4M8UA

The structure of mall mutant enzyme v200a from bacillus subtilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
559
structure length
559
Chain Sequence
SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDAIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPERADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
total genus 230
structure length 559
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m8uA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m8uA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m8uA02
1BVZA 4PSPA 4TXEA 4D71A 1DWIM 5E0CA 1NOUA 3UERA 5A6BD 1H1NA 2YL5A 3ARUA 2WMHA 3NJ3A 1HX0A 1PZ2A 5FKYA 4TTUA 2Y24A 1J0HA 2W91A 1V0LA 3FN9A 4ACZB 3WNLA 3U5YA 4JKLA 5IFTA 1RH9A 5D9MA 5DEZA 1JYWA 1QHPA 2W62A 4AZ6A 3WKZA 1VENA 1CGYA 3AS3A 3RM8A 4JZ5A 2IXUA 2OW7A 3THCA 3WMCA 3DX0A 2BVYA 3LXCA 1QX1A 1CPUA 2ZX7A 5KZ6A 3IAPA 4V27A 1SMAA 3G6LA 1UH4A 1HIZA 3ALGA 1TCMA 2D22A 1RD6A 1BQCA 4QCFA 1TA3B 3TP4A 2XVKA 4IPNB 4B3LA 1TE1A 4OBSA 4U2ZA 5ECUA 5I23A 3N04A 4J3SA 2J7BA 4URIA 2X2HA 1J9YA 1UZ4A 2VZTA 4HPGA 3A24A 1QNSA 1CXKA 4WF7A 4Y7EA 3RILA 1VJZA 3AICA 3H55A 5EFFA 5A69A 3A47A 1UYQA 1VB9A 3IJ8A 2YKKA 3BVXA 4PMNA 4AISA 4ZXLA 4HA3A 2ZXDA 2ZE0A 1W3LA 2J7GA 2VX7A 3GBDA 4P7QA 1GUVA 1HNYA 5LA1A 3VGDA 1GONA 3CUIA 3BSHA 5DF0A 3TV8A 2FE0A 3WMBA 1JIBA 4W86A 4RE3A 5CPTA 1HJSA 4XUYA 1CBGA 1C7TA 4DUVA 3W38A 4W7WA 2WM0A 1EIBA 4MNJA 4RL3A 2J4GA 1W1VA 3SUWA 1E3XA 2F18A 4AZCA 1B1YA 1SMDA 1UZ1A 1KFWA 1E71M 2YBUA 3HZ3A 2YFNA 1ZJBA 3D5HA 3MANA 3SCTA 3GXFA 1ISWA 3WNMA 3IAQA 4ATDA 1JYXA 2Y2WA 5A6LA 2HISA 1PPIA 1G01A 3VIGA 3GDBA 3WQ8A 4CKQA 3S2CA 1WZMA 4BQ5A 3VGFA 3BMWA 5CGMA 2WXDM 4GKLA 3K4DA 2CXGA 4FNUA 1KTBA 3VU2A 3CO4A 4ACYA 2WK2A 3PZQA 2Y4SA 2X05A 5E70A 4TX8A 4NRRA 1E0VA 1H49A 3UG3A 2F8QA 2WHLA 3BVVA 5D8WA 4TVUA 1K6AA 4MJ4A 2XJ7A 3WL0A 4UZSA 4JFTA 2CYGA 2DIEA 1UHVA 3FAXA 5CQ1A 2Y5EA 3VNZA 1H09A 4UQBA 3BUDA 1EQCA 3PZMA 5E0FA 2O9OA 2VI0A 1W1TA 1Q4NX 3ZMRA 3IANA 2C0HA 4DWSC 4AZHA 5GNYA 2D23A 3AXHA 5E6ZA 1GQJA 1KB3A 3VIIA 1J11A 3AIQA 5IHRA 1UOKA 2XN0A 1XYZA 1IT0A 2IGTA 5AY7A 5A2BA 1UKPA 4MB5A 2XVNA 3HJEA 1JZ4A 3A21A 4PN2A 5ABEA 1V3KA 2D20A 3GTNA 4GPNA 4HA1A 1GOOA 2CIPA 2UWFA 1X6LA 4AD4A 2Y8KA 1CXHA 5M17A 1QI2A 2FYVA 3EMZA 2VNCA 3EDDA 2ESCA 1TUXA 3VIHA 1ECEA 4DUWA 3VGEA 2XTKA 3H54A 4L4OA 3DX1A 2CKRA 3KL3A 1Z32X 4AWEA 4ZFMA 4TUFA 2CERA 1UQZA 1E4LA 1E5JA 3WNPA 1GHSA 2VTFA 3O2LA 4XZBA 1M7XA 5D9PA 1JFXA 2E40A 3BMVA 1LWJA 2WNWA 2ZOXA 3VTRA 1E5NA 3WF0A 2DIJA 3WDPP 4J3UA 5CSYA 4AZGA 3W25A 1KR0A 1GPFA 1HKKA 3WD3A 3VDAA 1JDCA 1G0CA 5HOSA 4IUGA 2VR4A 4HMEA 4OIFA 4DWSA 1AQHA 1BYCA 3WEZA 2E3ZA 2D24A 3BVTA 5LA0A 3H53A 1KBKA 1LL4A 3WUFA 1C8QA 1W9BM 2J7FA 3QHMA 4NX0A 5AYIA 2EQDA 3ZT6A 1VJSA 4CCCA 2YJQA 2WKGA 7A3HA 1OM0A 4C7GA 5C71A 1ZBKA 2DH2A 4PMOA 4PTVA 3AHXA 2DT2A 1GNXA 4UFHA 4HU8A 5CZKA 2WMFA 1QI4A 3WD4A 1NARA 2QV4A 3PHAA 1OIFA 4XZWA 4NRSA 2QPSA 3W81A 3L4WA 2CHNA 4Z2KA 1UKOA 4ACZA 3U7BA 3AIBA 5M03A 1WAWA 1XSKA 1UR4A 3HG5A 4XX6A 2FH6A 1BGGA 1G9HA 2GVYA 4A3HA 4IISA 1XD0A 1UD3A 5I79A 1E73M 1R7OA 3L4ZA 4P8UA 1V08A 3N17A 3SCUA 1K9FA 1ODUA 2ZUSA 4FNTA 2OLHA 1BPLB 1ZBVA 1R85A 3GZAA 4AIEA 3WY3A 4TTGA 4UOQA 5GQBA 3WF4A 1C7SA 3MSGA 1JZ2A 1V3HA 5D9OA 4W84A 2YA1A 1V0MA 9CGTA 3A23A 4MAVA 2J74A 4GXPA 3UR8A 2XFFA 2FDMA 2EABA 3UCQA 3D3AA 1HXJA 3M7SA 4W7UA 1LJYA 5M5DA 4WIWA 1OD8A 3CTTA 4B16A 1V6UA 2YFOA 1E6NA 2O9RA 4CN1A 4X0NA 3BGAA 3VGGA 1E55A 5A6SA 3N9KA 3BXWA 1XHGA 3NDYA 2YBTA 1C93A 3EJSA 3BAYA 3AHZA 4W89A 4D6FA 4TVDA 1CLVA 1Q6EA 1XYFA 2XUCA 2BY2A 1K9DA 2DT3A 5DT7A 3L4YA 1NOWA 4JCLA 3ARSA 4PMUA 4GZEA 1BSIA 2WMGA 4GO9A 4RE4A 4AZIA 1US3A 2OW6A 4FLQA 5C8BB 1JD7A 4Q7NA 1AQ0A 4W8AA 3VMOA 1QPKA 3SCWA 2VVSA 1UD8A 2ZIDA 4KH2A 3AXIA 3WY4A 3QHNA 1CXIA 4CCEA 4DO5A 1W9VA 1RP8A 3CV5A 4GQRA 4FLRA 5I3DA 1HL9A 3OLGA 2PC8A 4PMDA 3BAXA 4PRWA 3EDJA 3WEOA 2JF6A 4TX6A 4GI8A 2VURA 3GXMA 3LRMA 2GJXA 2D2OA 2ALWA 1ZJAA 1R46A 3T08A 1KGXA 3IJ7A 5BRPA 5I24A 3MUIA 1TVPA 2JALA 2JEPA 4UR9A 2E9BA 3W6MA 1CIUA 2V38A 4AY1A 5M3WA 3FY1A 3AIEA 2ZUUA 2CESA 2AAAA 2V3EA 4AMXA 2VQTA 2XM1A 2XFYA 2WC3A 1JZ5A 4BS0A 3EJUA 1W2VA 2VT0A 3MMDA 4EAMA 4FNSA 1JF6A 5E09A 3SCSA 4RE2A 4J27A 2CHOA 2VCCA 3ARVA 4F8XA 4L4PA 4PYSA 4FLSA 4TVCA 4X9YA 1UWQA 2F7RA 4XV0A 2XIIA 3KLLA 1PX8A 3VDHA 4CU6A 2WBKA 3BVUA 5F7UA 5FL0A 2V3FA 1ZL1A 2YDQA 1VEOA 3VINA 1GOWA 4MADA 4GINA 3DHUA 4IM4A 4H8UA 6CGTA 1HP4A 4HU0A 2J7EA 1FP8A 4NXKA 3BUBA 2OYMA 1QNRA 4D6JA 1FFQA 1IV8A 1W3HA 4B3KA 1QI0A 5I78A 4QDMA 3GH4A 3PZIA 1T0OA 1TQSA 1SFSA 4S3KA 1NM9A 1TR1A 1K9EA 4H8VA 1SR0A 1U33A 5I5RA 2O9PA 1M04A 4M8UA 3ECQA 3ARTA 4AD3A 1PX3A 2E9MA 1ZU8A 3CHCA 4DWSD 1FHLA 3CUHA 6TAAA 1JYNA 1WCGA 2FGLA 3VPLA 4Z2GA 2DSUA 3MS8A 4HOXA 1XV8A 2V3DA 3MUZ1 4EANA 1C90A 1UD5A 2VX4A 3ARQA 3O6AA 1OSEA 1PBGA 4H8HA 2IXVA 2NW0A 1C92A 3VM7A 1R87A 3AI0A 5ABFA 4V2XA 1UR9A 3PZ9A 1W1YA 1G1YA 1L8NA 1R34A 4P7LA 4UFJA 1ZS2A 1E6RA 1VBUA 4F79A 5JBFA 4R5EA 3WEMA 4M56A 4EK7A 3OIHA 3OLEA 3POCA 1NP0A 1WKYA 2BV9A 5FCZA 4EKJA 5BCAA 1OGBA 3CIVA 2G4FA 3K8MA 2GSJA 1MXGA 2YDRA 3WF1A 3VSVA 2DQXA 