4M8UA

The structure of mall mutant enzyme v200a from bacillus subtilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
559
structure length
559
Chain Sequence
SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDAIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPERADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
total genus 230
structure length 559
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m8uA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m8uA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m8uA02
3BAJA 1CGVA 2VNCA 3AHYA 4WKHA 2VCCA 2Y8KA 2VZSA 4AIUA 2X0YA 4AZBA 1UH2A 2D20A 3UR8A 5AYBA 3WDIA 3SCNA 1QVBA 3AMGA 3WQ6A 4ATWA 3BUBA 1JDDA 2PWHA 4M56A 1KTBA 1E40A 5HBFA 4UOJA 3LRKA 3O9NA 1JNEA 3ZMRA 1JDAA 1UWRA 4S3KA 3ZR5A 1D7FA 1NWUA 3W25A 2VQTA 2PB1A 3RJYA 1NM9A 1TCMA 4L4OA 4QDMA 4MTVA 4AWEA 5FCZA 1SR0A 3D3AA 4JHZA 1V3LA 1UD4A 3W82A 4DUVA 4PMOA 3BUDA 1G0CA 1XH2A 3W81A 5E09A 2W63A 2ZX8A 2WBKA 3THCA 1VENA 1AQMA 3VMNA 5D9OA 4ATLA 2EPMX 4ZXLA 1MW3A 1ZS2A 4TVDA 1HVXA 4H04A 3WIJA 3RIKA 4BQ5A 1G9HA 3M07A 4JAWA 1MXDA 1J0JA 1V6UA 2G3IA 5DEZA 4JHOA 1KR1A 3TTSA 1KR0A 1M03A 1WDQA 3AXHA 1DEDA 3VSVA 4E2OA 2XG9A 3CC1A 3ARYA 3SUUA 3AHVA 1SYTA 1HJSA 2V3GA 1BAGA 3K8KA 1HJXA 1HJWA 1E6ZA 1GQJA 4GKLA 1R75A 2X0HA 4LGXA 2ESCA 2VO5A 3VIJA 1PIGA 2IXUA 2C8NA 3RMEA 1ZBKA 3WF0A 3D51A 1RP9A 2WKGA 1OB0A 4XX6A 1FFQA 2WVUA 2EPOA 4U33A 3KLLA 3N18A 1QI3A 4AZHA 5I5RA 1OIMA 4OJYA 2UY2A 3WD0A 1BQCA 2E9MA 4PMVA 4XZBA 1CDGA 2VCBA 2Y2WA 1UUQA 1HF6A 1E9LA 4GZJA 4Z2LA 5HPCA 3WMCA 1ODZA 1F4HA 2X05A 2WPGA 4C7GA 2WHMA 2OLHA 4X9YA 1J12A 3OGRA 5AC4A 1LL7A 5A2AA 6CGTA 2WMKA 1VFMA 1CXHA 4J3XA 3VGGA 1VBRA 3WD4A 3GXNA 4IPLA 1VEMA 4NZCA 2DSUA 3I3DA 1JZ5A 4H8UA 3WMSA 3WY1A 1E1FA 1V03A 3MANA 5A8OA 1B30A 1UKQA 3AMKA 3WUGA 1QOXA 1V3IA 2WZIA 3SUSA 1BGGA 3WY2A 1JG9A 1TFVA 3DECA 3VIHA 2QMJA 2O9TA 3LPFA 4KWUA 5A6LA 1JYWA 1X6NA 5D4YA 2EEXA 1E6SM 4PMNA 3GXPA 1UD5A 4UNIA 7TAAA 2XIIA 1GCYA 1CXFA 2ZWYA 2XFRA 2D0HA 3QOMA 1KCKA 2FHBA 5ABHA 2F18A 3SEPA 2WMJA 3ARPA 3G6MA 5LA1A 3A4WA 4BQ3A 1B3YA 5A3HA 1UA7A 1QX1A 5E6ZA 1V08A 3W29A 3LXBA 2G3MA 2O9PA 3ZJ7A 2BVTA 4DWSB 3VSUA 3MUZ1 2RGMA 3WD2A 1NOWA 4PN2A 4Q7NA 4HA1A 4CCDA 3VD5A 2DT1A 3RDKA 3AS2A 3TTOA 1Q6EA 2X2YA 5JBEA 1C3FA 2XFFA 1JAKA 4FLSA 1A3HA 4QCFA 2VQUA 4IPNB 3SUTA 3ZJ6A 3W38A 1AQHA 1H1NA 4MNJA 3SCUA 3QOKA 2JEPA 2A3BA 1E43A 3VGDA 3W28A 4UOZA 3RO8A 1GORA 5BRPA 2EO7A 4TX6A 1CBGA 4RE3A 1QHZA 2OYLA 2VT0A 2QLYA 2BY3A 2D24A 5A2CA 3N9KA 4D6JA 5LA2A 1UH4A 3QHMA 4CVWA 1GOIA 1XRVA 2UWFA 4HMEA 1I1WA 3W4RA 3POCA 2EAEA 5A8MA 3II1A 2E9BA 5A6JA 4DO5A 1FH9A 4QFUA 4TVUA 4JIEA 4OBRA 3D52A 3CLWA 3PZIA 2O9OA 3MV11 2E0PA 3AS0A 3LPGA 3BAKA 3CHDA 1E6PA 1FP9A 3BSHA 5BXTA 3AROA 1LJYA 1HJVA 1KGUA 2MANA 3IJ7A 1CECA 1K9EA 1E55A 4AZGA 1NQ6A 1JFXA 3FNDA 4W85A 3AZTA 1HNYA 2GJXA 3AFBA 1BG9A 1W9XA 1E6XM 3WNPA 3SUVA 4HOZA 1EOMA 1QWUA 1XCXA 2D3LA 2E4TA 3K8LA 1CZ1A 9CGTA 5C8BB 3PZGA 4U5IA 2CBJA 1F4AA 2EPKX 3MMUA 3WQ5A 5I6SA 3BMWA 1BGAA 5FIPA 4FNPA 1ISXA 1EO7A 4JFTA 2YKKA 3IANA 1J11A 4Z2IA 1CNVA 4IM4A 1SMAA 1CLXA 4CKQA 2CITA 3GXFA 2XYLA 3OBAA 3VIOA 3EMZA 1O7DC 4TOQA 4HA3A 2DH2A 2Y5EA 1HJUA 4YHEA 5AC5A 2YJQA 2ZIDA 4B9ZA 4Y7EA 4UZSA 1JZ2A 1ZB5A 4AW7A 4MDPA 2GK1B 1V3JA 3A3HA 4W86A 1WPCA 1DWGM 1M01A 1UWIA 3DC0A 5I24A 3N1AA 2XGIA 4GZIA 3HN3A 4F9DA 3ZT6A 1E71M 3POHA 3CUGA 1E3XA 4FLOA 2E40A 4J3VA 2YDSA 1GJWA 2BVDA 2VC9A 4J3SA 3WDRA 3CUFA 3U5UA 1HP5A 3NJ3A 2WVTA 3VKKA 3EJSA 1DWIM 3ARTA 1UR2A 3WELA 2XTKA 1NARA 3WL1A 4AYGA 1VRXA 1WB0A 3F5JA 5E0FA 3WBAA 3KEHA 4ZEPA 2AMGA 4QLKA 3U5YA 4A3YA 1PX8A 2VL4A 4BCEA 1PEZA 3IAQA 1ODUA 2ZX5A 3L4UA 4P7NA 1QPKA 1GVIA 4PBGA 3AIVA 2WB5A 2ZUSA 1GW1A 1PIFA 3VO0A 1E6RA 3ARXA 2WVSA 1H4PA 1OGBA 3VIIA 1QI0A 1V6YA 1ITCA 2XVNA 1B31A 5CXPA 1E5NA 2O92A 2GSJA 3FAWA 1E3ZA 1IT0A 3GH7A 3BXWA 3GXDA 4KH2A 1ZJBA 4LYRA 1J01A 3AIBA 4UQCA 4AYSA 1R85A 1CIUA 3QR3A 4JZ5A 3BAYA 1J0KA 4U5KA 4PCSA 4YN5A 4DO6A 5IHSA 4GZEA 3BCFA 1T0OA 1TA3A 3VSTA 4MNLA 1C7TA 1UA3A 3GBDA 2J74A 3TA9A 3WY3A 5IXEA 1CEOA 1H0GA 3K4DA 1PX4A 3CZLA 3T08A 1Q6DA 3SCVA 4JKLA 1CLVA 2FHFA 1WDPA 3N04A 2RGLA 4CN4A 3WF2A 2WMGA 5JBDA 1ITXA 3RM9A 4FNRA 1KWKA 2UY4A 3T0DA 3ZJ8A 1EQCA 3H55A 1SMDA 3WQVA 2ZWZA 4WSJA 3VOCA 3NDYA 1DWHM 1NWRA 3WNLA 2X1IA 1G5AA 4P7LA 4HZ7A 3FN9A 5BYWA 1B3WA 3AMCA 2GUYA 3VILA 3WD1A 1HJQA 1BTCA 3JUGA 4GI9A 5I78A 3K8MA 4R27A 4PMUA 1W1TA 1JD7A 2WHJA 1GZJA 4M29A 4WJXA 3AISA 4U3CA 3AHZA 2D2OA 2IUZA 6TAAA 1WCGA 5IHRA 3MUAA 3CMGA 1HKIA 4GO9A 3F5LA 3W6MA 3ARSA 1BYDA 4FLQA 1QWNA 1RH9A 4EAMA 1IV8A 1KBBA 4B15A 1MWOA 1R34A 3DYOA 4URIA 3VDHA 1VFOA 5A6SA 4PUEA 4FNQA 2F2HA 2VCAA 3FAXA 1JZ4A 1Q6CA 2BVYA 3OG2A 5TD4A 4FNTA 2DPEA 3VIKA 5A8QA 3KE0A 5CPQA 1BYBA 1GUVA 3UG3A 1WZAA 1H3GA 1JZ6A 4W84A 4CUCA 3W6LA 4JL1A 1DHKA 3VNZA 5ABEA 3AXIA 1E6NA 1BHGA 3K46A 1C8QA 2V3DA 3OZOA 2YLLA 3DHUA 1UKOA 3CO4A 2JF6A 3OLEA 5ABFA 2BHZA 3VIMA 2WVVB 2YLAA 4OOZA 4GXPA 1XSIA 4UFKA 2XN1A 1QW9A 2W92A 1R86A 3GBEA 4D6IA 5CQ1A 3UERA 3LMYA 2C7FA 3OLGA 3NDZA 3CZGA 3EJPA 2CNCA 3CZNA 1XYZA 2Q8XA 2X2HA 2WK2A 1B3XA 