4M8UA

The structure of mall mutant enzyme v200a from bacillus subtilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
559
structure length
559
Chain Sequence
SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDAIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPERADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 230
structure length 559
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m8uA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m8uA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m8uA02
4MJ2A 2CYGA 2D0FA 3LXCA 4AZCB 1LG1A 1XHGA 2GJRA 1MYRA 5EMYA 5DT7A 2WSPA 3EJQA 2Y24A 1TUXA 4NX0A 3SCNA 5CG0A 2WMGA 4AZHA 2J7FA 3LPGA 4CU8A 2YIHA 1EQPA 3KLLA 1PX8A 3WH5A 4LXFA 4D71A 1MWOA 6CGTA 4DWSB 2A3AA 4UZUA 1NP2A 5A3HA 3IAPA 3BXWA 1CDGA 2EPNA 1M7XA 1C8YA 4PCTA 1UD6A 2JIWA 1ITCA 1CENA 3CH9A 4WKHA 1CGTA 2EABA 3BAWA 2G3NA 1W91A 1DP0A 4UZSA 3KL0A 3AQUA 4WSKA 1NWRA 1BYBA 3VU2A 2DIJA 2ALWA 4HOXA 3CZNA 4YHGA 3CZEA 2YBTA 1V08A 2F61A 4Y7EA 2G8ZA 5IXEA 1JYVA 4PEEA 2BV9A 2PF0A 5ABFB 2WKGA 3ZQ9A 1R87A 3AIRA 3VSVA 3F5LA 1JAEA 3GH7A 5FKYA 2GDUA 4QLKA 1KWKA 4GKLA 3W26A 3EBVA 3VIPA 3GNRA 1XSIA 4P7LA 1JDDA 5DEZA 4JL1A 3NJ3A 4DUWA 3BVTA 1HJXA 1DEDA 2OWWA 3PZNA 2XN0A 1CXLA 3MUZ1 1HKKA 3DECA 1WZMA 1R46A 1H09A 2RGLA 3BUBA 3PZIA 2VRJA 1HL9A 1A47A 3W6MA 3GZAA 1CTNA 1PIGA 2WW5A 3D4ZA 4ATDA 1E6QM 3GXNA 3BUQA 2QPUA 6A3HA 1E9LA 4PUEA 3PZTA 5A6SA 3T0BA 3WDIA 3VIGA 3SCUA 1GOWA 2DT0A 3VOCA 2CEQA 4R5EA 4C7FA 1UD5A 2F1AA 1UA7A 1C8QA 1GOIA 4BA0A 2FE0A 5AC5A 1CXFA 3WD3A 1NWTA 4FNRA 1ISWA 1EDGA 2WHJA 2WVTA 5FL0A 4AZGA 3QGVA 4HU0A 3THCA 1ISYA 4HP5A 2Y4SA 2CKRA 3WMBA 1XD0A 2VZVA 1D7FA 1V6WA 3SEPA 1XYFA 1VB9A 3MV11 5M17A 3W25A 3A4WA 4P7NA 1E1FA 3FY1A 4CCEA 4GO9A 4JFSA 2E3ZA 1ITXA 4HA3A 2F7PA 4W7VA 3K4AA 1KGWA 4AZBA 3W24A 3MSGA 5I24A 1KBKA 1J0YA 4DO5A 3VM5A 7TAAA 3EYPA 1ZJAA 1TMQA 2WWDA 1QI3A 3ZSTA 2BY1A 2YA2A 3UEQA 4UOQA 1GOKA 1OSEA 1VRXA 2XFYA 1GJWA 1XCXA 2J25A 5CLWA 3FXYA 4AD0A 5KZ6A 7A3HA 4H7VA 2WC3A 4PRWA 5AYIA 3DHPA 4FNUA 3GH4A 1BYDA 3T08A 5IFTA 1DWJM 4WLCA 5I23A 2Y5EA 4FK9A 5A69A 1TE1A 3WSUA 2PWGA 4AZ6A 3WQ8A 2W63A 3BLPX 1SMDA 1UUQA 3M7SA 3U5YA 4XX6A 4HPHA 3EMCA 1TG7A 2WVVA 4JIEA 2WHLA 4NRSA 4IM4A 4PMNA 1E73M 1TZ7A 1J01A 1IZJA 4CN4A 1MW2A 1GW1A 2BXYA 1Q6EA 2XG9A 2EACA 2UWFA 3RM9A 5E1QA 2X0YA 3WQVA 4YN5A 3BUIA 3WMCA 4MPKA 4NXSA 3WF2A 1K9TA 1SFSA 4UQBA 2UY5A 3W4RA 1MVYA 2F8QA 1SZNA 3DX4A 5A6MA 3K4DA 3GDBA 4GZIA 3VDHA 2XVGA 1W3LA 4GPNA 3AXIA 2WMIB 2E4TA 3VUPA 4OKDA 4FLOA 1QWUA 4AD3A 4OJYA 2YL9A 1NM9A 4OOZA 3APGA 3TTYA 3W28A 5A6KA 3EJPA 3AS3A 1EOMA 2ESCA 1JZ4A 4AD2A 3VIJA 1HVXA 3VMPA 4LGXA 4UCFA 2CBVA 3WN6A 3CLWA 4GXPA 3LPOA 3BCFA 2YA1A 1PX3A 2YJQA 4A4AA 4WF7A 1ZB5A 4XZBA 1OWQA 4AXNA 3DDGA 2G4FA 4BCEA 5HOSA 1HF6A 5A6AA 1HL8A 1KR0A 3LPPA 4TX6A 1R7AA 2VCCA 3GXTA 5I77A 3T0DA 1FFQA 3KL5A 4W7UA 2FYVA 4TTGA 1OINA 3LX9A 2W66A 3BMVA 2ZX7A 1CWYA 3WF3A 1UWQA 3KZSA 5FCZA 1EDTA 2ZWYA 1HKJA 2IUZA 1BGAA 3VGBA 3T2PA 1TQWA 1VBRA 4XV0A 1ZBWA 5HDRA 1N82A 3A47A 1WDSA 2A3HA 1JXJA 4EE9A 4CD5A 4DUVA 2HISA 4H8UA 1UR1A 1TQSA 2YA0A 1FHDA 2WCAA 3N9KA 1UHVA 3RPMA 1J0KA 1E55A 1E6XM 7CGTA 4GINA 4UFJA 1Q6CA 4M1RA 1V0LA 3VIMA 1QNRA 1D2KA 1LWHA 3BGAA 1D3CA 2J4GA 4KRTA 3S5YA 2OYLA 2YOCA 3NCOA 3AICA 3H55A 5DFAA 4UTFA 2BY2A 8A3HA 1CGWA 4MADA 1GOMA 3SCQA 3EJSA 2CIPA 1EHAA 4LYRA 4CN1A 2CCRA 1GJUA 1Q4NX 3SUUA 5D8ZA 1HP4A 4Z2IA 2VCBA 1GZJA 1NOFA 5I0DA 2WMHA 2D23A 2J8GA 1V0KA 3AMCA 3WQWA 1PZ3A 1OT1A 1GORA 1TR1A 2WVVB 3OLEA 3N12A 3MMUA 1WZAA 4PMZA 1V03A 3DYOA 4JFVA 3MO4A 1JIBA 2D0HA 4UNIA 3AHYA 3A23A 2XVPA 5CZKA 3OGSA 4AIEA 1PS3A 1UKQA 4WKAA 1HWWA 2XN2A 4Q7NA 4Z2GA 1XRVA 2ZOXA 2VVSA 2W92A 5HXMA 4M56A 1E6NA 4PMOA 1DWFM 2J77A 2X09A 3QR3A 5D9NA 4ACZA 4RE2A 4GIAA 2WWCA 1ISZA 3GYCA 3ZIZA 9CGTA 3VD5A 2VUYA 4FLRA 4M80A 4D6EA 3AHTA 1VFOA 4DWSC 1KXQA 3UESA 4OUEA 1E4IA 1NWSA 2PWFA 3KL3A 2WPGA 4WK9A 1GUVA 1E5NA 4MNJA 2VX5A 4F79A 3W6LA 2XHYA 3S6TA 4GO8A 3S5ZA 1NOUA 4UFHA 1O7DC 3UCQA 4B9ZA 1TVPA 5CPQA 4DM2A 5BXSA 3WDQA 3BAKA 2XGIA 3PTKA 3HMCA 4QDMA 1QBAA 3NSXA 3WF4A 2VCAA 3VGGA 1DWAM 2J62A 2VURA 3L4VA 1GQJA 1BHGA 3RM4A 1EIBA 2VRKA 2D3LA 3B9AA 2OYMA 2FH8A 2O9RA 1DWIM 1FH8A 5A6JA 1ZBKA 4D72A 2ZUSA 4AW7A 3W27A 1QX1A 1MFVA 2VX7A 2XWEA 4AMCA 1JNDA 1UKPA 4AYSA 2FH6A 4P7OA 1B3XA 1KXHA 1HN1A 1KR1A 3WY3A 4P8WA 2XVNA 2QHAA 5JUVA 3WNPA 3A22A 1XH2A 2ZXBA 3FAWA 4LYPA 1NWUA 1V0MA 3ARWA 4JHZA 5HNNA 4N42A 3VDAA 3FAXA 3H54A 3WELA 3BVWA 1MW3A 4CD6A 1LL6A 2CITA 3AIBA 3BAXA 2V3DA 3WY2A 2D22A 3WDPP 3U5UA 2J7CA 1UD4A 2FHFA 1TQTA 3CPUA 2VQTA 5FD0A 1JXKA 4UFKA 2EPKX 4OBSA 2CKSA 2Z1SA 2ZUWA 1QHOA 1C93A 2CXGA 3AFBA 2DIEA 4Z2KA 1XV8A 3CUIA 2XWDA 2VC9A 1E0VA 1JI1A 2EEXA 4JFTA 3PZ9A 3IK2A 1E6SM 1JZ2A 3BSGA 2ZUTA 1CGYA 3ZSSA 4CU7A 4A3YA 4JHOA 2PBOA 1W1YA 3RO8A 2Y8KA 4FLQA 3EDDA 1JGIA 2WYSA 1CGUA 4HOZA 3CZGA 3D5HA 3TP4A 4PMXA 2WKLA 4HMEA 3SUSA 4ZXLA 5E6YA 3WFLA 1C7TA 1W32A 3OGVA 3PBGA 1NQ6A 4UQ9A 1I1WA 4AWEA 4XB3A 1WDRA 1JZ5A 2J7EA 1GVYA 4UFMA 4N0RA 2G3MA 2JF7A 1GPFA 1LJYA 2XM1A 2WMFA 2XM2A 1E3ZA 4ACZB 1EH9A 1IV8A 2ZX9A 1Q6FA 