4M8UA

The structure of mall mutant enzyme v200a from bacillus subtilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
559
structure length
559
Chain Sequence
SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDAIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPERADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 230
structure length 559
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m8uA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m8uA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m8uA02
5I6SA 3LX9A 1GQKA 1TR1A 2WB5A 4UFKA 2D0HA 1JGIA 3H53A 1YQ2A 2O9PA 1W91A 4L4OA 1WCGA 3A23A 1V3IA 3GXTA 1W1VA 1PPIA 3II1A 4OOUA 2CBJA 4GPNA 1KCLA 5I79A 3LPOA 2DSZA 5EBAA 2ZIDA 1KTBA 2E3ZA 1B3VA 4DO4A 1TQUA 1A47A 4CKQA 1W1TA 3EMQA 2OYLA 2HVMA 1MYRA 5A8MA 3VSVA 2VX6A 1JDCA 1H11A 2WANA 3LRMA 1G1YA 3KL0A 1EIBA 3I3BA 2NT0A 4AEFA 4OGZA 1FOBA 1GJUA 3VMPA 4DM2A 1PZ3A 2D22A 3WDPP 4D1IA 4MNKA 3ARWA 3ZJ6A 2ALWA 3N15A 4WIWA 1KGWA 3GNPA 1KTCA 3RJXA 1QI2A 2J47A 1NWRA 2A3HA 3BMVA 3GXIA 4RE2A 3WY3A 3OGSA 3AIQA 3WBEA 2J8FA 2X1IA 4KRTA 3WH6A 2WWDA 3DHUA 5CSUA 1JD7A 3O2LA 3GDBA 1KXQA 5A8NA 4QLKA 3A6OA 2G3IA 4JL2A 1CEOA 2XYLA 3FAXA 3VD7A 2AAAA 1Q4NX 4CN4A 5IDIA 1W9PA 1XGZA 5ABFA 4GINA 2WW5A 3QGVA 5LA0A 2UY3A 5JBDA 2ZUTA 2JF7A 4PUEA 4B9ZA 1V08A 4FMVA 5CGMA 3AI0A 3WH5A 3AZSA 4QP0A 4ATWA 1OD0A 3CZGA 3UR8A 2QMJA 1JF6A 3K8LA 4WKFA 3CLWA 4CU7A 3GXPA 2CKRA 2GK1A 3CV5A 3VMNA 4HZ8A 1L8NA 4AD4A 3DX2A 4R5EA 1BYCA 2NT1A 2WVVB 1UR8A 2WKGA 4QAWA 3SCNA 1FFQA 3E1F1 4RL3A 3EDKA 2WMKA 2WZHA 1OBAA 4NSBA 2XN0A 1JFXA 3HU7A 5A8OA 4KRUA 2OW6A 3MUY1 1B3YA 2WLYA 2WK2A 3AHTA 4BQ5A 3GH4A 2F2HA 4TVUA 5I24A 2DEPA 2ZXQA 3LXCA 2UY5A 3A4XA 3WH9A 4PCTA 3U5UA 3WF2A 2VUYA 4DWSB 4J3SA 3QOMA 2ZX8A 4W8LA 1IZKA 4Q7NA 4QCEA 4P8WA 2EPLX 3G6MA 2BY3A 1PJ9A 3WF1A 4OZOA 4CN6A 2DSVA 3NYDA 3SCVA 4HU8A 5EFFA 2J7EA 5ABEA 4M81A 2A3AA 2WAGA 1GHSA 3F4VA 2D23A 3PBGA 3DDFA 2BVYA 2ZUMA 3T2PA 4S3KA 2TAAA 1UWIA 1W9UA 2DDXA 2DSWA 1WAWA 2OYMA 4ACZA 4PMQA 2WMGA 4X0VA 5FD0A 4KGJA 2VRQA 1E3XA 4H2CA 4P7LA 1HJQA 3CMJA 4FK9A 1LQ0A 2J25A 2FHBA 2V3FA 3ALGA 2B31A 4D6EA 4MAVA 2A3BA 2IXUA 4AD2A 3AS2A 2XSAA 4NZJA 1EOMA 2WHLA 2DT2A 2XN2A 1DWGM 4ZFMA 4UQAA 4HTYA 2WVVA 3EJQA 1WDSA 5GNYA 1CIUA 5D8ZA 1KXTA 2D24A 2QLYA 2F8QA 1GNXA 3MMDA 1UD2A 4A3HA 8A3HA 1VEMA 4UFHA 3OGVA 4P7OA 1VFUA 4MNLA 2G41A 2WBGA 4UNIA 1QBAA 5LA1A 2CIPA 1KCKA 1CWYA 1E0VA 1GONA 1UWUA 5M17A 1G0CA 4P8XA 4ZXOA 5CLWA 1PX8A 3ZJ8A 4J7RA 3MANA 4C7FA 1UKTA 3WFZA 1XYFA 1CGWA 4D72A 3ZR5A 1EO7A 3LPPA 4PSPA 1MFVA 4MB3A 1E6XM 3QOKA 3W27A 4BQ4A 1FFRA 1OT1A 1H0IA 1MQRA 2PC8A 5F7UA 1VFFA 5HDRA 3MUAA 2GDVA 3WIJA 3W6MA 3NCOA 1E6QM 3LXBA 4J3XA 2GJXB 3DX4A 1CXEA 4ML4A 1TA3B 2WCAA 3ARQA 4UFMA 4UFIA 2HISA 4W93A 4MJ4A 2OWCA 4OJYA 3VIHA 2OW7A 1CNVA 3BUBA 3WF4A 2Y4SA 2VI0A 1NWUA 2W63A 1FH8A 1DHKA 1HT6A 4W8AA 5DEZA 2J78A 3NSNA 1V3KA 3F5LA 3MUZ1 3QHOA 1C93A 1OD8A 5CZKA 1BYDA 3TP4A 3DX1A 1HP5A 4M24A 2WHMA 1B31A 3WFLA 1TQVA 2YA0A 2JIEA 4B9YA 1BHGA 1B3XA 2CBVA 4UFLA 3CZNA 4P8VA 5BXTA 2F7PA 2Y2WA 4QFUA 1E6SM 3UETA 4AW7A 4D1JA 1W2VA 3BAKA 1JXJA 3SUVA 1MVYA 1R87A 1ITCA 1XH1A 4NZFA 2EPOA 1US3A 1WDPA 4RE4A 4IPNB 3CMGA 2VMFA 3WMSA 3GYCA 1HVXA 1UUQA 3S5YA 1R46A 3A22A 3N12A 1YHTA 4UQEA 3PTQA 4QCFA 1JYWA 2WBKA 4W88A 1J0JA 1MXDA 4H8VA 2YBTA 2FH8A 3S5ZA 4OBSA 1XH2A 3OLIA 2VCAA 1GVIA 3L4WA 1DTUA 1KWKA 1DWFM 1MQQA 2CKSA 3WL1A 4QDMA 1W32A 3MSGA 3BCFA 4GI8A 4LPCA 3LRKA 4OOZA 5FIPA 4H7VA 1JL8A 1UH4A 1TVNA 3D4YA 4HA1A 4UZSA 3ZO9A 2X09A 2VOTA 2FDMA 1H4PA 4F8XA 2UWFA 4CVWA 2XIIA 3SCUA 5A69A 1UWTA 3VM5A 4YPJA 2D0GA 2YL6A 1MQPA 1QNOA 3BLBA 4AC1X 4DWSC 4P7QA 1G94A 4CD4A 1FHLA 3WUGA 3F5JA 4TTUA 2XPKA 1BYAA 1QNSA 1M7XA 2X2YA 3RMEA 2VZVA 1BGAA 4JCLA 1TG7A 1EQCA 3BVXA 4GKLA 3FHAA 1AQMA 3ECQA 4M8UA 1TQTA 1HJVA 1PEZA 3CHEA 4EE9A 1EQPA 4TUFA 4LQ1A 3ZJKA 3CUIA 4WKAA 5IFPA 1US2A 1V0LA 3EYPA 4AIEA 3TA9A 3FN9A 3ARPA 1ZU8A 2GSJA 2WMIA 3AHVA 3BVVA 3SUUA 2JE8A 2VX7A 3SCOA 4LYQA 4FLRA 4OIFA 3WNKA 1OT2A 4OKDA 1CGUA 3N13A 2DSUA 3EDDA 2G3JA 2X8RA 3T0AA 1ISXA 1CTNA 1BVZA 4ZE4A 3BVWA 1H0GA 1NM9A 1IT0A 3D51A 2VQUA 2F7QA 4AZIA 4J3VA 4K68A 2EPKX 2XFRA 4U2ZA 2E40A 1ZB5A 1PAMA 3RM9A 3W38A 2OLHA 3GXNA 3GBDA 2V3EA 2RGMA 2E9MA 1Q6CA 2D1ZA 4MTVA 1QHZA 1XD0A 1C7TA 2JEPA 1V6VA 1H3GA 4IM4A 3HG5A 1GQIA 4AZCB 1HKKA 1XD1A 1OIMA 5IHSA 3U7VA 3IJ9A 5A8PA 1KQZA 1XV8A 1UG6A 3PHAA 1GOKA 3W53A 2WC7A 3U5YA 1JDAA 4TXEA 1PBGA 5FKYA 3MS8A 5CPTA 3N9KA 3APGA 2ZX5A 3IGUA 4TOQA 1JYNA 4WF7A 1E56A 1VAHA 2FH6A 2EADA 5FOOA 1JI2A 2CNCA 3AIWA 2BHUA 4U31A 2BS9A 2BXZA 3WNPA 3PZNA 4JZ5A 2E8ZA 2CXGA 5BRQA 1CENA 2Q8XA 2VZTA 2Z1SA 3BMWA 1HXJA 3L4ZA 2BY0A 3CPUA 2PWEA 1V3HA 4PCSA 4WLCA 4URIA 1UKOA 1AVAA 4V27A 3WQWA 4AEEA 3AISA 1GOWA 2J8GA 3L4YA 4AISA 2YKKA 3A5VA 1V02A 3CUFA 1UWRA 3K8MA 2ZUNA 5HBFA 3VGEA 1R34A 1OGBA 4Z2KA 4CD7A 5M3WA 1W9BM 1KB3A 3UG5A 4L4PA 2ZE0A 1C7SA 1DWJM 1R75A 4YN5A 1J0HA 3HG4A 3GH5A 3W26A 2EBNA 3VDCA 4FNTA 1PS3A 1K6AA 1GOIA 1OCQA 1XCWA 1JZ5A 2EABA 3A4WA 3PZUA 3DHPA 2GJPA 3PN8A 1QW8A 1AMYA 1UKPA 4DUWA 3GM8A 2X2JA 2BY2A 3IJ7A 1V02E 