4M8UA

The structure of mall mutant enzyme v200a from bacillus subtilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
559
structure length
559
Chain Sequence
b'SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDAIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPERADLKSISLKPYEAVMGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 230
structure length 559
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m8uA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m8uA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m8uA02
2A3HA 3N17A 5ECUA 1E5NA 1A3HA 3SURA 5JBEA 5BXTA 1OD8A 1H0GA 4N0RA 2XVKA 3CGTA 4H7VA 2V3GA 2VZUA 3WFLA 2XN0A 2XIIA 2XWEA 4ACYA 1WDPA 3AMCA 2QV4A 4NX0A 1CGVA 2C7FA 4AZCB 3W29A 2GDUA 3EDDA 4D72A 3W0KA 5I77A 3VIKA 2GJPA 5ABFA 2VT0A 3EDFA 1E6RA 1XH1A 1LL4A 3CZLA 1JYWA 4CN4A 2YKKA 1UD5A 4E8CA 4IUGA 2J79A 3FXYA 3LRKA 4GO8A 3CZEA 3D4ZA 1X6NA 4U2ZA 4KRTA 4GO9A 4OOZA 3W82A 1JZ3A 3LXAA 4AYSA 1JZ6A 2DSWA 2YIHA 2V3EA 1GQJA 4MTVA 2WMIB 1RP9A 1BYAA 1QOXA 3NYDA 1MXDA 5DEZA 2J7HA 1XSJA 2XN1A 1V02E 1UH3A 4BF7A 2HISA 2VR5A 3AMKA 4UQDA 1CXLA 1B3WA 2FHCA 1LG1A 2ZIDA 2G3MA 3I3BA 4WF7A 5D8ZA 1V08A 3W25A 4CVUA 1DP0A 1V6UA 5CXPA 4HZ8A 4MB3A 5A6BD 4ZE4A 3TONA 1BAGA 1JZ4A 1TFVA 5C71A 1JZ7A 1GCYA 5IHRA 4HA4A 4P8XA 3CV5A 3WH6A 2Y2WA 1QHZA 2Z1SA 2WK2A 5M5DA 3ZT5A 4E8DA 3L4ZA 1U2YA 1VJZA 2XFRA 4UOJA 3RPMA 3M07A 2W67A 3THCA 4BA0A 2YFOA 4NRSA 3MUAA 5E1QA 1HF6A 1BSIA 2QF8A 1BQCA 2WHLA 1UR9A 1UWTA 5A6MA 3HU7A 7A3HA 2X2IA 1N82A 4CD8A 3HJEA 4LQ1A 4P8VA 5FL0A 4H2CA 3RM9A 1E0WA 3WY4A 4HA1A 1CIUA 1WDSA 1W9DM 3GNOA 4MNLA 1V0NA 5D9PA 4GZEA 1ZJBA 3WFZA 4NF7A 1C8YA 4GI9A 3GNPA 4WKFA 1B31A 1DWGM 4GZIA 3VTRA 3VMPA 2EO7A 4GZJA 5AC4A 2ZX6A 2NSXA 4V27A 7TAAA 3KLKA 2CBIA 2OWXA 4IM4A 1DHKA 1ISZA 2XG9A 1EDQA 4BQ2A 2EEXA 3QOMA 3SCPA 3T2QA 5A2CA 3ARRA 5DFAA 4JFSA 1EH9A 1HWWA 2PWFA 3ARSA 2DIEA 3PHAA 3JUGA 3RM8A 3VIJA 1UA3A 2GJRA 3PTQA 4PMDA 2F18A 1XH0A 3WY3A 3ZT6A 3DX1A 1E72M 1VRXA 5GNXA 2Y4SA 3AIRA 3MU7A 4RE2A 3WL0A 4J3TA 1EDGA 4XZBA 1GQIA 3A4XA 4DM1A 2YBUA 1VJSA 3KL3A 1EXPA 3SCUA 3OA5A 4NRRA 3DDFA 1SMDA 4J3VA 3EDJA 3N9KA 1UR1A 4EAMA 8A3HA 1LLOA 4DO6A 2ZE0A 2VX7A 3T2OA 2WMHA 3UR8A 3SCQA 1UWQA 1PZ3A 1V3KA 2NT0A 1GJUA 3NCOA 3GZAA 3CMJA 1TQTA 3TTYA 3BUQA 3AIQA 1J0YA 1OT2A 2GFTA 6TAAA 1C8QA 3K8KA 1QI3A 1GOMA 1BLIA 1J0HA 4MNKA 3CHFA 1NARA 3L4TA 4BQ3A 1XH2A 4D6EA 2ZXDA 3ZSSA 2GDVA 4NI3A 2OSXA 1RP8A 3CZJA 2DT0A 3EMQA 3BH4A 2VX5A 5AYIA 1KGWA 1QI5A 3VIMA 3G6MA 1W2VA 4W87A 1D3CA 3T09A 2WCGA 1KXTA 3VIOA 2WSPA 2O9PA 2W91A 4AD5A 4PRWA 2ZUVA 3EDKA 1RH9A 3M7SA 3APGA 4JFWA 2YBTA 4OBRA 1JZ2A 1E43A 1V3MA 1JYVA 2DH2A 3GXIA 2OYMA 4PTVA 4PMQA 2VOTA 4AZHA 1VBUA 4HMEA 3GXNA 3VIHA 1RPKA 4YHGA 5BXPA 1E4NA 2J74A 4FNTA 3BVVA 4W7VA 1JDCA 2D1ZA 4TVDA 3GXPA 4ATDA 4D6GA 2FDMA 3OZPA 1WB0A 5EBAA 2QPSA 4P7OA 1UD8A 1OIFA 4HMCA 2DT2A 4W5UA 4CD5A 1BGAA 2F8QA 5HOSA 2WB5A 1W9UA 2VRQA 5EMYA 3HN3A 2DT3A 3ALFA 3WD4A 1A47A 3NSNA 3WDPP 1FFQA 5A8NA 2CBVA 3GNRA 4DUXA 4GQRA 5BYWA 4N42A 1G01A 5CLWA 4U5IA 3CZSA 4C7FA 1TQUA 2F1AA 3FAXA 2BVTA 2W5FA 5IDIA 1WKYA 1KCKA 4A4AA 1E40A 3N15A 3MKKA 5E09A 2V3DA 3BUPA 3MI6A 4CU8A 2AOSA 4J3WA 3BVUA 1JF5A 3OGRA 1JZ8A 1UWSA 1PPIA 1K9DA 4DUVA 1UD6A 3VSUA 4UQBA 3ARUA 2V3FA 3W38A 3VOCA 1E6ZA 3EYPA 3BMVA 4GI6A 2WPGA 2EABA 3AZRA 2Y24A 3GH7A 3L4XA 2CEQA 1GQKA 3SCWA 1B3XA 1JD9A 1B3YA 4WK9A 5A6AA 4GQQA 2X2JA 2F7QA 1G0CA 3OIHA 2XSAA 5EFFA 3NSXA 4DM2A 5HDRA 4FMVA 2WVUA 3BSGA 3OZOA 4HOWA 4WLCA 4D6JA 4HA3A 2WC4A 3WNMA 2CXGA 3I3EA 4P7RA 1E4IA 1ZBWA 4TUFA 1CLVA 4M1RA 3RCNA 3SCOA 2DQXA 1W1TA 3A23A 1AMYA 4B9YA 1ITXA 2J77A 2E8YA 2Z1KA 3A4AA 3CZGA 4XUYA 4PCSA 4FLQA 4Z2KA 3BAKA 5LYRA 3CUJA 4J3UA 2VCAA 1I1XA 1Q6DA 5E9AA 1EOMA 1W1PA 5GQBA 3L2LA 3NDZA 4EK7A 1L0PA 3BLBA 4EANA 1KQYA 3LPFA 2JF7A 3VDBA 3WDHA 2O9RA 1CLXA 3LXCA 4PTWA 1KTCA 3OB8A 1KBBA 3WUGA 3A24A 4QLLA 4MDOA 2ZXAA 3HZ3A 3ZJKA 1M7XA 4LGXA 3CC1A 1UR0A 3VD4A 3D3AA 1VF8A 3QR3A 3VDCA 3F5JA 3SCSA 3WF1A 3WQVA 1JIBA 4JZ5A 2CCRA 2WWCA 4IPNB 3LPPA 3OLDA 1KQZA 1B0IA 1XYFA 4QLJA 2F7PA 1CXEA 2V38A 4GIAA 3U5YA 3T0AA 4CVWA 4CN1A 3GYCA 1UH4A 4UFLA 3BAJA 2YA0A 3MV01 1KGXA 4M29A 4P7LA 3DDGA 1UG6A 4CD6A 4UNIA 4WJXA 3DHPA 3E1F1 5JIWA 3NDYA 2BY2A 4H8UA 4HTYA 3W37A 1EA9C 2XVGA 4V2XA 2DH3A 4WSKA 2D2OA 2XN2A 2CBJA 3CHEA 2X0HA 1HKKA 1O6IA 2WZIA 2CKSA 3WF2A 2YJQA 3D50A 3VNYA 4X0VA 4OUEA 4EE9A 4DWSB 4HP5A 3DECA 2BXZA 3VX1A 1MQRA 1BVNP 3D51A 1RD6A 1VENA 4Q22A 4U33A 5ABEA 2V5CA 2VVNA 2CKRA 4KGJA 1DWFM 1HKJA 1J9YA 2WYSA 3EJUA 4H8HA 1J0JA 3A21A 1MQPA 1QX1A 1HL9A 2WNWA 3SIMA 3NJ3A 3DHUA 4CCEA 1R7AA 2BVDA 5GPRA 1UWRA 2XTKA 4M8UA 2D20A 4RL3A 3WUFA 4AXNA 3M46A 1R85A 3WH9A 1SR0A 3BAXA 3CTTA 4AD4A 2YL9A 2VC9A 2VURA 2VCBA 1JFXA 2JALA 3CHDA 4LYQA 1HP5A 3CH9A 3I3DA 1R8LA 1MW3A 1E56A 1KTBA 3WF0A 3RJYA 1W3LA 1UZ4A 4OOUA 1CXIA 5CSUA 4UTFA 3F4VA 1E9LA 4GPNA 4OJYA 3OLEA 2WMGA 3IGUA 3H53A 1DWAM 3VGDA 2E3ZA 1MW2A 1QNOA 4PUDA 2VQUA 4LYPA 1JD7A 3WY1A 3BVTA 5LA1A 1UH2A 1QI0A 5FKYA 1NP2A 1B90A 4R5EA 3HMCA 4WKHA 5BCAA 1GHSA 1EHAA 3AHTA 5CLTA 1CENA 1XSIA 3GM8A 4NSBA 3TP4A 