3WNKA 4JZ5A 3ZJ7A 1DWHM 2VVNA 4AISA 1GQKA 1PEZA 2E8YA 3OLIA 1CXKA 5AYBA 3IJ9A 3AHZA 4PTXA 3VIIA 2ZWZA 1SR0A 1VEMA 4AC1X 1V3IA 1EA9C 3U7BA 4E2OA 3IAQA 2GSJA 2DDXA 2J7HA 3OLDA 5M3WA 4W84A 2J7GA 2QV4A 4WKFA 3BUDA 4CU6A 1HVQA 3QHOA 2OW7A 2DEPA 2WAGA 5GNZA 2VMFA 1UR9A 4W93A 3EDFA 2J47A 3A24A 2NW0A 1C90A 1E3XA 3I3DA 1ISXA 1QNSA 3SUVA 2PWHA 2V3EA 1PAMA 3AMDA 4JCLA 2XGBA 1E6ZA 2EQDA 3NDZA 1EO5A 4FNTA 3L4UA 5ABGA 1MXDA 4D6HA 1O7AA 1JD7A 2X2HA 2VQUA 5C70A 1E5JA 4MAVA 3VIKA 1U2YA 3GXDA 4CVUA 1K6AA 3OIHA 1CIUA 2ZUUA 2O92A 2WCSA 3FNDA 3G6MA 3UR8A 3MUIA 1JZ3A 4WSJA 1JF6A 4V2XA 2JF6A 4GZJA 2OYKA 2W61A 1M01A 1G94A 4KWUA 4HPGA 1B90A 1J0IA 5DF0A 4DO4A 1CYGA 1YQ2A 4EAMA 2Y2WA 2DSVA 1B3VA 2ZX6A 1EO7A 1US2A 2DSZA 3F5JA 3A5VA 1X6NA 2FDMA 4D6CA 3CZJA 5E9AA 3EJUA 1CXIA 3H53A 1BSIA 1AQHA 1IZKA 2VT0A 3HG5A 1WZKA 3RDKA 2ZX8A 2FGZA 3RJYA 2JEPA 1W9DM 1CBGA 3SUTA 2BVDA 3D50A 3BAJA 5A2AA 3WFZA 2XTKA 3BVUA 4GQRA 4W86A 4B3LA 2VO5A 1TQVA 3NSMA 1W9BM 3SCRA 3AXXA 1HJVA 1C91A 2QMKA 1GONA 1FFRA 1F4HA 2WBGA 1J0JA 4E4PA 1WPCA 3VIFA 1UKTA 2YDQA 3N1AA 1CEOA 3DX1A 4CKQA 1T0OA 3L4YA 2YLLA 3GBDA 2ZXAA 3WQ5A 1UH2A 1ISVA 1PZ2A 2BVYA 2WANA 1UH4A 2GJXA 1C8XA 1TCMA 3PTQA 2VZUA 4ZFMA 4JCMA 1UWIA 4P7RA 1PIFA 1B0IA 1OGBA 3WL1A 3ZT5A 4AD1A 1G5AA 3AI0A 1KTCA 3MS8A 1U33A 1QWNA 3PZGA 4S3JA 5BWFA 2G3JA 5DMYA 3GXIA 3AHXA 1BFNA 1UG6A 3ARUA 1WO2A 1E4LA 1ZBCA 5AY7A 3W38A 1R7OA 2WLZA 4JKLA 2XYLA 3WD4A 1W1TA 1F4AA 2V5DA 3GH5A 1XC6A 1J10A 4CD4A 5A95A 2W4XA 3FN9A 4AMWA 4PTVA 2JIEA 3ZJ8A 4ACYA 3AOFA 2BXZA 3BLKA 3LXAA 4YPJA 2DSUA 1O6IA 2OW6A 4J27A 4AEEA 1UR8A 3AS0A 5F7UA 4PSRA 2WSKA 3AIWA 3AZSA 4NSBA 3VDBA 2VZTA 4QLLA 3VVGA 1L8NA 1BQCA 5CPSA 5C8BB 2WNWA 2WMKA 5I3DA 1H2JA 4M24A 3AIQA 3ARPA 1W3JA 4MDOA 3N18A 2PWDA 1QBBA 3NUKA 4GI9A 4D1IA 5GQBA 2UY2A 2D1ZA 2ZE0A 4MB4A 4ZXOA 1CLXA 2XFFA 1V02A 5JBEA 1W1PA 2ZICA 1E6PA 4D6GA 3WY4A 3I3BA 3VD7A 3DC0A 5FIPA 3B8SA 4Z2HA 3WBEA 1H49A 4W8LA 4MDPA 4NRRA 3GXPA 4MTVA 3CTTA 3WH9A 4IPLA 1V3HA 2JEQA 3BUPA 5HBFA 3WEZA 3ALGA 1JDAA 2GK1A 1RP8A 4D6DA 4MNMA 4P7QA 3RIKA 3WBAA 3PZQA 4H8HA 2W91A 1WNOA 5CQ1A 1M04A 1R33A 4X9YA 3ARVA 1E1EA 4GQQA 1ZU8A 1LWJA 2YLAA 2OWXA 4AMXA 2TAAA 4R27A 4MAZA 4QCFA 2WC4A 2JALA 4TVDA 4J7RA 5FL1A 4IUGA 4EK7A 1C7SA 3W82A 5E70A 1W1VA 4FLSA 1ZL1A 1KBBA 4D6IA 5EB8A 3OZPA 4OOUA 3HJEA 2GJXB 5D8WA 1V6YA 3EDEA 4W85A 4RE3A 1OCQA 2A3CA 1XSJA 2E9LA 3CMJA 3LRMA 3CHCA 4AZ7A 1H11A 4E8DA 1WE5A 1DHKA 3AMGA 3IANA 1TQUA 3ALFA 2X05A 5CPTA 5A8MA 4PMUA 3ZJKA 1B31A 1VIWA 1KWGA 1UWSA 4CD7A 4E8CA 3BVVA 2GFTA 2JE8A 5JIPA 5CLTA 2O9TA 2WZHA 2XUCA 2VZOA 4P8VA 3ZT6A 5D9OA 1XSKA 3WMSA 1FHLA 2F7OA 4U2ZA 4D6JA 4PMRA 3SCTA 2J75A 2E9BA 1LG2A 3WQ6A 1UWTA 3DX2A 3VMNA 5CSYA 4ATLA 1Z32X 3WIJA 1X1NA 2DPEA 4AIOA 1Q6DA 4HOWA 1XCWA 2VNCA 1C92A 1ZBVA 3FW6A 5FOOA 4AEFA 1UWUA 4J3TA 1AQ0A 3S2CA 3PZOA 2D0GA 4M82A 1UOKA 4QAWA 4CCCA 1JNEA 1V6VA 1CXHA 1LL7A 2GJPA 3LMYA 4UOZA 4HZ8A 5A2BA 2ZXQA 2UY4A 5I5RA 3BMWA 3CIVA 3BVXA 2YFNA 4LPCA 4C7DA 1G0CA 3SUWA 2QMJA 4FNSA 2CESA 5I6SA 1XYZA 3VIHA 1H3GA 1BAGA 2WVUA 3VIOA 3WDJA 4KMQA 2AAAA 2Q8XA 3BSHA 4WIWA 5BCAA 2X1IA 1UH3A 1QNQA 3WH7A 3CGTA 5A8PA 4KGJA 5IHSA 4AZCA 2BVTA 1JZ6A 3LRKA 1HKMA 1K9EA 3LPFA 3OGRA 3OG2A 3UG4A 1MW1A 3DHUA 3ECQA 3K46A 1HXKA 1NH6A 3WUBA 3G6LA 4PN2A 1QOXA 4UQDA 3SCVA 1K9DA 2PBGA 1JDCA 4L4OA 1QNOA 4MB3A 2G3IA 2WHKA 2XIIA 3O6AA 2CHOA 1B2YA 4ZEPA 1UASA 3VINA 3TOPA 1EXPA 1KXTA 1KQYA 3CC1A 1QPKA 5KEZA 3SCOA 1AQMA 1XH1A 3HU7A 4M81A 2WMJA 3CHEA 2DQXA 3T09A 4BF7A 2YBUA 2F7QA 3A4AA 4PYSA 3DYPA 4B9YA 1QI5A 2CERA 2DSWA 1H1NA 4X0VA 1RPKA 1VFFA 1JFXA 4F9DA 1QNPA 5IHRA 1VAHA 3L2LA 1MQPA 2VRQA 3SCPA 1PX4A 3AXHA 2CBUA 2W5FA 3EMQA 1CLVA 3MUY1 3WUFA 1B1YA 4D6FA 1UKSA 3BCDA 3QHMA 4NXKA 4KRUA 1UWRA 1H41A 4AYGA 3VM7A 5ABFA 2VR5A 1B9ZA 4BQ5A 3VMOA 3WENA 4IISA 4TUFA 1OGGA 1ESWA 2CBIA 3ARTA 4W5UA 3WNOA 3M6DA 3O9NA 2V38A 3KE0A 1JI2A 3K8LA 3GM8A 3VNYA 1BGGA 4CGTA 1BF2A 5JIWA 1R47A 5HPCA 3WNLA 2XFRA 3WEMA 2WHMA 2ZUNA 4AIUA 3A4XA 3OLGA 1H0IA 2VZSA 3OA5A 2O9PA 1J9YA 3UETA 3PZMA 2PC8A 4LYQA 4U33A 3BC9A 2J7BA 2Z1KA 1R85A 4CN6A 4YHEA 4ZENA 4AZIA 3GBEA 5LA2A 1OIFA 4MB5A 5BROA 3BLBA 1E71M 2ZIDA 4H8VA 1CNVA 4MNLA 2WBKA 2E8ZA 1WDQA 3ZOAA 4FMVA 1JZ8A 1JG9A 2Y8VA 1WAWA 1UZ4A 4UFIA 4TX8A 4J3VA 3RMEA 1UKOA 1PPIA 2IXUA 1B30A 1EHNA 1OD8A 4PUDA 1KCKA 1VJZA 3POCA 3MI6A 2D24A 3UERA 5ECUA 1OM0A 4Q22A 3WKZA 2GVYA 1VFUA 1G9HA 4QP0A 4URIA 4H41A 1RP9A 3WDHA 1UD3A 2NT0A 4HA4A 4F66A 1OD0A 3WNMA 3HG3A 4EANA 4PTMA 2ZUVA 3KLKA 1KQZA 1M03A 4B16A 1MXGA 1JFHA 2BFGA 1OBAA 1BG9A 4JKKA 4JL2A 4NF7A 1HX0A 1VFMA 2BHZA 3HZ3A 4NZJA 3WL0A 3SIMA 1DWGM 3TONA 3IJ8A 3VGFA 4J3UA 1NOWA 2D20A 3AS2A 3ARQA 3FHAA 4KH2A 3RJXA 4WJXA 2BNJA 2X2JA 2E0PA 3WF0A 3NYDA 2BHYA 4BQ2A 4ZE5A 3AISA 4DUXA 3WY1A 3LXBA 3L2MA 4DM1A 2NSXA 3N17A 2XVKA 3AIEA 4FNQA 4D1JA 5CXPA 3ZM8A 4M8UA 1DTUA 1EOKA 4PMDA 1H4PA 3AHVA 2DT1A 2D2OA 3ZR6A 2EADA 4FNPA 3VO0A 3AYSA 1KTBA 3VSUA 3ZO9A 3W81A 4M29A 1RH9A 4UQAA 1GNXA 4RE4A 4V28A 2XIBA 5A8QA 4PMQA 3VTRA 2OWCA 3CUHA 2EJ1A 2ZX5A 3L4XA 2W67A 1BVNP 3EJRA 4CD8A 1R86A 1LF1A 2G41A 5IDIA 4OBRA 1XD1A 