 4UTFA 3URNA 4XAZA 5HUPA 1T0OA 1Q7QA 3BL3A 4JNMA 3Q2DA 4W8AA 2J13A 3O6YX 3N6QA 1UWQA 2QDDA 4UTIA 3IPWA 2ZUNA 3MV11 4NJGA 3MYPA 1T8QA 4MPKA 3KCJA 3QYQA 4GACA 1Y5VA 1XIIA 2ZE3A 1XFBA 3DFPA 4MZYA 4RXFA 3VMNA 4LFYA 1GJPA 4GH1A 1NP2A 4AC1X 4LVGA 3THUA 2CZ5A 3DC8A 4XTDA 1JI1A 4OBRA 2FZ9A 1RVGA 5I79A 4W5UA 5AYIA 1B9ZA 2VGIA 3MA8A 2Z25A 1V8EA 2FDMA 3TKFA 4J3SA 6A3HA 1IXQA 1ZNNA 1X6UA 1UMLA 1O5QA 3CO8A 2FJUB 2A4AA 5HWJA 4MY9A 1OYBA 4UTTC 3E2QA 2DY3A 1RJPA 3B05A 1FRBA 1JI2A 3EOSA 2X1UA 2E1DA 1OHLA 1NFPA 3T6CA 2DZWA 3E2VA 5BZAA 2DGAA 3HFTA 4FHAA 1JG9A 2EPMX 3N25A 3ZR6A 4Y8EA 4PUDA 4FNQA 1QK2A 3WX7A 2OVLA 1CXLA 1LG2A 2FFCA 1SQ7A 3F4DA 3KEHA 1R2TA 3N9RA 3DGBA 3O15A 1UZ4A 2NVCA 1KRMA 2XIMA 3LCFA 4C6FA 1M41A 3SI9A 5SWUA 2OKTA 3MI6A 5AN7A 1FH7A 3W2MA 2YA0A 2RDXA 5AC4A 1GTEA 1E6XM 1C93A 3AIWA 3AHZA 3K1DA 3WK1A 1H0GA 1AQ0A 3U2CA 1JUEA 1RP8A 1LWHA 4O15A 4ACYA 1JFXA 3FX4A 4DJED 3GHUA 2E0PA 4HZ7A 4LEFA 4S3JA 1MRQA 3MYOA 4PCTA 5A2BA 3DDMA 1BWLA 2PTYA 3PZUA 5C54A 3KLLA 3AS2A 1TIWA 3C8FA 3K4DA 3S47A 1S3HA 3Q4DA 2V30A 2E25A 2QNEA 3ID7A 1RAKA 4PTVA 2F9RA 1DV7A 3VIOA 4F0KA 2R8WA 4GYKA 1GEHA 1LOQA 4GUIA 3UCQA 1PTAA 3VD9A 2PWUA 4BR1A 4RJEA 3IIPA 3IUHA 3MO7A 3OO2A 1EGZA 2XFWA 3MBFA 3GE7A 4L4LA 1AW2A 1H5YA 1QATA 4R85A 3D6NA 3AMGA 3W82A 3UZ5A 5I3GA 2PP3A 2H9AB 1ZQ5A 3EDFA 4JIRA 2VVNA 1F73A 5FI8A 3TYZA 4JYDA 1SJDA 4WSJA 1ITXA 3EOEA 2OZ8A 1V93A 2WJEA 3D3FA 4CN4A 4C6JA 4JY8A 4UQ9A 3QN3A 3K1GA 4OUIA 3DFQA 3A4XA 4AZIA 4U5IA 3SJNA 8XIAA 4H9ZA 2MANA 4O1EA 3UG4A 4ZQOA 2CU0A 3M43A 1JNDA 1JGIA 1IEWA 3RMEA 3CB8A 1XF0A 3RIKA 4UQBA 4JTQA 4PULA 5HNNA 1AD4A 2NVAA 2OT1A 1KM1A 4DWSB 3HG5A 2IQ0A 3D47A 4W7WA 4IMCA 4UQDA 3NSMA 1I2OA 1IWAA 2QUVA 4MY1A 2XTKA 2NQLA 3U0HA 3PUDA 2CBVA 1DQXA 4LYRA 4Z1DA 2NT0A 3PSWA 1KFJA 5CGTA 1T99A 4ERIA 3ARRA 1DJNA 1W3IA 4B2DD 1O60A 1ITQA 3I4EA 1MNSA 1IZKA 5D37A 2A3LA 4K3ZA 2XDFA 1TMQA 2QAPA 4H6RA 4L7ZA 4W93A 3TH6A 3DZ1A 4KCVA 2R94A 3TZNA 1EC7A 2QULA 4HU0A 2W0UA 4PUMA 4F0HA 4AWUA 3RRXA 3E12A 4YVXA 1G4EA 5IRPA 1R3SA 3QV9A 2NZLA 4KWSA 2BSLA 4FALA 1O94A 3EBVA 1HTIA 3M5VA 3EPMA 3KOFA 2WKJA 3ARZA 4GVIA 3TSDA 4CCEA 5DXYA 4PRRA 4AVNA 1ZCCA 1HL2A 2AGTA 1Q65A 1YTKA 3G1VA 1QRQA 1HXJA 1QHOA 4HYRA 3N2BA 1RA5A 1JPHA 4O57A 3MUIA 3QRHA 1OG6A 3CAQA 1V0LA 4E38A 3SUSA 5IBXA 3WBWA 4XSLA 4YVPA 1KXTA 4RKAA 1AZ2A 3KS5A 3D0CA 4LVBA 4NZ5A 5AZ1A 2BY1A 4PTWA 1BVWA 3AC0A 3ZVHA 1ENUA 2VQTA 3AHTA 3H12A 5C9WA 3PPFA 3CLMA 4I3GA 3TFXA 4O11A 7REQB 1S3TC 2R1NA 4BKNA 4F3HA 4NL1A 3CWOX 2CWNA 1ESWA 5C55A 4PL2A 4JFSA 4Y6GA 1TPDA 3PR2A 1B3VA 1OEPA 1NTHA 1QI3A 4ICNA 1QBBA 1P0NA 3AOFA 3VKCA 3BLKA 1UQZA 3GXNA 3TYCA 1OFPA 3OTRA 