3DBPA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 6-nh2-ump
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal Structure of Human Orotidine 5'-Monophosphate Decarboxylase Complexed with 6-NH2-UMP
rcsb
source organism Homo sapiens
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dbpA00
4WZHA 3GDTA 4CQAA 3Q94A 4P61A 4M6PA 3NM3A 1G67A 1EA0A 3BLFA 1IGSA 1I4NA 4Q4KA 5T26A 2ZA2A 1T96A 5EKYA 2CU0A 3TFCA 4X2RA 3MI3A 1KTNA 1P0KA 3W85A 2XN0A 4NXSA 3NQ8A 5LHFA 3TA6A 3NL5A 5FF0A 3CPRA 3I7RA 2VXNA 2OZ0A 1A5BA 3G1YA 2ZRUA 3QSRA 3Q37A 5LSMA 2EPHA 1JRBA 2BSLA 4ORIA 3LHZA 3W1NA 4DBEA 3OG3A 3PUDA 3N34A 3NDOA 2Y61A 4JD4A 2HTMA 2NXIA 1N7KA 3KVJA 4U28A 4BF9A 3DKLA 3LCIA 3WK2A 3QH2A 3CEUA 3MP4A 4OV4A 4R53A 1ZNNA 2CLIA 5F1UA 4S2CA 3UY8A 3B0UX 1QDSA 1B4KA 4NXKA 4FNTA 4MY1A 5F2MA 4C1KA 2YZRA 1B9BA 3NL3A 5F1VA 2G97A 2OJPA 1K8YA 1BWKA 2JK2A 3U2OA 2R94A 4D2JA 3HG5A 5AC6A 4WY0B 2WSQA 3G24A 5CPLA 2AGKA 3TSBA 2VFDA 2ZRYA 5D38A 1YTKA 4JTFA 3QYQA 4PODA 2CLEA 3SSJA 4N9BA 3TW7A 3C2VA 1FCVA 3NZ1A 1H7PA 3LXCA 1KV8A 3NPVA 4X3ZA 5FI8A 1TQXA 2W6RA 4QIUA 2QDGA 3LHWA 1DVJA 4ZQCA 4RV8A 4P2VA 4AHPA 1HFBA 1Q6OA 3M16A 5D03A 3SY5A 1Z44A 4U4MA 5DXXA 1OFEA 4O1CA 4JR5A 5BOOA 2RH9A 3VE7A 3UNDA 1OFRA 1F73A 1OK6A 3CB8A 4QISA 1O4UA 3FYPA 2TPSA 5I3FA 2Y63A 4Z1BA 3NQ2A 1OFDA 1P5BA 4A3UA 4LVDA 2H90A 2OT0A 2E5DA 3DBPA 2Y7GA 3EXSA 3W88A 2A85A 4Z1AA 3ABQA 4UTHA 3DFTA 3DFPA 4PC8A 2V8ZA 1MO0A 3UD6A 3KRSA 5G2WA 1TRIA 3W71A 3MYPA 4WD0A 4BI6A 3U6WA 4M7SA 1SW0A 2Y7DA 4PH6A 1HG3A 4K8HA 4ZQNA 5K3VA 1DV7A 1H61A 3SZ8A 3MHFA 1T99A 1TPWA 1YXDA 3EKLA 3M6YA 4AEOA 4K39A 2QR6A 3RMJA 3W73A 4FXRA 2VEPA 3FOKA 2EF9A 2ZTKA 2HS6A 3LXBA 2FPYA 1H60A 3FLUA 2JKPA 1IF2A 4CCCA 4O54A 3LI0A 1LCOA 1UB3A 3E0IA 3P74A 4XKYB 2VFHA 4WQ6A 1NEYA 2TSYA 4QNWA 5F4SA 3BLIA 3LHVA 3E12A 2NUWA 4G1KA 4JDBA 1ICSA 4UTUA 1OK4A 3YPIA 2R14A 3PBUA 5LNVA 4FX8A 1GEQA 4UTWA 3A5VA 4UTMA 1OYCA 4XBKA 3I7QA 1LYXA 5F2LA 3QMRA 3DKJA 1WOBA 1JUEA 5K7JA 2B4GA 3NL6A 5I3HA 2FFCA 4NJHA 1V7YA 1OFOA 4O0KA 3EWZA 3NG3A 2ZA1A 3C61A 2A1YA 2VEMA 3L5MA 3LCLA 3WJZA 1ALDA 2ZZ7A 4FNUA 4B5NA 4I9AA 4DO6A 3P62A 4OWGA 4FNQA 5IBXC 3O06A 3F4WA 3W1PA 3EXRA 4NX5A 1J4EA 3UQNA 1OJXA 5ABTA 1EIXA 4OQVA 1KTBA 1FUYA 1SSDA 5CZ0A 3KOFA 1TV5A 1K03A 3NL2A 1VR6A 4RK8A 1QR7A 3EWUA 2QCGA 3GKFA 4TMCA 2E77A 2A21A 3KRUA 3W7NA 2ABAA 1SPQA 2J88A 2Z1BA 3PS7A 4WXZA 1OG0A 1YPFA 3C0JA 4HNUA 4WOQA 2AAMA 3LCXA 2DZSA 5FESA 4MY9A 1RD5A 4JX4A 3B03A 1IXOA 1W3TA 2EAWA 2NXGA 2QAFA 2DZUA 2YSWA 2AQWA 3A21A 2C16A 2QCHA 4IMFA 1OFQA 3LDVA 5HINA 4JEQA 2ISVA 3S0CA 5FF2A 5D2WA 3LTPA 3OIXA 3G22A 1FWSA 3O05A 4ZQOA 4ORMA 2YFOA 1VHNA 1VC4A 1E51A 3C8FA 5AYZA 1L2UA 4Y9AA 4O50A 5HQEA 1QMLA 1JRCA 4AWTA 4ZVJA 4Y6GA 4QJ1A 3KHJA 2ISSA 1TV8A 4IPJA 5D2VA 3EB2A 5LKYA 5CKSA 3NQ7A 3DFOA 3GDLA 2JBMA 4QSHA 3HPSA 4UMAA 3HGSA 1OABA 4LTSA 4A2RA 5C6MA 2FTPA 3RLVA 2G95A 2FQIA 3GR7A 3Q58A 4N9EA 3W6YA 3HF3A 2NWSA 3QM3A 3OBKA 1FX6A 2QCCA 3R12A 3STFA 2YW3A 3EX4A 4O28A 5F4WA 4UTKA 1H7WA 4IXHA 4W9TA 1KM4A 2W0UA 3WFAA 4DO5A 4UMBA 1B3OA 2P1FA 2Z2UA 4R33A 1K02A 4WUIA 4FNRA 4HNTA 1JCNA 2E09A 2YX0A 4QAIA 3RFAA 3G8RA 5KZDA 4FIQA 3W74A 2DP3A 2QUUA 1ZALA 3WJYA 3R2GA 3TC7A 4LRTA 1VYRA 5CGQA 2NUYA 3T78A 3HB9A 2RKXA 2WSYA 5DCEA 1W3NA 3IIXA 1EWDA 3W87A 1XC4A 3TQKA 2ZFAA 1TV7A 5DN1A 3NQCA 4TMBA 5K4ZA 3L65A 1B57A 1PS9A 2PCQA 3NPWA 3N73A 4MLJA 4AWSA 4BWLA 2CLOA 2H3BA 3UXAA 1XBXA 5L9FA 3LHYA 1I2OA 3GZ3A 1WV2A 1JQVA 5AHFA 2QCDA 4BI7A 4JX6A 4Q32A 4CNOA 1S5WA 4IQLA 4BFAA 1FWTA 4MJMA 4MYXA 1I2NA 1F7BA 1W31A 3NQAA 1JCJA 4QM1A 2CLLA 4CCEA 3SIZA 2E6YA 3QQ1A 4JYEA 4CLMA 1PIIA 1SO5A 3CLMA 5I3JA 2CZFA 2BLEA 1R47A 2GUUA 2GQAA 1L6SA 3UWWA 2GPTA 3W7OA 3DFNA 3AJXA 3RK8A 2FB3A 3O15A 2B7PA 4UFIA 2QDHA 4MFEA 1QCWA 5AHNA 3G3DA 4UTTA 5DCBA 2Q8ZA 3DXIA 1TPFA 4RZ5A 1PL9A 1YLVA 4KWVA 3B06A 3FIGA 4DEFA 4CQ8A 2XN1A 3CM4A 2ZZ3A 3NQ6A 4AVFA 2YR1A 3LLDA 3GDKA 1JCLA 2EGZA 3HOJA 4JX5A 3SJ3A 5F2IA 4O52A 3L21A 2CLMA 4JTHA 1W3IA 4ZQRA 3TXZA 2VOMA 2CLHA 1D3HA 4K6AA 5DY3A 5AYYA 5L6UA 5CZJA 1X7FA 3LB0A 3FEMA 1ZJIA 5HUOA 2HS8A 1MEIA 1LBLA 5D05A 3LI1A 2WQPA 2W79A 2JKEA 3TKFA 3TE9A 2V2HA 4BR1A 3JS3A 3S6DA 3ABRA 4K36A 2BXVA 3O07A 3DENA 3PBWA 3LHTA 3W7DA 1TIMA 1VZWA 1V5XA 4O17A 1TPC1 3PB0A 1OX4A 1VPXA 1ZAHA 1TPEA 1GVSA 4E2BA 1X6UA 1MSSA 4ZZ9A 1WXJA 3C52A 2ZRVA 2RDTA 4RLIA 3I7SA 2Q8LA 3G0SA 1SQ7A 3PR2A 1UCWA 1UBSA 1A5AA 3UWYA 4O53A 4K7VA 2E5CA 3ZFHA 1FWRA 1P1XA 3QMTA 1NF0A 1VGAA 1W5OA 3TX9A 4OV9A 4Y96A 3MP3A 4XZ9A 1TREA 2V30A 3ELFA 2DZXA 4MZ1A 3CC1A 1FBAA 5LNSA 5DXYA 3W7KA 3BGGA 4RKAA 1K3UA 1SSGA 3DHDA 1XBZA 2NV2A 3W7QA 3T55A 4WY0F 8TIMA 1OHLA 5D2TA 2YCEA 4HPJA 1R2RA 1JULA 3C6CA 2H6RA 1D9EA 1Q3NA 4N2YA 2NLIA 4YXGA 2J9ZA 3V75A 3C56A 1IIGA 1KA9F 2VKZG 3S5ZA 1UASA 4JTJA 4HNVA 1YPIA 1LRTA 4HHPA 4YMZA 2G5WA 3QPYA 4GFSA 2A4AA 1KFJA 3I65A 3GVGA 4DO4A 4EF8A 1VS1A 3IEBA 2VFIA 1L6YA 4DF2A 3HO8A 5DLCA 5D09A 1OFBA 1OYAA 3KVKA 3QRHA 1VLIA 3H54A 1KFBA 5MHBA 1OX6A 4DPPA 1GPWA 1VLWA 3WJXA 1YDVA 3MI6A 1GYNA 3UY7A 1KBIA 2YW4A 2PRLA 5G4EA 3M44A 5LHEA 2WOQA 1SO6A 