4M8UA

The structure of mall mutant enzyme v200a from bacillus subtilus
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
559
structure length
559
Chain Sequence
b'SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDAIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPERADLKSISLKPYEAVMGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
molecule tags Hydrolase
source organism Bacillus subtilis subsp. subtilis
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
total genus 230
structure length 559
sequence length 559
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m8uA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m8uA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m8uA02
1BHGA 1UD2A 3BXWA 1ZJAA 3DC0A 4MDOA 1GORA 3A4WA 4F8XA 1D7FA 1EOKA 1TE1A 2E9MA 2PWHA 4M56A 1UKTA 4C7FA 3NIYA 4YPJA 1J0IA 3L4TA 2J8GA 5JIWA 1UD5A 3SUWA 3MI6A 5I6SA 3A21A 5CLWA 1B2YA 1HF6A 1X6NA 5ABGA 3VIJA 2EPLX 2FHCA 4J3TA 4GZIA 3TTYA 2WVUA 1BVNP 4R5EA 3O9NA 4HA3A 4S3KA 1H11A 4CU8A 2ZUUA 1EDTA 4V28A 3VDBA 4BZYA 5JIPA 2DT1A 4H41A 1E3ZA 3GBEA 1JF6A 1W1TA 4Z2JA 1MQRA 1E72M 1RPKA 1K9EA 1GOOA 1NOWA 3LRMA 4AEFA 1B90A 1W1VA 4DO6A 2CXGA 2DSKA 1HX0A 5A2BA 2PBOA 4J3XA 2BFGA 3WEMA 5A6LA 4TVUA 3TTQA 1LJYA 3KLKA 4AXNA 4BQ5A 5FL0A 3VKKA 2WWDA 5FL1A 1M03A 1ZJBA 5BYWA 5TD4A 3CLWA 5C71A 4RL3A 1LL7A 4W88A 3CUIA 3GH7A 2AOSA 3AZSA 3GXNA 2F1AA 4MNLA 4FNQA 2WAGA 4KRTA 2DQXA 7CGTA 4FLSA 2J77A 4PMUA 1UA7A 3QHOA 1UR9A 3CMGA 2HVMA 3WELA 1HXJA 3ZO9A 2J7BA 4P7LA 1QNPA 1AQ0A 1UH4A 1C7SA 5A1AA 1TQSA 1CWYA 3AIUA 3DYOA 4ZENA 2EPKX 4CKQA 4NXSA 3M6DA 3DDFA 4ZE5A 1JD7A 1IT0A 4CVWA 2CESA 1UKPA 4JFSA 3WF3A 1KXTA 1GONA 4MPKA 2DT3A 5EB8A 3AYSA 2ZICA 1U2YA 3CZ8A 4K68A 3N17A 2FGLA 1V6VA 2V3DA 5I0DA 1N82A 1CNVA 3WQ8A 3BVUA 2ZX7A 3LX9A 1FHDA 3VGEA 3UERA 1CGTA 3H54A 3S2CA 1MW0A 3EDEA 4FLOA 1B3WA 2VVNA 3EJRA 2YDQA 1C3FA 4OJYA 1MW1A 2PWEA 1VF8A 1GW1A 4CUCA 4JFTA 2X09A 4IISA 3ALGA 3AIWA 2J47A 2XM2A 1SYTA 4W85A 1RH9A 3AXIA 3OLGA 1WKYA 3MO4A 2DIEA 3VX1A 1E5JA 4W86A 2DT0A 3K46A 3L2LA 3UG3A 2VQUA 4PMQA 2ZWYA 3EDDA 4FNTA 1W9DM 5CQ1A 3SUTA 1ZBWA 2WZEA 4JZ5A 2D1ZA 4EANA 2W66A 2XGBA 1JNEA 4IPLA 2J62A 1TA3A 1VBRA 4HA1A 3ARTA 1JZ5A 2WHJA 1Z32X 4HOWA 1QOXA 1C93A 5A69A 5CPTA 1KWGA 1SMAA 4HP5A 3VDAA 1JG9A 3AI0A 5A6BD 2ZUNA 1V3MA 5GPRA 2QHAA 1DEDA 1H2JA 3PZOA 1UWIA 1EQCA 2J79A 2VRKA 2QMKA 2WCAA 2WK2A 3F5KA 4JL1A 5A6BA 3SCQA 1E0WA 3QHNA 5ABEA 2WWCA 4PMXA 1UD6A 2C7FA 2WMIA 3AZRA 2WMFA 2X2HA 1XSIA 1JZ7A 1JDDA 1TMQA 1B9ZA 3II1A 1E1FA 4HZ8A 1UZ4A 1UWQA 2HISA 4LYRA 1PPIA 8CGTA 3RM8A 4JFWA 3AMCA 4Z2IA 3OGVA 3WNLA 4PCSA 2W4XA 3ARZA 3AIEA 3W28A 3DDGA 1SFSA 3GXIA 1XCWA 4QLJA 5CPQA 2NT1A 4BQ2A 4M82A 3A6OA 2G3JA 3FXYA 2XJ7A 1D2KA 4QDMA 2OWWA 1IZKA 1XD0A 1GQKA 1V0NA 1WDRA 4JCLA 1W32A 3TTSA 3SCUA 5ABHA 3MSDA 1KCLA 4URIA 2WNWA 4XB3A 1HP5A 3RM4A 4CU7A 4AIOA 5BXRA 4FNRA 3CPUA 4N0RA 5HDRA 3F5JA 2BHUA 3WH7A 5M03A 1R34A 4X0NA 5EFDA 1OCQA 3OZPA 2ZXAA 2ZWZA 2WPGA 2DSVA 3E1F1 1HP4A 4R27A 4P8VA 2ZUSA 3OG2A 3WNKA 3WDIA 2YKKA 1H0GA 1H4PA 1QVBA 3WH5A 5E6YA 3MUZ1 3THDA 4GKLA 2VX4A 1BSIA 3WD2A 2J78A 