4ACZB 4AZGA 1OB0A 2E9LA 3POHA 2ZX8A 1FA2A 3VSTA 2J75A 4CCCA 1GOKA 1GOOA 3BXWA 2ZXQA 1BYBA 5AYBA 3PN8A 1TVPA 3MANA 3WH5A 2G3JA 2XWDA 1F4AA 4BZYA 1SYTA 3ARXA 3VMNA 3LPGA 4XX6A 2UY2A 1XCXA 4MDPA 2DDXA 1BF2A 3AHXA 3VM5A 1HTYA 3IJ7A 2BY1A 4JCMA 3K46A 3VD7A 1J18A 4PMRA 4ZXOA 4LX4A 1LG2A 2W66A 3AYSA 2OWWA 1UD2A 3OLIA 1UOKA 1HNYA 2FH6A 1GNXA 1JL8A 1UR8A 1VB9A 4OZOA 1C92A 3WQ6A 4TX8A 1AQ0A 3W81A 1E6QM 4B3LA 3RO8A 2G3NA 2DPEA 1M53A 3PZOA 3RMEA 1WP6A 3W24A 1DWHM 1F4HA 5A2BA 1Q6EA 2WLYA 4W8LA 2CPUA 1V03A 4YHEA 2OLHA 4Z2GA 4AY1A 2WMFA 4W88A 1JAEA 2WXDM 4CU7A 4BQ5A 3ZR5A 4B15A 2ZUMA 1HP4A 1ISXA 1DWIM 4R27A 2X2YA 1PIFA 1LL7A 3VSVA 3GH5A 2VZTA 1XRVA 5A69A 4D71A 2PWGA 2WMKA 3BVXA 1NP0A 4W84A 3ARPA 2JF6A 4GINA 4AZBA 5LA0A 2GUYA 1ISVA 3OGVA 3WMBA 3W26A 4KH2A 2C0HA 1XSKA 4NXKA 1BFNA 1C7SA 2DGAA 3PZ9A 1R86A 4YPJA 3A3HA 3VMOA 2YA1A 4EKJA 3AZTA 4AC1X 4UOZA 3VU2A 1TE1A 1QNQA 3OBAA 1U30A 3BLPX 5A95A 4CGTA 1UR2A 4H41A 3D4YA 1C3FA 5I5RA 2A3EA 2CESA 1TMQA 1GQLA 1HJWA 4PMNA 2GK1A 2D73A 2AMGA 5ABHA 1J01A 2BY0A 4J28A 5DO8A 5CGMA 1PX8A 3RM4A 1BG9A 2OSWA 3WSUA 2EAEA 4MAZA 2WM0A 2WSKA 1GZJA 2OW7A 3LRMA 1TVNA 4A3YA 2CIPA 2CERA 1BG4A 1H5VA 3L4WA 3WQ5A 1O7DC 1YHTA 5ABFB 2J7CA 1X6LA 4JAWA 4QFUA 4W89A 3M6DA 2WHMA 3WNNA 1HJUA 1JDAA 5BXRA 3PZIA 1E70M 2J8GA 5CZKA 1WPCA 5I23A 4PUEA 2VQTA 2UY3A 1GVIA 3MUY1 3CUIA 3AISA 4JCLA 1V0LA 3VGGA 1GPFA 1ZBVA 2X1IA 4LYRA 1B3ZA 3AICA 1V02A 1XD1A 1BGGA 1M03A 1UQYA 4U5KA 4PSRA 1C91A 1JAKA 4S3JA 3SUUA 3WD3A 1H0IA 1V6VA 3PBGA 3PTMA 1C7TA 2J25A 1CEOA 3KLLA 1ECEA 2IGTA 5DF0A 1E0XA 1E6XM 1OGGA 4UQ9A 1K6AA 5TD4A 1TA3A 1HX0A 3KL5A 4U3CA 4QP0A 5BROA 1U33A 3VDAA 3MV11 1FH9A 5A8PA 3BGAA 4AMXA 1AVAA 2G8ZA 2O9TA 3ARQA 3IK2A 3KWXA 4H04A 3AS1A 1H09A 3VIPA 3VD9A 3A6OA 4PTMA 4TOQA 2YOCA 3VX0A 4AW7A 1CZ1A 1CGXA 2D0FA 4F66A 2UY4A 2EPMX 3AFBA 3WQWA 2WVSA 4QDMA 2A3BA 3GBEA 2WBKA 5DT5A 4C7GA 3PTKA 1B2YA 3FY1A 1X1NA 1OSEA 1NOWA 3VVGA 4MNJA 4LXFA 3TOPA 1E1EA 2WMJA 5CPSA 5DMYA 4M81A 2ZWYA 2Y8VA 1HT6A 3ZJ6A 4JFTA 4DO4A 3OGSA 1BPLB 1XYZA 3WEMA 1GOIA 2XUCA 4DWSD 3NSMA 4WSJA 5A6BA 3D5HA 4JHOA 3BUBA 4JKKA 1W9XA 2WZEA 2D23A 2XVPA 4MPKA 3F5KA 3CZ8A 3AI0A 4JL2A 6A3HA 2WHJA 2F7RA 3MUIA 1W2PA 4P8UA 1W3JA 1KWKA 5CPQA 1HXJA 2VNCA 1UQZA 2IXVA 5I2UA 3T2PA 3W4RA 2W92A 4PTXA 1XGZA 3N18A 4D6CA 3DX4A 2ZUUA 3WDIA 1W3KA 3WNPA 1ISYA 1ZBKA 3WH7A 1UKSA 3HG2A 2XJ7A 3OLGA 1B3VA 2XHYA 3QHOA 1V6WA 1EGZA 1WZAA 2EPLX 1KXQA 3AHVA 3S5YA 3DYMA 3IJ9A 4FNRA 1UR4A 3AOFA 3PZGA 2O92A 4TX6A 2D24A 3K1DA 1V6XA 4PMUA 2X05A 3PZTA 4AZIA 5M03A 2FGZA 2WVVA 2Y5EA 2GJXA 2YL6A 1NWSA 2J7BA 1VAHA 1R47A 2BHYA 1QHOA 5LA2A 2X2HA 3EBVA 4DWSC 1UKOA 1TQSA 4FNUA 3WDJA 1OM0A 2YL8A 3DC0A 3VUPA 1WZMA 2BHZA 4W8BA 1E55A 2PB1A 5KZ6A 1CXKA 1W9BM 3TTQA 3O6AA 3S6TA 2A3AA 3NUKA 1JXJA 2E0PA 4GI8A 1R75A 1Q6CA 4ATWA 4X0NA 1Q4NX 1KXHA 1E0VA 1QNPA 2VX6A 2B31A 4AZ5A 1CGYA 2V5DA 3A5VA 4PSPA 4CN6A 3IAQA 4PCTA 2W62A 4ZENA 1MW1A 3AJ7A 4RE4A 1LWJA 3QGVA 1BYCA 2WC7A 1CYGA 3WELA 5D8WA 2W61A 1BTCA 2JFEX 4QCEA 4J3SA 1C93A 3WUEA 4FNQA 3CPUA 5D4YA 3MMUA 1TQWA 2DT1A 2CHNA 3TA9A 4FNPA 3RILA 4UQCA 5E6ZA 3O9NA 5FL1A 2PBOA 2E40A 1NOUA 5I78A 5I6SA 1FH8A 2EXOA 4J27A 3W28A 4TXEA 1CECA 4UCFA 2WWDA 1QI4A 5HPCA 2PI6A 1MYRA 4XB3A 3CZKA 4DO5A 2D3LA 3VNZA 4OKDA 1MQQA 2E9BA 2RGLA 1UHVA 2ZICA 1IT0A 1O7AA 1QW8A 3BUDA 1H49A 5D9MA 2BFGA 3VKKA 1JNEA 4OBSA 1QBAA 3UETA 1WDQA 5FOOA 1ESWA 4F79A 3WBEA 4TVUA 1UKPA 1VFFA 2J7EA 2YLLA 1IZJA 4OGZA 2WVTA 4FLOA 1FP8A 4F9DA 4JFVA 1GONA 1HVQA 1G5AA 2G41A 2VZVA 1EO7A 1SZNA 4E4PA 3SCTA 3BCDA 3W6LA 4J3XA 5HXMA 3K8MA 2PWEA 4M80A 3L4YA 4UZSA 4E2OA 3GTNA 1R33A 2JEQA 1CGWA 3WUBA 2EJ1A 3GXMA 3ARZA 1K9FA 4HU8A 5C70A 1HJXA 1K9EA 4HOZA 2WBGA 5IFPA 4HZ6A 1GUVA 3MS8A 3WN6A 3L4UA 3N13A 3W53A 3AZSA 3MSDA 2ZX7A 1VEOA 4AZCA 3U7BA 2MANA 4KGLA 1XV8A 2F7OA 4ATLA 1HVXA 3U5UA 1JZ5A 4UR9A 3ZT7A 1J11A 2CETA 5M3WA 1VFMA 3VIIA 3UR7A 1EDTA 1FHDA 2JE8A 3QHNA 4GKLA 3RJXA 1E6PA 3WBAA 3SCVA 3N1AA 1LJYA 2FE0A 2FH8A 2DEPA 3LRLA 5BXSA 1UWIA 3T0DA 5CGTA 2ESCA 3HG5A 2TAAA 5A6LA 1SFSA 1MW0A 1UD4A 1NWRA 1LF1A 5JUVA 3ECQA 1HN1A 4FLSA 3WNLA 1FP9A 2ZX5A 4HPHA 4W86A 1MXGA 5KEZA 5EFDA 1EO5A 2VZOA 1PX3A 1JF6A 2WMIA 2BHUA 1H11A 1JI1A 5A6SA 4YN5A 2JEPA 4MB4A 3QHMA 2XPKA 3CMGA 3WEOA 1I75A 1JI2A 1KGUA 1JNDA 3GXFA 3PZMA 3WF4A 3EJPA 2DSZA 1QBBA 4JHZA 3UEQA 3B9EA 4W7WA 1EQPA 3MO4A 1OBAA 1UUQA 4CKQA 4PEEA 4C7DA 1NQ6A 3PZQA 3RIKA 1QNRA 3B9DA 1PBGA 2EPKX 3GH4A 4HZ7A 4Y7EA 3CHCA 4ZE5A 2C8NA 3EDEA 1E3ZA 5CSYA 4UFMA 4Z2HA 1PAMA 4D1IA 1OD0A 1EIBA 3AMLA 4AIEA 1VEPA 3EMCA 3K4AA 4PMZA 3BAWA 4D6FA 2OSYA 1CGTA 4M56A 2WCAA 1KR0A 4M24A 3WMCA 1E1FA 1V0KA 3TV8A 1OINA 2UY5A 3WD1A 4UFIA 4TTGA 1ZBCA 3A47A 2XIBA 4IPLA 2A3CA 5HPOA 3K8LA 3H54A 3UG4A 1VFOA 1H41A 3AHZA 1PS3A 3MUZ1 1JXKA 1AQHA 3ZM8A 1QNSA 5A1AA 4HPGA 3WEZA 1VIWA 2E4TA 2VX4A 1TQVA 2WCSA 4D6DA 1W1YA 3LPOA 3UESA 1L8NA 4KWUA 3GBDA 1G1YA 1ODZA 4W7UA 3TTOA 3POCA 2ZXBA 1GJWA 3ARVA 2VRJA 1HJQA 1KXVA 3FN9A 3BLKA 1H2JA 2QHAA 4D6IA 1I1WA 3ZOAA 1NOFA 1J10A 2WW5A 1G9HA 2OYLA 3L2MA 4TTUA 2OYKA 5BWFA 2FYVA 2XVNA 3L4VA 2WZHA 2VR4A 3DX0A 3O2LA 4PMXA 4AWEA 