1ECEA 4OV4A 2CHNA 1XLBA 4MTVA 3GD6A 3AXMA 1TB3A 1PVNA 3EOUA 4I6KA 1V3JA 5JH1A 1KV5A 5J8LA 3TONA 2GGJA 2FTYA 1TRDA 5T9BG 1HKVA 2YL8A 4GBUA 5D09A 1KB3A 1XQKA 1OQFA 3EOLA 3VOGA 4DBEA 4QEEA 5TNVA 1TA3B 2ZZ2A 2ZBTA 4WKFA 1YBQA 1GOWA 5AKQA 3ZM8A 3L0NA 2FKPA 2PDJA 3VC6A 2A7RA 4RV3A 4R9XA 3U48A 4JCLA 2B0MA 1C91A 2QKFA 2GGHA 1YPIA 3ZT6A 3IANA 1LQAA 1M3UA 3CIVA 1W54A 2PWVA 3M7WA 4ZMGA 2VO5A 3E5BA 4LTSA 4NXKA 5F4XA 3UG5A 3VILA 5T8GA 1UP2A 3M4HA 4G1KA 1IZCA 4MWAC 4GLEA 2V5LA 4TQTA 3EX2A 3MV01 3ELFA 2ALRA 3I6RA 2HTMA 4GKLA 4H8HA 1U30A 3W1QA 3W2LA 3KFTA 2CNCA 3EGJA 4XAFA 4AZHA 2WPGA 3R79A 2NW0A 4LUYA 5E9XA 1XFCA 1QNPA 3GX9A 4K2SA 3VOHA 2VL4A 3O0KA 2FPTA 2QLYA 2BXZA 1DWJM 1GW1A 3WF1A 4HPNA 2PDMA 4DUWA 4FLSA 4RR4A 4UFIA 3Q58A 3NTYA 1WKFA 3LMZA 1POJA 2QCLA 3IAPA 3PB2A 1EA0A 4YHEA 4IMAA 1DQWA 4X3ZA 3EOOA 1TPWA 3KOXA 2CITA 1T40A 1ZLPA 2IKHA 4I7WA 3C3UA 4PBEA 4KWOA 2VM8A 1E0TA 1KCKA 3F4NA 3TXVA 1QOQA 2ON3A 3PBUA 3LMYA 3S5NA 3H4XA 1XUUA 4L56A 3WEZA 4KKXA 4PMVA 2F6XA 1XR2A 2PDYA 3PZOA 1XKYA 4D8ZA 1BG4A 5TF0A 4NAFB 1H11A 4QJ4B 4S39A 1DWHM 1TRIA 2VD8A 2OPJA 3RHGA 5CH9A 2VEMA 3LXCA 2YXGA 3TQVA 2RDTA 2PC4A 4RDZA 3KL5A 4C65A 3MMTA 5K9XA 3FOKA 1E4LA 4C6NA 4NZCA 1KRCC 3W6LA 3SRHA 1O12A 2EEXA 4MWAA 2PU1A 2OO0A 1J0KA 5EBAA 1CTNA 2OZTA 1L6WA 3N2OA 3GC4A 1TV8A 4CD8A 3B4UA 1UWUA 2V5JA 1FP8A 2KAUC 4ADSA 1QW8A 1E9IA 5M3WA 1CNVA 1VHCA 2Z1KA 4AAJA 2E5DA 3N6JA 2VRKA 4YWIA 3STFA 1BG9A 2Z26A 4HNUA 3AMKA 3BLFA 1ML1A 1PX4A 4D2JA 3ABOA 4QRNA 1FY6A 3MO4A 1RSCA 3DFSA 2Z28A 2D22A 4YS1A 4Z08A 1UZDA 4XIMA 4AZ5A 5D2XA 1JJKA 4KBXA 1EJ7L 5FL1A 2GK1B 5I5RA 1LRQA 3W4RA 1IEQA 2FZDA 4DYEA 2XG9A 3BW4A 3HPZA 1C8YA 3BARA 5BXPA 2PGWA 2GDUA 4KCTA 1H1YA 4PRWA 1VEOA 4TV5A 3U2OA 2YGYA 1XLHA 1XRTA 1UWIA 2XZ7A 4ZQRA 3IGSA 1P1XA 4WRHA 3W2NA 4OBTA 4LW7A 1JZ3A 4AMAA 1NWSA 1UD2A 2E09A 3NAVA 3TN6A 1GKQA 1A5BA 1QWGA 4RCXA 1CB7B 2AAMA 5AHIA 4IFKA 3VD3A 3PUOA 1PE1A 4GQBA 2EF9A 1DIDA 1WCGA 3E0IA 1JNEA 5AOUA 1UQYA 3FKRA 4UB9A 4F2TA 2ICSA 3UXLA 4EANA 3B9DA 2YBVA 4DY1A 3THDA 4GY0A 3KBJA 1HN1A 1LP6A 5CBBA 2ZVRA 4U3CA 5FF3A 4PB5A 4JD4A 1P1MA 3MU7A 4BQ5A 1YKWA 3M0VA 4LV9A 3DESA 2C79A 2F2HA 4CVWA 4K38A 4IP5A 3GDMA 5PTDA 4A3RA 2WHJA 1PYFA 2X1TA 2INEA 5I09A 3VI2A 2XIJA 1E6QM 3AWOA 1ME8A 4NI8A 4F0MA 2AQWA 1JDCA 5M17A 1J12A 3GRIA 3N73A 3TJIA 2WM0A 3CZ8A 4UC5A 3W1LA 3S42A 1MUWA 3JR2A 3PZQA 3QV6A 3V16A 3T0CA 1BXBA 3FVMA 3GDLA 4A35A 2IPGA 2GUYA 1REQB 3EYPA 3TMLA 4FOJA 1XYFA 1EPXA 4GI4A 2ALDA 3QXBA 1XIHA 3VD7A 4OIFA 4XVEA 3M6DA 1XLEA 2J6VA 4HSOA 4WY0B 3WF2A 1OIMA 3CH9A 3KRSA 4REQA 2EPLX 1F8IA 4QG8A 4Y9NA 3EXTA 3CLWA 4MYXA 1GK8A 3BJSA 1BTCA 4I9TA 2I16A 