2XHYA 1UH3A 3VIOA 4FNQA 1V0NA 2AOSA 3AROA 5GNZA 1SYTA 5A6BD 5DMYA 5HPCA 3VIJA 3WQVA 1ITXA 3T2OA 4FLSA 1T0OA 5A6SA 1C8QA 3WUEA 4AZCA 3UEQA 1I1WA 3PTKA 1LWHA 3KZSA 2WSKA 3CUHA 1OGSA 1S46A 1E5NA 3WQ6A 1GJWA 3W25A 3T0BA 3VO0A 4LYRA 3KL5A 2WCGA 1C92A 4D6JA 3DX3A 4FNSA 1QI0A 3WKZA 1FH9A 3O6AA 3BLPX 3CTTA 3VPLA 3RCNA 2CETA 1DEDA 1B1YA 4XX6A 5DT7A 3SUSA 1SMDA 3A21A 1UA3A 2CBUA 3VD9A 4JL1A 4XUYA 1E4NA 4PEEA 3W28A 4QLLA 1UR4A 4M82A 1RD6A 1J0KA 3VM7A 4KH2A 1FH7A 4ZE5A 4FLQA 1JD9A 3W81A 1XSKA 5I77A 1I75A 1EO5A 2XGBA 1JAKA 3GNRA 3I3DA 5CPQA 3EJUA 4JCMA 1HIZA 4P7NA 3WSUA 3W6LA 2VJXA 3AFBA 4W5UA 1NH6A 4BQ2A 4UQDA 4EANA 3AOFA 3AJ7A 7CGTA 1UR1A 1UYQA 1QW9A 1E43A 4DUXA 1E0WA 4MB1A 2CPUA 4EAMA 1R47A 3T09A 2J62A 1V6WA 3NJ3A 5ABGA 4AZ6A 1QNPA 3VGBA 4MPKA 2X0YA 1LJYA 3A24A 1JIBA 1HKMA 2VURA 3WELA 3U7BA 4W89A 4XZBA 3EJSA 2PB1A 3TTQA 4MAZA 1H5VA 4PMXA 1CXIA 3OIHA 3ZIZA 1UD3A 1JFHA 1V0KA 3AIEA 4FF5A 2BHYA 1UR9A 3MUIA 3RM4A 3WN6A 2Y5EA 5IXEA 3QHNA 2VT0A 4UTFA 1HL8A 5JIPA 1OSEA 1W3HA 1VEOA 3GXMA 3AMDA 4YHGA 4PTVA 5LYRA 1IV8A 1JDDA 2XVNA 3AIVA 4J3WA 1XSIA 2DGAA 4CCEA 1J18A 1VFOA 4U2YA 3ZM8A 3UG4A 3WMBA 5A6MA 2PF0A 3BGAA 3WY2A 2XFFA 4JFWA 3HZ3A 1UQZA 2XWEA 2OWXA 3MI6A 1BVNP 4AYSA 3OBAA 4V28A 4AZHA 4Z2GA 1J01A 3VKKA 3TV8A 3D5HA 4AZ7A 1QHOA 1BLIA 1E4IA 2BY1A 1K9EA 1IZJA 1E15A 1H2JA 1BQCA 3CZSA 1D3CA 3WY4A 2XM1A 4AYGA 3VIFA 4MDPA 5AYBA 1DP0A 2GFTA 5HNNA 3GBEA 1H49A 4Y7EA 4AZ5A 1QPKA 4FNRA 2OSXA 4ACYA 2VVNA 2EACA 1NP2A 2DT1A 2XIBA 2VRJA 5E6ZA 1EGZA 1BG4A 2WMHA 2J7FA 7TAAA 4U3CA 2YIHA 2F61A 1E70M 3WH8A 2F7RA 5E6YA 3WDRA 3D3AA 3VDHA 2CYGA 2BHZA 5DF0A 1U30A 1RH9A 3AQUA 5C70A 4XB3A 3MU7A 1MXGA 1HKIA 5GQBA 2FGZA 2F1AA 3CZ8A 2DSKA 1QI3A 4PMUA 3BCDA 1C91A 1VFMA 5E0CA 5AY7A 4PMNA 3TTOA 3WDQA 1TCMA 4BQ3A 3AMCA 3NSMA 4HOZA 4UOJA 3VGDA 2VQTA 2WC3A 5DT5A 3RPMA 1BF2A 3B9EA 1K9TA 2CERA 4MB4A 4NRSA 2YJQA 3MMWA 4AD5A 4LGXA 4AD1A 3EJTA 1ZBKA 1H09A 2A3EA 3HG2A 2JEQA 1WP6A 1C3FA 4E4PA 2FYVA 5CLTA 2WVSA 3CZKA 1TE1A 3L4VA 3M6DA 1GQLA 4CUCA 3AMKA 4DWSA 2XN1A 1A3HA 3EBVA 3BXWA 2WMJA 1JZ8A 5LA2A 3SUWA 3THDA 2EJ1A 4CN1A 3EMZA 1BG9A 3WEOA 1CGXA 5E1QA 5I78A 3WD3A 2MANA 3BVTA 5CG0A 3K4DA 1JZ4A 3N1AA 1CDGA 5GPRA 2W92A 1TFVA 1L0PA 1HTYA 3VIMA 4Z2LA 2WMFA 2ZX6A 3I3EA 1W1YA 1UR0A 3U57A 2C0HA 2X05A 4TVCA 2ZWZA 5FL0A 4J3UA 5CXPA 2Y24A 3AMLA 1Q6EA 1JAEA 4F79A 2BV9A 1VF8A 3IAPA 3O9NA 3WDHA 1JZ6A 1VIWA 4HA3A 5D9MA 3WENA 2XM2A 2ZOXA 2UY4A 1KBKA 5A2AA 4W84A 3ZT5A 1Z32X 2WWCA 2AMGA 3WNOA 2J7CA 4UQBA 3VMOA 2DIEA 1J11A 4TVDA 5A6KA 2XFYA 4X0NA 5CQ1A 5JBEA 2OWWA 5M5DA 3LRLA 1O6IA 4B16A 4KWUA 1JZ3A 1M53A 2WC4A 1CECA 5BCAA 4DUVA 3RJYA 2JFEX 2W67A 4WSJA 3WDJA 4V2XA 1FP8A 1F4AA 2W66A 4FLOA 4AMWA 2WVUA 2YDQA 2G3NA 3WD0A 4CU6A 1CGTA 4UOQA 1PIGA 1R7OA 2J4GA 4J3TA 2F1BA 3AMGA 5E09A 3WEMA 1F4HA 3AIUA 2FHCA 4PMOA 2ZICA 4AWEA 5JBFA 1HJSA 3PZMA 3DC0A 3GH7A 1WZAA 1B0IA 5EFDA 4HPHA 1HJWA 1LWJA 4M56A 4NRRA 1I1XA 2GJXA 2G3MA 1E6PA 1TA3A 4JFVA 4AIUA 2NSXA 3D52A 4DM1A 2F18A 2PWDA 4AD0A 1W9DM 5M03A 3QR3A 1ZBVA 4R27A 4AD3A 5AC5A 2C7FA 1KGXA 3WDIA 2YDSA 4UCFA 4OBRA 2C8NA 2J74A 4HZ7A 3WEZA 3CGTA 2WZIA 3BAIA 4H8HA 4D71A 4D6DA 1E40A 3IJ8A 3KEHA 2ZUWA 4PRWA 2VNCA 4HMCA 3L2LA 4D6IA 2PWFA 1QI5A 1V03A 3N18A 3WQ4A 3BAYA 2YBUA 3AHZA 3ZSSA 4GO9A 1UHVA 3ZR6A 1QX1A 1ZS2A 3L4XA 5ECUA 4CCDA 1ZBCA 1CGYA 1PX4A 1W3LA 4JHZA 3W24A 1E55A 1PX3A 3BLKA 1WKYA 2PI6A 4D6CA 4M1RA 3VNYA 4MJ2A 3BAWA 4WSKA 3KLKA 1GHRA 2W61A 1ODZA 3FW6A 4MNJA 1TVPA 4A4AA 1B3ZA 2VZUA 1UKSA 1EDTA 7A3HA 2VZSA 2V5DA 2OYKA 3SCWA 3TOPA 2BXYA 9CGTA 4GO8A 1DWAM 4CD5A 4GZEA 5CJ5A 4J27A 1FP9A 1FA2A 1KGUA 3CZJA 1ZBWA 3N11A 5C71A 4W7VA 2WPGA 3AS1A 1WE5A 3NDYA 1C8YA 2VR4A 3EDFA 3VTRA 3VDAA 1MW3A 4B3LA 3AS3A 1AQ0A 4GI9A 4DO6A 1EHNA 2VVSA 3RIKA 3VDBA 1CXKA 2E8YA 1KWGA 1OWQA 3AHXA 4NZCA 2XVKA 5I3DA 2ZX9A 4PN2A 1QWUA 3K46A 3WBAA 4M80A 1ISYA 1O7AA 1QVBA 2E9LA 2O92A 2BFGA 2ZXBA 3HN3A 2CHNA 3BSGA 4LXFA 3ZJ7A 4JFUA 3AS0A 3KWXA 1GOQA 5HXMA 2VCBA 3IAQA 4X9YA 2EPNA 2WM0A 5A2CA 2UY2A 3VSUA 1FHDA 1ECEA 1OINA 2EO7A 2D20A 4AXNA 1ISZA 1LG1A 1HX0A 1KFWA 3N17A 4AZGA 1X6NA 3AYSA 6A3HA 2QMKA 5CSYA 1R33A 3EJPA 2YL5A 1TQSA 4HOXA 2Y8VA 5AYIA 1E5JA 4Z2IA 1GOMA 2GDUA 2J7DA 3T2QA 5A6LA 2JALA 2ZUSA 1ZJBA 2RGLA 4JKLA 5JIWA 2FGLA 1WO2A 4NF7A 1CLVA 3OLEA 4JFSA 2J7BA 3WUFA 5BXSA 4NXSA 4W5ZA 4MADA 3POHA 1VJSA 1WPCA 1EDGA 1TMQA 5GNXA 1J9YA 3CHFA 4BS0A 4AZBA 3ZSTA 1U2YA 2W5FA 3PZOA 4W7UA 2PBGA 2CHOA 2G8ZA 6CGTA 2V5CA 1PZ2A 2J79A 1NWTA 1E1FA 2XVPA 2VX4A 2WHJA 3THCA 1CXFA 1EXPA 3PZQA 3ARYA 2XJ7A 1SFSA 2YA2A 1W9XA 3F5KA 2YLAA 5D8WA 1JNDA 3UCQA 2CITA 2GK1B 2IXVA 3GZAA 1XYZA 3WUBA 4Z2HA 3HJEA 1P6WA 2QV4A 2BNJA 1DWIM 1HJUA 1B9ZA 2ZUVA 3OA5A 3L4UA 3WF0A 3CUGA 3ZMRA 5A95A 4UQ9A 3MO4A 1UZ4A 3PTMA 3CBWA 5CGTA 2EXOA 4DWSD 4CD8A 2ZXAA 2ZUUA 3WMCA 3K4AA 2D73A 1ESWA 3W82A 1M03A 2QPUA 4QLJA 1E72M 5C8BB 4RE3A 1M01A 3G6LA 2XSBA 2PBOA 3NSXA 3GNOA 4U5KA 4OUEA 3PZTA 4JIEA 4PMRA 5BROA 4D6FA 1E6ZA 4PMYA 2W91A 4BZYA 5BXRA 1RPKA 1UR2A 1HJXA 4W87A 5BWFA 3FY1A 2D3LA 3VU2A 1WZKA 4AMXA 5TD4A 1NOWA 3ZT6A 1EOKA 3VOCA 2ESCA 1GOOA 2DIJA 1XC6A 4PYSA 