3DBPA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 6-nh2-ump
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal Structure of Human Orotidine 5'-Monophosphate Decarboxylase Complexed with 6-NH2-UMP
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dbpA00
3TQKA 1RR2A 3QW4B 1VLIA 1KLZA 3W1TA 4KWVA 1X7FA 2ISVA 4ONVA 2J88A 5K7JA 4RK8A 5G4WA 4O10A 3W7NA 1GVQA 1W56A 1X6UA 3C2VA 3OVPA 3GDMA 5IM51 3SI9A 2Q3OA 1KFBA 3OIXA 4TO8A 2J24A 2A7PA 4IX0A 3NPWA 1G4PA 2VFHA 4ZQCA 3M5ZA 3E12A 4LOCA 4U4MA 3NXFA 2FLIA 3HGRA 2WV8A 3P81A 3PUOA 5D04C 1BTMA 3UZJA 5HWMA 1TB3A 4WJEA 3OA3A 4MOZA 2ABBA 1G67A 4LV4A 3KRUA 3GDKA 3BVJA 1TO3A 1ALDA 4UTJA 3LI0A 4Z0SA 1GTHA 3LHWA 4LU0A 4HNTA 4ZQOA 2WPBA 5CKSA 1O4UA 1VCFA 1NEYA 2ISSA 3UQNA 3ZWTA 1KTNA 1K7EA 2WNZA 1VHCA 3T40A 5AC8A 1LOLA 5EKYA 3BG9A 1WX0A 5AYYA 3HOJA 1JR1A 2CLFA 3T55A 2A5HA 3I7QA 3L5LA 2H3BA 3W85A 5D2TA 1XC4A 2OX1A 4HHPA 4LRSA 1TTQA 1I2PA 3UD6A 1GYLA 3UZ5A 2R8WA 1JQXA 3L68A 3O63A 3WJZA 3O05A 4OE7A 3G22A 2YFOA 1IXOA 3QF0A 1OFRA 4KFPA 4O12A 2QEZA 3MHFA 1FWSA 1QPQA 1OFAA 5KMYA 2A4AA 1DHPA 4JTUA 1YXDA 4HSNA 4GE8A 2TMDA 3S8HA 1VQTA 3GKAA 2E09A 1H7PA 4JYEA 1AW5A 4AHPA 6ALDA 3KRSA 1TV8A 3W6YA 2VEPA 1SPQA 1A5SA 4UTUA 1EUAA 3LCIA 3W1XA 1K3UA 4O50A 1IGSA 3E9AA 1SSGA 2TYSA 1XBVA 1I2NA 3W7PA 1XM3A 3TX9A 3M5VA 4Z1CA 1W37A 2YGYA 4UXDA 1OYCA 3TW6A 3T44A 4EVZA 5D38A 4FB7A 2I1OA 1K8ZA 5A5WA 1RPXA 5DCBA 2TRSA 3OEXA 1ZAHA 3NR0A 5CZ0A 4QM1A 4IJBA 1DV7A 1CI1A 3C2EA 4GUHA 4NNAA 2ZCGA 1K8XA 3KAOA 1V7YA 2YZRA 4K38A 1R2SA 3G0UA 3KXQA 3NQ7A 3B03A 1XBZA 3BGGA 4BI5A 5LHEA 2QJGA 4IX2A 1S3HA 4JTKA 1O60A 3TC7A 3FEMA 2RDTA 3TXVA 1OFQA 2G95A 3MHUA 4Y9AA 2E6YA 4HSOA 1DORA 4BWLC 3W1PA 1XI3A 1JCLA 2B7NA 3ZWSA 2CW6A 1JUKA 1AG1O 5DCEA 1VC4A 3QW3A 2OCZA 4NVTA 3IIZA 4RXFA 4OV4A 5HMSA 1YLVA 2GPTA 4NJHA 4LC6A 3M1ZA 4N2YA 3CWOX 1MO0A 5LNVA 3B0UX 5E0KA 5CGQA 4ML9A 5F4XA 3U8GA 3S5OA 4RR4A 1PE1A 3M9YA 3GKFA 3QMSA 2YDAA 1VJIA 2OT1A 1U83A 3RLUA 2HMCA 5KITA 1I8JA 2E5CA 3PBVA 4DEFA 5HNRA 1FDJA 1LDCA 2GVLA 3H54A 4NX5A 4NX0A 3BK0A 3L2IA 1FWNA 3NQGA 5FF7A 4Y96A 4H6KA 4ICNA 5KTLA 3IIXA 1K02A 5DLCA 1TPB1 2Y61A 4NUWA 1SFJA 4IUOA 3HPXA 4JIPA 3STGA 3HBLA 4O57A 4DQWA 3TMLA 1TPUA 1W1ZA 2WO5A 4QJ1A 3DBPA 3G1XA 4LNYA 1OX5A 4FNUA 1YXCA 5FF4A 2BTMA 2RKXA 2C19A 3GDRA 1PV8A 2QCNA 1SO3A 1EX5A 1JULA 4MVAA 2QCLA 3BV4A 2Y7GA 1VYSX 2HTMA 3DFNA 1SZNA 1L6WA 1WXJA 1QCWA 3I7SA 2E5BA 5K3VA 3UPWA 4YCPA 2Z1BA 1NSJA 2OZ0A 1YDVA 1H62A 3LTPA 3HGSA 2JGQA 5TIMA 1KM3A 4ZQMA 2GVGA 1S5TA 3PR2A 1LCOA 4OU1A 4UMBA 5FF0A 1SFLA 2EF9A 2GUUA 1W0MA 3HG4A 3IIPA 1GVFA 3L5AA 4O16A 4XKYA 3WK3A 2ZZ4A 3N3MA 3NQ6A 4JDBA 5F2IA 3N2MA 4RZ4A 1FQ0A 4GWEA 1LZOA 1FUYA 4H3DA 1W3IA 1TREA 1T0OA 3GNNA 3EX1A 3E0IA 1HTIA 5AHEA 2C13A 5F4SA 3TKFA 1SW7A 1H5YA 4K39A 2ABAA 4K6AA 1ZHAA 1Q45A 2PE4A 3BG3A 1TIMA 3UYCA 4FXRA 2J9XA 4ALDA 3NQFA 1WQ5A 1XBYA 2FPTA 4C1KA 5ABTA 1ZFJA 5IBXC 1O94A 3DKLA 3IIOA 3NM1A 3BARA 2QCCA 1EP2A 1C8VA 3N2XA 5DELA 1MXSA 3LXCA 1H1ZA 4JTGA 1TPEA 3JR2A 1H60A 4U28A 3S6DA 2E1DA 3LDVA 3B06A 4GXMA 2G97A 3HQ1A 2JBMA 5FEPA 3NQDA 2VFDA 4LW7A 4XQ6A 3EWUA 1M5WA 1DJNA 4IMDA 4IGHA 2V2CA 1TMHA 3A9IA 4NXKA 4A2SA 3P74A 3VE9A 4UFKA 4WQ6A 4N6EA 4EIVA 1SU5A 1LLWA 2DJXA 3TSDA 5FEXA 5D2YA 2C1HA 5D30A 1SW0A 1H63A 4PTNA 4FX6M 2GOUA 3LBMA 5A8GA 3TH6A 4O28A 1AK5A 1C9DA 3C0JA 1TRDA 3W22A 4AXKA 3H55A 1OYAA 2Z0IA 1ZENA 1KFKA 4J9JA 5AC6A 3N9RA 5DY2A 1K7XA 4CCEA 5CPOA 3Q2DA 1QO2A 2V5LA 4H4IA 3ABOA 3CU2A 3VI2A 3O16A 4PL2A 3N19B 8TIMA 5H91A 1EB3A 4JTIA 4O53A 4Z1BA 1KTBA 3TFXA 4PL1A 4K37A 2VFIA 3O06A 1JQVA 3M16A 1ZAIA 1XKYA 1TPH1 3M0ZA 3P84A 3GXPA 1KM5A 3LHZA 1PIIA 2E6AA 1WBHA 3W7DA 3KVMA 4RXGA 1G4SA 2W0UA 2A6LA 2OJPA 4R7JA 1OFOA 5TQLA 3S0CA 4AAJA 1YTDA 4RJEA 3B04A 3QQ1A 1KM4A 3FKKA 3FA5A 3CEUA 4IMFA 2FPVA 4JTEA 1Q6LA 3VCRA 2RH9A 4FNPA 3STEA 3A21A 1WV2A 3DAQA 4FIQA 2HS6A 4M5PA 1UUOA 4N4QA 5FESA 1H7WA 4PEKA 4CQ8A 1UCWA 1LBMA 5D2WA 3WJXA 3FOKA 5GVJA 3DFTA 3MYPA 3U2OA 2YSWA 1QR7A 2QKFA 3A24A 3R12A 3C52A 1KV5A 2CLHA 5G4EA 3LHUA 2X30A 3M47A 1W8SA 4O0KA 4AF0A 3TAKA 1JCMP 1G7UA 2J27A 1KFEA 3C6CA 3G1SA 4M6PA 1E51A 4O8RA 4RZ5A 4UFIA 3MWAA 1XXXA 2C0AA 4OT7A 3UXDA 4LT9A 5K4XA 3NQEA 2CZEA 3ABSA 2JKEA 5U7SA 1KFLA 3NVTA 3SW6A 2B7OA 3FYPA 1SO4A 3W7KA 2A7NA 2NV2A 1L6SA 1FCQA 4XBKA 3V1PA 1EPXA 4LTSA 1B9BA 1Z48A 1QAPA 1L6YA 3G1FA 1KM6A 4O14A 4MIMA 4HKPA 4O1BA 1IXPA 1A5BA 3W9ZA 4QITA 3C3NA 3O15A 1FCVA 5CPMA 3QMTA 3SJ3A 3MUXA 3ZFHA 3HG3A 1G4TA 4GUIA 1OFPA 5AHNA 3P8IA 2Y62A 1HUVA 1EIXA 1FWWA 2ZZ7A 1R2TA 3PY2A 4NZJA 3MJYA 1DJQA 3OVRA 5LZLA 2DZVA 3P82A 3LXAA 4UTTA 1TPFA 5EYWA 3C4UA 4UIOA 2BZNA 5J5RA 2ZTJA 2W6RA 1IXNA 1KM2A 4NJKA 4X3ZA 3W2UA 3KVJA 1FXQA 1L9WA 4JTFA 3R5EA 4A21A 3EWWA 1PHQA 4MYAA 3PVFA 4GJ1A 1K8YA 2VEIA 4JIQA 4AHQA 3PUDA 1B4EA 5F2MA 4JX5A 2PRMA 4DF0A 5AFDA 3DKJA 3QQ0A 2NZLA 1TCDA 2CLEA 1MEIA 1X8FA 1G4EA 1DQWA 1R30A 3NGJA 4DPPA 5F1VA 3LCXA 3EXSA 4XTIA 1J2WA 1XUUA 4LVDA 5LHFA 1NF0A 5KSWA 4QISA 3OHIA 2C15A 5F2LA 5EBUA 5G1YA 2ZFAA 4R34A 1ZCOA 1SZGA 5HWNA 4JY8A 3L0GA 1OK6A 1Q6RA 3W75A 2NWRA 