1J0ZA 1KWGA 4J7RA 2BXYA 1IZKA 3AIBA 1KR1A 2VRKA 3ZR6A 3SUWA 1TG7A 4CD4A 3ZO9A 3GXTA 1E5JA 2VJXA 2EPNA 3ARWA 2NT1A 1PJ9A 3MMDA 2JIWA 5HBFA 3WQ8A 1ISWA 3D52A 2BVYA 1TCMA 3AIWA 4L4OA 1XC6A 4B16A 4ZEPA 8CGTA 3EJRA 2WKGA 4U2YA 3WDRA 3PZNA 1XD0A 2PF0A 3FAWA 2DSKA 2YDRA 1US3A 2YDSA 3VILA 3AMDA 3IAPA 1ZU8A 1FH7A 2J62A 1MFVA 1PX4A 1GW1A 3HG3A 4LPCA 4ZXLA 2Y8KA 2XGIA 4UQAA 1ZJAA 1OWQA 4CCDA 4Z2JA 1W1VA 2JIEA 4AEFA 1LQ0A 3SCNA 3UERA 2XFFA 1R7OA 1UD3A 1C90A 5E0FA 3AMGA 1Q6GA 2YDQA 3AQUA 2VVSA 5C8BB 4AZ7A 2IXUA 2XM2A 4AIUA 2XM1A 1JYNA 1SMAA 3G6LA 4JFUA 1H4PA 4Z2LA 3T0BA 1US2A 3WY2A 4B3KA 4B9ZA 3WKZA 3SCRA 1HKIA 1V3JA 4JKLA 2VUYA 1HXKA 5A6KA 3RDKA 3KEHA 5A8OA 6CGTA 1JGIA 1WCGA 2W63A 2VZSA 4WIWA 5AC5A 4CU6A 2ZX9A 2ZUTA 1M04A 2VO5A 1KBKA 4AD0A 1GOWA 2CBUA 3DX3A 1QPKA 4K68A 1Y7VA 4UFHA 5F7UA 2ZUSA 4U31A 2CITA 2ZWZA 5A2AA 2VL4A 4L4PA 2ZUNA 3VGEA 4MJ2A 1OGBA 1NWTA 4FF5A 5I0DA 4MJ4A 4HOXA 4AD3A 1T0OA 1J0KA 1UYQA 2XSBA 4HMDA 3N12A 4PMVA 1V3IA 4M82A 3AXIA 1VFUA 1ZS2A 4JIEA 4KRUA 4IISA 2GVYA 1EHNA 2WHKA 4W85A 3VO0A 3ZMRA 3ARTA 1WDRA 3TTSA 4MADA 4NXSA 2FHBA 1LWHA 5CPTA 3QOKA 4XZWA 4AIOA 4RE3A 1Q6FA 1LL6A 1NWUA 3AS2A 3WF3A 2QMKA 3AIEA 5HNNA 3WIJA 1QWUA 4F8XA 3GDBA 1D2KA 2J78A 1CTNA 5A8QA 1IV8A 1XHGA 3A4WA 3BVWA 2GK1B 3CO4A 4UQEA 5GNYA 2OWCA 1K9TA 3CUHA 3LXBA 1QI2A 1ZL1A 1MVYA 4D6HA 3SEPA 2YL5A 5BRQA 3VM7A 2X8RA 1JYXA 1XCWA 2G3IA 2PBGA 1Z32X 3WNOA 1W9VA 1WO2A 3AXHA 1V3HA 1HIZA 1R34A 4PMYA 1KCLA 2XGBA 1B30A 3J7HA 5DT7A 3H55A 3UG5A 3DYOA 1EOKA 5E70A 3VINA 5FIPA 3CZNA 4BCEA 2F1BA 2D0GA 3BSHA 2F2HA 4PBGA 2EACA 4AZ6A 2BS9A 3SUVA 4FLRA 4AEEA 2VI0A 3LMYA 5A6JA 1CPUA 3FW6A 1ITCA 3MMWA 3EMZA 2VMFA 3CBWA 4MAVA 3ZJ7A 4AMCA 1QVBA 2D3NA 4FK9A 3ZQ9A 2EPOA 1BVZA 1TA3B 1CXFA 4A3HA 3KE0A 3EJTA 4DUWA 1HKMA 1CGUA 3UG3A 5CQ1A 4WKAA 1EQCA 3A22A 3FHQA 4Q7NA 3ARYA 3FHAA 1W91A 5JIPA 2PWDA 1PZ2A 3MSGA 3CLWA 4PN2A 2J7GA 3ZIZA 1CWYA 1QW9A 2J7FA 2BY3A 4AMWA 1UWUA 3UCQA 4HU0A 2ZUWA 3WDQA 1AQMA 2QMJA 3AYRA 2XFYA 1OIMA 3CIVA 4UFKA 4AD2A 3BAYA 5FD0A 2FGLA 1J0IA 3VIFA 5E6YA 1KFWA 4BS0A 3CUFA 1WE5A 3WH8A 2EQDA 3BC9A 1ZB5A 3IANA 1DTUA 1UZ1A 3WL1A 2XYLA 2CHOA 3B9AA 4ZFMA 1WAWA 3AS0A 2DIJA 4NZFA 2D0HA 1NM9A 3S5ZA 5EB8A 2RGMA 3HG4A 1YQ2A 3EJQA 2CNCA 1D7FA 1QHPA 3II1A 2YFNA 2E9MA 4DWSA 1W3HA 3BUIA 2OW6A 3S2CA 4PMOA 2AAAA 2WLZA 2EBNA 1R46A 3WD0A 4MB1A 4JKMA 1KB3A 4UFJA 3KZSA 3KL0A 2BV9A 4UOQA 1VBRA 2YLAA 1FOBA 3W6MA 4GXPA 3BCFA 1E15A 3ALGA 4TVCA 4F9JA 3AHYA 1HJSA 3SUSA 5JBDA 4W5ZA 5D9OA 2X0YA 1GHRA 3U57A 3VD5A 2WAGA 4W8AA 3GXDA 5GNZA 4UZUA 5IXEA 3VDHA 3IJ8A 3VPLA 4BQ4A 4OIFA 1E6SM 3N11A 4URIA 3AIUA 2WVVB 2GJXB 1QWNA 3THDA 3DYPA 1JG9A 2J7DA 1H3GA 3WMSA 5IFTA 1CXHA 2VCCA 2F61A 4V28A 1MWOA 1E6NA 5CG0A 2QPUA 2XVLA 2ALWA 2E8ZA 4ML4A 5I3DA 5JBFA 1TUXA 1GOQA 1E4MM 4XV0A 3WQ4A 1FHLA 2ZOXA 1CBGA 1V3LA 4PYSA 5E0CA 1TZ7A 5ABGA 1MFUA 2D22A 1E73M 3OG2A 2WANA 3U7VA 4MNMA 3K4DA 1C8XA 3SUTA 2QLYA 1B9ZA 3LX9A 1CDGA 4KMQA 3ZJ8A 2HVMA 4JL1A 1FFRA 2FHFA 2EADA 3W27A 3AS3A 4ACZA 3AIVA 2W4XA 3BAIA 1CNVA 4AISA 2BNJA 5BRPA 9CGTA 1E71M 1V0MA 4CD7A 5A3HA 3NIYA 2J47A 4H8VA 1NH6A 4U3AA 2DSVA 3CUGA 4FNSA 4Z2IA 3EJSA 3N04A 4QCFA 4QAWA 1UA7A 1JFHA 5D9NA 2IUZA 2DSUA 1BYDA 3T08A 3VD3A 2J4GA 4P8WA 1H1NA 5A8MA 1S46A 3ZSTA 1OCQA 5IHSA 2WKLA 1VEMA 1PIGA 3BMWA 1UKQA 3VIGA 3PZUA 3WENA 3B8SA 1DWJM 1V6YA 4W93A 2WC3A 2J8FA 1P6WA 4AYGA 1OT1A 2Q8XA 1E4LA 4NZJA 3AROA 1BHGA 2NW0A 4X9YA 2YA2A 3F5LA 5AY7A 1TR1A 2CYGA 1UASA 1WZLA 4AD1A 2GSJA 1J12A 5M17A 7CGTA 3VGHA 1B1YA 1JDDA 1GVYA 5I24A 1HL8A 2PC8A 1OGSA 3PZVA 4CUCA 1DEDA 1UKTA 5I79A 1GORA 2O9OA 3VGFA 3WD2A 1E3XA 2VTFA 4P7QA 3AXXA 5FCZA 4MB5A 1ODUA 3FNDA 2UWFA 2X09A 4QLKA 3DX2A 5A94A 2PWHA 1W32A 1M01A 1WNOA 4S3KA 4D1JA 1PEZA 3WNKA 1G94A 5CJ5A 4P7NA 1WZKA 3VGBA 1W9PA 1HJVA 4NZCA 1R87A 2G4FA
chains in the Genus database with same CATH superfamily
1ODAA 3SSJA 3TO2A 1SDDB 1MY5A 3AITA 4I90A 2D03L 3LD8C 2XIIA 2R0LH 1WDPA 1ED3A 3AMCA 5EO1B 2QV4A 1ZLEA 3GMNB 2VKXA 1R6VA 5DD0L 1T5XA 1TZ8A 3GJFH 2CO7B 4HD9A 4CN4A 4IHOA 2F5AH 4JS3A 4PW9A 4CNIA 2M8XA 3APMA 2VLLA 4CADB 4P2RA 1P5UA 3S46A 4W9KC 4MTVA 4FQ1L 4OLWH 4FOJA 4OZFH 1EP1A 4D0CB 1XSJA 5BU6A 3RLGA 2EDNA 3EB4A 1T8QA 3QTGA 2FGWH 1QZNA 3S1WA 4AMKH 3JVFC 1XIGA 3L9BA 4Z77A 1VC4A 3MUCA 1JMZA 1LK2B 4NKCA 2AMXA 4Z8FL 3CV5A 3M7FB 3UBXB 1P7QD 4M1DH 2XGZA 1T6BX 3D2UB 5HGDB 5CSGA 4H9TA 3K72B 4Q9BA 5D7KE 1L6SA 4OZGA 4OZIB 5A6MA 1CQKA 5G4WA 1D5XA 3HI1B 1NMAL 3TJHD 4LSRL 2I16A 2X5PA 1X5MA 4HA1A 4PWHA 3GU2A 4QRUB 3ZHFA 5ADOH 3RGVB 1OCCB 4N2LA 4LMQE 1XS2A 1HDMB 3QEHA 2X10A 3PG9A 3V0IA 4G8EB 4XNQA 1DQML 3T0EC 3ZY7A 2CA3A 3A4DA 1MZYA 3RIAF 1FYHB 4YS4A 4IRSA 1A66A 3PHAA 4HGKC 3PTQA 4X0KA 5T1KB 1TTAA 4RX4A 5E1HB 4XP4H 1C08B 1FAIL 3URQA 4WRHA 2EIBA 5CHNB 4GQ9H 3OXSA 4ZBCA 3W1TA 4WGWB 4IS6A 4JDVB 1OYBA 3DXAB 1IAIM 4JM0A 1CTOA 1PZ3A 2FZMA 1X5XA 2Z91B 1ZVYA 2VR6A 3NFSL 2VEGA 3SBWA 3BUQA 2HG5A 2HH0H 2AQQA 3MBXH 1KM4A 1QQDA 2PPGA 1LEGB 2C79A 4HGXA 5AYIA 3LBOA 1LM1A 3QXDB 1WFMA 3HI5L 2XTJE 4H6KA 4D9QD 4P2AA 4ML9A 1UJ3B 3C8DA 3WE6B 1FL5B 2IQTA 1VFHA 3BE1H 4HUXA 1AJ7L 3CSYB 4C1LA 