3RO8A 3WQ5A 1EA9C 3SCSA 1UWQA 2NW0A 2YL8A 3AZRA 3CIVA 1JZ2A 3VUPA 1NQ6A 1QI4A 2V3GA 2XGIA 3VVGA 3VGGA 3AICA 1UD6A 3VD4A 5I0DA 4ACZB 1M04A 3DX0A 3KL3A 4HZ6A 3AIRA 3CUJA 4MDOA 2J75A 2BVDA 2DQXA 1LL6A 1VB9A 1G5AA 3NUKA 3IANA 2W62A 2FE0A 3AXXA 2VRKA 3UERA 2A3CA 4JAWA 4F9DA 1W3JA 3UR7A 4BF7A 1ZJAA 3VX1A 2X0HA 4XZWA 4E2OA 4W7WA 4C7DA 5E70A 1W3KA 3BVUA 1UOKA 5D9OA 4PMVA 3AIBA 5IFTA 4ZEPA 2CEQA 2O9RA 3BUPA 3T0DA 4TTGA 4EK7A 3LPFA 2YFOA 3BUDA 2X2HA 4PSRA 4A3YA 1UKQA 5KZ6A 3W29A 5A6AA 3FAWA 1HWWA 1MFUA 3ARSA 1TQWA 3OZPA 2O9OA 2W4XA 3BH4A 4DO5A 2JIWA 3POCA 4AIOA 5HOSA 2X2IA 4FNUA 3EDJA 3GTNA 5A6JA 5BRPA 4Q22A 1OIFA 4NX0A 4H04A 2EAEA 2V38A 3NIYA 4U3AA 2WKLA 3SEPA 4PMZA 3UG3A 4F9JA 3DDGA 2E0PA 1BYBA 4GZIA 4BA0A 1GVYA 3VIKA 4H8UA 2JF6A 1KBBA 3H54A 1CBGA 3BUIA 3L4TA 5EMYA 2ZXDA 1GPFA 4H41A 4BCEA 4AY1A 4LX4A 5E0FA 3EMCA 1ISWA 1HKJA 3VILA 4HU0A 4PTWA 3A3HA 4YHEA 4E8CA 3VSTA 2BVTA 3VD3A 1CZ1A 1O7DC 3BAJA 3A4AA 2XWDA 3MSDA 3LXAA 4HMDA 2D2OA 5DO8A 5JUVA 4U33A 1ZL1A 1HXKA 1OM0A 4PUDA 1OGGA 3PZ9A 3S6TA 6TAAA 5FL1A 3AXIA 5IHRA 4FNPA 4CU8A 4HPGA 1MW1A 1NARA 1E6NA 4S3JA 1OB0A 4WJXA 3CO4A 2QPSA 2D3NA 1N82A 4GXPA 3SUTA 1NP0A 3HMCA 3HG3A 1MW0A 4PMDA 5A6BA 3WNNA 1K9DA 1QNQA 1V6YA 3ZT7A 5HPOA 4CVUA 1Y7VA 3SCPA 1KXVA 2J7GA 3WY1A 1QBBA 5BXPA 1Q6FA 4E8DA 1CYGA 4TX8A 3KLLA 1DWHM 2WHKA 1TUXA 4KMQA 3ARVA 2CCRA 3OLGA 1WZLA 1XSJA 4NXKA 2XTKA 4GQQA 3S2CA 5D9NA 2O9TA 4U5IA 4P8UA 3ZQ9A 3D50A 1U33A 1HP4A 1Q6DA 4HA4A 2VZOA 2EEXA 1XH0A 3FNDA 2YL9A 1W1PA 1E73M 1KQYA 3LMYA 1GORA 3BC9A 4LYPA 2YDRA 1QWNA 3DYOA 3SCTA 3M07A 3CH9A 1H1NA 5CPSA 2XVLA 1CPUA 1UQYA 2YFNA 2DT3A 3IK2A 4W8BA 1KXHA 1LF1A 4J28A 4JFTA 1KR1A 2VX5A 1G9HA 5DFAA 1VBUA 1SZNA 3LPGA 3ARUA 1ODUA 3CHDA 2DH3A 1V6XA 3RM8A 1NOUA 3EDEA 2QHAA 1VEPA 3OLDA 3VX0A 5A94A 3K1DA 2ZWYA 3VNZA 4JKKA 3RDKA 2FHFA 3BSHA 1R85A 4P7RA 2VC9A 5BYWA 2VL4A 3BUQA 1JG9A 1VENA 2YLLA 2V3DA 2DH2A 3SURA 3PZVA 2J7HA 1WDQA 1D7FA 4UOZA 1JXKA 3J7HA 4F66A 2ZX7A 3PZGA 4KGLA 5FCZA 1BAGA 2WMIB 3AHYA 4MB5A 2OSWA 2OSYA 4HP5A 2PWGA 1AQHA 5A3HA 1UWSA 5I5RA 4MNMA 1XRVA 4D6GA 1CLXA 4UFJA 3ZOAA 3SIMA 5A1AA 1E4LA 4Z2JA 4CGTA 3B9DA 2DPEA 3WD1A 1CGVA 1HL9A 5A8QA 1GZJA 2WSPA 4CCCA 4TX6A 1E0XA 1BPLB 1RP8A 1PIFA 2WLZA 3N04A 1K9FA 4W85A 3KE0A 3K8KA 2PWHA 1VBRA 2XUCA 1HNYA 2YOCA 5AC4A 1CXHA 3VINA 3WD4A 3WNLA 3CHCA 1XHGA 1D2KA 3CZLA 3EJRA 3AZTA 3TTYA 2WYSA 3B8SA 1TZ7A 2E4TA 4GQRA 8CGTA 2GUYA 3WNMA 3CC1A 1C8XA 2Z1KA 2GVYA 1GQJA 1R8LA 3MMUA 4IPLA 3VD5A 1X6LA 3OG2A 3DYPA 3A47A 1KR0A 1EH9A 3ARTA 4C7GA 1ISVA 3AYRA 3W0KA 3W4RA 2CESA 2G4FA 2WNWA 3VGFA 4JHOA 1GUVA 3SCRA 3ARRA 1BFNA 1UA7A 4HMEA 3ARXA 5ABHA 1GCYA 1E1EA 1LLOA 1WB0A 5I23A 2Y8KA 3H55A 3WL0A 3WH7A 1CXLA 4EKJA 3T08A 1B30A 1JF5A 1HVQA 1B3WA 1E4MM 3B9AA 1JZ7A 2D0FA 1LG2A 1GW1A 4ZENA 1VRXA 1J0ZA 1W9VA 3FXYA 4HOWA 2F7OA 3NDZA 2DT0A 4GI6A 4UR9A 1QNRA 1R7AA 2IUZA 3M7SA 2VO5A 4ATDA 1H41A 4XV0A 2CBIA 3GXDA 1RP9A 3L2MA 1UD4A 2WZEA 1EDQA 4AMCA 1BSIA 3M46A 4ZXLA 1JNEA 1J12A 1X1NA 2QF8A 1LL7A 2VTFA 3ARZA 3MV11 3W37A 1R86A 3VIGA 3WD2A 5KEZA 1QHPA 4PBGA 1UD8A 4N0RA 1VJZA 1WNOA 1Q6GA 1V0MA 4D6HA 1JYVA 4PTXA 2EPMX 1HN1A 3TTSA 1XCXA 1EHAA 1UZ1A 1J10A 3DYMA 4WKHA 3BAXA 1V3JA 3VIPA 3VGHA 4M29A 2VCCA 1W2PA 2XVGA 4IUGA 4W86A 2EQDA 1BGGA 1BTCA 4GZJA 4N42A 3OB8A 1V6UA 3SCQA 2VR5A 1B90A 5E9AA 1JYXA 4UZUA 3OGRA 1J0YA 1NWSA 3ALFA 3CZEA 4GIAA 4IISA 1NOFA 1G01A 1LL4A 1E9LA 1V3LA 1JI1A 3VIIA 4B3KA 4CD6A 4JKMA 2GJRA 1SMAA 4NI3A 3UESA 3WQ8A 5I2UA 3WF3A 1C90A 3QHMA 3JUGA 2XG9A 1UASA 3TONA 1J0IA 3OZOA 2WCSA 5EB8A 4B15A 2WVTA 3MKKA 1WDRA 5D9PA 3FHQA 1UD5A 2E9BA 3MV01 5A2BA 2IGTA 3RILA 4WK9A 1E71M 3DECA 1QOXA 2WXDM 4PTMA 1HF6A 3PZIA 1B2YA 3GXFA 3AXHA 5ABFB 2J77A 3D4ZA 1MW2A 1UH2A 4ATLA 1WZMA 1SR0A 2YA1A 1V3MA 4UQCA 1E3ZA 5D4YA 1MWOA 1E6RA
chains in the Genus database with same CATH superfamily
5B7EA 1GQKA 4LMQI 5BOFA 1JGIA 2Z31A 5HDQH 1ZLWH 3CDYA 4UOW1 4CQAA 1A6WH 4LOVA 2ZCZA 3KBNA 3FJ6A 4NQUA 3ZDWA 2XPGA 4JFPA 2YSSA 2G2PA 3I3BA 3KGSA 3CZFB 2H47C 5CGBA 1CJYA 4XNZB 1Q2RA 4Z7QF 1I0BA 3HUJE 1LM1A 1KGWA 3DHDA 2AABH 3DKHA 2A7NA 2AW2A 3BMVA 3U9PH 4FL4B 4JAMB 5XINA 4YGAB 4MSWB 5CSUA 2EPHA 5FECA 5TE7L 3O2LA 4JQIL 1IHIA 4AVNA 4PRPA 3VD7A 2V30A 1CFQA 4KPHL 3MO7A 3B4UA 1C5DB 5JMOC 4GKZA 5ADPH 2JF7A 3HNSL 1R3SA 3DFSA 1CLZH 1YXYA 5GRJH 3H7VA 4E2DA 3U30B 3VMNA 4F2BA 3SPVB 2UWEB 1LBLA 4Y8FA 4PJCE 1KTNA 1ML0A 2OTDA 3NQ8A 1SY6A 4XWUA 1JFXA 4PWKA 1WRFA 3FOLB 3PL6B 5EPMA 1NEYA 4KCUA 5AL0A 5HJ3A 4PTUA 1MH5B 5BW7C 5CEXB 1MJJA 2Y5SA 5J8LA 4E5XG 3VAVA 1GG0A 3ME0B 1Y6KR 5L4JA 3WF2A 2VUYA 3PR2A 3TJIA 4J3SA 4M1CC 4QTHB 3WLHA 1OK6A 5I9QC 3MLVH 3LCXA 1JDFA 4O2FA 1OAYL 1UZ8A 4KKCC 5DRWB 1YVLA 2H0FA 1D8WA 2ZUMA 5FF6B 3TMLA 3EOLA 3LJ3A 1JERA 5I03A 2VXTH 3LCYA 4PMQA 2V81A 1NY1A 3ANYA 1KG0B 2X7VA 3D39A 3S5SA 1YDOA 4CAGA 2ADGB 4LPVA 4N6FA 2P5WD 1S7RA 3LM7A 4IKKA 4BEIA 2WHLA 5C0GB 1A4MA 4JQ3A 3ROLA 1WDSA 3ARFA 4XCCH 1NFDE 1UD2A 5DRXA 2G41A 2HVOA 2NX5A 1WAPA 3SY8A 4BSWB 5D1XA 3IF1B 2C7UA 4DBEA 1PX8A 3ZJ8A 5IHLB 1J4EA 1CT8B 3IIXA 1T0NB 2IVFC 1JCVA 4HISA 2DY3A 4PSPA 1MFVA 3QOKA 2HKHL 4R7XA 