2J7CA 2D0HA 2VOTA 2VQUA 3LPFA 5BXSA 1RPKA 2ZWYA 2QMJA 2WVVA 4Q22A 3CPUA 1GJWA 7TAAA 3AZTA 3KL5A 3CLWA 1UH3A 1G5AA 5A6KA 1V03A 1LQ0A 2E8YA 1ISVA 3CZSA 4QAWA 1HJVA 2PB1A 1ITCA 1DWFM 1AMYA 3IK2A 1DWGM 2EADA 2PWFA 2UY2A 1MW1A 3SURA 2YLLA 1HKJA 3W82A 2XVLA 2A3HA 3EJTA 2DPEA 2EACA 3FHQA 4KGLA 3ZJ6A 3B8SA 1O6IA 3WQ4A 2WBGA 4GQQA 1C8YA 2G3IA 2AMGA 2G41A 3QHOA 4WKFA 4LYQA 1GVYA 4J3WA 4PMYA 1QNOA 5BWFA 4OKDA 4AXNA 3N11A 3A4XA 4JKMA 3A4WA 1OGGA 3WF3A 2ZX6A 2CETA 3HU7A 1E6PA 5A1AA 3MMUA 3BUPA 1FOBA 1IZKA 3AS1A 1KCLA 1V3MA 1WNOA 2WMKA 1BAGA 1FP9A 3F4VA 3CUJA 3PZGA 2PI6A 1JD9A 1H0IA 2WLYA 2DH3A 1KXHA 2WZIA 5D4YA 1E0XA 3AZSA 3T2PA 3QOMA 4B15A 4PTWA 4MNMA 3RM4A 4B9ZA 2XGBA 1CGXA 3WY1A 5JUVA 1JZ8A 3NIYA 4H2CA 4D6HA 2OYLA 2E8ZA 3WF2A 2Z1KA 4U5IA 2QMKA 1VRXA 3UEQA 4JL1A 2DDXA 2XVPA 5JBDA 4MJ2A 1VIWA 3BCFA 2X0YA 3VSTA 4CUCA 5A3HA 1EDTA 3CZGA 1E70M 1CENA 1KWKA 1FH9A 5D8ZA 4CCDA 3N12A 4FK9A 3I3DA 5A8OA 2X2YA 1QBBA 7CGTA 1KQYA 1ISZA 1BG4A 3BUQA 3WDJA 2E9LA 1TQUA 4GI9A 3WUGA 2WZHA 3GYCA 1B0IA 4P8VA 5BXTA 2QPUA 2FH8A 3PZUA 5CG0A 4FNQA 3LXBA 3ZT5A 1EO7A 3PN8A 4MPKA 3VX1A 4NZCA 3T2QA 4BF7A 1E4NA 3BCDA 2J7HA 5HPCA 1EDGA 1WZLA 3VDCA 1C8XA 8A3HA 5AYBA 4GIAA 3DYMA 1PX4A 1GJUA 3AYSA 3VIMA 1XH1A 5BYWA 1PAMA 1B31A 4KGJA 3U5UA 1JGIA 2JIEA 4X0VA 1EHAA 3BC9A 2PF0A 4ATWA 3II1A 1OIMA 3GNPA 3GXDA 2F1AA 2NT0A 5A2AA 1BHGA 4LXFA 1DWAM 2EEXA 1B30A 4DO6A 3GNRA 2VZVA 3ZQ9A 1M53A 3M6DA 1JI2A 1BFNA 1JXKA 1E15A 1R86A 2BVDA 2C7FA 3WFZA 2ZXBA 1UWSA 1EOKA 2BY1A 1E0WA 1MYRA 6A3HA 2EO7A 4AZBA 2F1BA 4R27A 4UQEA 2VVNA 2WW5A 1JDDA 3LPOA 2EPNA 3T0DA 4XB3A 1W3JA 3MUY1 1B3WA 1UUQA 3TTSA 2QF8A 1JNEA 1V02E 3ARPA 3RPMA 1B9ZA 1UWTA 3ZJKA 3L4TA 2XWDA 3NUKA 1E43A 4Z2HA 2A3CA 2DSZA 3AYRA 2CPUA 2GK1A 2OSXA 3CHDA 1BLIA 3OZOA 5FOOA 1J18A 4HZ8A 2D3NA 1B3XA 5HPOA 1TFVA 2EPOA 2Y8VA 2WC4A 3AHYA 2CBJA 3NYDA 2WMIA 4UCFA 4QFUA 2X0HA 3IGUA 4U3AA 3DDGA 2X1IA 5CXPA 3VUPA 2VL4A 1VEMA 4P8WA 4D6DA 1CGVA 1N82A 1EDQA 3LXAA 5EB8A 3TTYA 3I3EA 2XWEA 1TQWA 3W27A 4FF5A 3WH9A 2F61A 3K46A 4UFKA 1WDSA 3AIRA 3BAKA 3GXTA 1R8LA 2BFGA 4J3VA 1W1PA 3AIUA 3VD7A 3ARXA 1TMQA 3L2LA 3WQWA 3ARWA 3LPPA 3AMCA 4HZ6A 1W3KA 3WDQA 2FGZA 2V5CA 2O92A 1I75A 2DGAA 2YL8A 4NZFA 4AZ7A 3SCPA 3N13A 2PWDA 1UWRA 2GJXB 5IDIA 3VIPA 4AIOA 2XVGA 3OA5A 2XSAA 2WC7A 4PMQA 2D0FA 3ZR5A 1CEOA 4UQAA 2AOSA 5DMYA 1QI5A 3CZ8A 1KR1A 4PMVA 4GO8A 3OB8A 3EJQA 2W61A 3AJ7A 3AISA 1OGSA 1MQRA 3NSNA 2BS9A 2TAAA 3KLKA 5E1QA 1BVNP 2WHMA 1J10A 2BVTA 2HVMA 3O9NA 4U5KA 4E8DA 4JL2A 2D3LA 4ZXOA 3UR7A 3PTQA 2G3NA 3D4YA 2J75A 3VMPA 4OUEA 4MDOA 1WDRA 4AMWA 2VX5A 5DO8A 1QWUA 1ZB5A 4D6GA 2G3JA 1W32A 3WNOA 3WBAA 4GZIA 1ESWA 1BYBA 4UNIA 1I1XA 5EBAA 4PCTA 1KQZA 4F9JA 5IFPA 3CZLA 3WNKA 1HP5A 3KL0A 3PTKA 3BAWA 1XCWA 1W9XA 4E4PA 2UY3A 1UR0A 2VRJA 2VZOA 3UG4A 4H41A 3T2OA 1Q6GA 1MFVA 1VEPA 4PBGA 1H3GA 1GZJA 2OYKA 3DECA 3EMCA 3WD0A 1PS3A 4MAZA 4LYPA 2PWEA 1UWUA 1CGTA 4P7OA 3VKKA 3WH5A 1XRVA 3VD9A 2WSKA 4Z2IA 3VD3A 2JEQA 5GNZA 3BSGA 4WLCA 1US2A 1NWTA 4JAWA 3U57A 1S46A 2ZUWA 1NQ6A 3FXYA 5JIPA 1OT2A 3WH6A 2EBNA 2EJ1A 3MV11 2J8GA 3AOFA 4P8XA 4PMXA 1HTYA 1QHOA 3MV01 1E6SM 2JFEX 3SUTA 4N0RA 1MQQA 2CBVA 5A6AA 1V02A 4YHEA 2VRKA 3CMJA 3NSXA 2MANA 2DSWA 3EDFA 1MW0A 3EBVA 5A94A 1MW2A 4UQ9A 1FH8A 2QHAA 4UZUA 4AMCA 3W29A 1UH2A 4M81A 4NI3A 4UQCA 4ZEPA 2XSBA 3GXIA 3B9AA 2XFRA 3MU7A 1M01A 3W28A 4KRUA 1KXTA 1J0KA 1JZ6A 1LL7A 3PBGA 4D6CA 2WLZA 1UASA 3KE0A 3AMGA 3SCQA 4CD5A 2EPLX 3KZSA 5CPQA 2GJRA 4D6EA 1PZ3A 1UR8A 3SCVA 1D2KA 1HWWA 3CGTA 3AFBA 1GQIA 1SYTA 2RGMA 1J0IA 2WHJA 2J79A 2J7DA 2W67A 5ABGA 1VFUA 2Q8XA 1CECA 4KWUA 3AXXA 3AHTA 2J78A 3RMEA 2W4XA 3RO8A 3VSUA 1J01A 4PUEA 3AHVA 2BY0A 4AEEA 8CGTA 2VCBA 3HG4A 3ZSSA 4AYGA 1OD0A 2J62A 2DSKA 2O9TA 2V5DA 5KEZA 3VNYA 1GORA 4BQ2A 4J3XA 4UFMA 3ZM8A 2CEQA 3CHFA 1WZAA 2ZX9A 4YHGA 2FHFA 3K1DA 5JIWA 4QLJA 1JNDA 4PUDA 1V0NA 3OGSA 4ZE5A 1Q6CA 5I77A 4PCSA 1HJQA 3WELA 1W9PA 2X8RA 2VR5A 1UR1A 4OJYA 1J12A 4FMVA 4HMCA 4BQ3A 1YQ2A 4QP0A 1AVAA 2W66A 1WE5A 1ZBWA 3W4RA 4AD0A 2C8NA 1QBAA 3VD5A 2NT1A 1K9TA 2VZUA 3VILA 2ZWZA 2YDSA 5LYRA 2YA2A 3GBEA 3F5LA 4Z2JA 2GK1B 3EJPA 2QLYA 2WHKA 1UQYA 3SUVA 1E40A 3CBWA 4HOZA 4J28A 1WPCA 5HXMA 2WPGA 2XM2A 1PIFA 1E3ZA 1GCYA 3N18A 1HJWA 5GNXA 3OZPA 1Q6DA 1E4IA 2V3GA 1OT1A 4JHZA 3CZKA 1Y7VA 2XN2A 2VX6A 4AD1A 4LPCA 1B3VA 4UFLA 3WMSA 3U7VA 2E4TA 3HN3A 5I0DA 2BXYA 1QWNA 4M1RA 3WSUA 2D0GA 3E1F1 1BG9A 1EXPA 4AD5A 1TZ7A 3VGHA 3GXNA 4W87A 4NZJA 1UKTA 4HP5A 4C7FA 1DWHM 1XGZA 3OBAA 4UFIA 1TA3A 1LL6A 2DT0A 4IPLA 4E8CA 3MSDA 5JBEA 2UY4A 4N42A 1JG9A 1UA7A 4FNPA 3ZR6A 1D7FA 3CZNA 2YIHA 1Q6FA 4NSBA 1R47A 3POHA 3BLPX 3SIMA 4AD2A 2YOCA 1X6NA 3WFLA 2WVTA 2J25A 1LLOA 1MWOA 2WVSA 5DFAA 2VRQA 3ARZA 3GH7A 1OWQA 3PTMA 1B2YA 1OINA 4F66A 4YPJA 2GJPA 2A3BA 1GOKA 3AMDA 4K68A 2WWDA 5LA2A 3RM9A 3L4XA 4D6IA 1NWUA 5I6SA 1FH7A 1LG2A 3AS2A 1R33A 4H7VA 5GPRA 1HT6A 3FW6A 1F4AA 2UY5A 1DHKA 2ZUVA 2WVVB 4HA4A 5A8QA 2BHUA 4AW7A 1MXDA 3FHAA 4HPHA 1U2YA 1BYAA 2EAEA 5IHSA 3CUFA 1CYGA 1UD2A 3FAWA 1KCKA 1NP2A 2F7QA 1GOQA 1JFHA 4MNKA 1ITXA 1CTNA 3WY2A 4WSJA 4JFWA 1DEDA 3OGRA 5A8PA 3F5JA 3ZJ7A 1V3JA 