1D3CA 3RILA 3GH4A 5DF0A 1UWUA 7A3HA 3ZR6A 4ACZB 3AJ7A 1PX3A 2VZVA 3L2LA 2JIEA 1XV8A 2J7DA 1IZJA 3B9DA 3MUY1 4WF7A 1W3JA 3WEMA 2CETA 3ZQ9A 3AS1A 1E70M 3ARQA 4ACZA 1E72M 4XZWA 4OZOA 3VD3A 2WCAA 3VNYA 1PS3A 5A1AA 2F61A 4QP0A 3AZSA 3WDQA 3L4WA 3CZEA 4QLLA 2JALA 1XHGA 2UY3A 1WZMA 1JF5A 4W89A 4PTMA 4U3AA 2ZUNA 4Z2HA 3BGAA 1EO5A 1GOWA 1R8LA 1NOUA 3T2PA 1PPIA 2XSAA 2TAAA 1GOOA 1ZJAA 2YL5A 3PZVA 1JYNA 2BFGA 1Q6FA 3WENA 4NI3A 3T0AA 1GOMA 4X0VA 3U57A 1LLOA 3WL0A 4UTFA 1OT2A 1EDQA 1CPUA 4EK7A 2EBNA 1J10A 1EXPA 2ZXBA 1HIZA 1K9DA 8CGTA 3KL5A 1GQKA 3OIHA 5BRQA 1C91A 3PN8A 1VAHA 2B31A 2WHKA 1V3HA 3NCOA 2YBUA 1C93A 4NZFA 1IZKA 4M80A 2E8ZA 4OBSA 3VIGA 3KWXA 1H49A 2WWDA 1CGXA 3FXYA 3L4TA 1K6AA 2E8YA 3WMBA 3THDA 1V6VA 2ZX6A 2DIEA 2JFEX 1JZ8A 3RJXA 4W8AA 4NX0A 2FHCA 1W32A 2VVNA 4UZUA 2J8FA 1DTUA 2VX6A 3H54A 3BLKA 3I3BA 4XB3A 3PZQA 1XCWA 2JF7A 3OGSA 2YBTA 1OIFA 4OIFA 1EDGA 3WDJA 4MADA 2WMIB 4BF7A 4EKJA 1JI2A 2YL6A 5D9MA 4UQBA 1MQPA 5I23A 1ESWA 3VD9A 4JFSA 1JXJA 2ZUVA 2BHYA 1GOKA 1UG6A 3NSNA 5A6MA 2VR5A 4J27A 5BXRA 1B3VA 1LG1A 4ML4A 4D71A 1UKSA 4GPNA 1BPLB 3BLBA 2J25A 1CXLA 3A6OA 1OBAA 2GVYA 5EFFA 4PRWA 1UWQA 1X6LA 2ZUTA 2V3FA 3WFLA 4D6CA 1TR1A 4B3LA 2YL9A 2XGBA 4CD6A 4MB5A 5E0CA 4NSBA 1KBKA 2BY0A 1FOBA 2EACA 1UR9A 5A6BA 3VDBA 1C7SA 5FKYA 4F66A 4HP5A 3OGVA 4CN6A 4DWSA 4PTWA 1XGZA 1JIBA 4PCTA 3W24A 1E4MM 3A21A 2FGZA 2BXZA 2GDVA 5BROA 2GK1A 3APGA 3GH5A 2J7BA 3W53A 1W2VA 1WO2A 4WKFA 3A4XA 1BFNA 2J7GA 1JFHA 3ALFA 2ZX7A 1GONA 1FA2A 2FE0A 2WC7A 5E1QA 1MXGA 2HISA 1L8NA 2DSWA 4OUEA 3VX1A 3GNOA 5M3WA 4M82A 3BUPA 4CD8A 1M7XA 5DO8A 2WCGA 4JCMA 1HVQA 1M04A 3KLKA 3TONA 1GQIA 4JKMA 4W7VA 4ZE5A 3AXXA 1H11A 3VGBA 5D8ZA 2PF0A 4A3HA 2GJRA 4W5ZA 3U7VA 1CENA 2WVVA 4DWSC 2FH8A 5I77A 2OW7A 2YFOA 3OB8A 3L4ZA 1JNDA 5E70A 4J28A 3VM7A 3BUIA 3N15A 2A3AA 3AIQA 4KGJA 3HG5A 2QHAA 3D4YA 2QMKA 1H2JA 1EH9A 4GI8A 1UWTA 4XV0A 4OOUA 2PBOA 3ARWA 2QV4A 3QGVA 2W67A 1UZ1A 1NWSA 1VIWA 4R5EA 1ZBWA 1CGTA 4UFLA 4D1JA 1WDSA 5FD0A 3IJ9A 5AYIA 3HG4A 2CKSA 4JFVA 3ZO9A 3PZNA 4AZCA 3WH9A 4OGZA 3EMCA 1GHRA 1HXKA 4W93A 4AMXA 3CHFA 3WF4A 1KWGA 3T2OA 2X2IA 4CD5A 1GJUA 2CESA 4QAWA 4LXFA 1QNPA 3RCNA 2A3EA 1W3KA 2EQDA 1B0IA 1OINA 1WNOA 3HG3A 1UR0A 3MI6A 1OD8A 4C7DA 4U2YA 3WH7A 1V3KA 3IAPA 1JXKA 3AMLA 2WM0A 2VVSA 2XVKA 5A8NA 2WHLA 1AQ0A 2QF8A 2CHNA 2XVGA 3DHPA 2YL8A 1NH6A 4W7UA 2ZUMA 4HOXA 4GINA 2V5DA 1KFWA 1BG4A 3T0BA 4F9JA 5FOOA 2D0GA 5A94A 5KEZA 3AI0A 3QHNA 4HZ6A 2OWXA 3EJRA 1E1EA 4D6FA 3AICA 5BCAA 1D2KA 5E9AA 2XHYA 4HPGA 4W5UA 4N0RA 3VIPA 4PMQA 1WZLA 1H5VA 3VIFA 4N42A 3CHCA 3EDKA 3SCTA 4DM2A 2CEQA 4A4AA 3WF1A 2BS9A 5ABFB 5DMYA 1HL8A 3PZMA 3SCPA 4KRUA 1CXIA 3WBEA 1PZ3A 4PMZA 3KZSA 3ECQA 1YHTA 2PBGA 1VBUA 3PTMA 1V02E 1XD1A 1GOQA 7CGTA 5EFDA 1UYQA 3WQWA 2JE8A 1O7AA 2E3ZA 1OT1A 3A5VA 3S2CA 1BYCA 3SCRA 3FW6A 3ZT7A 4B9YA 3CUJA 5CGMA 1JL8A 1EIBA 5CLWA 2W62A 3CH9A 4GIAA 1V3MA 2WSPA 3GNRA 4KGLA 4V28A 3RM8A 1QI5A 1B90A 2WMHA 4UFHA 3LPOA 3J7HA 1VF8A 4KMQA 1WZKA 4PTVA 2CERA 4GQQA 4JCLA 2IXVA 2XWEA 2AOSA 3F4VA 4IUGA 2PWEA 1GHSA 2BY1A 3AHTA 4P8XA 1L0PA 1VEOA 3PZ9A 2CHOA 2D22A 5GNYA 2FYVA 3AHXA 1ZBVA 2NSXA 2D23A 2UY5A 2XM2A 2XM1A 2GDUA 3WN6A 1JYVA 4DM1A 1OGSA 4AIEA 3T2QA 4F79A 4PSPA 3QHOA 1R87A 1US2A 1R33A 4H8VA 1K9FA 3O2LA 2VX7A 4WKAA 5IFPA 4ACYA 3MS8A 3B8SA 1KXVA 3GXIA 2G3JA 4D72A 1PBGA 3CZKA 3GDBA 2CBVA 2CIPA 4MJ2A 2BY2A 1E5JA 2V5CA 2VZUA 1CGYA 1AVAA 4DUXA 2W61A 3CUIA 1KB3A 3DX2A 4D6HA 2AAAA 3S6TA 1HL9A 3N13A 1UR8A 1R7OA 4LX4A 2GJXB 1ZBCA 3EBVA 5GNZA 2PI6A 3SCWA 4MB3A 3LRLA 2DT3A 1W9DM 4CD7A 2J62A 1UH3A 1UHVA 2XVPA 4EE9A 1W91A 2XUCA 2DQXA 3AIUA 1C8XA 1JF6A 2X2JA 1UASA 2OWCA 2YA1A 3CZ8A 4C7FA 4TX8A 1BYAA 1H41A 1E6QM 2WMFA 1KXQA 2WSKA 1E0WA 3SIMA 3PZTA 1I1XA 2DT0A 3TTQA 3EJUA 1VEPA 1W2PA 2J7FA 3M6DA 1E4NA 2WANA 2F1AA 3B9EA 1ZL1A 1VJSA 3PZOA 2YDRA 3DDGA 4FNSA 1VB9A 2VRKA 3EJQA 4E4PA 1JD9A 2BHUA 4UFJA 1FP8A 2WC3A 4HPHA 5GPRA 2YOCA 5CSUA 4M8UA 2EPLX 1TQTA 5CG0A 5EMYA 1NP0A 3RPMA 1UQYA 4AMCA 4W7WA 1B1YA 3VX0A 3AYSA 5D9PA 1J0ZA 2WZHA 3ZJKA 1CTNA 4PEEA 3MKKA 1CYGA 4MNKA 3W26A 3MO4A 1TQVA 4DWSD 1MVYA 2D0FA 3CBWA 1CGUA 1WKYA 1VFFA 4P7RA 4E8DA 4PMDA 3WY4A 6A3HA 4P8UA 1W1VA 3WNMA 3EJTA 2ALWA 4U31A 1H0IA 2J79A 1ISZA 4GI6A 2W66A 3VMOA 3WQ8A 3ALGA 1TQSA 1UD6A 4P7OA 4Z2JA 3VMPA 2J75A 3ZSSA 2VUYA 1FFRA 4AXNA 1XH0A 3PTQA 1C90A 2OYMA 4AZCB 1HP4A 1R46A 4FMVA 5GQBA 1N82A 2WKLA 3WH8A 1J0IA 1A47A 1W9PA 4J3TA 2CKRA 1Q4NX 5JIWA 1VJZA 3OLIA 4D6DA 1TVPA 1HT6A 1KGWA 3PTKA 2JIWA 5IFTA 5HDRA 3AIWA 4FLRA 1QNOA 1W9VA 4PMRA 4EANA 3A47A 2ZE0A 1V0KA 2WZEA 2OWWA 2HVMA 3MMDA 1E0VA 1W9BM 2EABA 2FH6A 2WLYA 4PYSA 5DT7A 1UD2A 3SUWA 1W3HA 1W1PA 4MB1A 1GQLA 2Y24A 2WC4A 2XWDA 2ZXQA 5JUVA 1PAMA 3CZSA 3G6LA 4RE4A 3WKZA 5I2UA 1TA3B 2VZTA 3W0KA 1MYRA 2XVLA 3ZM8A 5LYRA 1ISYA 2WW5A 3IJ8A 2YA2A 1LL4A 5A6BD 1V02A 4PMYA 2DSVA 2Z1KA 4KRTA 1BF2A 3BVVA 4DUWA 4BS0A 3UCQA 4M1RA 3GM8A 3DDFA 4X0NA 5IDIA 1EHAA 4UQ9A 5HNNA 3HZ3A 4UCFA 4LQ1A 5ECUA 3VVGA 4BQ4A 5F7UA 3NIYA 4U2ZA 3ARZA 1HKMA 5HPOA 1UKPA 4W8BA 1SFSA 1HKJA 2YFNA 4CVUA 1MW2A 1B9ZA 3WF3A 3L4YA 4CGTA 1Q6GA 4W8LA 3OLDA 3LRMA 