1W0MA 2J8FA 3G8EA 2OCZA 3CV2A 3WNKA 3QFWA 2E9BA 3LM7A 1ADSA 1DWIM 5JIWA 4AIBA 2JEQA 4D8LA 3CUHA 3BLEA 2BOEX 3GB6A 2R1PA 3PPGA 4XX6A 2WHMA 1L2UA 2CLEA 4CNUA 3Q67A 4W88A 1PPIA 3I4KA 3IJ8A 1KM0A 3NG3A 3H55A 4LAUA 4V1YA 4DBDA 1AA1B 4IIEA 4J5NA 4GZIA 4LUJA 4E0CA 4OV9A 1HG3A 5BWAA 3WKZA 2OEKA 2OOFA 4JHZA 1WZLA 1YPFA 3T05A 1MFVA 4IX0A 4P8VA 3HPAA 2H8ZA 5FAGA 3OVQA 2REQB 4L6DA 3PZVA 1KC7A 2WZTA 1YNPA 4WUIA 1HP4A 3ZYZA 5LHEA 3E0WA 1AZ1A 3DI1A 3S1VA 3W7CA 2OTDA 1UBSA 3FV9A 3BAYA 2XFRA 2JKAA 2FVMA 3GG1A 3W7DA 2NX1A 3A9BA 4DIAA 5J04A 3DC0A 1HO1A 3MJYA 2XIBA 4ZQPA 3S3GA 3WH6A 3GNOA 2YCLB 4WD0A 1I75A 2NQ9A 3HU7A 1UC5A 2AOSA 2V8ZA 1RCXB 3PS7A 4WJ8A 5C5YA 1XLLA 3I6EA 3APGA 1CW2A 4GINA 3WK0A 1A4MA 4BY3A 1UD6A 3VNIA 1SZFA 3M0XA 1JDAA 2YCEA 1HQTA 3IVTA 4NNBA 3VIPA 3M0JA 3M0YA 1JULA 2QZRA 1B3OA 4JBRA 7XIMA 1FFQA 1V03A 4M6UA 1O7AA 3GUGA 3PPHA 4AIEA 2C1GA 1P4CA 4W4QA 4FA3A 2H9AA 2Z1BA 4HK7A 3FXYA 2WSRA 3WH5A 5IOBA 4QJ3B 2DSUA 4HCDA 1UPMB 2B4GA 3N2TA 5I06A 4DI9A 2RDWA 2BFGA 4IT1A 3P81A 4XKYA 3THAA 3R8GA 1A0EA 1JYXA 1XLCA 1EO5A 3CHCA 1OK6A 2ZWZA 4JY9A 2HPMA 2OQYA 5E09A 2V5DA 2ZX5A 2PLKA 2YX0A 1CPUA 3GU2A 1G4PA 4LUTA 3DN5A 3CZJA 4F40A 4TVCA 1ZAHA 1NU5A 4KETA 3FSUA 1QI5A 1QNOA 4B5NA 4WXYA 1C9DA 3OG3A 3N04A 4KFPA 3LS9A 3KBNA 1YDOA 4HPGA 1V6WA 1EYEA 1WE5A 4G56A 3VX1A 3UJEA 2PLMA 1E3XA 3WLTA 3H2AA 5GJMA 5ABGA 3N29A 5BRPA 1A3WA 1GVIA 1PB0A 5K2ZA 1A53A 2XPKA 1E4IA 1CX9A 5CC7A 1KKRA 1JCLA 3NL2A 3ZLFA 4F8XA 5KZMA 1VLIA 4U33A 4UQAA 4NG3A 2XH7A 1XYLA 2RH9A 3WBYA 3NSXA 5ABEA 3MZ2A 5BWFA 1RXOB 1TTIA 4LNYA 4JIHA 2JEPA 1QPQA 1ZJIA 3VNZA 4JX5A 3UCDA 4LT9A 3TW9A 2UY4A 4QJ1A 1S5WA 3H53A 3BE7A 2FGZA 2FH6A 3GDRA 3A13A 2FPYA 2GJXB 1R3YA 5C9ZA 4FAMA 4PUNA 1G94A 1W37A 3BG3A 3A4JA 2DUAA 5BRBA 4O1BA 2PD5A 2MUCA 3QR0A 5DY2A 2ZRYA 3SFKA 1LOLA 1V3KA 3AROA 1Q2RA 4FX7A 1UUMA 2VUNA 3O6AA 3EXSA 4MB1A 4LS0A 4QS6A 3PFMA 1F5ZA 2R1KA 1C92A 3NIYA 3R10A 1N7KA 1W1ZA 3S8HA 3A3XA 3GNRA 4Y9MA 4YWSA 3G5EA 4DHGA 3GDBA 3VOCA 1LM1A 4GX9A 3W02A 3W7RA 1XDLA 2E68A 4ICMA 2Z00A 2NUYA 3J7HA 3DCPA 3VOIA 3M64A 1EWDA 4HZ8A 4JZ5A 1WYIA 4W85A 3R12A 3WJSA 1E72M 1PHWA 1GJUA 1Q2SA 3BK0A 2Y8KA 4D9PA 3T2PA 1PHQA 2X0HA 3WD3A 4Y9OA 3BZGA 5HNUA 3WUGA 1UJQA 5G1YA 1K8ZA 1ZP4A 3M47A 1KBBA 2V2HA 1QPNA 4ACZB 3OA3A 1RQEA 1YXDA 3KAOA 5LNSA 4Z2IA 3LERA 1M65A 1UZHA 4DUOA 3WQOA 5A3HA 1PCWA 2WSQA 1Q4WA 4RUBA 1S5MA 4B3KA 2TRSA 3G3DA 1J93A 2W3ZA 3T0BA 2XVLA 2CXGA 3UWWA 1EC8A 4NY2A 3KUMA 3VFLA 1KBJA 2CERA 2BHYA 4GRSA 1C3FA 1CLVA 4RL3A 3FCPA 1GPWA 1CXHA 1Q5MA 1LCOA 1B1YA 4HU4A 2BXVA 1V6XA 2Y0FA 1F3XA 1RY0A 4H9UA 2IUZA 1TA3A 2BTMA 1VLWA 5GNYA 5AECA 4BF5A 4K1WA 2Q02A 