4YCOA 3TV8A 2ZBTA 4AMAA 1GVRA 4GUGA 3TA6A 3S9YA 3SFKA 3VFLA 5G2WA 3CWNA 5C5YA 1OHLA 3GAYA 3L9CA 4I9AA 2B4GA 1ZNNA 2ZZ6A 1VZWA 3LHTA 1VCVA 3E49A 3F4NA 2DU2A 3W7LA 3E96A 3S1UA 3C2RA 3G1YA 1DL3A 4K8HA 3U6WA 1Y0EA 5G2HA 4HPXA 2QCDB 4M6QA 5F4WA 2X1UA 2D73A 3MP3A 3S42A 3RK8A 2GQAA 3P62A 4JX4A 4RV8A 1HFBA 3IGUA 1GG1A 4E2DA 4A29A 2AGKA 5LNUA 3W83A 1ONRA 4X22A 4N02A 5AHLA 3W72A 1WYIA 2ZRYA 5HINA 2Y7FA 5EPDA 1ML1A 5HR6A 2NX3A 4IMEA 1TPVA 4UMCA 1KTCA 2FTPA 4O4VA 3CIWA 4FIRA 3EX2A 4FNSA 4UTHA 4BI7A 4X9SA 1KFCA 2GVJA 3PM6A 3ELFA 2NUXA 1M7PA 2NV1A 5HQEA 4PODA 4JICA 3V75A 1F76A 4Z1AA 3WJWA 3N34A 4JTLA 5G5IA 3LCGA 1QFEA 3M6YA 4ADTA 1L2UA 3G1DA 3W1RA 3EXRA 3DFSA 1YPIA 3G0XA 3T78A 2H90A 5HUPA 1JCXA 2ZDRA 1SQ7A 4FEZA 1JUEA 2OMAA 2YYTA 1EEPA 4ZQRA 1H51A 5LSMA 4A2RA 3W2KA 1NF7A 1OX4A 1TSIA 4Y6GA 1F5ZA 3R89A 4WUIA 2B7QA 4LVFA 2NXHA 3PG9A 1A5AA 5CPLA 4C1LA 3AJXA 1K03A 3WK0A 2V8ZA 1BKSA 3VNDA 4WD0A 3QH2A 3KRZA 4MZYA 4XKYB 3W86A 1PL9A 4G1KA 4O18A 4MFEA 4XWUA 4M7TA 1VPXA 2H3DA 3FS2A 1PS9A 1KA9F 4Z08A 2QF7A 2V5BA 5D09A 4MKNA 2B7PA 3LI1A 4P61A 4Z0JA 5CPNA 3PB0A 4LV9A 5C54A 3SECA 5DXXA 3NM3A 5LGXA 3QFEA 2BSLA 3TJXA 1GJPA 1ZJIA 4MY9A 3ZS4A 2JKAA 3A23A 3HMJG 1SO5A 1F74A 3GDTA 4ORMA 4POCA 3LTYA 3W7HA 3D0CA 2VOMA 5EA9A 1QNVA 2W79A 3BLFA 2KZHA 1OFDA 2AAMA 1N55A 1LRNA 4MJMA 2Y85A 2WNNA 3EXTA 3TCEA 1OF8A 4MYXA 3ANYA 3THQA 1XCFA 2Y6ZA 2ZRWA 3G18A 4M19A 3S1XA 1Q6OA 1TV5A 1F6KA 1WOBA 4MLRA 1T99A 1W5MA 3HO8A 4UCGA 1LP6A 1XL9A 1VLWA 4NQ1A 4DO5A 1EUNA 4Q4KA 4HN4A 3NQ8A 3G1HA 2P10A 4NNCA 2ISWA 5D2VA 3OG3A 3LCLA 4O52A 3QPYA 1Q6QA 2JGYA 1F6PA 1VGAA 3SY5A 2DZXA 4GBUA 5F1UA 3UY8A 2CLKA 2QCMA 5DCDA 3PBWA 2TPSA 5K4ZA 3B8DA 1X1ZA 2O7SA 3GR7A 2E6DA 3UWVA 4ZZ9A 1H50A 3BG5A 3L65A 3PB2A 3RLVA 3MP4A 1LRTA 2YW4A 1I45A 1OX6A 5BOOA 3TQVA 3QEZA 3DZ1A 4UTWC 4S1FA 4LS1A 1TPWA 1P0KA 5LNWA 3I68A 1Q3NA 4Z1DA 3KOFA 3M44A 1TJRA 4AWTA 3GXTA 2YPIA 3W1UA 3DHDA 3UWWA 3C56A 2QDHA 4FXSA 2C16A 4EOUA 3QZEA 2NX1A 3C2OA 3IVUA 4RX0A 5HWJA 1SR9A 1D3HA 1DKWA 4WY0A 2NUWA 1T8XA 5K9XA 2I14A 3GXNA 2DZUA 3OBKA 4CCDA 2RHGA 2X1TA 3ATZA 3GLCA 5K9DA 3TFCA 1TRIA 4FX7A 1GVOA 1IIHA 1BWKA 3LOTA 3PAJA 2FJKA 2ZRVA 5FEWA 2DZTA 4UR8A 1AW1A 1A53A 2R94A 1F2JA 4RLIA 1VHNA 3IGXA 1W5QA 2EHHA 1ADOA 2ZA3A 5D33A 1GWJA 3PWAA 5I3FA 3TMQA 5EY5A 3LHYA 1P5BA 4IOTA 4YXGA 3NA8A 1W5NA 2LLEA 3SGZA 3P7YA 2A0NA 4AF0B 1QWGA 3HB9A 3TW7A 3BW4A 3W2MA 3W2LA 2CLIA 1KLYA 2QUTA 4LUIA 2WSYA 4DO4A 2B0MA 3MI2A 4JN6A 4AH7A 1PCWA 5J5DA 4HPJA 2EPHA 4ADUA 1JJKA 1RQBA 2WSQA 3W7MA 5D03A 4LVBA 4LVAA 3QMRA 1DBTA 3O8AA 1FDYA 3P5ZA 1I2RA 1IXQA 3DH7A 4OWGA 1YTEA 1MEWA 4AB4A 4TR9A 3TU9A 2FDSA 3M43A 1HL2A 3R2GA 1VYRA 1OVDA 3DI1A 3PF3A 5K2ZA 4UFHA 4E2BA 4LS2A 2ZZ1A 2O7QA 3I6RA 3LRKA 3MYOA 1V5XA 3S1WA 4TMCA 5CG7A 3PSWA 3HGOA 3K30A 4N9CA 1ICPA 3NZ1A 3Q37A 5L9FA 1UB3A 2Y88A 3HJZA 1DVJA 2CLMA 3S1VA 3W7EA 1RZMA 4HNUA 3QSTA 1QO5A 3T7VA 4BK9A 5K9CA 3WK1A 3N14A 1H7XA 2CFFA 4QQ3A 3NL5A 4FNRA 4MLJA 2VFFA 3DFOA 1GOXA 3LTSA 2VELA 4JGDA 4IPIA 2WQPA 4QAIA 2VEKA 4UNKA 4DPQA 1LOSA 3PG8A 2Q8LA 4D2JA 4UTLA 4AHOA 1GPWA 1VR6A 3TE9A 3HG5A 1JRCA 1FWRA 4NJIA 4IMCA 1R46A 3WFAA 2DZSA 3P80A 2DORA 2BWGA 3QM3A 3CT7A 3IVTA 3P67A 3NQAA 4QNWA 1LROA 1SUXA 1LORA 3GAKA 2UV8G 2ATSA 3QRHA 2IQTA 2C14A 3WJSA 1TPC1 4N4PA 3W1QA 4O19A 4ZVJA 2QUVA 2R14A 3W1NA 4YLWA 2FIQA 3TAOA 4GFSA 3H53A 2V82A 3O1NA 3USBA 4DBDA 1G7VA 3NOEA 1G6CA 1UASA 3W23A 3JRKA 4BF9A 4ZQPA 1SO6A 5AN7A 1XDLA 3ABRA 3BLEA 2WJZA 1RQEA 3HF3A 4N6FA 4MUZA 3T4CA 3WJYA 3LB0A 1LBLA 1VCGA 3QYQA 4ADSA 3FJ6A 3AO0A 2QR6A 2BX7A 3F03K 2ALDA 2X1RA 3INPA 4PFMA 4S2BA 5CSSA 1EP1A 5DBUA 1N7KA 2NLIA 4LWWA 4CNNA 3W7OA 2RFGA 2OT0A 5SWUA 1RD5A 1ME8A 3MBFA 3A5FA 2WNQA 2Y7EA 3I65A 1W5PA 2FB3A 1PHWA 4JTJA 4QSHA 4EF9A 2QCEA 2I9EA 3STFA 2YXGA 5CZTA 5D02A 1Z41A 2CLLA 2XN2A 4ZMGA 2E77A 4K36A 2A2IA 4Q33A 4WXYA 5AHFA 3W7QA 4GC4A 4S2CA 5HUOA 2Y7DA 3W7JA 1WAUA 3LCFA 3W7IA 1WOAA 4HNNA 4JY9A 2PURA 2YCEA 7TIMA 2NWSA 5EL1A 1D9EA 3CLMA 1OYBA 4LS0A 4E0CA 4UTTC 1H61A 2CWNA 3GDLA 3LBCA 3MP5A 2PRHA 1GG0A 2A1YA 4RZ6A 2HSAA 4DO6A 1XUZA 1M7OA 3FKRA 3LRLA 2WSRA 2H8XA 2V0TA 3P8JA 5DN1A 2F84A 4O15A 3BGJA 3L0KA 4AWSA 1I2QA 3CEPA 4CNOA 2QCGA 5BW6A 4EWND 3SZ8A 2EKCA 2Y63A 5E93A 4AVFA 3W88A 1QPRA 2GQ8A 3W7RA 1H7NA 5BNKA 5HJLA 3VE7A 1KW1A 2VFGA 2YFNA 1OX4B 1QOQA 1JRBA 1SSDA 3NEVA 4MFDA 1JVNA 4PCFA 3L5MA 4IPJA 1W54A 2GQ9A 3HGJA 3TC6A 2Q3RA 2PC4A 1GEQA 2J6XA 4FF7A 4UFMA 1XFBA 1MZHA 3W2JA 5MHBA 4Q32A 1KBIA 1U5JA 1O95A 3GYEA 4NJGA 4IWWA 3EKZA 4N9EA 3FYOA 3OVQA 5G1TA 4DELA 3LCWA 3B0VC 2V81A 3E02A 1JCYA 4O0ZA 5T26A 4DF1A 1ZALA 4NXSA 5E1QA 4GUFA 2A6NA 4CNPA 3MBDA 2GJLA 3PS7A 5L6UA 3GVGA 4DBEA 3GIYA 3DENA 1PVNA 2Z6JA 3DXIA 3PUEA 1BEUA 3ABQA 3IGSA 2P1FA 2NX9A 4RKAA 2X16A 5EMUA 3LLFA 3PBUA 5D32A 2J9ZA 2QJIA 3B4UA 2QJHA 4L4LA 1MEHA 5AOUA 3TK7A 1B3OA 3QC3A 2QCFA 1YYAA 2BXVA 1F73A 2BLEA 2E6FA 3PC0A 3IV3A 3M7WA 4N9DA 3R13A 4WOQA 4XZ9A 4ZQNA 3B0PA 3KVKA 3B05A 4LY8A 3YPIA 4MZ8A 5KZDA 1QMLA 3NL3A 2AQWA 3EKLA 3L67A 2C18A 5F2GA 2CU0A 4FNQA 1CX9A 3C61A 4KKXA 2FB2A 3RF9A 1FCBA 3NPXA 