1W3HA 1HKKA 3AJ7A 1H1NA 3AMGA 1HT6A 1V02E 1H09A 2YLAA 3DX0A 4H04A 3WIJA 2ZX8A 1MQPA 1BYCA 4PSRA 2RGMA 2W5FA 2XN1A 3D51A 3WMCA 2J7FA 3PBGA 1DP0A 3NDZA 3BVTA 4J28A 3AXHA 3WUBA 2EPMX 1Q4NX 1LLOA 5A8QA 1OB0A 1G01A 1FH8A 2GFTA 1XYZA 2EJ1A 4P7QA 1EHNA 3LMYA 3MANA 3VGBA 1E6SM 1R85A 4CGTA 3BAWA 4IPNB 3MKKA 3PTKA 4KGLA 1HNYA 3KZSA 2CEQA 3T2QA 2BS9A 3K8LA 3IAQA 1GOMA 2VVSA 2VRQA 2GSJA 4UFKA 4DWSB 1ESWA 1O7AA 3W81A 3BSGA 4OOUA 1MXGA 3EMQA 1PX4A 1GQJA 1NOUA 3IJ8A 3OLDA 2PB1A 5D9PA 1NARA 3WD4A 2WBKA 2G8ZA 1GUVA 1QBAA 1JYVA 2NSXA 4HOXA 5E09A 2Q8XA 3VIKA 1FA2A 3RO8A 4E8CA 1EOMA 2WKLA 2X2YA 1E5NA 2Y24A 4MTVA 3CZKA 2F7RA 1GVYA 2X1IA 5I78A 3TOPA 1GHSA 1CECA 5C70A 4D71A 2WKGA 1OT1A 4H8HA 3A22A 3WD0A 3D4YA 1ISWA 3HJEA 1R33A 1R87A 1C8YA 1JYXA 1E6PA 5I77A 3RDKA 4NSBA 2WMIB 2J7EA 4W89A 5IXEA 4PMDA 5D9OA 1B0IA 4YHGA 3FW6A 5A8MA 1JXKA 3AS2A 1FH9A 5EBAA 3I3EA 3BAYA 3PZVA 4ML4A 3UETA 2Y5EA 1D3CA 1HIZA 3LRLA 3CV5A 1LL4A 2D0FA 5CJ5A 3VU2A 4ACYA 4RE2A 3WEZA 3D4ZA 5DT5A 1I1XA 5A6JA 4UFIA 2UY4A 1W9VA 1VBUA 2G41A 2X0HA 1GOIA 3RILA 1E6QM 4AC1X 2YBUA 4PMVA 4AMWA 2WCGA 2G4FA 2J7HA 3OLIA 3SEPA 1U33A 3W27A 1CENA 3GH5A 3H53A 1ZU8A 2MANA 3PTMA 4MDPA 1M7XA 3WDJA 1K6AA 4MJ2A 2EPNA 4HA4A 3WDQA 4FNSA 5HNNA 3ZOAA 4HMEA 1HKJA 4D6DA 1KQZA 1IV8A 3FHQA 3DHUA 2XIIA 4TVDA 4OBRA 1US3A 2NW0A 3MUAA 3W25A 4HMDA 2JFEX 1ISXA 4ACZB 4BCEA 1FFQA 1TR1A 4HTYA 4M81A 3L4YA 4MNKA 4XZWA 1R46A 3LXAA 4JKLA 2OWXA 1E1EA 4AW7A 3SCPA 1BAGA 3RM9A 1QHOA 3ZR6A 1B1YA 1VJSA 2JF7A 3B9AA 1WZLA 1E71M 4J3SA 3GTNA 1KGXA 2XSBA 2WW5A 3MU7A 1QBBA 1E56A 1B3ZA 3B9DA 1QI5A 2Z1KA 3WDHA 2OWCA 4WJXA 1C8QA 1UQZA 2EPOA 3WF0A 4ZFMA 3GBDA 2WC7A 3NSNA 1OIMA 1W3KA 3ZM8A 5E0CA 2EABA 1EO7A 4N42A 2OYMA 3SURA 4E8DA 4DO5A 2XN0A 4QCFA 2JIWA 5BROA 4W7WA 5KEZA 2QF8A 4AZCA 4AZIA 1TZ7A 4GZJA 2WMGA 1VFOA 1ECEA 1PJ9A 1KR0A 1HKIA 3CZNA 4AMCA 3OBAA 4PBGA 3NYDA 1W3JA 1T0OA 3EJTA 1ODZA 1KBBA 1WE5A 3UCQA 1V02A 4WK9A 1AQMA 2W91A 1MWOA 4GI8A 1KQYA 5AC4A 5FOOA 4HOZA 2XVPA 1QHZA 3NSXA 1R47A 3VO0A 3VD3A 4BS0A 4S3JA 5JUVA 2XGIA 5LA2A 1GOWA 3IAPA 3POHA 3BAJA 3UG4A 5E6ZA 1FH7A 2YA1A 1J11A 1MYRA 1FP9A 1OD8A 4PCTA 2YFNA 3PZQA 2ZX5A 3UESA 1FP8A 2EBNA 1KCKA 2XIBA 2CBUA 4X0VA 1TQWA 1VAHA 1Q6CA 1NQ6A 5CLTA 3JUGA 1QW8A 1AVAA 2V3GA 2AMGA 3PN8A 4YHEA 3CZEA 4AZHA 2XHYA 3AICA 1V3HA 2OSXA 5DF0A 1CXFA 4DUVA 3WNNA 1DWAM 3U7BA 1V3KA 5KZ6A 1NH6A 2D0HA 1W9PA 1PZ2A 3RIKA 4LGXA 1E4IA 4D1JA 4B15A 2VR5A 3PZ9A 2VUYA 2A3BA 3U57A 3CBWA 1CZ1A 3DHPA 3F4VA 1V6UA 2DSZA 1HJXA 4PYSA 4TUFA 4EK7A 3WQ5A 3W38A 3OIHA 1V3IA 4W7VA 5E70A 3WD1A 1ODUA 4W8AA 2RGLA 2GVYA 1PX3A 1NWUA 3VTRA 4HMCA 1TQVA 3BVXA 2J7GA 4MNJA 1TQTA 1WDPA 3VIOA 4H8UA 2XVNA 1KWKA 3GZAA 5I5RA 1UWUA 1P6WA 1YHTA 4GIAA 4U3AA 3BH4A 3LXCA 5I23A 2W62A 2CPUA 4D6IA 1E0VA 1GQIA 2Z1SA 3GXMA 1VFMA 3DYMA 3RMEA 3VMPA 1ZBKA 1H41A 3HU7A 2WSKA 3ARSA 4UQBA 4TOQA 3AOFA 4Z2LA 3VIPA 2WB5A 1CXLA 3EDJA 2J74A 1EDQA 3IJ7A 2BNJA 1RP8A 1GNXA 3AIVA 4AZ5A 7A3HA 1VEMA 1E43A 2X05A 4PTVA 3AS1A 3VIMA 3ZR5A 1ZBCA 5ABFA 2VURA 2Y8VA 3G6LA 3J7HA 1J12A 1LG1A 4NZFA 4U31A 3NJ3A 3KE0A 4KRUA 4DWSC 4JIEA 2XM1A 1PEZA 1HXKA 2WBGA 3VGGA 