4HU8A 2ZICA 4GQRA 1XH1A 2J47A 4D6EA 1JZ7A 4TTGA 1BSIA 2NT0A 1QNRA 1DP0A 4LPCA 1LL6A 2EADA 1U2YA 1XC6A 2CXGA 3I3EA 4LYPA 3ARVA 4HMCA 4PTXA 1TE1A 1UWSA 4J3UA 2J8GA 4AZ6A 3A4AA 3MV01 2FGLA 1FH7A 3H53A 2WMIA 4TVCA 1DWFM 4WLCA 4UR9A 3VDCA 5D8WA 1Y7VA 1NP2A 2W4XA 1E0XA 4H7VA 1TZ7A 1UR1A 1QNQA 3ZIZA 1E4IA 4P8WA 4AISA 3WNKA 3CMJA 4ZXOA 5GNXA 1LWHA 3O6AA 3WUEA 3GYCA 3K4AA 4P7QA 2EXOA 3NSXA 4ZFMA 2DT2A 1FHLA 3LXAA 1DWAM 4DO4A 1FHDA 1EDTA 5JIPA 2A3HA 3DYMA 1ISWA 5LA0A 2XSBA 4K68A 3A23A 4AZ7A 1J0HA 3BAXA 4YPJA 2J77A 1TUXA 2VOTA 2J78A 1QI2A 2F8QA 4LYQA 1TMQA 5I0DA 4CU6A 3WEOA 4AMWA 1KXHA 2GJPA 2WWCA 4AEFA 1OD0A 1FH8A 1X1NA 2A3CA 1C8YA 1QW8A 2ZXAA 3MSDA 4MAVA 1HN1A 3EYPA 5DT5A 2D3NA 1PZ2A 4WSKA 5A6AA 1QNSA 2E9LA 3CHEA 3GXTA 1S46A 1RD6A 4BQ2A 1KGXA 1WDRA 2XIBA 2F7RA 1GNXA 5M03A 4AD4A 1GVYA 2NT1A 3EDFA 1U30A 2DH3A 3VGFA 1MQRA 4AD3A 1UOKA 2FDMA 3D50A 5HXMA 1UD8A 1B2YA 3NUKA 5DFAA 1TVNA 1WP6A 4UQAA 3HJEA 3TV8A 4ZE4A 2VR4A 3KL3A 4CCCA 2XN2A 3FHAA 4TXEA 5JBFA 3AMDA 3U7BA 1KCLA 1QHOA 3WDHA 3SCOA 3D5HA 3EMQA 4H41A 1MW0A 5CPTA 1KQYA 5C71A 1XSKA 2VX5A 4AZIA 1ISVA 1WE5A 3BC9A 3BVTA 4YHGA 2F7PA 5BXPA 1H09A 1BLIA 3CUHA 1JYXA 4V2XA 2XN0A 4HOWA 1LF1A 3WD3A 3BSGA 5E6YA 2Z1SA 5CGTA 3NSMA 2XJ7A 1YQ2A 1BVZA 4H2CA 1B3ZA 2G8ZA 2YIHA 1OCQA 2OSXA 4QCEA 4J3WA 1MW1A 3EDEA 5BXSA 3BH4A 3B9AA 1UZ4A 3FY1A 1JI1A 2QPUA 1US3A 2W91A 4W87A 4J7RA 1UR4A 4BA0A 4S3JA 2VX4A 2JEQA 3T09A 5ABGA 2WYSA 2J7CA 3HU7A 4JKKA 2PWDA 2DGAA 4UFMA 1WAWA 3K1DA 2W5FA 3UETA 3UR7A 2GFTA 3WQ4A 2V3EA 5A6KA 1JZ3A 1V0NA 1XSJA 2CYGA 1UKTA 1P6WA 4PSRA 2VRJA 1QHPA 4AD2A 3OZPA 4WK9A 1J18A 8A3HA 3CV5A 2VRQA 4HMDA 4BZYA 4PMXA 1TG7A 5C70A 1JDCA 1V6XA 1EQPA 3CZJA 4AD5A 3PHAA 1C92A 1W1YA 3BVXA 2ZX9A 5CZKA 3PZUA 1OM0A 3VUPA 3WDPP 4AY1A 3MUIA 2DEPA 2BV9A 3SURA 3HG2A 3WUFA 4AEEA 1O6IA 3VDAA 1G1YA 4ZENA 2OYKA 3VGHA 3IK2A 2ZXDA 1SZNA 2XFYA 1Z32X 3LPPA 3M7SA 2V38A 4D1IA 3GZAA 5EB8A 3UG4A 3VINA 5A8PA 2ZUUA 5FL0A 1LG2A 3L4VA 3DX1A 1OWQA 5A2BA 4HZ8A 4F8XA 3BLPX 3WEZA 4AIOA 3CTTA 1AMYA 4Z2KA 3EDJA 1OGGA 1JAEA 3AQUA 3TOPA 4Q22A 1W3LA 1K9TA 4TTUA 2O9RA 1MQQA 4CCEA 3BUQA 2OSYA 4FK9A 2IGTA 4MAZA 4MJ4A 3L2MA 3DX3A 4JFWA 4P8VA 1XD0A 3M46A 3L4XA 5CPSA 3ARRA 2QPSA 1E56A 3A24A 4HU0A 2DIJA 4E8CA 5CSYA 2WXDM 2D73A 3N17A 3SCQA 4NRSA 2NW0A 1R7AA 4B3KA 1MFVA 2OW6A 2PWFA 1CXEA 2PC8A 4NRRA 4AZ5A 1RP8A 3BVWA 5I3DA 2Y8VA 3AZRA 3VD4A 1EGZA 1UQZA 2VI0A 1VFUA 3EDDA 2G4FA 3GNPA 1RPKA 3N11A 3VD7A 3WSUA 3FHQA 3WFZA 4B16A 1CXKA 4UQEA 1HKKA 1KQZA 3WUBA 4AC1X 3D4ZA 1KTCA 2VJXA 3AYRA 1UD3A 2Y4SA 3ZT5A 5EBAA 5CLTA 1EOKA 2VZOA 2YA0A 1TQUA 3BMVA 1CGWA 3IGUA 1PJ9A 1CWYA 2G3NA 1I75A 1J9YA 2WNWA 3AS3A 4AD1A 3CPUA 3LXCA 4M81A 4JFUA 3AIEA 1EHNA 5I79A 3KL0A 1XYFA 1E15A 3OA5A 4NXKA 3LX9A 4CD4A 4HTYA 4XUYA 4Z2GA 4L4PA 3MSGA 1R47A 4NXSA 4MB4A 3W37A 3GXMA 3S5ZA 2F1BA 2WBGA 1KXTA 2DDXA 2ZOXA 1E73M 5FL1A 3VU2A 4W88A 1LWJA 3VGEA 1V0MA 3UEQA 4CN1A 4WIWA 4GO8A 2F7OA 5CJ5A 5A95A 1V6WA 4MNMA 2VURA 4HA4A 2J4GA 4JL2A 4TUFA 1HTYA 2X09A 1QI4A 1TQWA 1GPFA 2VTFA 2PWGA 1J0YA 5HOSA 2CBIA 3F5KA 2C0HA 4NZJA 2J7HA 2G41A 3VTRA 3RM4A 2BXYA 3W27A 3E1F1 5KZ6A 2F7QA 2OSWA 3VM5A 4UFIA 2CCRA 1BVNP 3WNOA 4PUDA 1V0LA 4MPKA 3SCSA 3UG5A 1EA9C 1QBBA 3ARUA 1LQ0A 3TTYA 3VPLA 4D6GA 4OKDA 1HWWA 5M17A 2J7EA 2EJ1A 3MU7A 1U33A 4UOQA 4FNUA 3CIVA 5D9NA 3UESA 3WH5A 2WAGA 5BWFA 4RE2A 4H8HA 1W9UA 1JGIA 3BAIA 3GTNA 3ZOAA 4NF7A 3NYDA 4V27A 3BCDA 4IISA 1NOFA 4M24A 4CU8A 4ATDA 2BNJA 4MDOA 1DWJM 2CBUA 5A69A 3DYPA 1G01A 3HMCA 4RL3A 3PBGA 1ECEA 2D1ZA 2X8RA 3BVUA 1QBAA 3A22A 3S5YA 3BAWA 2EPNA 2XPKA 3AOFA 2WLZA 2DSZA 4FF5A 2CPUA 5M5DA 3DX4A 3WNNA 3TP4A 1E4LA 1HX0A 4QLJA 1HXJA 3DX0A 1NWTA 1OSEA 3WH6A 1MFUA 4UQDA 2YDQA 4AD0A 1M53A 2VMFA 1G94A 1ZU8A 3ZSTA 2ZUWA 3CGTA 3N12A 5AY7A 4CU7A 3AIRA 2WCSA 2DSKA 3MMWA
chains in the Genus database with same CATH superfamily
4EN3C 3PNWA 1LO0L 1CGVA 2VNCA 4UAOB 4FXLA 3MJ7A 4M1CD 5GGQL 5SX4H 3AHYA 3NIDE 1FVEA 1QO2A 1U8PA 1RR2A 1K6QH 1NDMB 3E6HB 4JJOA 1FFPB 2VZSA 4JTJA 4AIUA 1NFDF 3ITXA 3R1GH 4ZFGH 4H6RA 4CQ9A 3HMXL 1QATA 1J05B 4PJEB 2NCMA 2UYLB 3FB6B 2D20A 1F61A 3MSRA 4PJAF 5MERB 1IXPA 2JK5A 3HS9A 1AMXA 4I13B 5C0EB 4G1NA 3SCNA 1S5IL 5INCA 3S5OA 3MTXA 3WQ6A 4Y4HC 1TT6A 3HC4L 1MEHA 4NYLB 4Z7NE 3KR3H 1IEHA 2BSRB 1D8WA 1HUVA 4E6MA 1P5VB 1ML0A 1XF5A 1BXXA 2ZYIA 2NW3B 3L95B 4LVAA 1KTLB 4UOJA 1FL3B 3QFDB 3C60D 4TUOB 5D03A 2AW2A 2PN5A 4JX5A 5JQHC 1UWRA 1BAFL 2G60L 2DDQL 2IANB 2XA3A 4DAGL 4WZHA 1HGWA 2VQ4A 1P6BA 4FABH 1XFCA 4QOKE 4UM8A 1EFXB 1N8ZB 1S9XA 3D6GA 4HHMA 1O94A 1NEZB 2L5HA 2OMWB 3MACH 4QXGL 1XQ4A 5E6RB 5LGHH 1TCMA 4Q8OA 5C7VA 2F19H 4W4NA 1PNDA 2L04A 3QIUA 4ANVA 3TYAA 1E7VA 1E4WL 3FO1B 5INDA 4QDMA 4TR9A 4Y4HD 1TNMA 5GRJH 3EGDB 2HKFL 1OF2A 1PO9A 1LORA 2CDEB 3P93A 1ZXKA 1SN5A 2WKOA 5GHWH 4Z7VA 4MVBC 3ESOA 1DYZA 3MLXH 4QYAA 4PMOA 5K93A 3BUDA 4XCCH 3S0PA 3H6OA 2O6CA 5E08L 3ZXAC 1F86A 1ML1A 4CQCA 3ALWA 3FT3B 2F9BT 3FUDA 5C0IB 5LXVA 1XWYA 3P77A 3GU1A 3SN4A 4R83A 3THCA 1YJDH 1ZV5A 5L9DH 3UJSA 3CQ0A 4TULL 4C65A 5FGBA 4RNHA 1Q1PA 3MCLH 3NYZA 5LBSA 3VMNA 1QOQA 3ZZLA 1S1PA 4MA7L 4H4IA 2XQBH 