1MEHA 2X2GA 3MHGA 3PAJA 3VCRA 4ONVA 5I3IA 3OVPA 4YCOA 1AW2A 3EX1A 1YDOA 4GE8A 3T40A 2DU2A 3N14A 5K9DA 3HG4A 1WDWA 1QWGA 4UC5A 3FFSA 4XTIA 1A5CA 2X1RA 2I14A 2ATSA 1F76A 2CZDA 3KVMA 3NPXA 3BW4A 3MJYA 2NXHA 4GJ1A 2OX1A 3H55A 1RVGA 3W2JA 3HMJG 3S1VA 1LDCA 1O5KA 2I1OA 5CPOA 4DXVA 2YPIA 4M19A 3QJAA 5BMXA 5C2XA 3W2UA 4LRSA 3LRMA 5G4WA 4LV4A 3UZJA 3TROA 1WA3A 5I3GA 1EUNA 2EHHA 2V5BA 3GLCA 1T8XA 1DHPA 1F6PA 5LZLA 4ZQMA 1TPH1 4N4QA 1YXCA 1ZCOA 5CSRA 4FNPA 1ZHAA 3PBVA 1G6CA 4WY0A 3B4UA 3O6CA 1SW3A 1XDMA 5K4XA 1JUKA 3MYOA 1XUZA 4Z1CA 1YTDA 2ZCGA 1UUOA 1YDNA 4DF1A 3G1FA 1LLZA 5KINA 4JTIA 4EIVA 4HPXA 3PUOA 4UFKA 5AC8A 3W83A 3O6YX 3N9SA 1ADOA 1KFKA 3A5FA 3PSWA 4UXDA 3IGSA 5EA9A 2FLIA 3A24A 3P8IA 3C4UA 5HJLA 3NVTA 2VFFA 3G1SA 1MXSA 5HUPA 2CW6A 3GKAA 1W5MA 3W70A 1W5PA 3BG5A 1IXPA 3DAQA 1GTEA 4ML9A 4MKNA 3TMLA 2DZPA 1S3HA 3QC3A 2CLKA 1LROA 1KM1A 1KM6A 2VEIA 3T44A 1OX5A 1ONRA 4MYAA 4POCA 4UIOA 1TTIA 2ALDA 1L6WA 1O94A 1AL8A 3CIXA 3BG3A 2J9YA 1DOSA 5C54A 1FCQA 2V5LA 1FY6A 1LRNA 1N55A 4NQ1A 4N9CA 3B05A 4JTKA 1THFD 3CHVA 3BPWA 3IGXA 4Y90A 1H7NA 3QMSA 4RX0A 3FKRA 1WAUA 5G2IA 3NQVA 2WJZA 3IVUA 1YYAA 4WX2A 5HULA 2ZZ4A 4WXYA 3LTYA 2H8ZA 2BZNA 2GQ9A 3LV5A 1EWEA 4LT9A 2XN2A 3BG9A 1XXXA 2A7PA 3SR7A 6TIMA 1KM0A 1K7FA 5IBXA 2PE4A 2C6QA 3GXNA 3M1ZA 2F84A 3LCWA 3TJLA 1LP6A 4X9SA 1LBMA 3O6DA 1SO4A 1KM5A 1Z42A 4MY8A 1K8XA 1XUUA 4ZL1A 3CIWA 4AF0B 3BARA 3WK1A 4AHOA 2B7OA 4NJJA 1W56A 3G3MA 4BI5A 3W7MA 1QOQA 1VJIA 5D02A 3MI2A 1W37A 1ZAIA 2Q3OA 3GK0A 4PL1A 2UV8G 5E1QA 2DORA 2QF7A 3DI1A 3W7CA 3H53A 5KMYA 3STCA 3MP5A 3KVLA 2A7RA 2Y89A 3W7LA 5LNUA 1H51A 4LVBA 3WJSA 1GVRA 3UPBA 4UUIA 1GVQA 3VE9A 3W1LA 3W7EA 4JY9A 4J9JA 1PV8A 2V81A 4JDYA 4A21A 1J2WA 1NVMA 1HTIA 3GAKA 3HIJA 3TIMA 4NU7A 4O8RA 1FDJA 3NOEA 5KZEA 1SFLA 3SECA 4O1BA 2H3DA 5LNRA 1RR2A 1TSIA 5D30A 4TX9A 5AOUA 1I45A 4O4VA 1JUBA 3O63A 1K8ZA 5AFDA 5FEXA 5D2XA 2V2CA 3NQGA 1EB3A 4JGDA 3OEXA 3DFSA 2JGQA 2GJLA 4YCPA 3EWBX 1GOXA 4JNMA 1FCBA 4LU0A 5D2YA 3TSMA 1QFEA 1JJKA 1VCGA 3DHFA 1GG0A 3B04A 1H7OA 4N02A 3TFXA 3P5ZA 4UTWC 4OU1A 3OVQA 4MUZA 4PTNA 4RXFA 1TJRA 3PG8A 4O16A 1GTHA 2BX7A 4DELA 5J5RA 1LOSA 2RDWA 2VC6A 1OF8A 3FKKA 4GBUA 5KZMA 4Y8FA 1M5WA 4IUOA 2Z6IA 3VI2A 3O1NA 3TH6A 1ICPA 4KFPA 1K7XA 1DJQA 1D3GA 4K8EA 5H91A 1SUXA 2YDAA 1ZENA 4AWUA 3TV8A 1UUMA 3CQ0A 3D0CA 3GXTA 3IIPA 4R7JA 4IOTA 1GG1A 1W5NA 2HSAA 3S5NA 4WJEA 3TQVA 4O11A 1DL3A 3MUXA 3UWQA 7TIMA 1WX0A 5DCDA 1PCKA 1H1YA 3F1QA 4UMCA 4N4PA 1W1ZA 4YL2A 3KAOA 2TMDA 3OHIA 3UPWA 5HWMA 3CTLA 2A5HA 2WV8A 3IIOA 3SW6A 2ZZ2A 1H7XA 3G1DA 1QO2A 4UTIA 5K2ZA 5K9XA 4Z08A 2ZTJA 5FF4A 4K37A 2Y6ZA 5A8GA 4KFOA 1PHWA 3WJWA 4DPQA 5F4XA 3LERA 1I8JA 1WYIA 4EWND 1AW1A 1ZAJA 1XI3A 2E6AA 2QCLA 3LTSA 3S1XA 3V1PA 3G0XA 3PULA 3BGJA 3SGZA 5HMSA 3MHUA 3L67A 2PURA 3L0GA 1FXQA 3B0PA 4H6KA 3LV6A 1JCXA 4IPIA 3TW6A 2WNZA 1KM3A 3P67A 4JTLA 4FEZA 1H50A 5BRBA 3KFTA 1OVDA 3DGRA 1Q6LA 3M43A 1W0MA 4LWWA 2X1TA 4CQ9A 4NNBA 5AHEA 4O1AA 1FWWA 3DFQA 4A2SA 4EF9A 3W07A 1I2RA 3C2FA 3W22A 4I7VA 2QJIA 5I3KA 5HR6A 4GRSA 3N19B 3EWXA 2E68A 2P0OA 3P82A 3W1AA 3THQA 4OHQA 3GIYA 5AN7A 4UFMA 3W1RA 3C3NA 2B0MA 4NNCA 3L2IA 3FJ6A 1P0NA 1EP2A 1R46A 3ZWTA 1XM3A 5AHLA 1H63A 3E96A 4H3DA 4GUFA 2ZYFA 1XBYA 2E6FA 2X1UA 4K38A 3NYZA 4GUJA 4FNSA 3EXTA 1TJPA 1C9DA 1IXNA 3IVTA 4OT7A 4N9DA 2QAPA 2CLFA 1ZFJA 2DJLA 1OFPA 4HNNA 3M41A 2DZTA 5FEZA 4JS3A 4NJIA 3TR2A 3GXPA 4LS2A 1Y0EA 2ZRZA 5A5WA 4JY8A 2J24A 4Z1DA 1DBTA 3W1UA 5GVJA 1Z41A 2DJXA 1LBFA 3GDRA 3U8GA 1G4TA 3VNDA 5EYWA 1KBJA 3W2MA 1G4EA 1U83A 1ICQA 3IGUA 4ALDA 3NA8A 4AAJA 3OA3A 2TRSA 2Y70A 4UCGA 1VYPX 3RLUA 2E6DA 1SFJA 2DZVA 2V82A 1KFLA 1FXPA 3QQ0A 3BVJA 1QOPA 1WBHA 3N9RA 3P84A 5G1YA 2BWGA 1OFAA 3B0VC 3L0KA 1C8VA 1ML1A 3P5YA 3NM1A 2RHGA 5CPNA 4MOZA 3UYCA 5LNWA 1Z48A 3HGOA 5G1TA 4Z0SA 4LUJA 1QPRA 5KSWA 3ABOA 4LOCA 3S1WA 5G5IA 1XFBA 2HMCA 4O0ZA 1VRDA 3GYEA 4IMDA 1BTMA 3TC6A 3W7IA 1H1ZA 1QO5A 2IQTA 1H5YA 3LCFA 4NZJA 5C5YA 5U4NA 4XBSA 1VH7A 1G4SA 1RQHA 3ANYA 4LC6A 3RF9A 3FS2A 3IRDA 3O16A 3W1XA 3LGEA 1G69A 4GC4A 1EPXA 4C1LA 1TQJA 3QFEA 1A53A 1MZHA 1SZFA 2ZBTA 1K7EA 3WK0A 3LM7A 4QITA 5KITA 3EEGA 2QUVA 4TU1A 4EVZA 5IM51 1RQBA 1TTPA 3PBYA 4JTEA 1G7UA 1O95A 1AL7A 1J5TA 1KFEA 1M7PA 3NQDA 4PA8A 4M6QA 4QNEA 2QJGA 4ZQPA 3GNDA 5TIMA 1TYGA 5D37A 3JRKA 2ZZ5A 3QZEA 4O12A 3A9IA 1IXQA 3W1QA 2F7FA 4JTSA 3PG9A 4XQ6A 4EOUA 3TXVA 2Q3RA 4NJGA 3M5YA 4O13A 3T4CA 4MIMA 3BK0A 2C14A 1S5VA 4UR8A 1I2QA 4CNPA 3AO0A 4TO8A 3QW3A 4S2BA 2J9XA 1TPB1 3GX9A 1I2PA 4M7TA 5DBTA 2ZRWA 3TMQA 1XKYA 3HPXA 1AMKA 3G8EA 1GVFA 1NAL1 3BV4A 4OGZA 3W3OA 4DF0A 3S8HA 2C13A 4NNAA 4AMAA 1H62A 3W7GA 5D04C 4JYFA 3EWYA 3G18A 1W8SA 4JXCA 1R30A 4JIPA 5AYXA 3C2EA 3DI0A 3GAYA 2ZQ0A 4HSNA 2DZWA 2VELA 3TAKA 4ADUA 4HIBA 2NX1A 1OF6A 3S5YA 1EP3A 3STEA 1SZGA 3C2OA 1OYBA 2Y88A 5CPMA 1TMHA 4GXMA 5EPDA 3NR0A 1VCFA 4FF7A 3TCEA 4O10A 4MZ8A 1KLZA 2Z0IA 1DQWA 4RZ6A 3FA5A 3HGJA 1PHQA 3I68A 2WNQA 5DELA 3BW3A 2A2IA 1L9WA 1NFBA 1FQ0A 1A50A 3P7YA 3P60A 3LLFA 5U7SA 2Z6JA 5CZSA 5TBOA 2B7QA 2E1DA 1JCMP 4MJZA 1FDZA 1YADA 3HJZA 1VYSX 1ZY9A 1RZMA 