3EDKA 1DHKA 1B31A 5CGMA 2E0PA 1CGUA 2TAAA 3IGUA 4FK9A 1TUXA 3HMCA 4P7RA 3AMKA 3QOKA 3FHAA 3BCFA 1TFVA 2F1BA 1VIWA 3ARQA 4MB1A 3CZJA 2WMHA 4P7NA 3WF1A 3M7SA 4OZOA 4DM1A 3SCVA 2E8ZA 3WY1A 1MQQA 4ZE4A 2VR4A 3IANA 3ZQ9A 2OYLA 2BY0A 2YDRA 4ZEPA 3VDHA 3DX2A 1E40A 4AMXA 1KXHA 5CXPA 2EEXA 1FHLA 3CIVA 4AD1A 1OINA 4Q7NA 1UHVA 2F8QA 1WZAA 1E70M 3WSUA 5FIPA 4H8VA 1M01A 2GJXB 4B3LA 1M53A 2QV4A 2O9PA 4M29A 4D6CA 4PMYA 1NWRA 1OSEA 1CLXA 1KR1A 2CYGA 3BAXA 2XFRA 1XH1A 3WY4A 1C7TA 1H49A 1ZBVA 4EKJA 3GNPA 3UR8A 1QI2A 3EYPA 2UWFA 5AYIA 4GQQA 3FNDA 1GJUA 2WVVB 3T0DA 2UY3A 1GVIA 2JE8A 1EGZA 3MUY1 1XCXA 4DM2A 4NRSA 1JF5A 3I3DA 1VRXA 3NSMA 2WC3A 4V2XA 1E6NA 3OLEA 2GDVA 1E6XM 2CKSA 5D4YA 1C92A 3M07A 2FGZA 3BLKA 1JFHA 2IXVA 3CZLA 4AEEA 5A6KA 2J25A 4J3UA 1EQPA 3WQ6A 3FAXA 4H2CA 4TTGA 4D1IA 2WVVA 2VQTA 3CUGA 4M1RA 1QI0A 3WENA 3K8MA 2X2JA 1TVNA 2WLZA 3WD3A 4UCFA 1BG9A 2O92A 3WFZA 3SIMA 3PZMA 4QLLA 1VFFA 1QNOA 3CHFA 4F79A 3WUFA 1LWJA 3WFLA 4EE9A 1PIFA 4W5UA 3K4DA 3T0BA 3RPMA 4KWUA 1XC6A 3AROA 3VM7A 2WMKA 1UASA 2VMFA 2JIEA 2NT0A 3N15A 1HVQA 1L8NA 3KL0A 2WLYA 1WDQA 4WSJA 2XSAA 9CGTA 1KFWA 2V5DA 5LYRA 1ZL1A 4FF5A 1MFUA 1CGVA 3PZIA 1EXPA 4GQRA 2W67A 4B3KA 4EAMA 2G3MA 2WANA 3AHYA 2YJQA 1J0JA 1EA9C 4UOQA 2D2OA 3ZSSA 3WF4A 3VSVA 1HL9A 1G9HA 5FD0A 1JIBA 4U3CA 1O6IA 1K9DA 2E9LA 4AD3A 3CZSA 1Y7VA 3ZJ6A 3WQVA 2BHYA 3POCA 2WM0A 4WSKA 3DECA 5BWFA 3EDFA 2VX7A 1HWWA 1W9UA 1F4AA 3OZOA 3WEOA 1BPLB 3VGHA 3W82A 1HL8A 4LYQA 2QLYA 1H0IA 1R86A 3VVGA 2WVSA 3NUKA 5DT7A 2XN2A 3UR7A 3GXDA 3SUVA 3F5LA 4H7VA 1V3LA 3BMWA 3AHVA 4DUXA 2VT0A 5IFPA 3OA5A 1OIFA 2VZSA 3MV11 4TX8A 6TAAA 3BUIA 3VGFA 1W3LA 2VX5A 4D6JA 2A3CA 4U33A 1JZ2A 2YA2A 3OGSA 5A8PA 3L2MA 2CITA 4AIEA 2ZX9A 1ISZA 4BQ4A 2CBIA 4MJ4A 2VZVA 3ZMRA 3VMOA 4E2OA 1E15A 5IDIA 1JZ4A 3AIQA 1EH9A 3VSUA 4PMRA 5CSUA 2BY2A 1VJZA 3MMUA 3WNMA 3CO4A 4ACZA 1QWUA 1H3GA 2BVTA 2G3IA 2JF6A 4NZCA 2W63A 1JDAA 3BUQA 8A3HA 1FFRA 3O2LA 3EJSA 3SCNA 1IZJA 2WSPA 3AIBA 3WL1A 4AY1A 4OGZA 3D5HA 5AYBA 3AHZA 2D3LA 1EHAA 3DX3A 3VM5A 3ZIZA 2Y2WA 4HPHA 5IHRA 5BRPA 3BUBA 3L4VA 3CHEA 4PMOA 3L4XA 1ZS2A 1V3JA 1MXDA 4PTMA 3WBAA 1J01A 1UD4A 2PC8A 5A6AA 3G6MA 3WN6A 1B3YA 2OW6A 2ZUVA 3KL5A 1HJQA 4M80A 4DWSD 1Q6FA 4RE4A 3VIGA 1VEOA 3AS3A 1GZJA 1BQCA 1TVPA 1X6LA 4PTWA 1J0KA 1AQHA 2WCSA 4W87A 5M3WA 2JEPA 1QNRA 4HPGA 2O9OA 3AIRA 1SR0A 5A8NA 1LL6A 3K1DA 4UFHA 4E4PA 1CPUA 5FKYA 3WDPP 4F9DA 3BVVA 1UD8A 4L4OA 1MW2A 2J7DA 3MS8A 1HTYA 4GINA 2VOTA 4MB3A 4UQEA 4A3YA 4QP0A 5JBFA 1XH2A 1AMYA 2CHOA 5D8WA 4DO4A 3VIHA 3WMBA 4LPCA 4NX0A 3ARVA 5DO8A 4NF7A 4JL2A 4PTXA 4CD8A 3HG2A 4ATDA 2XVKA 1MVYA 3HG3A 1OD0A 2CBJA 4JFUA 5I24A 3BUDA 3VILA 2EAEA 4CN1A 1A47A 4U2ZA 1NWTA 1DTUA 2D23A 4TTUA 3PZNA 1RP9A 1UG6A 3GXTA 4GO8A 3DX4A 4PUEA 3A47A 4BA0A 2XTKA 3VUPA 3WY3A 2WHMA 2VZTA 2DDXA 4J27A 2BY3A 4JHZA 2WHKA 3WNPA 3WNOA 3BAIA 5GNXA 1US2A 1BGGA 2YBTA 4AYSA 2J8FA 1BLIA 3VIFA 2IUZA 3AYRA 4P8WA 5HPCA 1MW3A 1JYNA 4D72A 1JAEA 1J0ZA 4JKMA 3GXFA 3VINA 1OGGA 1Q6EA 3UG5A 3T09A 3WQWA 3A23A 1J0HA 3W37A 2FH8A 1CYGA 4U5IA 2W61A 2YFOA 5F7UA 3WUGA 3GYCA 4ATWA 1MFVA 3A4AA 1UR2A 2J75A 2GJPA 3CUFA 