5E6YA 1Z44A 2SFPA 1POKA 2B7PA 5FCZA 1UP0A 4GXWA 3FN9A 2NSOA 2RHGA 3STCA 1DXFA 4LWWA 3I3DA 1A5LC 1J0JA 4HHLA 3W7OA 4CQBA 1KKOA 1TR1A 4BK9A 5FJTA 4S1FA 3TROA 4WF7A 4XSMA 3WQCA 2GSEA 1SW7A 3NZPA 4JTSA 4MAVA 3VNLA 3PZMA 1NH6A 3FA4A 3CMGA 1UG6A 2VD9A 3R89A 4WXZA 3N2XA 4KGJA 2DZAA 2DZPA 4WOZA 3V5CA 2GVJA 3L4UA 3SGGA 4AHOA 4A3QA 3HJEA 4F9DA 3DYOA 2BOFX 3CAKA 4LS2A 3UD6A 3GR8A 1CGWA 1ZB5A 4DELA 1VP5A 5FEPA 1DHPA 2GGIA 1WOBA 5A95A 4CNPA 4MJZA 2AMXA 1GQNA 3ZWTA 1WXJA 3RCNA 2QCMA 2Y5JA 4Q4MA 2X05A 4JQAA 3DECA 4XAPA 4LB4A 5HDRA 2IKJA 5G2IA 3AAMA 3NPXA 1YMYA 3HBLA 3AYTA 3WDIA 3PAOA 1A0CA 4WDTA 5I02A 3L0GA 1H1NA 3NNTA 5LHFA 2JIEA 3W1PA 1XHGA 4BI7A 4GC3A 4XVDA 3QV7A 4S3BA 3MPGA 3VOFA 4AHQA 4PGLA 4AZGA 4D6HA 3A4AA 1E40A 1ITCA 3UJFA 1F7BA 4E5TA 4UWMA 3RCYA 8XIMA 4H6KA 2A6NA 1H63A 2IKIA 2ZA2A 4U2ZA 1YXCA 1LBMA 1F6YA 2WWCA 3POHA 4IG2A 3NQVA 2YFOA 3I68A 3L0KA 2CYGA 2R6OA 4B5VA 3IIOA 5I3IA 1TMHA 1X39A 1LBFA 1J5TA 2E28A 1LUCA 2P5NA 3H2EA 4RV8A 3G0SA 4AZBA 2EBNA 3U4FA 2VGFA 3LM3A 3MKKA 1HF6A 4LX4A 4Y9AA 1EX1A 2WC3A 3F5LA 2GJLA 2VWSA 1SYTA 4XBKA 3QC3A 3W7IA 3MP5A 4M1RA 2PS2A 4PUUA 4YTUA 5RUBA 3T9PA 1GVEA 4EACA 4HMDA 3KOZA 1B57A 1EEXA 4YTSA 1AD1A 1CGUA 1F3EA 2J4GA 2GZXA 3A12A 4I7UA 1D3CA 3GG7A 4GYFA 4HNLA 2A3EA 3PULA 1WDWA 2QCEA 4CEUC 4GHRA 5G4WA 3GXPA 3W1AA 3AXIA 3ABXA 3VCCA 1L6FA 1XP3A 3TDFA 2E5BA 4H4IA 3SIMA 4JICA 3B3DA 1M03A 6ENLA 3VCNA 3PVFA 3H7RA 3R8HA 7TIMA 3L67A 4K39A 1NAL1 3DEQA 4H3DA 4NU7A 4DXKA 3P7YA 2DVTA 1KCZA 1KCLA 1I2NA 3PK7A 4ZTXA 3NYZA 1US0A 3D3AA 3NSNA 1MUCA 1X98A 5JIPA 3ARSA 5CG7A 4R7JA 2ONEA 1XLKA 4ZCWA 3VNKA 1EJSC 4E3VA 1EUAA 1B30A 1E3ZA 1TZ9A 1VYPX 3KBMA 2IXUA 5K7JA 1FWGC 2OX1A 3FAXA 1VBRA 1XC4A 2Q71A 3CZEA 1J79A 1ZS2A 1Q6FA 3G1YA 3FSTA 1C7TA 4TX8A 2OZ3A 1GW9A 1YE4A 2PF0A 3OZOA 4M24A 3LRLA 1K8YA 2NWSA 5D04C 4XZBA 2ZOXA 3LTSA 3W2KA 4IJCA 4ZOEA 3M0MA 1AUSL 3D46A 1G1YA 2Y7GA 2GJRA 2WJFA 2QCFA 4HPJA 4Q4OA 3MUCA 2XINA 1GOKA 3C2EA 1S2UA 4XAYA 5EBUA 1SPQA 1N8FA 1XYAA 4IMDA 3U3HA 3W76A 3WDQA 4JX4A 1RJRA 1V0NA 3TN4A 4AZ7A 1QO2A 3GR4A 1QASA 1FWJC 5FJUA 4QG6A 2CESA 5DLCA 4Q3MA 2FDSA 4B15A 3LNPA 3WH7A 4O17A 2PDIA 4Z2KA 5E0CA 1CXKA 3JRKA 3E74A 5JBFA 4LF1A 5IXEA 1NARA 1R2RA 4AIUA 3EXRA 3W2UA 3ZWSA 1QMLA 3TTSA 2XUCA 3VM5A 4LB3A 5EL1A 2HWGA 2WNQA 4X63A 2WCAA 2ZIDA 1L6SA 4R7OA 4MZ1A 2J88A 3CQIA 3H26A 2CLIA 3PAJA 3TYUA 1KM4A 4KGLA 3FJNA 2HRWA 3TW6A 2FTPA 2DQWA 3EA3A 5EFFA 4JN8A 2YZRA 2NXGA 4IPJA 4MUZA 3GXDA 1RCQA 2AMGA 4IGMA 3UQNA 2J77A 3BAIA 2XWEA 1XISA 1S39A 1MDRA 4ZZ9A 2PDQA 2JKEA 1E6ZA 1ZY9A 2WO5A 2WHLA 3BV4A 4IM4A 4CQ8A 3B9AA 3U7VA 1B3ZA 3WF4A 3GWQA 1SUXA 3DKLA 3WD2A 2DSZA 3ES8A 