4ENED 4FQHA 4UTKA 4R34A 1G9NL 1CDHA 4JMNA 1TTGA 3RPIA 3QQ4B 1NGQL 1QRNE 2D3VA 4S1RH 4HMCA 4W5UA 1HH9B 1N68A 5DY2A 5EWIL 4OZ4A 4GQRA 1UJPA 5BYWA 3LKSA 4I9WE 5MENA 3HE6A 1KRCC 4S3AA 3CZSA 4GUQA 1A9VA 1TWIA 5LCVL 4OSUH 1WV7T 2V3DA 4PI0A 3TCXA 5E6UB 5KYXA 2VJ0A 1SJBA 2HKHH 2J72A 4LOCA 1N2RA 2WZPA 2FJSA 4DN4L 3WN5A 4U1KB 3VSUA 4M6PA 2JB5L 3QQ3B 1LO3H 3F64A 3KH4A 3SCWA 3SPJA 2K3HA 5CM1A 3B9KD 4ETQA 4N0YL 2CLHA 4DM2A 3Q37A 3QXWA 1R3JA 1HXMA 4K7YA 5EOQL 5ESVA 3QZWG 4XCNB 3GU9A 3KPRD 3HRZB 1WHOA 5CEZD 4QROA 4Z2KA 2VAAB 4X9BA 3R89A 3ZLFA 8PAZA 4GMSL 1ZVSB 1NCBH 3SE9L 2VISB 3LH2L 4KQ3H 5F88B 1KCBA 4LGXA 3ZUCA 5C3TA 5C0AB 5BRZD 3TA4D 3U5YA 5KSUA 4QRPB 2KZWA 4UFLA 4CLMA 4ZUUA 1NDYA 4M6VA 3QS3A 4W70A 4MLSA 4XD5A 2WN3A 3E1F1 3FCSA 1T5KA 1I82A 3C60D 3MRFA 5AOJA 2IKGA 2RFXB 2RFGA 2DD8L 4E4UA 3PBVA 3BVDB 2V9UA 2OMUA 4JFEA 3P4OB 2BASA 3MZ2A 4OUEA 4EE9A 4KVCH 4B9KC 1NBVL 1QTSA 2YAFA 2X6BA 1RD6A 5IVZA 5CC3A 1P84J 3GO1L 3OAYK 4KGJA 1TRDA 5SWZB 3MCNA 5I8KL 5K39B 3PRZA 5FWQA 2XTKA 3GNNA 1BXVA 5HHME 2NTFB 1R9FA 2VC9A 3BPCB 3K7UA 2A99A 3CAVA 1QFWH 3UTSE 1DBKL 5FO2A 2QUMA 1N3NB 2TSYA 1OPGL 4FKEA 2RQEA 4OOUA 1D3GA 4H88L 1QSED 3LSCA 3HBZA 3H2MA 3UYPB 4G1EA 2Y5JA 3CT2A 4ABVA 1S2CA 3ZKSD 6XIAA 1RZKH 3SE8L 3F7VA 4P23D 1NEPA 4PGZA 4N9DA 3AHTA 5CLTA 3G9VA 4NPYA 3MNVB 4IIFA 3ARED 5DD6B 3L12A 3BD3A 3QJAA 4CSTA 2P88A 5IF0B 2DV6A 4EN2A 2ASHA 4K7PX 4Q9RH 2ZOWA 3GB7A 4RGMC 3IVKB 1GZ1A 1BBJB 4BFAA 4GYFA 4H8WC 5HYJE 3ZE1B 4GW4B 3W1NA 2MQGA 2LU5A 4GAJL 2UZXA 3QKEA 3Q6FA 1MIML 4Z1PA 4TRPL 1W0VB 3HA0A 3GD6A 2XT1B 1FVCB 1ND0B 4O58H 2DN7A 4YHEA 4YLWA 3ILQC 3MVTA 1G4PA 4AY1A 5CFAA 4CU7A 1CBVL 2MOGA 2OU4A 3RVVC 3VSQA 4KKCC 4AJ0A 3D0LA 2JF6A 4OFVA 4MA8L 2GUYA 1DQDL 5IB4B 4X8CA 2Y88A 3QORA 4OCYL 2XFWA 3HKFA 3O1NA 4ELMF 5IQ7H 4AG4L 4ZOBA 4EUPA 2QULA 4OQTA 2DWEA 2H6PB 4APQA 3UBPC 4YIQA 3BLPX 4CGTA 4R9OA 1OOAA 2A9ML 4ALAL 2CD0A 2J24A 4HVXA 3BN3B 2OZ4A 4XO3A 1CG9A 2ENSA 1MFDL 1R3VA 3HS9A 4CSZA 2F8VA 4DKAA 4A3YA 5HDLA 1SBSL 3BLEA 4QFUA 2NXZC 1G4MA 3KRBA 4KTYA 2WHMA 4Z3JA 3VGGA 3T44A 2V81A 5CGYD 3AICA 5JZ7D 1DZ0A 1M03A 3BK0A 1UM6H 4TUKH 5AFAA 5ECGA 3P3UA 4X6CE 3LY0A 1HILA 1PCWA 2EE9A 3WS3B 4KRNA 3HR6A 2O61A 3MSYA 5E6ID 3CMOH 3QR1A 1M9HA 2Q09A 4FABL 3ERPA 4IMCA 4IJCA 3AS1A 3VD9A 5IVNA 1MPAL 3I75A 3QJQB 3C8KB 2WVSA 3VD1A 2ADAA 3EWUA 3EOSA 1WA1X 2ZOKB 4Z7WA 4UT6L 1D7BA 2GGIA 2WXLA 2X3CA 5FYLE 3EPNA 1E1EA 5HGAA 3AUWB 3TBYB 5A6BA 5C0JA 4JKKA 1WZ1H 1XF4B 2DZTA 4B2DA 4N5ED 4RBPK 1N4XH 1N8ZB 3BLOA 3G6JF 3MUIA 4NG3A 4L61A 3H2PA 1FRBA 3N18A 3IXTA 2WKJA 2XU2A 5D2LE 3WNPA 3UAJA 3WLHA 1EO8H 4KTGA 1B3VA 1J8RA 1V6WA 4Y4FD 3O9WB 1A3XA 3QPZA 4O4YL 2NYYD 2Q5BA 3N2XA 2APXA 4S0HA 1E4KA 2D24A 2EH7H 3BW2A 1TPVA 5G4EA 2Y3AA 1RIUH 2VKZG 5JW5B 4GRWH 2BSSB 4RMTA 4YAQA 3SKUD 3VUPA 1S9KC 1Q6OA 3ZTJH 2CK0L 3VH8G 1E30A 3QJRB 1IAOA 4HISA 5FO8A 5DURB 3ETBF 1OQXA 1EV2E 1XLAA 2P76A 1R75A 3F1QA 2B31A 4X61A 4LCYB 5CEYB 1F61A 1AIZA 2XACC 5HJDA 3W83A 1BWMA 1XCTA 4WV1C 1SUHA 3HNVL 3I6KA 4TUUA 2CKBA 3CCHB 3BGFC 2ISDA 3P2DA 3SOTA 3VXSA 4NQEA 2M83A 4WW2C 2E40A 3K6NA 3W28A 1E1CA 1WFOA 3RWDA 3N1MC 1YNYA 5B8CA 4DPBX 2WNXA 4PVMA 25C8L 1EP2A 3SDYH 1UHVA 4OV5B 5L8JB 1UWGL 2HT4D 3B0PA 1BRLA 4LBAA 1YUKB 4JRWA 1ESWA 3U0TB 4AQ1B 1KCVL 5L4IA 3G0UA 5HPMB 2DUZA 4HZAA 1XVSA 5E9XA 3IJYA 1TNNA 2C3VB 4EUPH 1IT9H 4OQTH 1S6NA 4RAVA 3S9DB 3I7SA 3ENEA 3VXMB 1HVQA 1ZALA 1MSSA 2OMTA 3OGCA 4IJ3C 3MODH 2OZ4H 4ABQA 3VG9C 3EXSA 4J4PD 1YMMD 2IWFA 4JN2B 3N9GH 4PTNA 1UURA 4Y5YC 2BODX 4XP6L 5I18L 2Z1VA 4XOCA 2YMTA 4EX4A 4Y88A 4NIYE 5BXFB 1J96A 3FEMA 3EWCA 1P0SE 3GX9A 4P0DA 4LNRA 1RLCL 3NJIA 2AEWA 4K37A 3IJSB 1LJYA 3PV6B 2V68A 2BVWA 5CCJA 1HHJB 3EGSB 4LLAA 2GSGA 4EQ2A 3HG5A 2WHVA 5DUBB 1E65A 5IB5A 4O57A 3SIZA 3L5WA 3OR7B 5IUCA 3E0GA 4PV9B 4WJ8A 1JI1A 4PTUB 5A6SA 2JEPA 3VXQB 2ZZ5A 3WEOA 2QVNA 4FQCH 3EJPA 3K0WA 1UBPC 4PG2A 2NLJB 1T20A 2W5PA 3ML9A 3KDMB 5GRVK 4MZ2A 2G4JA 2AEIT 1MAML 2LT9A 3BDBA 2RUSA 4X6DF 1R30A 3MBEC 3FX4A 2C26A 5EO0B 4TM9A 4XAYA 3QUXB 4D1IA 1ZWIA 2IPGA 2NNFA 1V10A 4IGHA 4KEUA 1OYAA 1Y65A 2RDUA 4Z7QB 2GY5A 2DKSA 2LOEA 4FQIH 2GJJA 1IF2A 2FPTA 4JRYD 2F58H 3MRHA 4M6OL 4OCXH 1I8IA 4D6DA 1I4FA 4GY4A 5GGTH 3QG6B 4TF4A 3GBDA 3FTWA 2L7UA 4XVUD 2XWZA 2WZHA 3ARBB 4YGVA 4X42A 5DC2A 3GMLA 2V37A 3RAOA 3P0YH 2EDMA 2OT0A 1A49A 3V0FA 3D52A 1T41A 1NKRA 3O2WL 4L8CA 5GRWA 4CAGA 4LV9A 5CLZA 3FH5A 4IP5A 3VFNA 4A05A 1M2VA 1IAII 3OBEA 1PUDA 4ZMGA 2CKBH 4I5BB 4G2AA 1HWGB 1BAFH 4E0RB 1T2JA 1G87A 2FQFA 4MYPA 4OD2A 5ANMA 4LKXA 5E0FA 1CDUA 2BSTA 1YDOA 3AMGA 1GC1H 3PY2A 1RY8A 2AXHA 2GTZA 4K4KA 1US2A 1CE6B 1SHSA 4PRDA 4Q8PA 1HKIA 1YY8A 3TAKA 4ZX6A 4MZ1A 2UBPC 5A8OA 5GGUB 4WWPA 3ZZLA 3N25A 4AD0A 3B2VH 2DRUA 3V0GA 3Q3GA 1QPKA 3KM2A 1HG3A 4U31A 3GB6A 1T2XA 5D9SA 4JFYB 1QCWA 2IDFA 2X3AA 1E9OB 1OY3B 4MNQD 5FDWA 4PG9A 2FUQA 5E9DA 4BE6A 2R0KH 2O6EA 3WKQA 4QG6A 2WHKA 1N18A 4M7TA 3LKRA 3PQYD 4QX4A 2B1AL 5I26A 5DHVB 5CPTA 3QOKA 4FIQA 4W68A 2QVKA 1MJUH 5HQEA 3I68A 4GBDA 1ROCA 4UTUA 3V8OA 5BV7C 3BVWA 1U6AH 4LNCA 3R11A 5I19H 2FPVA 5BRQA 1T1ZB 3EH2A 3V0DA 5ILTH 4EVZA 1W6LA 2DQ6A 2Z7UA 4CEUC 