3BCDA 3CHCA 2FYVA 3L4WA 1Q6DA 3AS0A 3W24A 3WH9A 4ATLA 1LQ0A 1WO2A 1F4HA 3SUSA 1CGXA 1V03A 1QNSA 2VO5A 3BUPA 5AY7A 1L0PA 2BHZA 2WHLA 2IXUA 5A3HA 3ARYA 4PMZA 4Z2HA 1UKQA 1E6RA 2XPKA 2AAAA 2O9TA 4CCDA 3THCA 1KGUA 1B3VA 4J7RA 3HG5A 5DFAA 1DWGM 2CHNA 4NI3A 3ZSTA 2A3HA 1E4LA 1CBGA 1NWSA 5GNZA 1CGYA 2VNCA 2WZHA 3WBEA 2DPEA 3W0KA 3MMWA 4IUGA 5LA0A 2JEQA 4AD4A 3AMDA 4AZ7A 2OSWA 2XG9A 2ZUWA 2A3AA 4HU8A 4NZJA 2X2IA 1G5AA 2E40A 4LYPA 3T08A 4CD4A 4PN2A 3HG4A 3WY2A 3VOCA 3ARUA 1G0CA 5HBFA 3AQUA 3W6MA 3WH8A 4MB4A 2WYSA 5IFTA 3NDYA 3VNZA 2E8YA 4TVCA 1KTCA 4AD5A 1WCGA 3AXXA 4CCEA 1GHRA 1VFUA 4F9JA 3GH4A 1TCMA 1A3HA 1UQYA 2WXDM 4XUYA 2F2HA 5E9AA 5HXMA 1GJWA 1HN1A 4HU0A 1QX1A 4M8UA 3VSTA 1QHPA 4OOZA 1W2VA 2YDSA 5CG0A 5C8BB 4OUEA 1V0LA 4UFJA 3WKZA 2B31A 5EMYA 3PZUA 3BLPX 4W93A 2DH2A 4ZXLA 4D6HA 2PF0A 3K4AA 2ZUTA 3WDRA 4B9YA 3TONA 3L4ZA 2V3EA 1KXVA 1BFNA 2CBVA 3ZT6A 3CC1A 2Y8KA 5I3DA 2FE0A 4UR9A 1NP0A 3H55A 1W9BM 1R75A 1WB0A 5HPOA 2WMJA 3VD5A 3N13A 4UQAA 3B8SA 3N04A 4KGJA 1I1WA 4JHOA 2VJXA 2EXOA 3O6AA 2OLHA 1VEPA 3U7VA 1BTCA 1QPKA 1V6XA 2VCCA 2PWFA 4UQCA 7TAAA 2CKRA 2BY1A 2YLLA 5A8OA 3CH9A 4WKHA 1U30A 2OYKA 3W53A 3AZTA 1M04A 4AISA 3T2PA 2VCAA 2PWGA 1UR8A 2BXZA 3N18A 4Y7EA 4Q22A 2V38A 2PI6A 3A24A 2YL6A 5D9MA 5CSYA 2ZXDA 3CGTA 1YQ2A 5IHSA 3CUJA 4CN4A 1R7AA 1WDSA 4PRWA 3VD7A 4LX4A 3PZTA 4CN6A 3BVWA 1FOBA 5I2UA 1JZ3A 4AYGA 5LA1A 2WZIA 3VD9A 1HJSA 2W92A 4UOZA 5AC5A 1C90A 1JD9A 1WP6A 2ZXQA 5M5DA 2CERA 4A4AA 3KEHA 1JNDA 2D73A 2WVTA 5DMYA 1KGWA 4U5KA 1UYQA 3WH6A 5FCZA 3EJPA 3MV01 5A2CA 1XV8A 1I75A 5CGTA 1BYDA 4NRRA 1CLVA 2YL9A 1ISYA 3ARRA 3EJQA 1BG4A 3ZJ7A 2BVYA 4QFUA 1TA3B 1LWHA 3CTTA 3OB8A 3TTOA 2VCBA 1E4MM 2FDMA 3DYPA 3WMSA 4AD0A 4BF7A 1XSKA 2YA0A 4WIWA 5E0FA 2ZIDA 3U5YA 3SUUA 1ITXA 1B30A 1QWNA 3OGRA 1CXHA 1V08A 1OM0A 2IGTA 2E9BA 1O7DC 1HVXA 2FH6A 2CETA 1UKSA 4Z2KA 4WKFA 1CIUA 3L4UA 2ZXBA 2YL8A 4JKKA 2XVLA 2JALA 1PS3A 5E1QA 4UTFA 2CCRA 4UQ9A 3W6LA 1DWFM 2BV9A 2D24A 4LXFA 3VNYA 1NOFA 3S5ZA 3VGDA 1XH0A 1CXEA 1OGSA 2EADA 3A5VA 1XSJA 2ZE0A 3AFBA 2GUYA 3EMZA 2QMJA 5A94A 1UWSA 2PWDA 4FNPA 1UR4A 2DSWA 1V6WA 4LQ1A 1GPFA 1ZB5A 1PBGA 4JAWA 2A3EA 5CZKA 4B16A 6CGTA 2D3NA 4CVUA 3SCSA 1NP2A 2YL5A 4A3HA 1QW9A 1WAWA 4C7GA 2ZX6A 2J7CA 4IM4A 4P8UA 4XV0A 2YOCA 1W1PA 4F66A 3PTQA 4PEEA 2Y4SA 3HZ3A 3T2OA 4XZBA 3T0AA 3TP4A 1HJVA 4GXPA 1BGAA 2VC9A 4FMVA 1G94A 3SCRA 2DH3A 2E3ZA 2F7OA 1S46A 2WC4A 2XYLA 2X8RA 2DGAA 3LPOA 2DT2A 2F18A 2ESCA 3GNOA 4AZ6A 4DWSA 1BF2A 3W4RA 3CUHA 3N1AA 2FHBA 3PHAA 4QCEA 1OBAA 3KL3A 3SCTA 5A6MA 1JL8A 1KXQA 3GDBA 1TQUA 1UWTA 3W26A 1WPCA 1LF1A 3HN3A 2GDUA 1EO5A 3QGVA 1K9TA 1B3XA 3D52A 1JFXA 1X1NA 2ZOXA 1CTNA 4MADA 4FNUA 1QI4A 3D50A 3RCNA 1UA3A 3LPPA 3CZGA 3IJ9A 2X0YA 1W2PA 1JI1A 1UR1A 2YIHA 2UY5A 5I79A 4AWEA 2DIJA 4OIFA 1DWJM 3SCOA 4GPNA 3BLBA 3NCOA 1PAMA 1RD6A 4YN5A 3AISA 4AZGA 1OGBA 1UD3A 3AMLA 3ARXA 1BYBA 1HJWA 4AZBA 2GJRA 3U5UA 4D6FA 5BCAA 3RJXA 4BQ3A 3RJYA 2D0GA 3N12A 3LRKA 2F7PA 5HOSA 1R8LA 4W84A 2XUCA 4GZEA 2CNCA 1SMDA 3D3AA 3N9KA 3VD4A 2ALWA 1XYFA 3AHXA 4CD7A 4FLRA 5D9NA 1CEOA 1G1YA 4TX6A 5DEZA 1KTBA 3BAKA 4X9YA 2VRJA 4V27A 