4AYSA 4YN5A 1F4HA 2ZX5A 5AC5A 1QNQA 3MI6A 4CD7A 2A3AA 3PZTA 4CN4A 5BXPA 3ZOAA 3VIJA 4QCEA 1UWIA 1ISXA 2PBGA 3SCNA 5EMYA 1V0KA 1R75A 1BF2A 1HF6A 4TOQA 4AZ5A 1MVYA 1E9LA 3PZVA 2BXZA 3L4UA 5DT5A 2WZEA 2D73A 2CBIA 3LRKA 1BYDA 1VBRA 2OWCA 3M46A 1RP9A 1V6WA 4EE9A 3NSMA 5CJ5A 3HG2A 1UR2A 3VGBA 2ZXAA 5TD4A 3VOCA 4Z2LA 5AC4A 1QOXA 1EH9A 4P7RA 5CGTA 1B3YA 1XSIA 1E6ZA 3WUEA 4C7DA 2JIWA 4WSKA 3TA9A 4ZE4A 2VO5A 2PBOA 2WYSA 2GDVA 4MDPA 3CZJA 2GFTA 4W7VA 3ZIZA 4JKKA 4OGZA 2PWHA 2XYLA 1JXJA 4CN6A 2WANA 1KBBA 5IXEA 1MW3A 1ZBCA 4QLLA 3A22A 4UTFA 5CPSA 1XCXA 1JAKA 4BCEA 4KRTA 4M80A 1MQPA 1E72M 2A3EA 4S3JA 1VAHA 4LGXA 2BHZA 1AQMA 3PZOA 1HL8A 3WH7A 3WBEA 1JYVA 2IUZA 3AIWA 3WL1A 1VFOA 1HN1A 2G8ZA 2CBUA 2D1ZA 4DM2A 1CXEA 4D1IA 4OOUA 5FD0A 1D3CA 4W85A 3IJ9A 3OGVA 3ZJ8A 3WDIA 3KEHA 4CVWA 4MNLA 3AMKA 1E4MM 3RJYA 4PSRA 2W5FA 2VJXA 1QVBA 3WDRA 3B9DA 1MFUA 1UG6A 1KGWA 2CKSA 1HVQA 1A3HA 1OBAA 1PEZA 1VFFA 5A6BA 2GUYA 1GOIA 3WQ6A 3OG2A 4D1JA 3DC0A 1NWSA 4DUXA 3BVWA 3VIKA 1CZ1A 1OB0A 2RGLA 3ZSTA 4KMQA 3DYPA 1B3ZA 4CVUA 5EFDA 3ALFA 3K4AA 1BTCA 5ABHA 3DX4A 4MTVA 4MB4A 4D72A 4U2YA 2F2HA 2CNCA 1QW9A 5A95A 1KGUA 1QW8A 2WVUA 1E6QM 1NH6A 2EPMX 2DT1A 3L2MA 3AZRA 4W5ZA 3UG5A 5D9NA 4CD6A 2BHYA 1E56A 3BLBA 1W9DM 2J8FA 2XPKA 1ISYA 3ARRA 3UETA 3WUBA 3GXPA 1GW1A 3WN6A 3D50A 1CDGA 3GH5A 3UESA 3ARYA 4DWSB 3AIVA 3W37A 1KTCA 2X2JA 2DSVA 2YL9A 3BH4A 1V3IA 3WNNA 1GOMA 1KWGA 1R7AA 5FL1A 2F7PA 1XD1A 4U3CA 2XIBA 2WMIB 4AIUA 1H0GA 5CSUA 5I2UA 2WMJA 1GQKA 2WB5A 2W92A 5CLTA 1QNPA 5A6MA 4A4AA 1A47A 1O7DC 2WWCA 4U33A 3FNDA 3SEPA 1TG7A 3MUAA 3A3HA 2WSPA 3BAIA 2ZXQA 3B9EA 2ZUTA 1FFRA 3SUUA 2FHCA 1W2PA 1YHTA 2Z1SA 2JF7A 2YA0A 4CGTA 3AQUA 1SZNA 1NOFA 4W5UA 4WJXA 3VDBA 4MB3A 3T09A 3CH9A 4NXSA 5HDRA 3A5VA 2WCAA 3W6LA 2OSYA 1X1NA 1GQLA 3BAJA 1XSJA 3NDZA 3LRLA 3VMNA 2ZUMA 3BLKA 1FHDA 5A2CA 3D52A 1KXVA 3DYOA 2X09A 1CNVA 1C91A 5FIPA 4JCMA 1H41A 2VMFA 3QGVA 1UKQA 1GVIA 4W88A 2XG9A 4JHOA 4UQDA 4GI6A 2FHBA 2VCAA 2YLAA 3VVGA 3D51A 2BY3A 2W63A 3M07A 3LX9A 1QHZA 3VM5A 1LWHA 2F7OA 2WCSA 4WK9A 5A6JA 4JIEA 1O7AA 4J7RA 1CLXA 1C3FA 3JUGA 3MMWA 2DEPA 1CGWA 1XH0A 2CCRA 4WKAA 3K8KA 1V6XA 1HJUA 3TTOA 3VIFA 1HJXA 3VX0A 4B9YA 3AS0A 4M82A 1WDPA 1TQTA 3DX2A 3WD2A 3RCNA 3N15A 1JZ3A 4OBRA 1OCQA 3SCOA 4OOZA 4ATLA 1UKSA 3THDA 1E1EA 1WB0A 4WKHA 1CXFA 4OZOA 4U31A 4W93A 3G6MA 1L0PA 3ZO9A 4GZJA 1LG1A 1JAEA 2YL6A 4CD8A 3QR3A 4BQ4A 1HKMA 3T0BA 1WP6A 3I3BA 4LYRA 4W8BA 2EXOA 3J7HA 4AC1X 2J77A 4HZ7A 2XHYA 3W0KA 4UOZA 4LX4A 3S6TA 1GHRA 1QI3A 1WO2A 1V6YA 3DHPA 1ODZA 3W53A 2X2IA 3WQVA 3TOPA 1U30A 2XGIA 2E0PA 1PIGA 2WKLA 4JFVA 3AMLA 3WIJA 4PTXA 3KWXA 4CD4A 2VZSA 2OWWA 1H5VA 1WDQA 3APGA 2NSXA 1V6VA 1XC6A 1E6XM 1HVXA 1J0ZA 1JI1A 1NWRA 4FNRA 3VIOA 5BXRA 3CC1A 2VUYA 4ML4A 4W8LA 3L4VA 1M03A 4H04A 4LQ1A 2JE8A 5A8MA 2GDUA 4AZCB 3LMYA 3HG3A 5A8NA 3A6OA 2OSWA 1H2JA 1VF8A 3NCOA 4P7NA 4PEEA 2VC9A 3QOKA 2G3MA 1TVNA 2EPKX 3W24A 4E2OA 4PTMA 3S5ZA 1VFMA 1UD4A 3AROA 3VD4A 5BROA 1TQVA 4M24A 3RDKA 1IZJA 4AEFA 1EOMA 3TONA 3OLDA 1J0JA 5ABFB 2WAGA 1EO5A 2B31A 4BZYA 3MKKA 1DP0A 2J47A 2WCGA 4QLKA 3N1AA 2ZICA 3BUIA 4CU8A 5E6YA 1W91A 1JF5A 3ZT7A 4BA0A 1BGAA 1V3LA 3PZNA 1JL8A 4ZENA 1PJ9A 1H4PA 1J0YA 1KXQA 4F9DA 1DWJM 5BRQA 3K8LA 3LPGA 5HBFA 1JZ7A 2ZUNA 4HTYA 3T0AA 4J3TA 4CU7A 4JFSA 3WENA 3GM8A 3CZEA 3HMCA 1UA3A 5E9AA 3EMQA 3WDHA 4HOWA 2BNJA 1UD6A 3DDFA 3W26A 5CLWA 1CWYA 3F5KA 3MO4A 4JFUA 1FA2A 4A3YA 2CITA 4DM1A 2ZX8A 4M29A 3WH8A 1E1FA 1CGUA 3CMGA 1WZKA 1DTUA 3CUGA 2PWGA 1W9UA 3RJXA 1EHNA 1HKIA 4FLOA 1P6WA 3VO0A 1I1WA 1EA9C 1JDAA 5HNNA 3WQ5A 1LF1A 3CHEA 3GNOA 4PMZA 3WD1A 4HMDA 4MB1A 3RIKA 3DX3A 3EDEA 1HXKA 3SCRA 4DO4A 1B90A 3EJRA 3OLIA 4V28A 2XN1A 3A4AA 4PMRA 3D4ZA 3EYPA 3SUSA 1CXLA 5C70A 1XH2A 3S5YA 4UOJA 3EDKA 1H11A 2OWXA 4NF7A 3TTQA 1EGZA 1EQPA 1G94A
chains in the Genus database with same CATH superfamily
2AJZA 3E9TA 1BVZA 4PSPA 1CLYL 5F7YC 4HEME 4DZBA 4IBTA 2YZ1A 3ZHKA 4D71A 4ICXA 1WBXA 4PB9H 3PQYE 5LB1A 3R8GA 4LYKA 1JP5A 1RVFL 1S7WA 3KZPA 3P60A 4HJSA 5IB3B 5DN1A 2JI1A 4GMTH 3D47A 1PLGH 1FWSA 4XB7A 1FBIH 1PL9A 4ZRGA 1NDMB 2W91A 1HSBB 1N18A 4ODXB 2J4WL 4YIQA 4ZBCA 3U5YA 2K8QA 3L5LA 4HIIB 1RH9A 3PAZA 2JH2A 3FFCE 3HIZA 1V51A 2GUOB 3F8UB 3NFPB 2O6PA 2Y3AA 4OD3L 1AHWC 4GG8A 4RNRA 4BFBD 4DN3H 3W2DL 3TZFA 3CSYA 2BOBA 2QEZA 2VFIA 3KCWA 2RA1A 1FKXA 3GU2A 3SADA 4TUKH 1TNMA 2F7FA 3K6IA 5E2WH 1KFAH 4ZUWA 2IOIA 5ADPH 1ZTXH 4S0SD 2RDTA 3IJYB 3MC0A 3KLHC 1MG2C 1YPZE 4DGYH 4MYPA 4JDZB 4MZ2A 5CD3B 4IGSA 4ODXA 1SLUA 1N64H 1QQDA 2NYZA 2VEKA 4HXBH 4TQTA 4V27A 4FF7A 4Q97A 5ITBH 1L9RA 3ROLA 1KRMA 5DFTA 1SMAA 1MZZA 3RU8H 4Q9RH 3G6LA 1TCMA 1A0CA 5IV2B 2QVKA 2HFGL 4XP1L 1BQCA 4PJHB 1FBAA 4OBSA 1VFBA 1FCUA 3OAUL 4GYPA 4HHPA 4TLSA 4YHNB 4UV4H 3II2A 5HUPA 2P24B 3T3PF 2GIXA 4LOVA 5I23A 3FQNA 4G42B 3SE4C 2XGZA 3CHQA 2H1PL 2IJ0C 1UT9A 1XCQB 2IPUK 4WF7A 1JWUB 1XR8A 2C9AA 4Y7EA 3RILA 3KWVA 5AB3A 5JIMA 1ICQA 1T4KB 5EFFA 5A69A 4JM2F 3A47A 3QCTH 1MXSA 2GKIA 3KYMA 3QDMA 1M7IA 4M4PA 1Q63A 1TV3A 1L6FA 4FXTA 5BUGA 3JZ7A 5LUMA 3TFKD 3VOFA 4JE0A 1ZHAA 4A6YB 3O6CA 3V9EA 1IGCL 4WHTA 4ZTEA 2PDXA 4WUUB 