4M5YL 3PS7A 2VDKB 2FUQA 1Z6JT 2QHLA 2VO8A 2WWNA 3HAEA 4MCYB 2IFFH 1JPEA 2KLTA 4RAVB 4JZJA 1YNKL 5DJAB 4ERIA 1ZS2A 4G1MA 5CFAA 1DXFA 1P0KA 3M0LA 3M1BB 4AC4A 2AKRB 2WLIA 2O6FA 3DRTB 4HJUA 4FIRA 3UH8A 3T05A 3WIJA 4IMFA 4AGMA 3ZKSD 3G0SA 5A43C 3R4IA 3NFSH 3BSZH 2HA1A 2J56A 3IKCB 3QZNA 4LMQE 4NM8L 4Q6IA 4WCYL 3SJVE 5TPWH 3TA3A 3UO1L 5IFHL 5KSAA 4JAWA 4MXVF 2A1WL 4D8PB 5JNYA 3B2UC 2JELL 2G3IA 3WJZA 2KQMA 4DJDA 1UMLA 4HJIA 4JFZH 4PGCA 4RISH 1NMAH 2JV6A 1WZ1L 4U1IB 3P2TA 3VSVA 5J6HA 2XG9A 3APCA 2YXGA 3CC1A 2D4FA 4PJXB 3ARYA 2DUAA 3FULA 1MAMH 4FEIA 4EOWH 4G3YH 4HKJB 3LB0A 4AQLA 4PWJA 4JRYD 32C2A 1NDWA 2G3FA 4GKLA 1R75A 4NERA 4XP4L 5HR7A 5AW4B 4O1EA 3OWEA 2XQYK 4HC1L 4GJJA 1NTHA 5LO7A 5F4WA 1PIGA 2NXYC 3CXDH 3ABLB 5F8QC 1P1MA 3DGGA 3HR5B 3EO0A 3MV8A 4HPYH 1KFEA 2CAKA 4JPKH 4FABL 5U4NA 1ZBKA 2GCYB 2QZQA 1X5ZA 3REVB 4KKAD 3VNLA 4BWWA 4QLWA 2WKGA 2VR7A 3UTPD 4MY8A 4B2DD 3R0KA 3QZEA 4P3CL 3HBZA 5IMKA 3LVEA 1TV2A 1QI3A 1YXYA 3KVMA 2ZCZA 1SEQH 1IFGA 2VYRE 3FQNB 3L0NA 2Y62A 2RQ8A 3QUXD 4OJYA 4YGAB 3WD0A 2ICWJ 2WSDA 1FZJA 4JY4B 2E9MA 3F58L 4XZBA 3RNDA 5K1VA 4XAWH 2MQCA 1KCRH 3OXRB 5DD3H 1DZ0A 1CDGA 3DGGB 3HR5A 2F38A 2HSAA 3DBXA 5D2TA 4PLKC 2AV7B 4FKEA 1AH0A 1E9LA 5EL1A 5HPCA 5F0LB 1VBGA 1WS7A 2KI6A 3MLWH 3T0WA 1OF8A 3W2DL 1RZKL 3HQ1A 2QPEB 3LKOB 4JG9A 3W1TA 1T1ZB 4P5MA 4ZAKB 2NNCA 3OGOE 1AZ2A 2VW7A 3T0ED 1B4RA 1F4HA 3CV7A 1AJ2A 2NRDA 5DFVC 1T5XA 4C7GA 3Q65A 4N0UB 3W2DH 2OLHA 5BOFA 2OLDA 4Y2DB 5I3JA 1KBWA 1S9WB 1UCTA 1FWEC 1NTDA 3Q6FA 2DEYX 1QEWB 2J5WA 3DURA 5A2AA 5KSBB 2PYEB 4CSZA 5CIPB 5I1GL 2WMKA 1VFMA 1CXHA 3CCHB 1D5ZA 1HL5A 5DJ0A 1CC3A 3VGGA 5XINA 4B5UA 1TIWA 3WD4A 3B2PA 2R1XA 1T4KA 5CEXB 2QZRA 3CFBB 4BKLB 2CO1A 2YD2A 3HBGA 1FG9C 4KRPB 3LHTA 1JZ5A 7REQB 1RZ8A 3KTXA 4H8UA 3B5TA 1VZGA 2QEJA 1M7UA 3FT1A 4TRPL 5JIMA 2DVUA 3FVDA 1B30A 5L8KB 1UKQA 1RIHH 1JTPA 2PDIA 3WK2A 1B6DA 3A6CL 4RVBA 3AC0A 3UYOD 1G84A 1DSFH 4AMKH 1RULH 5GGTL 4ELKB 1CD8A 4P5SA 1RV8A 1V3IA 5EC2B 5G2NA 1T03L 2ADJB 4YZWA 3NGJA 1Z3GL 4FQIH 1IKOP 2GGJA 3FOMB 4MS6A 1XF2A 3S96B 3IU4L 4FFVD 1BGGA 1MZRA 3WY2A 3CLMA 1ITBB 3UJIL 1TFVA 3UU0A 3MCKB 1KIQA 5MENE 2W88A 1X5MA 1RBOB 2JJTA 5FJTA 3PAJA 4GBUA 4AEHL 4LRTA 4Y16D 4O2EA 2R0KL 1N5AB 3OF6D 2ZCLH 4LYQA 1E6SM 1OSYA 1GZPB 1N67A 4H0HB 1UD5A 2DLIA 2GCYA 2P7TA 2Q86B 3KJ4C 5ILTH 2PDBA 1SHXA 3GR4A 4UTKA 3K80A 1N3NB 4A7QA 5HNTA 2ZWYA 2IQTA 4BUQA 1G7QB 3SKMB 4D9PA 2H9GB 3LSOB 2D0HA 4LU5H 4ODHL 4U1LB 5DRZA 3M6YA 4OTXH 4LDEB 2HG5B 3Q8CA 3KPNB 2MNRA 5DBUA 1DBKL 5LA1A 3QHZL 3VXSE 4ANWA 4HVBA 2X0UA 1KCUH 3D09A 1UP0A 3E49A 3GSUA 4QGCA 2PGEA 3QUHA 3R0DA 3L1OL 1UTDA 1KXQE 3KCPB 3GUGA 5A3HA 1UA7A 1QX1A 2IAMD 5C2GA 2HJFB 1NAMH 2CLZB 2FO4B 2YAQA 5FW7A 3BX7C 2IOMA 5ANHA 3IF1A 1BWVA 2HXAA 4HJGA 5GS0D 4B3ZA 3G5XA 3EHBD 3LNPA 4R8WL 3RZCC 3T3PE 1UZ8A 4JE0A 2Z0UA 4IOFD 5HNUA 1Z7JA 3L9EA 4Q7NA 2G0KA 3SKNB 4TNWF 3TMQA 1QR1A 4QTIL 3BVDB 4L18A 3AT0A 3SDDA 3TTOA 2X2YA 2QJMA 1S7UA 4HS8H 4V1DE 1E5UI 3ZQXA 2P24A 5E9DA 2AABL 2Z91B 5GHWL 1KEGL 1OFEA 2P76A 5E56A 3KEDA 3NCMA 3PLYA 4E9YA 1CMOA 1NGWB 3PWLA 4DSYA 5AW9B 1G0XA 1UACH 2CGRH 4N68A 5LLIC 1TTQA 2WWMD 3QXTA 3TA3C 3ZJ6A 1A3RL 1N55A 4G6JH 1HAWA 2E27H 3VXRA 3T6QC 2B2XH 1CR9H 4IU3A 4K07A 3RZCD 3KBSA 3KOWA 3IWUA 2JEPA 3TZVC 3VGDA 3QY7A 3RO8A 2AXFB 4HFWA 5C0GA 2ALRA 3M41A 4HPOH 3QPQD 2VT0A 3EOBA 5D72L 3TWYA 4QGYA 2BGQA 4LAKA 1NZRA 2D24A 2Z4GA 5DK0B 3NK4A 4GOSA 3UOAB 2ZJSL 4LLQB 4XBPA 3CN2A 3N9KA 3V4VH 3MLSL 4GJTB 3FO2A 2P3EA 1VPQA 3W1QA 3L5XH 4Y5YA 4HMEA 3NQKA 1GOIA 43C9A 4Y1TA 1P6AB 3ATAA 5ISZB 3L1GA 5DURD 2QCGA 3EFOB 4FFTA 5H4YA 2EP6A 3GSVB 3KJ4B 5FDWB 3L3HB 1EEYA 4EI5D 3EZ8A 3C6SB 3AAZA 5DS2A 1GJIA 1MMFA 1NF7A 1YEWA 3II1A 4GG6B 4LCSA 1A1NA 4EACA 5PCYA 4DO5A 1ET5A 3COOA 3QDGE 3QI9A 3KAOA 3M5VA 2AERT 5DO2D 4RV3A 4ZFZB 2F5AH 3E80A 4EIBA 4ENEC 1MFBH 4KJYB 3N06B 4JIEA 1R5WA 3PP4H 4ALDA 4EWJA 1QSFD 3ULUD 1ILSA 3RNKA 4OZ4B 1M7DB 3PZIA 4J6RL 4KJWD 2O9OA 3AS0A 3T40A 1GOHA 4HGWB 4KMLB 2FZ3A 3LPGA 1F8TL 3ASOB 2Y06L 5CSBA 5C9JB 3RTLA 3GSVA 5EA0L 3GGWB 5ENWB 3IU3B 4PJEF 3ZBMA 1E6PA 1YEKH 1FP9A 3JVAA 5DZLA 1UBPC 2WIIB 1GH7A 1OWRM 4K9EL 4YFLF 3HGSA 3KDPB 2CGYA 5BXTA 2GITA 3QZOA 1TETL 2PWUA 3CFKB 1KGUA 3BPLC 5IJBC 2DP3A 2R24A 3OC5A 4XMKL 5D30A 4BK9A 5BUAA 3IJHA 1UPPA 1K9EA 4WI7A 5DCEA 2VR6A 2FL5B 5E6IA 1A6AB 1NQ6A 1U9KA 2MPAL 4GD0A 4O15A 4W85A 4ZSOE 5C0GB 5LNUA 2GJXA 2P8CA 3T6CA 4ISVA 4I0PA 4BEQA 1AXSB 1KJMA 4G1EB 4ZS7H 1MRDH 1W9XA 4PW3A 4XAGA 3WNPA 4JNXA 2F8OA 3C5ZC 1H62A 4NAFB 1A9EA 3AG3B 3PWGA 1JRHL 3KPOA 4GW5A 5CMAB 1UROA 4M3PA 3PPEA 4HOZA 3HB3D 4N2NA 4WJ5A 2W0FA 2ZXGA 4KK9C 1PZDA 2D3LA 5IBTH 3F03K 5KJRL 1KV3A 1INDH 2E4TA 3K8LA 1KJ2L 3RY6C 4ASTA 2ZZ2A 3C2AH 2PGFA 3DO4A 3B3IA 3LB6D 4LBAA 4NC0B 5T1KD 3O06A 3ARBD 3P5YA 4U5IA 1IGIH 3ZIYA 4XGZB 4LC6A 3MGOB 3QARA 4RA3A 5J56B 5EF3A 2WO4A 2H6OA 2BMBA 3IUDA 1FQ9C 1JTTA 3NGFA 1MSSA 3NL5A 1ZVYA 3CU7A 3RY5A 5IBUB 3S4TA 5FIPA 4PJ5E 4JREB 7TIMA 1G7MB 4C6QA 1TYRA 4HJJL 4TVPD 3IANA 4O1FA 1J11A 1XGRB 4XP9H 4X6EB 1CNVA 3HE6D 2Q76B 4G42A 2F8XC 2QCCA 4Y5YB 3T7VA 1FGVH 4LDCA 4AQEA 2HKHL 3V52H 5IFAL 3HFML 