1UZ1A 4OIFA 1E0XA 4QFUA 1UD2A 3DDFA 3T2OA 1U30A 1UQYA 1W2VA 5EBAA 3UG5A 3NDYA 2FHCA 1W9VA 2VTFA 4U2YA 2WMIA 5JBFA 3A21A 2QLYA 1V6XA 1W3KA 3MKKA 1VJSA 1HXJA 3CZKA 1V3JA 1HTYA 2XSAA 5D4YA 3TTQA 3OB8A 4BQ4A 3CBWA 4CCDA 2QF8A 1MW0A 1E4NA 4Z2JA 2XN1A 1W9XA 5E09A 3CZ8A 2MANA 4AY1A 3QOKA 1X6LA 3PN8A 4TOQA 3ZMRA 5EFFA 4OZOA 1SMAA 3AIUA 8CGTA 3T0AA 4U5KA 2XVLA 3J7HA 1AMYA 4NZCA 3M46A 3VNZA 4UFLA 3DX0A 1UD8A 2AMGA 1H5VA 1HJWA 3D3AA 1QW9A 1JD9A 5A8OA 1ZJBA 2OSXA 2A3BA 3W53A 1V0NA 2OSWA 3U57A 2C8NA 1KGUA 2PB1A 1I1XA 1W9PA 3WD2A 1XGZA 1J11A 3WNNA 4TVCA 3A3HA 3FHQA 1MQRA 1G1YA 2FGLA 2PWEA 1E70M 2EXOA 2YDSA 4QLJA 1TA3A 5I78A 5BRPA 3MUAA 2WC7A 2WXDM 1NP0A 3MU7A 3NIYA 5M03A 1QI0A 1FP8A 3RILA 3ARSA 1KGXA 3EMZA 2ZUMA 1UR2A 4L4PA 1J12A 4UQEA 2DGAA 2YKKA 2WZEA 2E9MA 4H04A 2NT1A 1EQCA 4HZ7A 2B31A 4CUCA 1V6UA 4PCSA 1CXEA 2BHUA 3WDRA 2O9OA 3N11A 2CETA 3OBAA 5A6BD 2EAEA 1KXVA 1IT0A 4Z2LA 1M53A 3TA9A 3AZTA 3U7VA 3L4ZA 3OZOA 3MMDA 4GZEA 3A6OA 1E0WA 1ODUA 3IGUA 5ABEA 2YFOA 4JKMA 3B9DA 2YL6A 1BG4A 3K8MA 3CHFA 2EPMX 3RCNA 1ZS2A 4H2CA 3JUGA 5D9PA 4V27A 1HJUA 5ABHA 3VGDA 3VILA 2J74A 1B3ZA 4J28A 1PJ9A 3VPLA 3D4YA 2WB5A 4TTUA 2DH2A 5M5DA 2D73A 1UR0A 3VGHA 1LLOA 4BS0A 3GTNA 4W8BA 3AYRA 3VSTA 1E15A 5BXPA 3AIVA 3K8KA 3ZR5A 5A8NA 4UR9A 4AD5A 4DWSD 5E0FA 4JAWA 3W0KA 2V3GA 4MNKA 3BH4A 2JFEX 1UQZA 3HG2A 3ARXA 1HIZA 2C7FA 3EJTA 3F4VA 1JYXA 2FHBA 1WDPA 4UQCA 2W62A 4U31A 1ODZA 1VF8A 1L0PA 4GI6A 2X8RA 4W88A 3L4WA 1GCYA 3AMLA 4W8AA 3CHDA 1UA3A 2WZIA 1HJSA 3VD4A 2X0HA 4P8XA 2CPUA 5A94A 1CPUA 3POHA 1W2PA 3PZUA 1FOBA 2VR4A 1R75A 3BAIA 1GQLA 2YDRA 2GUYA 5C71A 3EDKA 2DT3A 5CSUA 4F9JA 3F5KA 1R8LA 1TVNA 3W29A 1UR4A 1E72M 4MJ4A 5E0CA 1K9FA 5IFPA 4HU8A 3NSNA 4LQ1A 4FF5A 5LYRA 2BY0A 5AC4A 1LL4A 3K1DA 3ARYA 4MB1A 3VD9A 5A1AA 5CJ5A 1BTCA 3AROA 2YL8A 4TXEA 3B9EA 1BVZA 3ARRA 1JF5A 2XJ7A 2EPLX 1I75A 1E40A 3CV5A 1GHRA 5CGTA 3BAYA 1FH7A 2BS9A 1GHSA 3PZVA 2QPSA 3VGEA 2CNCA 4U3AA 4U5IA 3MSDA 1E6RA 5GNXA 3CZSA 3MV01 1TA3B 1S46A 2J78A 3VX1A 2WK2A 1NARA 1B3WA 1FA2A 3L4TA 1PBGA 3CMGA 3EDJA 1JL8A 3QHNA 2XSBA 4B3KA 5JBDA 1KFWA 1GVIA 3IJ7A 4BQ3A 2OSYA 5A6LA 5LA1A 1A3HA 4HA1A 5I2UA 2VX4A 4PTWA 4NZFA 1WCGA 2F7RA 1QHZA 2J7DA 3T2QA 2PI6A 4U3CA 2RGMA 3DYMA 2J79A 4W87A 4S3KA 3WH6A 1BYAA 2F18A 6TAAA 5BYWA 1QW8A 1FP9A 3N15A 1TFVA 1V3KA 2V3FA 4CVWA 1AVAA 4PBGA 4J3XA 4W7WA 3UR7A 3CUGA 3VDCA 4J3WA 1V02E 2EPOA 1KCLA 4X0NA 3LRLA 3SURA 4JFWA 1W3HA 3AJ7A 3ARZA 5BXRA 1MFUA 1HP5A 3HG4A 1US3A 4KGLA 1QVBA 2F2HA 3ZT7A 3D52A 3WQ4A 2DSKA 1GQIA 3RM8A 2DT2A 4AD4A 1SYTA 4C7GA 5BXTA 3KEHA 1HT6A 3HN3A 1J18A 2OLHA 2V5CA 2VL4A 3WF1A 2WLYA 3SCWA 4XZWA 2ZXDA 2VX6A 4HMCA 1KB3A 5A6BA 1EDQA 3W37A 1BLIA 3GNPA 1UYQA 3N13A 5DT5A 3MMWA 2C0HA 4F8XA 1OIMA 1ECEA 2GK1B 1GOQA 2HVMA 3GNOA 1Q6GA 4EKJA 2DH3A 5LA0A 1XH0A 2E40A 4A3HA 5EFDA 1WZLA 1QI4A 2A3EA 5D9MA 1VEOA 2EO7A 1V3MA 1LQ0A 5TD4A 1JAKA 1C3FA 2WVSA 4UOJA 3AMKA 1HJQA 1W9UA 3PHAA 3CO4A 4W89A 3II1A 3WEOA 2J8FA 3UG3A 3WH8A 2GDVA 4DWSA 2IGTA 3I3EA 2F1BA 5BRQA 1J0HA 1HNYA 4B15A 2AOSA 4IPNB 1VENA 1CZ1A 1WB0A 3VX0A 1GOOA 1JZ7A 3ZJ6A 4W5ZA 1YHTA 4OGZA 3PTMA 2UY3A 5A2CA 2IXVA 1EGZA 3D51A 2VOTA 1J0ZA 5E6ZA 5HPOA 1V3LA 1JYWA 5GPRA 4XUYA 4DO6A 2BY3A 3O2LA 2X2YA 5CGMA 1FH9A 3DX3A 3WUEA 3QOMA 3GXMA 1WP6A 4ZE4A 4K68A 4GI8A 1BPLB 4RL3A 3WUGA 3CUJA 1BYCA 1OT2A 4HTYA 1G01A 1E43A 4PSPA 5DO8A 1QHPA 1B3YA 3WD0A 4QCEA 1VBUA 1R34A 2WM0A 3CUFA 3AS1A 3MANA 3TTOA 2YL5A 4PMVA 2D3NA 1E56A 2CBJA 2EBNA 1HKIA 1CGVA 2VJXA 4LX4A 1OB0A 1JYNA 3N04A 2XPKA 4JFUA 2X2IA 1MQQA 1P6WA 1VEPA 3AZRA 3KWXA 4HMDA 4P8UA 3E1F1 1CGXA 1CECA 3SCSA 1WKYA 4AZ5A 3VKKA 1RD6A 1E4MM 3VD3A 3THDA 4TVUA 5GNYA 4ML4A 4NI3A 4ATWA 2CHNA 4BZYA 3WD1A 3M07A 1H0GA 4HZ6A 3CZLA 2VI0A 2WCGA 1OGSA 1Y7VA 3TTSA 5I79A 4PMYA 4J3SA 3TV8A 1QI2A 3GXFA
chains in the Genus database with same CATH superfamily
2ADFH 2ORBL 4RGND 2WUCL 3QWRD 1QLFB 2GJRA 5CJXA 1R17A 2WSPA 1E0UA 4GSQA 1GYNA 3SCNA 2KQNA 1I9JH 3HN8A 2R4SH 4KY1H 4P46A 4D94A 5IBUB 2GSGA 4ONHA 1T1WA 4HIIB 1ZPLA 3DVGA 2F54D 1M7XA 2EPNA 3LNFA 2WXJA 4M61A 3N6JA 3IFPB 3MSYA 5ICZA 3FBKA 4BGDA 2X4OA 4YHIA 5B7MA 1L0XA 2E7CA 1NCCL 3QV6A 1F7BA 5FA3B 1P1MA 3V4VB 4WENB 5IB1A 1Q9OB 1JK8B 2H7WA 4QRPB 2IH8A 1ZGLM 4FFTA 4MCZA 3BVTA 1BREA 2VDRB 1LLZA 4PRPD 4L37B 1QPNA 1HKKA 4XPGH 1LNUA 4LVFA 1UOWA 1TTJA 2G2PA 3VWJC 3JU2A 3W39B 4RVBA 4GMEA 5ICYB 1O5DT 1OG0A 1V51A 3QO1B 2YPKB 4LSRL 1T21B 2ZUQC 2NYZA 1EC7A 1QSED 3OB0H 4PRTA 3P11H 2QCFA 3DVIA 3PWNA 5C0RL 1MCDA 3GKWL 2GW5A 1J8HB 1N6VA 1T1ZA 3HPAA 4G6ML 3MROB 5IMOB 4K8HA 4EZKA 3FY1A 1G7LB 3MRCB 1EZWA 5AVNA 5FFOA 2Z92B 1EWDA 4JHUA 1KBKA 3QH3A 3I7SA 3GSQB 3MOAH 2WWDA 1LMIA 2XXCB 4L1GA 1KLGA 4Z7UA 1VRXA 3SDAC 1I8IB 4UMSA 3QXDB 2PPAA 3AG4B 5CMAB 3E3QC 3FTWA 4KVNL 2V7HB 1VC4A 3O6FA 3B9KA 5TPWL 3C2AL 4W9EC 5IVOA 3DURB 2HFFA 2BB0A 3UP8A 2ZOUA 4XX6A 4LIQH 4Y5YB 4QIUA 2ICWI 2JXMB 4MPKA 2ATKA 3M9YA 3BPWA 2ESVB 4N2BA 1SFSA 2RD0A 4N20A 4CQ9A 4N4YB 3DX4A 3VDHA 3T8XA 3R7MA 4K73A 3AXIA 4Y2OB 4M9OA 4EN3D 1ZLVH 3QQ0A 4X8JA 5D71L 3PP7A 2C9PA 3OZYA 4TVPD 5T1DH 4N6QA 3APGA 5A6KA 3TLRA 5F97E 2YZRA 1S9KC 