4UQDA 1GOKA 3QHMA 4KH2A 4J3VA 4P8XA 4U2YA 1KB3A 1K9FA 3ZJ8A 1DWIM 4ZXOA 1E55A 3FY1A 1VB9A 4JCMA 5ABFB 2XWDA 4CCCA 1W91A 1CXKA 4NXKA 3BSHA 3LPGA 2F61A 1ISVA 4P7OA 2OW7A 3ZT5A 4J3WA 3MSGA 1BYAA 1J10A 2XWEA 5GNYA 5M17A 1GOQA 4CD6A 4UFMA 5BXTA 3BGAA 1C91A 3ZT7A 2V3FA 1XHGA 3FAWA 3W29A 1E73M 4M24A 4TXEA 3B9EA 2GK1B 4RE3A 1JI2A 1HJUA 1OT2A 3WQ4A 4MB5A 4D6EA 1UOKA 3I3BA 3GXPA 2VZOA 1V0KA 5CPSA 2D22A 3S5YA 4WLCA 3ECQA 3LPFA 2PBGA 1CDGA 1E9LA 3GNRA 2XFFA 3CHDA 2ZUMA 4MAVA 1KBKA 5A2AA 1XRVA 5JBDA 2XVGA 1V6YA 1SZNA 3VPLA 3AHTA 4HZ6A 2EO7A 4UZSA 1JDCA 4L4PA 1C8XA 2VX6A 3BC9A 3CMJA 2OSYA 3EMCA 1EIBA 2CIPA 3M46A 3DX1A 2J4GA 4HZ7A 4QLKA 3WL0A 1E4NA 4CD5A 4Z2GA 3FN9A 5BRQA 3S6TA 5ECUA 4XX6A 4UFLA 4CU6A 1JXJA 3IK2A 5A6SA 4WF7A 5BXPA 4QAWA 1W1YA 1JYWA 3TA9A 1PZ3A 1LG2A 4UOJA 4UZUA 1PX8A 3WUEA 1J18A 5JBEA 4W5ZA 5A95A 3KWXA 2V5CA 2EQDA 4MNMA 1QI3A 5BXSA 2DSUA 1TG7A 2QPUA 1J9YA 2C8NA 3SCWA 4AIUA 3VMNA 2BVDA 3ARWA 3EJUA 1E3XA 4PMNA 1WZMA 1JAKA 1R7OA 2EACA 3VX0A 2VTFA 1E6ZA 4PSPA 1W9XA 3BMVA 5EFFA 1GQLA 3QR3A 4GI6A 4GO9A 2DEPA 3ALFA 1GCYA 2QPSA 1OWQA 2UY2A 3UEQA 4UNIA 1UUQA 4KMQA 2BXYA 2D20A 3KLLA 1NM9A 1ITCA 3ARPA 4OBSA 1V0MA 3WF2A 1UZ1A 1PIGA 4AZCB 4OKDA 1VENA 1DWHM 3GM8A 2FHFA 2VZUA 3MMDA 2C0HA 2VI0A 3VIIA 1CGWA 5GQBA 5D8ZA 1UKOA 2E4TA 2F7QA 4AD2A 1JZ8A 4GI9A 2O9RA 1XD1A 3APGA 1Q6GA 1QNQA 1WZKA 4W8BA 1UWRA 1XGZA 6A3HA 1CXIA 3PZGA 2VL4A 4W8LA 4PUDA 1EDGA 4JFVA 1BVZA 4W7UA 3ZJKA 2XFYA 4WKAA 3A4XA 3N11A 4B9ZA 2GK1A 2GJXA 1UH3A 3TV8A 1E0XA 4FLQA 4MAZA 4DUWA 3QOMA 1JZ6A 1J0YA 3A3HA 1WNOA 1UH2A 3K8KA 1UR0A 3VDCA 4D6GA 3MUIA 1HKMA 1H5VA 1JGIA 3LXBA 4C7DA 2G3NA 3EBVA
chains in the Genus database with same CATH superfamily
2G5RA 4M6OH 3BXWA 2PO6C 4KPHL 3UFIA 2GGEA 4ACTA 1HCVA 1GORA 4LESA 5HJDA 3RE0A 3H26A 4KQ4L 3QY6A 4AWUA 5CBIA 5JPMC 1KJ2H 3A4WA 1TVLA 5TE4L 3VFCA 3CPRA 2X9XA 2QL1A 1BGXL 1E5UI 4KKLD 4KO9A 3UP8A 2JKTM 3DH7A 2XI9A 1CVRA 5T1DH 5C9RA 1OAKH 2NWRA 4M56A 3EYSL 3BSZA 1J7VR 5A6TC 4C7FA 4HIXH 1B0GB 3RWEA 2EUVA 5E2TH 1DE6A 2EKCA 1A49A 2OZ4L 3NIYA 5AVVB 1J0IA 4L6OA 4LOUD 5BZDB 3GDTA 3QQWA 4GYBA 1M6JA 4WI0B 2YR3A 4DNMA 4MA7H 3RZCB 2EDWA 3LSOB 3MRQB 1OPOA 3TPKA 3QW4B 1WGOA 5I15H 4OCRL 4UTMA 2X12A 3BGMB 4P2OD 4ZUVB 2BX5A 1PZ1A 5ABGA 4PMFA 3HB3C 4WKZB 3MREB 3ZUCA 3RU6A 2XNAB 4LSUH 3PABB 4F9PC 2WVUA 2FQFA 3CSFA 3IBOA 1NLBL 4BK5A 1JGMA 4PN6A 1A6VH 4Z7UE 5IVXE 1BF5A 1BVNP 2A9CA 1MVUB 1E0TA 4S3KA 4ZUTB 5FDWA 3W70A 5C6PB 2HTLD 1PDKA 3K71A 2RH0A 3VDBA 4OJAA 5HI4C 1XLDA 2WN3A 4PRPE 4JD4A 3QIBB 4G56A 3PF2A 4D94A 3U4KA 4NNPH 4H41A 5ESAB 4AT6B 3TEWA 2ZCHH 4QY8B 3NQCA 5JXQA 1O95A 3EFDL 2WQPA 4QRBA 4QOKD 1EKOA 1JF6A 4EXQA 2CKBL 3HC4H 3LI1A 1KLUB 3FU3A 3PSVA 4LB3A 4MLRA 1W8EA 1OC7A 3NVQA 4MJ6B 2ISWA 43CAB 1KCUH 1K9EA 3PAJA 5DZJA 3TCEA 1NGQL 4YXHL 4AEFA 1AGCB 5EU4A 4L4TE 2CXGA 4DO6A 5IVNA 3CL7A 2PR9A 2OXGB 3GR4A 3UU0A 5DUPH 4P2RE 2VMDA 1RA5A 2YYUA 4TVUA 4MHBA 1LJYA 4XVTH 3TTQA 1JFQH 1KB9J 1VPOL 2V5TA 5FL1A 1M03A 1ZJBA 2BC4B 3MLZH 3SQRA 2ZKXA 5TD4A 2NW2A 1O5DT 2Y0SA 1E1CA 3SKOB 2D7TL 4FCAA 2YPIA 2RALA 1RLBA 3T6WA 4RL3A 2PEVA 5E1GA 4N0YL 2B7PA 3SIZA 