5HNRA 2ISWA 4N6FA 5LGXA 3BLEA 4UNLA 3GR8A 3HGRA 4IGHA 3LBCA 3PVFA 3UWZA 3L66A 4E38A 3M47A 4NZFA 3TSDA 4E0CA 4O1DA 3QEZA 1TPVA 2VEKA 4FXSA 3S42A 3GDMA 4KKXA 4UTLA 4JTUA 1EEPA 5KTLA 1QNVA 1P4CA 3W2NA 3R5EA 3OVRA 2JGYA 1WOAA 3LCGA 3IVSA 4JTTA 3TQ0A 4JIQA 1XCFA 3TJXA 3EX3A 2PRHA 4LS1A 3PWAA 2EKCA 1ME8A 2NX3A 2R91A 2QCEA 1TO3A 3K30A 1T0OA 2A6LA 3GB6A 1F2JA 4O18A 3ZR4A 1G7VA 3EWWA 4OBTA 2OCZA 5G2HA 3VKJA 3M5ZA 4Q33A 1BEUA 1LZOA 4FX7A 1F5ZA 4NJKA 1RV8A 3W7RA 3M7WA 5C55A 1ME9A 3PB2A 5HWNA 3TUUA 3E02A 1MEWA 3PSVA 1ME7A 1GQNA 4IWWA 3EKZA 4WOZA 4XKYA 1AG1O 3STGA 1JQXA 2P10A 3W1TA 3CT7A 4LY8A 1KLYA 3UWUA 4LUIA 1CX9A 2OT1A 3FJLA 3W2KA 5AB3A 4AF0A 3W84A 1F6KA 2NZLA 1HO4A 4K7YA 3SGUA 3LX9A 5F2GA 2Y7FA 1EX5A 3NZRA 4DBDA 3R13A 4PL2A 4CCDA 4KFNA 1XDLA 2QJHA 4L4MA 4N6EA 4X22A 1WQ5A 2GVLA 5EBUA 4JTGA 5DY2A 4AB4A 1NF7A 2VFGA 5CZTA 5DBUA 1F05A 3N2XA 3W7HA 4O57A 5HWJA 4O4WA 3TU9A 1TPUA 5AHMA 3S5OA 4O14A 4XWUA 2XFWA 1FCUA 4A22A 5EMUA 3NNTA 2O7QA 4ZMGA 4AH7A 3PUEA 1FDYA 1TCDA 1KFCA 2GVGA 3M9YA 1WBJA 1O60A 1LLWA 2ZDRA 1HL2A 3N3MA 5J5DA 4HN4A 5FEPA 1SU5A 4MPQA 4MZYA 2C3ZA 1JR1A 3DH7A 3NPUA 1BWLA 1NSJA 1SR9A 4LS0A 3JR2A 2YYTA 5FF7A 1TRDA 3ABSA 4LVFA 3CEPA 4RJEA 3DU0A 3UZ5A 4HT3A 5HR7A 3B8DA 3TK7A 2WKJA 4HKPA 4ADTA 3NGJA 2YGYA 2C19A 1QAPA 3BW2A 2FIQA 3LBMA 2A6NA 3O8AA 4IX2A 2CZ5A 4JN6A 5BNKA 1Q6RA 3R8RA 2Y7EA 4OE7A 3RU6A 1AW5A 4MFDA 4JICA 4IMGA 3A23A 2FB2A 4GNJA 1EP1A 3CU2A 4CNNA 5H2ZA 2CFFA 2QCFA 4FB7A 2ZZ1A 2I9EA 3KRZA 1QPOA 3NQFA 4O19A 1DJNA 3MBFA 2Y62A 2ABBA 3F4NA 1SW7A 3TAOA 3SFKA 2CZEA 3W9ZA 3ATYA 2CWNA 2ZZ6A 2QUTA 1AK5A 2C15A 4IMCA 2RDUA 3W75A 2ZRXA 4NX0A 3L0NA 1EUAA 3P8JA 3W76A 3MW7A 1PVNA 6ALDA 2O7SA 4RCXA 2OMAA 1GWJA 3PF3A 3DZ1A 4S1FA 4M5PA 5EL1A 1CW2A 2Y85A 1JVNA 2QCNA 5EY5A 5E0KA 4UFJA 3KXQA 2WO5A 4PFMA 1F74A 2FDSA 4GUHA 1H7RA 3NXFA 5TQLA 2RFGA 2WSRA 3A22A 3W7JA 4XUGA 3LOTA 3HG2A 3MBDA 3IIVA 1FWNA 3R89A 1VHCA 2VENA 1X8FA 1TB3A 3L5LA 1LM1A 1UJPA 1LOQA 1SZNA 1PE1A 1LOLA 4HSOA 1CI1A 3G1AA 1W5QA 3M0ZA 1XL9A 3EX2A 4FHAA 2C1HA 2V2DA 4FIRA 4IJBA 4AHQA 1YXYA 3TDFA 1KV5A 3THAA 1DQXA 2NX9A 1LORA 4UTJA 2A7NA 2GVJA 2J6XA 2QCDB 5AHIA 1TPDA 4I7UA 3SI9A 2VFEA 3NAVA 1GT8A 2PRMA 2FPTA 2GOUA 3IIZA 3W7PA 2R8WA 5D33A 3S1UA 1M6JA 3W23A 3CWOX 4AXKA 4NUWA 3CWNA 4YWIA 3IV3A 4LVAA 4LVGA 3NEVA 2ZA3A 5CG7A 1BKSA 5FEWA 1QPQA 2WNNA 3MMTA 3QSTA 4NT0A 3G1VA 4NVTA 1KM2A 3P80A 2ATMA 2QEZA 3T7VA 1G4PA 2J27A 4YLWA 2NWRA 1Q45A 1HO1A 4BWLC 4ICNA 3P61A 1Q6QA 3W72A 2QKFA 1R2SA 2B7NA 4PEKA 4FO4A 3VFLA 5E93A 3BO9A 1X1OA 1W54A 2D73A 4GUIA 1TTQA 2GQ8A 4UFLA 4IMEA 4L4LA 3RNDA 1PCWA 1SO3A 3TNOA 4UNKA 2NUXA 3PC0A 4FX6M 3LRKA 4IX0A 4LC8A 5SWUA 4QQ3A 4MVAA 3HPZA 3W1MA 3Q2DA 4E2DA 1TTJA 3HBLA 1A5SA 3G1HA 3G0UA 4RZ4A 5FF3A 3M5VA 1SZEA 3M5XA 5K9CA 4RXGA 3ZWSA 4UTTC 4Z0JA 3HQ1A 2LLEA 3FYOA 4JYDA 1KW1A 1OX4B 1GZGA 1U5JA 3INPA 2FJKA 3C2RA 1QPNA 3LHUA 4IXXA 3MO7A 2G96A 3N2MA 3P81A 3NQMA 1N8FA 2YXGA 1O5XA 4XTDA 4DQWA 2V0TA 1JCYA 1RPXA 4LW7A 2X30A 2TYSA 1DORA 4I7WA 1DKWA 1M7OA 3HG3A 4R34A 3UWVA 3LCHA 4O15A 4MLRA 4LV9A 5D32A 1VQTA 1GVOA 4TR9A 4ADSA 2X1SA 1GJPA 3KX6A 1LTDA 4GUGA 3W86A 1RQEA 3NO5A 4TIMA 4PCFA 3W2LA 1C29A 4UR7A 1XBVA 2X16A 5BMWA 2NV1A 3NQEA 2YFNA 5AC7A 3USBA 2QCMA 4UFHA 4KWWA 2WPBA 3LRLA 1S5TA 2E5BA 1R2TA 4H4IA 3EX6A 3E9AA 3I6RA 1HUVA 1GYLA 3QPZA 3G1XA 4A29A 3ATZA 1B4EA 4RR4A 3PM6A 5LGZA 3L68A 1VCVA 2KZHA 1IIHA 2GJNA 2C18A 1KTCA 4BK9A 3S9YA 3MWAA 3GNNA 5CSSA 3QF0A 3F03K 2JKAA 3UXDA 4LNYA 3ZS4A 3WK3A 2H8XA 4GWEA 1X1ZA 2V9DA 3QW4B 2A0NA 3L9CA 3LXAA 2FPVA 5BW6A 1LRQA 1YTEA 2PC4A 2BTMA 3L5AA 4M6VA 2C0AA 3E49A 2YYUA 3PY2A
chains in the Genus database with same CATH superfamily
1NIUA 3KCJA 1MUCA 2A3LA 4NZCA 5CC3A 4M6PA 3NM3A 3D47A 4UTFA 2INZA 3BLFA 1IGSA 1MVYA 3L4VA 3WD0A 3QZAA 4H9XA 3CO4A 4XG1A 2OSXA 7ODCA 4DUVA 1EJWC 2ZA2A 4HNOA 1V3LA 2CETA 4UQEA 3M64A 2XN0A 5LHFA 3NQ8A 1TVPA 3NL5A 3TA6A 1BYDA 3REQB 2WVVA 4MB4A 4CD4A 1UKOA 1Q6CA 3Q37A 1HVXA 1XLMA 3II1A 3LHZA 5DT7A 4DBEA 3PUDA 3BAXA 3LENA 3E1F1 3VNYA 3EDFA 4GYFA 2NXIA 2DSWA 4QQUA 1HKJA 2VVNA 3LCIA 1RA0A 3HQNA 1TELA 3S2LA 2BB0A 3FHQA 1J93A 2FZMA 4Y9NA 3AWOA 3B0UX 2CHOA 1QDSA 4GVHA 5E09A 1AVAA 2GWNA 4C1KA 3BCFA 1B9BA 1RK5A 3DG3A 2G97A 1UD3A 4V15A 1R38A 2WSQA 5CC7A 1MMFA 4Q7BA 2VFDA 5D38A 4JTFA 2AMGA 3QYQA 4F2BA 4PODA 3SSJA 3TW7A 4NI8A 1FCVA 3UR7A 1NU5A 2PF8A 1Q4NX 3GNXA 4X3ZA 3D5HA 1TQXA 4W8BA 4QIUA 1B3YA 2QDGA 2XIBA 1Q6OA 1OFEA 4TX8A 5BOOA 4DNHA 2H9AB 4JFUA 1UJQA 3CB8A 4QISA 1EYWA 3E2VA 2W92A 2GDUA 3MV11 3U48A 2V69A 1NDYA 2H90A 2E5DA 3ISIX 3DBPA 4D72A 2V3FA 3ABQA 4UTHA 3DFTA 2AKZA 1RCOB 4PC8A 4DJFD 5G2WA 2ZICA 3MYPA 4WD0A 4BI6A 4C6EA 1CLVA 4R88A 4I6VA 4PH6A 5K3VA 3SZ8A 1VFSA 1QHPA 1YXDA 3SM0A 3BMXA 3M6YA 2XIIA 3B9DA 3S1GA 4WR3A 4ILSA 1QW7A 3T6CA 1XYMA 4FXRA 1J8VA 1P6CA 1A0EA 1E72M 4OECA 2HS6A 3V18A 1WUFA 2XUCA 3R1ZA 3SADA 2FPYA 2V68A 1JEZA 5GNYA 3FLUA 2JKPA 5C7HA 1IF2A 4ZO8A 3NIYA 1GOKA 3TEVA 3WX7A 3E0IA 3QN3A 3WBEA 1U1JA 4QE4A 1IT8A 3E12A 1JGMA 2D22A 3VZXA 4MNJA 1IT7A 3BJFA 4Q8UA 3EWCA 4HMNA 5LNVA 4FX8A 3BZJA 1OYCA 