1Y0LB 1A6WH 4UAOB 1OSPH 1W0WA 5K9OA 3DIFB 4Y1AE 43C9A 1YEKH 4UM8B 5AW1B 4A4AA 1S5HB 5EMLA 2VMCA 3GEFA 1TZAA 3NCFB 4OLXH 3EYQC 1KC7A 4RZCB 4LAQL 3GXTA 4ENEC 4C4KO 4FMKA 1FFQA 4TTGA 4FEZA 1F86A 1CWYA 5DXWA 3ZDXF 2OR9H 4PGBA 2HT3C 4HFUH 3QR0A 1O5PA 1KIPA 1ZBWA 4JPVL 4UMCA 4DNHA 4MAYB 5BQ7B 5L2JA 1R2TA 4APQC 3VXMA 3CZFB 1DBKH 3K2IA 4A2FA 4BINA 2PYED 2IQAA 3A9BA 2XG5A 3ZX1A 4ZW7A 4Y4HB 5KYWB 4Z7VE 4GRWH 1JUFB 4I2XB 3GIPA 3GSXA 2Y69B 2OZ8A 3CT7A 1NDGB 3T4YA 5ALCH 4X6CB 2ZQ0A 3HPLB 4OFYA 1G9NC 3SGKC 4WKAA 1Q85A 3S42A 5I03A 4KUCF 2NXYB 4QCIA 2CUAA 2XKSA 5D9SB 2QKIC 4RE2A 2DB8A 1TEFA 1IGWA 2ANUA 5CN1A 3KYOB 4D0CB 2WPGA 3WQPA 2VX5A 2AEQL 2ODOA 3Q37A 2O6FA 1O7DC 2XACC 4DI8A 1K3UA 3QV8A 2ZYHA 5DD3L 2RH0A 4H83A 2DZPA 3EB4A 4XTRD 3B34A 3RZWA 1TPEA 2P5NA 2ZC1A 4ELMB 2OMYB 3BKCH 4O02L 4KJPC 3W7HA 4AY8A 3UAEA 2NX1A 3A22A 4WHCA 2FDSA 4LYPA 2R1KA 3BZFA 3C0JA 4QM1A 1AQDA 1ZCCA 3NFSL 3FB6B 2XWZA 2D22A 4AY0A 1VGAA 2JLLA 2JJTA 3EPOA 3A6BH 3W57A 4LQFH 4S0SD 2DIEA 4A04A 1FTXA 4XUGA 1S7WA 1U36A 3CVHL 2XWDA 5L6UA 2VC9A 4E5TA 3W85A 1S6NA 1Q90A 3F03K 1S7XB 4B90A 3QRBA 3QCUL 4N6RB 3TSBA 5EUKA 4LLMA 1ZK5A 3H0TB 1UZGA 3SE4C 3NJGA 1T2QL 4YPGA 3L48A 2WWMC 3GNML 5B1BB 2Y7OA 4UM9B 1H60A 2NX3A 3GQYA 1LK2A 4IJ3B 5DUMH 4R4ND 4PJEA 2EKGA 3QS3A 2CKBL 1S9WB 1LROA 3OLDA 5AFDA 1WBZA 5G2HA 2VMFA 3GINA 3C9NA 1NGPL 3I3DA 4KXZH 1IIGA 4JN8A 2X10A 5C07A 1JMZA 1PY4A 1E6ZA 2WO3B 1RZGB 5KTEH 1EO5A 4HIBA 4QT5B 2YD2A 1O7AA 4PN6A 1E5JA 1E2ZA 3V4BA 1BIHA 3BPLC 4Q6IA 2P5EB 4OV6F 4ZAKB 1G7PB 4UUJA 3CSGA 3R4DA 3U7YH 1FH2A 3RNKA 2IDFA 1CLZH 2OI9C 1CI1A 3F5JA 2WXGA 4XZLX 3QKEA 3ALPA 3HG5A 1UYWH 4UIKH 1YNTB 2ZSWA 5GS1A 5I30L 5C0QA 3QIWC 2B4CL 4DF2A 3NIGE 5EYWA 4YXKL 4RMBA 1PY0A 4XO3A 4IBSA 1XGYH 1SFDA 3O1NA 2OX4A 5D1QC 3FB7A 5LHDA 3QDMD 3WFEL 4E4PA 4G1EA 3NZ1A 3R8BB 1D3GA 4YC2B 3KS5A 4OD3H 4CC1A 3O9WD 4E36A 1UWIA 1TJHL 3HZKA 5IW6B 1GZQA 3I6GA 4JX4A 3AUOA 1CFTB 4BZ1L 4YWIA 3HLAA 2F7IA 3GNXA 4PCPA 2V5YA 4FKKA 4JKLA 1K8YA 4FX5A 3WHE1 3AAMA 3P73A 1CICD 4AE1A 3FJ4A 4LSPH 4WEBL 2AK1H 2OW6A 1PV8A 3ZJAA 1I8UA 4PSRA 3F7YB 2VZTA 2OCCB 3EWUA 2ATSA 1XYAA 4M24A 1WBXB 2EIBA 3FYOA 3D2UA 3MVIA 4JHVA 4WXYA 4QHKJ 3HUJA 3VXOA 2XFFA 1LCOA 2YAHA 5CJNA 4DNMA 2OSLB 3PWLA 4HKBB 4E5XG 3CTTA 2GT9A 3BUPA 3N2MA 1GHFH 2ED7A 2VISA 5I28A 3UTSD 1H8OA 2Z31C 3D0LA 1F1DA 3RWFA 4P7QA 2Q7YA 1KUMA 3EKZA 3ARVA 1TX0A 1ZAGA 3CC5A 4S3FA 3MO1B 3G1HA 4E9RA 3CTLA 4KKBD 1VA9A 1Q0YL 1GW6A 3L6FB 3C8KB 5I8EA 1NGYA 3R1GH 3QS2A 3AAZB 2JALA 2P8BA 3R4IA 1IWPA 4K71B 4YEEA 5E70A 1W1VA 1OLLA 4M8QA 5G55A 4Q9BA 3UBXA 4IEFA 2ZYIA 2X40A 1MUJA 4RE3A 4Z7UE 5LZLA 3MCLL 1IBGL 1BBDL 3O8XB 3FMGL 2VLMD 4HU4A 1H8LA 1REIA 3ZJKA 1GZGA 2B4GA 1PBYA 2NX5A 3DBXB 3DOIA 2VZOA 2OOGA 4NAMA 4B9CA 4DGYH 4KJQD 2J27A 4D6JA 4YSPA 4BFJA 1UWTA 5CSYA 3KPOB 1KYAA 5F1OB 5LCVH 2UV8G 5E2WL 1AH3A 3FT2A 2Z0UA 3DG3A 4RLDA 4PLNC 3P14A 2GGGA 2F53A 1VADA 4CCCA 4XMWA 3TJEL 5A2BA 2F5BH 3C09B 4ILSA 3TVAA 5D38A 2ZP0T 1VLXA 3TH3T 2QJJA 3FC8A 2V5JA 1S7VA 1TR7A 4JQVC 2WIIB 4XH2B 2K7PA 3E80A 1DTNA 4WHBA 3MRHB 5C09B 4KGJA 2BVTA 4L6OA 3LV6A 1MFNA 5IM7B 4TOYH 3LPFA 4LGRB 1U3HB 2BERA 1GY2A 3ZDYB 1K9DA 3SBRA 4JFDD 2X6UA 4OD1L 1I8JA 2G3IA 1CZ8H 2XIIA 3F04A 5IRPA 3S8FB 2BOCB 4EZLA 3QIUB 1CJYA 2UX6A 2XFGB 3CPGA 1OTSC 1CLOH 1NCWH 2BGNE 4EUPB 2OX1A 3TT1H 2WGNB 4Q4PA 3JXAA 3AXKA 3U6RA 3H7BB 1YZZA 2P5WA 2YC1A 2CLZB 4IF2A 4AYGA 3VM7A 1LQ2A 5HDOA 3UWWA 2V38A 3S4SA 5F7DB 2X4TB 5DELA 1OIOA 3VWJD 5JHMA 1WA3A 4JZOA 2H1XA 5I1AA 1GC1H 3RVWC 5HPCA 4P4KB 2D2CC 1Q6OA 5HHMB 5EMKA 2RTTA 2W81C 3S2LA 1UURA 4NY2A 2Q2LA 4H8VA 2WBKA 1O9ZA 2P3ZA 2H6UA 3QCTL 2DQEH 3MCNA 2PWVA 3OZMA 1NFBA 4WWPA 1RP9A 2YEZB 1MAMH 2JB6B 1A02N 4XZIA 1OD0A 4HA4A 2ZZ2A 4HZLA 4MJIB 3CWGA 3SDAD 4LEOA 1T5AA 1W0VA 3M0YA 4O00A 5AAWA 1SFJA 1H3WM 5EU6A 4AI7A 3HE7C 3Q8AA 4MWFA 5E99L 4YBHA 1C5CL 2DZBA 3MV8D 1QDSA 3RJXA 2X2JA 1A2YB 3ITXA 1YDPB 3USBA 4ZE5A 4WTQA 2WQDA 3W70A 2FECL 3SGDI 1FZOB 4F5CA 3SE8H 5B3JE 1RZ8B 5KVFH 1JZJA 1MNZA 1YY8B 2FMNA 4HZMA 1MH5A 4OV4A 4RE4A 2Y6TE 4PMQA 1HWGB 2OWCA 2YCEA 2ZX5A 3W9ZA 4L1BA 5J6SA 4B5ZA 2C91A 3OHIA 5I73B 4HS8L 4XPFL 3CO8A 2BIMA 2J3SA 3FU3A 1NIAA 5F3BB 4LLQB 1EEPA 5JZ7C 1CGSH 3VU1A 3SZ8A 2XGZA 5K93A 1D9EA 2XSAA 3S0CA 3IETB 2QF8A 2J73A 4Y2DC 2FX8H 4FC3E 3EYQD 8CGTA 3PB2A 1R3HA 4ENED 2R0WH 3DX0A 2LAGB 3CAKA 1IEHA 2NY0B 3JTSB 3G22A 3NAAH 2OSWA 2H3NB 3U57A 3P3TA 3W23A 2HT3D 3RLGA 1I1XA 1EP1A 1NQBA 1CB2A 2W8CA 5AZEH 3VTTA 4H1LB 2AL2B 4NCC1 4RNIA 4APQD 3RILA 1ICTA 4UZGA 4Q8BA 4BSVA 4HV8B 5H2BB 3BPOB 1PDYA 1TVHB 4L8CA 2NT1A 2E9MA 1W8GA 1HHHB 3V7AG 4DJEC 5C07E 4E68A 1T03L 1IC4H 4E9QA 2PDHA 2VC2B 3Q5TA 2CETA 2F6XA 3NCYS 2OMUB 2EAEA 2Z1WA 2FJHA 1RIUH 1HXMB 4ZS6C 3F7JA 2P3YA 2RUSA 4KK6C 4YE4L 4JRXB 1QJWA 3WNJA 4EI0A 1Z5YD 3N44B 3VPLA 3ZDWA 2WB5A 4NHUB 1ADSA 3L95B 2OEKA 4ERAA 1M1BA 4TM9A 3GMLA 1E15A 3RX4A 3AIVA 1JV2A 1P7KB 4I1NB 1DDHA 4G9FD 3ZL4H 3CN2A 2WY3B 4WZ9A 2CDFB 1HQRB 4FNLL 5D7LA 3V0JA 1GZHA 4JRFA 5EZOH 3FVDA 2X0HA 5IV2B 2A6IA 3KPSB 5C71A 4AVIA 3ELAT 5TIMA 3LENA 4MJ4A 5I16B 4ETQA 5KVDH 5LYRA 4JPIA 4HWEH 3BX7C 3BUTA 4MB1A 