3MTRA 5F7UA 2YGYA 1E50A 4YDLB 5BOZG 1QLEL 2BX5A 4DWDA 3WLWD 3FFOA 2WCAA 1NMBL 4K8RH 4XNZC 4RAUB 2R69L 1AW1A 3PWJA 1LLWA 1CL7L 5IHZB 5EOQL 3J8F7 4H8WH 4IHCA 3B2XA 1IGCH 4QHLB 1IAMA 3MRPA 1F05A 3C9NB 1FI8C 4AHQA 4NBYB 4RRPM 1NCGA 1ADDA 4DLMA 4AQAA 4NZFA 4HYTB 3MLZH 3FCGA 1DJWA 3SJ3A 4X2RA 3KPNA 3RKDD 1NBVH 3O2VL 1P2CA 2RAGA 2IWGA 3N85H 4EKXA 2HT4D 4BJHA 2C9SA 1XH2A 3VZYA 3W76A 3FVDA 3SN1A 3WL1A 4XK2A 4P2OB 1JL8A 1UH4A 3ZO9A 3ATYA 4J3ZA 2ZC8A 3DVNB 4B97A 3ONBA 5DEFB 1D6VL 4J39A 1UWTA 12E8H 1EZ2A 2YL6A 1Y18B 1KT2A 4UQ3A 1AH0A 1A0EA 1BGAA 5DN1A 4JCLA 3O4OC 1TQTA 2P5ED 3CLMA 1HJVA 3BT0A 3DG6A 3L3IA 8XIAA 4HYRA 1YBQA 3CV1A 3B2UC 2W88A 1BVKB 5KYWA 3BVVA 4ETQB 1S2AA 4FLRA 4TR9A 1BEUA 4NUGL 4NKIH 4WEUD 1BWWA 1CK0H 1IFRA 4JY4A 5B21A 1FL6A 3U9UA 1NM9A 1DQDL 5I76B 3QJHB 1M65A 4CNSA 3CCHA 2DKSA 1ZB5A 3P0WA 4EI0A 3QIUA 4IJCA 5GZOC 2H2SC 5HR6A 4F24A 3TEXA 2D1ZA 4OJEH 1NC4A 3T3ME 4FFZL 4KNSA 4MYWB 3U7VA 4UINL 2XXFA 3QHTC 4ELKB 1PSCA 2REQB 4LQFH 4OLZH 3G5VA 2ZX5A 2BC4A 1T2QH 1BSLA 5FOOA 5IVNA 1WA0X 4ZYKA 4RDYA 3RYMA 2L8AA 5DJXB 2PWEA 4XIAA 4YDLC 3W1AA 2BJML 1NDMA 3WQWA 1YEJL 4WW1B 2X1RA 1BZEA 3C8KB 1WXJA 3K8MA 5I1HL 1TDQA 2Q7AA 4PHXA 3LH8A 1WYJA 5IEKA 3HG4A 5BRBA 4LUTB 1PS3A 4GUHA 1DSFH 1JNNL 4QRBA 2AJ3B 5SX4H 3W7PA 4APQC 5J5RA 1PD1A 1Y5WA 2ZZ1A 1U95A 4Z0XA 2NNRA 2VXQL 4Z7UE 3H8NA 3B7SA 4JVPA 4S2CA 3MLWH 4PJFB 4I85A 4J12A 4ABVA 3NEOA 4XD3A 4KUZH 3O2DA 5FI8A 1I9IH 4JM4H 5EZOL 3AABA 4DJDD 4LALA 3QR0A 2YPKA 3MRQB 2WSRA 2HPTA 4XUYA 4AY8A 2CG9X 4QLLA 1BTMA 3RTQD 3TO4D 1ME8A 1FSKC 2ZUXA 1QBML 4JFDB 1OZQA 3FONB 1CD1B 2I16A 1JAKA 2BERA 3C8FA 2W0FB 4ODTL 1TYEB 2NNFA 3F58L 1NUGA 3TTEA 3W6LA 1GTNA 1YDPA 4ELMF 2PDYA 4BEQA 4H1LA 1GPOH 2ZKYA 3ILPB 1EXHA 3O6FD 4FHJA 1HKMA 2EDRA 1KKRA 4W89A 1QFWM 1CXIA 4LFYA 4MGXA 1ITBB 3RM4A 2ZRWA 5F2IA 4U05A 3TJLA 4QHKJ 3DVGA 4X4ME 3QDJD 3HZMB 1IV8A 1XSIA 5SX5K 3P82A 4UYQA 3CPGA 2YPLA 3U4AA 1PAZA 2BOFX 4XCFH 4JO4L 1A7PL 5EU6A 1X5MA 4NLHA 3LBOA 4X5XB 1SJHB 3TV8A 5JIIA 1ADQL 2X1SA 4YOKA 4PRIA 1BLIA 1ZZMA 5ALBL 1CZ8L 5J6HB 1CB7B 4JLRA 4XIMA 1H15A 5J0BA 2PDFA 3SE4A 5AYBA 5D71L 1Q94A 1UWGH 3EFFB 3UWZA 4Q8OA 1RA0A 3MODL 4AHOA 2A73B 1NP2A 3ULVC 3CXDH 1MFNA 1OALA 4PJ6A 1B3JA 2F61A 3ZUNC 3SDCA 3VDHA 1I7TB 4M6AA 1G7QB 2Q8ZA 3CZ8A 4ZUUA 3BCDA 1TCMA 1CBJA 5D96B 3RPMA 2H32B 3D2UA 1JN6B 4JQIA 1IC5H 3RPIB 4XWOD 4P2AA 1T22A 4F8LA 1XLFA 4OU1A 3MWCA 2NY4D 3QO1B 4BHUI 5C0DA 4R2GD 1IVTA 1RJYB 2B9BA 5KSAC 4MDIB 1K8IB 5IQ9A 3C2RA 4MNQB 4OTXL 1FQ0A 1FBAA 1R30A 5KS9A 3KPQA 4N4PA 3EYFB 1VGEL 5IQLA 3NSDA 4PYHA 2B2XL 4XXWA 4ZW5A 2NY0D 1E9IA 4BE6A 3WCYA 4DXXA 4O1FA 2X4PA 3VMOA 3F7PC 2E9GA 3CXHJ 3WFCH 3I6RA 3AUOA 3X12A 3HE6B 2X7LA 2X4QB 4MSSA 4K39A 2VH5L 4W9EC 3DXIA 1D6EA 3F7LA 4S2BA 5LGXA 3U83A 1HH6A 3BQUD 3U1PA 1S9KC 1RZGA 4CU6A 4AXWB 4CNTA 1GOGA 4DWHA 1MLCA 5EU7C 4OCYH 2ZICA 4X6CE 1JK9B 2F8VA 5A16A 3QA3B 3HTWA 3RLSA 1OCWL 1JNLL 4G59C 4AV4A 4QRTA 3D52A 5K59E 5KN5A 5KJ4A 2X0WA 1HHKB 5DO2D 1RV8A 3UPBA 4LW7A 2J3SA 4OBRA 2C8NA 4QRRE 5IVXB 4I8DA 4XNMA 2ZUWA 1MNZA 4PRWA 4MDJA 3L2LA 2GT9B 5BV7L 2CDEA 4IEFB 1Q45A 2ATSA 3C6LC 1AGFA 2PGWA 1ZS2A 3L4XA 4NZRL 3OKNB 5BWAA 4M1RA 4NNAA 2IAMA 1GHRA 1A9BB 4WWNA 4DKTA 3V6OE 3G5XA 2R69A 3EHBB 4XO8A 4Z76B 4UM8A 4DI8A 2J2ZB 5M95B 5A2KH 4AG0A 3W72A 2OXHA 5D96C 5JORB 5I73B 4U1MB 4I5UA 3GBNH 2JGQA 3L2IA 3EZJB 2BZCA 3PDDA 2W80C 4HPYH 2Z31B 2GCYA 3PVFA 3GD1C 3ISYA 2HKAA 4PB0L 3N40F 3LM3A 1S5WA 3D5OF 4JFED 3VI4F 4IBYA 1TIMA 2JIXA 4I3SL 3MRNA 4RGMB 3DPDA 3JWDL 3O7UA 2WM0A 2XPGB 4JFPB 3L9RA 2AQ3A 4LNVA 3RGTA 5H1WA 4URTB 4G7EB 3HMXH 2C19A 2YRLA 2CH8A 4Z2IA 5K9OA 3OAZK 2DI9A 2YXXA 4UUJB 4J3OG 5C2UB 4PJAA 4RRPA 2VDOB 4GUJA 5BXSA 4NXSA 5F1VA 5FECB 1KPVB 1DQIA 2F9RA 4PRPB 4AZBA 5EBLA 2G8ZA 1CFQB 3FB8B 2J79A 5HDQL 1JVOA 3HE6C 1GZ1A 4KFNA 4FFWD 1T4WA 3SSGA 4GX9A 4LDCA 4QQ3A 4YE4H 3PZQA 4IKLA 3UTQB 3ZIMA 1I8IA 3KS0H 3EX3A 4UOW0 4CC0A 3HG0A 1VBGA 1BZ9B 4JPSA 1ES0A 1LMIA 4XAFA 2W79A 4OLVH 2ZXAA 3TA3B 1GY1A 3BZDA 3INPA 2AABL 2D73A 3W82A 4PULA 4JRXD 1MJJB 1Q7MA 3U9PL 1P7QD 4L65A 4Y9NA 3F05A 1YN7A 5SX4I 4JPGA 2TSYA 1WA1X 5ADPL 1FWEC 3JWOH 2DJXA 1CLZL 5GRJL 4O2FB 5IM51 3ZXWA 1UZ8B 1Q0EA 1BQKA 3FUKA 3A3WA 3RO8A 4OQ1A 4GOAA 3VUPA 1YCSA 1VHCA 3APYA 1K3ZA 3FA3A 3VXUE 1TJ1A 1MF2H 3D39B 4JAWA 5DMGC 2FJHA 3ILQC 1S7RB 1LWIA 3E12A 1IE7C 1SZGA 2NQJA 4YL4A 1O5RA 3ARFB 3LQLA 2GSHA 3T0DA 2ZRUA 3FT2B 5I73C 3BUDA 3MLVL 5KZDA 3FXIC 2NX5B 5E2WH 4G8GD 3HGOA 2PYEE 3OZPA 5D1XB 4TNFA 3DROB 5FOJA 4ORIA 2D3JA 3EDJA 5A6JA 4K94C 3P73A 4S1DD 2V38A 2WOBA 4U3AA 3BD4A 5FDYA 1H9VA 2VXTL 4TNVF 5HVGB 4DF2A 5EUKA 2PKDA 3HW7A 3FUFA 4H4NA 2ZWSA 2Y2YA 4AYFA 3PWJB 5BRZD 5IQ7H 2D2OA 3LQZA 2Y5QA 2YEVB 4L3FA 5BPPA 1UEMA 1GY2A 4XCCL 2K8MA 3RPKA 4QM1A 4G8FA 3WMPA 5FXCH 3TBSA 1R3JA 2NVCA 4WU7A 2ATKA 4MNGA 1E28B 1KCRH 2D2JA 1KGYE 3QORD 5FF7A 2R2HA 3SCPA 4MY9A 2QFPA 4A2MA 43C9A 3V0UA 4AQAB 4Z7VF 4O8RA 3E0FA 5HJXA 4Y9BA 4NO2A 5C0RH 3C75A 2YAPA 3D0LA 3KPNB 3KLLA 1P1MA 4ZXBA 4TUUA 2HVNA 2CALA 4I0PA 2XH2A 2VZOA 3CUPB 2EVIA 1E9OB 4K8RL 3ETBF 1DXFA 2GAZA 4QYOA 4H8WL 3BVNA 1RSYA 3DYOA 3M07A 1IGCL 