2QJHA 1F4XH 3CDFA 3GHBH 3THUA 4Q0XH 1H15B 3P2TA 2N7BA 1OVZA 4PJHA 4YHOL 1NAL1 2ZXDA 1W3LA 2HG5B 1R3VA 4XZUA 4AGQA 3CFBB 2VX7A 4DI9A 4ENZA 3H4GA 1LLAA 4Y4HB 1TZIB 3IXAA 3B37A 5ABZA 5IFAL 2D7PA 2K9FB 2PMZA 4I7ZC 1GONA 1EZUA 2O4MA 3GRIA 3QRHA 5LA1A 3NL6A 2YUZA 3I6LE 1NUFA 1A53A 5SWSD 1FFNA 2FE0A 4AV4A 3LH2L 3C2FA 4XD6A 3LQAL 2Y6SD 1C7TA 1OSPH 1EMTL 1KCVH 2F08A 3PCYA 4DUVA 3UY8A 2HH0H 2ERJB 3C5QA 4BDVA 4LGPB 4MD0A 1AD9B 3GDKA 43C9A 4GSQA 3F4DA 1BQRA 3GUTA 1E3XA 2LLLA 1I4FA 1J9TA 3ILQC 4JRXB 1FGNL 2MOGA 4XBGB 1XGRA 4C4UA 1B1YA 3CQJA 1UZ1A 4F7CB 2WTRB 3VKCA 1AKJA 3IYLW 4YBQD 1KFWA 4FHAA 4P57B 1E71M 3ZKXC 1D5ZB 1J8KA 2Y7LA 5EO1A 2NYYC 3GAYA 1KXTB 5K9XA 4Y19E 1IR2A 1GMEA 1RK6A 1HU8A 4LESA 3MANA 3MPCA 3WNMA 2ARJA 3EH1A 3R7MA 2NY5L 4H1ZA 1S7WB 3MJ8B 2P53A 4Q4IA 3UNTA 5CJMA 1X5AA 3KHDA 3EYQD 1F2QA 4P46D 1VLIA 3FOLA 4YYCA 1IBZA 1PG7H 5KYYA 2F2KA 3C0JA 2AJYL 4ZZFA 3IIPA 1EZWA 2WPBA 3HZVA 1YNKL 1KT2B 1T7VA 3FT4A 3GLZA 3IKCA 4F27A 3RZCA 4GC3A 1DDHA 1SVBA 3DG7A 3MJ9H 1ZHLA 4JFFE 4ENEC 4ZR8A 2O6EA 5G5DB 2CUMA 4WDXA 3V9CA 1EF3A 1H7XA 1CBVL 4KESA 2I56A 1D5XB 2AK1H 2CXGA 3K4DA 3ZMEA 1XH3A 3RAJL 4B9IA 2TMDA 1KTBA 3OG6B 5FI8A 2ZZ1A 1PBYA 3W1LA 3N42B 3HLAA 5T3XL 1WEJL 5I07A 3T77B 3ENEA 3W74A 2VR2A 4GRWF 4HD5A 1CZ8L 1J9SA 3MNWA 4R7VA 4PB5A 4E9YA 2A77L 1AGFB 1YVLA 3QDHA 2DQTL 3RI5F 4NAFB 3AW5A 1UCBL 4R4BA 2VDLH 4S0TD 5KSBE 4F2BA 3C61A 1F45A 4TX8A 3W3OA 4YHLL 2YGQA 4JTSA 1OAYL 3NA9L 4DHGA 2H2SD 4JZNA 3DC8A 4TQIA 1TKWB 2Y7QA 3LEVH 3EH3B 4TVUA 1AZNA 1UWGH 4ZFOA 4H1LH 5DMNA 2XJ7A 3WL0A 4MMXB 4INFA 4J1UA 2DD8L 1OALA 3JSSA 2BSLA 4Z78B 4O58H 5CQ1A 4PJFE 1NCDL 2CZ5A 5AB9A 2DLFH 2XWJB 2WQRA 3VWKB 5I76A 4UT9H 1YCSA 1YN7A 2R23B 1E9QB 3FT3B 3PWNB 5FF6B 4AEIH 2IVFC 4AT6A 5FGCE 1XLGA 3BUDA 1FUNA 1FHVA 3EWBX 2WQUA 4D9LH 4OI9A 4L3ED 5JORA 1G6CA 3DGRA 3DX6A 3U48A 4HF5H 2EVIA 4PY7B 2G4JA 2X1TA 3MRHA 4JMNA 3D8MA 1W1TA 1CYXA 1FAIL 2FCBA 3QFJA 3TA3A 4ZUUA 5FYJH 1USZA 5EZLB 4OE7A 3FOMB 5TDOA 4E9WA 4FS9A 5FECB 4AK1A 1RPUA 5D2LB 3N6YA 4CGUB 1ZHBA 4PJ5E 5HWJA 4PS4H 1IGFL 1TVHA 3VFOA 4IL2A 5I5IA 4A35A 1FIGL 2HJLA 4X98B 4XNMA 4XZLX 5JPMB 2AKMA 1W16A 1XGRB 5C0CD 4K3GA 5IHRA 1UOKA 1NIAA 4N24A 2RFGA 2XN0A 4H9UA 3DX5A 1KTLB 4X7SH 4DW2L 5C3LD 1G0XA 5IWLC 2WWKO 3H22A 3PABB 1OPOA 3OL2A 3VQMA 3A12A 4XNYH 5CS7A 1MDTA 2P5EE 2A5UA 4U1KB 4YN3A 4Z7QB 2XH0A 1NQBA 4YHIA 4A2RA 4LKXA 2G5BA 4MB5A 1R6VA 3TF4A 1CT8B 4X9HA 1MUWA 4HJ0C 1P4LB 4TUOB 2F54D 4Q6IC 4JTIA 1MHHA 3BGFB 5GIRA 5I28A 2IQAB 3SDYL 1A6WH 5D1XA 1W0MA 3PABA 1DUYA 4JY5H 3QFWA 3B2PA 4O53A 2WINB 3FFSA 4YVXA 2ADGB 2J72A 3MTXA 3MTRA 2QCGA 4GPNA 1CG9B 1NDZA 1A8JH 2IW0A 2DLFL 1I2QA 2Y89A 3QNYA 3HNVL 3QUKB 1A7RH 2WZ6A 4JPKL 3DROB 1SEBA 4X4XB 1XUUA 1CLKA 5M17A 1CXHA 3B56A 5FF4A 4GX8A 2FYVA 4C83B 1E8YA 1ADDA 1F74A 1ZVYA 2X6VA 1WV2A 3FT9A 1SVZA 4PGBA 4CADB 1FVCA 1KPVA 3MOBL 2BERA 3KZ8A 4K9EH 3DJSA 2XTKA 5K1JA 4LO9A 3DX1A 1DQQA 1YEFH 3QJFA 2HVJB 3FQNB 4G42A 5FYJU 2CKRA 3S9ZA 4A6YH 4FTVB 1WEJH 4JANA 3QEHA 3A3XA 2DF3A 4ZS6C 3FQ1A 3GUFA 5IBLC 4PIRF 3K7UA 3SGJC 1A7RL 1XAKA 1KPVB 2QELA 4PYGA 5B7FA 2DRUA 2B0SL 1A5AA 3P0VH 1E5JA 1ZCRA 4FI7A 3CIAA 2VTFA 4JQ4A 5BOPA 4NASA 2VUOA 2O5NA 1OX4A 2A2IA 3UXDA 1M7XA 1GYAA 4DYEA 4MSWA 4Y9CA 2RTTA 5IKCB 1IAIL 1RJLA 1W15A 3S3BB 2A7RA 2BOEX 4IG2A 4OM1L 3GHEL 4Z0BH 1TVHB 4DPPA 2WXGA 4FZEL 2HV5A 1TFHA 4E5TA 1E5NA 2EE3A 1KN2H 2ISVA 1L9NA 1OARL 4X4ZA 2E47A 3D2TA 5DJ6B 2E3VA 3UAJD 1IGWA 2Z91A 5TK4A 4R90L 4ZOEA 4WGVB 1E9PB 4YLCA 1H3UA 5TQ2L 3UW6A 4U7KA 2YAMA 2COVD 2FTWA 1GPFA 4DKFH 4A67A 1HKKA 3TASA 4Z8FL 3CFJA 4TQEH 1G0CA 1XLFA 3VE7A 5HOSA 1IFHH 2VN5A 3G5XB 4N2GA 2VR4A 3EG9A 4HMEA 3XISA 1GZ1A 1C5BL 4GUPB 4PW3A 1AQHA 3TE9A 4HJJH 2YX0A 3EBAA 2EDFA 4FXGA 5LA0A 3DOSB 2GHWB 2AABL 2VFHA 4E2BA 2NXYD 3VXRB 1KBKA 3FFOA 1ZHKB 5HYEA 3JZYA 2VN6A 4JQXC 1V05A 4UV7H 1OSPL 4XCCH 4XHJD 5DYOA 5IF0A 1SBSH 3BQUB 4X6BA 4KS0A 4HF5L 4BK9A 4IRSA 3MFFA 1L7TL 4FERA 4HLZG 2DIAA 4NX0A 5E8EA 1TG8A 1LO0L 3ZT6A 5DD6B 1TSHA 2JF1A 3AXLB 3F7QA 2Z29A 4CCCA 3MLWL 1LRNA 2NY0D 2ROYA 1P5VB 1ZTVA 3PWAA 7A3HA 5A40E 3RGVA 1RPQA 1HUVA 5AW2B 1A02N 2DD8H 1ZBKA 4R7OA 4H6EA 2Y7NA 1GOGA 1R3HA 5BZWA 5L6YL 4PTVA 3FFCA 4K3JH 4UT6L 5SWQA 3FJTA 4YHOH 3WFDH 3QV6A 4N6EA 5C5YA 5KBDA 1BRLB 4L6HA 1I1AC 3KYNB 4RFEA 4HNVA 4MQ7A 3MXWH 1L6WA 3DPBB 3PHAA 3R19A 3GVWA 3HE7B 1NWPA 2XZCH 2BSBA 2P42B 3FTSA 1DQQB 2CHNA 5ACLA 3C0LA 3AITA 4NM8L 5SWQB 4Z2KA 3SFKA 1KJMB 1H5BB 2FQGA 2MNJB 3AO0A 4OLVL 4IGBB 1XBDA 2L5HA 4X6DA 5PTDA 2HEJA 1L9TA 1UP3A 3MLVH 4UV4L 3CVBA 3KMDA 4O52A 1XSKA 1GGUA 3GTHA 1U8NA 4WVRA 1EO8L 2X4UB 4R96B 5HMDA 2ABBA 2VXNA 4DBWA 1BGGA 1G9HA 2BVQA 4X4XA 3GLCA 4M19A 3V6BR 2ZF8A 3RU6A 1IJNA 1E73M 1TQBB 3NO5A 1DBBH 1IM9B 2AJYH 4BFOA 4A7VA 1KYOJ 3HI5L 5K1VA 3V9FA 1UOVA 1S1PA 4HUKB 2GGEA 4H6RA 4ERIA 5EV7A 1DJYA 4X22A 3CMOL 2OLHA 3R89A 4S11A 5JW5A 4PB4A 3S4TA 5L0QC 1KJ2B 3LGGA 5AFDA 3OHMB 3W83A 1WDDA 1I6NA 3RNKA 3ZTDC 5HGBB 3GLDA 1EX1A 2VDGA 4A2MA 3BL3A 1YEGL 4QUOA 1QFEA 4JJOA 4ZO7A 4UTWA 3IMTA 4UOQA 3DN5A 5DQJA 3STLA 1C7SA 4IQLA 3WF4A 3RVWC 2VWTA 1K02A 4WWNA 2C3WA 1JPDX 3GJEB 4JFZH 