4JD4A 3GNDA 3W3OA 3NPVA 4AWUA 4P2VA 1RQHA 3CPRA 5D37A 4UUIA 4ZL1A 5CSRA 4OHQA 4UFLA 2EAWA 1T96A 5I3HA 3W70A 5BMXA 4O1DA 2CZDA 3TJLA 4Y8FA 4GNJA 1OJXA 4BFAA 4AEOA 4Y90A 4O1CA 1W3NA 3CTLA 3TXZA 1WDWA 3NAVA 1Z42A 3BPWA 1NFBA 1QPOA 2DZWA 3W71A 3QJAA 1FXPA 3EEGA 1NVMA 1S5VA 3DGRA 1EWDA 1FWTA 3MO7A 1AW2A 4L4MA 4PA8A 3WK2A 1RV8A 1P4CA 4JNMA 1FY6A 1AL7A 1IF2A 4OV9A 3UXAA 5LGZA 3N9SA 1TTJA 4BI6A 4I7UA 3C2FA 3TDFA 4WX2A 4O4WA 4MZ1A 2NUYA 1H7RA 1LOQA 5BRBA 3BW3A 2PCQA 4BWLA 4O17A 4XUGA 4JTTA 2QDGA 4TMBA 4JXCA 3RU6A 2FPYA 1EWEA 2JK2A 1XDMA 3TSMA 1OFBA 1YADA 1EP3A 4FHAA 3W76A 1KFJA 4WY0B 2PRLA 1GQNA 3G8RA 3W1LA 1UBSA 3EX4A 3UWZA 4UTIA 3W2NA 2QCDA 1W3TA 3MW7A 1D3GA 4JTSA 1OFEA 3QPZA 2XFWA 4HNVA 1QDSA 3C8FA 5LNSA 3HPZA 4JTHA 1TTIA 3FFSA 3DHFA 4R53A 1A5CA 2CZFA 5I3GA 2TSYA 3W73A 4DF2A 5I3KA 3P60A 3W1MA 3IIVA 3DI0A 4O13A 5FF3A 3FLUA 3M5XA 3A22A 5AYZA 1GT8A 1UUMA 4JX6A 3S5YA 3UNDA 3W87A 1AL8A 4JR5A 2VKZG 3ATYA 4A22A 1P0NA 2C6QA 3G1AA 1TTPA 3EB2A 4QNEA 2FFCA 4YL2A 3G1VA 3GZ3A 3W07A 2CZ5A 1H1YA 1FDZA 2ZYFA 2X1SA 2RDUA 4TIMA 2ZA1A 1KM0A 1R2RA 4LC8A 3EX3A 3R8RA 2ZRXA 2JKPA 1I2OA 1IIGA 1J5TA 1KM1A 1DOSA 4UTWA 4WZHA 1M6JA 3M41A 4N9BA 4ORIA 3TUUA 3KHJA 5KZMA 2DZPA 1FCUA 1EA0A 2Y70A 1TPDA 1QOPA 4GUJA 4O11A 4I7WA 2NXGA 5G2IA 5I3JA 3F4WA 2GJNA 1G69A 1OG0A 3SGUA 4MPQA 4NZFA 4DXVA 1TV7A 4M7SA 2J9YA 2VENA 3W74A 4A3UA 4BR1A 4IQLA 3UWUA 1PCKA 5HULA 1VRDA 3L21A 2HS8A 2NXIA 4E38A 3O07A 1GVSA 3F1QA 4UC5A 1KBJA 3BO9A 1AMKA 1YPFA 4EF8A 5IBXA 1VYPX 2ZZ5A 5D2XA 5DY3A 4HT3A 1B4KA 4UTMA 3NQ2A 4NT0A 1LLZA 2VEMA 1O5KA 3O6YX 1ICSA 4K7YA 3W84A 1SZEA 1I4NA 4IXXA 1UJPA 3CIXA 3NG3A 5HR7A 3CC1A 2P0OA 4JYDA 3SSJA 3HG2A 1ZY9A 2QAPA 3TROA 1A50A 1R47A 5DXYA 3IEBA 3UY7A 2ZZ2A 3LXBA 5AHMA 3M5YA 3NQCA 2V2DA 1TYGA 3RNDA 3ZR4A 3P5YA 2Z6IA 4LVGA 4WY0F 3GB6A 2R91A 3UPBA 5DBTA 1GYNA 5C55A 5U4NA 1N8FA 4XTDA 4O54A 3TIMA 1K7FA 3NQVA 3EWBX 3LLDA 4OGZA 1HO4A 1C29A 1B57A 4FNTA 5KZEA 1ME7A 3LV6A 3LRMA 1F05A 1W5OA 3O6DA 3LV5A 1S5WA 3PSVA 3THAA 4HIBA 3W7GA 4OQVA 3STCA 1WBJA 2VFEA 4GRSA 4JDYA 2Q8ZA 3SR7A 1BWLA 2QCHA 1YDNA 4B5NA 5C6MA 1VS1A 4KFOA 5AYXA 3TR2A 3G8EA 3NO5A 2EGZA 3G3DA 3A5VA 1YTKA 3LCHA 3EWYA 3PULA 5AC7A 3NL2A 3PBYA 2ZRUA 2Y89A 3NDOA 3CB8A 2WKJA 2ZA2A 1OF6A 4OBTA 2Z2UA 2QAFA 4QIUA 5FEZA 5BMWA 2A85A 4CQ9A 3KVLA 1TJPA 3NZRA 3UWYA 1ME9A 2V2HA 4M6VA 2V9DA 1O5XA 1F7BA 4JYFA 1ICQA 2QUUA 3DU0A 4RCXA 4FX8A 3MI3A 3NYZA 3FJLA 1CW2A 4X2RA 3TQ0A 5D05A 1JUBA 4KWWA 1TQJA 4UMAA 3HIJA 4WXZA 3UWQA 5H2ZA 4W9TA 4UR7A 4JS3A 4XBSA 4CQAA 1KV8A 1LM1A 4UNLA 3EX6A 3W7CA 4K7VA 2H6RA 2VC6A 2ZQ0A 3N73A 2H8ZA 4CCCA 3W1AA 3NNTA 3JS3A 4LUJA 1GTEA 3MHGA 2G96A 3G24A 3NQMA 4WOZA 1X1OA 3G3MA 3LM7A 4LRTA 2YR1A 4MY1A 3VKJA 5TBOA 3GX9A 4YWIA 4FO4A 2E5DA 4K8EA 1GZGA 3GR8A 3DFPA 3RFAA 2G5WA 3FIGA 2X2GA 3CQ0A 1ZAJA 1H7OA 3CHVA 1J4EA 3BLIA 1OABA 5FI8A 3RMJA 2A7RA 3CM4A 4NU7A 3G0SA 2DP3A 5LKYA 5C2XA 5I3IA 3S5NA 2A21A 3GK0A 3QSRA 4O1AA 5AHIA 4MJZA 2WOQA 5AB3A 4NNBA 4YMZA 3EWXA 3LGEA 1P1XA 3TSBA 1TQXA 1LTDA 1HG3A 1QPNA 3L0NA 4IXHA 4PC8A 2YW3A 5KINA 1YDOA 2V30A 5CZJA 2YX0A 1RVGA 3LERA 4PH6A 2YYUA 2ZTKA 2ZZ3A 2DJLA 3NL6A 3P61A 2FQIA 4CLMA 3MI6A 1LRQA 2F7FA 5CZSA 3MMTA 2CLOA 2E68A 3Q94A 1SW3A 3KFTA 3EWZA 1HO1A 4R33A 4UTKA 1SZFA 4JEQA 2VXNA 3NPUA 3KX6A 3L66A 1YXYA 4NJJA 3IRDA 3Q58A 2ZRZA 4UFJA 4I7VA 5LNRA 1LYXA 4TU1A 3BW2A 6TIMA 1XBXA 1JCJA 3S5ZA 1Z44A 2ATMA 3TNOA 1LBFA 3IVSA 4KFNA 2XN0A 3I7RA 2XN1A 4TX9A 1NAL1 5FF2A 3O6CA 4MY8A 1FX6A 4IMGA 3HPSA 2C3ZA 3SIZA 1FBAA 3DFQA 1MSSA 1OK4A 3LHVA 1WA3A 1W31A 1DQXA 2RDWA 1JCNA 1VH7A 3LX9A 1THFD
chains in the Genus database with same CATH superfamily
3LENA 4ZTXA 1MRQA 2ISVA 2WZIA 2QIIA 4GMEA 1IR1A 3NZQA 5FSDC 4O10A 3GTNA 1F3EA 4A8IA 1V6VA 1J0IA 3S47A 4V15A 3OIXA 3UZZA 4TO8A 3GWQA 2A7PA 4IX0A 3NPWA 4AZGA 3F4CA 3VGHA 1W32A 4LOCA 2WCAA 1J79A 3QC0A 2PAJA 2WV8A 3OA5A 1BTMA 1E3XA 3URNA 3UZJA 3T2OA 4MB5A 2P8CA 1G67A 4LV4A 3KRUA 4XIAA 3UR2A 3BVJA 1L6FA 1TO3A 1ALDA 2ZIDA 3KTXA 1I1XA 1DIOA 4H41A 3VDCA 3SJNA 5BRPA 5CKSA 1O4UA 3LU2A 5BROA 3VZXA 5FACA 3ZWTA 1VHCA 2FFIA 5EKYA 3GC5A 3HOJA 4KS0A 3QHOA 1E6SM 3L5LA 3W85A 1YKWA 3CUIA 2QMKA 4HHPA 3GR4A 2JQXA 4KGLA 3VC6A 2WXDM 3L68A 2NT0A 3O63A 2VHLA 4OE7A 2ANUA 4HU8A 2BVYA 4HCLA 4KWOA 3O0KA 4AY1A 3CO8A 4KFPA 4O12A 2J7CA 1JYXA 1OFAA 5KMYA 1H0IA 3JZEA 4GI4A 4I6KA 4HYRA 4XK2A 4GE8A 2YL5A 1XH1A 3WUEA 1VQTA 3GKAA 2E09A 3WEZA 2XGIA 1H7PA 1JZ2A 1L0PA 4AHPA 6ALDA 5EB8A 2VEPA 4XZIA 3RJXA 2XSXA 1K3UA 4O50A 2PDKA 1IGSA 1XLIA 2P76A 4MWAC 1VAHA 4G8TA 1ZSXA 2ONEA 3M5VA 1J93A 1W37A 1ECQA 4GYPA 3TW6A 4EVZA 4FB7A 1RPXA 5DCBA 3OEXA 4JQAA 2V68A 3GFZA 3VNMA 1R2SA 2XINA 3B03A 4KWUA 1TJ0A 3KCLA 5TNVA 2GUYA 4JTKA 4IX2A 1S3HA 1O60A 3W0KA 3FEMA 5A6BA 4XBJA 3MHUA 4J35A 2E6YA 3QR3A 1JIBA 1FP9A 3LPOA 3W1PA 1XI3A 1A3HA 1H2JA 1VC4A 1LF1A 3S2LA 2BG5A 2WQDA 2CC0A 5A8OA 3U57A 3M1ZA 3OW1A 4PTXA 2QYGA 4RDVA 5LNVA 1BKHA 5E0KA 1P0BA 1D7KA 3FHAA 3TYEA 3S5OA 1PE1A 1W1PA 3GKFA 3QMSA 4L1WA 4M82A 3RLUA 3PBVA 3BLOA 1RK6A 4NX5A 3BK0A 3NQGA 4Y96A 5KTLA 4HU0A 1G01A 1X97A 