3BLDA 3VCLA 1ZHBA 5HD8C 4KRPB 1BZ7A 2V17H 2FX7H 3SJVD 3M0IA 2B7OA 4HN4A 1KT2B 3U79A 4U7SA 4NQSA 3ZE1F 4N0FA 4UQ3B 1SJAA 3F3HA 4JKKA 1CDBA 1HCFX 2GQ9A 3MLZL 3GGWA 4BZ1H 5HHPA 1DVQA 2P9RA 3L3IB 1NBVL 1WITA 2O6PA 5HVWA 1IBHA 4KK5C 4WDIA 1ZPLA 4L4LA 4PRHE 3ZL2A 4WI5A 1X5FA 2V5SA 2UZYA 2VZ1A 5AVRB 3NQ6A 3ZOAA 4GUGA 4HJGA 4JY4B 4JHBA 1FL6B 3UGEA 3U9UB 4BWLA 4ZRGA 1YDVA 3MR9A 4DZBA 1ZHNA 1QCWA 1F3XA 5FLUA 1JPFA 3BT2H 5A8QA 4FJZA 12E8L 3QIUB 1SXBA 4PBFA 4FKHA 1NC4B 4HKXB 3KBEA 1DEEA 5HGAB 2X12A 4XCEB 4L4VA 4E9TA 4MIMA 4HH9B 4WWPA 4ZTPH 1LEIA 3EJRA 3STFA 3CC1A 5XIAA 3G5VB 4KFZC 2BC4B 4ZO6A 2Z26A 4FNLH 3WO4B 2XZQH 4C7GA 3BGFB 2VUOA 2W81C 3WS6A 4P57A 1FNFA 3S97C 4NKIL 3E2VA 1CK0L 1A7QH 3QJZA 3HIZA 1DFXA 5T3ZD 1NDMB 1EPFA 4LCWD 5F88A 1R3RA 4TUJA 5I6KA 1RBAA 2P28B 1ZXKA 3KPSD 3DHMA 1U42A 1OCBA 2BOBA 3U2ZA 4DF0A 3G7TA 2ALAA 3BJTA 3HC4H 2GUOA 1PNDA 1G1KA 3FF7A 1SQ7A 1J12A 3T78A 4LQFL 3HNTH 1EAPA 4OLZL 3W37A 2DAVA 4M61B 1T2QL 3QJVB 4NO0B 5GGTH 5DJ6B 1DQUA 1U95B 4Z0XB 1THCA 1S3KH 3MBDA 1E4KC 1N8IA 4DT2A 2B7PA 3DIFA 5LIUX 5I2IA 4PP2A 2VCCA 3BD3A 3SE9H 4A66A 4JTKA 4JRYB 2OMNA 1XUZA 3Q9PA 2VM4A 3KLSA 3K2GA 4K7FA 2XWRA 1XXFC 2PXYD 2YPKB 2WXHA 4C91A 1DSFL 2BVEA 3MYOA 1G0DA 1Q9WA 2VN4A 1BREA 2IGLA 1F76A 1GGBH 4L8CA 1WOBA 1P5VA 1F86A 1RCQA 4LAKA 2K6ZA 3DECA 4Z7OB 4H1LB 1QSZA 4WEMB 3QEUA 1E3ZA 1NGPH 1MWOA 3MLWL 2HFFA 4BFAA 1JPTL 2IC2A 4KUZL 4PU2A 3VWJA 1I9IL 1Q38A 4JM4L 4AKQA 5EBMB 4BXSV 2WJ5A 1JCMP 3W1PA 5CBIA 1B3VA 5H2BA 2XISA 3QIUC 4R85A 4UXDA 5DELA 4FX5A 3VSVA 3KL0A 3VFMA 2NT0A 5EU6B 2E3VA 1FOBA 3U0PB 5C2GA 3NP4A 4OSUH 4PRIB 3TO2B 2APFA 3REQA 3VNDA 2CBPA 2SEBA 1GPOL 1YJDH 4JLRB 4LUIA 3PSWA 1H15B 1RZIA 1TF4A 4RDQF 2CGZA 1Q94B 3ZE2F 3FAXA 4KXCA 5IDIA 1E5UI 2YWZA 5KSBF 4PUEA 4B9ZA 3IWVA 1OD0A 3UR8A 3SDCB 3HBLA 1YPFA 4CU7A 4XCFL 3U2JA 3MJ9A 4QRPA 4ZUUB 2DMBA 1F3TA 3IDIA 3PJNA 2XN0A 1KYOJ 2FJGA 2GQ8A 3LTSA 2VWEE 2ZXQA 1UWGL 3QOMA 3LLDA 2H8PA 3SD5A 2YLKA 2DZVA 4Q7NA 4U3HA 3QQWA 5C0DB 4HF5H 1E4WH 4OZOA 4RWHA 1AHWA 3CXDL 1U93A 4HK3J 1OP9A 5IQ9B 3GFUA 2NZIA 5KS9B 4ES8A 3KPQB 5E03A 3UC0H 4LZKA 3PBMA 1C5DA 3U6XA 4NOBA 3Q06A 3UP6A 4GXWA 3JQOB 4FK9A 3NPUA 1RL1A 5EMJA 3FQTA 1EZUA 2J9YA 2B31A 1D3GA 4JR5A 1IC5L 3NJHA 3AS2A 3SPVA 5HGDA 2X4PB 3X12B 4ZQNA 3NZ8A 1BXAA 3PL6A 4P2YA 3WLBB 3ETTA 5DC4B 4PJEE 3DXAE 1D6EB 2P5NA 5CZXD 1HH6B 1IBGH 1RZGB 2WO2B 4DEFA 1G87A 4YJ5A 1OG6A 3WFZA 1MLCB 4QTHA 2BGSA 2V5LA 3SHSA 4HIJA 4B5EA 3WIJA 4R3UA 2ZA3A 2VMCA 4MXQD 5AW3B 5DRWA 3TT1H 1I1AD 5KUKA 1IT8A 5DR5H 1OP5K 4Q6JA 2QQNH 3I6SA 5D72H 3WFCL 3VGAB 4KV5F 3BZEA 4YTRA 4KKAC 3QHOA 4XNMB 4O4VA 1L6ZA 3DX1A 4BHUA 3IE9A 4F2TA 2CDEB 1EBPA 1SBBA 1MZRA 4AHPA 2ADGA 5I0XA 1LROA 4UFLA 1F0LA 1SVDA 5B38A 1OEPA 5EEYA 4JFHD 1AGFB 5FAAA 1IM9D 1JGVH 1TZGH 4AW7A 1DUYA 2FPTA 3SUVA 2BM3A 1CI5A 1US3A 4OCYL 1SUXA 3DFQA 1QLEB 3GYCA 2K1MA 4Y0GA 3SDCC 4AF0A 5MHSE 1E4JA 3G5XB 2N56A 3L5WA 4E5TA 4UM8B 1ASOA 4N8PA 3EYOA 3OLIA 1DWFM 4C6FA 3MSGA 2NQCA 2OXHB 1UXMA 4KNTA 3KGUA 4Y2DB 5C7XH 2MCMA 3VFGH 4NM8H 4F58H 5CILH 3OQRA 3ZTJG 4P7QA 3H9SE 2GCYB 4RAUA 2ZTBA 3C52A 4HJIA 3WUGA 2GEEA 3CTLA 5L9FA 4E9YA 2I27N 1DUZA 1AC0A 4PRBA 2JIXB 3MRNB 2EJAA 4PUUA 3L9RB 5I6NA 5HYIA 2ORBH 4HXAL 2DJ4A 3ELQA 2P48B 1TPFA 3FN9A 1T20B 3VQ2C 1KFJA 2F53E 4DAFA 4RDBA 2VX7A 3NVQA 5FJJA 4XXWC 5D7IE 5K9OB 3ZU8A 3N13A 2F38A 3ISRA 5I1KH 1R0AH 2D4FA 2WBXA 3BEWA 1IGTA 1MCWM 4PJAB 3GBNL 2F7QA 2B0SH 3OMIB 4BH7A 2Z35A 4XO6A 2V0AA 3W3BA 4JM2F 5EBLB 2EXTA 3RM9A 4HPYL 2VYOA 4FO4A 3RK8A 1XD0A 3TF4A 1ZENA 4IM4A 3VI3A 5GRXG 5JW4R 1Z3GH 3DVNA 1I8IB 1BBDH 3CASA 5DEFA 3QAQA 3GRBA 4EI5A 1IC7H 3WLNA 2ARJQ 4GRWE 3APGA 3NZHH 4WGVB 2BHUA 3HMXL 3QY7A 5HI5C 3ASWA 3I4EA 3S6DA 4PJ5D 4G6FB 3ELFA 5EO0B 1D3HA 1GGIH 2W0LA 1I3GH 4CD7A 1BVKA 3UG5A 1YN7B 2P0IA 4PW3A 4DP9X 3F01A 3OVRA 4YE4L 3P0GB 4YAQA 1TMLA 1CICA 2XA3A 2DN7A 2IH1A 1MIMH 4KKXA 2XZAH 1KENH 3SDDC 3MNDA 5IB2A 1CC3A 3G6DH 1T0OA 2IAMC 4I3RH 4OLVL 3B9NA 4M3HA 2PS2A 3CUHA 4ELKA 4LLDA 5BZWA 4OV9A 1NTDA 3RYSA 3WKZA 5FFOA 1JCXA 2VN6A 1TFHA 3OF6D 4EVNB 1SDAB 2P7TA 1WDWA 2VDLH 1UP0A 3CJJA 3JWOL 3KVQA 3RR4A 5HMEA 4M82A 3C12A 4EI6A 3VXMB 3P73B 3R79A 3Q2NA 3OAYK 2VJXA 3LZRA 4N6EA 4HNUA 1KCBA 5EUKB 4PJ9D 1MF2L 2J62A 1RI8A 3DBXA 5EU4A 3UDWA 4AYFB 4AJ0A 3B9KA 3VSQA 2ED7A 3L5JA 3D08A 5HHNA 3TNNB 3WK3A 4M8QB 4PTTB 4HULB 4US6A 4OB5H 3TBSB 1R3JB 1BOYA 1H7WA 5D2NB 4WU7B 3FCBA 2ATKB 5E2WL 2IANB 3MJ7A 4P04A 1USQA 4XD4A 4N5ED 43C9B 4M1BA 1SPQA 4XODA 4NO2B 3D0LB 4ZXBB 1J8HE 3VU1A 4IJ3C 2IWKA 5HYEA 3UZ5A 3FONA 1CD1A 2GAZB 2W0FA 3FYIB 4XNXH 5IQ7L 5LDSA 3BVNB 4R7LA 2OSXA 3BWSA 3BWAA 1J5TA 2Y1YA 1EJTC 1BZ7B 3ILPA 4U3CA 4WWOA 3L13A 1E70M 4R7OA 4OFKA 1KCRL 4NQSB 4CVXB 2LAGB 4N0FB 3LB0A 4QGTA 4AIBA 1NU5A 1QI3A 5FIEA 1M05A 5C0RL 3GGWB 5HHPB 5GGRA 5E0CA 5RUBA 3TTOA 4YBLB 3EZ8A 4QHKI 2LTQB 1R3IH 4WDIB 4AD5A 4LFHG 5GSVA 2A3EA 3LHVA 2YAMA 3AALA 4LHUG 4CUCA 1G1OA 2E74C 1XBZA 2A7RA 4XVUD 4HJGB 3EBVA 4NASA 3BPWA 1O5XA 4JO2L 4RMWA 4DZBB 3SUWA 4Q8PA 4U1NA 2V17L 2A85A 2FX7L 5EIIG 2OJPA 2Z4GA 4ZA0A 4CRPA 1W0YT 2OEMA 3F4WA 3F7JA 1TFVA 5JIMA 4L4VB 3PHOB 2JXMA 