3QMRA 5H8UA 4D6CA 5I3HA 3N9KA 1BYCA 1JF6A 1OFOA 3H22A 4C6JA 2A1YA 3L5MA 1UUQA 3VKCA 4W86A 4I9AA 3AHTA 4FNQA 4J4KA 4NZ4A 2ZX6A 1MRQA 3KOFA 3RRAA 5BRQA 3THCA 1QR7A 4P8WA 4IP5A 3GKFA 1PDYA 2QPXA 2PP0A 1SPQA 3PS7A 4MDOA 3TN4A 3GFYA 4E4PA 3WDRA 1SZRA 3NSNA 3DGBA 4MY9A 1EKOA 4JX4A 3B03A 1IXOA 1W3TA 2YSWA 1HW6A 3A21A 4W5UA 1I1WA 1T41A 2C16A 3RXZA 1OFQA 3SUTA 3LDVA 2ISVA 1W1PA 2P8BA 2PAJA 3S0CA 4F3HA 4IG2B 4JKLA 1FWSA 3AZSA 2XIOA 1VHNA 3URBA 4YTTA 1E51A 4GINA 5AYZA 1J0YA 3BLDA 4Y9AA 3LMYA 1YPXA 3P2VA 4YVPA 3EKGA 1JPHA 4QJ1A 1BVZA 1UH4A 1KD0A 1NDWA 5LKYA 3CZGA 4QSHA 3HGSA 1PTDA 3A4XA 2Y8KA 3G5EA 4F66A 2G95A 1J6PA 2CWXA 3OBKA 1UIOA 2QCCA 1UH3A 4A3QA 1A3HA 5F4WA 3WDJA 4KIRA 2OELA 3N2TA 1EFZA 2W0UA 3WFAA 3WNLA 3U57A 5M3WA 4UMBA 1B3OA 1CECA 3H70A 2OLAA 1JCNA 1VEPA 1DWIM 4GD0A 1Q7MA 1YQ2A 2WHMA 1ZJAA 4G56A 3W74A 2DP3A 2DGAA 1NFPA 4MNMA 4MNKA 5CGQA 1K6AA 5DCEA 1W3NA 1J79A 2YDQA 1XC4A 3TQKA 5A69A 2WK2A 1TV7A 5DN1A 4KGLA 4B3LA 1B5TA 3L65A 4ICMA 1KKOA 4M56A 1SFTA 3NPWA 2J7DA 3N04A 3BSHA 3TLLA 5A2AA 5TNVA 4DBSA 4KRZA 4DZIA 3VX1A 1V6VA 1WV2A 9CGTA 4Q32A 1W17A 1S5WA 1ZPTA 3ES8A 5AYIA 2PI6A 4MYXA 1I2NA 3GU9A 4H83A 1Q6DA 5LA2A 1DTNA 3AALA 5CAHA 1PIIA 5I3JA 2GQAA 3UWWA 5DFAA 4B4HA 3CXOA 5ABFA 2P3EA 3AJXA 1GORA 3CS2A 3AAMA 1J0IA 1QCWA 3PN8A 5HBFA 4JQAA 1B3VA 1PL9A 1H3GA 3BZGA 5CGMA 3B06A 3R10A 3FIGA 4KETA 4DEFA 1EZ2A 2F61A 3PHAA 4CQ8A 2XN1A 3MV01 1E9IA 4D9PA 2YR1A 1FP9A 4NILA 4XKMA 4CVUA 3HOJA 4JX5A 3L21A 1VPQA 3CYVA 1K77A 1JFXA 1XP3A 3VGFA 5DY3A 2D2JA 1ZJIA 1QHOA 1BHGA 1MEIA 1DJYA 2ISDA 3TYEA 2W79A 3TE9A 4C65A 2IPWA 4UZUA 4K36A 4GX8A 3PBWA 1A5NC 4NIRA 3LHTA 3W7DA 2XHYA 3BICA 2XDFA 1V5XA 1IGWA 2NLYA 1TPC1 2QIIA 2PCEA 3WH7A 1TPEA 2BODX 4O1EA 1X6UA 3C52A 4P7RA 2RDTA 3I7SA 1SQ7A 1UBSA 3UWYA 3GUWA 3AMCA 2PBOA 4FA3A 1K4GA 2I57A 1Z8AA 2W27A 3UXLA 1NF0A 4OVXA 3TX9A 4QDMA 5H8PA 3E0WA 4XZ9A 4HHHA 4A3RA 2V30A 4MZ1A 1HJWA 3CC1A 4BF7A 1OCJA 3WLNA 4RKAA 1K3UA 4O0QA 4A05A 2NV2A 2ZE3A 1QRQA 3SUWA 3AFBA 3EPOA 3WCZA 8TIMA 3TYAA 4ZEPA 1WKYA 4IJRA 2YCEA 3UESA 2NLIA 3THDA 3VGDA 3E3HA 2VKZG 2UY5A 1KCKA 2J13A 4FAMA 3CJPA 4IQJA 3B97A 1UWAA 2G5WA 4GFSA 4DYKA 1TR9A 2GJXA 3H7RA 1N8IA 3GVGA 4EF8A 1PAMA 3IEBA 4XB3A 4HA1A 1LG1A 2CBIA 2Q71A 3A4JA 4R85A 3WNPA 1J0HA 4Q4QA 1OFBA 1VLIA 3ECQA 1KFBA 1R7AA 5H1WA 4DPPA 2ONEA 1A49A 1YDVA 2ZUSA 2KAUC 1KBIA 4TVDA 5I0DA 5G4EA 2WOQA 1SO6A 1MEHA 5C0QA 1XIBA 5IHRA 4QS6A 3VCRA 3OVPA 1K6WA 4KESA 1AW2A 1FWGC 1YDOA 1XSIA 2J8GA 3L4TA 4AD0A 1ZJHA 1BF6A 3M7SA 3N14A 3GXMA 1JPKA 4YIWA 1QWGA 4UC5A 1OIMA 4BQ4A 4UQAA 5CJNA 2I14A 3REQA 4CGTA 1F76A 1F8MA 1ZJBA 1ITXA 1XIJA 3NPXA 1E5JA 3MJYA 5D9PA 3K8KA 4PMQA 4DNMA 5FL0A 4XD4A 5BU6A 2OQYA 4ERAA 3HMJG 3C0SA 1I9CB 2VVSA 3KHDA 2I1OA 5CPOA 3VNKA 4S3DA 4A8RA 3HTWA 4LRSA 3TROA 2BHZA 2VC5A 2GGHA 2WWDA 1T8XA 3ZOAA 2XIJA 1F6PA 3CHCA 1GQIA 5LZLA 4ZQMA 4D6JA 4KEUA 3VIOA 4DZAA 3B9OA 2DT2A 4FNPA 3BANA 4B4FA 3LM3A 2ACSA 3GG7A 3QTPA 1XUZA 1M03A 3LD5A 3CH9A 1VIWA 1BSLA 5E70A 1LLZA 2CCRA 5CPSA 2XH0A 1F61A 3ZO9A 4HPXA 4BQ2A 4HU0A 3A5FA 2WHKA 3PSWA 2INFA 2FLIA 3SUUA 3KWSA 5HJLA 3NVTA 4FR1A 3G1SA 2PA6A 1RBOB 1VFLA 2FDMA 1W5PA 3BG5A 3EDEA 4PMNA 3POCA 4Z42C 4Z2KA 3OW1A 1POJA 2XM1A 4S3CA 2F9RA 3T44A 3VDAA 4H04A 1ONRA 2OWCA 4MYAA 3ICJA 2UY4A 1UKTA 3BG3A 3RU8X 4F79A 2E9LA 4F40A 1RD6A 1C7TA 3QMSA 3KZPA 3VPLA 3NQVA 2WJZA 3IVUA 4WX2A 3AROA 1Q66A 4GZEA 2XN2A 3VIGA 1RJQA 1K7FA 3HQOA 1LP6A 4PRRA 5LYRA 4IPPA 4U2ZA 4MJ2A 1US0A 4MY8A 1K8XA 3NOYA 1J18A 1XDJA 3WK1A 4AHOA 2B7OA 3KBWA 3FW6A 5REQB 3SURA 3G3MA 4BI5A 1BWVA 3GC5A 3OQEA 5D02A 4CUCA 4MM1A 3RO6A 1M41A 1KRAC 2HV5A 4I8YA 2QPUA 1HGYA 3OBAA 2UV8G 5E1QA 5DRIA 1FTXA 1Z6KA 1B3ZA 3H53A 3OU8A 3T2PA 4DY1A 3T0TA 5LNUA 3EEZA 3NQBA 2CBUA 3WLKX 3W1LA 3W7EA 4IIGA 2PDWA 1HTIA 1G0CA 3HIJA 4RV3A 4O8RA 4TUFA 5KZEA 1SFLA 3SECA 3GD6A 1RR2A 3GUGA 5AOUA 1JUBA 4PMZA 1EB3A 3MKKA 1HGWA 3U9IA 2GJLA 4YCPA 4WIWA 1TWDA 4HB7A 1KCZA 4LU0A 1ZBVA 2W91A 3DHFA 2Z2AA 1JI1A 1KR0A 3TOPA 3SSZA 1MRAA 3QPEA 3TFXA 3WNMA 3P5ZA 4UTWC 1KKRA 4Z1YA 4GC3A 4MUZA 4BCEA 1TJRA 1YEYA 3SQMA 3PG8A 3WF3A 4ACYA 3F5JA 2BX7A 4M51A 1PX4A 3QQWA 3F4CA 1MW2A 4G7EB 3IJIA 4NRRA 3EOUA 1OF8A 3IACA 3FKKA 2WANA 4GBUA 5KZMA 2Y8UA 1FA2A 3LPFA 2Z6IA 5D9OA 3T0DA 4J40A 4X9YA 1ITUA 3CZJA 4QJ3B 1E9ZB 1D2KA 2JFEX 2RGLA 1DJGA 3SN4A 4IOTA 5LA0A 2EG8A 4MDPA 3FYYA 4WJEA 4ZE4A 1DL3A 4H01A 1YRRA 2PLMA 1KGUA 4XZIA 1LLOA 1NM9A 1HJXA 3F1QA 1OCBA 1V6WA 3VOHA 3SCTA 2CYGA 2TMDA 3MSYA 3SCSA 3OHIA 3UPWA 4REQB 2GWGA 2YBUA 2WMJA 3IJLA 4MF4A 1RH9A 1HKVA 2ZXQA 3RR1A 4YHGA 4ZSTA 4CEUC 2ZTJA 1EJVC 3ZVHB 4TX6A 2ZXBA 3CMJA 3QV7A 5A8GA 5F4XA 3SJNA 1UH2A 1AW1A 1ZAJA 1C7SA 1Z89A 2E6AA 2VP8A 2WMIA 1HJVA 3S1XA 1MI3A 1JFHA 2PURA 4DYJA 1KRMA 4EWJA 1YX1A 4H6KA 4QJ4B 1JCXA 3AU2A 1XLDA 3TW6A 2WBKA 1A5MC 3THUA 2J77A 1YHTA 5AZ0A 3WH5A 1G94A 1KRBC 5BOFA 1Q6LA 1OT1A 2ZC1A 3NJ3A 3MANA 4H00A 4LWWA 2DEPA 1FWWA 2Y5EA 2W61A 4TTGA 4DBUA 4EF9A 4I7VA 3OYXA 3ZR6A 4HK7A 3BV7A 1TJ0A 3PZMA 4GRSA 1Q2RA 2V5DA 4EXQA 3PPFA 4J2MA 1M04A 3FJ6A 1XM3A 1H63A 3E96A 4QLKA 4H3DA 1IT0A 2ZYFA 3O0FA 