1I3RB 5A1AA 4KJPD 1KW1A 5EU7E 1Z9SA 4UT6A 2C1PB 3BAYA 4O54A 2VXSH 4M6OH 4PGEA 3PZVA 2QPSA 3WFBH 4X7TA 4JY4B 3TAKA 3D3FA 2WXHA 4HJFA 3B2UC 4CSTA 1PBGA 3KMDA 2H9GB 1CYXA 4EVNB 3BQ5A 3PWVB 4LIQE 1FV1B 5KBNC 1C9WA 2DVUA 2QDVA 1NDZA 4ZO9A 4NQEA 1EP2A 3RAJL 4FOJA 4QSHA 3ES6A 2JB5H 1Q7QA 4A8RA 2HCVA 3D85A 4HPYH 3LRLA 4BK5A 3LNMA 3EBIA 2WWMD 1ZQ5A 4E3TA 2VN5A 3MBXL 5LIWX 3LRSB 3A5FA 1DN2A 3NOIA 4G7SB 1OW0A 3UVAA 4AD4A 3LD8C 1P1ZB 2G37A 1WOBA 3KEHA 4RLIA 1WCBA 1TKWA 4R88A 4EDWL 2KZ1B 1OY0A 1AW5A 1ECEA 4YDKL 5DHMC 3WD5L 5DD0H 3PVFA 4EKJA 1T20A 4AW4A 4UV4H 5EFDA 3G9VA 4JPKL 2HXUA 5EBUA 3W07A 1FBAA 2MKWA 3AW5A 3GB7B 4JHWL 5TD4A 1C3FA 4OGYH 3ME0A 3SPVA 1U8NA 4LCUA 4IMFA 8FABA 2F1BA 4RWYH 4K38A 4BHYA 4K94H 2CJUL 4RH4A 5K9CA 2JH2A 5J9PA 4PG2A 2NX5E 4GRWE 5F7AA 2ADJB 4XO4A 1F9CA 5EEUA 3H42L 1MCEA 3KPMA 2J6XA 5CGMA 2QUNA 1MFAL 4WHTB 2OX5A 2X4RB 3VC6A 4RL3A 3LCFA 3Q5OA 1OT2A 4PSPA 3QIWD 4FQCH 2TSYA 2I1OA 1MN4A 2F53E 2ZWKA 1LEIB 4FQPA 3VG9B 4AX3A 1XF3A 4IRJC 3UCCA 1CGVA 4J3ZA 2W1NA 5D1QD 4QXTA 1OB0A 3NRFA 4CDHA 3N04A 2PTXA 1ZHBB 1FZJB 4U6TA 5CEYA 3NCYP 3GS0A 4N9CA 4TVUA 3FT3B 2GHWB 2J5LC 2HKFH 3LEPA 1FWNA 4YHKH 3KR3H 3EIFA 1Y7VA 1ADOA 1XBYA 5D72H 3ZVHB 3NSDA 4W9IC 4IRSB 2V2WA 1T0NB 2D0FA 5D2LA 3P9MB 1J5DA 3NZ8B 2MPVA 1T89C 2Y24A 2J8TA 2H0FA 3M0XA 4ZMLA 1W17A 3FO1B 5T3ZH 4TULH 3E6FB 5MKGB 5BOOA 2XV3A 3QN3A 1BECA 4L3EA 1JUBA 1SHXA 2A3AA 4KKCC 3HNSH 1ORSB 1C8YA 2GC4C 2JIWA 4LJ3A 2P5WE 5FV1L 1U92B 2F5AH 1S7UB 3KL0A 5D7IE 1KPRB 1BYBA 4KKZA 4PBXA 3BPNB 3KD4A 3JV0A 5I1CL 2J6EL 3CZEA 4QQ3A 3GH7A 3J8F7 4NYUA 3MZNA 2Z31D 1MHPH 4PJDB 5DZNA 1AZBA 4QXUH 3WGVB 1ZD6A 1DVQA 4YHOH 3E0GA 1JGLH 5CR1A 3JVAA 2R29H 4Y9PA 1P7TA 4B9GA 5IHHA 1EFZA 1A47A 4RAUA 3W6MA 5JH2A 3DTDA 3D4ZA 1G6RH 1S5MA 1XF2B 1XLHA 3MLSL 5DGQA 5CLYA 1S3TC 5AOJA 1L0QA 4R5EA 4YTSA 2ZG2A 3O06A 1MDTA 1MDLA 1YC7A 3OXSA 4FNRA 3IT8D 4WRLA 3RU8L 5EU6E 4FP8H 3VVWA 4MUPA 4BQBA 4DEFA 1I1RA 4ALAL 3NG3A 5ISZA 3QSRA 1CFSB 5AAPA 3W7KA 1IAKB 5C2GA 1SHMA 2WLLB 4FR6A 4XGZA 4F5CE 1X97A 1DEEA 1G4PA 1FL6B 5CBAB 3WN5B 4MWAE 3Q6FA 4AZ8B 2Y1VA 1L9NA 4FNUA 5IMLA 1TU2B 1OFPA 4QBXA 3L3GB 3O6LL 1OTUC 2G50A 3CVBA 2Q8AH 3OG4B 3N1QC 4GW4A 3S1VA 2LGNA 3V6ZA 4U1MA 3LB0A 2NUPA 4CN4A 1J05B 2EACA 3E9UA 3CN0A 2XTJC 4AYFB 3BE1H 5FM8A 1BW8A 2F8QA 1SZNA 3BO8A 4BZ2L 4UR8A 2V33A 2WMIB 3PSWA 1AE6H 1B4LA 4NOFA 3TZVB 1JZIA 5BVJA 5EUOA 4NIYE 3WXWL 5DXXA 5JHDA 1XUZA 3PK7A 1U21A 3JT2A 4AD2A 4AXWB 4UCFA 4XPHH 3QY7A 1IJ9A 4U1NB 3LPOA 5BOPA 4M5SA 2BJML 1OTSD 2BVOA 1C08A 1YRRA 1CB7B 5JPNB 2BVPA 3LKOB 4PJIA 4NIKB 5FUOL 3T0EC 3C6SB 4BFNA 5AB0A 3FVMA 1YLVA 3LQAH 5KSAC 4WU5A 2JI2A 5D1ZI 1J9SA 2PCQA 3KZSA 1EDTA 1Q2RA 2CK0L 1HILA 3LCXA 3G3DA 5E6RB 3Q43A 2ARJB 1XGTB 3OJGA 3UTZB 4OJCA 4C65A 4MLSA 4Q4RA 3NEEA 2QUTA 4GINA 3RVWD 3V9EA 3LHWA 3V0VB 4R33A 5FWRA 3RWJA 2A6LA 3H55A 4KTGA 5DFAA 3CPLB 3SCQA 4OZHB 3EOBA 3V95A 2IKHA 4M3JA 1OFBA 3BYTA 3WU1A 1TIWA 5AC6A 4XNQB 3DN5A 2PP9A 1U8HA 1OFAA 3VNKA 4ROQA 3U7WH 3W1QA 3GXUB 5GJSL 1ZP4A 2VC6A 5D7LE 4Z1BA 5HXMA 2YDAA 4ZMQA 4RNFA 2X09A 5JXQA 1OB1B 2F19L 3GIVA 2A99A 3UH8A 2R39A 5IB3B 3N2JA 3HE7D 5FK9B 3KL3A 1O6SB 1DVTA 1NGZA 1CX9A 2ZSVA 1XLFA 1Q1PA 4H8WC 1UA6H 3I2CL 2DLFH 4EBQH 3QPXL 2WWKT 3NYKA 3PTKA 1NGXB 1DWAM 3TC7A 5F9WB 4PJ6A 2B39A 3L4VA 3MA9H 1EIBA 1GKRA 2B0SL 5FCUL 1OXYA 2IADA 3JWDH 3WJSA 1K03A 4AMCA 4ZNEA 1FAIL 3N0AA 3CAQA 1RZFH 3BV4A 1PZ5B 4OCYH 3FZUC 2BIPA 4HEME 3EYSL 3KPLB 2YGPA 1HEZA 3D39A 2GG1A 3B0YA 4YK4C 1MRQA 4JHZA 3UJSA 5JZ7D 4MGGA 4CD6A 3AIBA 3BOFA 5C6TL 5C97A 1TQTA 3VWKA 4KBPA 4HDIB 1WEJH 4Y2DD 4R8WH 1O68A 2A6KA 3G5ZB 1JI1A 4HPOL 4LSVL 2R7EB 3ASNB 3FUDA 1F3WA 1YPFA 4JTDA 4R0LA 3UYPA 3EDDA 2MCAA 4RNRA 1UOZA 4KU1A 4HLZG 5KMYA 3N2XA 4X6FA 4P5SA 3FSOA 3OA3A 4MA1C 1JZEA 5K5YA 2HP4A 2YPVH 3DFNA 1MQKH 3HPZA 4WFHE 4AVOA 4XD5A 2G3MA 3LM3A 4IBYA 4F8PA 5T1LA 3ILPA 4DJED 1DUYA 3QUXB 5IJKC 1SR0A 2XN9B 4N8PA 4KJWC 1DIOA 5EEXA 5M3WA 4W84A 4ZS6D 4WKFA 4MMYA 4KK6D 3ZLHA 4L8SA 3D69B 1JK9B 4RK8A 1I4FA 5CINH 4HS6A 5I1HH 3N1MC 1OT4A 4ZB0A 4X5PA 1ADQL 2Z4GA 3ROOA 3SKNA 1OCJA 2Z1XA 5CSZA 5DZJA 2V9UA 4E9VA 1X5IA 3UR8A 5XINA 4ICCX 4YDIH 1MRCH 4YSCA 1PGRB 2B15A 1I1FA 15C8H 4HPGA 4XTIA 3N19B 4D8OA 4Q52A 5FJPA 5A7EA 4MNHA 2BZCA 3MMEB 1C8PA 4ZMAT 2BSDA 3MLYL 1ZGLB 5HDLA 4Z3TA 4G1NA 2XY2A 4AMKL 5I0XA 1CG9B 4Q9QL 4LC8A 3NGFA 3HA1A 2Z9TA 5JW5A 1KTDA 3CWNA 2NZIA 5D2LE 5FM5O 2YLLA 3GBDA 4QLWA 3B2UD 4Z0BL 1DQTA 1PSKH 1SF5A 3GI8L 1H5BC 2W9DL 1A7RL 1JVKA 5KVFE 3NTCL 3MS8A 4YLBA 1R3QA 4WGWB 4L3EE 4JKWA 4U1JB 3KPNA 4N9BA 2I26N 3B7YA 3DPDA 1J10A 1KBGH 3MLZH 3G1XA 4C83A 4P2OA 5HDQL 2NSMA 2WWNA 5KVEH 4JJ5A 5GGSY 3VFWA 4P2RB 1CF8H 5EHFA 1WQVT 3M7OA 4OUUA 5CAKA 3S37H 3TV3L 4GUHA 3DJTA 3U6WA 2I57A 3W7RA 1S2VA 1V05A 4D1IA 1ZVSA 1AGBA 1IGML 4MB4A 4WGKA 2ZICA 3AVEA 2NY1B 3UYCA 2FJGB 1JWSB 2VDLH 5I1IL 3O4LB 4QR7A 4G7YL 1EQWA 4G3YL 1TCRA 3OR6A 1HJBC 4Z1AA 3PZQA 1WNOA 4X7FC 3GPSA 1H3VA 4X9YA 3FN3A 4F9LA 1BRLB 5I8KH 3FS2A 2AC0A 4EZMA 3UYIA 4PL2A 4HXBL 5ESVB 5I1KH 1J88A 2ZJSL 1PLBA 2QEZA 1JPSH 1NPJA 3SDXB 5JOPE 3GLDA 1CE6B 1EUTA 3S5SA 2OP4L 3EDEA 2ADIB 