1HNYA 4NUWA 1SFJA 3MA8A 3HPXA 3HBLA 1W1A1 4ROQA 4W4QA 3VK5A 3EAUA 3VAVA 3SCTA 3G1XA 3QV9A 4NI8A 4WDWA 1CXIA 4TV5A 1ZUAX 3AICA 4GG9A 3IJ9A 1JULA 2W4XA 3VOJA 2FTWA 4MVAA 3I3DA 2VZVA 3BV4A 4P7OA 1SZNA 1DXIA 3I7SA 1NSJA 4AYGA 3ZYZA 2WYSA 4IISA 2XGBA 1P0DA 2NVAA 3LTPA 4AZ6A 2JGQA 3PR2A 2EF9A 4MMWA 2CWXA 1GVFA 2Y5JA 4XKYA 2PD5A 3N3MA 3NQ6A 4RZ4A 4W85A 5AYBA 4ZO7A 1FUYA 1UKOA 1W3IA 1TREA 1T0OA 1PSCA 4NZCA 2BOGX 4BF5A 2YBVA 1GJUA 5J8LA 3GE7A 4PULA 3POCA 1O7AA 1UWTA 4H00A 3KOWA 4K39A 4PSRA 5GJPA 4K6AA 3UERA 5D4YA 3UYCA 1TIMA 4GQBA 2J9XA 1E71M 1WQ5A 1OT2A 2FPTA 2WC7A 2XSAA 1TV4A 3UCQA 5ABTA 1W9BM 1FHUA 4GQRA 1UMLA 4F66A 5JH1A 3N2XA 4JHZA 1W8GA 3W37A 4NZ5A 1H1ZA 4JTGA 4HTYA 1X6LA 3B06A 3CL8A 3AXKA 3UCDA 2CITA 4DBUA 3T0DA 3GTIA 1HJWA 2HBVA 2OTDA 3M0YA 1A4LA 3GUGA 4KCTA 1DIKA 2OQYA 3V3WA 4CD7A 2FYMA 2V2CA 3RU8X 3A9IA 2WHMA 3PZUA 2GK1A 1Q8AA 1Z69A 1PEZA 4EIVA 1Q7MA 1LLWA 5T91A 1PTGA 1H63A 1JD9A 1KBBA 4AZHA 3UJ2A 1I6NA 3V16A 5C8BB 2J7GA 5LXXA 3K8MA 1KQZA 1TRDA 3TVAA 3AS0A 4GZEA 4PMXA 4JL2A 3ENLA 3W22A 1P7TA 3H55A 2PBOA 1OYAA 2Z0IA 1E0UA 1ZENA 1WPCA 5DY2A 1UR0A 4C6PA 4H4IA 3U4AA 3CU2A 1R3TA 4JTAA 3VI2A 4ZB2A 1Y7VA 4PL2A 3OZPA 8TIMA 4XV0A 2OLAA 1KTBA 2PDHA 1XICA 3TFXA 3VINA 1XKYA 3N15A 1KM5A 4IFKB 4EWJA 3AXMA 3QN3A 1BSLA 3W7DA 1J12A 1N8WA 2A6LA 3RPTA 1EO7A 3S0CA 4IF2A 4N0RA 4B5VA 3B04A 4IH3A 3QR0A 3VGBA 1GQKA 4G7EA 3S3GA 1MYRA 3FA5A 4HPGA 3A21A 2IXUA 4FIQA 2HS6A 2W62A 4M3PA 1UUOA 4N4QA 4WCJA 4M8UA 4CQ8A 5GVJA 2YSWA 1QR7A 3C52A 3DX5A 2EG7A 4KEUA 2DZBA 2VQUA 4AZ5A 4HK5A 1W8SA 4MNJA 1SFTA 2AQOA 4O8RA 2DVTA 1QW8A 4UFIA 3V5CA 2XU2A 1XXXA 3ARZA 2PTXA 3WSUA 1E70M 1GQIA 3TN5A 3ABSA 3NVTA 4JBRA 4B5SA 4F0RA 2Z1XA 1K9FA 1QT1A 1M7XA 3GH7A 4A4AA 4LTSA 3SUTA 1GNXA 1B9BA 4MM1A 1Z48A 3OU8A 3CWHA 1XCXA 1V77A 4PMOA 3CYVA 2OGYA 3DYOA 1XIDA 3IJ8A 3MVIA 4QHRA 1KXQA 3O15A 3WFLA 3K1DA 3QMTA 3SJ3A 3GXMA 4PUNA 2VEGA 3MUXA 2PWGA 5AZ0A 4GUIA 3TJ4A 1OFPA 4L4PA 1J10A 3P8IA 2Y62A 4IZGA 4C7FA 4DYJA 4GIAA 3QFWA 1R2TA 4TUFA 4GH1A 4J3VA 3OLDA 3OVRA 4MKVA 4DVOA 1TPFA 5BYWA 3C4UA 2GDQA 1FVPA 4NP7A 2W6RA 2Y5EA 3VXGA 3E38A 4KEZA 4EX4A 3KVJA 1SJAA 1ADDA 1L9WA 4A21A 3EWWA 1XH2A 5AKQA 1PHQA 2PWHA 3B8WA 3PVFA 3EWCA 4GJ1A 4JIQA 1I0DA 1YIXA 3EOOA 3NO1A 2WVVB 3UETA 1R85A 4JFTA 4OTKA 5F2MA 4JX5A 3VDBA 4NKCA 4DF0A 1RBOB 1UP2A 3QQ0A 1A5MC 4HB7A 4KBXA 1VJZA 2ACUA 2Y8UA 5LHFA 5KSWA 2Z2AA 3GNPA 3OHIA 4HZMA 5DX7A 4DWSB 1V6XA 3SUUA 5EBUA 1C90A 5CSUA 3GBDA 1ZCOA 2IPGA 1B9ZA 5HWNA 1OK6A 2FZNA 2ZBTA 4AMAA 4DUXA 5M1TA 1R3RA 1CECA 1VRXA 3VFLA 3CWNA 5DO8A 1J0YA 3IS4A 5C5YA 3GAYA 2C79A 3R11A 2E25A 3KM8A 3PJUA 3H2CA 5E6YA 3E49A 4QG8A 4PMUA 3S1UA 1DL3A 4K8HA 1JPDX 2QCDB 1PWLA 4M6QA 3WF4A 1POKA 5F4WA 2DT1A 3TWBA 3SCWA 4QXIA 2FZBA 3P62A 2QULA 1GHSA 1GG1A 4E2DA 1TV3A 3DYMA 5KETA 3OQEA 1E6ZA 2RGLA 2HZGA 3S5SA 1NOFA 4IMEA 3HPFA 4J3WA 1WAWA 2FTPA 3E0FA 4WRHA 4I9JA 4JN7A 4X9SA 1KFCA 2GVJA 3PM6A 3ELFA 5HJXA 2NUXA 1M7PA 4PUDA 4AD2A 3PUGA 1MDRA 4JICA 1EC7A 4Z1AA 3WQVA 3N34A 1QFEA 4QJ5B 3M6YA 4IPPA 3H2OA 7REQA 3G1DA 3W1RA 1EJXC 3EXRA 3QKEA 3VIGA 1NQKA 1YPIA 3G0XA 4FLRA 2YBUA 2PUZA 3TTEA 1SQ7A 4FEZA 4C6NA 2YYTA 3OJGA 5CPTA 4IFRA 3WH5A 4P8UA 1PZ1A 1NF7A 1OX4A 2W67A 2VD8A 1CEOA 1ZPTA 2YL9A 2EJ1A 4EACA 1LLOA 4MF4A 4LY4A 1BKSA 3PBGA 2DIKA 3RM9A 4M1BA 1JD7A 3W86A 3HQPA 1RLCL 3FS2A 2CXEA 3N4FA 1KA9F 2V5BA 2YOCA 1M9HA 1UWAA 4TOQA 2PF8A 2D1ZA 2Z1KA 1S2VA 4J7RA 4C6MA 3NM3A 1IEXA 4MY9A 4MGGA 3HMJG 1SO5A 5DF0A 3T81A 4ORMA 4KEVA 1A3XA 3LTYA 3BCDA 3D0CA 2AQVA 4UBPC 5EA9A 1GVYA 2W79A 3BLFA 1DWHM 2KZHA 3DG3A 2AAMA 1C3FA 4UQEA 3MC5A 1MQPA 4J27A 1TWIA 1OF8A 2GSHA 4MYXA 4XG1A 3GM8A 4RE0A 3G18A 3WLKX 1V8EA 3MDWA 2PDPA 1F6KA 1HGYA 1GKRA 1XL9A 4YTTA 4NQ1A 1E6XM 3R10A 3NQ8A 5I77A 3G1HA 1GQJA 3R94A 4US5D 3QPYA 2OO0A 5E6ZA 1GPFA 4L4OA 3SY5A 3AWOA 2DZXA 3F5JA 4GBUA 2CLKA 2ZXQA 1VJSA 3EMQA 2TPSA 5EMYA 3WBYA 3T0AA 2WKGA 1TJ2A 5DT7A 3QLLA 1JZ6A 1J01A 2REQA 3L65A 3RLVA 1GQLA 1TCMA 1TVLA 1OX6A 4Q8QA 3AHZA 4QSFA 3PZOA 3CXOA 3CV2A 1EYEA 4GCAA 1VFHA 1TJRA 3TYAA 3KOXA 1PKYA 4FXSA 4KCUA 3IVUA 2V69A 3ZLHA 1SR9A 3M0HA 2NUWA 1T8XA 2J47A 5HNNA 4A3HA 3NOYA 2DZUA 3W53A 1M04A 1CB2A 5BU9A 4LUSB 3CL7A 4RNJA 3OLEA 1JFHA 4EPEC 1TRIA 3MUIA 1IIHA 3LOTA 1H0GA 2FJKA 5FEWA 3KCOA 4B2DA 3FA3A 1E0TA 4RLIA 3IGXA 3VIMA 3BCJA 3TMQA 1MNSA 1LQ0A 3N2OA 2OVLA 4US5A 4IOTA 2LLEA 4LAOA 2A0NA 1PKNA 2A3LA 2DIEA 3TW7A 4PYSA 3W2MA 3W2LA 5TAOA 4QDPA 5FCZA 3AJ7A 4ZEPA 2QUTA 3AYVA 1O5RA 1S1PA 2I9UA 1V3LA 4ADUA 4DZIA 2ODOA 2PP0A 2XIBA 4XISA 4XAGA 3O8AA 2BNJA 1FDYA 4JIEA 4LYRA 3P5ZA 4IIEA 3CUXA 4AB4A 1VD6A 3QYSA 8XIAA 3TYUA 1RCQA 4LS2A 1IWBA 2VZUA 4QAWA 1T41A 3I6RA 3IUDA 2X0HA 1EJRC 3U5UA 3PSWA 4ZOCA 3K30A 1ICPA 3Q65A 2CLMA 3W7EA 3R25A 1QO5A 3WK1A 5A3HA 5DRIA 3ICJA 5RUBA 1POJA 3GO2A 4FNRA 2J66A 4K2SA 1XYAA 3SRKA 3LTSA 3CH9A 1YQ2A 3RRAA 2VELA 1RCOB 3LPPA 4MJ4A 1U2YA 1AFSA 3WIJA 3PPHA 4D2JA 1GPWA 5E5CA 3TE9A 2OYKA 3ARSA 1J11A 1GK8A 1XGEA 4NJIA 3KE0A 3WQ5A 4ATDA 3TNBA 1NDYA 4UTFA 4A3RA 2DORA 3CT7A 3P67A 5M2FX 4BZYA 2DEPA 4OVXA 2WBKA 4EPBC 4OUEA 2ATSA 2IQTA 2C14A 