1E2ZA 4BZ1L 1LEIB 1K8XA 1XEDA 3IFPA 2O5YH 3FT1A 2IGFH 3NA4A 4Y16B 3WLJA 2XOTA 1D2PA 4PJXA 3WDHA 5AALA 2CO7A 2V33A 3D4CA 4P57B 3G6AA 2AERT 2V8LA 4TUJB 4JHAH 2JI3A 4P07A 4WXZA 1M53A 4JNXA 1S39A 3BT2L 3L23A 4HHPA 4LU5H 1IWAA 3QPXL 3LKOA 3JT0A 2BOBB 1DN2A 4AMWA 1N7KA 2YCKX 5DVLA 3FA4A 1ADSA 5AOMA 3LI0A 2GUOB 3PP4H 4OWGA 4ZTPL 2F8IA 3IJ6A 2YCJA 4JYEA 4MDRA 4A35A 1EAPB 5JOPE 2GPTA 2OMUA 2RDUA 5CC6A 4ZQPA 2ALDA 2NSXA 4MNQA 4EZLA 1EUNA 4FNLL 2XZQL 4A8NA 3US1A 2DEWX 3EOAA 3VWKA 3QSTA 4G56A 4FFVD 4NQTA 3EYFA 3NCFB 4ZXBC 2YDSA 1WD8A 2PMZA 3DIFB 2Y72A 5I2IB 1A7QL 4ODHH 4PP2B 3WEZA 4I0PC 4H8HA 4D6DA 3CNYA 4X0KA 4K7FB 2YAOA 4ZFZA 1UHVA 3K5SA 4MKTA 5EZJA 3CMOH 3HC4L 1AE6H 2X4QA 5D7EA 3UABA 3JBG7 2GGGA 4L8CB 4D94A 2PP9A 3HNTL 1P5VB 1ZA3A 5GGTL 4X9SA 4AXWA 3CLFH 4LP4A 4YDMA 5G4HC 5C71A 4YBLC 1S3KL 1BF5A 2LTQC 5C0CE 1MW3A 5BV7B 2Y22A 3QEUB 4RMVA 3SE9L 1LP9E 3D85A 3QA3A 2HFFB 1DJZA 5BVJA 5KYXA 2PTWA 2X6AA 3AHXA 3RE0A 4TPRH 3VWJB 2ZX9A 1J9SA 4OZIF 2E9LA 1YEGH 3SQLA 4HBQA 5H6HA 5IVXA 1XSOA 2ID5A 3VFMB 3C8DA 1FE8H 1HX0A 4XTDA 3ZDZB 4C4KO 1MCCA 4AZGA 3NFPB 1QT1A 4OZFG 1Z8AA 5GJPA 3REQB 1SO5A 3OKNA 3ECWA 2SEBB 4C54A 3NG3A 3W1QA 2J4WH 2HH0H 1NGPL 4Z76A 3T5WA 5GNXA 3KS0J 4PY8I 3UXDA 4FA7B 3MJ8B 2J2ZA 2I17A 1LOLA 2VJ8A 2H1XA 4AZ8A 3KXQA 5JUEH 4W9HC 4XP6H 2YLAA 4OLUH 3O8XD 4RMTA 1UCWA 2UXVA 3NCXA 4G2DA 3G8RA 2DWYA 1BZDA 5SWSD 1AIZA 4QRPB 2GBVA 1G6CA 3OA5A 4NO3B 1L0XA 3CBWA 3QZBA 4KJPD 3U9WA 3IDIB 4OSUL 1HWHB 4ICNA 2XY2A 2QGHA 2GYIA 4DGWC 2FJGB 4KK8C 4K2SA 5F7EH 1YJDL 3FH5A 4YC2B 4G7EA 4GMTH 1M01A 1XLAA 4BYHA 4HZMA 4KXAA 4OF0A 4WWKA 5BQ7A 4PMRA 2H8PB 2PPAA 4BZYA 5EIQA 1GW6A 1QP1A 4UUJA 2RIKA 1AHWB 5LNRA 1U93B 1DE6A 2Q2EB 3SPGA 1XF3A 2HG0A 3VOCA 4CQDA 1GOOA 1HXMB 4MNHA 1KPVA 1NDZA 3HMXA 1P0DA 4XMPH 4PJCF 2V3GA 4UDTA 3FB8A 4G70B 1M4KA 5F9WB 5I0DA 5TF1H 3KL3A 1K3IA 4F0HA 1TR9A 4MDOA 1OADA 1XIDA 3UTQA 3AXXA 3GEFA 5KITA 3FQTB 3S8GB 1QOKA 1TU2B 2X0HA 3BVUA 5HGDB 1BZ9A 2TRSA 4I1PA 3RA7H 1MHHA 2I5IA 1QYGH 2QLVB 5FDWA 2XT1B 5REQA 2D7TH 1BQSA 3NZ8B 4L3AA 4PG9A 3TA3A 4FEZA 3GRGA 5BV7C 4HF5L 1E4WL 3W29A 4B5NA 3FAWA 3CN3A 4PVBA 3VWJC 3Q7JA 4GG8B 3POCA 2N0KA 2IJ0C 4R9OA 3GTNA 1OIFA 2EAEA 2XFWA 5K2ZA 5FAGA 3GDKA 4PMZA 3UC0L 3D8MA 5AVVB 3RQ3A 4GXVH 4HIJB 3WV0A 2JF6A 3EJYD 5EMYA 3A5FA 2ZXDA 5I71C 1RQEA 2X3AA 4JVUA 3BZGA 2ZOTA 2A0NA 3BN9C 1Z89A 4J3OH 3AXIA 3BZEB 4KDTA 2XPYA 4WI6A 2Y0FA 1IKNA 3FKRA 3VQLA 1F6KA 4GXPA 2BVPB 2VQ4A 1MI5E 1AJ0A 1TTBA 5B38B 1Y7VA 1IBGL 5G2NA 3OJVC 1DUYB 4HD9A 3JWDC 1Q6FA 3FT2A 4MPQA 4W9FC 2VR3A 1DWHM 3NIDE 2EDDA 1ZSDA 4AF0B 3ULSB 3NRPA 3FB6A 3RFRA 3TT1L 5EL1A 3DROA 3L5WB 1HP4A 3EYOB 5DR5L 4IQDA 3FJNA 3NPWA 2QQNL 5D72L 1I85A 1U2HA 5JXQA 3CEUA 3QY6A 2OJEA 3LPGA 1JTOA 1XCTA 4PE8A 4YK4B 4ZAKD 2AK4E 4GUPB 4OT1H 3VUSA 4Y89A 1PZ5A 5HULA 1DUZB 1JGVL 1TZGL 4PRBB 4DX3A 4KTDH 4BSVA 5EYWA 3QMSA 1AHWC 1HHIA 2YS4A 4FL4C 4YBHA 3CVCA 3E9TA 1XIMA 4PGDA 4JG0H 2DH2A 1E28A 4QTIH 2E76C 4MTMA 1DOSA 3QGAC 1BAGA 1J1OH 2OSYA 5GGVH 4YHYB 4DEPB 2E59A 3VZXA 1JCYA 4UFJA 3DTUB 2OQLA 3MUGA 4KI5C 3U30C 4PB3A 1H7PA 3BEWB 1IGTB 5C7XL 3DETC 3VFGL 4BH7B 2WZ0A 1HL9A 4J4PC 3FS9A 4OV5B 2Z35B 4NM8L 4F58L 5CILL 4L7ZA 3GHPA 3CUPA 2FEJA 1E9OA 2GQ3A 1GZGA 3SO3B 4IP5A 1T1ZB 2AQVA 4YHPB 3VE9A 3MDUA 3K72B 1HNYA 4DFIA 1HSBB 4KUCD 3PL6C 5E6IB 4LIQH 3VI3B 3QZAA 4PFMA 4PWGA 3B8SA 4BCYA 4YLWA 4EI5B 2ORBL 4WUIA 5D4QA 1TFPA 3CX5K 1FL3B 5CH9A 2DW6A 4PS3A 1FYTE 3LVEA 2CESA 5AW1B 1ME7A 4Y90A 5I1KL 1R0AL 3UVIA 2EILB 4B53A 4BK5A 1E1EA 3WL0A 2B0SL 5BQDA 5FSEC 2FO8A 4WRHA 3KPRE 3L45A 3T3MF 4FQJH 4ZO9A 1UXWB 5AOUA 1QNRA 4BZ1A 5G4MA 3SM0A 4YAQB 4HC1H 1WAAE 1CICB 1L9MA 1Z3GL 4CNOA 1YZZA 2IH1B 1BBDL 5FOBA 4Q8WA 3M46A 3QFJD 3AYTA 1IC7L 1LL7A 2DF3A 4M1DH 3ULUH 3NZHL 5IB2B 4BUGA 3T3PF 3WAJA 3QSKB 5F97E 1WNOA 1Q6GA 4HKXA 5HGAA 3OMZA 4XCEA 1FNEB 3DYMA 4GG6E 4HH9A 1XTMA 4HT3A 4M29A 4LLDB 2VLJD 4HT1H 5BZWB 1BQGA 3KVPA 3QC0A 3STPA 1HK6A 3E7JA 1GGIL 4LLMA 1E9ZB 5E9AA 4RZ5A 1I3GL 1DDTA 4A7VA 1G01A 2P7TB 4OGAD 3BEVA 4LVFA 3OBKA 1C90A 4EF3A 3JUGA 4Z1PA 5DD3L 3RDJA 4EI6B 4UMAA 2WCSA 1MIML 1FO0H 2JJSA 2XZAL 1KTLA 1KENL 1T7XA 1ZALA 3EA2A 3CN0A 2XTJE 1YE6A 5EN3A 4KWVA 2UZXB 1DYSA 4Z7UF 4RW5A 3G6DL 5HJGA 4JS7A 1J8VA 4I3RL 3IB4A 2J77A 1ZJIA 1MEIA 2D03H 3GR7A 4S39A 3DBXB 5EU4B 3B9KB 5I6SA 4H8WC 4M61A 4EF8A 4YHYC 3R8RA 4DEPC 4NO0A 5DJ6A 5HHNB 3C8NA 4D0BB 3UBHA 4BGLA 1H8OA 3A23A 3PWPE 3ZDYE 5T9BG 1RPXA 4JQ4A 3LPOA 2VDLL 1YX1A 2R1KA 2QDWA 5DJ0A 3KYKH 3MLYH 1TQUA 1EUUA 2OYLA 3MJ7B 1JPTH 4JRYA 2VABA 5ITFA 4LKCA 4IMKA 4P2OC 2I26N 5F44A 4QEHA 3BE1L 3DRQA 3FB5A 3ZJ6A 1JF1A 4JNZA 1PDKA 4MJ6A 5EOCH 3GXIA 2YAEA 3OGSA 3C60A 2HPMA 3I6LE 2Q71A 2BOEX 5A8NA 4G82A 3BWAB 1VFAB 4OB5L 2RDTA 3BP7B 4J5NA 3N42B 4L4TA 1XLDA 2I24N 2XSXA 2UX7A 3ZLGA 3T0TA 5CEZD 3N0AA 1M05B 5EBMA 5GGRB 1CICC 3QEHB 4AYMC 3CWOX 4BIKA 3MUY1 2WLYA 5GSVB 4Q4OA 3ABLB 5DC9B 3C5ZD 1SQMA 4OU3A 3U0PA 4XNXL 3GQFA 3HR6A 4Q7DA 2ZX8A 3TO2A 4FZ8H 4O58H 3TVMD 4AGOA 5AW6B 4U1NB 2ZKXA 2YZ1A 2G3XA 4LAOA 5BZZA 2ONEA 3GIQA 4FYQA 3MBED 4WY0B 1KM3A 4XHJC 4XOBA 1M9WA 4Y5VB 3CFTA 3LVTA 2QSQA 2FFIA 