5MERA 2O5XH 1ADQA 1TITA 3CSYB 4XNQB 4XMZA 5BQDA 2DH2A 3CQFA 3QGAC 1R3IL 4C59B 3QPZA 3TUUA 2V7HB 3IVKB 3BEWA 3S36X 3P9LA 2J57A 4Y7EA 4UZSA 2Z8VC 1DEEA 2DWEB 1LHZA 4UILH 3C5SA 5JLZB 3UPRB 3VI4A 3QPYA 2NNAA 1T21A 3D3FA 3VABA 3PSWA 3FQTB 1DFXA 3A3HA 4ZT1A 4YSUA 2OKTA 4BFFA 1A9EB 3D85B 1WPCA 4ONGH 3VD1A 2C26A 4PGBB 5I24A 1DWGM 3N1AA 1A7PL 2YPLE 4N26A 2JNZA 4PLJD 4YXGA 3FPYA 2IQDA 1WISA 1KUMA 3BFWA 2RALA 3A6BH 1N18A 4I0PD 5F3BB 1MUCA 2OZNA 4PLKD 2JCCF 3MYJB 1Q85A 4Y5XB 1MRDL 5C07E 1M1BA 3CUGA 1F1DA 4Q8TA 3QEUB 5LNSA 3OMNB 3P74A 4GUJA 3R4DA 2GZXA 1DDTA 1S5HB 2JB5L 3DN5A 3UCCA 3UC0L 4JO3L 1A1OB 3V0HA 4BK4A 3VI4F 3TFCA 2VC9A 2AQ2A 4GSUA 1FFTB 4J3SA 3F2BA 3NCJH 5KVFL 4YVXA 1Q65A 3NJ3A 3GIPA 1DANU 1EUUA 3QVAA 1KD0A 1A02N 3PWNB 4BFAA 3ARTA 4DF2A 3BKMH 4EPKA 3SRDA 1LDPH 1XT5A 2WB1A 4L0YA 1UR2A 2P3YA 4JFPA 4LEXL 3WELA 1A7QH 3E8UH 4NBZB 1NARA 1F3DH 5D7SH 1XUZA 3FSVA 2O56A 1F45A 1U8LB 4I0PC 3LCHA 1WB0A 1I1AC 3OC8A 4B95C 1FWTA 3IRZA 3EIFA 1F3XA 5E0FA 1XGUA 3CDYA 2PP9A 3JV4A 2BMKA 5LG1A 4Z7OE 4WUIA 1MCFA 2NNRA 2CLIA 1H3XA 4UT9A 3W72A 2AMGA 1CVRA 4ZS7L 5E2WH 3MXWH 4CW1A 4I77H 3GVGA 4N2DA 4GPVA 1YYAA 5ACZB 4BCEA 2RJGA 5IREA 2OOGA 4KV5F 2Q86A 1PKLA 2J1ZA 5I8CB 3ATDA 1ODUA 3T0EE 3CMOL 2NR6A 3QUXB 3I6GB 4P4RB 5HJ3B 5AAWC 1N8WA 4EOUA 4PBGA 5E2WL 1XGPA 2XXMB 3QKEA 1Q63A 4XQ6A 2F6AA 2WB5A 2ZUSA 2F53E 3PTDA 2VLRA 3ARXA 5FF7A 4CNOA 1WVZA 5K3VA 2XVNA 3RX4A 1F8TH 5D7SL 3E6FA 2O0TA 5DVMA 1MCPH 1MLCA 1MUJB 4F0SA 4P2OD 3U1PA 3O2DL 2O92A 1RK1A 1EJOH 1U91B 4Y4KC 1RU9H 5DJXA 1OFQA 3AWGA 1P1ZB 3BP4A 4WTZA 2XLLA 1BMGA 4G6JL 1IR1A 5BV7H 2XSXA 3PNRB 1ZPLA 1YXCA 4PYGA 4BH8B 1SPDA 5IB2B 1XF3A 1R3VA 1NC4A 4NZTL 4F2MA 1H5BB 4AVOA 2RH0A 3MRKB 4ZTPL 2EH8H 1NDGB 3JT0A 1E4XI 3EOAB 4UQCA 1EX5A 5C6MA 3ZL4H 3SDDB 1CIUA 4XPBH 1SHSA 4R7DB 3BIKA 4NN5C 4RDBA 2MCG1 3BAYA 3ID7A 1J0KA 2IOIA 3N6QA 4JTHA 4RMRA 2HVBA 1FY6A 1X4ZA 5JDSA 4DO6A 4HDIA 3KOXA 1BXCA 5IHSA 4GZEA 4XSLA 4OAWB 3BCFA 1T0OA 2C9QA 2W81C 4OZIB 3E12A 3TZVD 3MVTA 4QGTA 1C7TA 1P4UA 4WEMB 4GMTH 4OAWA 1Z8AA 2QV5A 3GBDA 2YPVA 4ABWA 5HGHB 3RRXA 2B15A 4FFZA 3P67A 4W9FC 1REQA 4EZJA 3X1EA 3WY3A 5EO9A 4OIBA 1CEOA 5DMKA 4XIAA 1ZTXE 1ANUA 4HETA 4DP1X 5HMEA 1JGDB 1EDYA 2G3ZA 1E1CB 1OADA 2HQAA 2RDXA 1UB6B 3CZLA 1QR4A 4X6DB 2PO6C 3V4UH 3LI1A 4AITA 1GTFA 4ODXB 5EDSA 3A4EA 2NZ1A 2WZAA 1Y1UA 4JKLA 1MNUH 5IOKA 2FHFA 3GSXB 3FS2A 2WXPA 3N04A 2X6AA 4FQCH 1I1AD 4CN4A 4IOSD 5JBDA 1VESA 3TNNA 4P3WA 3SJNA 4LUTA 1AANA 3ABKB 1KIRA 4FNRA 3RIAF 1N2RB 1Z41A 4MDJA 3T0DA 3IV3A 3FOMA 4N9GB 2BFVH 3H55A 1DIOA 1IBGL 1WA1X 1U8QA 4KI1A 2OL3H 3FQ1A 4PUBH 2OULB 3ZDXB 3NDYA 3QYQA 4I9MA 3CSPA 4B5VA 4CC4C 5E95B 4G11A 2X1IA 1RZ7H 4P7LA 2J1WA 3VG0H 4KRMB 3BH8A 3KDMA 1TTRA 2XRAH 5BYWA 4RMSA 3U4EB 1PZ0A 1HJQA 4HH9B 4FQ2L 5K2ZA 5AAWA 3ROOA 4PJXA 1TZHB 2JTDA 1CTOA 5ECGA 4M7JH 4GI9A 4N6RB 2YD3A 2GJNA 1TWZA 4QSHA 5I78A 1ITUA 5IV2B 4PJFB 1AUSL 2ZBTA 5FM5M 4X61A 5HYSA 1QFWL 3G9AB 1GZJA 2EDMA 3S48A 1KRAC 3SCMB 3ECBB 4P2RA 2ICEA 3FFOA 4NNBA 3SDAB 1B9BA 4R6UA 4QNWA 1VLXA 3PIQA 1WCGA 3CWHA 4D0CA 1Q38A 5EN2B 1RFDH 1UM5L 3LCIA 4P4KB 3FEMA 1ETZB 5KYXB 4W9IC 4GMSL 3NSJA 5JDSB 1CL7I 2D7PA 3MRLB 2JCCE 3QHFH 4GO9A 3ARSA 3TBBA 5ID1A 3D2UB 1BYDA 1J2WA 2J9XA 1QWNA 5D5MF 5KJ4A 2AC0A 3NEEA 1KEMH 1FL5A 3HMWH 1LQSR 4D94A 1MEWA 3GSOA 4LCWD 4LRNL 5AYUH 1OYCA 4B15A 4AYBA 5FUZL 5CF3A 3DYOA 5SV3A 3D33A 5I1EL 2JH2A 5A6SA 4U1JB 2PETA 2RA1A 4ZB5A 3FT3A 1IM9A 5BPPA 2ATAA 1TU2B 3DG3A 3B0YA 1KGJA 4QRPB 3FCSB 1TEGA 3OG2A 2FO8A 5TD4A 1OFBA 1YUHB 3KPRD 3MOQA 2DPEA 1ZPTA 2ZP8A 1A5OC 5BOEA 4FNLH 2Y2YA 3GD1C 2PXYD 3ZTNL 2OPCA 2CXEA 2DZBA 3LIZH 3LNEA 1JN6B 5D5MA 1E9ZB 3BSMA 4P2QD 2X12A 2MNUA 2VDRL 3QHTC 2FTWA 3B8DA 5AVNA 3GMMA 3QEQE 3X11A 4Z7WB 4HXBH 4LBUA 2NUWA 4UT6A 1QFUH 2VLLA 2HFFA 1BHGA 4BFIA 4TOYH 5IIEB 2X4NA 1DQLL 5B1AB 2YLLA 5DMLA 1WCQA 4DJFC 1M3UA 1UKOA 2JF6A 2F74B 3ZN6A 3GIZL 4PMFA 1Y5VA 5ABFA 4ZA0A 5LGJB 1IBZA 1YMHA 4DF9A 1V8EA 3C2FA 3OPZH 2W79A 2H26A 5E2UH 3MCOA 1EXUB 5DWUL 1XSIA 25C8H 4PJ5D 2EDEA 2GTWB 4R3UA 1K1DA 1R86A 1I8UA 3P0VH 4OZGA 3F6IA 1NCAH 3GBEA 3O3UN 1L3WA 1U8LA 3TA3B 5CQ1A 2RACA 3HB9A 5BO1L 2GHZA 1VHNA 2C7FA 1W0YT 3NDZA 1BQHA 1OGTB 1TMCB 4LLAA 4ZTOH 1E5CA 1RXOB 3RWIB 4YSCA 1MI5D 2FPYA 3VVWA 2PRMA 3PJTA 3OG6B 3NFSL 3ZE0E 5T3ZH 2G3XA 2H8XA 4ZSTA 5AWNL 4YDKH 2WK2A 4LPUA 2AJVH 2EIDA 2CMRL 4YOKA 5GGVL 4DVRL 1E50A 7FABL 4FPSA 4I8DA 3VOIA 3DKHA 2OMXB 4Y9AA 4JRLA 1NDMA 4UCGA 5DF0A 2PTYA 3ZVIA 4MAUH 1WXYA 1DIKA 2J21A 3ZR6A 1JPKA 5AZUA 2MTPA 3AJ7A 2B39A 4QMEA 1QP1A 4GUGA 4XWGH 3KS0J 4PCFA 3L2LA 2ABBA 3FF8A 5G5IA 1LL1A 3HZMA 2ACSA 2RAMA 5DJ2A 1RY0A 4LCWE 4Y4FD 4XNMB 4YS1A 3V1PA 5DK2B 3KLAB 2J7DA 4PW4A 1DBBL 1R24B 3C09C 4FC3E 1LD9B 3SDDD 3WGVB 2DI8A 4AE1A 4A8NA 4JG0L 2ZA3A 4MFEA 1E8WA 2XPZA 4D9LL 1NL0L 2G2RB 3TEUA 4NFBA 4L8CB 2WOYA 1BXBA 2Y25A 1DBKH 1PTZA 1Q8JA 1RY7B 3CFKA 2FT8A 2A4EA 2ITEA 4DY1A 4JO8A 1HQRA 4NM8H 4WCYH 2HPMA 3VD0A 2WCAA 4NKCA 3VNYA 1S5VA 2YRBA 3UIYA 3R89A 3EWYA 2F61A 4MA1B 4LUSA 2BNRB 4GVIA 4O10A 5CD3A 3FCPA 3WDQA 2V2XB 3L4WA 1KYAA 2ZCHH 1DQQA 1H3PL 1WIPA 3QG6A 4Z1CA 4OFQA 3TBSA 4O19A 