3QJTB 1H8LA 5AENA 1JZFA 2F08A 2RACA 4AZ6A 5I0ZA 2XNAB 5A6JA 3FW6A 3B8VA 1OYCA 4AMCA 1GS6X 1A6UL 2YHGA 1JXDA 4N7QA 3BEVA 1GSKA 4XWGL 4Z1YA 4F7PA 1B2WH 4Q4RA 1DJNA 4RSVA 5DRNA 3UGUA 3HG1B 4L3AA 3JWNE 1OIMA 4Y4KC 5BJTB 3IVSA 5FD0A 3Q6GH 3STPA 5LAPA 3EKCA 2VN7A 4JO1H 2XY1A 3GDKA 3N1FC 2QQLH 3VXPA 4ZFMA 2HRHA 2X30A 4L5FH 4PTDA 3CHOA 2HT3C 5ACZA 4XZMX 5FCUL 3CQIA 3QWOA 3PWUA 1W80A 1I1AC 4KHXL 1GKQA 4L0ZA 3X17A 2CWRA 4DWSA 3ZL4L 3DX6A 4C55A 4B4HA 2HE5A 1SY6L 1R46A 4MB1A 1TVBB 1LWRA 4DW2L 3GLAA 5DQ9A 2VKWA 3R12A 2DDQL 3SO3B 4PQXA 4PJCF 4N26A 5I02A 4D9PA 3LQGA 1EC7A 1W8SA 4W8AA 3OVGA 2CRMA 5I8EA 3N11A 2OZNA 3SKMB 5SX4H 4B90A 2XU9A 5EEVA 2V2TB 5HI3D 3T77A 4ZQKB 4HC1A 3ZYOA 4JAMB 4M7LH 4PV8A 4OTKA 3UADA 4H20H 3RTLA 2XVLA 4HK3J 3G1DA 5JBFA 4OLYH 4UV4L 1GYAA 2FO1A 2XUWA 3MA7B 3E1ZA 5HA7A 4RFEB 3UJRA 1AD4A 2PPCA 4HGWA 4GUPB 5I16A 3BKML 1GR7A 1XIEA 1C8XA 2XTJB 1A50A 2ZRUA 3GSRB 1DN2A 2ZP0T 4J5NA 3V6OA 1FFRA 5AW1B 4C47A 3TWAA 2TSBA 5CEXB 2QAPA 4HK7A 1S1RA 3BAIA 4MA1C 3Q2LA 3N34A 5I1GH 1QRNB 2CNYA 2BC4A 3N04A 1Q9KA 3TYFA 3CEUA 3GVQA 3KTCA 2YB1A 4KVNL 2DSUA 2J4GA 1ZCOA 2HROA 1S46A 2KUTA 4JPKL 3TQPA 4BQBA 2PYED 3M6YA 1CFTA 3QISA 4NERA 4HUWB 5J3HD 3P9MB 4ZQOA 4Q8VA 3O3RA 3MMEA 2NZLA 2V17H 1AKJD 3NO1A 4ZMLA 3ZK0A 4CQAA 4NNPL 1OGSA 3R0NA 4MA7L 4B9PA 3QVQA 2HNEA 3RL1B 2UWFA 3MUHL 3MROB 1JK8B 2FEDC 4D1JA 1MFBL 2QBWA 4HWUA 4F8QA 4MUZA 1A7PL 4DESA 3SURA 3KLHC 4OW6A 4JFHD 3R0UA 3VC5A 2XWEA 4ACYA 3ABLB 2UUDK 4F2MA 3AQZA 3TW6A 9PCYA 1NTDA 4NYUA 4P2QA 3MV9D 5D7HA 4LFHD 3RB7A 1FCVA 3HCVB 1LL4A 4HIHB 1VHNA 1UD5A 4V33A 3DXIA 3QJHB 3SECA 2NX3A 4N24A 2C0AA 4PWEA 4OOZA 5LGJB 3Q9QA 4DEUA 3KYNB 1NBCA 3G0XA 4TLSA 2YQGA 1OFOA 1YUHB 2WMIB 4WCYH 1JGUH 3W1PA 4XBGA 3T0VA 2J7HA 2K8MA 2GITB 2VWTA 2VDQL 1MVUB 2PDWA 3LZRA 3LCWA 1EGMA 3H3KA 5EU5B 4FX8A 4JG1L 4ILDA 1FCCA 1TFVA 4P8XA 5A8GA 3VU1A 3OAUH 4X80L 1I9IL 1XX9C 4E8DA 4JO5A 3ATZA 1AZ2A 3VOGA 5HHMB 3QQNA 3MUAA 5E1QA 1A2YB 1F3DJ 3W07A 2DEWX 2O5YH 2VZ3A 1JWMB 3LOTA 1F90L 1NVMA 4QR6A 1CIUA 4DZIA 5HUOA 4F7MB 3GNOA 3DV6B 3FS2A 2IV9A 3UTSB 3TLRA 1MHEA 3QPQD 4M48H 3U7YL 2KKQA 4PS7A 1RUQH 2YXXA 1T89C 1JRBA 3F5WA 3W7LA 3TSDA 1HCFX 3KLKA 4L4LA 1Q5MA 4FI7A 1EDQA 2MCPH 2NSQA 1PS9A 2ZAHA 4Y5XA 3PS7A 4HC1H 1AY1H 2E56A 2PCXA 1S5IL 2QW5A 1SN0A 1UA3A 4NGHL 3MZTA 1DFBH 5ANHA 3ZT6A 3SQRA 2Y07L 1UENA 3WQPA 4HXBH 3IEBA 2XWTB 3KWVA 3GFUA 2YBUA 5JPMC 1OK0A 3EO9H 3LKQB 2R94A 3NPXA 8A3HA 4WI9A 3ROLB 1D5ZB 1JUEA 2KAUC 1WICA 4XXWC 3R1GH 4TQEL 2IADB 5HYJB 1C8QA 4XX1G 3FFSA 2D2GA 4OR1A 1TRIA 4BDVB 3CHFA 4D6EA 3ZSSA 5GS0C 1W72H 3FJTA 3QIUD 3CZJA 1ONQB 5JUEL 5C0AE 4AF0A 3HGSA 4IX0A 1PYWA 4GXFA 1TE6A 3K2UL 4KROC 5PAZA 2YBTA 5FYKL 3HAEB 2EE3A 1OG0A 4HB7A 1H60A 4KJWD 2ZRYA 4YHGA 5G1MA 3DGCR 4W7VA 4ZFQA 3IJQA 2QPSA 1UD8A 4XN1A 5E93A 3P0VL 4NNYA 3NSNA 3UYIA 3S1UA 3N40F 5EDXA 4R0LA 4KKAC 4UILH 1NLDH 3HS0C 4P04A 5E5UB 4Q6KA 5DFVD 3FAXA 3GW3A 2ESVE 1PLCA 4PA8A 4DAIA 1V5JA 3TC6A 4TVSa 5TK4A 4J12A 2I9UA 5E5MA 1OAKH 4K94L 1F11B 3BOLA 4J6IA 2XZCH 2IBGA 1F3JB 4ZR8A 4ZD3L 3GRBA 1KNOB 1UFUA 7FABL 5AW9B 1AMKA 1JNNH 2YBRB 4I5UA 5K4XA 2V7HA 2EEBA 3UJSA 3QQXA 4FMVA 4X6CB 3IJDA 4UAHA 3N4EA 1NU5A 3O6FB 1RZGB 1DVXA 3BP4B 5CPOA 3I3EA 1E4IA 4OM1H 2WKOF 1M6OA 3HV9A 4JNMA 5L8LB 3FUHA 3EOAA 1KENL 3L68A 3EF4A 3THQA 2E8YA 1QWHA 2Z1KA 2XH7A 3FYEB 2VCAA 1LO5A 2IOIA 2D7NA 3NDZA 1B6DA 4AW4A 4GW5B 3EFDL 3GKFA 3P3SA 4TVPH 3A24A 1GZHC 4MDOA 3ZDXE 4KY2A 2DQUH 3SN1A 3WQVA 2WWCA 3OMAB 3BZEB 5E2UH 3F4WA 2XFXB 4EKXA 1E9ZB 1EFQA 3F2LA 2E7DA 1YYML 1Y07A 4AEIL 5FGBC 1SOKA 3EHBD 1G7JA 1UG6A 5D2LB 2GWNA 5IT2H 5LXGL 1OTUD 4HTYA 3GMPB 5C0DA 4UB0L 1DVZA 4PJ9D 5INCA 5IJKA 1OFBA 4HPYH 1J8KA 3ESVF 3R0DA 1DWFM 5KG9B 3ASOB 1K6QL 4H8HA 5TE4L 4XPFL 3ULUD 1FA4A 4PBWD 3RGHA 1DIEA 2R4RL 4IG2B 1A21A 3H42L 4JGNA 4G56A 1KTJA 4BE5A 3JU2A 3GI8L 3KRSA 4QCIA 1E67A 1IGTA 3WF0A 3CIQA 4ZYKB 5C0FB 4GMTL 3DGBA 3EO1B 2WLHA 3BPLB 4P9HH 2CALA 1U3ZA 4YL4A 2JKAA 1NIDA 5C0RL 3T1FA 1K8XA 4BFKA 1O12A 5DJZA 2XWXA 4Z3IA 2WWKO 5I1KL 1MAJA 3L9YA 4NP7A 2YPLA 2YZRA 4JN8A 2TRHA 3HMCA 1LT8A 2B08A 2HLAB 4FMKA 4XRCA 2YD3A 3QQDA 3NRQA 5DVPA 4NSBA 2WMPA 1X8FA 1FA2A 4RFNC 4MD4A 2E68A 3AWEA 1ZA3B 4Y90A 3OJDA 4OFYA 1YEHL 4IJRA 4P57A 1DBMH 1MY7A 3AAMA 1SQ7A 1P2CA 1QA9A 3I9GH 1UR8A 4GT0A 3F03K 2P7TB 1RUPH 4JXCA 5MHSD 4JQIA 4AG0A 1M53A 3SPGA 1FLRH 3DOPA 3UC2A 4X4XA 4FFVD 2WMFA 1Z66A 4B7LA 3O8AA 4AM0Q 1D5IL 1DXFA 4YHPA 1X5KA 5DRZA 4G7SB 3TPUB 1AS8A 3TESA 3BVXA 1CFQA 3GF8A 5DMNA 1MF2H 3TVMA 4K3JL 1Z5HA 5MF5A 3U9UA 1J4EA 1PL9A 4F3HA 3WTTA 4KI5F 1ROWA 4I3SL 3RFZA 2JJSC 1TSRA 3F04A 2CESA 3WX7A 3ESOA 4QRSB 3G5EA 5I1EH 1LO0L 4JQVC 5ABHA 2BY0A 3WSUA 4XXDA 3W84A 3FQWB 1DQTA 3FT3A 5BZWA 1Y5VA 3MLYH 4AGLA 2CERA 4JO3H 4Y2DB 5ABFB 1BAWA 1MZZA 3W3BA 3ZKND 1K85A 4OF6A 2XWJB 1JAKA 1ZA6B 1EJ8A 4APXB 1MQ8A 3VXRD 2ROXA 3OKDB 5B1JC 4JN1H 3V7PA 5FHBL 4CL7A 5DUMH 1WITA 1PBYA 2GSMB 1JULA 2ZFAA 4U3CA 3QNXB 4FFZH 1JWUA 1VZIA 3R5EA 4PH6A 4J40A 1KDIA 3L1GA 1SEBB 3INOA 2O9TA 1B4RA 4EPKA 1SVCP 2EIDA 2EPMX 1LOQA 4CGUB 4XSMA 1EZVY 4I0PD 4RV8A 5MEQA 1EJUC 3GSOA 4X9HA 1NOWA 2QIWA 