1BYBA 2W91A 1I9CB 3GG0A 3H53A 4Z2JA 3O1NA 4B4FA 1BHGA 3THUA 3A47A 4DBDA 1EJTC 4HNLA 1G7VA 3EEZA 5F7UA 2NQZA 3W23A 3P0WA 4NIRA 2QXWA 5A6LA 3LZ3A 3NO3A 1SO6A 3H26A 2WJZA 3WNOA 3WJYA 4AVNA 5A8PA 3QYQA 3FJ6A 3AO0A 3WDHA 2BX7A 4AZ7A 2ALDA 2X1RA 3INPA 5CSSA 2ACRA 4CNNA 3RR1A 1ISVA 5SWUA 1ME8A 3MBFA 3A5FA 4P8VA 4GIYA 3PNZA 1W5PA 4D8ZA 5IFPA 2CZVA 1BG9A 3DN5A 4QE5A 1HN1A 4AZCA 5CZTA 1Z41A 2CLLA 2UY3A 2E77A 3A13A 3BMWA 5HK4A 4WXYA 3LNMA 3W7JA 1WAUA 3M0LA 4Q4OA 4GI8A 3W7IA 1WOAA 2VM8A 4HNNA 2VVNA 2YCEA 1V7AA 3CLMA 4A3YA 3GG8A 3N04A 4JZ5A 1H61A 1UA7A 3QQWA 1XQLA 1TV2A 2XGZA 4Q6JA 3LBCA 2PWUA 4QS5A 4DYEA 2HDJA 4EK7A 3FKRA 3APTA 2J7BA 3LRLA 2WSRA 3VZZA 3GTHA 4MWAD 3RCNA 5DN1A 4K68A 4OOZA 3BGJA 1TFVA 5E70A 2WMJA 2VQTA 1QPRA 4ZODA 2R24A 4O8AA 5I0DA 2PTWA 4ZFCA 2IKIA 3I6TA 1QXLA 2GQ9A 3TC6A 1GEQA 1JEZA 2IQDA 2FHBA 4UFMA 2P5NA 1KRMA 3Q4DA 1Z89A 5MHBA 4Q32A 1Y5WA 1KBIA 1OCQA 4HZ6A 1HJUA 2BDQA 5G1TA 3B0VC 3LCWA 4DF1A 4NXSA 5EMMA 4C6OA 3PS7A 1DP0A 2ZICA 3H21A 3WO8A 2IS7A 1EJVC 3DXIA 1VFMA 3PUEA 1UIOA 2UZ9A 3IGSA 4CEUC 4D8LA 2VMFA 1D3CA 3GNXA 5EMUA 2Z1SA 4D6HA 2PDGA 3OOQA 3LLFA 5D32A 2QJIA 4ZCWA 2F2HA 2AMGA 1V3HA 4XZNX 4F9JA 5ABGA 1HL9A 3VX0A 4E6MA 5C7HA 2BLEA 1OIFA 3IV3A 4N9DA 3E0WA 1EJWC 3B0PA 3GD6A 4GKLA 3YPIA 5KZDA 3NL3A 3UF9A 4E4PA 3T4WA 3VU2A 3GYCA 5AZ1A 4KKXA 3MKKA 5HAOA 5MKGA 5CGMA 3T6CA 3ABXA 1RJQA 4JD4A 3ARYA 1IE7C 4P2VA 2OSXA 4IQJA 1F8IA 4MWAA 5GJNA 5I3HA 1OBAA 1OC7A 1FH9A 5C0QA 4GNJA 5I00A 3H6OA 2CEQA 4MADA 1GHRA 3AZTA 1JPMA 4L6HA 4MPKA 1MFVA 3MO7A 3R4IA 4L4MA 4PA8A 1ZBVA 1ZL1A 1P4CA 1FY6A 1QWKA 4B16A 1PTDA 4I7UA 4B92A 3TDFA 4O4WA 3ARQA 1H7RA 3BW3A 1VENA 3AIVA 1IEQA 1XLHA 2CXGA 4JTTA 1PTAA 4IL2A 3TSMA 1OFBA 4DX3A 4MTVA 2HPMA 2VYOA 4W84A 1GQNA 2DY3A 3AIWA 3W1LA 3TQPA 3KDNA 2PA6A 4NRSA 3W2NA 2QCDA 1SGJA 3EPNA 4JTSA 3QPZA 4E4FA 1QDSA 3D46A 2MUCA 1ZU8A 1FTXA 1XJBA 5LNSA 3OPSA 4F0SA 1D2KA 2PDUA 3S46A 2BOFX 3KCJA 2YCJA 2CZFA 3WLTA 3CV7A 5I3KA 4QJ4B 4M6UA 1DJGA 1V08A 3W1MA 2CKRA 3IIVA 3MPGA 4Q4MA 5FF3A 3M5XA 3A22A 4R9OA 2I16A 5IDIA 4J3ZA 1GVIA 3W87A 4JR5A 4A22A 1RA0A 2X42A 3EB2A 2E1WA 3PTKA 3LEPA 1FDZA 4Q7NA 4PUUA 2ZYFA 4EP8C 1V0LA 3EDJA 4TIMA 3BC9A 5IXEA 1BG4A 4FOJA 4WSKA 1C93A 1XLEA 1IIGA 4UTWA 4WZHA 1VB9A 2ZXBA 1M6JA 2YKKA 1RA5A 3TUUA 2O9OA 2Y70A 4YVVA 4GUJA 1K6WA 5MF5A 3L2MA 4E5TA 4LJ3A 1OG6A 4YYFA 2OO6A 3SGUA 4MPQA 4NZFA 3CZEA 4C6BA 2J9YA 3MMUA 3W74A 4A3UA 4ZENA 4Y8EA 3UWUA 3KRBA 5HULA 5D9NA 3L21A 2HS8A 3O07A 1IZJA 4JFVA 2XHYA 1BLIA 4LF2A 1VYPX 2J77A 2OZ8A 1SR0A 4E3TA 4INFA 4NT0A 2VEMA 3GHRA 4X2PA 3RILA 3QOKA 2ZUWA 3W84A 5CC6A 4QP0A 4IXXA 3NG3A 4YTSA 3PPGA 1FFQA 2NQJA 4ERAA 1HXJA 3SSJA 3VKKA 3VX1A 3WQPA 1ZY9A 3SIMA 4W5ZA 2WBGA 3OTRA 1FKWA 1MW3A 4TVUA 3M4HA 3IUHA 1FFRA 1ODZA 1HKWA 3RM4A 1UH2A 2QV5A 4LVGA 2PZNA 4WY0F 3ARWA 3N3TA 3TYCA 2OELA 3UPBA 5DBTA 4DJED 4S23A 1JL8A 1IT7A 3OLGA 5U4NA 3D3AA 3VUSA 3NSXA 1K7FA 4FOUA 3LLDA 3TOPA 1B3XA 1C29A 2WWCA 4FNTA 5KZEA 2PS2A 3FDKA 3LRMA 3WZ0E 3O6DA 3CLWA 1S5WA 1EZ2A 2OQHA 3PSVA 1WKYA 3WD0A 3W7GA 4OQVA 1CZ1A 2PMQA 2VFEA 3M0KA 2AMXA 4JDYA 3SR7A 1BWLA 2QCHA 1YDNA 5T8GA 3V0SA 3WQCA 1W6TA 1JFXA 1NDVA 3AZRA 1REQA 3G3DA 3KL3A 1VFOA 3EWYA 3PULA 3VIFA 1TE1A 3WG6A 2QGYA 3NL2A 4J3TA 2ZA2A 4F48A 4QIUA 1ELSA 2Z2UA 4ERIA 4LFYA 1RXOB 3KS6A 3M46A 4CQ9A 1Z6KA 3KWXA 1TJPA 3NZRA 1XSJA 2JF7A 1UZ4A 3ZR6A 1O5XA 4L56A 3WLMA 1FRBA 4H7ZA 4X2RA 3UG3A 5REQA 1QI4A 4AFYA 3WNKA 2DFAA 1JPHA 3W7CA 3AZSA 2H6RA 2VC6A 1AJ2A 3BLKA 3PFRA 2OGJA 4OBSA 3N6HA 3W1AA 1YW1A 4HA0A 3JS3A 3NQMA 4LRTA 4NYUA 4FS9A 4J28A 3WNNA 3GR8A 3RFAA 3VOFA 5FJPA 2G5WA 3BJFA 4N42A 3RG6A 2HXUA 3RUBL 1V51A 3VKCA 1P6WA 4E8CA 2Z25A 2XPKA 5C2XA 3ARXA 3QSRA 1MQRA 4O1AA 5AHIA 4K8GA 4MJZA 3O7UA 3GW0A 4D6CA 3ANUA 4F79A 3AYRA 1UIPA 4HOXA 1QUMA 1HG3A 2WMHA 4IXHA 2VRKA 3PN8A 2YW3A 3FEQA 4PTVA 3OIHA 2F8QA 1JDAA 2DJLA 1EDGA 1V3JA 2FQIA 4D6JA 5CZSA 1QBBA 4I8DA 4WJ8A 1F4HA 3EWZA 1ONXA 4XO6A 5CQ1A 1SZFA 2CIPA 7ODCA 2QDEA 3KX6A 3CAQA 3U2ZA 1YDYA 1EGZA 1TA3A 4TU1A 6TIMA 4G7FA 6ENLA 4RNFA 3VD4A 1Z44A 4LAZA 2XN0A 3GDBA 4Q8PA 4GOAA 2PDIA 3FX4A 1GEHA 1FWBC 1HVQA 3LLXA 4IMGA 4B91A 3SIZA 4ATWA 1FBAA 1XDJA 3LHVA 3CZKA 1W31A 4URIA 3MUZ1 1MQQA 2HPIA 1W3JA 2OEMA 4KWVA 1VF8A 3GHTA 1GKPA 3QPEA 2VZSA 4RK8A 4BY3A 1W56A 1A5OC 1FWIC 3CAKA 3GXFA 3FGCB 2Z29A 5IM51 3NEHA 1KFBA 1R3QA 4HNCA 2J24A 1G4PA 3EDEA 4OZOA 1CNVA 2YA1A 2FLIA 3IRSA 3AS1A 5D04C 5HWMA 1KXVA 2EPOA 1HJQA 1J96A 1E15A 4LH8A 2QPXA 4UTJA 4D6IA 3ES8A 4HYWA 4ZQOA 3ONCA 2HVOA 1NWRA 5CAKA 1NEYA 1ITCA 1BVNP 3T40A 1LOLA 2OSWA 5AYYA 3B9OA 3GXIA 3I7QA 4DZHA 3RXZA 2FHFA 1JPKA 3XINA 2DH2A 2H3BA 1VBHA 5D2TA 1XC4A 3WD2A 3A12A 3FN9A 2YA2A 1G94A 1E72M 1EPVA 3AALA 4UOQA 3UZ5A 1OC6A 5BOFA 2J8TA 4H04A 3PZQA 3O05A 1EKOA 3QF0A 1QPQA 1R6WA 4W87A 1NWUA 3SN1A 1DHPA 1X98A 1J9YA 2TMDA 4D6EA 3G6MA 3FJNA 4JYEA 1WUFA 1JNEA 1TV8A 2YCIX 3MDUA 1EUAA 3LCIA 3EZ4A 4GI6A 3E9AA 3PZMA 1SSGA 3DOPA 1I2NA 1O5QA 1VBUA 1XM3A 3FHQA 4Z1CA 1QNPA 1OYCA 2OSYA 1EH9A 3UJRA 1T7LA 2I1OA 3ZVHA 3XIMA 2ZVIA 5CZ0A 3N18A 1DV7A 1E4LA 4GUHA 4PMYA 1K8XA 3OBEA 