3WLOA 2OB3A 4RPPA 2DQXA 1BPLB 1J0ZA 1XIDA 1LLWA 4AHPA 3CNYA 3ME3A 5I03A 1ISZA 1DHKA 4G6CA 1DWGM 1Y5XA 3OA5A 4ZOAA 1JXKA 1MEIA 1D8WA 1E0VA 4BEUA 4AXKA 3F4CA 3FEMA 1QNRA 2OODA 2YCLA 3NL3A 3RX3A 2W63A 5HQMA 1UR8A 1J6PA 3VIIA 4LAZA 2HROA 1VYRA 1HVQA 4HU3A 4I9JA 3S1XA 1K02A 1Q4NX 3ERPA 2QUTA 1ZRQA 2GQ3A 3CZGA 4BI6A 4LU0A 1TV5A 3ARYA 4JNYA 4INFA 4NSBA 3LLFA 1RCOB 3ZJKA 3NZQA 3GFZA 7TAAA 4ZQCA 3OODA 3OQ8A 1UUOA 3N4AA 3RCMA 2R24A 4AD4A 1CEOA 4H9TA 3AIUA 2BVWA 4ML4A 2C13A 1FVPA 4DJDD 2PWFA 2HK1A 1EL3A 1KFEA 1PS9A 3QY8A 2CCRA 4XG1A 2XFFA 4OOZA 2VCBA 1G7VA 1GZGA 1PXGA 1RK5A 3CHEA 4UFHA 1SFTA 4ZOBA 3APYA 5A6SA 2PTZA 1P0KA 4PZVA 5FEXA 2ZX6A 1W3JA 4WEVX 3TVAA 3IUIA 5EB8A 4FLQA 4M8UA 1P6CA 1Q66A 1VPXA 1PEZA 4ZO8A 5AVHA 4ZTYA 4C6DA 1OFRA 5HMSA 1WBHA 1EJWC 1K70A 3PHAA 1K1DA 4Z1BA 2H8XA 4XUGA 4J3ZA 2Y61A 8TIMA 3P74A 4BZYA 1F6KA 5LIWX 3MTWA 2Y7DA 3L21A 3QTPA 5E93A 5IFTA 1W9PA 3WQPA 4DNHA 1KR1A 3WG6A 4AVFA 1ZCOA 1GT8A 1TFVA 1N8IA 3H23A 1R0MA 1G67A 1RBAA 1SW0A 1R38A 2Z24A 2DVUA 3LCXA 1P0BA 1H1ZA 3FDKA 1K9EA 5ABFB 3SN0A 5I3KA 4TTGA 5HR6A 1UA3A 2EG6A 4ADUA 2PZ0A 2WMHA 2X42A 3W7EA 5C7VA 2QR6A 3TZFA 3UU0A 1NDZA 2V3EA 3BVJA 4L1XA 4DWSD 3PY2A 2QGHA 3ECQA 4F66A 1NQ6A 1BLIA 2OLHA 1PIFA 3N4EA 2QCCA 3W7KA 3W7GA 2XYLA 3RR4A 2W27A 4P5UA 3CUIA 2VYOA 4QSHA 2DFAA 2GQ9A 4NZFA 4L9ZA 3HOJA 1WNOA 2QEZA 1EP3A 3CIWA 4CCDA 4DJEC 5DMLA 4JIIX 5BXTA 2IS7A 1F3TA 1W9VA 4ZB5A 2X41A 3G77A 5XIAA 3TYBA 4A3YA 3BPWA 1JZ6A 5A8PA 2Z0IA 3QM3A 4EPDC 1Y5WA 4JEQA 2XM1A 1EBHA 3WFLA 5DMMA 3WLJA 9CGTA 4N4QA 3W83A 4UTWC 3HGSA 5C9XA 3NQ8A 5CPQA 3RF9A 3BAKA 4AISA 4OTKA 3W01A 2C1HA 3LLXA 4FIRA 3HPXA 2QMJA 4LVDA 2Y1HA 4S3FA 5I3HA 1SSDA 3EKGA 4O0QA 3ZR4A 4JTJA 1IT7A 3S46A 4ACZA 2W79A 1YIXA 2A3CA 2QAFA 4IICA 1SJBA 1YLVA 4L6OA 1HIZA 4O13A 1BF2A 1TQJA 4IHCA 1MO0A 3PM6A 2C0HA 4QE5A 4HNOA 1QU4A 8A3HA 4N9BA 1JDEA 4H1ZA 2WM1A 4AVOA 2IW0A 3AU2A 2D69A 2VT0A 3B9NA 4RZ6A 1DTUA 3ITXA 2ZC8A 1D8CA 2XFYA 2YYTA 3DX5A 2CLMA 3WQ8A 1XXXA 4U4MA 3DENA 5HQLA 2R82A 1BHGA 3PBGA 4JIPA 2G97A 2GJPA 2PB1A 4MKSA 4KEVA 3EWXA 1XIBA 2PGRA 4TU1A 1KV8A 2CLKA 2VJXA 4HU8A 4O1FA 3GSMA 3L23A 2P1FA 2O56A 1BQGA 1FXQA 3RO8A 3FY1A 4EWJA 3NEHA 1A47A 2J6XA 4DJEA 3EX6A 4OKDA 4S3AA 1I4NA 1OF6A 4ORIA 1YADA 4FX8A 3RXZA 1YNYA 3KX6A 3A5VA 4GUFA 4XD4A 3KS6A 3II1A 3GW3A 3UG3A 3SCSA 4PSRA 4EE9A 4NZ3A 2HZGA 4UTMA 2VZUA 1J0YA 2H6RA 2ZC1A 3O3RA 1DWAM 4RX0A 2VZSA 1FWTA 3LCWA 4UTWA 3G1SA 1FCQA 1E1FA 3IJLA 3I7RA 2D2HA 2P8CA 4H2HA 5FOOA 4PMZA 3VO0A 5FA5A 1FBAA 4QE4A 2J7BA 3H21A 2AQVA 2WKLA 3OLEA 4OT7A 3E49A 4S23A 4LV4A 1PO9A 1AVAA 3VGEA 1NY1A 3UBPC 1HUVA 5CKSA 3E2SA 4JTEA 1Z6KA 1WA3A 1K77A 