1XEUA 1WICA 2N59A 2OCFD 4AV5A 1V0MA 4YUEL 2FQEA 1BQUA 3MRRA 3SCMD 2FZMA 2KMWA 2J74A 3UR8A 1A9EA 1RJLB 1NBVL 2NY2B 2CDFA 5BS0D 2PODA 1PLGL 4CILA 3D85D 4W7UA 2VLLB 3EJZC 1OX4B 2XFWA 1N4XL 2CMRH 3TN4A 4NZ1A 4YBLC 3KYKH 3HKZA 5IFAH 1M42A 5ANMB 1IXPA 5E95B 2GUOA 3FFCD 4RKAA 2NY4C 4ICCX 3H6OA 1OW0C 4G9DB 2V17L 5DEGB 3QXUA 1TSRA 1NCCL 4HKXA 3MHZA 1I8IB 1XHGA 6TIMA 5AECA 5CO1A 3OAYH 2AJ3A 1V02A 4ONOA 3RX8A 2OX1A 3WK3A 4FEZA 2YK1L 2WLKA 4IRSD 5CBAA 1KV3A 2Q7YA 2ZZ5A 3OZYA 3HE7C 4WQOA 2SFPA 4MJ5A 3WFBH 4NKCA 1RQ5A 3ME0B 1XT5A 3FTVA 5DMIH 5F6HJ 2DUAA 2OFJA 1BBJA 5CHNB 3SIKA 2RALA 3VTTA 1RL1A 2YQ2A 3FYPA 2DT3A 5I19L 4WGXA 2OMUA 2HFFA 3SRKA 2UZXA 1PG7X 4JCLA 3T3MB 2BMBA 3LIUA 5E94A 1US3A 2OW6A 3PB0A 2CU9A 1XF5A 5C8BB 4XPAH 4O1AA 4I6KA 4IGBD 2YRBA 2FNWA 1O4UA 2XACC 4W8AA 3DOPA 5HHME 1YNQA 2LAGB 1QPKA 3GYRA 9XIAA 3FQWB 1NPUA 5DZPA 1H0DB 5JQ6L 4KH2A 4IJRA 2FVNA 2N4IA 3BDKA 4CCEA 1HQTA 4DO5A 3VXPA 1BMGA 5I3DA 3AACA 2WZPA 2B81A 4PRNB 1IFGA 4MCYB 1LROA 3TYFA 3CYVA 5J56B 1ZT4A 1YQVH 4JVPA 5C7ZA 3QQ1A 2WMPB 3RDTD 4LLVB 2PDLA 3SYCA 4JPVL 3VNJA 3S5OA 1E4WH 3ES7A 3Q1SL 3TYGH 4D0DA 4TUKL 1KBGH 3LRMA 3CH9A 4LRNL 1TLMA 2NY7L 2IKHA 1UWXK 3GRGA 2ARJB 1VBGA 4Z7UE 3BXNA 2W0PA 1FYHB 1TVDA 4HC1A 1BGXL 1KGXA 4X98A 4XNMB 3RRQA 3IJ7A 3U6XA 3OKNB 4L5FE 4NLAA 3O8XC 4NG3A 3FUJA 3MUIA 3N34A 1MVFA 4LARH 1RK1B 2CZNA 3GI9H 4A7QA 3MUXA 2DWDB 2E9BA 4EF9A 3F5WB 2FJKA 3EUUA 4NZDA 1FVDA 2ZF9A 3NH7H 5M3WA 5BJTB 3BW4A 4IOIA 1JNLL 3VA2C 4FPSA 3M0LA 4N0YH 4HYWA 2V3EA 3W1QA 2O30A 2EAWA 5D7JD 4YWGH 2XM1A 3QS3A 4YK4C 4IOFC 5CMAA 2LOEA 1JZ5A 4M3KB 4D9RD 4E5XA 3EJUA 2WLLB 3PY9A 3VXOA 3G6JA 4JPIA 4UT9A 4I5UA 3BVNB 4RPQA 1V55B 1JK9B 3OPUA 1J9CT 3PWPE 3W7EA 3SCSA 2ZWSA 5C0DA 4BHUA 4Z7VA 3N4EA 4NIRA 3Q5TA 3QQDB 4TMCA 2TSYA 3OQ8A 5EMMA 1VRDA 4L4PA 3SQMA 2J88H 3TBVB 1AXTL 5A2FA 2ATSA 3FKUS 3BN9C 2AXFB 3GPSA 3MDWA 3RX4A 3QZAA 4FABL 1H8LA 1MCEA 3VRIB 2DM2A 5HHVH 3UXLA 1JRHL 4NQVA 2YSWA 4JFED 5HP5A 5A7EA 5IFHL 2YXMA 4Z7VB 3N43F 3IJEA 2EIZB 1QMLA 3SE8H 1JULA 4M61A 2NV1A 3VI3F 3VXOB 2I5IA 2DICA 3QNXA 3TJEL 5JW3H 4GINA 1ELSA 1U8CB 4R84A 2AI0L 3V0EA 4LWWA 1FCCA 1V4YA 5TE6L 3GS4A 4WWID 2J7EA 1MRCL 4S2SA 1FP8A 1N68A 2AEPH 1XF5B 3TEXA 3QWRD 4YXLH 4HS3B 4JN8A 5DUPL 2VC2B 1C5CL 3TJHC 4CCZA 1FPTH 1W3HA 1OM3H 2GQAA 1T7WA 1BCIA 2K3TA 2B2XH 1L0QA 3G5VB 3QR1A 4JPKH 1IAKB 4P5TA 5KSBA 1JZHA 3QWOB 1EDHA 2YD1A 5EEUA 1T0OA 3P14A 3HB3D 4QHLA 5C0GA 4XBSA 1NM9A 5DBTA 4TUJB 1SOSA 5F7DA 1AY1L 1ROWA 3VG0L 2DQEL 1S5HA 4RWYH 2O9PA 1M04A 4I2XA 3U30C 2JBMA 5I0YA 1LK2B 4HNLA 3BQVA 3N29A 5I75B 3UWYA 4PUMA 3P0YL 4XTRC 1PY4A 4HD9A 1IO4C 4AWSA 3KEDA 1JVKA 5FB8A 2ZOKB 2Q3ZA 2R2BA 2XLLA 5AVZB 3FJLA 2CGRL 2R69A 2EC8A 1QBMH 3GSOA 3SYPA 2PO6B 1GTHA 5CGYC 1M1XB 2XY1A 1KB5B 2BNUB 4FZ8L 3E0VA 4GH1A 5F9WB 3R10A 4Z2GA 2I27N 5LNRA 2WD0A 4P2YA 2EIDA 3MUZ1 5L4IA 3SDAD 1P1VA 4AQAB 2X0SA 5DBUA 3T05A 4JO4H 1UD5A 5GGTH 3UTTE 2C1HA 4WW2B 2ZOKA 3O6AA 1OSEA 1AMXA 4DKTA 4XO9A 3H2NA 4LB4A 4WWPA 1MJJA 2JFCA 2DTSA 2HAZA 5ABFA 1H63A 4XWGH 3AU0A 4OIIH 2XJKA 3PZ9A 1TZIA 1W1YA 3MV8B 3W1AA 3OW1A 1RZPA 1JGLL 2F58L 2VWEE 4M4RB 3RBGA 3NQAA 3UBXG 1R34A 3ZKSD 1WXZA 2OLDA 3Q7JA 3L4CA 2WV3A 4EQ3A 3CFCL 5JPNB 1VGKA 1ZS2A 4XSMA 4YCPA 1U93B 4UT9L 2NLJB 3BICA 2NV9A 4DGIL 2AQSA 2ATMA 2BIPA 1I0DA 1XVSA 4M56A 3QKEA 3LNIA 1AY1H 5GGVH 1WKYA 4M1GL 5CN3A 2M1KA 5CU5A 3JVAA 3FQYA 4UC5A 3NA9H 4RCAA 5BCAA 4KIRA 4NT0A 5DCBA 1BAFH 4XAWH 5ANMA 3AG4B 4JICA 5FUZL 2WO2B 2Z64C 1ICPA 4WOZA 5DJCB 1W5MA 2FMOA 5KANG 1B0GB 4X7TB 4E41E 4LLWA 4ZMNA 1INQB 1MXGA 3H0TB 5CSZA 2YDRA 2F5AL 4OCYH 4ZMGA 1MDLA 4IIGA 3UR5A 4Q22A 1C12A 4OLUL 2BP1A 5KVDE 3PDDA 1R24A 1M2OA 1U93A 2YPLB 5C09E 4GY0A 3D2UA 2Q6ZA 1GJWA 3KXFE 1IEQA 1PL3A 4HIEB 2AK1L 4O51B 2DJSA 2W3ZA 1AG6A 3BWSA 5JZ7D 3SBWC 1UH3A 5FFLA 1H7PA 5EIIG 3U25A 3U82B 3V0HA 1EC9A 3RXZA 4A7TA 2E6YA 1TWSA 4NX5A 1LQ0A 1I53A 1ISVA 1MCPH 2HX8A 5L7XL 1A80A 3I68A 1YNKH 1IGJB 4Z77A 5FGRA 1XDLA 4ZUWB 2OTDA 1K6WA 4WNSA 4GA8A 4A8NA 3F6LA 5IUSA 3QSKB 2FR4B 3QC0A 1ND0B 1UM6L 5FWRA 5IB5B 4DPRA 2Z24A 4TX9A 4KNUA 4JO3L 3DJ9A 1MW1A 3SURA 1JK8B 1DQVA 3TX4A 3VU1A 5TIMA 2A3HA 3TJLA 3GS0A 5B21A 4GYBA 1WWWX 3QCVH 2BZ7A 3QQ3B 4UDTB 4BFGA 4DBEA 1V7NH 1QK2A 3R79A 3CZUB 2VERN 4KGLA 1MFEH 3B8SA 3UFIA 4BFKA 4DVRH 3VQ1C 1O6IA 4JR9L 4LCCB 3MR9A 1W3NA 3G1SA 4BH7A 1BQHA 1UJ3B 4KKPA 1H1YA 5AZEH 4YSSA 5D93C 1R9ZA 1RLBA 3MFFB 2APTA 2WBGA 4GSUA 3DFYA 3OR7B 3VXUA 4B27A 2CWNA 5DELA 3MACH 2IKGA 3UJIH 1X5IA 3BAEH 4NO0A 1UBSA 1DVUA 4NGHL 4ZDHA 5E99L 3ISYA 5B7EA 1JEZA 1GVYA 4J3WA 4PMYA 4IIQC 4FA7B 4IUOA 1F8TL 3DLQR 2FSEB 4NN5C 2NY0C 3W7RA 1XF0A 3BLIA 4GUHA 4NHVA 1F7BA 1X39A 3NJFA 4L1GA 3TWCL 4QLWA 2PDWA 4JFHD 3A4XA 4JKMA 1RKRA 1ZLVH 1YJDL 1A7OH 4WEUD 3A4WA 4K6AA 1OGGA 3WF3A 5I18H 2FTYA 1IBDA 2ZOWA 1PFOA 2CETA 2QADD 3O9WC 1E6PA 1YQVL 3EPNA 1U5HA 4JTJA 1VCFA 3DIPA 4P2AA 1KCLA 25C8L 3PQYB 3K5SA 1PEWA 3H1ZA 4FKEA 1AACA 1BAGA 5EOTB 1FP9A 5CJQH 1I2NA 2HCZX 1SFTA 1GYVA 2BK8A 2D4FA 1V6TA 2B7PA 3F4VA 2ADIA 3JZUA 4XG1A 5C8JB 5I71C 3UZYA 2PI6A 1KZYA 2WLYA 3QY7A 4MWAB 1O5DT 1RAMA 2LV4A 2BG5A 2WZIA 4PJ7E 4WTZA 