4FR6A 4JM2F 2HNEA 3GH7A 4NFBA 3AZSA 2OMVA 3WFCL 3HEIB 3EAUA 1DANU 4U1LA 3DBPA 3GE7A 2F1AA 5FK9A 4YVXA 4HS3A 4KRTA 5G4MA 3D87B 2DQXA 2NXGA 2UXFA 4ACPA 3CCHA 4YBLB 4QXUH 4Q6IA 2J77A 1XGYH 4XP5H 4O1CA 1UA7A 5ITBH 3CL6A 1XCQB 3W2LA 5DWUL 3IF1B 5C0ND 4GT7A 1FL6B 3PUOA 4NBXB 4QRPB 2YYTA 4LEXH 3D2TA 3DBSA 5JIDA 1KSRA 4M03A 5BXPA 3P74A 2OMTB 3DVIA 2F7IA 5BQDA 4P7LA 3B8YA 4DNLA 1HZLA 3VIHA 5E6SB 2DZXA 1I0BA 1C7SA 4PFEA 1CLYH 2YSTA 4X6DF 5A1AA 3PS7A 2IH1A 3QSTA 4LOVA 5EMUA 4JZOB 3AIUA 4Z23A 5IHZA 5A16A 4GK8A 2F54D 1BOGB 3LQAC 2VN6A 3O0KA 3R25A 2D3JA 3R8RA 1YNKH 4QNEA 2DJUA 1V77A 4ZFOL 5ANMB 1HC1A 1OHZA 1EZWA 2ACSA 4WDTA 4CVWA 3TZFA 2O6CA 5HHXH 3LKQB 1EB3A 1BKHA 1J86A 3WF3A 2R2BB 2Y22A 1XIWC 4K3EH 3G6JE 4LBAA 3U0TA 2GDQA 1P7QA 4S1RH 5KETA 2R29L 4N3TA 4TSCL 2ZICA 3D33A 4WXZA 4A2FA 4BSVA 3LLDA 1FUYA 4ABQA 5E2WH 3CZ8A 1CFSA 3ULSB 3FKUS 1T7ZA 1V6VA 5C92A 4KUZL 3GIQA 5EZJA 1ONWA 5C97A 3TN3A 2XTJC 3EGDA 3CN3A 1YDYA 1P84K 4OCWL 5BV7L 2BNQA 3BVUA 4XNUL 4H6RA 5FKAA 2ICSA 1BBJA 1K7EA 1DO6A 3UERA 2PYFB 2RDTA 5JZ7D 3RWJA 4XWGH 4I1PA 4WHTB 2ON3A 3H54A 4CSPA 4OZIA 3S3JA 2VYOA 5K9DA 2GAZA 2PW1A 1NFDA 4FLOA 5TE6L 3S98A 1HKWA 4HHHA 1QTPA 4L4TD 4P2RA 2YDQA 1KJ3H 1V7MH 5CU5A 2PO6D 4L1LA 5F44A 1XXXA 1QOKA 2YCLA 3DIVA 4OJYA 3P3SA 4YHNB 4PR5B 4Y4KA 1FWGC 2XIMA 2J88A 1MH5B 4CUCA 4DBSA 2V2XA 4NRYA 4XXWA 1EZ2A 2MJWA 3EUUA 3RUGE 2XM2A 3GSXA 1NM4A 4W85A 1C5DB 1INDH 1MJ7H 1YO4A 1RH9A 2G2RB 3DHDA 2EKGA 7REQB 1WKYA 2I07B 4UMGA 1BYPA 1A3WA 1Z9SB 4DJEC 1Z0NA 5K1JA 5JHDB 3K46A 3B0XA 4EI6A 2ARJA 3FFCD 3REWA 5D70L 4QR6A 2VQUA 5C0CE 4Z7VE 1TIUA 3G6AA 3E0GA 1RUML 4AQ8C 1BREA 3I50H 3Q2CA 4HWEL 4YDJA 4BI6A 5EOTB 2ZDRA 3PWIA 5CQ1A 1JHTA 4EXKA 3KAAA 3W87A 4A3RA 1Z5YD 1XF5B 2FO4B 3K2KA 2E9JA 3MV9E 5DFVD 1CDBA 1EBGA 1K1DA 2JBMA 4GQGA 2IKIA 5BVPL 3ZVIA 3SJ3A 4I48B 5CGBA 1AG6A 5E4IA 3SY0A 1PKQB 2QIWA 4JTKA 4KFNA 3QUML 4OIIL 3RX5A 3GX9A 5H4YA 4MA7L 4WO4C 4Z7QF 1K72A 1VBRA 4PUKA 2EYTA 3ARTA 4K5MA 3WS3B 2I16A 4MG4A 3IJIA 4RDQG 1JZ5A 2NTSP 4F27A 5M2FX 3PQYB 4LLUB 3MC5A 4FRWA 3THDA 5F9JB 4MQXD 5AZEL 1V8EA 1NLBH 2V2WA 1KWGA 1SMAA 3FK3A 2VZ1A 3G04B 4HP5A 4ICXA 5FYKL 4L3ED 1R3JB 1BQ5A 1E8XA 4N22A 3T3MF 2WV3A 5PCYA 4AYDC 2ZUNA 4REQB 1FO0L 5A6BD 3PWPA 4J8RB 2Z0BA 4M8VA 4OGXH 3PZOA 2B4CH 4HUWA 1UXSB 1UWIA 5J6HA 2YQ3A 5DJ2B 3HR5B 3OV6A 3KPRA 4K7PY 4JOMA 4RRPG 4PJCA 4UWMA 1FC1A 3QXAA 3IDUA 1QRNA 2OA9A 1P7KA 5EN3A 1IB5A 5AVSB 3EYQD 1KLGA 3GMPB 3NP3A 5D2LE 5BXFB 4PJEB 4EN3B 3GRBA 4HJJL 2EIZB 4HUXB 5IFHL 4AW4A 2PLKA 1KM6A 4Q8NA 2IPKA 4GRWH 3ABXA 3QHNA 4IRZH 3SCQA 3T3PF 3GZKA 4YTTA 5ABEA 4PMXA 4PJ7E 4A2EA 1MIMH 3RRQA 1EUTA 3LHAA 4XWOC 4Y5VB 4ERSL 5ABZA 1JPKA 3PNZA 1PAZA 4JAMA 1ORQB 3KRUA 4C6QA 3MFFB 3PNWB 3RR1A 4NN6B 1TUPA 1XDTT 4KKNA 3NDYE 4NN7C 5F1OB 4Y19B 5MEOB 4RX4A 4Y5YB 4BH8B 2R0KL 3QFEA 1TPEA 4O14A 2WAHA 1IAIM 1JPGB 1Z6JT 2FT8A 4Q56A 4RQQB 1CJYA 2HISA 3BTNA 4P4KB 3GU2A 3IWUA 4FQHB 3RM8A 1F4YH 1AJ7H 1SYVB 3BGFB 3VH8G 5K4ZA 5CINH 3KGTA 3KVDD 1PLGL 4NSKA 1IGIL 1LOQA 5EOCL 4Z2IA 2Q6WB 1ETJA 3DFTA 4PG2C 1X98A 3VNLA 3FQ2A 4JRYA 3W0WB 4NHCH 3IMTA 1I9IL 3WJYA 1XEDA 3LKSB 3ORJA 