4HPNA 3DESA 3BE7A 3GY1A 3NYZA 4GACA 3UR8A 2G3MA 3IVTA 4OT7A 4U3AA 2CLFA 1VF8A 4HNNA 3M41A 2Z1WA 2XVPA 2J7BA 2PZ0A 4LEFA 3GXPA 5A5WA 2DZBA 3GVWA 1SJCA 2J24A 2D0HA 4IJCA 5GVJA 3DN5A 1Z41A 4F2UA 3S2MA 4C6QA 1KBJA 5HJXA 3AS2A 3AISA 4ALDA 1ICQA 3CH0A 4C91A 3OA3A 2DVTA 2E6DA 1Y65A 1QTWA 1W9UA 5G1YA 1DJXA 1DJHA 1OFAA 1DYSA 1ML1A 3P5YA 1CXLA 3NM1A 3UYCA 5LNWA 1TX2A 4LUJA 2C0HA 4XO7A 3AMKA 4LOCA 3S1WA 1QI4A 2WVUA 3EDJA 1G01A 3CPGA 3W7IA 1JZ5A 2DVXA 1F4AA 2W63A 1XISA 3U7VA 4E5TA 2XWEA 4JTQA 3RF9A 3IRDA 3W1XA 1AQ0A 1G69A 1MZHA 4ASTA 4CKQA 1K7EA 3W0KA 4QITA 3EEGA 1WDQA 1V93A 2CC0A 4TU1A 4EVZA 3QFWA 3IRSA 1TTPA 3PBYA 4JTEA 3WD3A 5AY7A 1JCTA 1AL7A 3ZM8A 1M7PA 4HHLA 4PA8A 1AQHA 1YNPA 4RUBA 3GDBA 3GG0A 3NSMA 5TIMA 1TYGA 5GNXA 3IAPA 3N4FA 5CBIA 4JTSA 2CZVA 4G1NA 2QPSA 3WLLA 3SN0A 4RL3A 5GNZA 2PDQA 4CEXC 1S5VA 4TO8A 1F8IA 1LG2A 3QW3A 4S3JA 4S2BA 5FJTA 1LUCB 2J8FA 4M7TA 3TMQA 3PTKA 4Q4SA 1XHGA 3HPXA 1AMKA 1GVFA 4OGZA 2PWHA 3W3OA 1V3HA 1P43A 1H62A 5BXSA 3ZLFA 3GSMA 4L7ZA 3EWYA 3SRHA 3WH6A 5GJNA 2WC4A 1R30A 5AYXA 4GJIA 2X41A 1TZZA 4JIHA 4HSNA 2DZWA 2VELA 3BMWA 4GHRA 4ADUA 4HIBA 3FA4A 4ZXOA 1RAKA 2DIKA 1Y5XA 2XZ7A 3S5YA 2J6VA 4AU0A 2JALA 1UR4A 1VKFA 3NWRA 2EEXA 2VUYA 4L6DA 4FF7A 1YIXA 4YVVA 4MZ8A 3TZNA 4WCJA 1PHQA 2WNQA 2WC7A 5DELA 2A2IA 1NFBA 4JL1A 4GISA 2BFGA 4LUSB 3HA1A 2E1DA 1V02E 1FDZA 1US2A 1YADA 1Y8BA 2BXZA 2DV0A 3F5LA 5HNRA 4N6FA 1XINA 3RN6A 3GR8A 3COTA 2O9OA 3PVFA 1IE7C 2GGJA 2RDXA 2YLAA 4Q8WA 3GQYA 5ECUA 4AEFA 1XIFA 1PX3A 4Q8QA 3W29A 1QNVA 2YDSA 2QT3A 3VGBA 2DSZA 5A6SA 4NP7A 1P4CA 3W2NA 2JGYA 3TQ0A 4JIQA 4PTXA 4LALA 2PRHA 4LYPA 4LS1A 4BQ5A 4MADA 2WM1A 5EGRA 5HNTA 1KGXA 1DE5A 3ZR4A 1G7VA 3EWWA 2OCZA 5HOSA 3E2QA 5EMYA 4PGLA 1AH0A 4FX7A 1F5ZA 4NJKA 1RV8A 4AZ6A 3M7WA 5C55A 4QEHA 2GK1B 1ME9A 1R85A 3TUUA 3E02A 1MEWA 1NH6A 3PSVA 3W4RA 4XKYA 1AG1O 1JQXA 3ZIZA 4LUYA 3W1TA 3CT7A 4M3PA 1ZCCA 4W89A 3ZSSA 1EC8A 4DUXA 5REQA 2VX6A 1HO4A 5F2GA 5LIYX 3LX9A 4H2CA 1MFUA 1UR3M 3OLEA 1XWYA 1EX5A 3AUOA 3WBYA 1UKSA 1E15A 4DBDA 1W3HA 3WEOA 4W8AA 4GG9A 4R3UA 4KFNA 4L4MA 4N6EA 1WQ5A 4K8GA 2GVLA 4JTGA 4A4AA 1JD9A 1Q4WA 1JPMA 3GU2A 5IXEA 4DN1A 3IARA 4O57A 4NY2A 1UD5A 1ECQA 4O4WA 2GQ3A 3S5OA 4O14A 2D3LA 3ABXA 1E6QM 5A6KA 4Q7IA 2BMBA 4QLLA 2PZNA 3APTA 3QOKA 2O7QA 3H12A 3R0UA 1TCDA 4JN7A 3M9YA 1DWHM 1O60A 4IIHA 2RUSA 2ZDRA 1HL2A 3ZVIA 3GNRA 4URIA 3TYBA 4H2HA 2HXUA 3N3MA 1UMYA 5FEPA 1SU5A 4MPQA 3M4HA 2C3ZA 4INFA 7REQB 1NSJA 4ZB5A 1B30A 4RW5A 5FF7A 2VR5A 1B9ZA 3OQ8A 3GHUA 2OO0A 3CEPA 3DU0A 2HZGA 3B8DA 4ADTA 1TWSA 3BW2A 1QAPA 4JN6A 1EL3A 3S2CA 2CBJA 3B9AA 1REQB 1S2VA 3TYCA 3UGRA 5H2ZA 2MUCA 5BOEA 2B31A 4MKSA 1JDCA 2EPMX 2J75A 3NQFA 5FOOA 1DJNA 2Z1KA 3VD5A 1SW7A 1WKDA 3SFKA 1S1RA 4U5IA 1WZAA 3FHAA 3FXGA 4Q8TA 1J2BA 4FZIA 4GYJA 1SM9A 4ZENA 1W8GA 3IPWA 3W28A 4K1GA 5A8NA 4RW3A 3A12A 3VOGA 3QVQA 2BNJA 3L0NA 1FWJC 4H8NA 2Y2WA 4YNGA 4AD2A 3UPMA 3WD2A 6ALDA 3DZ1A 1XD0A 4M5PA 1VIZA 2OTDA 1VB9A 1R0MA 4QROA 1WZLA 4KH2A 1GVYA 3T2OA 4GQBA 4KF1A 1WKFA 3AXMA 4REQA 2WO5A 3WBWA 3HQPA 2VYOA 3VA8A 4GUHA 2RFGA 2WSRA 4PCTA 3W7JA 2WSKA 1T5AA 2HISA 4XUGA 5MF5A 1FWNA 1VHCA 3GTXA 3STPA 1X8FA 1XH1A 1JYXA 1TB3A 3PTMA 3VINA 1XJBA 5A94A 1CXEA 3H4XA 2Y1HA 5FJOA 3TTYA 5KETA 3WQCA 1Q6FA 2PGRA 1V8EA 3H7VA 4XSLA 1XL9A 2C1HA 2V2DA 3H2EA 2NQ5A 1VFFA 4IJBA 1FOBA 1FWAC 1DQXA 2NQLA 2BS9A 2CNCA 3SAZA 1R3QA 3N29A 3G2GA 1CB7B 2BP1A 2WMKA 2FPTA 2GOUA 3IIZA 2R8WA 2WCSA 3S83A 2FVKA 4PMOA 3V5OA 1S2TA 2V5KA 4Z2JA 1YW1A 3NEVA 2BXYA 3MQTA 2VQUA 1BKSA 1O12A 1YDYA 4NT0A 4MWAC 4IP7A 2QEZA 3T7VA 4HZ7A 2V5CA 3PJTA 4JKMA 1ONXA 3AYRA 4S3FA 5JVLA 1Q6QA 1R2SA 4XD6A 3VFLA 5E93A 3N17A 1X1OA 2VL4A 1DJIA 1TTQA 1GK8A 2YB1A 4X0VA 1PCWA 1SO3A 2RJGA 4NZ3A 1XLAA 2OR2A 4RE4A 3LRKA 1JZ2A 1AFSA 4ERIA 4KS0A 4LC8A 4R9OA 1UOZA 1WDDA 3LSCA 2WZIA 4FLSA 3W1MA 2YLLA 3PJXA 3GTHA 2V3GA 4XISA 3HBLA 2OLSA 5FF3A 1SZEA 4RXGA 3W53A 2VCBA 1GVIA 1W6TA 1XV8A 5FAJA 3FYOA 1VFOA 1OX4B 4NKCA 1PKYA 1R3VA 4UBPC 3WQVA 2FJKA 5E6YA 3LHUA 4IXXA 3FX4A 4EXAA 2Z2BA 2R6OA 1O5XA 1XIDA 2V0TA 1JXJA 3BSMA 3TWAA 5C9RA 3WQPA 4YPJA 1HL9A 5C9UA 4LV9A 2X8RA 5A6AA 1M7XA 1NDZA 2D2GA 1VQTA 2OZ8A 1SJAA 1LTDA 3DUGA 4UOQA 3KUMA 1C29A 3KBVA 4C6CA 1DWFM 1KXVA 2I16A 1KBLA 3WLPA 3LRLA 1S5TA 1JAKA 1GZJA 3E9AA 4H8UA 1YMYA 2Y5JA 1EPVA 4A29A 2ZADA 3PM6A 5LGZA 3KBSA 2AL2A 3PJWA 1IIHA 2GJNA 3FN9A 2E3ZA 4BK9A 3S9YA 1JZ7A 3GNNA 3QF0A 4BHYA 3F03K 4LBUA 3CL6A 2JKAA 3BOFA 3B8TA 4PB4A 4GWEA 2VTFA 1PX8A 2ZC8A 3LXAA 1UP2A 2JF6A 5BW6A 2YL8A 5HATA 5A2BA 4M6VA 2VWSA 2Y4SA 3OO2A 3TYUA 4AB4A 1LUCA 3GDTA 5LA1A 2BVTA 1G67A 1EA0A 1UA3A 3IJ8A 1I4NA 3WQDA 1H0IA 3CAVA 2PLJA 2Z7GA 4L9ZA 1U2YA 1DIKA 4L9YA 3EOLA 2GDQA 3PK7A 1P0KA 4B2DA 3G1YA 2ZRUA 5LSMA 4GYPC 3W1NA 2PTZA 2WAGA 3CAKA 3AS3A 4DLMA 1WE5A 4RZBA 1NTHA 3NDOA 2Y61A 4JD4A 4U28A 4AXNA 3DKLA 3R94A 4I9JA 4OV4A 4R53A 1LL7A 3GW3A 5F1UA 3NYDA 3UY8A 3ZLGA 5F2MA 3AU6A 3L4XA 1JXKA 3FSTA 2BDQA 2YXXA 3KDOA 3U2OA 4B9ZA 5DMMA 3G24A 1UA7A 4MSSA 4JIEA 4E8DA 1ADSA 3DFHA 3AIRA 1OD0A 3C2VA 3CT2A 1H7PA 3O2LA 3LXCA 4KCTA 3HPFA 1KV8A 1Y5WA 4LGXA 5FI8A 