3RUGA 5T3ZD 3BRGC 3PBYA 4WRHA 2E77A 4IRSB 3AZSA 3A4EA 3RY5A 4UAHA 3ZE0F 5T5FH 3BG5A 4B0MM 4GG6F 4G8IB 2QKIB 2I7SA 1IM3D 1KB5L 2VSCA 3OTRA 1UXWA 1L6XA 4JUTA 2XGBA 4TOYL 4Q4QA 1CGXA 4OVVA 4DAGH 3L5HA 1JZ8A 4R2GB 4N5ED 1K3UA 2D31B 3E0LA 4QCIB 1SXNA 4H2CA 4XE0A 4WV1A 1IGYB 2WUCL 5D04C 3B4YA 3WF2A 3QW9A 2VWEC 3GLEA 3RPIB 2P10A 2GTWB 4H26B 3GB6A 5CMAB 2B5IC 1KIRB 4AL8H 2QV5A 1CQYA 3RU8L 4Q9RL 3IVKA 2DDXA 2V9DA 4HCRH 4ECLA 2NW2A 3JV4B 4MJ2A 1VIWA 1MI5A 1E9PA 3BIKA 3K6OA 4XX1E 5IM51 3QIUD 2JJTA 1FG9C 3QK0A 2R0KH 4US6A 1DQLH 1TMHA 3NCEB 4HWZB 1HESA 1L3WA 5DMJB 5F1NB 2HROA 3W7IA 1U8LA 3MRFB 1TYGA 3FB5A 3US9A 1FH9A 4E6MA 4PHZA 1EUTA 3I3DA 4L5ZA 2NTSP 4E0CA 5DJYA 5A8OA 1O66A 3CIXA 3CU7A 2QDDA 2NQLA 4OGQC 4HNCA 1KQYA 2NX5B 4KFMA 2V2DA 2WTOA 2NSMA 3DOSA 4WWKC 4MA3A 3WLRA 1PZ1A 3V4VL 5BWAA 2R69L 1PLAA 1B0IA 1E0TA 3L12A 1S5VA 4I9JA 5CG0A 2EKCA 4IIEA 4ZNCD 3FU9A 3ZJKA 2XT1B 3WEBA 5HGBA 5DVMA 3QCUH 3BCDA 2J7HA 5EZJA 1M6OB 2APXA 5CC5A 5HPCA 3NZ8A 4ILDA 2WB7A 2HQAA 1C8XA 5EEVA 1E5ZA 4BA8A 3MREA 4FEIA 2OAAA 3Q2DA 3VFTB 4RDYA 4W9TA 4LSPL 4L8CA 6PTDA 5M95B 3QC5X 1SLWA 2YAQA 1IGIL 3CDZA 3FDWA 1JGMA 1VFHA 2AQWA 2C79A 2CLHA 1ILSA 4JYDA 3W7NA 1B31A 3U83A 1KM0A 2Z7ZA 4B9JA 1RCXB 4X0VA 4G6KL 3HW7A 2V2WB 3CSPA 3MMEB 1BBJB 3QS2A 5CHNA 5F9OH 3BC9A 5I0ZA 5HHMB 1I45A 1TUFA 3PVFA 3L5WB 5KSVA 4RQQB 2BSRB 5F3HA 5GRVL 4A39A 1ONXA 2ZCGA 3CAQA 1DBBL 1G7IA 4ZOAA 1DJGA 1FP5A 1JTOA 3TBTB 1QSFD 3DX6B 2UYLB 3VC5A 4LXFA 2QJIA 1I1YA 5EDXA 3DV4A 1B30A 4OFQA 2CK0L 4F0SA 5F4WA 3I6GB 3C8DA 4JGJA 5LWYL 1U41A 1D9EA 3P5YA 4IRJC 4KHTH 2CHWA 3LRSA 3MUGA 4P04A 4Q52A 3FEQA 3JV0A 1E15A 2F84A 4PC8A 2X1XR 4K37A 2JI3A 4C4KT 2C7FA 4H8WH 3TT3L 1CK0L 4HISA 4YHIB 1B4JL 3MN8A 1Q1JH 2DZXA 1HDMB 1SHXA 2E9JA 1R2RA 3UWQA 3BSZH 1QRNB 1EOKA 1LMIA 2HWZH 1GAFL 5BZWB 5I5MA 4LMQE 1KULA 4XCFH 4O13A 3SDDC 3L3GA 3EH5B 3N19B 3ARGA 5DC0A 5DWPA 2XZ7A 1AZZC 4D3CL 4R27A 2R14A 3L0GA 4IP4A 5F2LA 3WLLA 4O4YH 3BQUD 2YDAA 3NCJH 5DT1H 4PMEA 2VVNA 2WW5A 2OJEB 1GSMA 3BDYH 2IIJA 1NLBH 4GIOA 2ZTBA 3KXFA 3RWFA 4WI0B 4XB3A 5J9PA 4HJEA 2UY5A 4AQ8C 3LKPB 3MUY1 3ULVE 1W3JA 4RNFA 5D1XB 1EJOH 2CR0A 1DZ0A 3ABMB 4HXAL 4F8PA 5C0CA 3O0LA 3T6WA 2ZZ6A 2QF8A 3UTPD 3GR4A 3ARPA 4N22A 4XP4L 4GYJA 1B9ZA 3EGDB 4OSUH 5B39A 3L4TA 1F00I 3NUKA 1X5KA 4JHAH 3WBDA 1TV2A 1HWHB 4LSUL 3SKOB 1E43A 2WNQA 2ZRVA 4H7ZA 3NSCA 1WT5C 2X3BA 3QFJD 2GK1A 2KZKA 4NLHA 2OSXA 4AEHH 3BG9A 2NLIA 4MSSA 4R3UA 2X12A 5FM5M 4PMJA 5AVTB 4OJCA 2V4LA 4UMSA 4MF4A 3KAOA 2B9AA 2GI7A 1KNOB 3CMFA 3GZPA 3QIUA 3QUMA 2KZBA 2EPOA 1K4CA 4JNMA 3WK2A 3NCCB 4WTXA 4G9FD 1BVOA 2Y8VA 1MIEH 1GVOA 2XJLA 4QR6A 3QIWA 4LHUB 3NYDA 4LBAA 5C9JB 2PCYA 3F12B 4NQSB 4PODA 1G0DA 4HH8A 1KKRA 1X5ZA 3T77A 1KSRA 3DX8A 3L3JB 2RDUA 4OFVA 3QNZA 2Q7AA 4FQ2L 4O5LL 4X5PA 5DMGC 1LK3L 1IT9L 1DBKH 2CRZA 4F37K 3G04B 2GT9B 3IAGC 4UTIA 2Y07H 8PAZA 3WFCH 4QJ1A 3T4YB 1RV6X 4OFYD 5EBLB 5GSRB 1VEMA 2WY3B 2BDNH 2E7DA 3GHEH 4LCYA 4TF4A 4X5RA 4P8WA 4D6DA 1CGVA 4O00A 1JGEA 2Y06H 1AS8A 3V5KA 2VLRA 2LLEA 1EFXA 4MNGB 5DRWA 4AYDC 4L0ZA 3MXVL 4IK6A 1QSFE 2XWEA 4RWHA 1TQWA 1NFDE 2UUDH 3TZVD 4FIRA 3QQ4B 1JCTA 2N0MA 3ML9A 3SFWA 4HSAC 5DJXB 1GHFL 1P5UA 4PJAB 2OCJA 3FRPA 3L6FB 1WKEA 1XDJA 3S5LA 1WGOA 5JR1L 5KVEE 3AIRA 3LLXA 3QUYD 5I6NA 1I1FA 3BAKA 3V7AG 2H9AB 3L3JA 3C3UA 4UTBL 5CWSB 1P0EA 2Z7KA 1PCXA 4GO6B 4GHRA 3LKNA 4KI1A 2BFGA 5GZOD 2J9XA 2P80D 4I9TA 3AZUA 5EB9A 3QPYA 1ED3A 3MNZB 3L3DA 5IGXH 3V5CA 3ARXA 3DGGA 3Q5YA 4MMZC 3CT2A 1SUJA 4LLUB 1HINL 1AH3A 2XDFA 1L7IH 4QXVA 4X6BB 2GEEA 3W2UA 4PD4K 2Y5TA 4LCIH 2WTPA 2J8UF 3LPPA 5T33H 3I6EA 1W56A 1EJ8A 2PPGA 4JPWH 4P99A 4P9HC 4YYFA 3VDGA 1ZE3H 3WKML 2ZCZA 3HC2A 5FYLD 2UV3A 3RVTD 1XCQA 1WTGT 3RLSA 3UTTB 5IJBC 2O92A 2V5CA 3SN1A 3WUWB 1TQCB 4JPSA 3V0IA 5E9XA 5I6PA 4LE8A 3M44A 3N3MA 2YXGA 2P24A 5LGZA 1ZLUH 7TIMA 1UQSB 2ZSWA 4NZ4A 3MLUH 4O10A 2QGDA 3N44B 4OLZH 3QEUB 2PWDA 1LD9B 3W02A 3J27A 4GXVL 5IDIA 3HI1A 3FCGA 5C0FA 5HHNA 2XVGA 5F44A 4GX9A 5CUSL 3ZVIA 3QORC 4C56D 3CVHL 2XSAA 1AR1C 1QK0A 4IBZA 3U9PH 3R13A 2D0FA 4PMQA 3D39E 2AMXA 4GG6E 2QUNA 5LGJA 3MRCA 4Y19A 4F2EA 4GAYA 4UQAA 1YLBB 3BESR 3V4UH 5CPOA 3CZ8A 5EO1B 1KR1A 1AFVL 5EU7C 4CKVX 3PFQA 1HKFA 2BB0A 2WLHA 3SDDD 1K7EA 2VAJA 5F7WC 3VNIA 1L9QA 1F18A 2W61A 5JQHC 4RVBA 4YJZL 1OGSA 4OV9A 3G08B 3PL6C 2Q10A 4GMSL 4WDIB 4PJ5B 4KWSA 1KBLA 1UM5H 5DJAA 4CQCA 4XPGH 4NNPH 1AP2B 4MKNA 3WCZA 1Y18B 1MEXL 2AQNA 2HVKB 4G3YL 1J10A 4AW4A 2KZ1B 2BVTA 3IVKB 2HVMA 1DVTA 1J05B 5JMOC 1U8KA 1R3JB 4AZ8B 1AQDA 1D7CA 2ZZ3A 3DAQA 3QEZA 4AVJA 2D3LA 3D18B 4QXTB 1TZ8A 2VR3A 5IP4A 2HJKB 3PTQA 4ILSA 3D4YA 3FQUB 1SJDA 5DS8B 4B4FA 3SKUD 1PNDA 1UWEH 3QISA 1OK4A 2XXFA 1WDRA 1X7SA 2X1QA 2OMZA 2XWZA 2H32B 1TJ1A 5F7LB 2YD6A 5BS0B 5J5EA 2ZRZA 2BSSB 4YIWA 1IIIA 4KTEL 3ROLB 3CX5K 4XN2A 3WNOA 4LP5A 4BV1A 3N2CA 5E5MB 4IJTA 1I1XA 3H2CA 4ODHH 1YEKL 5E8PB 2Q8AH 2E5CA 2UX6A 2V2WA 5EBAA 5IHZA 4KKBC 4DK5A 4GAFB 3L2IA 3DROA 4EMZA 3VABA 2QJDA 4H88L 5IFPA 1LGVA 1MCWM 3KL0A 1SQ2N 5GSVB 4P46A 4FQ1H 1F6PA 3SSJA 3NSDA 2OMWA 1NMBH 3RL1A 1TPH1 3B7RL 4E4PA 1UR0A 1CDBA 1RZKC 3USZA 1TPB1 3UG4A 2I24N 1RPXA 3T2OA 