4B3ZA 1S3RA 2Y8VA 3NTYA 3SDXA 5JHDB 4YFDB 3OM3B 2MHAA 3QUZA 4YWGL 1U0QA 3HOJA 5DCDA 1F00I 3PVFA 2I85A 2VEPA 4P8UA 1EJVC 3IM1A 3NPVA 2J2ZA 4JO2H 4WFHE 1ISYA 4FD0A 3ZPDA 2XJ7A 2F0CA 3PM6A 1A6TB 2NY6B 3VTMA 2EEFA 3TEZA 1KXQA 3SJVE 1MLCA 2XZAH 3RBSA 2OX5A 4O12A 4NO0A 4F2EA 4PCFA 4AZIA 3PK7A 3QIWD 5K4ZA 1NWSA 1WHPA 6PTDA 4EF9A 2H6OA 5T8IA 2DKUA 1GPOL 2BWQA 2VXSL 1QZ1A 5AD0A 4S1FA 4H2AA 3FQRA 3VW3H 2K7QA 4IMGA 2A3AA 2E5CA 1KGIA 4RGOH 4S3GA 2X7LB 1W8EA 4NAQA 1IL1A 3RDTC 3RX8A 5D72H 1R3HA 3RWCB 1CD8A 2FQGA 4OD1L 1AO7E 1T1YB 3GSNL 1MW1A 4AQEA 4WW2F 1EWDA 4HS8H 4PB9L 4TUJA 2NNXA 3INPA 4EZLA 1BKHA 4YVVA 4O0ZA 1XL9A 4PRAA 4MMZC 1F1DA 4O54A 3KM8A 5I6SA 5C2UB 1X4YA 4JQIH 3E8UH 2AJUH 4PJEA 3W70A 4K1WA 3MPGA 4HH9A 2A85A 1MJ7H 5DRXB 3WLQA 1IT0A 1S8DB 3C5SB 1O7AA 2W9DH 1MEXH 1QW8A 1F3XA 4OBSA 3FUJA 1WDQA 8RUCA 1H5BA 1HKLH 2WVTA 4X6FA 1BWVA 3MREB 1FP8A 2E1DA 2QTVA 4MQTB 2RAMA 1EDYA 2AJSH 5REQA 2DQMA 2VN3A 3L9CA 4ZTPH 3RXZA 1UUMA 3DTXA 5ICXB 5FYJL 3VFWA 2JEQA 3B7RL 1SDDA 1JTPA 4TNVK 3ARZA 1XGQB 4XZHA 4XIMA 1URZA 3G6DL 5EO1A 3KJ4B 1HVXA 3GMNA 2PPFA 5LN8A 3QAZB 4DXXA 3Q2DA 1OP3K 3VIIA 2ETWA 3RYSA 2WSRA 5K9CA 2CO7A 4NZRL 5IQLA 5BXSA 2OYPA 3T0DA 1XLKA 2AK1L 3PAJA 3W2MA 1CE1L 1UD4A 3HC0B 3UZZA 5JUVA 3ECQA 4HTBA 2CLRB 3GC5A 3OV6A 4CADA 4M6MH 5EFDA 1AQKL 1TSIA 2R15A 1MCPH 2ZTBA 5EOTB 4D0CA 2DIAA 3S4SG 4N2DA 3X2QB 4N2GA 4FNLH 5C86A 4LU0A 4Z3TA 1W17A 3TM6A 5JPNB 2ZWNA 4K71B 5KVMC 1UBSA 5FUCC 2Y1HA 1AL8A 5DMJB 1LK2A 1K77A 3PUEA 3GRWA 1NL0L 3UBXA 3ISYA 1EIBA 3Q0HA 5HGDA 1T80A 4M61B 3OSVA 3NTCL 1QPQA 5I7GA 3K72A 3C09B 1MZRA 1KCSH 1BVLB 2UY5A 5ITFB 4M5ZL 4OZIA 2ODOA 3HI1A 5L2KE 2OK0H 3GY1A 2QCMA 3MUZ1 1XDJA 1J5TA 2APFA 3RGVA 1GPWA 2AJVL 3MLXL 1MI5D 4FPSA 1HDMA 1BFVL 1VPOL 4G8EA 4KWUA 2IGFL 4IHBA 3POCA 4YZFE 1GS7A 1RIHL 2OJEB 1G9MC 2HRWA 2OYLA 5IROD 2XVNA 2CHXA 3LB6C 2Z3FA 3MRDA 5KYWA 4TQTA 4M5TA 2H4EA 5T1KA 2VR3A 4IXHA 4LVAA 1EFXD 2VJXA 4MJZA 4GG8A 1C08A 1CLYH 4RZCB 4JFFE 5CHNA 1TCMA 3GAKA 3AIWA 1XIWB 2BSLA 4X7DC 3MRKB 2GIMA 5KSBF 5EU6E 3BJTA 4JDVA 4UTTA 3DXAA 5D1ZI 4E68A 1DBBL 3VILA 3NCFB 4YEFA 3UZQB 3DBPA 2Z91A 4OGXL 5AL0A 1NY1A 1NGXB 4MJID 4L1XA 4EZKA 4ECLA 2FWLB 3HG1E 1LEGA 2OZTA 3S3BB 3SGDI 5AC6A 1NAML 4IIHA 3PGDB 3O41B 3WK2A 5C8BB 3QXDA 1LOSA 4K7FB 3GNDA 4LDLB 4GLRI 2HKFH 4J8QA 4M6AA 5EF3A 4A8NA 2X4NB 1HXKA 5D7SH 1UJ3A 2HB0A 4PW3A 4FR1A 4V2CB 3WE6A 2W0UA 4DBWA 1FL5A 4ABUA 3CSYA 1YO4A 4NO3B 2X0UA 3C2VA 3OKEB 2CBUA 5F7UA 2Q2EB 2CITA 1BQHB 1VERA 3QQ4A 2ACRA 3AXKA 4PRID 4FXTA 1P7BA 2ZUNA 4AYBA 4NQSA 2NXYC 4Z3FA 5IR1B 4FRWA 1HH9A 2NY3B 5D71L 3NQDA 3RZCB 1UCBL 2R8WA 3EYQC 4IISA 3J07A 4GIYA 1JRCA 1P9MC 3KMDA 3L1FA 1OAXL 4M1GL 4REQA 1WOAA 2B5IC 4F91B 5ICYB 3Q8BA 3PG2A 2N0KA 3RX5A 4U1KA 5CJOL 3G6JE 5IW6B 3QQ3A 3W76A 1DCEA 4HIXL 1BZEA 4LHUB 3V5HB 1XCWA 5DS8B 1YQVH 1Z42A 1CK0H 2LAGB 4DAFA 4A1RA 1KCLA 5ID0B 5JHBA 5FW6A 1E7UA 4JOMA 5DEGB 4HFWB 1EK3A 3TFBA 5LHDA 1TTCA 5CMAB 4XCNA 4EF3A 4XB8A 3HRZA 3QULB 3N9SA 3W23A 3ZJ7A 2H9GB 4N2KA 1BVZA 1OCWH 3IDNB 1U8MB 2VAAA 4YBQD 4WKAA 3KPLB 1EQCA 3Q44A 1BZ8A 3UO1H 4WK2B 1ZVSA 3CN2A 1VLXA 2PWDA 5AHMA 2VISA 4F9LA 3ZIZA 3GHPA 5F88A 4HNTA 4QNPF 3AYRA 4WSGA 4CQCA 1NUGA 4L6OA 5E94B 4UFKA 1TMLA 2IWKA 3GRWH 4Z7OF 3WMPA 4MCNA 4NCC2 3APDA 1J0IA 4QRPA 3TNMB 3IANA 1ZB5A 1UC5A 5IJCC 3SDAB 3BURA 3QJVB 2NW3B 4MQ7B 2GOKA 2IS7A 5EZIL 3WU1A 3FT0A 3BJFA 5F9OH 3V7AG 3P4OA 4Q6YA 5C7ZA 5LNVA 1TX2A 2GBAA 4YDJB 5DWPA 5C09E 4A2FA 3OODA 2JJTA 3S2CA 5TQ0L 1ZCRA 2WLZA 1C5CH 3EH1A 2YJLA 3KL0A 5SWZA 4ZUTB 4JGUA 2PXYD 4LASH 1CFVH 5JBDA 1JPTH 3MP3A 1PSCA 2CDEB 4X22A 2NTFA 3OC8A 4G8GD 3IJ8A 1YNLH 4OLVL 4C4KO 3BPCA 1Y6MR 2WVVB 4KWVA 4Q8MA 2FUTA 3UROR 4FXFA 5KTEL 2J7DA 4ZZKA 2NY2C 1N3NA 1GYWA 3NSJA 3ARGB 3ZBMA 5CGBA 1C16B 3FB7B 5CJ8A 4ML4A 3UA4A 2FL5B 4QT5B 3UYPA 4XV0A 1EDHA 4W9LC 2WTRB 2ZOXA 4D2NA 4P2CG 3EXJA 4PYSA 5F9WC 1HCZA 3RA7L 3ESNA 2HTKC 5FECB 1XF5B 2VL5B 1Z0NA 3BQUC 3LX9A 1M7IB 3PU7A 3SE3C 4HBCL 1NCDH 4PB4A 4RJEA 3KD4A 3MNVA 4ODSL 1RZJH 5EPMB 5DD6A 4CD7A 5IF0A 2XA8L 1BEXA 3NCJL 3QUGA 5I8CB 4PJGE 3MO7A 4LARH 1BBJA 2XG5B 4ODHL 3NH7H 2BVEA 5FK9A 4GW4A 3IE4A 3B8SA 1BM3L 2ADYA 1W0VA 3V0UA 3NM1A 2ESVB 1G7UA 1FVCA 4RZ5A 1XBYA 3RPTA 3SKJH 3T7VA 1ND0A 3JTBA 5EBUA 3KBSA 3NAAL 4ZMYA 4A6YA 1GVYA 2X4TB 1TZIB 4S1SL 5I79A 1GORA 3VGFA 3DEQA 2B1HH 3GT6A 4C5YA 4LCIL 4TV3A 1S78C 1FNSL 4X5LA 4CNSA 3OO2A 3GVWA 4XO5A 5IB4A 5DMGC 3QZLA 1YNKH 1TJHL 3KYOB 3AACA 2QKIB 4NZCA 4ZQNA 4LSUL 1QK0A 2H6PA 4YDMA 1JS4A 3TCTA 4E9QA 5AFDA 1FZJB 3CN3A 4BKNA 3DURB 4QXUH 4A2HA 2EDQA 2OPJA 2C7FA 4LOEA 2D4DA 1WOBA 4N2MA 2GJPA 5BV7L 4BKSC 1T83C 1R9XA 2H90A 2WLJA 1A4LA 3ZDXB 4LVEA 4ZNEA 2D69A 1VGEL 3UBGA 3NABL 3QXAA 1CCWB 4JCWA 4XZIA 4KPHH 3BPWA 2DSWA 4L9DA 2V3EA 3KLAA 1XF0A 3IRDA 1B3OA 3WS3A 5DEZA 3MFGB 3AMKA 3A0OA 4P2YA 1LG1A 2G3MA 1V08A 5DSCA 2P43B 1RCOB 4QRRD 1GTFA 3C8KA 3D0VB 2ZOKA 4RRPG 2Y2WA 1RJYB 2J9XA 1MHPH 3L4ZA 2P8LB 2Z27A 4L2LA 4UOJA 1S3TC 1WTLA 2HTLD 2WHLA 2RDXA 2BVOA 4CD8A 1XF4A 2QADD 4LQ1A 1SJXA 3JR2A 1N8ZA 4N2FA 5E03A 3ZKQD 1O9WA 5GHWH 1ZJBA 3MB9A 5I1CH 3PPFA 2IAAC 5CLXA 1ORQB 2Y22A 2EO7A 