3RO8A 2W6RA 2IXUA 4RV8A 5D03A 3SY5A 3OGRA 4XVDA 1NWSA 3H4WA 3PANA 3AIQA 2RH9A 4XAPA 2YDRA 1F73A 1OK6A 2TPSA 2VC7A 3S4TA 5A1AA 4V27A 2ZX5A 2BHYA 3BAKA 3KL3A 4N0RA 1XPYA 2BBFA 1P5BA 2PU1A 4A3UA 4UQ9A 4KEZA 4L4PA 3IGHX 3L4YA 4LVDA 6XIMA 4PTMA 1RHCA 3W88A 4Z1AA 2Z27A 3VILA 1GVEA 4D6GA 3DFPA 3RX3A 2V8ZA 1O1HA 1TRIA 3IJ7A 3U6WA 3ARXA 4M7SA 4ROQA 2CKRA 3AC0A 4K8HA 4ZQNA 3MHFA 1TPWA 3FA3A 1P48A 3KP0A 4K39A 3S9IA 4ZCWA 3ONBA 8XIAA 2EF9A 3K13A 4ZE5A 2G3FA 4Q7NA 1C91A 1H60A 4CCCA 4J3UA 1UB3A 2XJ7A 1HKKA 3CLWA 3LMZA 3P74A 2AOSA 1B0IA 3O7UA 2TSYA 1EBHA 1I75A 5ABGA 5HPOA 4LCSA 2HWGA 1ICSA 1OK4A 3YPIA 2R14A 4PCPA 1GEQA 4DUWA 2XPKA 3A5VA 2NT0A 4UOJA 4UTMA 4BJHA 2WJEA 5F2LA 3H8AA 3DKJA 1WOBA 5K7JA 3M0MA 9XIAA 3SDOA 1PYMA 3M46A 4JTCA 2ZA1A 3LPGA 3C61A 1UC4A 5HMFA 4AY7A 4C6MA 2VEMA 3VDHA 3WJZA 3RM4A 1RCQA 3KEHA 4JTDA 3PZNA 4B5NA 3P62A 2ZWYA 3CQJA 7REQA 1UG6A 1FUYA 1TV5A 4I9TA 4ROPA 3NL2A 1MXGA 1X6NA 3S2JA 2QCGA 1RY8A 1UR0A 2A21A 3ZZ1A 1AUSL 1V08A 3C0JA 4DM1A 4P5UA 2AAMA 1REQA 3TLQA 5FESA 3B8IA 3PZUA 4IGNA 3AQUA 4TXEA 2OG9A 2EAWA 2QAFA 1E73M 2O9PA 2QCHA 4WRHA 5HINA 2ZVIA 5D2WA 2QUMA 3OIXA 4YTUA 1N8WA 4J27A 3G22A 4NZ1A 1RLDA 2V3EA 4ZQOA 3S47A 1IEXA 1VC4A 1HX0A 2INEA 3RLGA 1L2UA 4LY4A 4PMJA 3AI0A 2VDGA 4O50A 5FIPA 1QMLA 5DMLA 4AWTA 1HNYA 2XINA 4JL2A 1KWGA 2ISSA 1TV8A 3T0AA 5D2VA 3WO8A 3MJMA 5CKSA 4UMAA 1OABA 4GBDA 3G6MA 4A2RA 3I4KA 5ABEA 1CYGA 1SYTA 4HOZA 4W7VA 4N9EA 3QM3A 1Y7VA 1FX6A 3STFA 2YW3A 3EX4A 1OZQA 4KCWA 4W9TA 4O1FA 4FF5A 3GXDA 4R33A 1K02A 4CN4A 2E09A 3ANVA 4QAIA 3RFAA 1EDGA 3G8RA 1ZALA 4D6HA 4JNYA 3R2GA 2VDHA 2NUYA 5DT5A 3AXIA 3WF0A 3WQ8A 4MWAA 1QI3A 5CGTA 3LK6A 1JD7A 4TMBA 1A5KC 1PS9A 1PYFA 4S3EA 1ISZA 2PCQA 3N73A 4AWSA 1PZ1A 3KCOA 2CLOA 3UXAA 8XIMA 3GZ3A 5AHFA 3VKDA 5A6LA 2G41A 1K4HA 3FK4A 4BFAA 4MJMA 1BSIA 1W31A 3OZOA 3VZZA 4CCEA 3AIBA 2WNWA 3SIZA 3I3BA 4JCLA 1C93A 3ARPA 3HV8A 1ISWA 1SO5A 2UBPC 2CZFA 2BLEA 3TN3A 1UD2A 2GPTA 3DFNA 4LSBA 3RK8A 2FB3A 2XYLA 1WDRA 3G3DA 1GCYA 1XQLA 2DUZA 2J8TA 2ADAA 4GY7A 3WH9A 5CBBA 4DWSB 2YCLB 3W37A 4GXWA 1HF6A 3BWWA 1JCLA 2GSHA 3UNTA 2ZX8A 3SJ3A 4RNHA 2CLMA 4B5XA 2BOGX 4JTHA 2VOMA 2XGIA 1E6ZA 5AYYA 5CZJA 1X7FA 3LB0A 4ZB2A 2Y0FA 5HUOA 2HS8A 1BVWA 2GLKA 1LBLA 5D05A 2WQPA 3TNBA 3AYTA 2YL9A 5HDRA 4BR1A 3A9BA 2AL1A 1XYBA 5FSDC 1DTUA 3VKAA 1TIMA 4FXFA 4LAKA 1R7OA 2J62A 1AQFA 2AKMA 2AAAA 4AIOA 4DWSC 4GH3A 4AY8A 1OX4A 4ZO9A 3IK4A 2HDJA 1X96A 5CJMA 3BLLA 1AJ0A 1SJDA 2ZRVA 5EMKA 3H23A 4AD1A 4UR9A 5M5DA 1C9WA 1OGBA 3G0SA 4YYCA 1UCWA 4QSFA 3BQ6A 2E8ZA 2QF8A 1R3WA 3FCPA 2VEGA 3ZFHA 5JQ9A 4A8LA 1P1XA 3E2RA 3DG7A 2ZE0A 1WCGA 4OV9A 4Y96A 3MP3A 1BVNP 4JPGA 3ARQA 4NL1A 3TP4A 1W9DM 3IS4A 5EMLA 2XM2A 1U1UA 4OOZA 4DX3A 3BDKA 1FBAA 5LNSA 4EE9A 3BGGA 3WUEA 1XRVA 1XBZA 2Z1XA 3W7QA 3CB3A 7A3HA 2HNHA 1J01A 3DFYA 5D2TA 1Z9AA 2VRJA 1RA5A 1VJSA 1UASA 2IKIA 1CGTA 3F5KA 3LQLA 2VGFA 3W26A 1A5UA 4HNVA 3R4IA 1LRTA 2PTWA 4HHPA 1KFJA 1I0BA 1EDTA 3MMWA 3HV9A 1CCWB 4JTAA 4D1JA 1L6YA 1IYXA 5JIPA 3A4AA 1EGZA 3D3FA 4GYPA 5DLCA 4IUGA 2ZUVA 1OYAA 3KVKA 2ZUNA 1AZ1A 3H54A 5JIWA 4GKTA 1H11A 4AYSA 1GPWA 4NAFB 3WJXA 4DB7A 3UWEA 4Q8VA 3FDGA 4HBKA 3MI6A 2QIWA 3CZKA 1GYNA 2PRLA 3M44A 5LHEA 2X2GA 5I3IA 4AYGA 4GGBA 3UA4A 4AUBA 3F4DA 1TCMA 3VIKA 2X05A 2OGYA 3VABA 2OYMA 2DU2A 3RYSA 3UZXA 3HG4A 1WXZA 3FFSA 4TVUA 1A5CA 1X38A 2X1RA 2ATSA 2EXOA 4GJ1A 3FV9A 2OX1A 1I6NA 2BV9A 1FHVA 3H55A 1RVGA 1DPMA 4ZFMA 1H5VA 2PDNA 1P6WA 1VFMA 3T8QA 2QMJA 2X7WA 5CLTA 1LDCA 2IPFA 8RUCA 1BTCA 3QV9A 3ZLHA 2WVVB 5XIAA 1F4HA 4M19A 3PBGA 3W2UA 3S6OA 2XSBA 5I3GA 1EUNA 2V5BA 1EXBA 3GLCA 1UP3A 2QJNA 3GXFA 2V5JA 3ZMRA 2PDIA 1QU4A 4G8TA 3UW6A 3O6CA 4DJEC 2WPGA 1J11A 1GJUA 5D9NA 1E56A 4GIRA 2ZCGA 1UUOA 1XYZA 3G1FA 1W1IE 4EIVA 4ML4A 2JF7A 1NWRA 1OCQA 4I90A 4J2PA 4UFKA 2ICSA 5TD4A 3VTRA 3O6YX 4XBJA 1H2JA 3UP8A 3IGSA 5EA9A 2OLHA 4W5ZA 3DEQA 4CQDA 2G4JA 3RCNA 1U22A 5HUPA 2BY1A 3W70A 4EP8C 2PDHA 2EPKX 4E8GA 1S3HA 4C7FA 3GNPA 2CLKA 4C90A 3Q65A 1D8WA 1OX5A 3PNUA 1O94A 1AL8A 2O4QA 1V77A 1E0UA 2J9YA 1DOSA 3IWPA 5C54A 5C71A 1FCQA 2V5LA 1E3XA 4AQLA 4N9CA 4PMDA 2VOTA 4PN2A 1THFD 3WIJA 2PSNA 4C6OA 5HULA 3LTYA 1H4PA 2ZWZA 2BZNA 1K8CA 1OGGA 5E0FA 4W85A 3SR7A 6TIMA 3GXNA 1J96A 3TYDA 2F84A 3WD4A 1LBMA 3HFYA 1SO4A 1KM5A 2J7GA 3CK5A 1Z42A 1XUUA 3MY9A 3CIWA 2HK0A 2J47A 4AF0B 3ORWA 1OWQA 3W7MA 3RRXA 1W91A 1GPFA 1W37A 4WJ8A 1V0NA 2GGGA 2Q3OA 1H0GA 4JFVA 1V0LA 3L12A 2YL5A 1LF1A 3K4AA 2P76A 4CCZA 4C7GA 2O4MA 3VGHA 3UPBA 4R5EA 2QHAA 9XIMA 3VE9A 3WQWA 1J5SA 4PULA 3PZTA 1XIMA 2GUYA 4HCHA 1JG9A 1QJWA 4GFIA 4LQ1A 4AD4A 3NOEA 1HQTA 2PLKA 4O1BA 2H3DA 1WDPA 4TX9A 1NP0A 5TF0A 3EGJA 5LIUX 4JQ4A 3M0KA 3V0SA 1XX1A 4RDYA 2OQHA 4JNMA 3UG8A 2IQ0A 3VOIA 1GG0A 1IZKA 2PWUA 4N02A 1KC7A 2PMQA 3CHFA 4D8AA 1UWIA 3EYPA 1HJUA 1QOXA 4PTNA 1WKEA 4H7VA 4O16A 1GTHA 1CPUA 3M0YA 1X98A 1VFUA 2VC6A 2PBGA 3OGVA 3O1NA 2QXWA 1ICPA 4BKNA 1D3GA 2WMFA 5D8ZA 2YDAA 1P1MA 3CL7A 2X40A 4MG4A 1UUMA 1GQKA 3D0CA 3A3WA 1JZ4A 2PC8A 4UWMA 2WJFA 1W5NA 4WJXA 1PXGA 4Q4RA 1GONA 4GVIA 1H49A 3WN6A 1VBUA 1S2CA 2Z28A 4N4PA 2JEPA 3KAOA 2WXDM 