1RPKA 2VC7A 2ZYFA 2UY2A 6REQA 3AU6A 4HNNA 5IDIA 1J6OA 4UXDA 1TQXA 4J3UA 3O05A 3NYDA 3ATYA 4PMYA 2NX3A 2BVYA 3K5XA 1V6UA 2XSAA 4GZJA 4AEFA 4IL2A 4O52A 3TTYA 3WDHA 4D72A 5XINA 4B9ZA 1GVOA 4D6GA 1VBJA 4C6IA 2X2GA 1W9UA 3AIQA 1W3HA 1ZAJA 3MCOA 1ALDA 5LIKX 3C5QA 1FCVA 1Z32X 4NI3A 4V27A 4KWUA 3ITCA 1UR2A 1FWDC 5E70A 1VCGA 1R3WA 2VURA 1CT5A 3A64A 4R3UA 2V3DA 4GZ7A 1TE1A 4J3XA 1LWIA 3W73A 3GXIA 2ZICA 1FTXA 1E0XA 1MZRA 1E9YB 2GQ8A 1V4YA 3L12A 1SVDA 1B4EA 4US6A 1FWAC 4JX6A 1CDGA 3QGAC 4B2DA 2WVVB 2V38A 5KZ6A 1XH1A 1IGSA 1W1TA 4PTDA 3T2QA 3AYVA 3HFYA 1OCJA 4XZHA 5C9UA 1B54A 1WKDA 2YL5A 2I5QA 1O6IA 3KP0A 3AZSA 1FWIC 4J9JA 4QROA 1BRLB 1MW0A 3BOLA 4QHRA 4PODA 5KINA 1AG1O 1MNZA 4ORMA 2YLAA 4GJ1A 1J5SA 3S5ZA 3PFRA 3PZIA 5AYXA 3LENA 4GYJA 1N8WA 1ADDA 4HOXA 1SO3A 4R34A 4P7QA 3A47A 3CYVA 5MKGB 3IK4A 2QUNA 3WYZA 4XD5A 1IWBA 3WENA 2X1RA 5KZDA 4PMXA 3KLKA 2C3ZA 1VKFA 3RK8A 1OGGA 3TW7A 3HN3A 2D3NA 2Z1SA 4KEZA 4ECLA 4IWWA 1KR0A 1PWMA 2BB0A 3WCZA 1J4EA 3PP7A 1W5MA 1EB3A 4KERA 4DM2A 3TJLA 4M6PA 4GABA 4JTTA 1R30A 3BQ6A 3M46A 1M7PA 1XSKA 4W84A 4IJBA 4TX9A 4ZBCA 2JBMA 3T07A 5DCEA 4FXFA 1DPMA 1LRNA 3WNNA 4EPEC 3B9EA 3R1ZA 3W1TA 4BQ2A 3LBOA 7ODCA 4IZGA 1OYCA 4CUCA 3E02A 3ITGA 1Q85A 3HG3A 5TQLA 3O6CA 3THQA 5AC5A 1SFSA 1F4AA 2VOMA 1ZSXA 5EPDA 1H7PA 5DX7A 2CPUA 3M0IA 1J96A 1MSSA 3F03K 5G5IA 3RILA 3XINA 2ADAA 5D03A 3NQDA 3HG2A 1EZWA 2C8NA 5CJ5A 3OG2A 3XIMA 4D6CA 3UYCA 1J8VA 3H24A 3VYLA 2Q09A 4QAWA 1VCFA 3LHWA 4EXQA 1TWDA 5HWMA 2IXVA 3HPSA 4IL0A 2W4XA 3VGHA 3WELA 1E1EA 1RJQA 1OGSA 2WC7A 1ZALA 5D2YA 4IJRA 1HL9A 1UOKA 2O9RA 1G4SA 3NXFA 1D7KA 1QNVA 2JIWA 4ERAA 3CJPA 1SZGA 4IGSA 1ZGDA 3L65A 1KM5A 1UKOA 3W7NA 2Y7FA 1PIIA 3O07A 1J01A 3OIXA 4M7SA 4EK7A 4NX5A 1LTDA 4FLRA 4U10A 4I6VA 3WJXA 4E2DA 4MDOA 2V69A 1R85A 3FGCB 3EKLA 3PNZA 1VRDA 1MVYA 4E4UA 3OYZA 5CJMA 5HWNA 2VHLA 4XD3A 2V68A 3SUUA 3H2FA 4H9MA 3G8RA 2EJAA 4Z2JA 1E43A 2H90A 5JH2A 5CPOA 3N1AA 4WIWA 3PTKA 4GUGA 4LBSA 5HA7A 2VX5A 3V36A 2GGGA 3U5YA 4GA8A 3PJTA 4AFYA 3GW0A 4DF2A 1F61A 1J0IA 3IVSA 1OFQA 3MT1A 2H3BA 1EIBA 1JZ8A 5C2CA 4CNSA 3TR2A 3BXWA 1TJ0A 1P7TB 4WDXA 3ITOA 2VI0A 4C6BA 1EC9A 1HT6A 4DJFD 1BKSA 4YPJA 3ZS4A 1EF3A 3AYSA 1XI3A 5DMYA 4QG9A 1GG1A 3P67A 4LYKA 2ZZ4A 7PTDA 4DAIA 1XIFA 3MHFA 2Q6ZA 3GTFA 2Y5EA 1E6NA 1FWWA 3IK2A 1XBYA 1G69A 2F2KA 4IMGA 1I1XA 3N2MA 3SQSA 4CD4A 2YCJA 5T91A 3VIFA 2UWFA 4L1GA 2Z2UA 4HJWA 3ANYA 3MS8A 3TNOA 4CNNA 1TYGA 3W7LA 5KZEA 4GH3A 2UV8G 4PCSA 3WNLA 2ZA1A 2QQ6A 3VIMA 1QI4A 3P8JA 2D24A 1JAEA 3URQA 3ABRA 1OF8A 3QBUA 3LGGA 3LHVA 3MVIA 4CU7A 3N11A 2YOCA 3UNTA 2ZRWA 4EAYA 4RLIA 2I56A 2AL1A 1CZ1A 3BURA 4MNKA 1A5MC 3W1UA 4UTHA 