1V7YA 3P2VA 4K38A 2Q02A 2CNCA 1Q7QA 3SB0A 4HNOA 4BI5A 1DJXA 3TC7A 2YDRA 5HBFA 4AG0A 4KCWA 1JUKA 1AG1O 4IGNA 4BKNA 2VX5A 5TD4A 4RXFA 5HMSA 3LD5A 4WIWA 2GPTA 3T8QA 2A3HA 4BQ3A 3F4VA 4C7GA 1U1JA 2Y2WA 1CGUA 5CGQA 2FZDA 5F4XA 1YBQB 1M03A 8XIMA 1FOBA 1QASA 1J0KA 1XLGA 5HATA 1U83A 5KITA 3QV8A 1V6YA 2E5CA 2J75A 4DEFA 5HNRA 2PPGA 1XIJA 2JALA 4RE3A 4NX0A 6CGTA 4ZE5A 2HJPA 1FWNA 3BH4A 3W25A 3VNJA 5FF7A 3BMVA 1J0HA 1RUSA 3IIXA 1K02A 5DLCA 2Y61A 5DT5A 1NM9A 2QJJA 1A5UA 4CGTA 1JYWA 2VRQA 1XIEA 4LAKA 4YWSA 4Z2HA 4LNYA 3F5KA 3UCCA 2CBIA 1XYLA 1DJHA 8RUCA 4W7UA 1DWIM 1PV8A 4LYKA 1JF5A 3MANA 2BBFA 3DFNA 2ALRA 1QCWA 2E5BA 5K3VA 1W17A 4GKTA 3TTYA 3IUIA 4H9TA 2D3NA 1YDVA 2DUZA 2OZ0A 1P0EA 4PTDA 3CZLA 4PMJA 5XIMA 1HKVA 3HGSA 2GVGA 3WD3A 1S5TA 1LCOA 5FF0A 4UMBA 1SFLA 2GUUA 1W0MA 3MKVA 4Q8MA 4FP1A 5F2IA 2ZC8A 1LZOA 1UP0A 4H8UA 3GNNA 3I3EA 4XKMA 4YIWA 3E0IA 3PZ9A 1I1WA 3KOYA 1M7JA 4CD8A 1Q4NX 4NRRA 4GGBA 2CESA 3T0TA 4ALDA 1M1BA 1KKRA 3G2GA 1UQYA 2V3DA 2ESCA 3K1GA 1OGBA 4U3CA 3LXCA 5D9OA 3JR2A 1H60A 4W8BA 4ACZB 3K8LA 4R7WA 4GXMA 2G97A 1B31A 3HQ1A 3HQNA 2VFDA 3VKBA 3FNDA 1IEWA 3XISA 3EWUA 1M5WA 1KCKA 4FA3A 4RL3A 4FLSA 3NCOA 4F0KA 3P74A 3VE9A 4D6DA 3AUJA 4DWDA 3KTCA 2IPFA 3QV6A 5ECVA 3B8IA 1GOIA 5FEXA 5D30A 3GFYA 1M65A 1RJPA 3TH6A 4GYJA 1C9DA 4PMVA 4P8WA 4PMQA 2BGNE 3H4WA 1KFKA 1Y5XA 4J9JA 4Y7EA 1XLMA 4NG3A 4JN8A 4CCEA 5E9AA 4GQGA 4QGCA 2EKGA 3N19B 3UYIA 4AIUA 5H91A 1EB3A 4JTIA 3NSMA 4XZHA 4JHMA 4PL1A 3RITA 2GJPA 3H7UA 2VFIA 4NAFA 1ZAIA 3O3RA 1TPH1 3N29A 3MCNA 3KVMA 4RXGA 3C86A 2XIQA 3AOFA 1VIWA 2OJPA 1GW1A 3AISA 1BQGA 3AXIA 3OG2A 3GFXA 3WMLA 1E1EA 5AYIA 2YB1A 1YTDA 3M07A 4ZOAA 3QQ1A 1KM4A 3FKKA 3IACA 3AHTA 4LX4A 4IMFA 1DJWA 1Q6LA 3VCRA 2RH9A 3A4WA 2DQXA 3NQBA 1XWYA 5FESA 4ZO9A 1H7WA 4PEKA 3S9IA 5ABFB 1LBMA 4LSBA 2XSBA 1BRLA 5D2WA 3FOKA 3FSTA 4EPDC 3MYPA 3BOXA 2QKFA 2WZMA 3MV01 1OM0A 1ISWA 2W92A 4V2XA 2X30A 4O0KA 1S39A 3TAKA 2GGEA 1KFEA 4M6PA 3DG6A 4WGHA 3M0MA 5A6SA 2I5GA 1R8LA 2VP8A 2PGRA 4OT7A 3HV8A 5K4XA 3NQEA 3VUPA 2EBNA 3CQKA 4C65A 1KFLA 2VGGA 2WMIA 3GVRA 1UHVA 3IJQA 1GCYA 3N2BA 5T9BG 4JQ4A 1EPXA 1LUCA 4XAZA 3CS2A 2XWDA 2VX7A 4MIMA 3L2LA 1IXPA 4QITA 3C3NA 2VT0A 5CPMA 4YHEA 4L61A 4U3AA 4AIEA 3ITCA 1G4TA 1Q63A 3GY1A 1JXJA 1CLXA 5JH2A 1EYWA 3TTSA 4O0QA 1XH0A 2I17A 1HUVA 1EIXA 1UZHA 3IK4A 4ZFMA 3VVGA 2ZZ7A 1LL7A 1HL8A 4RDWA 3PY2A 1N2VA 1E56A 1DJQA 3MJYA 1I0BA 3TR9A 5EYWA 4AYSA 2PODA 4UIOA 5J5RA 2I5QA 4HU3A 2IKGA 4NJKA 3WFZA 3BZJA 1ITUA 1XRFA 3W2UA 4H8VA 4CQCA 4MYAA 1K8YA 4A6GA 3SRFA 3PUDA 2ZXAA 4IHCA 1KGWA 5AFDA 2NZLA 1BGGA 4NHVA 1IR2A 2PLJA 1X8FA 1G4EA 1DQWA 3NGJA 4DPPA 2VDGA 4R88A 4UQ9A 5F1VA 3LCXA 3EXSA 4XTIA 1J2WA 5CBJA 1CPUA 1NF0A 1C7SA 2C15A 3WLNA 3UZXA 2JIEA 2D23A 2VJXA 1CDGA 3W24A 2QJNA 3E1F1 4DLMA 2BHYA 2NWRA 4YCOA 3EBVA 3TV8A 1GVRA 3PK7A 2X7VA 1K4HA 3TA6A 3SFKA 2WZEA 5FKYA 4AX7A 3AMLA 1OHLA 2YXOA 2G4JA 1EIBA 2F61A 3L4XA 1ZNNA 4NY2A 2GJRA 1VCVA 4XSMA 5HPCA 3MMDA 5CSYA 3U6WA 1Y0EA 1UWRA 2UY4A 2D73A 1TZ9A 2HRWA 1CGYA 2QQ6A 9XIMA 2OU4A 2AKMA 3WEOA 2Q8XA 1HFBA 1YEYA 3IGUA 2XVNA 5LNUA 4N02A 1BPLB 1V03A 4D72A 1UC5A 3W6LA 3WUBA 2Y7FA 3H8AA 1MXGA 2R6OA 5XIAA 3CV1A 3E0VA 4ZOEA 3KZPA 1KTCA 4O4VA 1XIFA 4BQ4A 3LG3A 4FIRA 4EAYA 3VDAA 4FLQA 1QATA 4BI7A 3TCSA 3VABA 1YNYA 3FXYA 2WHLA 2J7HA 3U7BA 4U33A 3WJWA 4JTLA 2DIJA 3LCGA 1I75A 1L2UA 2P8BA 4XIMA 1SJDA 3GUWA 3T78A 1OZQA 2ZDRA 3UJEA 1NY1A 3S83A 1DIDA 4I9TA 1TSIA 1KC7A 2BB0A 3OQ8A 2B7QA 2DT0A 1A5AA 1XLJA 3AJXA 5FL0A 2FJUB 4GYFA 1K03A 2PLCA 3WK0A 2V8ZA 3RLGA 3QH2A 1HKKA 3KRZA 2XISA 1KWKA 1LL4A 3VD9A 4XKYB 2HK0A 2WLYA 2D0GA 4G6CA 4G1KA 4MFEA 4DRSA 2WHJA 3ZM8A 1PZ0A 2H3DA 1XLCA 3B8VA 3LI1A 3PB0A 7PTDA 3VIIA 5C54A 5FJJA 2BY0A 4QDMA 2W63A 1UD5A 2BSLA 3TJXA 1DJIA 1GJPA 2JKAA 3A23A 2I5IA 1J18A 2JEPA 1W2VA 4POCA 2BS9A 3W7HA 3IPWA 1QNVA 3MCMA 2BASA 3KBNA 2PWDA 3H2EA 3LGGA 4X0NA 1LRNA 5CJNA 3V0UA 3WQDA 1KKOA 3EXTA 4XVDA 2CPUA 3THQA 2Y6ZA 4M19A 4UR9A 3S1XA 5D8WA 3FYYA 1VFTA 1RPKA 1WOBA 4MLRA 4UCGA 1W5MA 1BD0A 4FK9A 2AGTA 5E0CA 4DO5A 3UVAA 4HN4A 4CNTA 2QPSA 4NNCA 3LCLA 1QBAA 3AFBA 1QI3A 2JGYA 1E4NA 2GK1B 4J1OA 1K6AA 2QGHA 2G37A 2H9AA 4BS0A 3VKAA 5K4ZA 3URBA 1Z7AA 3UWVA 1H50A 3BG5A 3LK6A 1P7TB 1TZ7A 4C6IA 4DXKA 3CYJA 3UBPC 1IQ8A 5FOOA 4LS1A 3I68A 1Q3NA 3EOLA 4Z1DA 4JIIX 4D9PA 3M44A 3UG4A 4E4UA 5JUVA 3ERPA 3GXTA 1NDWA 3UWWA 4JL1A 2O4MA 4NASA 4Z2LA 2NX1A 1BWVA 3V35A 1D3HA 1DKWA 1Q6FA 1R0MA 5I7GA 1TWZA 3DUGA 2I14A 3GXNA 2EG8A 2PLKA 4CCDA 2F2KA 2RHGA 1AODA 1K9TA 2D22A 4G7EB 3VM5A 3RO8A 1JPIA 2F6UA 4FX7A 1GVOA 4A05A 4KERA 3PAJA 4GVHA 4PGLA 4RZBA 2GFTA 2WJFA 1AW1A 2R94A 1VHNA 3CZGA 1YBQA 4AMCA 3KL0A 3PFMA 3H7RA 4LUTA 3AXXA 3UZWA 4EKJA 4B15A 3LHYA 4ZOBA 4DNMA 2G3IA 3OZYA 1QWGA 3WYZA 2XH7A 1KLYA 4LUIA 4DO4A 1NP0A 1YX1A 3RRXA 5J5DA 4DJDC 4GO9A 2FGZA 1GORA 5LXEA 4MB3A 4LVBA 4ZR8A 3QMRA 1X7IA 4RUBA 7TAAA 2YZ5A 2O55A 3H70A 3DHUA 3T0CA 2FDSA 3QZ6A 3M43A 4GVGA 3R2GA 3AMDA 1VYRA 1OVDA 3PF3A 5K2ZA 2GWNA 4M81A 2E28A 2ZZ1A 3QV7A 2YDSA 3S9ZA 3S1WA 3GH5A 3NZ1A 1LT7A 3HJZA 1RZMA 3FVMA 4HNUA 3QSTA 2R1MA 4BK9A 