3GJEB 1ECQA 4F15C 4U7SA 2UY3A 4FKKA 2G37A 5FKAA 3QDGD 3IEBA 1NIUA 4F9PC 4AG0A 3QG6B 5CBEB 4PTMA 3V6OC 3BO9A 3Q05A 4DUOA 1ES0A 3BDKA 1G6RL 4HHHA 2C3WA 4RXGA 3GFXA 5L9DL 1PNCA 1Z3GH 4A2FA 2BSRA 4W6WB 2IWGA 5IUCA 2NW2B 1DBAL 3D39A 4HYTB 1GOOA 1E3FA 5E1IA 1BVWA 1ZGLM 5ID0B 1SO3A 2WQPA 3O6LL 1QAWA 2Z35B 4JE4B 3G3MA 4IMGA 1BFVL 2GJ6A 4PJGF 1Q6FA 4FCAA 4PIBA 1GS6X 3SZKC 1E5BA 3PB2A 3OG4B 2F54D 2X4NB 1V7MH 1LT7A 3CAWA 3U57A 3DERA 4OLWH 2DORA 2Z6IA 3IAGC 4LSBA 4PTDA 3SGJC 3WL0A 5EBWA 4NQVB 4MZYA 2CU9A 3GSNA 2EBNA 3QGKC 1J10A 4RGNB 1K9DA 3LZQA 4XCNB 5LGHL 4XXCC 3KL5A 5ESQA 4B5SA 3MRPA 1GQKA 3B04A 5EU4B 3PN8A 4S3CA 5RUBA 4JQIH 5F1SA 4DZBB 1ADSA 4RNRB 1JGLH 1VZWA 2BPBA 3FONB 4PJCB 5EOCL 3SPVA 1WYJA 4DK3A 4JTFA 3LY6A 2J6WA 3KD4A 4IEFB 4O16A 4F7TA 4NZFA 1I6NA 3T8QA 2VDKL 3EJZD 3VTAA 2B3IA 1IZKA 4B3EA 4GH1A 9XIAA 1FJ1B 1EO8L 4LIQH 4LLUA 5EC1B 3FRPA 2EYTB 3BKJH 4JQXA 1A7NL 2Z91A 1CGXA 3VA2C 1OKEA 3NACL 3GE7A 1VDGA 1R5VB 4WO0A 1LK2B 3GBNL 3WU1A 3EFFA 4ZFQA 5E94A 3WMBA 3LB6C 2JFEX 4XAWL 1A2YB 3UACA 1F3WA 4LGPB 4W8AA 1XM3A 2ZZ1A 1F6LL 1S5IH 4JUTA 4MQSB 4MVBD 1FL6A 1BQGA 1BD2B 3OQ3B 2OQYA 5T9BG 3H54A 1J5OL 2E1DA 4ZFGL 2W38A 4I18C 1JCVA 1XGTB 3DOPA 4PRBB 3ZDXF 2WAHA 3B05A 4DJED 5IB1B 1A65A 1WFOA 3N1GC 4OCSH 3SGDH 3R43A 5D71H 4XZNX 3AU1A 3OX8A 3AG2B 1NDVA 5AY7A 4XBKA 15C8L 4I6KA 2E7BA 1JRBA 5EEWA 1SYSB 4WKZB 2ZCHL 1DUYB 3E9AA 4DEWA 2UUDH 1I1YB 1RD5A 2R1KA 1QNIA 2NY2C 2DMHA 4MMXA 2XG4B 4WI0A 3VUSA 1X96A 3GDLA 1G7QA 3SKMA 1XLLA 4DBSA 5I23A 1IIIA 2QQKL 1HL2A 2E7HA 1KN2L 2KPWA 1MAML 2FIKB 3BWUF 3H24A 4C6FA 2F53D 1DV7A 4XK2A 4YCPA 4IHCA 1JXJA 2ZCKL 2XICA 3DOSA 2CDGB 3D46A 3PJUA 3S88L 5CEZD 2VR5A 3TO4C 3CIWA 3VXSA 5BXRA 3IK4A 2G4JA 1IC5H 3QF0A 1PG7H 4HX1A 4P2OC 2ICCA 3FB7A 4IQHA 5IQNA 5ETUB 3RTQA 2IOOA 4GPNA 2O26U 1TENA 4MCZB 2LV4A 5EBMA 5C0AB 3MYOA 3N73A 5AKQA 2J25A 4PM1A 3UZQB 1WUFA 3WL9A 3AALA 4AHOA 4F4RA 5LCVH 1ZOXA 2HRGA 4AKOA 1Z3NA 2NV1A 2ZUQC 2QR0A 3AY4C 3BL3A 1XCQB 2V3FA 2UVEA 4D6CA 4B3LA 4M5YH 4KKQA 4N2YA 3L9RA 1GMIA 4JM4H 1XF4A 1T1YB 4MB5A 1TOXA 3BHBA 4YDKL 4EIZC 1DE6A 3GC4A 3TFXA 1QRNA 1TVLA 1F6KA 2BCMA 2WQWA 4JD4A 1SOQA 4KWVA 4ZK8A 5C07B 4FYQA 2DQGL 2OZTA 1DQDH 3WIAA 1FOBA 2EACA 1WOAA 3H22A 4J4PD 4LANA 1H8LA 2YR3A 3EXTA 4GC3A 5GSRA 4K3JL 4PB9H 5FKYA 1USQA 3ECVA 4UTWC 1NCDH 3OGVA 4CN6A 3G5XB 4RMWA 4QISA 2DTML 1G4SA 3QKZA 3FSZA 5IMLA 3W24A 2VLMD 2P5WD 4BRJA 3PWVA 6ENLA 4U3XA 5G2WA 2ZOLB 5IUSA 3N4EA 1WBXB 1A25A 1MI5B 3IIOA 1CYWA 3UPMA 3OKKB 3APGA 1GSMA 1K7EA 3GSMA 4CBPA 4R96A 2I26N 1AD9A 4WV1A 4N90D 2RDUA 4P23C 2XBZA 1TX0A 3AADB 1QQDA 2NY5C 1QNZH 3HPLB 5I6LA 1TEFA 5MEQB 3OKLA 5DURB 4AT6A 1FA2A 4ZCWA 3BZJA 2HISA 1G6VK 1AK5A 2BWDA 4X7CC 2YBGA 3LH9A 1RCXB 2PZNA 2ALDA 3QAZB 1OLLA 4A6YL 1A0EA 2VUNA 3M64A 4XCYB 4QTHA 5JDJA 4A04A 2YPVH 1WWAX 3S6DA 1UBSA 2H6UA 3VTMA 4XMXA 4BA8A 3HM7A 4CD8A 4YHIB 3I4EA 5TJWK 4YJ5A 3O3EB 2ZRYA 2YGOA 4U7MA 1HVQA 3OPZL 2QSCL 4JEJA 2QDEA 3IJEA 1CE6B 4DK6A 1V7YA 3KPSA 1ED3B 5AB0A 3RHWF 2P5PA 2E6DA 4W7VA 5B80A 1T0PB 3HMXH 4Y2NA 4OT1H 3J8F7 1HAUA 1KV7A 2DZXA 4QDPA 2GJRA 2WVVA 2ZOOA 1HS6A 4IKKA 4WEEA 4GNKB 1HILB 4MAYA 3IKKA 4WHDA 4PB5A 1ZA6B 5KVFE 1SF5A 2VDRH 3QCUL 5DCCA 3DUGA 3SW6A 3W76A 1RZIA 1JNDA 2HFEB 2PO6B 4JFDB 1IM9D 4FI7A 4XTDA 1X9UA 4KGJA 3QQNA 4QQUA 2J55A 2QHAA 3KP1A 1KLZA 4DWDA 2IDUA 2OXHA 3FU7A 4MJ6B 4Z95H 4DOHB 1UWTA 2J8TA 2EEAA 3Q43A 3G1SA 3ULSA 3ARWA 3NQCA 2GUOA 4HZ1A 3QGVA 3MHFA 3QH3B 3AFLA 1XCQA 3AY4A 3VNMA 5DY2A 4KZEH 2C19A 1CGTA 4DHGA 3QEHB 3W71A 3GDKA 4D1JA 1QOPA 5D2NA 3MRIB 5H35B 2EXWC 5TH2A 1NQKA 1A6WL 4JFVA 1XRFA 2CKSA 4G80A 1DJIA 1X7TA 3ZO9A 3KGUA 1M9HA 1QMLA 1TPWA 1RJYB 7PAZA 4LO9A 3N6HA 4K8HA 4RZ6A 3WH9A 1OARH 3H3KA 3FFCA 5EF1A 4N1CA 4G80B 3VD2A 3EMCA 5MENB 4W93A 4RNJA 1GGTA 4FG6C 2ZF8A 3OKKA 3CHFA 1VYPX 1EC9A 3SODB 1BEYH 4UTAA 1LLWA 1Y5XA 2RCSL 4GW1B 3BDYL 4BBWA 3GLAA 5K4XA 4CD5A 1DLHA 3WHXA 5IROD 3NRPA 4PJ5A 1S5MA 3P84A 2FT7A 4Y4HA 4QAWA 4NOBA 5IBUG 3BW4A 4L7ZA 3GSXA 5AW0B 2AXGA 3FRUA 5F9AC 4OFCA 3W1AA 3QUYA 1QUMA 1QNPA 4F1SA 4NZRH 5DYOB 2Z27A 1Q9WA 1JSYA 3LKRB 1S1RA 2IAAC 5TE6L 2GGHA 5A3IC 3LBOA 4U0QB 3NWRA 1SYSA 5T5NF 3V6OE 1UYWH 4TNVK 4JFOB 1REQB 4C7DA 2L7JA 2XWJB 1WV7T 2O4EA 1GGCH 3LEVL 4X4ME 3WH7A 4H7CA 2MKLC 1MCNA 1OHZA 3HA0A 3IAPA 1LBLA 3PK7A 1NKGA 4O8RA 3B34A 1M1XB 3TM6A 1XICA 4U1IA 1ZE3H 5KBDA 3BUVA 5CU5A 4IRJA 4KPHL 3NIGB 3RWGA 3GR7A 2RDTA 5LHDA 1CDIA 2NNXA 2VAAA 1NH6A 4H5SA 1I9JH 3P7YA 4E41E 1HE8A 4HYRA 3T77B 1BOGB 4IP4A 3O3EA 3ML9A 1XLHA 1KULA 3C6LC 1IEVA 2V5DA 1NDGA 4KVPA 1I8AA 1PSKL 2ZRVA 1AYRA 2WBJD 3SJVA 1FHVA 2VEMA 3MRFB 1MCDA 2EYTA 4JFEE 4L5FH 2PYED 3PHSA 1H6UA 5FAAA 1U3ZA 1HG3A 4NRXB 4EPDC 1MHHB 1R3KB 1B4JH 3HEIB 5JORB 4B5ZA 4KWOA 4LT9A 1EDHA 3I75B 5D1ZB 2NVDA 3AI0A 2RB8A 4HZ6A 1DVFC 3UGUA 1DVQA 3OR6B 1RUSA 2EZ0D 3EJRA 4BZ2L 5BCAA 5E5MA 3B3BA 3AICA 2Y1AA 4D6FA 2VDLH 4M1DH 1FYTA 5E1AA 5AW5B 3RIFF 4DZBA 2FJHB 5GS2D 3THML 1LP9A 3MYZA 3ESVF 4J3OF 2H45A 2HCZX 3KJ6L 4QKXB 4WEVX 2ICSA 3G6AA 3Q8EA 3V4BA 4XVTH 5G5DB 5J4MA 3VNIA 4DM2A 2Q8BH 4A4AA 1Y1DA 3ES7A 3D05A 1A6WH 1MN4A 2A6JB 3FO9A 4FXJA 5IRPA 