3LCWA 4U6YA 1K2DB 1KJ3L 1T7YA 3TGXA 5E2JA 3VH8B 4B5NA 3CUZA 2JJUA 2CBQA 1QPPA 4AYMC 1LUCA 1O1HA 3BW9A 3JR2A 5GRVL 2WLNA 3PGDA 3MRPB 2OJEB 4IRJD 2AJVL 3TYBA 3JZEA 3VXGA 2WBXA 4JTFA 4LP8A 4PJAA 3VI3E 3SB3A 4NJIA 1S9YA 1QR4A 2DPEA 3O0RH 4DPPA 1HKLH 2PDIA 3A9IA 4DB7A 2B7NA 4LLVA 2VNCA 5I3IA 5FHAH 4HW6A 3IJHA 3S2CA 3PZOA 2QHLA 4FX6M 1M3JA 4H6QA 4LBUA 5HJBA 1KBVA 4K7VA 1BZ9B 1DR9A 4OZFB 2QCNA 5EUOE 4LPCA 5KVDE 5E8OB 1OAZL 3LHAA 2Q09A 3X3GH 1A65A 3ATDA 4OIBA 4L0ZA 4WJ8A 1A0CA 5E2UH 3QDJB 2CHRA 4AZCA 2HN7A 1FWDC 3Q2WA 5D1XC 3OG2A 3MHUA 3UG4A 2R23A 3DHUA 2UY7A 4B5WA 1NMCB 3S34L 4KKCD 4UV7L 3NQGA 2XLLA 1EJSC 1QNOA 4X9GA 4NZDA 2G2NA 3T4WA 1B2YA 2R2CA 3CSTA 4ZEPA 4YDZA 3TBYA 4YH6A 1JNLL 4HHWA 4S39A 1FSKB 5EIIA 2QVHA 4PW4A 4WHYG 2F7QA 3M4HA 1H1NA 5A5WA 2ICWB 1BWKA 1GXEA 1UKSA 1TJXA 2N1KA 4KXZI 4PP2A 3T4AB 3WENA 1A3QA 4IMLA 1YNPA 1DE6A 1PYFA 1J93A 3D25B 2FEDC 1A0QL 4X6CF 1L9WA 3KWTA 1IGTB 4XSMA 3LB6C 4CN6A 5E2VL 5INDB 3ZLQC 2C3GA 4W9FC 3S5NA 4RRPG 2YAPA 1EAJA 1U8IB 4U1LB 5BZAA 1UC5A 3RL1A 1DOSA 3WIFA 4HIHA 4PJHA 2XJKA 3CDGB 2QCLA 3CIQA 4ORGB 3TH4T 3OVRA 1OBAA 1IEBB 1GVEA 5HVHB 3KLAA 1NU5A 3PPEA 1A7QH 2HFEA 2P1FA 4ELMF 4WR3A 2BOFX 4JBRA 2D20A 4ZNEE 4XP4H 1OTUD 3C75A 3LXBA 3QISA 1KFKA 2XVKA 2X30A 3D39E 2NSQA 4JR5A 3KAOA 4AJWA 4BH7A 3GZQA 4GSDH 2XTJD 3BP7B 2BSLA 1GNXA 5AW8B 1I8KB 2YYUA 3VTRA 1CDUA 5IESH 2GGHA 2MCPH 1LF1A 1WWCA 5HQMA 2HVKB 4XXCC 2HK1A 3WTWA 3DDFA 1D8WA 3KH4A 1S9XA 4JGUA 1VZIA 1UZ8B 1OARH 3CZKA 2VZ1A 4NQTA 4PIRF 3OB8A 4RFOL 5CZVH 4JM4L 1VF5C 1HIML 4UTBL 3Q44A 5L2KA 3RZCA 3PWAA 3T0ED 2XVLA 3J7HA 3WK0A 4IU2B 4FD0A 5KSAD 1DKWA 3B03A 2C8NA 2AV7A 3L9BA 3T3ME 5A2LH 1J5SA 3RIFK 4F7EA 3SDCB 1WBYB 3HNTH 5T3ZE 1C5BH 4ESKA 1TA3A 1PMYA 5D96B 1E9OB 4DO7A 2WXDM 4HWBA 3BANA 1BFTA 4KJYB 1NAKL 2HLAB 1REQB 2DMBA 4BA8A 2Y5TB 3FRPB 4UQEA 1HCYA 1WKEA 2NCMA 5GZOA 4PRRA 3AXLA 4E0RB 3PGFH 3WDRA 3R5EA 3F65A 2PDNA 3ZZQA 5AECA 5KBDA 5FGCB 5E5MA 4JKMA 2MIZA 1OAXL 5DWUL 1GL4B 3REWA 1MDRA 3B2PA 3TO2A 4KC3B 1HJUA 5ABHA 3VGDA 3N9SA 5JMRA 3RUBL 4ZS7H 3HC3H 5I1EH 1PTGA 4PRNA 1UR0A 1KELH 3K8KA 4MNKA 1N4XH 4X6DB 1YNTF 2MOVA 1U5HA 3EJTA 2CLIA 1HOEA 3L0KA 3MLWL 2XXGA 4LLAA 2QHRH 1GIGH 3P4OB 1BQLH 5FDWB 2FTWA 3CLEL 4ZUWA 1EHLL 5EB9A 3GW3A 5HHVL 5DHEA 1P53A 4L1XA 1FL3A 4X5XB 2FMOA 4PJ5A 5D7JC 3ARDA 3BLEA 4ISVA 3H21A 2J88A 3US1A 2YCLA 5AC4A 1P4IL 4GW1B 3VD9A 1XIWB 1BTCA 3K30A 3SY5A 5ACMA 3FZUD 3H7VA 3SADA 1D5MA 4KH9A 1RVFH 4KFNA 4FA7B 2FZ3A 2XV6B 3OX8A 4H6EA 1FA2A 3W3OA 5ADOH 3MU3A 3CMGA 4ZFGL 2VFEA 3CDZA 4WI3A 1HHGA 1XCFA 3RCMA 5FW6A 4HA1A 2ZXWB 3U6XS 3HMWL 3LSBA 4XBPA 4P49A 43CAB 2J79A 2VD8A 4QXVA 1K77A 3LNPA 3KZPA 4S1DC 3WUWB 3CUGA 1X5AA 1RUQL 3DC8A 5IT2H 3RFZC 4O12A 3NRQA 4NO0A 4PS3A 1DL7H 3U30C 3PWIA 3QI9B 3VXPB 3VKCA 5AZ2H 4DPQA 1I0BA 1OAKH 1GQIA 2X7LB 4JVUA 4R97C 1SYTA 4P59L 3L3DB 1XFCA 4NQCD 2PLJA 4HZAA 5KBMA 3WTUA 3UCDA 5J1AB 2GK1B 3VFMA 3JQOB 3K5XA 4KJWD 3FYIB 2DWTA 4Q7IA 2DH3A 3SQOL 3CFEB 1MCKA 2X42A 3UGVA 4J12A 1IWAA 5DQJA 2IPUG 3FU7B 3TEYA 5C0AA 5DDHA 4TUUA 1TEGA 3PHAA 1TE6A 2PURA 3GBML 3U46A 2DYPA 1OO2A 2YRBA 5IJDC 1WFOA 4QRBA 1VENA 4QNPE 4OGZA 4RFEA 1HINL 4JMNA 2EILB 5ICXB 4NQDB 2P80D 4XBKA 1ETZB 3II3A 1YEHH 4XUYA 3HPJA 4YDLC 5CCGE 3VXSA 4YDJB 3D8MA 4L29B 4PJAE 3GDKA 2BGQA 2GHZA 5IUSA 2EC9U 3MGOA 1LK3L 1JQXA 2HV5A 4D0BB 5IQLA 5JQ9A 5CNHA 3UDWA 4EPKA 1CDJA 1BXBA 4ERSL 1Q72H 3TTOA 3RITA 1HKIA 3N4FA 4Y8AA 4PR5A 2E28A 5DVKA 1UUOA 3IDJB 2WBJC 3O2DH 1MQQA 5CPMA 3E1F1 3QUHA 1DQLH 1GSKA 5D6CA 1K8CA 5C0BB 4A3QA 4B9IA 1AMXA 4QRRB 1BGXH 2Y7DA 1CBVH 3DGGA 3BH9B 1TTRA 4J3SA 4XAWL 3TWYA 3CU2A 3ZDYF 5DK0A 4KRLB 4GEIA 1MYRA 1U1UA 3GG7A 1IEWA 3FL7A 3GRWL 4P2YA 1J1XH 1BDYA 3P9LB 4F7CA 3B97A 5JORA 4CU8A 2R82A 1JV5A 3ZZLA 3KXQA 1TVBA 5TNVA 1XFBA 1WSST 2VJ0A 3EOSA 1CE1H 3I6TA 2J1XA 1WAAF 2XICA 3K74B 1CGTA 3KTCA 2M26A 4HUCA 5I18L 4MQTB 4XRCB 4WI0A 1UG9A 4ZPVB 3QHFL 4P06A 3WFDL 1I2RA 4NC1E 4PEEA 5EO9A 3V5FA 1JPEA 3SJNA 2Q10A 2AHIA 2WZMA 5I9QB 1AKJA 3VZYA 1ZLEA 5LKNA 1XR2A 1DEDA 3GMRA 3MUZ1 5GIRB 3N34A 1S7RA 2F8XC 3AUVA 5KANG 3MZ2A 4ATDA 3GI9L 3X17A 5LQBH 4C6OA 3KNBA 4PUEA 5DJZA 1PCWA 5A6SA 1YEEL 3MRRB 3T0BA 3OGCB 2IQ0A 4XAKE 2Q76A 1GGYA 5FYKU 4N8VB 5AOZA 3EO9L 5DMKB 4FAAB 1ZLDA 1SLUA 3MLUH 3DX7B 1EDGA 3MO7A 4MJ5A 4HP5A 3NACH 3VE0A 1N67A 3ZL1A 5KUMA 5LN4A 2W07A 3GU1A 3KJ6H 1MLBB 1BCIA 3B40A 4OVUA 4YHYB 3W24A 1EF3A 3MSGA 4G82A 4YQXL 5GS0C 2OS7A 3VM5A 3EYPA 1ZHAA 1RZJL 1F07A 3KP1A 4Y90A 5GJNA 2QVFB 5L0QC 1UENA 3PUEA 1T3FB 2DWDA 3PNWB 1IGJA 3QNXB 1X4ZA 4OM0H 3R13A 3NN8B 1ZT4A 1F3EA 3IDUA 4BFFA 1DWJM 4AQEA 2J55A 4KXAA 2Y5EA 2MNRA 4ZMTA 2B9AA 1XGRB 5JIKA 3O3DB 3FUNA 5IB2A 2O6CA 1TG7A 2WHLA 4LS0A 1J01A 1H61A 2MTAA 1I9CB 4GRLC 4CBPA 3S6CA 2IXQA 4G7EA 3QW4B 4BY3A 2CIKB 5D1XD 2J2ZA 3X11A 1A5FL 1U2CA 3V0FA 5TQLA 3QULB 4NQQA 3GMNB 4S10A 3AWEA 4IDLA 4OOZA 3JWNG 3A6CH 3VIJA 2VDQL 2IC2A 3WN6A 2XKNA 3MXWL 4OQVA 2ISDA 4HAFA 2YA1A 5EBWA 5FOBA 3QLLA 4C6MA 2XRAH 5A6AA 3LPWA 3B4YA 4Y1AB 4ADGA 3T0DA 4W7UA 1JGVH 2FYVA 2F7FA 4B4FA 4HX1A 4JM2B 4BCZA 2A74B 2QL1A 3RYMA 5KVEE 5FO7A 3VCLA 2FQFA 3P30H 4UT6H 