2VZOA 4PTVA 4RNJA 2IQDA 3SW6A 3VD9A 4RE2A 5K2ZA 3ES7A 4GCXA 4MB3A 2W3ZA 4K37A 1VD6A 2FZDA 4XSMA 1B3XA 3U2CA 2R1LA 1WYIA 5AC5A 4R9XA 3T4WA 1XI3A 4FOJA 3V1PA 3G0XA 3SGZA 5HMSA 1R3TA 4L80A 1FXQA 3NZPA 4GQRA 3QGAC 3K8LA 3WENA 4IPIA 2WNZA 1K70A 4DO7A 4JTLA 4FEZA 2O9TA 1H50A 5BRBA 1OVDA 3DGRA 3SQSA 1VFTA 3ARYA 1W0MA 3OYZA 3VIMA 1OT2A 3DFQA 2PDGA 2WB5A 4DWSA 3C2FA 2YCLA 1DXFA 1NQ6A 2ZVRA 2TODA 4AD5A 3DYPA 4Q8MA 3CUGA 4HU8A 4W8LA 3N19B 2PD5A 1DQUA 2PP3A 4HA0A 3GIYA 4UFMA 1S1PA 4S3KA 2B0MA 1R46A 2WZHA 1Y5VA 4GUFA 2E6FA 2X1UA 2XG9A 1TJPA 4K2SA 5KEZA 2QAPA 2HVOA 8CGTA 4KT2A 2DJLA 1SGJA 4WKHA 3AOFA 1A3WA 5C9XA 1QT1A 1MDLA 1V3MA 2DZTA 4JS3A 4NJIA 4E2VA 4LS2A 2ZRZA 3KOWA 4H41A 4JY8A 3G6LA 1TZ9A 2R1KA 4DJFC 4WLCA 2WJDA 3U8GA 5EYWA 7ENLA 2DPEA 2PPGA 1U83A 3HN3A 4AAJA 2TRSA 3WDPP 4UCGA 1F3TA 4A3YA 2V82A 4LB3A 1KFLA 1UZDA 1FXPA 5DRCA 3MT1A 1QWKA 3EB3A 4I8DA 3BLPX 1LWHA 4WSHA 3CBWA 1DJZA 4W87A 4KBXA 3TOYA 4S3AA 4XK2A 4X60A 4MOZA 1Z48A 3BC9A 4Z0SA 1AMYA 4W88A 1QPRA 3SUVA 3VCNA 5KSWA 3G77A 1J0JA 4O0ZA 2W66A 2ESCA 4OUIA 3GYEA 3TC6A 1H1ZA 5HMDA 1QO5A 1BG4A 1OC7A 2IQTA 1YKWA 1H5YA 2X2YA 4NZJA 5C5YA 4LAMA 4XBSA 1G4SA 3ANYA 3MUIA 3LGEA 1EPXA 3TTQA 3PZGA 3QFEA 4U2YA 4H8HA 3BCDA 4FK9A 5KITA 3TN6A 3SCNA 3P0XA 2QUVA 1UZ4A 4WGHA 4DBWA 4NAEB 4NG3A 2Z1SA 1RQBA 1JPIA 4HYRA 3CPUA 1O95A 5D9MA 1J5TA 1RY0A 4QNEA 4ZQPA 4EPDC 3GNDA 4LPCA 4R7OA 1EHNA 5D37A 3QZEA 4O12A 1IXQA 3OODA 2HE5A 4Q8NA 1NOFA 1W1A1 4N42A 4NJGA 4O13A 3CQIA 2C14A 1X8CA 4BZYA 1E1CA 3AO0A 1CGXA 4J5NA 4V28A 3T81A 1TPB1 1W9BM 1I2PA 4RPPA 4DJEA 1XKYA 4HQVA 3G8EA 1NAL1 3BV4A 1KRCC 4PMVA 4QCEA 4AMAA 3W7GA 4KQNA 1G9HA 3AXHA 1BG9A 3G18A 1W8SA 3RJXA 2OU4A 4U33A 2CEQA 2D0GA 3E5PA 1TMQA 4GPNA 2PFHA 2ZQ0A 3TAKA 1D3CA 2NX1A 1OF6A 3MKVA 2BG5A 3ZT7A 3DHUA 3EMZA 4XAFA 1SZGA 1BXBA 3V16A 4E8CA 2Y88A 4IHCA 5EPDA 4ERGA 1JF5A 1OC6A 2OZ3A 1VCFA 4F2TA 3LU2A 4O10A 4C5ZA 4KGJA 1R6WA 3UG4A 2Z0IA 4DXXA 1DQWA 3DHPA 3FA5A 1XLKA 3BW3A 1XLEA 3PPGA 3P7YA 2HJPA 4PCSA 3P60A 3VD3A 1IEIA 5TBOA 2XTKA 2V3DA 4PMUA 3PNZA 1JDFA 4L1WA 2VDIA 1WZKA 1C3FA 3LBCA 3WQFA 4E38A 1PWMA 3TSDA 4AW7A 4EPBC 1BF2A 1TKKA 3HM7A 3S42A 4K1WA 4UTLA 1IEQA 1EEPA 1ENUA 4M1BA 3DYMA 3R5EA 1RJPA 3LCGA 3KBJA 2OGJA 2GOKA 1OINA 3GW0A 4JTTA 3QHOA 5J04A 1E6RA 3GC4A 3SCWA 3Q4DA 1ME8A 2NX3A 1EHAA 2QCEA 1TO3A 2A6LA 3K30A 1CGYA 1F2JA 2W67A 4OBTA 3WQOA 4IZGA 4GMEA 4C6NA 3W7RA 2XVKA 2ZDSA 1T8QA 1GQNA 3TC3A 4P7QA 2FHCA 1V7AA 1HKMA 4WOZA 4Q3MA 5I5RA 1XF0A 1PTAA 3FJ4A 3ARSA 4W7WA 3UWUA 4LUIA 2NVCA 4HOWA 1GOIA 2X0SA 3W2KA 4AF0A 1VBRA 1F6KA 1TVLA 2Y7FA 2XVGA 3WZ0E 3U3HA 2DUXA 1ZU8A 4H9VA 4ZOBA 4TVCA 3RCYA 5DY2A 3ARUA 2VFGA 5CZTA 3GVRA 1F05A 3W7HA 2VC9A 3B8UA 5HWJA 1XGDA 3TU9A 5BXTA 2R1NA 4LAZA 1EJ7L 2VRKA 5GQBA 2QV4A 4A22A 3NNTA 2DSUA 1KQZA 4US5A 2J7EA 3T05A 1FDYA 1DP0A 1WBJA 1IHIA 1EO5A 1LLWA 4MHBA 3WH8A 1UWRA 4HN4A 2YBTA 3FGCA 4MZYA 3DH7A 3QXBA 2XISA 3NPUA 3H4GA 3JR2A 4XD5A 4XAZA 3VFCA 5JBEA 4U5KA 4LVFA 2UY2A 2W62A 4RJEA 1PKNA 3F2BA 4IFOA 2WKJA 4HKPA 1NQKA 4AD3A 3LBMA 1S3TC 1DIDA 1Q6RA 3R8RA 3L2MA 1FKXA 1XQKA 4IMGA 3A23A 3T08A 2CFFA 4FB7A 4MAVA 1N82A 1RP8A 3MBFA 2CIPA 4AG0A 2EJAA 3WEZA 3W9ZA 3ATYA 4HNLA 2XH4A 1XS2A 2BOFX 2JIWA 2CWNA 3BAIA 3ZJ8A 1HKWA 3SO7A 3W82A 2QUTA 2RDUA 4FMVA 2ZRXA 3W76A 3NUKA 5T9BG 2W9MA 2OMAA 4B5WA 3HPAA 6TAAA 3AHYA 3MCMA 3ZR5A 4DXKA 2Y85A 1VBGA 3VOFA 5EY5A 2QV5A 4UFJA 2VGGA 4XVEA 3KXQA 5IRPA 2BOEX 1IZJA 1F74A 4PCNA 5TQLA 1H7RA 3NXFA 1UR8A 3LOTA 3HG2A 1E43A 1ZP3A 1OIFA 3U4FA 4X63A 5IFTA 3TTSA 1UJPA 1AH4A 1C90A 4C6PA 3N2CA 4FI4A 1OM0A 4HJFA 3WLRA 4OBRA 3EX2A 2HCVA 4KIEA 1FVPA 3LBOA 5A6BD 3KTSA 2OSWA 1KV5A 4V1XA 1QW9A 4HA3A 5HQLA 2WMIB 2QNEA 1W32A 1FP8A 1S5MA 2PRMA 2DT0A 3C5QA 4AIEA 2FGLA 3E2SA 4Y8EA 4DZ5A 2J66A 1M6JA 3S1UA 4GVFA 2YL6A 2F38A 1UQYA 1KCLA 3CWNA 3RLHA 4PMYA 1VEOA 4YWIA 1YNYA 4LVAA 4HYVA 4LVGA 4MJ4A 3B9NA 4QLJA 5GJMA 5CG7A 4DJFA 5E9AA 3VGEA 3K5XA 3URAA 4HYWA 4HNCA 4NVTA 6A3HA 3K4WA 1AD4A 4ATLA 2D3NA 1E40A 1R3SA 3UCCA 3WFZA 2A3HA 1Q45A 4ICNA 2B7NA 1S46A 4Q4PA 1W3LA 6REQA 4UB9A 4ZO7A 2GQ8A 4UFLA 1CZ1A 4HN8A 2NUXA 1JDDA 1Q5MA 3PC0A 4FX6M 3SCOA 5SWUA 3MUY1 2PB1A 4QQ3A 1V6UA 4E6MA 1TG7A 1TA3B 3UF9A 2WZTA 1B31A 3G1HA 3M5XA 4UTTC 1R9YA 3B8VA 2LLEA 2IS7A 1FHUA 3AS0A 1XH2A 1EQCA 2IXVA 4ATDA 4JYDA 4AVNA 1GZGA 1U5JA 3DX5A 3INPA 4HTBA 1QPNA 3LNPA 2MANA 3MO7A 4H7ZA 3N25A 3RPMA 3QGKC 5BXRA 3VC6A 4QAWA 3OPSA 1JCYA 1B1YA 4JFSA 3GIQA 2TYSA 1DORA 4I7WA 4DYEA 5F7UA 4J3TA 1Q13A 2J78A 3UWVA 4O15A 1OG6A 2PTDA 5CJ5A 4IIFA 2VX7A 1GVOA 1DHKA 3S3GA 2X1SA 1GJPA 4GUGA 3GS6A 2CITA 5I78A 2VT0A 4DRSA 1RQEA 1Z3NA 2P3ZA 5JH2A 1XBVA 3I10A 3USBA 3AXXA 1GKRA 4HMEA 1IWBA 1R2TA 4YHEA 1EJUC 4S3GA 3I6RA 1HUVA 3H21A 1GYLA 4NAEA 2BVDA 1WB0A 1JDAA 3KBNA 3VNJA 4RR4A 2QZRA 3NVDA 3RX2A 5JXQA 1BGGA 2GYIA 1FWHC 2DFAA 2PDXA 3MWAA 5AC4A 1TE6A 3VNZA 2P53A 1BFNA 2OPJA 5FD0A 3LYEA 3QW4B 2QGHA 5JH1A 4WGXA 2FPVA 2X0HA 1RUSA 2JIEA 3UZZA 2ACRA 2C0AA 4ES4A 1PO9A 4WZHA 4LBSA 4C6LA 3Q94A 4CD7A 1W9VA 3NO1A 2A79A 1IR2A 1DIEA 4LCRA 5T91A 5T26A 4GXPA 3EWDA 4JBRA 3UU0A 3TFCA 1Z32X 