2D3VA 1KN2H 2V5MA 2IFGA 2Q09A 5AHLA 3S2NA 2JXMB 4Q9RH 3IFPB 4LSVH 1E3XA 3MCKA 1R3IL 3AUVA 2DY2A 2J25A 3LS9A 2OK0H 3ALGA 1XR9A 4PJXB 4MAVA 2BTMA 2CO7B 3FIGA 3GDRA 4A2FA 2C1PB 4Z3IA 5ENWA 3G6AB 3QFEA 4B3ZA 4IUOA 4C65A 5DBTA 2G5WA 1CLOH 3OGVA 2K3TA 1V93A 3UDWC 5FW6A 4H6EA 4TNGA 5AKVA 1R38A 3LKOB 4L5FE 1G0CA 2XWZA 3NQ2A 4DNLA 4MQXC 2HQAA 2AP2A 1ODAA 2IMRA 1EXBA 3ZR5A 3TYDA 1HOCA 2BW4A 3ZY7A 3NTYA 3VYOA 3EA1A 2I7SA 2O5YL 2OMUB 2E28A 2IGFL 1KFAH 2CWXA 2GG1A 3EOAB 3VWKB 4KKQA 1WCBB 1NGXA 3HVDA 1HT6A 4A21A 1C16B 1AFSA 3MUZ1 5HYJE 4JHAL 1YADA 2XBDA 4X0KB 4B9YA 1BHGA 1B3XA 5DA4A 5F21B 4LU5L 5IY5B 2B1HH 3SR7A 3BW3A 3SJNA 4ZFZB 4M7LH 4QWWD 4X6CF 5EZJB 1S5HB 3BZ5A 3H2AA 3KVMA 3PP4L 2DV6A 2WKJA 3L3JA 2A5HA 1PYMA 3WLBA 1KLYA 4N26A 5K59F 2Q6ZA 2E75C 1ZA3B 3PXLA 2HUHA 5C5YA 3PTQA 2JVUA 2VGGA 3PNRB 2E5EA 1GVIA 3AADB 4J6IA 2KT6A 3LRKA 5CEWA 1SSGA 4OOZA 4H7VA 1TVNA 2VLLA 4ODHL 4XN2A 3D4YA 1JJUA 3D85B 3PIQA 2VOTA 3BESR 5L2KD 5BVJB 5KYXB 3SCUA 4FJYA 2WXGA 4MJIE 4F4RA 1FHLA 3R8BB 4ZMYA 1QNSA 1NAL1 1EGMA 3M5XA 3DFTA 3G24A 4ZSOA 4K3JH 3CMOL 1AE6L 4GKLA 3LZPA 1OVZA 2Z6JA 4JX0A 3M41A 2N7SA 1MI3A 1KBWA 2BZNA 1OSPH 2AQ2A 4WFGD 2L04A 2N3JA 3MZGB 3VKCA 2GFBB 1MCNA 3CLFL 4UQ2A 4YLCA 3NGBB 4W9CC 1N5YH 1CGUA 4DK6A 3O6KH 2RMNA 5TF0A 4HXAH 3I65A 4PY8J 1ZLVK 4HK6A 2PEVA 4TPRL 4POZD 4OECA 4FTVA 2V3EA 2E9MA 2DQTH 1KBPA 1T3FA 4OZHA 1YEGL 3I10A 4AZ8B 3OQ8A 4Y2DA 2EZ0C 3RN6A 3TKFA 1J1PH 3CQFA 1PBGA 3MS8A 1FE8L 4DERA 1JI2A 2BXZA 3FU7B 5IIEA 3ABOA 4U1GB 1O5PA 1PS9A 2RJMA 1DCEA 1PL3A 4V2CB 1AVAA 2J4WL 1A6PA 2HH0L 2DIKA 1JSYA 4H3DA 3CUFA 4IP7A 2QHLA 3TL5A 4WWKB 5BQ7B 4JQVA 1T20A 4E41D 3MCMA 1NDWA 4MZ8A 1XIIA 2CBMA 1GOIA 4FQLH 5JUEL 1XF3B 4OFCA 2GJPA 4XP6L 5C0AD 4OLUL 2XWXA 4MNHB 3GM8A 4OUOA 4K7PX 3IFOA 5AW2B 2V68A 4UDTB 1L8PA 3DFNA 5HPCA 1X96A 2IDTA 5LDUA 2F7FA 1WIUA 4XGZB 2QQKH 3P4OA 5F7EL 3SW6A 2NNXA 3HIJA 1BJ1H 3N2BA 4LPUA 2V2WB 1GRWA 5J1AB 3KL5A 4GMTL 4FNSA 3CM4A 1MHHB 3QUKB 2V37A 5FDWB 5REQB 4EIVA 4PG9B 5FAJA 2W8CA 2DEYX 4PEEA 5EO0A 3ZTJH 4ZVJA 4FLQA 4QNPE 1Y6MR 4EQ2A 1BCIA 3IDMB 4XMPL 4ICXA 3EJUA 4FFZA 1P4IH 4YVXA 3IXTA 5TF1L 2E86A 3T4YB 3NA8A 3EOSA 5FYKD 4TS6A 1TV5A 2VDMH 5HNTA 1LJYA 3A24A 1A4BA 1C5CH 2YO3A 3BG3A 2AZUA 4QO1A 3RA7L 5KJRH 1IXNA 3SQOH 2X7WA 1UR9A 4Y4FD 1QYGL 2D7TL 3L08A 3HGSA 1KLUB 4EVZA 1F4WH 3EHBC 1SBSH 4U2YA 4Q8VA 4W9JC 3GZQA 5MHBA 4W68A 1XIJA 3HZVA 3AXLB 4JX5A 4BFNA 4EVNA 2VMJA 2Y7QA 4GXVL 1ZSDB 1BWKA 3FB6B 1DZBA 5ACLA 4DQAA 4JN1H 3NJFA 3I6KA 5D2LA 3SAZA 2Z31C 4ODVH 43CAB 1U3HD 4AYGA 3VXMA 3DFOA 4FXLA 2VXQA 3ZZLA 4K8GA 4DB7A 3V10A 2QDVA 4RGMC 4Y1AD 1CVRA 5D7LE 2MQ0A 3QXDB 3FRPG 2XU9A 3JZUA 5E6ZA 5TJWK 2OJEB 2WMHA 1NBQA 4JG5A 1XCTB 4WWKC 3VK5A 1KTRL 4FQPA 3DFPA 1BJMA 4XZIA 4QE4A 1OG0A 2NPLX 1PZ5B 2BHZA 3NCJH 4JPIA 5C70A 4LSSH 4GT7A 4BSVB 3TNNA 3QEQB 4XO7A 4M8QA 4O0ZA 1PY4A 4PTTA 5E6UB 1HHIB 3ROOA 4PGDB 5D2NA 4HOZA 2IANA 2I9EA 1YEIH 4NRSA 3RLVA 1VKFA 5D4HA 1ZV5A 4K1WA 2GWNA 3BG5A 4JY9A 2FBJH 2PO6A 3C86A 1GQLA 4DWSA 3MUGB 3LGDA 1XLCA 3L0NA 4C6OA 1MLBB 3GFXA 1TVBA 2EIDA 4E0CA 2X4NA 1F58H 5I78A 4OT1L 4N5UA 4G1EA 3TA3C 3N1AA 4KTDL 4XB8A 3L0KA 3QTPA 3VIMA 2EKSA 4JO2H 2WMFA 4LAQH 5FJRA 2C0HA 3CFBB 4TF4A 1EAQA 4JG0L 1XYMA 2CO2A 1QD0A 3F7RA 4QTIL 4ZNEE 4CVXA 4HKZA 1J1OL 3WENA 5GGVL 4KHTH 1ADQA 1QMUA 4I1RA 2WNNA 1AQKH 3U4EA 4C1NA 3LDBB 5LG1A 2XFYA 2F6KA 1P4LA 1PG7W 2QDGA 3B37A 5GS0H 3WDJA 2CO1A 3LNPA 2WVUA 3JWOC 4KDTC 4TUOB 1CGTA 4FX8A 1IKNC 1PIGA 4LIQL 1EEPA 5FOBB 2L7JA 3FC8A 4RQQB 1LWJA 2YCIX 3QPXH 3VB9A 3ARFC 1TPH1 2QVIA 3R8HA 5IROA 1NUNB 1T41A 3X3FH 3QBTB 1GA2A 1EHKB 3WLPA 3F65A 1YMMA 3PHOA 4D9QE 1M71B 5D1XC 4I90A 3PFRA 3ORJA 4LLMB 4Y16A 2G96A 3HG1D 4MA8H 4FQJL 2FWOA 4RWYH 3BEVB 3M0XA 1F6LL 3STBA 4DYKA 3CPLA 5D38A 4HC1L 1LMKA 4LOCA 2C16A 3VE7A 1U21A 2W61A 5B39G 3L5AA 1KTLB 1B3ZA 4M1DL 3ULUL 2QIWA 3QZOA 3NNTA 1NM4A 3Q05A 4CD5A 5JHDD 1VBJA 3W00A 5AHMA 4DNMA 3ID7A 3BUYA 4M43H 3VTRA 5GIRA 3ECVA 1QPRA 4HT1L 4L5ZA 1M3UA 4RJEA 2J6EH 3GLCA 3QQ0A 3T65A 1TX2A 4XNQA 4J2MA 1B4KA 5C0BE 1FF5A 3GHEH 5DJ0B 3SADA 4NO5A 2R2BA 3NMEA 3EH3B 4NQCA 2VABB 5ITFB 4LKCB 1FO0L 4RFEA 2DW5A 3E6FA 5FK9A 3UJIH 3DRQB 2YL5A 3FB5B 4L0YA 1JF1B 2DQDH 2E6PA 4KRPC 1MFAH 1IR1A 5B1BB 1PDKB 4MJ6B 3L81A 1U3NA 4NNYB 2D03L 3C60B 1DVSA 3K71A 4JFSA 1GC1H 3CHXA 3LOTA 4IQJA 4OCLC 4W7UA 3SE3A 3W83A 1BF6A 3WLLA 1Q1JH 4ISVA 4BK5C 1ZCRA 2OBGA 2ZXWB 2XA8H 1H5BB 2G9KA 3KYKL 2VXNA 4L4TB 3MLYL 1JR1A 3F5KA 5D8WA 4CDHA 3CPRA 4XN4A 3F85A 3ZMRA 1MG2C 3ET9F 3CT2A 3UZJA 3V35A 1QSEE 5C54A 4CD8A 4ZB0A 3RRXA 2ZUUA 5ISZA 4XZ4A 5EOCL 1WV2A 4E2BA 5JHAA 1UBPC 3NFPA 2HLFD 3PZTA 4OUEA 3TXZA 3VABA 1JULA 1A2YA 5H8UA 2C0AA 1ICQA 4RV3A 2V2CA 5LUMA 1TUFA 4QT5B 1PD0A 2XXGA 1XC6A 3UO8B 3WO4C 3VFUB 2IPTL 2DOCA 3BGFC 2OR9H 3S0PA 2J8UA 4BFOA 3B05A 3MJ8A 3AICA 1GOXA 3DX0A 5C07D 4HZ6A 1CURA 1GMIA 1NC2D 2J75A 4QISA 3MCKB 2JJSC 3EXJA 4MAYD 2JKPA 5KSVB 1XR9B 4ES9A 2TYSA 1MRAA 1QLFA 4F3HA 4NO3A 3QIWB 2DYRB 2CEQA 5ENWB 1T0PB 4FZ8L 4IOTA 4O58L 5KZ6A 2HBVA 3GAYA 1KM0A 3IDNA 2X0VA 3D25A 3CIWA 2VDRH 4BKSC 5DZ9A 4Y5XA 4NNXB 1TR7A 5FPIA 3Q67A 2AQPA 5CZJA 