1G7MA 4CD5A 4M9PA 3DLQR 4JZJC 2GPZA 1DBAH 2FEDD 5BW6A 3QZWB 4WWKC 3B2DC 4UFJA 1CR9H 5IQOA 3CASA 1LWHA 3BGAA 3QJRB 1D3CA 1FGVH 3B7UX 4A7SA 1IGYA 2E6DA 5E8EB 2GIXA 1HZHL 4IOIA 1FA4A 2L8AA 3LB6D 4YWGL 4OLUH 1IE5A 3N44F 1DJGA 4G7VH 1OK0A 3V6OA 1OAQL 4LCYA 5IZ7A 4UTLA 5HHNB 4GRMB 1S5IL 1F0LA 4Z7VB 3C60C 4WV1B 3QUYA 2FBJL 1QRQA 1LO0H 4XP5H 1XRVA 1S3KL 2ZWLT 1BM3H 1KEGH 2GJ6D 1RLBA 4YR6B 2WWCA 3QKZA 4FRWA 4AJ0A 3G0XA 4DWSC 3UESA 1EO8L 1F4WH 4LHUB 4UWMA 5FACA 4BEUA 3OTRA 2QULA 2XHYA 2X1QA 3MRMA 3CFJA 3QAQA 3QV9A 1V93A 4DI9A 2QGEA 5FYLE 2WJ5A 4IIBA 3BUYA 1IGIH 1GQJA 3MRJB 4I0PA 1NIBA 2CO7A 4KWVA 2FH8A 1AI1H 3Q2VA 4M48L 2BRRH 5CCKH 3S6OA 3LNHA 1QX1A 3NT0A 4LBEB 5K9XA 4YMPA 3LNGA 1CFVL 3P61A 3ARBA 5HHXL 1KR1A 4G43B 5F2LA 4Q8MA 3VXME 1FBIL 3FAWA 3N85H 2HRHA 3TNBA 3TIEB 3WY2A 5F8RC 1K3ZA 2BPBA 4UFKA 5FKPA 1E2VA 2AXHA 3QUKA 1E4KC 3B06A 5C54A 4V15A 4K23H 4J39A 4GXMA 3IK2A 3O2DA 1R9XA 4G6JL 1WK0A 1YUHB 4WW2B 3LCLA 4C6IA 3WQDA 4GUPB 3PJSB 2IAND 5F4XA 3R58A 2VSMB 1OK6A 2WYSA 5JNYB 1Q38A 3TP4A 4HOZA 5AW2B 4CC4A 3W7GA 3W1UA 1C7TA 2NYYC 4LW7A 4UQ9A 4M7LT 2K1MA 1J1PH 2VDKH 1MWAL 4Q8TA 1JZ5A 1YTDA 4MJ6B 5FF7A 1O7VA 2XM2A 1UZ6F 1JBJA 1XGEA 5K39B 3WBXA 3ZS4A 1DWHM 1LO4L 3H4FA 1PS9A 4A2RA 4HD9A 2PCYA 5AVWB 1C5DA 4GS7B 1LVEA 4Z0XA 5EF0A 4PAZA 4HJWA 4UIMB 1ETA1 5GNZA 4CNPA 4OKVB 3V6FA 2J47A 5HK4A 4NJHA 1AQ8A 1OHZA 5C0FB 1EX0A 3G6JA 1I7UA 2V5MA 4FR1A 5F2IA 3GSOA 4WSHA 5TH2B 5AHNA 5D7EA 5T1KD 1B3IA 1FQ0A 1NICA 2J4WL 4HUMB 4JFED 2VQUA 1MHEA 4KVCH 2Q8LA 4XC1L 2GDQA 1VCAA 2EYRA 4HK6A 1AY1H 1BWVA 4GX8A 1BYNA 3X12B 1IKNC 3QXAA 3WLWC 3RI5F 1FWTA 4MQSB 4NB7A 2Y2WA 1N55A 1B3VA 3AREA 1AH1A 4GIPD 3A5VA 1EZUA 3IFOA 4RSYA 5D7JD 3GBLA 1GVFA 1D5IL 3RJYA 1CBGA 5C86A 3WFZA 2R2EB 4W86A 5JXEA 3WJLC 1W9BM 1HAUA 2OQJA 1IM3A 2CUHA 4FQQA 4DEWA 2Q3XA 5IHLB 3DO3A 4KDWA 4NM8H 1HL5A 4U1KA 5FEBA 1VIZA 4KQ3L 1L9MA 2C9RA 4Z0JA 3HMJG 2GJXA 4PJEE 4O5LH 3FTUA 4ZFMA 1C1EL 3IFLL 2HQAA 2CFFA 4DZAA 1NIDA 2HKHL 5F1IA 3LKPA 4YAQB 1TPVA 4ZQTA 4JFQA 1DQUA 4EIUA 2YN3A 4P3CH 4S1DD 2GSGB 1UXMA 4ONHB 1T1WB 4ACYA 3WS6C 3SPCA 4PWIA 3BLKA 1JCKA 3RGVB 1TPUA 4A3RA 2P8MA 4J27A 1W72H 4AEEA 5ICZB 2X4OB 4YHIB 3V0WH 2Z34A 3VDBA 3LRGA 5D33A 4HF5L 1EZVX 3A0OA 2VLJD 3Q9QA 1H0DA 4PJDF 2D2GA 3CUPB 3C08L 1W5OA 1VYRA 5IB1B 4MLJA 4MXWH 1YKWA 4Z7AA 4MCZB 1ZAHA 3APNA 3CK0H 5DWPA 3GXPA 1ILSA 4OV9A 3UQNA 2BNQA 1JDAA 1BMGA 3MCOA 1BXXA 4HK0B 1NFAA 5HMDA 1KLZA 3HA0A 4M6NH 5KZCB 1XLDA 1QFOA 3AM8A 1E1EA 3EOLA 4R84A 4US5A 4MKTA 4R85A 4J2PA 1RMFH 3P0YH 4PVMA 3OHMB 4IUGA 1ZRUA 3WJMA 4V33A 2P9RA 5EB8A 1T1ZB 3GAKA 1LLWA 3IWPA 3IRCA 2A3CA 1YEIH 3O07A 3BARA 3QH3B 4B0MM 5LJYH 1S7QA 2BMKB 4X5WB 3N25A 4E8CA 3BVVA 1JPKA 3K72A 4KI5E 3W7NA 4TUKL 4WI6A 3O6FB 3B9KB 2HFFB 2WBJD 2DU2A 4HOWA 3HUJE 3T78A 3PHOA 2YSSB 4U1SB 3BKML 5IR1B 5TK4A 1S9VA 4YHZL 4PJ9C 4EPBC 3UBPC 3ATEA 4LU0A 3QB7C 2H1PH 2AKMA 4WIWA 3L67A 2R1MA 3P77A 1NF7A 1R30A 1W0WB 1AAJA 5K9OB 3LRKA 5B7FA 3ES7A 3UGEA 3S35H 2J7LA 1D9KA 1ZANH 3BO9A 3Q06A 1BEXA 3AJXA 4Y9AA 2H2PC 2EUVA 1CQYA 3ULVL 1ICQA 3QGKC 3QGAC 2WHKA 3EX2A 4E9XA 3QRFM 1RZKH 1UASA 1H50A 2BMBA 1GGCL 3DVNA 1XH1A 4PUBH 4QX4A 3PV6B 2HMIC 4PGBB 1IF2A 4O02A 1KIPB 2CLHA 4DTGH 3ZTJH 3QTPA 2V2TB 2XZAH 3JZ7A 3I75A 4F9DA 2VDOB 4NDMA 3QUZC 5L2JB 3FSUA 3BCDA 4LRNL 1H41A 1ZHKA 4OZHF 4BQ5A 3VMOA 1DBJL 1I3GH 5AWNH 3NJVA 4W9JC 1A9BB 3AQYA 3L3OA 2IQAB 2V68A 4MXQC 4BF9A 2XG5B 2R2HB 1BP3B 5K59F 3EOOA 3SBPA 3U0PA 2PC8A 2A4CA 5D70H 3V8OA 4X80L 1RUPL 1S7SA 2D2HA 3FU5A 1B0GA 3OXRA 1BF8A 5BV7C 5DJ0A 4NUMA 3ZL2A 4NZUH 3OZKA 5D1ZB 3Q58A 3ECBA 2Y5JA 4HKJA 5GS0D 2Y7NA 1T66C 3P2VA 4PTMA 2N4IA 2PTTA 2CO1A 1I1AA 2ZRVA 4NF7A 5L8JB 1NGQL 3HZ3A 1ADWA 3QYMA 4MOZA 2WXOA 1XYBA 1MFDL 5A6IA 1CD0A 4JS3A 4AUBA 4HUUA 2QR0B 1WICA 1G7IA 1JHLH 2BHYA 1PHQA 2VGBA 1DDTA 2NSXA 5LXGH 2XPYA 1XISA 1EEUA 2XG4A 2RGSA 3QQ3B 3DERA 4GFXA 4FNPA 1XCTA 4Z18A 1YYLH 3P67A 4NN5B 4UQAA 4LLYA 3EB2A 4GRLD 1DZ0A 4Y8DC 2EUWA 4HJEA 2AQ1A 4CD8A 1E3FA 1KB5L 4NAFA 1FJ1A 3T1FA 1K8DA 3OKNB 1WX0A 1P4UA 2BVWA 3EKGA 1EHXA 4U2YA 1S7WB 3LZOA 3PNZA 1HTYA 3A67H 4CCDA 1TJIL 4YDVB 1UJ3A 1W9XA 4IJRA 3U1QA 3TN0C 3KZ8A 1SMAA 4NQVA 3KW7A 2DY3A 5AHEA 3O2VL 1AMYA 1H15A 1ICSA 1HFUA 1LILA 4LLMB 1POKA 3DTUB 5MEND 3GAYA 5A8OA 4YPGB 2B81A 1TVLA 3WD2A 3O6DA 3QZNA 3RX7A 3VFNB 4MNGA 2PWEA 5DRNA 4JTHA 2L7UA 4QTIL 3CU1A 4WWKD 2HNEA 3C5ZA 1QI0A 1UEMA 2ZUMA 4BZ1A 4DGWC 4Z76A 2VDPH 4F8NA 3G6JE 1WTGT 3IVKA 3CVIL 1WBZB 4PCSA 2CDEB 2VM3A 1W72A 3C9NB 3OBAA 4M0XA 1YTEA 5I66B 4Z1YA 2I24N 1M53A 2F68X 3U7VA 3SDDC 1AG1O 2E47A 3O41A 5C07B 1X9LA 4JY6A 5JO5B 3HTWA 3C60D 1ZS2A 5JQIB 4RISH 3LKSA 1TNNA 4ZZFA 2Z7YA 3GKAA 3SYOA 2VM9A 4GBUA 4LAKA 1LOQA 3QJVB 2PD5A 4UUJB 4BS0A 3GTNA 3LVEA 1PW3A 2XX1A 1SVZA 4XZ9A 5FXCH 4DWSD 5D09A 1INDH 2R9HC 3BH4A 2R0ZL 2EDXA 5HWNA 4R3UA 1R5IA 2C15A 3TLLA 1KCXA 4GG6A 1N7KA 1CL7L 1CU4H 2ZSWB 5GS1B 4DYKA 3QHZH 1XYCA 3UGRA 2GJLA 2JQZA 2AAVA 4FQIH 3BT2L 3RJQB 3FT4B 2GCYA 4ES8A 1B4RA 3AGWA 1IXQA 5IFPA 4FF5A 4Y19D 2O7QA 3AROA 3S5LG 1GYVA 2B20A 4TXEA 3B9EA 1JF5A 4KZCA 3LTYA 3FTSA 5KYXA 2HH0L 1GZQB 3U4BH 3BFOA 3I6GB 1U91A 