3ZLHA 4GZJA 1U5JA 1F07A 1TQCB 5FSEC 4IGNA 4F1SA 1SLWA 4PGCB 2W80C 4UTAL 3NQAA 3MUJA 4NBYB 4KKZA 1EQWA 3O9WA 2V2HA 3HC3L 5JQ6L 2QJNA 1XFCA 2X2UA 4QRTB 4YHOL 3PV7A 2YRLA 3CDFA 2N7AA 2FZ3B 3ATDA 2AJZB 3RAJL 3UC0L 4URKA 1J79A 1VJSA 4PJ5E 1OABA 2BSSA 3RURA 5GZOC 4J3VA 3ASNB 2AGJH 4FHAA 3GJFK 3LCYA 4UANA 4NAFB 1B9BA 3UXAA 4LCYA 4Y2OB 5CEYA 3SD5A 3MLZH 2WD0A 2DLIA 4OCSL 4BQ3A 3CJPA 1Z7JA 1ETB1 5EULV 4GIRA 4LAQH 3HM7A 4KFMA 1GCFA 5H2ZA 3CZFB 5C7VA 2F38A 3CCHA 1D9KB 3PWJB 4BSVB 4NC1E 1H7WA 3VFPB 2J4WL 4HLJA 2XICA 2H41A 3GXIA 4QE5A 4X8GA 3OVUB 5BXPA 4JPVH 3BVVA 3DMMD 2D1ZA 5IHWA 4A6YH 3KW8A 3N44B 1WB0A 3L8QA 5AZ2H 3RTQD 4OV5A 5HOSA 2FYMA 3TH2T 3U0TA 4AQ1A 4DEPC 3F4DA 3TDFA 1FG9C 5HPMA 3RR4A 3OQRA 1GTEA 1TQUA 2F1AA 5L6YL 2Q71A 2VMJA 5CJNA 4NP4H 2C3VA 3QZEA 3FFCD 3D69B 4NWTL 5F8RC 4I0KA 3VXMA 4C6KA 5SWSD 1XQ4A 2NLIA 2CLFA 2K9FB 3GC2A 4KK5D 5LDUA 3QXVA 3L4XA 3K6FA 5JOPE 4JN2A 1B3YA 4DJMA 1BJ1J 1CYWA 3T3PE 1FGNL 1JPEA 3NPSC 5HDRA 3VRIB 3H12A 2O56A 4XMPH 3CVHL 5BXFA 3H9SA 3NGFA 3B2MA 3U9PL 3A23A 4B9YA 1G1KA 1ITXA 3HB3D 3IJSA 4V1DD 4PCSA 3PV6A 1N67A 1HHJA 3S6OA 4X7SH 2JV6A 3KTXA 1RBAA 5DUBA 4NHUB 1X5GA 4AL8C 4IKKA 5DHXB 4BRVA 4G7VL 2SODB 3EFFB 3OR7A 4PV9A 4BH8A 4PTUA 4WFEE 3VXQA 3CBJB 3LPPA 1ZE3C 3E12A 1I9EA 4OB5L 4E9TA 4DYEA 4Q6JA 2ED7A 4IPJA 1RIVH 3M7WA 5FR3A 4P3CH 2ZKXA 2NLJA 3KDMA 4MWAD 1SZFA 3NZSA 4Q8NA 4Y19E 4WJXA 5MP6L 1NGPL 5EO0A 3HQNA 2E75C 3QUXA 3O4OC 1IFHH 4FA6A 1PG7L 1HKKA 2YJQA 3C6SB 5EZJB 3SJVB 3VX1A 2GFBB 4RKAA 4U33A 1XEUA 3KS0H 1ITBB 1I0DA 1PKYA 4HWNA 1E4JA 4CCEA 5F7AA 1ZV9A 3WUFA 4X5WB 4NT0A 5F7HA 3VFGL 1JGMA 2JGYA 3QG6A 3AW5A 2VURA 1D5BB 3V75A 3UMTA 2XQYA 3FKUS 3ARBA 1T4WA 2NR6D 2OULB 1AO7B 1N2VA 5ALCH 4F7CA 1BREA 3KDNA 2E3ZA 3ITCA 5JA8B 4WEBL 3VZXA 5C1MB 3OMNB 4ZFGL 1B90A 1PCSA 1UWFA 5E8DH 3BDYL 1O6SB 2EXSA 1V7NH 1A5FL 2AL2B 4ACZB 2DYPD 4Z7NF 5F7DB 3PBWA 4L6HA 4I5BA 4ZOEA 1BYBA 3UYRH 3N6JA 4JTAA 1Q90A 3CHQA 4E0RA 4UTMA 4MYAA 1IC5L 1GYCA 1LQ2A 3OB0H 4CC4A 1FX6A 4XPTH 4LL9A 2FJGB 1EC8A 2DW5A 4D9RE 1J1OH 3K46A 1CE6A 1DJIA 4ZXOA 5JHDE 2O7SA 5BOPA 3SRDA 2XN9D 4KXAA 2FJHB 1P0EA 5KN5A 5GS0L 5GGUA 1CR9H 4B3LA 1R9YA 5CBJA 2Z6FA 2AW2A 5DJ2B 3PWVB 1Q6EA 2WLYA 3W0WD 4JFYA 4XZ9A 1E9OA 4XMKH 1ISXA 4N87A 4S0SD 4R27A 2L5HA 1NC2D 4POUB 2YAHA 4P07A 4EXQA 1ISVA 4N0UE 4E9RA 3W26A 1TV8A 4L2YA 1XSKA 1C7SA 4R4NC 1IARB 3LQAC 5DHVA 5CCGE 3I50L 4Y2WA 1UR2A 4XZUB 15C8H 1E2ZA 1P4UA 1PTGA 1BG9A 4GYKA 4MAZA 2JELH 4I1RA 5KZCB 3ISWA 1HL2A 2BIHA 5FGSA 5HYEA 1T1ZA 4S3EA 3S6CA 3WSQL 4YXKL 4PUUA 2ZKHH 1WUFA 3UP8A 4U1MB 5CN1A 2N3JA 3L17A 3AISA 1F6KA 2JJWA 5IHUL 3D30A 1XICA 3S3DB 2OCJA 4PSRA 3NMEA 3DIVA 2O5ZH 1XRTA 2YAEA 5CD5C 3PJSB 2XNAA 1CEOA 3THML 5BW7A 5IOBA 4H00A 4ZPVB 3LZFL 5LWYL 1BGXL 3PP7A 2E86A 3MDJA 4Z7AA 4PGBB 5IB3B 1F3TA 3QJOA 2A1WH 3PANA 5AZ0A 4J4KA 4AMXA 3DGGB 2G8ZA 2NQZA 4N8VB 2EH8L 2P8BA 1WKDA 1CDBA 1NBYB 3GMRB 4WWKD 4XPBL 4JDYA 4M7LT 1B2YA 5ETUB 5BJTA 5L2KB 1JTTA 3APNA 1ZGLB 3VZZA 4PN6A 3OGSA 4AEHL 3K13A 1PLAA 3BUBA 5DO2C 4M9PA 3PB2A 4JNYA 3O4LD 1PKOA 1SBBA 5C7XH 3WJJA 4JL2A 4DJFA 4DZHA 4H7CA 4OJEH 1K7XA 3DBXB 5KBNC 1N8OE 4Y4HC 3C6LD 4PFHA 4N3TA 1Z3GL 3WH7A 1EGVA 1OTSC 3NJGA 3QJZA 1X44A 2C9PA 1XIFA 1VCVA 3QHFH 4JM2D 4JFFB 1DVSA 3DYMA 1XDMA 3VOHA 5EU6B 3QUYD 3B0VC 4L05A 3SKMA 5B39B 1UA6L 1K03A 3ZQWA 4XI5C 4ZQKA 2BHYA 4JAMA 5DJYB 2YL8A 4GS7B 1N64H 4UIMB 5J0BA 1ZIBA 3DOSB 1W9BM 3NQCA 2E0PA 4UT9A 4RFEA 5KITA 4AQLA 1EX1A 2XV6B 4GY0A 4KERA 1IM3D 3L0NA 5TQ2L 1X98A 4LCSA 1MSPA 3DUUB 3GSRA 3OPSA 1OG6A 5IFJB 2RQ8A 2DQFB 1TWZA 1KBWA 2DJLA 1BYCA 5D1ZC 2HVOA 3N0PB 2JFEX 4QCEA 1BF5A 3FUNA 3U0WH 1UW9A 2X4SA 1PU0A 1Q3NA 3ETTA 1QRNA 3CX5J 3IMBA 1T0MB 4XHJD 5EV7A 4WW1B 4M43L 4PJXF 2Z93B 4KXBA 2QHRL 1I1CA 3EFOB 2WLLB 1YDYA 1VACB 3WBXA 4UI2A 1JVNA 5C07E 1YXYA 3B04A 1A0QH 1UACH 3EO0B 1AFVL 3V4PL 4RWYL 4HUWA 3TO4B 3P9MA 4HJWA 2VCOA 5B3JE 3UETA 1TPDA 5FOOA 2PDJA 3KBWA 1UKPA 4QTHB 1T03H 4POZC 4LEEA 4KEZA 3G6JB 4R5VA 5DHVH 4NJGA 2W9EL 4BEQA 2ZVIA 4HNNA 3DRTB 1NLBL 3JUYA 4JFVA 5JQIB 3MROA 3MACH 3UJTH 4RDVA 2VUOA 2WNGA 1C12B 5CZSA 3N6QA 3D33A 4MAYB 3PP4L 2ATSA 1FKXA 3C0SA 3IDYB 2YAPA 2Z8VC 2DZAA 3L4UA 5CP3A 3AZSA 1DLHB 2JLPA 5HI5D 3H3PL 3MCMA 4QRQB 3U5UA 1HH6B 1J93A 2A74C 4DWHA 3AAZB 1XLMA 1J11A 3HCVA 5E08H 4G5ZL 4HIHA 2FE0A 3IFPB 4OF0A 1UWIA 1QJWA 4H2HA 3P8JA 4IFRA 3OVQA 5LGJA 1ZAHA 1I8AA 1MW0A 3KYNA 3RX2A 2VSCA 3P02A 2CLEA 2ZX5A 2EXWC 1FNLA 4OVUA 5DD3L 1YUHA 2WMIA 5D2TA 2WQUA 2YPVA 2E7BA 2VXVH 2QCFA 4NJHA 3IJEB 3PAUA 2GITA 3QZ6A 1JI2A 3TBWB 5JW3L 3BIKB 1MVUA 4PBEA 4A8LA 4QWWD 1KCUL 5EU5A 5GS3A 4C7DA 3PZQA 5C09B 4XXCA 1GA2A 5CN3A 3W6YA 4Y7EA 4Y16B 3PLYA 2PW1B 1Y6NR 3RUGF 5CPMA 3QQ0A 4Q8QA 5HI4D 4FX5A 2A0LC 1FDLL 3H2AA 1A2YA 1CFBA 4FEZA 4X5XA 1JWMA 2V8ZA 2NNAB 3FJNA 1E9QB 5L7XL 3FN3A 4W9JC 4F7MA 3NZHH 3DV6A 4QYAA 3TC9A 3UTSA 2JQAA 4XNMB 3I4EA 4PS3A 2P80D 4J3ZA 4W9DC 1CU4H 3NRPA 5TPWL 3CLFH 3TTOA 1GJWA 3FF7A 2Y0FA 4DELA 3KCLA 3OHXA 5T5FA 4LP4A 5BWFA 1NSNH 3M0IA 3T0XA 3RVXC 2EXYC 1U36A 1IZKA 1LK3L 3P62A 1FRGL 3GXTA 5FKPB 5EEUA 4AE0A 2XWTA 4UT9H 2FB4H 3LN3A 1SPQA 5GGVH 4E41D 