4PRRA 2XVLA 1MRAA 4PZVA 4QQ3A 4GVFA 3KBVA 2DUXA 4F40A 3VIOA 4MLJA 3DFOA 3CL6A 3RCYA 3CPGA 4JGDA 4QAIA 4IGMA 4HZ7A 2VEKA 2O9RA 3BAKA 4DPQA 1EFZA 1PKLA 3QTPA 2FGLA 1EXBA 1VR6A 1AZ2A 2XH0A 3W38A 1JRCA 1PX4A 2VX4A 3SQSA 4IMCA 5FJRA 3P80A 1WKFA 2DW6A 4QNWA 1LROA 1SUXA 4L64A 3DDMA 3ZOAA 2UV8G 2X1IA 2RJGA 3WJSA 1XHGA 3GW3A 4N4PA 4IMAA 4ZVJA 3HU7A 4X0VA 3W1NA 4GJIA 1GYMA 1K8CA 4YLWA 2FIQA 3VYLA 4GVIA 4GFSA 1B1YA 1UD3A 4M24A 1AD4A 1FHDA 2V5KA 4HMEA 3R58A 1UPMB 3FSUA 2Z2BA 2DPEA 3LYEA 1EF3A 1AQ0A 2G3FA 5CXPA 1XDLA 3ABRA 2GSJA 4N6FA 4LB4A 2FVKA 4R85A 4ADSA 2QR6A 4UB9A 3WELA 4PFMA 1N7KA 5XINA 1S2AA 4LWWA 3W7OA 2RFGA 3MJMA 1RD5A 3AAMA 4E2VA 2GJXA 3I65A 3OBAA 4JTJA 1EDTA 4EF9A 1W3KA 3UGRA 2PP3A 3AIQA 1W1IE 2XN2A 4ZMGA 1UD4A 4K36A 2A2IA 1EGVA 4PCPA 1O66A 3AIUA 3W7QA 3JZUA 3N13A 2MNRA 2ZUVA 2Y7DA 4S3AA 4GISA 4HN8A 4IIHA 3OGVA 5EL1A 2QW5A 3GVQA 1VBJA 4E0CA 3QGKC 2VC9A 3KEHA 2CWNA 2XIJA 2CBJA 2XM1A 3L4VA 4ASTA 3LUTA 1V02E 3RCMA 2PRHA 4C6DA 4DO6A 4UZSA 2DVUA 1R87A 3AYSA 4GY0A 5CC5A 5BZAA 1QHZA 4HOWA 2DDXA 1W1TA 3ITLA 4CNOA 3SZ8A 1MZRA 4AVFA 4H01A 2GQ8A 1H7NA 1K1DA 5BNKA 5HJLA 2YFNA 1OX4B 5DANA 1SSDA 4XO7A 4PCFA 1JVNA 2D0HA 4IPJA 3PPCA 1W54A 2O9PA 2Q3RA 1XV8A 3B9DA 4XUYA 3VMNA 2E40A 5DRCA 3T1GA 1U5JA 1Q2RA 4A8LA 3WL0A 3FYOA 2W66A 2V81A 3E02A 3GNRA 5T26A 4ZA0A 3NVDA 3FDGA 3UP8A 3GIYA 4IT1A 3J7HA 1CIUA 1OADA 4WSJA 5A6BD 4FLOA 2CHOA 5KEZA 1C92A 3VCNA 4H9YA 2NX9A 4RKAA 2WZHA 3PBUA 5M03A 1B3YA 2X05A 4L4LA 1B3OA 3QC3A 4H8HA 1YYAA 4Z1YA 3PC0A 5D9MA 2ZWYA 4U5KA 2V5JA 4WOQA 3R13A 4MZ8A 4W89A 1UW9A 1Y65A 2E9LA 3EKLA 5F2GA 1TX0A 4UCFA 3C61A 2WM1A 4FMVA 3DC8A 4FI4A 1KR0A 1YNQA 4NSBA 1A0CA 2WNWA 1OSEA 3ZQ9A 3ZR5A 1H5VA 4XD4A 4RPPA 5BMXA 2PP1A 4O1DA 4UQAA 1OJXA 4BFAA 4NYYA 1F07A 2REQB 4A35A 1EGMA 1W3NA 3CTLA 3EMZA 3TXZA 1WDWA 2PDFA 4V27A 2OB3A 1Z42A 3BPWA 2PU1A 3S6OA 4LBRA 3EEGA 3WNLA 1FWTA 4QE1A 4IG2A 7A3HA 5A8QA 4Q4RA 1QNQA 4C6JA 2HE8A 2GYIA 4OV9A 5LGZA 3N9SA 3QXBA 3C2FA 1LOQA 3PAOA 2RDXA 3ARTA 3AYTA 4KPLA 2ZX5A 1Z9AA 4TMBA 2FPYA 2WANA 4HJWA 5FJOA 2JK2A 2POTA 3ES7A 1YADA 4FHAA 2JIWA 3AU2A 4MNKA 1LWHA 1KFJA 3G8RA 3EX4A 5HMFA 3S2NA 1XX1A 3L12A 2INFA 2BGQA 1X38A 2XFWA 1DXEA 3I4EA 1DXFA 2ZUMA 3G6LA 1W1VA 3IJ7A 3DHFA 1A5CA 2BMBA 2TSYA 2NVCA 4NF7A 3W73A 5IRPA 4YTQA 2OEKA 4KH2A 4HCDA 3AIBA 4CU7A 2VC5A 2QPUA 2PDLA 2GGHA 2A3BA 1TMQA 4C5YA 3C0LA 5BXSA 4QX4A 3R8GA 3CH0A 1AL8A 3ATYA 4QNEA 4DM2A 1XP3A 3BMXA 4NL1A 4RPQA 4FZIA 1H1YA 1TUXA 2YCLA 2X1SA 2RDUA 3T9PA 2Z27A 1R2RA 4LC8A 1EQCA 4F0MA 1FHLA 1D8WA 1J5TA 4B5UA 3ARUA 1DOSA 4N9BA 2VTFA 2DZPA 3SCSA 4Q6XA 1EBGA 3HN3A 1TE6A 1E9LA 2NXGA 3GG1A 3PP7A 1OG0A 4CNUA 2JEQA 1FP8A 3CMFA 2VENA 1Z8AA 1OQFA 3AMKA 3U9IA 1GVSA 3F1QA 5CJMA 3SUWA 3VGFA 2OOFA 1YPFA 1PO9A 4LBSA 1P6CA 3P0XA 4E2OA 5D2XA 4ERGA 5DY3A 4HT3A 3EB3A 4UTMA 4IQDA 3WLPA 5G1MA 2PDBA 4F4RA 4Q3MA 1BYDA 3O6YX 3PHAA 2PDXA 1SZEA 1I4NA 5LA1A 1CTNA 4Q7IA 3CIXA 5HR7A 4AC7C 4JYDA 2DT2A 5CEWA 1BXBA 4KRUA 2UWFA 3SAZA 3TROA 1A50A 1R47A 5DXYA 4Z42C 4D71A 2ZZ2A 3SURA 1MWOA 4CKQA 5AHMA 3B8TA 3M5YA 3UA4A 1QU4A 4W8LA 3S2JA 3NQCA 2PDWA 2V2DA 3WLLA 4FOKA 2ACQA 5A69A 2OOGA 2R91A 2WAGA 3F7JA 1AA1B 4FR1A 3EDDA 3RX4A 4O54A 4IIDA 1CCWB 1SJCA 2DH3A 3MKCA 2XZ7A 4S3EA 3EWBX 3HM7A 4HD5A 3KW3A 1E1CA 4PR4A 5I06A 1AH0A 3UR5A 3THAA 3N12A 4UWMA 2DT3A 2HCVA 3MSDA 1M01A 1FWCC 5C6MA 4AZCB 4TTGA 4ZTYA 1OCJA 2EGZA 3WBXA 4QFUA 3RPMA 4HPNA 2WVSA 3BV7A 2FVLA 2ZRUA 2Y89A 2Z1WA 2ADAA 3UW6A 2QAFA 5BMWA 1V3IA 3K5XA 3B8SA 3URQA 2A3CA 5CC7A 1E73M 3UU0A 4PFHA 3SCOA 1F7BA 4JAWA 3WH7A 2QUUA 3DU0A 4RCXA 4FX8A 3MI3A 1CW2A 1U22A 3UNTA 5LIUX 4KWWA 1TQJA 5H2ZA 1R3VA 3UWQA 2VVSA 4AY8A 4TVCA 3EDKA 4W9TA 3VILA 4CQAA 1KV8A 2PGEA 4K7VA 4Q8VA 2ZQ0A 3OYXA 3OGRA 2H8ZA 1GOQA 2PGWA 4Q4PA 5HQMA 3VMPA 2EO7A 1GTEA 2WCGA 3MHGA 5BU6A 4I9MA 4KETA 2WHKA 2YR1A 1B2YA 4I6VA 4MWAE 4YWIA 2QHAA 3P14A 3FIGA 2X2GA 2XDFA 3UXLA 1EF2A 1ZAJA 1J8VA 3VOCA 3RMJA 2D24A 2A7RA 4M1RA 5I5RA 5C7VA 3W29A 4S39A 4M56A 3UT0A 3NUKA 1W1YA 2A21A 5I79A 1XIIA 1EJ7L 5AB3A 4NNBA 4YMZA 2HXTA 1LWIA 3WUGA 1LTDA 1ADSA 1HKMA 5KINA 1E6QM 3H2AA 5CZJA 1PIGA 1B3VA 1DYSA 3OO2A 3LERA 4L80A 2OG9A 4PE8A 1BAGA 2OKOA 3NL6A 4CLMA 3SRDA 2FKPA 3MI6A 1S3TC 2F7FA 2CLOA 4NZ3A 2E68A 1NFGA 1SW3A 3N4EA 1BFNA 4R33A 4TXEA 4UTKA 3EOEA 4I3GA 5FIPA 2VXNA 3NPUA 3EPOA 3L66A 3PNUA 2VCBA 4GK8A 4UFJA 1LQAA 1NQ6A 4I7VA 3BW2A 1JCJA 1LBFA 5MKGB 1TVNA 3V18A 3I7RA 3CK5A 3O6CA 4C1NB 3N17A 1DPMA 4MNMA 1B30A 3DFQA 4ZSTA 5M5DA 3GS6A 1WA3A 4MWAB 2RDWA 3H2MA 1TR1A 1JYNA 3TQKA 1RR2A 2FZ9A 4WDTA 1VLIA 4ONVA 2J88A 5K7JA 1X1NA 3W7NA 1GVQA 3WBAA 1G5AA 3W6MA 2PDCA 1KO0A 1X6UA 1WUEA 4YU1A 2Q3OA 3WN6A 4L65A 3TLLA 2C7FA 2VFHA 4ZQCA 3E12A 3NXFA 3HGRA 5E9XA 4JTQA 3P81A 3PUOA 1PAMA 4WJEA 3OA3A 2ABBA 5EU9A 3GDKA 1RP8A 3LI0A 2OR2A 4Z0SA 3WF3A 1GTHA 1RALA 1XGZA 2GVYA 4HNTA 2VR2A 2IKHA 4FR6A 2WPBA 1VCFA 2ISSA 4BJHA 1K7EA 2WNZA 3UR7A 5AC8A 3EA1A 4PBGA 1A5KC 1WX0A 4HHLA 2CLFA 1OEPA 1OINA 3QVQA 4WDUA 3NSNA 2P88A 2OX1A 5IOBA 4LRSA 2X0SA 4PRTA 1TTQA 4P7LA 4B9ZA 1I2PA 2VX6A 2DGAA 4MDPA 3UD6A 1JZ4A 1NWTA 4OKDA 