2QCDA 1P4BH 1XTMA 1GVOA 4WO4B 4TQ8A 2VSKB 3IJ7A 3CWOX 1NF0A 5I2UA 1IKFH 1P6AB 1IFHH 2UXFA 4L8DA 4J6IA 3O3AB 2IFFL 2PI6A 1ILUA 3HV8A 3CH1B 2F18A 2EUXA 1AVAA 4AL8H 1P5VB 4NCDA 4ZUTA 1QW7A 2NYYD 3SURA 3D2UB 1QBMH 3MZGB 4OZ4B 4JYDA 1XR9A 5BXRA 1H3PL 2I9TA 5EMJA 1T4WA 4KQ4H 5HY9A 2BNQE 1J87A 4XB7A 1HT6A 5EMMA 1Q65A 2VX6A 2GT9B 1TZOA 1AD0A 2VISB 3Q8BA 3D0LB 4JRWA 2E75C 3RWFB 3DZ1A 4DXVA 3C2RA 1P5UC 3O8AA 5EU3A 2EO7A 5C0CD 3SDXF 5I8EB 1NGYB 2NQDA 4JNYA 3OU8A 3OKMA 3UG3A 3UY8A 1BQHA 1J0HA 5F7YC 2YBRB 1LWIA 4M8QB 5JPMA 3R2GA 3RTQA 2DQHH 4WD0A 1AJ2A 2R1WA 2NTFB 3WLWD 1ZJHA 1FO0L 3PB0A 4WZHA 3DSNA 1X5JA 3X3FH 1G0DA 5DUBB 5GPRA 4FQJL 5E1IA 3B2VH 3UJ2A 4JOMA 4NQEE 4ZE4A 1PKOA 1Q9LA 2NX5B 4GRWB 4K68A 4MA7L 2IH1A 1XF1A 3AY4A 3THUA 4P2QA 2A6DA 1KJMA 3CUJA 1MHHB 5DO8A 3EWZA 5HVFB 1QHPA 1XPYA 3RG1C 3RGHA 4K5PA 4ZX4A 4GY4A 2YL5A 4Z1CA 3LNEA 5C0IA 2CBJA 3FT2B 1YYML 1OGTB 3WEXA 4EI5C 4AM0Q 1JYNA 3QQDA 2F53B 3RKPA 2X2IA 1VADB 1ZT7B 4A2SA 2O7SA 4E2DA 1CECA 1LRQA 3SCSA 3V5OA 2QFPA 1VQTA 2I7GA 1WS7A 4NI3A 2CHNA 4BZYA 1S7VB 1RD5A 2JK5A 1BKSA 4Q6XA 3VUSA 4PMYA 3TV8A 1JCMP 5DHYB 4RFNC 4LOUC 4ZPTA 2AJSH 1XHGA 5E8DL 3C8DA 1FC1A 4ONGL 3PUOA 3WLBA 4WX2A 2P46B 2APXA 5KW9H 4QG9A 3PUCA 3EBGA 2I5GA 3SPJA 1G6CA 4IIQC 2H26A 3QUML 2VN3A 1BZEA 3HS0B 1AP2A 3GIYA 2RR3A 4JB9H 2PGFA 1UD6A 3NFNA 4X8XA 1YYAA 3O81A 2FBRA 2HJLA 1OAUL 1TUFA 2DIJA 3U6RB 1NAML 1J8VA 2Q6WA 4OF7A 4E41D 2P5WB 2YC1B 1KSRA 1A7NL 2OJ1A 1E6OH 2RFXB 4M1GH 5BPPA 4LDLB 5D7IB 1LE5A 5D37A 1LEGB 4NRYA 5DEZA 4Z78A 1AZUA 5I1AB 4JGNA 4XX5A 2XN0A 4JAMB 5FYKD 3A4EA 3HBQA 2VFDA 1YNQA 3ONCA 4H5SA 3QV7A 3U0WL 3GXNA 2D4FA 2DQIH 1IVLA 4LEXL 2XZ7A 3IRPX 4JW3A 1AHWC 4LU5L 1YY9C 3F4CA 4XP9H 4MY9A 4DQOH 3NAVA 3SCMA 4RUBA 4N8UA 2Y61A 3EG9A 1A6AA 3WQOA 3QZOA 2DQDH 3BFWA 2WLIA 3WMBA 4O28A 3F7RA 4HZLB 3QJOA 2Z8RA 1W0VB 4KOBA 2O4MA 5HYJD 5EU6B 4MA8H 4QDGA 3DXIA 2DBLH 1E51A 1H1YA 4MWFB 1RURH 2Y7EA 3TFBA 2PDJA 4AYID 1F45A 4OU1A 4HWBH 3LHVA 3FQRA 1D5RA 2WNXA 4NJJA 4DYJA 4AGNA 4PRWA 5FX3A 5FYJL 1AXSA 5FA5A 3DHFA 1UM5L 1P6FA 5BWAA 1ZWIB 2WB7A 4HH8A 2XFXA 1UR3M 4MWAB 1TIMA 3TA4D 4KBXA 4PJ9D 3EMCA 3UBXI 2OCFD 2IMRA 2QAFA 3TBCA 1HFBA 3IU4L 3K13A 2YR3A 3RM9A 5E1QA 4DP6X 3BUIA 3UWZA 1IT7A 2FPTA 1FLTX 3ZU8A 3U0HA 4BK9A 3Q48A 4IFRA 1D3HA 3ESVF 2FKPA 5IB5A 4AGQA 1X5XA 3W5NA 4AEIH 4PLJC 3RGTA 3IN0A 2H0PA 5LN8A 2N01B 2H2PD 1KMGA 2R69L 3VMPA 3WK1A 1EFXB 4YTUA 1NCBH 3HR5B 4MNGE 5GJMA 4NLHA 4LNCA 5T26A 2HMID 2FX7L 4YXGA 4TX6A 2VCCA 4B5EA 5F7HA 1YECL 5ISZE 4AFYA 4KNTA 5I26A 4ES9A 4BH8B 3KWUA 2DOCA 3QAZB 3QUZD 1TYEB 1YPZA 4LVOC 2J88H 1NBCA 4FABH 1VBRA 4ODVL 3FUIA 1T7LA 4N9EA 1W5MA 4JE4B 4I89A 2IOMA 3DWTA 4H8UA 1TQSA 2GK2A 5FYLH 2MMXA 4XNYL 2OYPA 4MXQD 5G4EA 1TZGH 4JDVA 2O5XH 3GT6A 1DQVA 4MKSA 3UX9B 4J23A 3AICA 2FJHB 3KPRA 4UTFA 3NO5A 1M3UA 4ZFOB 2XDHA 4IJBA 1EA0A 5CEXA 4BWUA 3UT0A 3X1FA 1XLGA 4YL9A 4X6DF 2YW3A 3WCYA 3NQCA 1FWBC 1TPDA 5DQPA 4KNUA 1NTHA 3GMLB 1JV2B 4CSZA 2Q1EA 3AHYA 1XRSA 4GG6E 3FCTA 1DDHB 1UKQA 1BZOA 4M6VA 4K9EH 3EFOB 1T66D 1T6WA 4H01A 5PCYA 1AACA 4ACZA 4Y4KC 4JRYA 1B54A 9CGTA 5JHDE 4GGHA 1K8ZA 2NY6C 5D7LB 3INOA 5E6IC 3WBDA 4TYUA 3ARFA 3EXJA 1E5NA 4HS3A 3KLSA 2A6IB 2VDNL 2P3EA 5KYNA 1ZAJA 3RRXA 4PJIE 2X4SA 3HC0B 7FABH 3WDQA 3BZEA 4ETQB 4QDMA 4J5VA 1TETL 3FTZA 4JPIB 5K9JL 3ZMNA 4KOCA 1Z9SB 1IAIL 1M7DA 4ZW5A 1X7SA 4PGEB 1TPXC 4X7TB 1FYTA 1U0QA 3ID7A 1JNDA 2I14A 3FYYA 4RXFA 1P7BA 1A14H 4ZUVB 1Z8AA 3GUWA 4CVZA 1XH2A 2DKUA 5DUJA 4L9LC 5KSBA 3KGTA 4C4UA 1PCKA 3B3IB 5D2NA 3VG0H 4JTUA 3P0VH 4PTUA 4HJUA 1H3UA 3TN0D 2ZG1A 4Q8OA 3SI9A 4FOMA 4JEJA 4U0RC 1CF1A 3EA2A 5DJ8B 4ODUA 3D85B 3WTVA 1SXAA 3MOBH 3HOGA 2A83B 4PP1C 4K8RC 3NJFA 1FWXA 4ICWA 2PN5A 5DLLA 1CGUA 3E1ZA 2MEJB 1DZBA 4JHBA 4RMTA 1I1WA 1JQVA 5T33L 1WCBB 4XB3A 1GVYA 1TKWB 3O16A 1SJHB 5I15H 3BWAA 1TWDA 1UCTA 3KVPA 4JZ5A 2VVNA 1FZKB 1PEZA 1T20B 3OLIA 1CXKA 5KBKA 3ZKXC 4JO8A 3EW3B 3IJ9A 3S0PA 2CHZA 5D2TA 5DRIA 1VEMA 2FVMA 3STZB 1O60A 3TA6A 2G0KA 1KGYE 3Q94A 3MGAA 1DCLA 2E6JA 3KM8A 3SDDD 2OW7A 1P7QD 1AFSA 3ZE2E 5E1AA 2Z8VC 2XIMA 2R4RH 2Z93A 4U4IA 4CKVX 5J9PB 1N8FA 1FCGA 1RCXB 1IM9A 3VXRA 3SRFA 4P2QE 3VZXA 2Y5SA 2R9HD 1F5ZA 3NA9L 5AN7A 2EVFA 3GYRA 3BDBA 4QE1A 1T96A 2C79A 1G94A 4BKNA 2OX5B 3OBEA 1J0IA 1HSBA 3TYFA 5IQ7L 3SYAA 4EAMA 2BRQA 4NKIL 1IEXA 3JWOL 4KV5E 2DTMH 2F8OA 3LS4H 4Z08A 3I10A 4NN7C 3V0DA 4IPJA 5FWQA 4Z0SA 4F2EA 3QIBA 1XF3B 2VDKB 4Q3MA 1KY6A 4QXTB 2CLPA 4FCAA 1GKEA 4G5ZH 3GTIA 1OE1A 1EPXA 3L5HA 2ZXEB 1NL0H 2N0MA 1BV8A 1OCZB 5CEYB 4PJ8B 2WBGA 4EPEC 1WPCA 2X9XA 1UKTA 5SWSD 2EXWC 4PWHA 3NQFA 1UH4A 1QSFD 4IOFC 2HKAA 3D3VD 2TMDA 2V2WB 4D9LL 1OGBA 5CJQH 5D2LB 2MUCA 1R2RA 3WLJA 5BWFA 4HHAA 1ERNA 3T8VA 4LT9A 4A05A 5HHOA 5M1TA 4PLKC 4KHXH 3PU7A 5T9BG 4L3EB 4GMTL 4B7LA 3VOJA 3QNZA 1BA9A 1T6BX 4KK9C 5D6DA 4JHAL 1UP3A 4TLUA 4F58H 1U83A 3D12B 3PWPB 2WMKA 5IUCA 4M7LH 2YQ2A 5SWZD 5GQBA 3L3JA 4XN1A 2D1ZA 1E6PA 2QSVA 1DYZA 5GRWA 3I3BA 4NP9A 1SJBA 5FIPA 3OR7A 4BZ2A 3GSNL 1H49A 2PZNA 4JFFA 5HBFA 2LHAA 2XPGA 4MRCA 1SEQL 3KXFA 1P7TB 3ZGIA 4KKNA 4RAUB 5FEPA 3BEWB 3BP6B 3U2ZA 4FTVA 3MNZB 1AGCA 3N14A