1CURA 5HJ3A 1XC6A 4QQUA 3LKQA 4KI5E 2VFFA 3SGKC 2QSCH 3PXJA 4S10A 1QABA 3ROLA 1D5ZA 1HC1A 4PJGB 1FH7A 1PX4A 4AZUA 5DC0A 4P2VA 2XGIA 1RK6A 2Q87A 1EXBA 3HURA 1TFPA 4CQ9A 5HYJA 1P48A 3VKCA 4BDVA 2YK1L 3BOVA 2FRGP 1ONQA 3W1AA 3QM3A 4AIUA 4WY0F 2R8SH 3PNZA 2OMVB 3WKZA 4DJEC 3DV4B 3FU6A 5AC5A 3TJ4A 2DLFL 4LPUA 3HAEA 1U9KA 4EPEC 2YD5A 4K68A 1Y7VA 2G97A 2G30A 3M1CA 3HN8A 1RJCA 3EKZA 2VL4A 2QEZA 1TPC1 3K2IA 4MJ2A 1HI6B 4LALA 1JNLH 4ORGB 4U6HB 2YN5A 3FO2B 2YRBA 4C4BA 1U8LA 4WDTA 2OR9L 4WJ5B 4EPBC 3H8NA 2WIIB 4XCFL 5JMRA 3WF3A 1KB5L 1CTNA 4AAJA 1XHGA 1F3JA 3TNOA 2OQLA 3QAQA 2DQEL 1KNOA 5CP3H 2YBRA 3L21A 3GSWB 3SGJA 1MVYA 3LKPB 3SEPA 5GVJA 5AVVB 4AH2B 3KHOA 1L7TH 4IIEA 4JDZB 3I6LE 3S6DA 4HUMB 2V5LA 3LU2A 5E95B 4XKYB 4PPTA 4X6CA 3MZGB 1OP5H 1F5WA 1PZBA 3O6FA 1RZGA 3BP4A 2JIXB 2ICCA 3FO1B 1LNUB 3BSHA 5CZVL 4FFYL 2BS9A 3PHSA 3WLLA 2J20A 3ZKMD 4W6YB 2YPVH 4E2BA 4MNHB 3TQVA 2F6KA 3X3FL 3T04D 2POZA 4GW5A 4N0FB 3MA9H 4KAQH 1NDGB 1OHZA 4A7GF 5FGRA 2C4XA 5HMDA 1J1XH 3WO8A 3DJ9A 4GBXD 4PUBH 1VF5C 5CZRA 3V4LA 3R1ZA 2D7TL 1X97A 4JQ2A 1XGDA 2VDMB 3ATYA 3QDJE 4XNBA 2VMEA 4R84A 5ACMA 1X4XA 3BZEA 5D1QC 1W8GA 3LM7A 2XFXA 3QSTA 3IT8D 3LZ3A 2WN2A 1EKOA 1DJXA 2VC2B 3AALA 2YCEA 1P6FA 1WC7B 5D2LA 2AGTA 1NMBH 5CBBA 3GMPA 2HS8A 5DJ8B 1JZIA 3LNIA 2X44D 2YFNA 4MXQD 3DU0A 4N2EA 3ITOA 2E7FA 1V77A 4UNLA 3T9PA 1KB3A 2Z7YA 4UFJA 5KG9A 4UOQA 5H6HA 3U8GA 4PJ5B 5ENWB 2FT6A 2G5WA 4IG2A 1OQOA 1ZV2A 1MNUL 1KACB 3O8XC 2ZWLT 1BMZA 3VDHA 1IEAB 3TZVC 2E7MA 1DJYA 2DBLL 3IMTA 4AVJA 3UH8A 2KZHA 4FX6M 3HC4L 3R8QA 3WJYA 2HQAA 4US6A 5BMFH 4W1TA 4ZYKA 5C0FA 1E6NA 3EO1A 5F1IB 3E2RA 3RY5A 1G9ML 3DFHA 3F00A 2OEJA 3K2KA 2JB6B 1ECZA 1LOLA 3KAAA 3E7JA 4OF3A 3QXTA 4PS4H 5DJCA 2HLAA 2YMXL 2FDSA 3KR3H 5FM5M 3FOKA 5E8PB 3WLKX 1A02N 2UXGA 3S1GA 2CFFA 4X7FC 4H8VA 5LG6A 1HE8A 3EJSA 3HBGA 4ZJ9A 1ZA3A 2BINA 1C29A 1YEFH 2G3XA 3VTTA 4IXXA 2R51A 3BN9D 3O3AB 2C6QA 4BK8A 1ZPUA 2P7TA 1FZMB 5JDSB 2NZ9C 2ARJB 1PDZA 3V6BR 3HE7C 3S36L 3O3UN 4ZW7A 4N6QA 5E2VL 3ARFB 4JK0D 1HL8A 3RPDA 1DEDA 2AQ1A 4EUPG 3WD2A 1RVKA 3SOBL 2TSAA 4NI8A 3TPUA 1A6VH 2OI9B 4MB5A 4GCXA 3W7KA 1ZRQA 3T3PB 5IEHB 3KJ6H 1POJA 1M01A 2LU3A 3F4NA 2PC4A 3WNKA 3TE9A 3OJVC 2WWNA 2OTPA 3W3OA 4XNDA 4L3CB 1IEQA 4PJCB 2A3HA 4MXVF 3H2CA 2CJUL 2V3GA 4QRSA 3VAEA 4AQAB 3PWLB 2FLIA 3W7GA 1UADC 4JZNB 3FQWA 3W29A 3MXWH 2C1PA 5ABFA 1MJ8H 2GGEA 1U21A 2BOEX 2NXIA 1EEXA 1E27B 4R7XA 2GIXA 1NCNA 2PUZA 5JIMA 2XWJA 1ZA6A 3W9EB 4APXA 3M5ZA 4OGAD 3EOTH 2BNQE 3DO3A 5FYLH 2YIHA 1DSFH 4DP5X 2BSRB 4LOUD 4CVZB 1BDYA 2WXIA 4Y19B 3QNXA 2PDLA 2AQOA 1GIGL 3FUMA 1XF3B 5KSBE 1SEBA 1ICQA 4ZAKC 3B40A 4NB7A 2FT7A 5FM5O 1TZOA 4O2EB 1ZPTA 1H6UA 5AC8A 5E56A 4K5LA 1JPGB 4GOSA 1XKJA 3P3TA 4DB7A 1NIAA 4K3EL 3DTDA 4NO2B 1MFAL 1XLEA 1U2YA 3REQB 1LBMA 3A13A 5DVOA 3ZQXA 1E5AA 3TCLB 2F53D 1WRFA 2QJDA 4FYSA 4P8VA 4Y5VB 1W9DM 4IQJA 3OG6B 2ZZ6A 1AGFB 3JSSA 3QUHA 3DSFH 1ZHNB 3O63A 1P69B 5E6RB 2CBIA 3D39D 4OIBA 4J3OH 1A6TA 1DVTA 4XP1H 3ZXWA 4KTDL 1H6FA 1NELA 5BO0D 3ARRA 2BDNH 5FOBB 2VGGA 3MJGX 4K1GA 3JBG7 4PMDA 2NZIA 3DX1A 1QR7A 2Y4SA 1OAJA 2EIJB 1ORSB 4LGSB 5BZDB 3X3GH 2WXJA 35C8H 2X1OA 1V8EA 4DP6X 4KO9A 4TUOB 3WLSA 3T4AC 4WR3A 5AOZA 5J1TC 1OADA 2QXWA 2ZE0A 4YH6A 4MHHG 1UWQA 3ZW3A 2X7LA 1WXZA 3QI9C 3NZ8B 1QR4A 1HIML 1KB9J 3OWRA 5HULA 3RWCA 1J0HA 1C5BH 4DK3A 1T1YA 4XPAH 2W38A 4JHWH 3HTLX 3DUGA 1JPKA 1Q0EA 2HXUA 3E9UA 4DFIA 4L56A 2WCGA 3VIOA 1K4DB 2WQWA 2G2PA 4DY1A 4PB5A 2MOQA 1JPSH 2ZUXA 1UQSB 1P4IH 3CB3A 2YBGA 1R0AH 1RPKA 2PP1A 1PZDA 1E4NA 4N0UB 1DLFH 1TZGL 3IBOA 3OZPA 4S2SB 1WUZA 1AHWC 5DRXA 4DZ5A 1S8DA 3C5SA 4RNJA 2C16A 2WB5A 12E8L 4OFDA 1H3WM 4Z95H 2AQPA 2NV2A 1EEZB 3SJNA 4WFFD 1H6TA 1G01A 4ZMQA 3QZOA 5IDIA 1KCKA 5FJOA 1R5IB 1IYXA 2A77H 3MREA 1F7BA 2AOSA 1S3HA 4TSBL 5DEJA 1F58L 1PPIA 5I1JL 5EB9A 5JA9A 1OEPA 4N86A 1XLCA 5C9KA 4TV5A 3BMVA 1I8LC 2Y24A 1NWPA 2CEQA 5HR7A 5ICXA 3LEVH 2DQTL 3SE6A 2B20A 4GQQA 1ZKAA 1GGTA 1XGQA 3PJWA 3VYNA 1Z41A 3BSGA 2ZADA 3QA3B 4P7RA 2J1WA 1FZOB 4QF1B 5IOKA 4M1RA 2EDWA 4KIEA 1EJSC 3QGAC 1I7UB 2HPOA 3L3GB 1L6WA 4WI5A 2YLKA 4NC2B 1J88A 5GQBA 5F6HJ 4XMTA 3CQQA 3HC0A 3IETB 3LPFA 4KIRA 3UZJA 5BRBA 2NQ9A 2WSYA 2F54E 1QLFB 2CLRA 5DLML 3BWSA 4HQQH 4WEMB 3M7OA 4O5LH 2ZXAA 4H8WL 4AGOA 1HQTA 2WQXA 1PD1A 3QR3A 3CWHA 2CRYA 1UATA 5E24E 4JZ5A 4F8PA 4CCZA 5ADPH 5K2ZA 4TMCA 2V38A 1WDDA 5JXAH 3T0AA 1UH4A 2JKEA 5JPNA 4M7ZC 1GVFA 3VE7A 3MV01 5F4WA 2YN3A 4WI4A 3DDGA 4UNIA 2A7PA 1NQBA 2C3ZA 3FU3A 2P4AB 4M62L 4GJ1A 1A6AA 4Q52A 5C9WA 2DWXA 2WZIA 4M61A 4IIQC 3T8QA 1DQQB 4L65A 4HCDA 3VNYA 3GG0A 5DANA 2EDDA 1BVLA 3ELFA 5ITFA 4HG4J 1U1JA 3GHBH 4ELKB 3U6XS 3IFNH 1WYJA 1QX1A 3TA3C 3MLSH 1YPFA 1JCNA 3ZL1A 3O2DL 3DO7B 2AQNA 3LY6A 3RVUC 4AXNA 3M46A 1KGYE 1YLVA 3A4JA 5FHAL 3VFLA 2Y89A 2R29L 1EUNA 4P46C 4KCUA 4QRBA 4F9PC 5TE6H 1R17A 3QNFA 4NI6A 2WMGA 1LHZA 3FC8A 3P4LA 5DHEA 4RZCA 3E5BA 3KOXA 1MUCA 2Y5QA 2ZWSA 3N50A 1XIWA 3ETSA 2R4SL 3BVTA 3MRKA 2NTSP 4NKIH 5HJBA 4R5EA 4Z0BH 4GSDL 5FO9B 1T1XB 3PL6D 3P40A 1XSIA 1OAQH 3UZQA 1NGXA 4XG1A 2QJHA 3D2UA 4NOFA 1U3HC 1GOOA 4M6QA 5C07B 3IS4A 3G1YA 1IEVA 4ETYA 3Q5TA 4HJSA