5G4HC 3WLIA 1Q6GA 1YE6A 3GBEA 5HBFA 2NLIA 2D2GA 1XWYA 4GO9A 1K7FA 4C6KA 2VEKA 3QFEA 4P7RA 4PEEA 3NO1A 3S83A 5HQEA 2DSKA 3EWYA 4GI8A 3M5ZA 2E8YA 3KL0A 2Y2WA 2FFIA 4HA4A 1QK0A 2PBOA 1RR2A 4XKMA 1ONRA 2CLPA 3UZXA 4KCWA 2BHZA 3SZ8A 4IFRA 4DF1A 2I5GA 1ECQA 5A6BD 1A3HA 3RM8A 3RFAA 1H7WA 3K8MA 3ABQA 3WK2A 5DBTA 1RVKA 1EDGA 4B4FA 2X1SA 2PC8A 1KTNA 2YSWA 3A21A 2CBJA 3QTGA 1GEQA 3USZA 3LUTA 3TC3A 3AHVA 1NDYA 2NUXA 4LF2A 3RUBL 4ICCX 2NQZA 5EMLA 3VIKA 5CG0A 3EDJA 3GIYA 3S2JA 1DIKA 2HS6A 3BZJA 5DO8A 3IJIA 3CUZA 4GY1A 3CPRA 2OSWA 3CQHA 1XGEA 1V02A 4MB5A 2VFEA 1L6YA 3EA1A 3GG0A 3GFXA 1E6SM 4KWVA 3K30A 5G2HA 1GVRA 5AFDA 2BNJA 3W23A 3WQFA 2X7VA 4KEMA 1C8VA 3QY6A 3QJAA 3PG9A 3EWBX 4AG0A 3WH9A 4I8DA 1JZ5A 4PMUA 4A21A 4GBDA 4PRTA 2WMIB 3SGUA 1E1CB 2WMKA 1EJTC 3SRDA 5M2FX 5KTLA 1O5XA 2DZBA 1XIMA 2A85A 4CN6A 2A5HA 4QR6A 1Z48A 2YB4A 3WJYA 1ZL1A 1IIGA 2F84A 3GH7A 5FD0A 4EVZA 5ABFA 1THFD 1QHPA 3QVQA 4BQ3A 3LD5A 2A21A 5A5WA 3CV6A 3R5EA 1QOPA 3R94A 1IXPA 1Z89A 1EFZA 2PMQA 1CXIA 1HJQA 1OCQA 3VZXA 1TO3A 1HNYA 3WQVA 4YIWA 2UZ9A 3ZQ9A 4HHMA 2PWDA 3OZYA 1V0MA 3QYSA 3GS6A 4ZE4A 1F76A 4GNVA 3W07A 3P61A 2J78A 5D33A 5DY3A 2CETA 2E6YA 4M29A 4J35A 5A6KA 4Z1CA 2X30A 4L5ZA 3BCDA 3ONBA 5F7UA 3V18A 2EKGA 2BWGA 3WF0A 2OWWA 4F2UA 2CLFA 3BSHA 1XPGA 2X40A 3NQMA 3QQ1A 1XL9A 4HCLA 2V81A 3QLLA 3ZLGA 4F4RA 4Q32A 4UQCA 4C1LA 2ISSA 2C91A 2DSWA 5CPSA 2WVUA 1OFDA 1KRAC 4HMNA 4MNMA 1W9XA 5H8PA 3N14A 3SSJA 1ZUAX 3UR8A 1OT1A 1GUVA 2HS8A 1MXSA 4LH8A 3FJ4A 3DI0A 2HCVA 1KCXA 4HN8A 1VQTA 5FACA 3IIXA 3RDKA 2FH8A 3TEVA 3B0VC 4V1XA 1BSLA 2P50A 1UD8A 2DIKA 1K4HA 4ROQA 2QCDA 3DU0A 2WNZA 1KQZA 2A79A 1SM9A 3SCUA 3DERA 1FFRA 3E6EA 2VDGA 4HMCA 5BXSA 1Z8AA 3VU2A 4H7CA 3ZR5A 4I5XA 3SCOA 1UWAA 3UWQA 4HSNA 3KWSA 5LNWA 2R1LA 3BWWA 2XN2A 5EMUA 1XDMA 3LSCA 1O5KA 3TOPA 2Z29A 3UF9A 4LALA 5I24A 4LGXA 2EPHA 3NQAA 3G18A 2I57A 1ZZMA 2GVYA 5LIUX 5CLTA 2NX9A 2J66A 1FKXA 4K68A 2B7QA 1A5KC 5A8NA 3GYEA 1UWTA 2DP3A 1V08A 1CECA 2XISA 3TAKA 3AMDA 1PKNA 5ABHA 3RG6A 4C1NB 4GWEA 4CEXC 1OINA 5I00A 3G1XA 3E3HA 1E51A 4F0SA 4FXRA 4M80A 3RGTA 4PH6A 4NNAA 3WO8A 4I7VA 4NRRA 3SUWA 1VFMA 2YL9A 4I90A 1NQKA 3R58A 4AQLA 1FWEC 2J9YA 4D6IA 2WBGA 5I2UA 4IIFA 5DXXA 3W38A 2G4FA 2BVDA 3ZFHA 4QLKA 2ZRZA 4N6FA 2B31A 3UZYA 1ONXA 5FAJA 5JMUA 4CGTA 2ATMA 3OEXA 4UTJA 3N34A 4OFCA 4PSPA 4IIHA 2ZE0A 4D71A 1J2BA 4H8VA 1F2JA 3QMTA 2VDIA 4XAGA 5LGZA 4LCQA 1XH0A 3FAWA 6CGTA 1TWSA 1E4NA 2J7EA 5BOFA 2ZZ6A 1TUFA 3V75A 3NEVA 1TJRA 2G37A 2PCQA 2D3LA 4UMBA 5CPMA 1E4MM 2OEJA 3UXIA 5E6ZA 3ARWA 3R6IA 4E2VA 4IOTA 3WQGA 4G1NA 1ZTVA 1PZ2A 2I9UA 5EMKA 2INFA 2DZVA 2J79A 3VNJA 4WR3A 1UKPA 3S2LA 2PDBA 