3FTZA 2QR0B 4LV9A 1MFVA 4FXJA 4J3ZA 5EH1A 5FJTA 2PPCA 2VKWA 2W07B 1WS7A 4G8EB 4JO1H 3RWJA 1H3GA 2EC9T 1UADC 2O4QA 3C52A 1UEMA 2OYKA 1WSST 4JDVA 4GSDL 4X5XA 4IXXA 3ARBB 3EMCA 2XI9A 2EDJA 2VXQA 3NRPA 3RWCA 4P2CG 4MAZA 1T6WA 5IJVB 1K8YA 3D0CA 3BP5A 4LYPA 3WD0A 3WLNA 4KTYA 1BFOB 1J8HA 2JXMB 1Q3NA 1UWUA 3W2NA 4YXGA 5J5RA 1CGTA 2E7LC 3VKKA 1FO0B 2F8OA 4KI5D 2PYEA 1P9MC 2PWVA 1WCQA 4O0QA 2IH1A 5DJYB 3A0OA 4Z2IA 2VLKE 5AOZA 5AAWC 4NJJA 2Z31C 2FTPA 3NCXA 1GW6A 4M6QA 4JAWA 2ZADA 2PDFA 4QNPE 3TCSA 4YSQA 4G9FE 4I3SL 4MMXC 1EJ7L 1QLEH 1FY6A 1Q6QA 2BIHA 1NQ6A 1W5NA 1UA6L 3FXYA 2QLVB 1TJXA 2WTRA 1OT2A 2EBNA 1QUPA 1WD9A 2BVUA 5C0BD 3N40F 1EXGA 5AYUH 4KUCD 1K6QL 4Q9CA 1FVDB 2VLJE 4XN8A 3X13B 8XIMA 2HRWA 2JFEX 4Z7QE 5IHWA 3L13A 2NUXA 1U2HA 5J1TC 3RFZB 4HN4A 1DIEA 2VRKA 2FVLA 3AREA 2Z27A 3LDBB 2DEWX 1A6UH 1I7RA 5K1NA 2VMCA 2MJWA 2QADB 2UY6B 4QO1A 1UXWB 4NENA 3BW2A 1S9XA 4UQ9A 3FTWA 5DD5H 5C6WH 5CGYD 1BJMA 3A6BH 4DEFA 1NBQA 3C8HA 4LVNC 1RHHA 3FXIC 4MA8H 4YDKH 2AHIA 4D8AA 5LNUA 4UZUA 5CEXA 2Y5SA 4AMCA 2F74B 1RIHL 4QOKD 3NK3A 3MV9E 4HBCL 2VL5A 3ISWA 4ZEPA 3ALPA 3QB7C 1PO9A 3MP3A 4WD0A 1U36A 3O3DA 4G8GD 4NQEB 4UQ2A 4Y96A 4ZZKA 3V1HA 5I8CB 4L3CB 2JQMA 2X4OA 5HGAA 4JQXA 2B16A 2DUXA 5BQ7A 2DQUL 4JRYB 3OC5A 1BPVA 4JFXA 1W31A 2X9XA 3DVNA 1K4DA 3ML8A 1DVFC 4HWEH 4ES4A 1H60A 1IEAA 3MRQA 3O11B 2OPJA 2XH2A 4GISA 4QQUA 4B5SA 4H4IA 4OR1A 4QHNB 3QZOA 2F19L 2OL3H 4X9GA 1OAJA 3TROA 4D6CA 2H3XC 2NX5E 1UASA 5AKVA 3USBA 2IDCA 2QL1A 1VFBB 5F96L 2P0IA 3C12A 5EG6C 4AKOA 1LEIB 6ALDA 2BOCA 4F7MB 4KETA 4YDLB 4NAMA 3GAKA 2CLRA 2MPAL 5KG9A 5E4EB 2GJRA 4FF9A 1B2WL 1UR8A 5AZUA 1D2KA 2BNQD 1HQ4B 3QARA 5TE4H 2OQLA 3O15A 4MPQA 2WXJA 3CGTA 2WLLA 4QXUH 1BQHB 2PYED 1UJ3A 4ISVB 3M5ZA 4HUCA 3SKNB 1SYTA 4PGCB 3FMGL 1YG9A 4A2FA 1KFBA 4L8BB 5ABGA 3WLHA 4ZQNA 4HV8A 5LSMA 1VFUA 5KS9F 1OFPA 1LEKB 2ESVD 3D5OF 2EDMA 3U0WH 1Z9SA 1CECA 4J4PA 3KHJA 1GEQA 4DJDD 2FO4A 3C08H 4UTTA 3TNMA 4RGNB 5AOKA 4MFHA 1BJ1J 2NOYA 1TJGH 4CVZA 3IACA 5C0RH 2G2RA 4JDYA 5REQA 1XFBA 2PO6A 4FI6A 3ILPA 1YSOA 5CZTA 3RO8A 1GYWA 3WQCA 4JEGB 1DV7A 1LO5B 2MCAA 4YSTA 3AU6A 1MZHA 4EPKA 4MLJA 1G43A 1P4BH 3HG4A 2A7BA 4G6AC 4QT5B 3S3CB 2R8SH 3LZFH 4BXVA 4XAGA 3ITCA 2YZ8A 1TIUA 2O9TA 1ACZA 2WXFA 1ZS8B 1KFLA 2FZNA 1A4JB 2V5DA 3W2DH 5T3ZL 3DI3B 4EAYA 4LLVA 2YARA 3UJJL 5C0JA 5KTEL 5FW7A 2PTDA 1MFCH 3A67L 3O6LH 2XWTB 4A1RA 1EGJH 3SE3C 4WUUA 1JNDA 1AJ7H 4ZUSA 4PUDA 5IVOA 4OCXH 1JJKA 3TN0B 3G5VA 4ZCWA 1M7PA 1MJ8L 4YNYA 2DBJA 3B9KC 5I74B 3VB9A 3DHMA 4ZE5A 1YAIA 4MAYA 2WBJB 2Y1HA 4MMYB 5J1AB 1Q6CA 5ECVA 5T91A 2L4OA 1O1HA 4PRDA 3DVNB 1IKOP 3E6HA 3WIAA 4BJLA 1D3HA 4AQEA 1Y07A 5I17B 3ULAB 2MIZA 4GG9A 2ZPKL 3DUUB 4L3CA 2X4RB 1KIPA 4OJYA 3HEIB 3MLZH 4PQXA 3JU2A 4J4PD 2DQCL 4LSTH 1ECQA 4YDNA 2ESVA 3UROR 3OWRA 2DJMA 1QBLL 3LNHA 1WS8A 3TH3T 3E9AA 3T6CA 4ABVA 1WE5A 2W66A 1ZBWA 5GGRY 5B39G 3CB8A 2YGYA 3QQWA 4CNNA 2KQNA 4AD0A 3VG9B 3UIYA 4DCQA 4X4YB 4OQTA 3N91A 2ZKWA 3BDXA 3UL4A 1K9TA 1EZVY 3F62A 4QIUA 2X30A 1OKEA 1KLYA 3CVIL 4KW2A 4DNMA 4PJAF 2Q3XA 3F5LA 5I6KA 1I7RB 5G2HA 2E6QA 1NFAA 5FCUL 4LSRL 1CR9H 4JG0L 5B4MC 4W1TA 4WW2A 3QUZC 5F7HA 5IEHA 5TE7H 4RFEB 4LVFA 3P73A 4Y90A 4C56A 1BXCA 3CQPA 1VCAA 1Y6NR 4DJED 4GAGL 1AL8A 4C5YA 5AD0A 3VW3H 3E96A 3EW3B 1AR2A 2TPSA 3EYQC 1WIOA 2BH0A 3QJZA 4WEBH 4L8BA 4M7JL 3EFFB 3TYUA 5T1LD 2XM2A 2X4SB 3CLFH 1PIFA 4HG4J 1P7QA 3EYSH 3GHPA 1E3ZA 5DD0H 35C8H 3TGXA 3Q0HA 4IM8A 1Y65A 2QF7A 4GY7A 3NFSH 1ZXQA 3FRPG 4ZPTA 3QY6A 4O17A 2CCLA 1KG0B 2QQLL 4ONGL 3TC7A 1R3KB 2LLNA 2CM6A 2XN2A 3HZMB 3KR3L 4RAUA 1IBGH 2PYEB 3THML 5HHOB 1OYAA 4UFLA 2MCPL 3N85L 2GB2A 4KKAC 1X97A 3GC5A 5BU6A 3WQOA 5MEND 3EO0B 1SXCA 2QFPA 4G82A 3WG6A 4FOMA 4EI5B 5ELIA 3KVPA 1N8ZA 1QWNA 3WKQA 2QIWA 1I8LA 5LAXB 4XPHH 1EC7A 4DO7A 1BG9A 4HAGA 5FO9B 1RZIB 4LC6A 1O12A 3MBEA 4CC1A 4AD5A 1OTUC 1TZ7A 3VGHA 2JWYA 5DQDH 1JFQL 4RX4D 3GY1A 1G4RA 4W87A 1NCJA 5D2XA 4HV8B 3HPJB 4K94L 1KO0A 3HNTL 4F40A 2XZZA 5CGBA 3BANA 1PUDA 2YZRA 1P4IH 2ICSA 4ISVA 4BUQA 2ISWA 1UATA 3BP4A 7XIMA 3HFMH 5AW1B 3KPLB 2BVPB 2ICCA 3CCHA 3MSDA 3S1VA 1SJEB 1KFEA 2G5RA 3QO0A 1ECZA 1FL3B 1UA7A 2OMUB 4C4KO 1W1A1 2FJFB 1RZKH 3ZR6A 1OFRA 5G1MA 1D7FA 4GRMB 4OZGE 1A2YA 5D7LE 1RHHB 1TZZA 2NY2C 3K6SB 4OKVA 3TCXA 4ZO9A 4MMWA 2J2ZB 3HAEA 1X6NA 3WFLA 4UU9A 1ITQA 3KNBA 4M43H 4N8VA 5DO2D 4QRNA 4PJ9A 1GGTA 5KSAC 5C09D 3OHXC 3UXFA 1JPHA 4LEEA 1J8HD 3QFJE 1HEZA 2ZNXA 3C5ZA 5C0AA 1LLOA 1OCJA 4N6QA 5DFAA 3GIZL 4YC2C 2WSRA 5DEGA 4QTGA 2XA8L 1ASQA 2BLFA 2VLJA 5DLMH 3VJ6A 1BEYL 3HFFA 2E28A 3EWXA 5DD3L 4XVTL 3L65A 3S8HA 3K72B 4F66A 1AGEA 1ZRUA 4Y4KA 1EZVX 1C5DA 1N0XL 2ZSVB 5CJOL 4YPJA 2V2HA 5JYLA 1AE6H 1T83A 2R83A 1C9DA 1TNNA 1NC2B 2H3KA 2WWDA 5E4OA 3RM9A 4XMLH 2EYRA 4F9PC 3CN0A 1UCTA 1FH7A 3VZXA 4ZJ9A 4HUUA 1CI5A 4JVWA 4L1SA 4H7VA 4EI5D 4ZTPH 3W5NA 1CL7H 1BLNA 1NANH 1HT6A 3NPSB 2YHGA 3NIGF 4GAAA 2MCMA 1DHKA 2ZUVA 4PREB 5CBEB 4JM4L 2CK2A 1JWSA 3BKYL 4NENB 2MHAB 1U91B 1WBZB 1T03H 1ZT1B 5ESAA 1DLHB 4AW7A 1LT7A 5E9DA 4TXVB 1A3ZA 3ES8A 1DXIA 1HHJA 2IWKA 2NXZD 5I1IL 4KX7A 2LR4A 1R1CA 3VGAC 3COOA 4BKLA 3HHSB 4YMPA 1NPNA 1MHHB 