1NMBL 3AY2A 3GFUA 4QRQB 2J5LB 3VI3B 1YY8A 3WIHA 4IQEA 1CGSL 2WYIA 4F37F 5JXAL 4QHPA 3H42L 4F0MA 5KSAA 4F58H 1OAYL 2E5EA 2EP6A 3F6LA 4JFQA 4IBUA 1BEUA 4FFVD 1OZTG 4U7MA 5GRXG 3ZBMA 4KZDH 5AW7B 3F2LA 3FQ1A 2X88A 1J9RA 1HCYA 3A4FA 3NZ8B 4FNLH 3A6OA 3C2OA 3EGSB 4M1BA 2XJ7A 3M1BB 2C71A 1A1NA 2Z65C 4YNYB 1ZA6A 3ARDB 4XXCC 2VLMD 2WCPA 3TTSA 1XFBA 4LALA 3LOWA 1YDOA 4M5YL 2VAAB 1BQLL 2VQ1B 3RWHB 4QRRE 3W7RA 1TO4A 1EV2E 5E0QA 2J24A 4TV6A 3E74A 4MQSB 4A6YH 1T22A 5C6TL 3W7JA 3L54A 4FTVB 3GHRA 4Z7WE 3GSNA 4DGVL 2HP4A 3KGUA 1BFOA 2Y89A 1BM3H 3CPUA 1QPNA 1EERB 4N86A 1VKXA 2YW3A 4HVBA 4AGNA 1BQRA 2ILLA 2X4QB 3C5XA 9PCYA 1GZ1A 5LNUA 3FS9A 4M93B 2PA6A 4LZKA 4C4KO 4UYQA 4ZQTA 2BHUA 4U3HA 2WIMA 2WSQA 4LT9A 3TSMA 3WH7A 1EEPA 1JTOA 1R34A 4X0NA 3IGSA 5LHFA 4BE5A 1W3IA 4JZNB 4PGEA 3H12A 3PXHA 2ZXAA 4Q4KA 2WPGA 1HSBA 1ZVHA 2DSVA 3IGLA 5LGJB 4B5WA 3MRPA 4NM8L 3WNKA 2POTA 1H0GA 3N6HA 1P7TB 1H4PA 4NQCA 2WQSA 4OCSL 2HLEB 3WD5L 5D9SA 2UZXB 1JPEA 5E6YA 4LKXA 3MUZ1 1I9RL 4X6FB 1JV5A 5D03A 5LDSA 1A1MB 1PZSA 4LSPH 4XNYL 1TU2A 3IU4H 4GKLA 4W68A 1Q63A 5KITA 5T5FH 3C6LD 3LDBC 2LVEA 3W88A 1H8SA 1GG0A 1HKKA 1IAKB 3AMGA 1K8IB 2E47A 5BV7C 5AVWB 5GGTH 3KW8A 3HC0B 4UOW1 1UOZA 1KTLB 3M0YA 1DQQA 4GNVA 1CK0L 2EKJA 4B90A 1DQDH 4PWHA 4IMLA 4YHMH 1MRCH 4TNWF 4D8PB 4W4OC 4FKEA 5MENB 4NQDA 4YDIH 4MA1B 3GLZA 3O0RH 4X98A 2AGJL 3ESMA 1JNNL 2G0KA 3PAVA 4BCYA 1LRNA 4ZFGH 1UOWA 2WM1A 3DPBA 5CO1A 1LK2A 1ZP4A 3D51A 6TIMA 2GBTA 3O3AB 2DQMA 4F92B 1MI5D 4RGNB 4AWSA 4M6OL 5HHQB 1AW2A 2J7FA 1SXAA 4R90L 1MJUL 1HIMH 1MAJA 4J28A 4LCWE 2E7CA 4I90A 1A4JB 1PNCA 3MRIA 4GAYA 4M6PA 5MF5A 1XGTA 4F7TB 3WJLC 1G9ML 2FBOJ 4QTHA 1CZ8L 5GXBB 5A8QA 1N18A 3CH1B 5JIHA 2YDAA 1MIEL 1UATA 2D8KA 3O2VH 4GSUA 4XP6H 3IAGC 3D30A 2ZONA 2YMXH 4WOZA 3LMYA 1CR9H 1TVDA 3G8RA 4GXUM 5DRWA 1O9VA 3VGBA 1RUSA 3MANA 4G42A 2C19A 3WNJA 1S7WA 2VLLA 2ZOKB 3HG1E 3S88L 4YE0A 1JNHA 1TTRA 3KCPB 3L3KA 3M7FB 5EIIA 4I8DA 3PTKA 3CJJA 4KGLA 4MNGA 3DSNA 1MCKA 4PPTA 4ZW8A 1XIMA 2BS9A 3U6RB 3K8LA 3RGBA 2NUPA 1CL7H 1AA1B 5HVHC 3REQB 3RPTA 4DJED 2VVSA 4LSUL 1PHWA 2OKOA 1SYSA 1UZ6F 2D31A 3SKJH 2VN3A 1EAPB 2VE6B 4NNXA 5FB8A 4XXDB 4DWSB 1IE4A 2OB3A 3U2SB 4QG9A 2PPFA 3DPBB 4A2SA 1BMZA 1KXTB 3BYTA 1NGYA 3DHMA 4R0LA 4N2AA 1ESWA 3GU9A 1UBPC 1IBGL 1DFBH 1FNEA 1TOXA 2DM7A 4GRWF 1SF5A 4X98B 4U6YA 2ATPA 5CJ8A 1AC0A 1GZHC 3EMQA 4NJHA 4QM1A 1TMCB 1PQZA 5AWNH 2D4FA 4ELME 1PU0A 1P1VA 1GQJA 2Q8BH 3Q06A 2ODIA 2APVA 2C1GA 1P7BA 3VCRA 2VDRB 2AMUA 3GEWB 3IJ8A 3M17A 5AZEH 4CEXC 1OLZA 1TSRA 2NX5E 1FN4B 4JHVA 5D9PA 5BRZE 3NIFF 1YE4A 3DSNB 2DI8A 4FXRA 3GB6A 3F7YB 1I0DA 3S5OA 1EJ6A 2X2UA 3HGOA 2FKPA 5HMDA 1RIVH 5SWSD 5ADPL 3AITA 4LC8A 1A8ZA 3FFDB 4FYRA 2JB6A 5U4NA 2Q8XA 3QR0A 1R5WA 3HOJA 5KVDL 5C7XL 3F03K 3JWNC 2PODA 3PB0A 3Q8EA 2KZHA 1SO6A 4F3HA 5CCHE 4NQTA 4RNJA 3IMUA 1L0XA 2GC7C 3FK4A 4CDHA 2H26A 4KRMB 2VERA 4QXTB 3QKZA 4IRZL 4MTVA 3ESVF 1N7MH 1M7DB 3G7TA 4MJJA 3CZKA 2QCEA 1GVYA 1PYWB 2PP7A 2X1IA 1QSFE 3REVB 1A6WH 2GQAA 4OGYH 3GC4A 2B08A 4WHBA 3W2JA 5GGVH 1AGEB 1G7IB 1B9BA 4XXDA 4XXCA 4KH9A 4EIZC 3UR5A 1E5BA 3A22A 1HK6A 1A3LH 2I17A 3REQA 5E6ID 