1R9ZA 2QF7A 2FJKA 2XVGA 1JFHA 4E4FA 3WDPP 1IEXA 5HPOA 1OX4A 3CYJA 3CB3A 3W71A 2BY0A 4IMEA 4F0LA 1TVPA 2B7OA 3IACA 3IRDA 3LEPA 3GNNA 3F2BA 4LBUA 3SB0A 3POCA 1GJWA 2J9ZA 1TJ1A 3OVPA 2W5FA 4GZEA 1BQCA 3PC0A 2OMAA 3NURA 4MG4A 2BXYA 4FX6M 3VFCA 5I77A 5DRIA 2VZTA 4Q4PA 1LORA 4ZQNA 1X7FA 1R9XA 3A5FA 4XWUA 4H7VA 4GG9A 3T0AA 3K4WA 3TLQA 4B4HA 2ACUA 4K6AA 1BRLA 1CGYA 1S2AA 1WDRA 1G0CA 3CHVA 4N2YA 5H8UA 1HJSA 3B8WA 3NZ1A 1RPXA 5IBXC 3Q45A 4HHHA 1B90A 1DKWA 1WX0A 3OLGA 2P8BA 4JL1A 4DZ5A 3SCQA 4MLJA 2J47A 4GOAA 3RR1A 1GORA 5MKGA 1OT2A 3VUSA 1XBXA 3IAQA 3PF3A 4URIA 2DW6A 3HQ1A 1O1HA 3TTQA 4NJHA 3B40A 3GM8A 3WDRA 3A4WA 4Q4SA 1K6WA 1CXFA 1IT0A 4LJ3A 2DW7A 4LAKA 3NCOA 2IPFA 2QV5A 1NFBA 1U5JA 2AAAA 1KM2A 3LI1A 3TC6A 3FA3A 2XIIA 2XIOA 1LG1A 5D8WA 1UWRA 5GNXA 3VOJA 1TWZA 2AQOA 1IE7C 1XM3A 2XN1A 3ICJA 4UCFA 5HMEA 4DZAA 2G50A 5AC8A 2HNEA 2QIWA 1K6AA 3SUTA 5DCDA 3OOQA 3G0XA 4OGZA 3Q65A 4UFLA 4NQ1A 3LG3A 4NJIA 1DJHA 1GKPA 1MQPA 3TCSA 1XS2A 4KT2A 1X38A 1T7LA 4KIRA 4D6DA 1U22A 1B3WA 1MMFA 1VZWA 3NM1A 3NVDA 2V0TA 2OGYA 3AI0A 1IXNA 4GFIA 1J9YA 5D8ZA 2CZEA 1GQKA 3W7PA 1CIUA 4J4KA 4O16A 3H8AA 4DXVA 2FMOA 3G6LA 3KTSA 2FZNA 4WJXA 2OWXA 3NOEA 4JTRA 1WZKA 4UNLA 3CQKA 4ZSTA 3CAVA 2WZEA 3JZEA 1JYWA 4Q8UA 3W1MA 2OYMA 3EX3A 3QGKC 2AKZA 1GHRA 4QCEA 2P53A 5LXEA 1KLZA 2CLLA 4F0RA 3FHAA 3PSVA 3CZKA 3T42A 1A0DA 1TIMA 2QUUA 2NT1A 3WK3A 1K03A 2AGKA 1H2JA 3ZXWA 1M53A 3VMPA 1AW5A 1GVQA 1OFOA 5DFAA 3T0DA 1EDQA 4MAZA 5HNTA 1RBLA 1O68A 3T09A 4HVXA 1YDVA 3B0PA 3HV9A 4FOUA 4GMEA 4LY8A 2KZHA 4U3AA 3N2CA 1F9CA 3LY0A 1W17A 2E40A 2XVKA 3LTPA 1OC7A 1A80A 3PTDA 4D1JA 3KE0A 3L4YA 3FGCA 1XIJA 3BGGA 5CAHA 3G22A 4IPNB 4O18A 5HMFA 3T0TA 2E6FA 4BF7A 1JZ2A 2WLYA 4AWSA 1EOKA 3VDCA 3TNBA 3NL5A 4HK5A 2HVOA 3H54A 4KEUA 5CC5A 4CQ9A 1WUEA 4ZFMA 3WLMA 3TYEA 4YN5A 3AMCA 4WSHA 4BI5A 2PTDA 3S9ZA 1KFBA 4F48A 4JTGA 5IHRA 1NOFA 3QSTA 4CQAA 4ZB0A 3CWNA 1OBAA 5D05A 4ZQMA 5IDZA 5LSMA 1A5AA 3O06A 3GTNA 1M04A 1PZ3A 3BGJA 2GSHA 1TV7A 2YL6A 3WLLA 5CGQA 1XYBA 3PTMA 4GVFA 3P14A 3OLIA 4FK9A 2GLKA 4FOKA 4Q33A 1KWKA 2BHUA 3IUDA 1IIHA 2YDQA 4S2CA 1NF7A 2YFNA 2Q01A 4FXJA 4Q8VA 1P7TA 4N42A 2WW5A 1DJGA 2HXTA 3FS2A 2A6LA 2CZFA 1EIXA 3DIPA 3GKFA 4HCHA 1VS1A 2ZXDA 1VIZA 1JDDA 2ZUVA 5CXPA 3SURA 1F05A 3RLGA 3CS2A 2YB1A 2WMGA 3QQWA 3ARXA 4A3HA 4PCFA 4R88A 2XJ7A 3TYAA 3V1HA 4I8YA 1O95A 2XH4A 1GYNA 2PZNA 3L2MA 4KQNA 3MBDA 4ZENA 5MF5A 2ZKMX 2WSPA 4U5KA 3WD0A 3MUY1 3GVWA 4MSSA 4Z42C 1LZOA 3OIHA 1EWEA 4K7YA 5A6LA 2G4JA 1XGZA 2P3EA 4NF7A 2OYKA 1IR1A 4RE4A 1TVLA 1V77A 2F61A 4ENLA 1VIWA 4TV6A 1WDQA 2VCCA 5D9PA 1P6WA 4LCRA 3RM9A 4JCMA 4D6EA 3GTXA 2GVGA 5CZTA 4R7WA 1DORA