3MI3A 4ZOCA 4IGMA 3W85A 3I7RA 2VXNA 3DIPA 3QSRA 2ACUA 3PBMA 2BSLA 3BUVA 2Z4GA 2E28A 7XIMA 1OADA 3OG3A 2PDPA 3N34A 3OA5A 3UCDA 2HTMA 2POTA 1POKA 4HPGA 3KVJA 5DO8A 3ZT5A 4BF9A 2VHLA 3WK2A 3CEUA 1ZNNA 4IIDA 4B5VA 4D6EA 3ARZA 3KS5A 4PBGA 4S2CA 4OJYA 3WLQA 3WLJA 4NXKA 4FNTA 3NCOA 1ODZA 5CEWA 4QDWA 3WQEA 3KL0A 5F1VA 2OJPA 3TYZA 1K8YA 2QDEA 1SVDA 3K8MA 1BWKA 2R94A 1L0PA 4D2JA 1YE4A 1CB2A 2VGIA 5AC6A 2DH2A 4FSAA 4WY0B 2ZRYA 1E6SM 2GUBA 4DJDD 2CLEA 4N9BA 4GGHA 1M65A 1RCXB 3UT0A 2E0PA 3TW9A 4NYUA 3NPVA 2OODA 1DVJA 4P2VA 4AHPA 4B16A 3M16A 5DXXA 1V6TA 4O1CA 2ODOA 2NSOA 4DUOA 3VE7A 3B0XA 3NFUA 3UNDA 3FAXA 1Z69A 3WF4A 1SJBA 2WMGA 3N18A 3O0KA 3SN1A 4GI9A 5CSUA 1VAHA 3CAQA 5I3FA 1OFDA 4HCLA 1MUWA 3MCNA 2OT0A 2GGIA 2Y7GA 4GQQA 3NSXA 4PZVA 1MO0A 3KRSA 3W71A 1TX0A 3TN5A 3QV8A 2Y7DA 2D23A 1NELA 3KWXA 1T99A 4MKVA 4AEOA 3K1DA 4M29A 4KWSA 5EMJA 1E1FA 4ZO6A 3W73A 1T7LA 2VEPA 2ZTKA 4WEVX 2PDFA 4TV6A 1WXYA 4ENLA 4O54A 3LI0A 1LCOA 2F6KA 4JHMA 1QHZA 4XKYB 4WQ6A 1NEYA 1JI2A 3LHVA 3PTDA 4EAMA 4L6OA 4G1KA 4UTUA 1DWAM 1JYVA 5FL1A 3GVVA 3IK2A 1IZCA 4JQ3A 4XBKA 3I7QA 1LYXA 1UPPA 1XIIA 3OP2A 3E38A 1W2PA 3UJEA 3OLGA 2DDXA 5HK4A 4HMDA 3NL6A 5DX7A 4I6KA 1TV4A 1WNOA 2XH2A 4L56A 5EU9A 4EXBA 4O0KA 3TQPA 4RE0A 1PSCA 4WK9A 3LCLA 1TUXA 3C0QA 4FNUA 4DO6A 4OWGA 4UQDA 3TCSA 3O06A 3F4WA 2E1WA 5ABTA 1KTBA 3VNMA 5CZ0A 1VR6A 3KCLA 4RK8A 3B0YA 1JPDX 3WBAA 3ZSTA 4TMCA 3KRUA 3SUSA 2ABAA 2BY2A 2Z1BA 3AIWA 4A8NA 3AMDA 4WXZA 1M9HA 1YPFA 4OKDA 4HNUA 1WPCA 4WOQA 1CTNA 4F0SA 2DZSA 1RD5A 4P7NA 4ZSUA 3KLKA 4IMAA 3H7UA 4AX6A 1JZ8A 1EOKA 1Q8AA 2AQWA 4E3TA 3TA9A 4JEQA 5FF2A 1QNSA 3O05A 5I06A 3G1RA 2OSYA 2YFOA 2W5FA 3N12A 3WUFA 4PMXA 4C6KA 1JRCA 1NWTA 4GQ0A 2PWFA 4Y6GA 4ZVJA 6XIAA 3KHJA 2WWCA 3E0VA 2FH6A 3V0UA 2NQHA 2FJUB 2NSXA 3PPCA 1O6IA 5C6MA 3HZ3A 3RLVA 4JHZA 1RXOB 3HF3A 2NWSA 4UOZA 4O28A 5XIMA 4IXHA 1UKQA 1KM4A 4DO5A 4FALA 2Z2UA 2YX0A 3GZAA 3KLLA 4FIQA 2QS8A 1XIHA 3O6AA 1VYRA 3T78A 1UP0A 4XX6A 2WSYA 3WBXA 3IIXA 1EWDA 3W87A 2PDYA 4NF7A 2XIMA 2I56A 2PGWA 4LYKA 3NQCA 1B57A 1DXIA 2ZUWA 3I6TA 3KBMA 4Y9MA 4HTYA 1E0WA 2IW0A 5FCZA 2QVNA 3KP1A 1P7TA 3CUXA 3LHYA 1I2OA 4G2DA 5JBFA 3V5FA 4BI7A 1E71M 4CNOA 4IQLA 2Q6ZA 4GI8A 3NQAA 1V3IA 1Q2SA 2HBXA 2Z00A 3QQ1A 3WDHA 3CLMA 1LT8A 1E6XM 2CESA 2XIQA 1L6SA 2YCKX 4C6DA 2EPOA 3W7OA 3NEHA 2BY3A 3VOCA 3H2MA 2OX4A 2B7PA 4UFIA 1R3YA 4UTTA 5BXPA 2IPGA 3DXIA 4BF5A 3VMOA 2PDJA 1YLVA 4FLQA 1ECEA 4H19A 1EOMA 1GNXA 4AY1A 1T6MA 1EQPA 3Q45A 1CLXA 3U2ZA 4EACA 3GE7A 1W3IA 2EJ1A 4LXFA 5L6UA 3FEMA 4PR4A 3RR4A 1GQLA 1TA3A 5T9CE 4E3VA 5CLWA 3GTIA 3RPDA 1HT6A 4MTVA 1P0BA 3A13A 2V2HA 4H9UA 3S6DA 2BXVA 3O07A 1KFWA 3DENA 3AIUA 5B80A 2X7VA 4CVWA 1TR1A 1VZWA 1UWUA 1W3JA 3PZOA 5C8BB 1VPXA 1ZAHA 1A5OC 1HZYA 1MSSA 1XFCA 2FMNA 3N4EA 4ZZ9A 1DE6A 3ERPA 3EDKA 2Q8LA 1MNSA 1ZRQA 3PR2A 4J3SA 1A5AA 1UIPA 4MB5A 1PZ3A 2E5CA 1FWRA 3IJQA 4GCAA 3QMTA 4YWSA 1W5OA 2OYLA 4ACZA 2Z24A 1TREA 3LQGA 3UA3A 3AHXA 1SSGA 3DHDA 3JVAA 3KM8A 2E67A 2PWDA 1E6NA 1TV3A 4I9MA 4ZFCA 1EA9C 5I6SA 4HPJA 1R2RA 1TWIA 1JULA 3C6CA 3R79A 2NV9A 1Q3NA 3WF2A 3MZNA 3P93A 4YXGA 5CZKA 4I5XA 3BQ5A 3C56A 9RUBA 1IIGA 1RPKA 1NOWA 1E0XA 4JTJA 1YPIA 1QK2A 4YMZA 3QPYA 1QPKA 2A4AA 1B2YA 3AIVA 3OBEA 1CXFA 4DO4A 1VS1A 1NJJA 3AWNA 4DLFA 1MW0A 1XRTA 1QNRA 2YCIX 4DF2A 3DC0A 5BCAA 3ITCA 3D3AA 3QRHA 2AL2B 1CNVA 3KTXA 1OX6A 1UYQA 1O66A 2D1ZA 2DW6A 1VLWA 1KGWA 1ZUAX 2PTXA 4V1YA 3UY7A 2YW4A 3CZLA 3F2DA 2HK1A 1XLJA 4AZCA 4L1GA 3MHGA 5A8OA 4ONVA 3GHRA 4RE3A 4YCOA 5EFFA 2F2KA 4KEVA 4WDTA 3JZUA 3AYSA 2EBNA 5JBDA 4WSJA 4Q8PA 5K9DA 1Q8JA 2WCGA 1XGZA 1WDWA 2WQDA 3EPMA 2QW5A 3VGGA 2HPMA 3KOXA 1SFSA 2CZDA 1SMDA 3UJSA 4Y9OA 2NXHA 2HVNA 4J3WA 4LJ3A 4KWOA 1L8PA 3W2JA 1XSJA 5I09A 1V0MA 1PTGA 3EDDA 3MSRA 2QQ6A 2DQXA 4F9JA 1UQZA 1O5KA 4IF2A 3GIPA 1V79A 3NZQA 5BMXA 5C2XA 3UZJA 3LRMA 4ZB0A 1WA3A 1DHPA 2PWVA 4WDUA 1TPH1 4N4QA 4WKFA 1YXCA 3DG6A 1ZCOA 5CSRA 4IFRA 3ONCA 4WY0A 1VPYA 2IKGA 1SW3A 1XDMA 5K4XA 1JUKA 4BEQA 4OZOA 1J10A 2X0YA 4H8VA 4DF1A 3VVGA 2HBVA 3PUOA 1B90A 4H7CA 3LS9A 2R82A 4XO6A 5AC8A 3GHSA 1CXKA 2VD8A 3N3TA 3RCMA 1W1YA 3C4UA 2FTWA 1CDGA 1U5HA 5T8GA 3AS1A 3OHMB 5C2GA 2WZMA 4FLOA 1IXPA 4JOMA 4ML9A 2E7FA 3U2EA 1LROA 1UZHA 2GSJA 4PUDA 4QX4A 4UIOA 1TTIA 4DVOA 3GRIA 1V4YA 1AQMA 3CHDA 3H6OA 3SCUA 3HJEA 3UG5A 3PZVA 4QGCA 6ENLA 5C70A 1N55A 3V0TA 3CHVA 4I5RA 4L9XA 1H7NA 4RX0A 3OZMA 5CC6A 1GW1A 3FKRA 5G2IA 4J3VA 3R8HA 2ZZ4A 1S2WA 4IICA 4QJ5B 3VKKA 1R86A 2GQ9A 3LV5A 1EWEA 4LT9A 3WSUA 3BG9A 1XXXA 2A7PA 4JIRA 1ZB5A 2NT1A 1XH0A 2CERA 3BOXA 3M1ZA 1NFGA 1RALA 3LCWA 3TJLA 1U5VA 5IOBA 3O6DA 2BHUA 3ITTA 1L2QA 3T0CA 3BARA 1QNQA 4NJJA 3M0JA 4LAOA 2PODA 1QOQA 4IP4A 1VJIA 1PEZA 3MI2A 3IJ9A 3GK0A 4PL1A 3ZYZA 2DORA 2QF7A 4O8AA 3EB4A 5BROA 2FZBA 2R9RA 4PUUA 3KW3A 1H51A 4UUIA 3V7PA 4F48A 4JY9A 4CNSA 1PV8A 2J74A 4JTRA 4A21A 2CLPA 4UNIA 3GC2A 1J2WA 1NVMA 4XZNX 4NU7A 4UCFA 3CYJA 1EX1A 4C7DA 4G6CA 2A3BA 1TSIA 5D30A 2GGEA 2P8CA 2VCCA 4O4VA 4PEEA 4JQ2A 2X1IA 3O63A 5AFDA 5FEXA 5D2XA 3OB8A 3QGVA 3PP7A 3OEXA 4JZ5A 3DFSA 3FEQA 2JGQA 4N7QA 4HU3A 1GOXA 2A3EA 3WNNA