3AG4B 4FERA 1KN2L 2Z7UA 1OHZA 1HOCB 3QDAA 4Q9RL 4EZMA 4LSVL 3OZLA 1BGXH 4A38A 5FA3A 4BCEA 4IMKC 5EEXA 1HXMA 1ETA1 3A3HA 2OK0L 4YHEA 2D7QA 4OZFH 5FA4B 4XXCA 1KULA 3TJXA 4KX7A 1NGXB 3O07A 5FF4A 4FNPA 3UAEA 3GHBH 1CLOL 4YZWA 3EXTA 2WBJD 1CQKA 2J12B 1TU2A 1MW0A 3UTTB 2NV1A 4ABUA 1CF1A 2NW2A 1KXVA 4KO7A 5FYLH 1JMZA 1OFEA 4HK5A 4HA0A 2WXPA 4XAPA 3L3JB 1U1HA 1OD9A 3V16A 1TUXA 4F8NA 2Q10A 2KUTA 3NCMA 3DHJA 4GG8A 2NX9A 1KFAL 4S1RH 1W1PA 4HB7A 3VB8A 5T8GA 2QGBA 2VOMA 1D5IH 3MXVH 4NUWA 1AG0A 2VLLB 3Q45A 2BIQA 3PIQB 3S3SA 4UTBH 4J28A 3T0XA 1WKFA 2XYBA 1V6XA 2V5TA 2QHAA 4B2DD 2B1HL 4MS8D 4A04A 3RGVA 3C6EA 4M7LL 2ZWYA 3GHSA 4ZSOB 5DYFA 4BK8A 1OXYA 3SE4C 2BVPA 4UOZA 2QBWA 5F4XA 1T5WB 4K36A 3KHJA 4UQ2B 1CLYH 5AKSA 2OS7A 1MY5A 4YXGA 3ULSA 4GNJA 3WD1A 4JM0A 3BO8A 4WVXA 1BPLB 2DZSA 2KKQA 4FTVB 4J23A 1FCBA 4PS8A 1YNPA 3MCNA 2XUCA 3CVBA 5I6LA 4M7ZB 1T3FB 4OZHB 5AKRA 2VZ3A 3AG2B 5CC5A 5JQ9A 4K3JL 4TLSA 4N2AA 3OYXA 3RGBA 1D2KA 4JFXB 3TTYA 3SDXA 2E7CA 2AKRA 2VAAA 4LYKA 4QXVA 3OC5A 4HK0A 1OSPL 4GUPA 3TVAA 4UU9A 5IIEB 5D7JB 4BGDA 1NICA 1N5YL 2XIOA 3O3AA 3BGGA 1OHLA 4RPPA 4E5XB 4E36A 4HMEA 3O6KL 4TQPA 3LCIA 2DJSA 5DZJA 4E3TA 1YXDA 2UUDH 3DN5A 4NRZA 5DQPA 2P3ZA 4CNUA 1E4MM 1X5ZA 2DQJH 1RK1A 4LL1A 4MA3B 1VRXA 4OCXH 2DQTL 2F7OA 3T8VA 4RNHA 1X5IA 4ZX4A 1H41A 3L2MA 1QRKA 5LKYA 1ZTXE 5A6TC 4GRWF 2Y6SC 4OV5A 1OPGH 1J1PL 4ENED 3GIPA 4OCMC 3IFOB 4BKTC 1T1ZA 3BJ91 4YHPA 4O4YH 4BZ2H 5I75B 1FVEB 3Q8FA 4WK4B 3K72A 2V2XB 4DTGH 1HSBA 5E6IA 2R23A 4OFQA 4HETA 3BAXA 1BA9A 2APSA 3P4OB 2OZNA 4W86A 2FEDC 4QHNA 1FL3A 4MMWA 4IGMA 3OVPA 1J0YA 1XP3A 4WGHA 3USZA 4B3KA 5EB9A 4FQLL 3DKJA 1UASA 3QJAA 4IJTA 2NTSP 4CMMB 5EB8A 5F8QC 3L66A 2Z91B 1IIKA 3VGAC 4QOKE 1UXWA 2DUXA 3IXTB 4DP1X 3EO0A 2DLFH 1U5VA 4RETB 5LZLA 5DD3H 2QQKL 3L3GA 4MCYB 5HANA 3NVTA 3TX9A 4M5SA 1UH2A 2KZBA 3FK3A 4MASA 4QE5A 2NLJB 1E6RA 1JP5A 4M4RA 3BW4A 1TR1A 4NQEE 1OT4A 1XO8A 3IUIA 4QO1B 3HNVH 5K1NA 2ISFA 1AZBA 1VESA 1JZDC 3WLOA 4OOUA 2CBJA 4HC1A 1FNEA 5I79A 3U7YH 5ESQA 5EBAA 5CZTA 4HZ1A 5IFJA 3UAAA 4DO4A 4JJHA 1W1TA 2KPNA 4N9DA 3O9WD 3GQYA 2XWBA 2X30A 5B1AB 2GKIA 2VX6A 3HMWH 5LQBH 3HZVB 5EOCJ 3T4CA 5L8KB 4XMTA 1GJUA 3BZ4A 3S83A 2VW7A 3SDAB 1IBDA 1P4IL 4MNKA 4Y2DC 2AITA 2Y7QB 4EWND 3QYMA 2FT7A 4JTRA 4P2RA 3QDME 3N1GC 4LC6A 4PD4J 4WIWA 3D30A 1PLGH 3MKVA 2VDML 3I6KB 4GQ9L 5CCHE 5D2LB 3INUH 4REQA 3W7KA 2ITCA 2ZXEB 1C5CL 4KIEA 2UZXA 5K1VA 1CEOA 1WF5A 3BE1H 5KJRL 2VDLB 3SQOL 2OTWA 4E9XA 4GINA 2PR4H 3GVRA 5JBDA 1L4IA 4QP0A 1F4WL 1AMKA 1A6VH 1SBSL 3ME3A 1FO0A 5IWLA 3GXPA 4EF9A 1GMEA 4JPIB 1L8NA 4LK4A 3UCDA 4D0BA 3MHZA 2NT1A 3MOBH 2F5BH 3QCUH 4LUSB 3EDKA 1F5WA 3DGGA 2WZHA 3ROOB 2LV4A 3EWWA 4Z7WE 1NIAA 5LNVA 4GG9A 4JN1L 3GZPA 1HYSD 4FMFA 5DQ9A 4ODVL 3V79C 3WBYA 2F2HA 2PO6B 3LXCA 2D7PA 3WH9A 3HBPA 3MHGA 5EEUA 5AVTB 4DWSB 2ODIA 3BQ5A 4X5WB 4W8LA 2GVLA 2MCPH 1J9TA 1KUMA 4XPGH 4ERGA 3M8OH 1TVBB 1JRBA 2X4NB 3KR3H 3R94A 2CWRA 2ANUA 3NCJL 3DDFA 4G1EB 4NP4H 4QDGA 5L4MA 3PAVA 1W8NA 4LSSL 4R88A 1E8XA 1KIUA 2EKSB 3LKQA 2FZBA 1VFAA 1CUOA 4HALA 3BP7A 2YAQA 4UILH 1YEIL 3BG9A 3TH6A 5EZLB 4HKZB 2FBJL 3W0WE 1RY0A 1TTIA 1EOMA 2XN2A 4UQAA 1ORSA 2PDMA 4LT7A 3U4EB 3UG8A 3OKMA 4C1NB 4KBXA 4HAFA 1ICSA 5I1GH 3QEHA 2KLTA 1J5CA 3ECUA 3WZ0E 1P4LB 1E67A 1ZPUA 2WBGA 1NIDA 1KCKA 1GONA 1F58L 4P8XA 2AGKA 2FVNA 2CAKA 4RXFA 3U1SH 2VLKD 2FFCA 1CGWA 2AJVH 1EO7A 4PBVC 1E2WA 4LAQL 4GGBA 1UURA 2X41A 4LWWA 5T3XD 2QZ5A 4WY0A 5H8MA 4Y19D 4LKXA 2X2UA 5IESL 1D7BA 4Y5VA 1QJWA 4ELDA 4F5CA 4KHTL 4HJUA 4N90D 1EFXD 1AQKL 1YMMB 4W8AA 3RDTA 1T21A 1FRGH 4ATTA 3LCHA 2PLCA 3B5TA 3RLUA 5GS0L 2ZQKA 4JYDA 4P8VA 3IMUA 3ENEA 1X5JA 2FWOB 2C1PA 1FCVA 3CPLB 2DM3A 5CBBA 1DQJA 3VC6A 1F7BA 4N1EA 4XNBA 4OE7A 1TJRA 4H88H 3OJGA 4S1FA 5GGQH 3U2CA 1DVTA 4U6XA 1GYVA 3L4WA 3X3FL 1HFBA 1WWCA 5D2NC 3BUYB 1YIXA 1CLCA 4Z8FH 5GIRB 1FY6A 4KXDA 1UTDA 3BTNA 4PRTA 5C2XA 3T65B 4AC1X 4DWSC 4MA8L 4XNQB 2ODHA 5B22A 3W9ZA 1TSIA 1WCBA 2BSED 4RWYL 9RUBA 1GKQA 1C16A 4NO5B 2R2BB 1C1EH 5E6RB 4H40A 5DQJA 4NQCB 2UYLA 1WFTA 1XL4A 3DO4A 3CUIA 4G43B 3ES8A 3AT8A 4RFEB 2PLTA 3E6FB 3UPRA 5FK9B 5B7FA 1ZU8A 4WI8A 3AHVA 1SQ2N 4TTDC 2QTVA 4QXIA 1S5HA 5G4EA 4Q4KA 2HVBA 1V10A 4M43L 5C08D 3T0AA 1FWAC 1CTNA 3QMRA 3FQNA 3BVWA 3DGCR 5HQMA 1H0GA 3U6XS 3K71B 5TDOA 1RHCA 4MZ1A 3F83A 3B97A 1OZTG 2J6EL 1QNZH 3EX6A 2XWCA 3RVUD 3W2MA 5DFVD 1A4LA 3CJPA 2G97A 4ISVB 4GY7A 1OAXH 2YUZA 2HSAA 2NXIA 3KM2A 3GHEL 1OIMA 3RCYA 1MQKH 1RY8A 3T42A 2CZ5A 2VJ0A 4WF7A 2IH9A 4BQ9A 2IQ9H 4UMGA 4BWLC 2BS9A 3UJIL 2DQDL 1MFAL 2QPDB 2YDAA 5ISZB 1QK0A 3AISA 5IROC 1GC1L 3TN0D 3OB0K 1AQ8A 3LYEA 2QR0A 2GFBA 2J73A 3OGOE 4X7EC 1A2YB 2F2KA 3IBOA 1Q1JL 4XXDA 2UX6A 2XA8L 3T2NH 4Y16C 1CCWB 3RVXD 5ILTH 3WS6C 2J8UB 2FTAA 1BJ1J 2YN5A 4Q8BA 3MV8E 4KHXH 5KVGE 5AZ0A 5KVDE 1I3RB 2Y06H 2IPKA 1QSVA 5I0VA 2CXKA 1TV4A 1ZLUK 4JQAA 4OI8A 1QLFB 1AO7D 1EC9A 3HUJF 1JZFA 3DX3A 3O6AA 4U4IA 1O7VA 3FU7A 1LOQA 2NY2B 4CEXC 4L3EE 3IDNB 3D25B 4HWZA 3N14A 4Y5XB 2BGNE 5SWZA 2K7PA 3WYZA 2OR9L 3HJ0A 2FTWA 2NWRA 4LCQA 5CPQA 5I3HA 2HLEB 2Z2BA 3HAEG 4UYPA 2J8OA 7CGTA 3WTVA 3EFDH 1BBJB 1RPUA 4GKOA 2XZCH