3C6LD 2ZWNA 3ZTCC 2Y3AA 5CBAB 1P4BL 1T04A 1MG2C 2C9XA 3NK3A 3OKOB 5EOTB 2Y69B 5TDPA 2J8UF 2NY4D 5HI4C 4NGHL 1EUTA 4A63A 4PI0A 4Q9CA 4YTTA 4R4FH 1ZS8B 3OB0H 3KZSA 1OCWL 2PF6A 2J20A 3T81A 2FX8L 3ECQA 3FL7A 3RJDA 1YHTA 4ZUTA 3VE7A 1V02E 1KCSL 2NDGA 4F15B 4GUQA 4X8JA 1RPUA 4PBDA 5KSWA 5IB1A 4OQ1A 4ZD3L 5K1NA 4O58H 4DGYL 5HATA 2POTA 4KJPC 4WWID 2DYPD 4TSAL 4K3EH 1UZHA 2Z8RA 1J1PH 3TNOA 3ICJA 3ALPA 4M6AA 4AVNA 4XNXL 3TBTB 3QRBA 1W54A 4PGJA 3DMMC 3GHPA 4RGNE 1F02I 2YKLL 3G6DL 3ZT7A 4CNIA 3CUJA 5HGBA 2ZP9A 1EAJA 2DM4A 4ZUTB 1RVGA 2VQ1B 2X16A 2HFGL 3NCFB 1W0VB 2L7QA 3WO4C 4J40A 3WL9B 3MV9A 4PUMA 1EIBA 4R4NC 1DN0B 1BVNT 4L1TA 4NZUH 4XAKD 3V8OA 4PUJA 2YLHA 1FHNA 2XC8A 1UVQB 4GIAA 4OV5B 1WCBA 4ERGA 1FRGH 5I00A 3RF9A 2P1YA 3R06B 2KZBA 2JB5H 3GNRA 2FBJL 5JVLA 1NPJA 4KROC 2B1AH 3D12B 4MZ1A 1WF5A 1EF2A 3ABXA 2NTSP 1UXMA 2OP4H 1EC7A 2OR9L 2BNQA 2H3NB 4MDIB 5I76A 1ICQA 4Q8QA 3S1WA 4KMQA 1WZKA 5DELA 4KHXH 3LNMA 4AY8A 4LSSL 4DYKA 4JCLA 4L8DB 1K7XA 1J1XH 3LMZA 4UMAA 4KCVA 2WBJB 5FUCE 1S9YB 5DJYA 3DX7A 5ICXB 1XX1A 5HY9A 3DU0A 5IWLA 4ONGL 4YHZH 1R2TA 3F4VA 3ASWA 3L3KA 3TT1H 1VERA 3AREC 3HHMA 3C5QA 4H9XA 1C9DA 1TJMA 3OKMB 4QRRA 3TA3D 1ONWA 5GGSY 1D3GA 1ZAIA 3LIZA 5IG7A 4K6AA 5IVXB 2VE6A 1BQUA 2VSMB 3O0RL 5FF6B 5F6HI 5KW9H 1OSPH 4ZL1A 5CP3A 2F6KA 1UGKA 1LP6A 4RX4D 1BQHB 3NCJL 5I26A 5CH9A 2GW5A 3BD4A 5KYUA 4N5ED 1T80A 4ZOEA 1A5FH 3H7RA 2XM2A 3IIZA 2PGWA 5MKGA 3P2DA 4MJIE 4JO3H 2QGYA 3GNML 2IBZY 4AIEA 1RKRA 4OF3A 4XB7A 3T2QA 3UYPA 4U1GC 2VKXA 2BBFA 1RI8A 2QDGA 5SWZE 4PB9L 3QHOA 5ITBL 3UAFA 2ZD0A 5JYMA 5CGBA 1UC6A 2DQGH 1XBZA 1XL9A 2O4QA 2VX7A 4WKAA 5DD6A 3GSRB 4YBLB 1FXPA 3GG0A 2FPTA 2CO2A 4UV4L 3ZRSA 4C83A 1SLWA 2V2XA 2KX9A 3T4AA 2PXYB 5GRVL 5L6YH 2HFFB 4KBXA 1HTIA 3QORB 3I6KB 1PBGA 1RHHA 2XKUA 3ZWSA 5T3XH 1ND0B 4ENED 3LSOA 4L0ZA 4FDWA 3O4LE 4QDGA 4P61A 4WOZA 4XHQA 5KJRH 1U8CB 4H88L 4DHLA 5CMAA 1WEJL 1BFOA 3U4AA 4YZFF 2FSDA 4DUXA 2NXIA 3CFCL 1KB3A 2YSSA 4OUOA 4ECNA 3E3QE 3O9WA 3VXRB 1BZ8A 3U4BL 1MJJA 4MG4A 4GLRH 3B9KB 2Z4TA 3MRRB 4NKOB 1O5KA 4ONFH 5FW6A 2GJXB 1NEUA 3EA2A 3EBVA 4LX4A 4RKAA 1I4FB 1QRNE 4AQAB 1BQRA 5MENA 5GNZA 3SCWA 5I1DA 3KHDA 4MB3A 4TX9A 3VACA 4Y1AB 1NCUA 4OCWH 4OTKA 2OQJA 3S3BB 3QJRB 3MRQB 2V2CA 3OVPA 4JGNA 4OWGA 4P4KD 2FDSA 2UWEA 2VR3A 4QWWC 4ZMQA 2K4AA 2O93L 4HS6A 3KOYA 3MRMA 5IQ9B 1ZTVA 4O53A 3D69A 4QHMB 4S1DD 1D5IL 2BJMH 2AJ3B 2GIMA 2X2JA 1NEZG 4BRVA 1EERB 4B41A 1AGCA 3MX0A 4YLBA 3CZ8A 1JVLA 4J23A 4EUPG 3SQLA 1DXIA 5ADOL 5KBPA 1EEXA 1GZ1A 4XN1A 5CJBA 1BBDH 4LOVA 3GAKA 3NCYS 5FKAB 5AEAA 3N2JA 1T4KB 2DQCH 1XZWA 3C5JA 2G5BB 3L65A 3LZFL 3PSVA 5D7LD 4O8AA 1H61A 3S7GA 3RPTA 4JRXA 2D03H 3SKJH 1EYWA 3SOBL 1NELA 3EJUA 3WYRA 5AOJA 2OZ4H 1YC7A 2X4TB 3M44A 1Q8AA 1EXUA 4PJDF 2X10A 1MUWA 3M17A 4WUKH 3UL4A 5D7IF 1T0MA 3IFNH 3TEYA 1ZL1A 4GVGA 3UXLA 3PR2A 4EQ2A 2YDRA 3PZOA 4OZFG 5I1KL 2A6LA 1OV8A 4P9HC 3ELQA 1GOXA 3JWNH 1HI6A 2VRKA 2Z9TA 4BFIB 3WTWA 2QDDA 4OSUL 2UY7B 3FKRA 1PD6A 4P2RE 1YA5A 3MBEB 4F33B 4BI6A 4LLMB 1QSFB 4UFJA 5ITFB 1OPGL 5IGXH 1C1EL 2XWBA 3DBXB 1OSZA 3DIFA 4FXGC 4KC3B 2WJ7A 4PH8A 5GPRA 3S35X 3W56A 4D0DA 5IR1A 5IBLC 2Z92B 5L4MA 4QT5B 2VWTA 2VKZG 3QORC 5TK2A 3RPDA 3S5LG 2AZAA 4HLZH 5I73B 5JO5A 1GGBL 4DP2X 2EPLX 2IGFH 2LFEA 2UZIH 3BP7A 3SPCA 3TCLB 4IMAA 1LBFA 2W59A 2C1PA 2H6PB 2CO4A 1NP0A 1V7NH 3CC5B 3MA7B 4LNCA 5C0FB 3OKLB 1QVOA 4OCXH 1J9TA 4AT6B 4JQIA 4QHNA 2PYEE 1QZ1A 2V8MA 2DL2A 3QDMA 1JV2B 4EDWL 2A7PA 3MJ8B 3QEQD 5KANG 4GIPD 3IJYB 3X12B 4LSPH 4TTDD 1U4EA 3FSOA 1B1YA 4OCRL 1FFNB 4I1PA 5C7HA 1DYSA 2FB3A 3ZJKA 4JFDE 3DETD 1E0UA 4PEEA 1BOGA 1G4RA 3MKKA 3TZVB 3A4JA 3GSQB 1KBJA 4GY7A 2VXUH 4JTKA 5DUMH 4MNKA 2EVGA 3CLEL 3EYOA 2A85A 3MO4A 2GL5A 3X3GL 5HHPB 3RFZC 1BZ7A 1CFMA 1MVYA 2D0FA 1EP3A 4E0RB 1CGUA 2G4GA 3NAVA 5HJLA 1Q9OA 4HIXH 1VFFA 3G08B 3VTTA 1OC5A 3B2VH 4JQ2A 3L2NA 2DQEL 4ORGA 2QPFA 4J4PC 5LGKA 8RUCA 4HH9A 1J2BA 2PGRA 2EDWA 4BFJA 2NUPA 1VF5C 5I19H 2BDNH 3EYFB 4IBUA 5G1MA 5KG9A 4ZAKA 4EZMA 1Z44A 5KZEA 3WNMA 4M02A 2X30A 1R0AL 3L5WB 4AH2B 3S42A 5FSDC 2E27L 4U31A 1H0IA 3BHBB 3WNJA 4UXDA 3TN0A 2AK4A 1AXTL 2NY7L 1UWXH 5ALCH 1JR1A 3F7YB 1YJDC 2CWRA 1NBYA 4N0FB 3C6CA 3GTIA 3VMOA 3QQ9C 3TH3T 1IQDA 4I6VA 3LS5H 4LRIA 1TR7A 1KJ2A 2G97A 1ZVHA 3CHXA 3MU3A 4TSCL 1YRKA 1YKWA 1O7SA 4PUUA 3VMPA 4R7OA 4P23D 1LDSA 2C1PB 2H6PA 5F1NB 4QJ1A 1NGQH 3ZSSA 4YL2A 2VUYA 4I0KA 1INQB 1OALA 3F7QA 3Q3GA 1VGEH 3PTQA 2CSPA 4AZCB 3F7YA 1HP4A 3NIFE 2DKSA 1HCVA 2BDNL 1R46A 4L1XA 3CAVA 4FMVA 2PDJA 3LV3A 5GQBA 3IU4H 1N82A 2WYZA 3EB2A 3UZJA 4OFYD 4LS1A 4FQHB 1DLFH 2WXFA 3QAQA 4ES9A 1ECYA 1PE1A 3W9EA 3HLAA 4HIXL 2PPCA 4EI5A 3BW2A 4EI0A 4JYEA 4WHBA 4PY7B 1DSFL 1MELA 5I5JA 2VHLA 5ANME 3GD6A 4O1AA 3MNZA 5JIWA 1Q5MA 3CO8A 4R34A 4D6DA 1N8IA 1DCEA 3B97A 3PTKA 1ZQ5A 3W7JA 5IFTA 1BOYA 3JWOL 2YZRA 3RBGA 4N2MA 1T22A 4LU5L 1QNOA 3P4NB 4L48A 5KBLA 1NFAA 4Q33A 2OMNA 1OAQL 1QXLA 3GMNB 2PR9A 4EANA 3KWWA 3QWQB 4LAUA 2ZPKL 4DJEC 4ONHA 3PWPE 3TN3A 2A7NA 3TZVA 5KS9F 3D7PA 3GJFA 4IMDA 2VH5H 1YY8A 3WQVA 3EB3A 3KMDA 3ME0A 3OAZK 3G5VB 4L29B 3LH2L 3FQ2A 3KWSA 2P5ED 2QDVA 4APQB 5CAYB 2BP3A 2XWCA 