1PKMA 2F6XA 4R3UA 3WJZA 3E0LA 1U33A 2V3FA 2YFOA 3APYA 2R1LA 1IXOA 3LSBA 1OFRA 1V0MA 2QEZA 3MHFA 1XR2A 5A2AA 2D3LA 1S2TA 2Z00A 4HQVA 4JTUA 3CB3A 2J78A 3S8HA 3APGA 4FALA 2I56A 4GX8A 4OIFA 3W6YA 3GG7A 1SPQA 5FL1A 3W1XA 4QLKA 4LYQA 5GJMA 2XH2A 2ACSA 1GUVA 2JFEX 3S4TA 3I4KA 4HCHA 2TYSA 4O1FA 4YVPA 2INZA 1XBVA 3W7PA 1PWMA 1D8CA 1RK5A 3CAVA 4H83A 3T44A 2WCSA 5D38A 3V1HA 1K8ZA 3DIPA 3T08A 3VGDA 4QM1A 4CN1A 3K8KA 2GUBA 1J0JA 5HMEA 4NNAA 3WQ8A 3KAOA 2YZRA 3G0UA 1SZRA 2HWGA 1WDRA 3B9EA 5LHEA 3KBWA 1XYZA 2QJGA 1HX0A 2XFYA 3AU6A 4PUJA 1S1RA 2RDTA 4ZSUA 1AJ0A 4Y9AA 3WQOA 1DORA 3TC3A 4DUWA 1EQPA 8A3HA 1JYVA 1JCLA 2B7NA 2CW6A 1ONEA 2G0WA 5DCEA 2C1GA 2OCZA 2NW0A 4OV4A 4CN4A 1V3MA 1WXZA 4LC6A 1CGTA 1DQUA 3CWOX 1T8QA 3M9YA 4HMCA 2CERA 4WGXA 2V38A 4ZO8A 2OT1A 1I8JA 3GSMA 1JAKA 3IJDA 4R27A 3VOIA 5CBIA 1VFFA 4DBSA 1FDJA 3H54A 4MSSA 1V02A 4B2DD 3SDOA 4RW3A 1H49A 3L2IA 4LPCA 5H8UA 1CWYA 4ICNA 4X60A 1Q65A 4ZB5A 4M51A 1VFSA 3ZJ7A 1TPB1 4FPSA 4MB4A 2VCCA 3A4XA 3STGA 1M3UA 4LALA 4O57A 2NVDA 1A0DA 1IT8A 1TPUA 1W1ZA 2WJEA 3TMLA 2WO5A 1TUFA 1OX5A 5FF4A 3QZAA 1J2BA 3WLRA 2BTMA 2C19A 3GDRA 5CG0A 4IP7A 1SO3A 3SGGA 2J8FA 3FY1A 1LQ2A 3WMSA 3WDJA 3QY6A 1WXJA 3UPWA 4YCPA 2Z1BA 3MS8A 5HPOA 1KBKA 3RYSA 2X40A 4RNIA 1H62A 3UVIA 5JIPA 1KM3A 4ZQMA 3WDRA 4NZ4A 3D5HA 3HG4A 3IIPA 3WK3A 4O16A 1Q2SA 3AHXA 1K9EA 4XX6A 1REQB 4JDBA 5AY7A 3N2MA 1FQ0A 4J5NA 2D2HA 4L9ZA 4DY1A 3EX1A 4X9YA 3GVWA 1W1B1 5AHEA 1MFUA 1HKJA 1YRRA 3R7MA 2C13A 2CBVA 2YXXA 5F4SA 2IPJA 1H5YA 3GU9A 3E5PA 1ZHAA 3WQEA 2PE4A 3BG3A 4F3HA 4HSHA 1QOXA 4WR3A 5REQB 1O94A 4J3SA 3IIOA 3NM1A 3BARA 1VEOA 1EP2A 1C8VA 1IZKA 5DELA 1JZ7A 2EPKX 1XPYA 4I5UA 3U2EA 3SQLA 2D2JA 3W28A 3IANA 4QRNA 2WWDA 4U28A 3S6DA 4AISA 3LDVA 1ZQ5A 4YTUA 4PUMA 4C7DA 1UD8A 5C9WA 4LW7A 1DJNA 4DJDA 1JG9A 2QJMA 5AVNA 1TMHA 4CQBA 4NXKA 4A2SA 4WQ6A 1Q8JA 1HP5A 2DJXA 5D2YA 1SW0A 4IIFA 3M64A 4PTNA 2GOUA 5A8GA 2QVHA 1EC8A 4PB5A 2VUNA 1AK5A 3C0JA 1U30A 3CV6A 1XLKA 9XIAA 1E0VA 1BXNA 5AC6A 3N9RA 5CH9A 2ZUUA 1S46A 1UR2A 5EBAA 5CPOA 1QO2A 2V5LA 3ABOA 2CHRA 3EB4A 1E5JA 3IGHX 4O53A 4Z1BA 7ENLA 1DHKA 3VPLA 3K4DA 3O06A 2OWXA 3ARPA 3M16A 2O92A 3M0ZA 3GXPA 1PJ9A 4WSHA 4AW7A 1ZTVA 2E6AA 1PZ2A 3IARA 1WBHA 3PBMA 2XH4A 5GNXA 2W0UA 1DEDA 9RUBA 4LF1A 5TQLA 4BF7A 1TA3B 2J62A 1QW7A 2FPVA 2Y8VA 1E0XA 3STEA 4M5PA 5ENLA 1PDYA 2IKJA 1ODUA 1E43A 4IQEA 1PUDA 5CLWA 4GINA 4M29A 3CQIA 5GNZA 3F2CA 3JU2A 4HBKA 4P7RA 2PDMA 3M47A 3MU7A 4AF0A 1W9UA 1JCMP 1G7UA 1IEVA 1F61A 3C6CA 3G1SA 3VIPA 1KNWA 1E51A 4RZ5A 3GRIA 3KL5A 3PJTA 2VEFA 2GDVA 3MWAA 2C0AA 4FF5A 1PIFA 1CT5A 3UXDA 3T09A 3BAWA 3GIPA 2JKEA 5U7SA 3FYPA 3E2VA 3H22A 3W7KA 1PXGA 2NV2A 4Q7BA 1L6SA 4GZIA 4XBKA 1UWUA 4JTDA 4Q8OA 2JE8A 1L6YA 1EDQA 3IWPA 3G1FA 5C2GA 5A6KA 3BJTA 1KM6A 2GOKA 4HKPA 2A79A 3MQTA 1WE5A 4ZE4A 1FCVA 1O1HA 4UOZA 3ZFHA 1QI5A 3SBFA 1EHNA 1WKEA 3M6DA 4GZJA 1CXEA 1FWWA 1KRCC 3AS3A 4NZJA 3OODA 1AD1A 1WDQA 2DZVA 1C9WA 3LXAA 3ABZA 2ZTJA 4C5ZA 1IXNA 3RIKA 3CTTA 3PPFA 4X3ZA 1FXQA 3R5EA 4H7VA 5A6JA 1U1HA 4X61A 3VOGA 1B4EA 5I02A 2PRMA 4BHYA 3OZOA 1PB0A 1TCDA 2CLEA 3JW7A 4REQA 4Z2KA 1R30A 5BWFA 2YJQA 1F6YA 4MAZA 4ECLA 1FWFC 1WP6A 1UR3M 3H2NA 3BAJA 4C6CA 4H7CA 4GXWA 4QISA 4WEVX 3PJXA 3ZVHB 2J8GA 5G1YA 1H3GA 1SZGA 3CASA 4JY8A 1KXHA 3W75A 4AC1X 4JKLA 3CNYA 3UJFA 2J7DA 3S9YA 1HT6A 5G2WA 2NSXA 4J3UA 3L9CA 2NQ5A 3R6IA 1FWHC 2B4GA 1V4YA 2ZZ6A 4JFWA 1IZCA 3W7LA 2X2YA 3G1YA 4HPXA 3AWNA 1K4GA 4Q8WA 2X1UA 3PWGA 2GQAA 2VURA 4JX4A 4RV8A 4F9DA 1ECEA 4A29A 2AGKA 1KR1A 3W83A 1ONRA 2F9RA 4X22A 3TW9A 4QLJA 5C9UA 1EBHA 5HR6A 3KBSA 1H11A 1VEMA 1WB0A 2B31A 1DWJM 5HQEA 2E0PA 3V75A 2BY3A 4U5IA 4C90A 3AXHA 4F2BA 4V28A 4C1NA 4L1GA 5BOEA 1VP5A 5HUPA 3BAIA 2XIMA 3EWDA 3K13A 1JUEA 2OMAA 3VZYA 1EEPA 1WDPA 3E2SA 1H51A 4A2RA 1R7OA 3W2KA 2PWFA 4Y6GA 3BICA 5CPLA 1NOUA 3HPAA 3PG9A 4ICMA 1YE4A 5JIWA 5HNUA 3VMOA 2PDQA 2F38A 4HHMA 3VNDA 4DWSC 4WD0A 1OCNA 3N2CA 1NTHA 1PL9A 1ZZMA 3H24A 1EZWA 3EA3A 1GW9A 4Z08A 5D09A 4MKNA 3QKZA 2B7PA 3CPUA 3C3UA 4F2UA 4P61A 4B3ZA 4LV9A 5CPQA 3SECA 3WH6A 5DXXA 3SCQA 1R9YA 1JGIA 5LGXA 3CQJA 3BSMA 1BTCA 4YNGA 4ZGYA 2INEA 4EE9A 4KIEA 3GDTA 3PZTA 4AD3A 2VOMA 1WZAA 4P7NA 1ITXA 1QNSA 3N6QA 1OFDA 1W3HA 4J40A 4MJMA 2WNNA 5C71A 1MI3A 3ARRA 5CC3A 3ANYA 4N7QA 1V6WA 1KCZA 1Q6OA 1Q66A 4GABA 3W01A 4KQNA 2DW7A 1VLWA 3O9NA 4DZAA 1EUNA 4W86A 2P10A 1R38A 1HVXA 2ISWA 4GZ7A 4IIGA 1CGXA 1Q6QA 1F6PA 1VGAA 1ZJAA 5F1UA 3UY8A 2NV9A 4QJ3B 5DCDA 5LA0A 3PBWA 3SY1A 2WSPA 4U31A 3EKGA 3RX3A 2VO5A 1X1ZA 3GR7A 3D3FA 1HQTA 3DEQA 3QBUA 4ZZ9A 3PB2A 3HZ3A 2Y1HA 3E6EA 1TWWA 5BOOA 4G2DA 9CGTA 3DZ1A 1QI0A 1TMLA 4UTWC 4S1FA 1MMFA 1EA9C 1DIEA 5M17A 3GHUA 2FH8A 1TPWA 5M3WA 1P0KA 3BJSA 2GZXA 1W9VA 1E9YB 3KOFA 4AWTA 2YPIA 3TTQA 3W1UA 4NAFB 4JIHA 3THCA 3ALFA 2QDHA 2C16A 2J4GA 5DFAA 1J6OA 4EOUA 2Z7GA 4GYKA 3U3HA 3TYDA 3C2OA 4RX0A 3KBMA 5JBFA 1JNDA 6REQA 4WY0A 2CKSA 2XWEA 3A4AA 3UPMA 3SSZA 1UH4A 2PEVA 4IJCA 1AH4A 4I5RA 5I24A 2X1TA 1A5NC 4HZ8A 4LBUA 2X0YA 3GLCA 5K9DA 1T40A 3QGAC 2OWCA 4FAMA 2WM0A 1UWSA 2Y8KA 1RJRA 4L6OA 4DLFA 1A53A 1M68A 1S5NA 1XRTA