1RCQA 4YNGA 3FAWA 3OB0H 4ZFOL 4P2RA 5HGHB 4NVTA 1T99A 3FH8A 2GVLA 1NGQH 5BPPA 3FA4A 5BVJA 5DK2B 4BF9A 3IFLH 4DELA 1Q9WA 4ZTOL 4O9HL 4OLWL 5EA0L 3NFNA 2AXGA 2VXVH 4WSJA 4NFBA 4JFPB 4Y9EA 1VZIA 5SX5H 1BWVA 3KXFB 5CZXC 4YDVB 5D6CA 1JV2A 3VI3B 3H2FA 1EC8A 1DIKA 3ZJ7A 4B3ZA 1HOCB 3IETB 2J9YA 3CK0L 5IT2H 2HNEA 3ERPA 3M1BA 2ZX5A 1WBHA 1GYUA 3WKYA 5U4NA 3FRUA 1FN4B 4HLZH 1TTPA 2DZAA 2QSCL 1REQB 3BPNC 4E4UA 2CA4A 1M6UA 5I15H 1OOAA 1YN6B 4L9LB 3PZTA 4TV5A 2JKNA 3COTA 4FQIH 3TA3B 1MZYA 3VIJA 1IKFH 1E5UI 1A3QA 3SGEH 1C8VA 1KTDB 4KT2A 4YHZL 5C07B 1V0KA 1E8ZA 1MCKA 3BMXA 2CIIA 4LVBA 5F7FA 4TULH 1BF2A 3LM3A 3VAVA 4LEXL 5DJXA 4M6UA 5BNKA 1E9LA 2BXZA 3IIVA 1WRFA 2P28B 3LOWA 5BW7C 1ZEAH 1AHWB 4P2QA 5EDSA 2WZEA 3LZ3A 4DVOA 4ZGYA 1IM9D 2R9HC 1FH2A 4GJ1A 2H6RA 2JKWA 3M41A 4JREB 1KTDA 1RP9A 4DP4X 3IPEA 4ONHB 3HUJA 4X8XA 4EXAA 1PYFA 2FSDA 3FPXA 1TEYA 4HGXA 2QQNH 3HG2A 3VGBA 2R29H 3U0PA 1G1KA 3OXSB 3TO4D 3GSVB 1R3LA 4BXSV 5AVHA 1QOXA 4MA1C 1GGOA 1IXNA 5AC4A 1HQRB 1BZ8A 1KLUA 1UZ8B 5BRZD 4NQSA 4DKAA 4C7DA 5GJSL 1S4IA 4PRTA 1O0VA 2H41A 3HLAB 5D1QB 1S5NA 4UTTC 4EOUA 1NKGA 1H9VA 3RVWD 5GRXG 4Y5YA 2MCPH 5ISZE 2JIWA 3TA9A 4ZE4A 2VO5A 2GDVA 5DYOB 5LBSL 2GFTA 2INFA 5CINL 3JV6A 4IF2A 2PWHA 1H3PH 3GSQA 3D3VB 1MNSA 4M5YH 4Q8NA 4X2PA 2V8LA 1KBBA 3SM0A 1HKWA 3T40A 1Q0EA 1IIGA 1A14L 1NBYA 1G4EA 2V2XB 3UDWA 3OOQA 2DQGH 2A9BA 2OPCA 4OZHF 4I0PA 2DTMH 5CJXA 1JAKA 1F3DJ 1ACYL 2K7QA 3CHPA 1OFOA 1RR2A 4N90D 1T6BX 3FPYA 1V7MH 1XR9A 3DI2B 4FQLL 5IWLA 3GGWA 2C71A 7REQB 4JLRA 5EC2A 1IM9A 5FV1L 1N0XH 4ELDA 4P2OD 2DN7A 1VP5A 4M3JA 3PPCA 4KIEA 3M43A 3OG4B 2NXHA 3W7MA 5JU6A 3ULSA 3HQOA 4WOQA 4DZ8B 4HIXH 3LDVA 1UENA 4GY4A 2NY3B 2R24A 2M26A 3F3HA 2NNCA 5DC2A 2CGYA 1GKRA 2A3EA 4S3JA 4ZUUB 3HBZA 3HS9A 3DSFH 1SOXA 4Y4HC 4H6KA 1C5DB 3EHBB 4OZGA 5FPIA 1Z48A 3DH7A 1JXDA 5DC9B 1AQMA 1FVEA 1JXGA 2DL2A 1S7UB 3BJSA 2Y5JA 3HI1B 3QORD 3S36X 4Y1AD 3PZOA 4QEEA 5FGCB 2P76A 2ZZ2A 3V35A 1HL8A 4IXHA 3BPNB 5SWZB 1UOLA 1JYVA 1IGSA 2NX3A 1OCCB 5F8QC 3SO5A 3W2LA 4MVBC 1U3YA 3SBPA 5HK4A 3IJ6A 3I2CH 3MRIA 3SSZA 4I5BB 1U2CA 4OD2A 1MELA 4G59C 4MIMA 4C1LA 3B0VC 4IBUA 3LTVA 1WBJA 4ONFL 1MO0A 4W85A 4JRYD 3IJ9A 5F72S 4KRPB 3WDIA 4O2FB 4QROA 4LP4A 2R2EA 1BQHG 2Z8SA 5JW4M 3RG6A 4JMXA 4MNLA 3MLRL 1EHLH 2C14A 2AGTA 1V27A 3PJNA 4DFIA 1FJ1A 1TZAA 2GSIB 5D70H 1VHCA 1SBBA 3FU8A 4LVAA 4K3DL 1N2RA 1H3WM 2EIEA 4M5TA 1AMKA 3ALWA 4PSRA 1ZK5A 3D25A 2GLKA 3Q8AA 5EUOF 5TDPB 4J1OA 3QUMB 1INEH 3BQUA 2HT3D 2VGFA 1F3JA 3ZKMD 3WKPA 2VD8A 2OZ3A 3G9AB 3BWZA 3VXQA 5FF2A 1QVBA 4W4OC 4X6DE 5I6LA 5CP7B 3B9DA 3S9IA 4U1LA 2VDPB 1BZ9B 1CI3M 1UXSA 1Z42A 4WKZB 1UG6A 1IBGL 1KGWA 2A9CA 2GJ6E 3FT4B 3IKCB 4HHGA 3RZCB 5HHXH 1AYOA 3LZOA 5L88L 1HVQA 2GWNA 3QSRA 1M6OA 2VW6A 2GQHA 1PEZA 5IMLA 1U83A 2UBPC 2GUYA 3O3RA 2G9HB 2JKTM 5J04A 1Z3RA 7FABH 3APMA 2BSEA 2JLPA 2Y5QA 4XHQA 5L6YH 3WQ6A 3C08L 1NWSA 5C0CE 5FHBH 5D5MA 5FS5A 1FWJC 4GJTB 1XL9A 5C08E 2ZZUT 1K85A 1FO0L 2QAFA 1XGUA 2C26A 2D69A 5IMOA 1EXUA 3KRUA 5I82A 4W68A 3G5ZA 4LPWA 4ZXBA 4Y5XC 4PTUA 3ZSTA 3ULSB 3DYPA 4MASA 3GMQA 2XN9D 3OX8A 2IPKB 2WXOA 4BEUA 3OR6A 1P53A 2HG0A 3E8UH 1BTCA 1TRIA 2HXTA 2NZLA 4JLRB 5EC2B 4N8CH 5LG1A 4F9LC 5I1GL 1LHZA 4HFUH 4MSWB 1B2WH 2L0DA 4U2YA 2WLJA 4LSRH 4RSVA 3C6EA 1KGUA 1QW8A 1YPFA 4MNQA 43C9B 4PY8J 4E9TA 1E6QM 2EPMX 2GPZA 1N5AA 1RSCA 5D9NA 4W5ZA 4LLQB 3UG5A 4I48B 3VFMB 1O94A 2Y8UA 3RLHA 2Z8WC 2BHYA 3QW4B 4O1FA 2VM3A 4GEIA 1A1NA 2PW1B 1G5GA 2OL3L 3HZKA 3GSQB 1E9QA 1SF5A 3LRSB 3MUGB 5EHFA 4KO5A 4N9OB 5JMRA 2ZXGA 3WUBA 3DA0A 4ELKA 4GI4A 1ZGLM 3M0VA 4J1UB 3AWNA 5EWIL 5HVHB 4FRWA 4LUYA 1YEYA 2P5PA 1CDGA 3CFBA 2DQHL 4RX4A 5ICXA 3MMTA 3ARYA 3ZRCC 3UPRA 3MBED 3O41A 4C83A 2E7BA 4JQIA 2OTWB 8FABB 4JNYA 1MNZA 4G6CA 1REQA 4GVFA 4NP4H 4NKOA 3RUGB 3WTTA 4HHMA 5JMUA 4TM9A 1U8PB 2OKOA 2P8LA 3EO1B 3FNKA 1GOMA 1KWGA 1U3HC 3MBXH 4OCXL 4MA8L 1JV5A 4V1DB 5FOJA 4R8WH 1XLDA 1KEGL 2YMTA 4GAJL 3ULUE 5A43C 2WMIB 1H0GA 2V30A 5HJXA 3S2NA 5I2UA 1CB2A 2FBRA 5IQLA 2NNXA 1LZOA 3UO8B 5KTEH 4R33A 1GQKA 4Z7NF 1Z66A 3DVFA 1E51A 5G5DA 5AYTA 4Q2ZA 4L1HA 2BVOA 5A6MA 3UG8A 4Q6IB 4M1CC 5C0ND 3LEPA 3Q01A 1O7DC 2JJWA 5I1AB 1AODA 1MWAA 4I3RL 4HIBA 4YLBA 4BFRA 3FNDA 1BX2B 3ZN6A 5KANI 4PGDA 1D6EB 3D4GA 3ME3A 5CFAA 5M03A 4WW1A 3M86A 3RWGA 2ZYIA 4PRAA 2C1GA 2ZUTA 2IBGA 3DDMA 3BLEA 3WKNA 1T66D 4K3ZA 2QKIC 2WKJA 3SUUA 2IPKA 3GSWB 5BV7L 5I1JL 1LO5A 3R1GL 3VOIA 3L0NA 2UXGA 2W59A 1YHTA 1QWHA 2YA0A 3KCLA 4UUJA 1F8MA 3L2NA 3AQUA 4ZQCA 4M3PA 4FIQA 1NOFA 4K71B 1SW7A 3Q13A 3MUCA 4QX4A 5LIKX 5T8GA 1YC7A 2N7SA 5J8OA 4F24A 5L9DL 2Z00A 4WJXA 2NQJA 1LP9A 3KPNB 3VDBA 4LIQL 5DR5L 3CZFA 4XN5A 2IMMA 2YPKA 4PV9A 5IY5B 4X3ZA 2I5YL 2P8PA 3NIGB 5D2NA 4OZIE 4XZMX 5LAPA 3W6LA 2O61B 5GJSH 2OSYA 1U8MA 2HRLA 3GKWL 4QHKJ 4WGWB 5ETUA 1XSJA 1HZYA 2Y0FA 5HUOA 1HQ4A 3LRLA 3QIWD 2FEDD 3KWTA 1FFNB 4YJ5A 3BEWA 4BWLC 3VMNA 5KVDH 3MRMA 3LEYH 4QKTA 1RFDL 4QIRA 2BWDA 3UTSE 1FHDA 2PRMA 1OPGH 3LNMA 3R6IA 2GVGA 5KZCB 1DQML 1JCVA 3PWJB 3TNNA 2O7SA 4PUUA 3MWCA 1ZD6A 1IQDA 3LZNA 4EZJA 3WLWD 2F7IA 5A2KH 5KYXA 1DYZA 3LEXA 2JMRA 3NCBB 1NIBA 4HGKC 3VFWB 5EPMA 4KBXA 1WQV