4NB7A 1ELSA 3NQBA 1JWSA 4JY5H 3N34A 4G7QB 4PYSA 2Z2AA 5D32A 2V5MA 2D7QA 1W3HA 1ERNA 4HPJA 3NJMA 1GQLA 3QLDA 1H7NA 2QKFA 2OQJB 4WTWA 5JUVA 4M00A 4JG1H 4LV9A 1SY6H 2C3ZA 4JPSA 5DHYB 1IT9H 5FJUA 1JHKH 4N87A 3G2GA 1TA3B 3WKZA 4ODWB 4Z7QB 4RGND 1NAMA 1QNVA 1ISYA 5KANI 5D7IB 2WW5A 3W0WA 2R39A 1KYFA 4Z7VB 5CPNA 2HTLC 1SEQL 1UGNA 1LL4A 1A9VA 1IQDB 4P49A 1TO3A 4LCUA 2VDKH 3RI5K 3GRIA 1BF2A 2O5NA 1GPOH 1RVFH 2CALA 5CCKL 2P8PB 3ARBA 3C60A 4C54A 4CSTA 3E2SA 4BS0A 4NQVA 2GJ6D 3D07A 3FTZA 4WKZA 1O7VA 5B8CC 5ESVB 3PNUA 2ZOWA 4U0RC 3IVKA 5F7WC 4F9LA 4F7EA 1MNNA 3CUPA 3WS6A 4HC1H 3TTEA 2O7QA 3IJLA 1R4XA 4H2HA 1NC2D 1WWCA 3T78A 5IDIA 4WRHA 5SWQA 3FUIA 2QPDB 3T3MF 1X5GA 2QQNL 1PKOA 1EHAA 1IB5A 1LK3L 4GZ7A 4WI4A 2EDXA 4G9DA 4LQ1A 5F1VA 5ECUA 4JX4A 2EDDA 4KV5E 4OJAA 3LENA 4BQ4A 3NIYA 2WNNA 2F15A 4JMXA 2W9LA 1QRNB 1LQ2A 3JRKA 1TLMA 4LWWA 3W1RA 5HPOA 4A2LA 5BV7C 2EE9A 3ZYJA 3VKBA 3NCBB 1R3HA 4QJ3B 3EOAA 3TBSB 2DQJL 1W0WB 1ZA3B 3UO1H 3JWOH 1KY7A 5HHME 2CWNA 5AAMC 3PB0A 5DJDA 4EF9A 5I6XC 1H19A 1HWHB 4PUWA 1FDZA 3L3IB 1CU4L 1TTGA 3HG1D 2QR0B 4LKXA 4CGTA 3GMRB 1Q6GA 3PF3A 1HXMA 3OLDA 2XINA 3GJFK 2XRAL 3T0CA 3VAVA 2ZICA 5DXWA 3QIWB 3C8HA 4NKIL 3S9YA 2I07B 3F7VB 2J47A 4D6EA 1IWPA 4DQOL 4OI9A 2BTMA 4PJIF 4TTGA 5CZSA 3IPEA 5DR5L 4DH2A 3P6LA 2YAMA 3X1GA 2NT0A 1QNRA 2CWXA 4D0DB 5IR1B 1AO7E 4UV4H 4O54A 1PU0A 3C5SB 5JLZA 4ZUVA 1YDNA 1BGXH 2BH0A 2HWZH 2YD9A 5GSVB 3M0JA 1U2YA 4L4VE 2AEOA 3UTSA 3A13A 1IAIL 1NMAL 3I3EA 3CYJA 4LYPA 4Y19E 4HMCA 2ZQKA 4PGBA 3GMPB 3L4CA 3B9KC 4MJIB 4TMCA 2I07A 3BUTA 1OFPA 2Q20A 1BGXL 1A6PA 1ZT1B 4M93B 4IOSA 5TPWL 4CSSA 1OFRA 2OFJA 4IL2A 6XIMA 1NOLA 4NDMA 4NS0A 5GGTA 1CDBA 1YN7A 3A0OA 1LILA 3EYSH 4LAQH 2VOMA 3W7GA 1HHKA 1FH7A 3MR9B 2GQ9A 4PJIA 4Z3FA 3GBLA 4L1WA 1ZLWK 3D30A 2YMXH 1IGTB 3PG2A 3T4YA 1U3HD 3GZQA 3KHOA 4WLCA 2HVKA 2R1LA 1XSOA 3CQIA 2CQVA 2G5BA 2IKGA 3BJLA 3NFPB 3ISYA 4GKSB 4H7VA 1VHCA 2HVKB 3K6IA 5LIWX 1UR1A 1XIGA 1A5KC 4W9HC 4G8FA 2IPTL 1ME8A 3OHXA 5AVUB 5IQ7H 4Y9OA 2VAJA 4JFFA 4EBQH 4P8WA 1HESA 4HEMA 4KJWC 1IE7C 3BZ4B 1OGAE 2OR9H 3GIVA 3ORJA 3ZW3A 5C2UB 5BO1H 4P0DA 2EKSA 4BK8A 5LVEA 1LWHA 3FU0A 1PY4A 3C9NA 4UV7L 3NJLA 4Z77A 2CHRA 1LT8A 2EG6A 2PNDA 3MGOA 5INCB 1EAPA 1Y6KR 2Z93A 3WUEA 1CB4A 4YWGH 1M71A 5E5UB 4JN2A 4DGIL 4JN7A 1MCRA 3TBYB 3H9SB 3GU9A 4P2OA 2JQXA 4I5RA 4U4MA 1SJEB 4EDWH 1RZJC 2PFHA 4PGZA 4XB8A 2CIIA 4DETA 1S9YA 1Z5YD 4C58B 3U79A 1EDTA 1FHDA 3GNNA 3MDWA 3P4MB 4U7KA 1NF0A 3KPOB 2A3HA 3AREB 2GOKA 3PBVA 3D08A 2DRUA 1ACYH 4AVJA 1IGYB 2IGFL 5H94B 3WJJC 4XKMA 4AAJA 1QLEH 5M2FX 3VOHA 3L3DA 3WFCL 2VD8A 1TQJA 3BAXA 4YPJA 3BRGC 1MHEB 2Q6WA 3TBYA 5I0DA 2ZSWB 4UC5A 4PCPA 3MRHB 4LSVH 4Y1AD 1IGFL 4AMWA 4HUVA 4ZFOA 2IH9A 3BP5A 1KXHA 2A1YA 4PVLA 1JCYA 1FE8H 2VXQL 1DR9A 4HBCH 4I88A 2Y1YA 4AJ0A 4AEFA 3RHGA 1P0BA 2J5LC 5H1WA 1BVLA 3A3YB 1ZJHA 2FK9A 3WJLA 2PP3A 4HC1A 4PMJA 4Q8PA 4PRPE 4XWOC 1QW8A 3IFNL 3Q06A 2ZXAA 4CNIB 4LVEA 5FO9B 3IMVA 2VCOA 1GAFL 1HN1A 1MNSA 3RP1A 3EYPA 1UXLA 1IGWA 2D3NA 4OB5H 5DT5A 2A4CA 2R82A 3M0KA 3UWYA 1IMHC 1WXZA 2ZOTA 3QC5X 5C9RA 1EEZA 5KZMA 1Q2SA 1TDQA 3S2MA 5HYSB 5FF6A 4GUPA 1FWJC 3B6SB 4RAUA 3KVLA 1JWUA 3EDFA 2BRRH 4Y16B 4MNGB 3VK5A 2NZLA 2DH3A 1MQRA 4AD3A 2W0FB 1OG6A 5F1UA 4MA8H 4Q3MA 1EZUA 1HKFA 2XNAA 4PYHA 5C0BE 1P7TA 2B4GA 1UD8A 4MIMA 5DFAA 3G6JA 1GVFA 2QUTA 1NMBL 4UQAA 2ISWA 2PDYA 5AVHA 3MBXL 3HJEA 2EIKB 1SDDA 2NLJA 4E41B 3TV8A 1RBLA 5FESA 5L2KA 1GK8A 5IT2L 1G9ML 2M2DA 2BNUB 3NZHH 3T6VA 5DK2A 1MHHA 3P3SA 3GHSA 1FNFA 3W9DB 3DDMA 4C6KA 2F68X 3F2LA 4JN2B 4CVZB 3U7BA 4JPIA 4XCEA 4K3DL 3QO1A 1MCQA 3QIBB 4X4YB 2AAMA 4FMFA 2PDMA 2XZAH 1QHOA 4GSRA 1PL3A 1WFJA 5D2NB 1DXEA 4K8GA 4LHQB 2VP8A 4RZCB 1KXVC 2DWDA 1GGCL 1A1MA 1DVYA 2JKTM 5DHEA 4APQA 3MRBB 4OZFH 5IJDC 2ZFAA 2G50A 2VX5A 3ERXA 2EAWA 4X7TA 4AZIA 1UYWL 1W0WA 1ZA3A 1WE5A 3LIUA 3BVTA 1GTNA 2V68A 3FU7B 4MJ6A 3DJTA 3PIQB 5E8DL 3U9UB 3QSTA 1BLIA 4WNQA 1EPXA 1UIOA 4V2XA 3W7QA 1DVTA 1MNUL 5ALBL 3CH1A 4NX5A 2GDQA 4HOWA 2K6ZA 1Q9KA 1RJQA 4U3SA 3L3HA 3ULUC 1O60A 2HG5A 3DGBA 2X3BA 4OVVA 4EN3A 4XOEA 2V9DA 1KPUB 2DQMA 2FSEB 1AZZC 2RCSH 2BM3A 4ES8A 1N8FA 4MOZA 3W86A 3QCTH 3PGCA 1GYAA 4QEGA 1MCEA 2R14A 2C9SA 4G2AA 4Q4PA 4XMWA 1TPH1 2P42B 3EG9B 4LARH 2XJ7A 4GMTL 1T1ZA 4P5MB 4MY9A 3EYOB 3FJ6A 1BBJB 3NZ8B 1JBJA 1B3ZA 3BT2L 4NM4L 5EU6A 2P43B 5AB1A 2EICA 2OJZL 2UZYA 2YJLA 4PJBA 3E74A 4KZEL 3QMTA 1Q45A 1S3KL 2GBAA 3JWNC 2XQ0A 4J3WA 1MW1A 1GZPA 5DUML 2AVFA 3EDEA 2ZVIA 4QTGA 4WY0F 4B9FA 3WJXA 1G43A 4J3BA 3W0WB 3OR6A 1OGAB 3ESMA 4OCRH 1QUNB 3VXSD 1L2UA 4H19A 2APXA 3LZOA 3LOWA 2K6WA 3QEGL 1E6OL 2GJ6E 2NY4B 2W91A 3DSFL 4QHLA 4JRFA 4Y4KD 1WA3A 1E9QA 1N0LA 3RFRA 4X22A 2XN9A 4G8GD 3TXZA 5PTDA 1RZ8B 5IK3B 4Z17A 3PFRA 3EEZA 2CLVB 4XMLL 2AGKA 2IPWA 5CJXA 2VX4A 4U6HA 1QASA 1KFGA 4TTDC 2JEQA 4M7LH 3H26A 1NCTA 3IACA 3WFHB 4AMAA 3QR2A 4KAQH 3RVXD 4HWUA 3ZHDA 1YEHH 2PWDA 4N1HB 1QEWA 2A2IA 2VIRA 2HFGH 5HYJD 2WYIA 1ETZA 5KYXA 2DGAA 1E9PB 3BMXA 1AS7A 2IDQA 1AL7A 1OB1A 1RQ5A 3LERA 1MJ7L 1KPUA 2FSEA 2HLFD 4PL2A 1O66A 2E7CA 4I9JA 3WBDA 2X7LA 1FYTD 5D1ZD 3OO2A 1F42A 1CQKA 2P52A 4O58L 4DGYH 5C0CA 2NNF