5F0JB 5C3LD 2O26U 2TYSA 4K8GA 3Q2DA 3AADB 4MS8C 2EC9T 5F2IA 5GS1B 5CGYC 1JPSH 4JQIA 1VPXA 3ZDXB 4KJQD 5EIIB 1RJYB 5MENA 3OXSA 1SPDA 4Y9FA 4LVGA 5EOCH 3FXIC 5KSWA 1DQQB 4Z7VA 3KP1A 5EMLA 2KL6A 1DXFA 4GFXA 4Z5RA 1UCBL 2ATSA 4PAZA 1K8IA 5AVXB 1PXGA 3M0IA 4JFDD 4JFQB 4ODUA 4H6KA 1E2VA 3GTVA 3QFDA 1TQCC 1JERA 1MHEB 2AFNA 3HIZA 4GKNA 3AS2A 4PD4J 4QYOA 5MI0B 1P6BA 4W4QA 3G6DL 3VWKD 1I9JL 4OAWA 2MCMA 1PKOA 4QGCA 4ML4A 1MDTA 3IV8A 4GMSL 1U92B 3TH6A 2G75A 1QKZH 5TDPB 4W9DC 4RFEB 4NT6B 4BFGA 2UY7B 2MNUA 3EWWA 3X2QB 4TNFA 5A7EA 2D0FA 3CZFB 4OLYH 4Y6GA 1U8LB 2R29A 3VU2A 3O3AA 3QUZD 3LV5A 4ACYA 3AREB 1IL1A 1WG3A 5LBSL 1D5ZB 5I6OA 3HW7A 1C5CL 5DT5A 5GS2D 1H3UA 3M86A 1PLBA 3H9SD 3QZNA 3QUGA 4IIGA 2BMKB 3RX8A 3S97C 4PS3A 1W9VA 4R53A 4P99A 1I3GL 2KLTA 2WJ7A 3CD4A 4P3CH 3RJOA 4AVJA 3AYTA 1GOIA 4AV0A 4LY8A 4S23A 4ZOAA 2VDPB 1BZ7A 4UNUA 2TRHA 2Q7AA 4PMVA 3UJEA 1BYOA 2AJYH 2R0LL 3HE6A 2OFJA 4WU5A 4Y4KD 4HSHA 2FX9L 4AMWA 4GY0A 1KLGB 3GMPA 5JR1L 3B06A 5BW6A 2Y3AA 4OJEH 3SEPA 4OZFA 1ME8A 3WN5A 5IQ9A 3GH5A 1EPFA 4YFDB 3H53A 3TFKD 3WJJC 4FMKA 2QKIA 1KYUA 4HSQA 2EC9U 1X39A 5FW7A 2WZPD 4JZNA 2EPNA 1COBA 3QG7H 4PJAF 2OMXA 3SGUA 5D5MA 4N2LA 1GR7A 1H1YA 1EX0A 3F3HA 2NZ9D 4N2NA 1REQA 4X63A 2EE3A 2X7LA 1IV8A 1KQZA 5EULV 3NFSH 4JHAL 4YWIA 3LNIA 5DJAA 1M05A 1RZGA 1KM2A 5E2TL 3CSBA 3UTSB 3UWQA 4HMDA 1ZRUA 4GXVL 5T9CE 4H8WH 3P81A 3SDYH 1J87A 1QVOA 4M81A 5DD6B 1F8TL 5AOMA 1JNNH 1MZYA 1R46A 4JKLA 2AKZA 3LHWA 4ZD3H 2YPVA 4I48A 2C1PB 4KCWA 3RR4A 1TVBA 2GITB 4G1EA 4R2GB 3IMBA 2CLRB 5KUMA 1OEPA 3S37X 3IGAB 1BAGA 2MKLC 4LIQH 3RM9A 2FO4A 5D8JL 3ZR6A 3FKRA 3APDA 3NZ8A 2HLFC 1A7RH 3A4EA 4Y5VA 1VJSA 1GKRA 2GSEA 3DXIA 5IKCB 2GQHA 2VLJB 3Q5YA 1M42A 2Y5TB 4OGAD 4ELMB 1XL6A 1AUSL 2J9ZA 4AG4L 3G6AB 2QADC 3GTNA 1KGXA 3ZL2A 2CK0L 2EIBA 1KYOJ 2XSBA 4RKAA 4KO5A 4TMBA 2QT6A 3B03A 4QX4A 5J5RA 4I0CC 1S7TA 2VDNL 4HOMA 4M8QB 3B9DA 1HEZA 2INZA 4HU4A 1KBVA 1W17A 5DRCA 3VABA 3QXAB 2VAJA 1XYAA 5GGQL 4WJXA 4IS6B 1UQZA 4AQLA 1ZVNA 1VHPA 3HR5A 1AP2A 3ZK0A 5J6HB 2Q6WA 5I30H 2HZGA 3BARA 3QH2A 3D2UB 4DXVA 3G08B 2LW3A 2ESVA 1ASOA 2V5KA 1RUQH 3GBDA 2E7MA 3GMOA 3NIFE 4ZFMA 3ILQD 4UB0L 3B2VH 1W8GA 1M2OA 5AYXA 4YHNA 4P3DA 4ANUA 3TZVB 1W3KA 4E5TA 4Y9PA 3E3QE 4FXFA 3M7OA 1AI1L 1RIUH 2K7QA 4U1IA 1UJ3C 1KCVL 4AK1A 4DO5A 2XN0A 4LSRH 5D7IA 2ZQ0A 3UWWA 12E8H 4L4TA 4P2RD 5E8DH 1WK0A 3IN0A 2FJHB 2A21A 2G0WA 1AZVA 3OKNA 5LXGL 2BSCA 1G7LB 1K02A 4MS6A 1WUEA 2HE5A 3TCLB 1YEGL 4AZIA 1LD9A 1TZ7A 2WMGA 3T0VA 3PL6D 1ECEA 5J13C 4HPXA 2A79A 2XETA 1FH5L 5CBEB 4QITA 3NQVA 4L4LA 4PBGA 3BH8B 1RZPA 3CBRA 3TJEL 4FXTA 2AKRB 4AMKL 3NYDA 4QNPE 3WUWG 2VXQH 1WE5A 1FFNA 3QMSA 3MZTA 4J8RA 5FACA 5EZPA 2EIMB 1EZSA 4LHQB 1H5BC 1U8NA 4JGMA 4LIQE 1FL3A 4C6PA 2FQGA 5JPMA 3NEEA 5HYEA 1GYUA 2BSED 4WFED 1N67A 2W91A 4ZMGA 1MWOA 3O2DL 4N20A 1RUAL 2N1TE 3U8GA 2Z25A 2NRDA 5CZVL 1UB5A 3VU1A 4C65A 5FA4B 3MRBB 3WFHB 5AC4A 3MX0A 5JHLL 4KJYA 1N0XL 2E6QA 1QHZA 1H9DA 2PAJA 4CVXB 3VO0A 3UAFA 3O1NA 2OQJB 4HKZB 2DKUA 4N24A 1DVYA 5DDHA 1RCXB 3BGFC 1YEJL 3EG9B 2V82A 1IU1A 4J6RL 4S3JA 1U5VA 5CWSB 1KO0A 1XF5A 4KPHH 1X4XA 4OUOA 3G6JF 1PTAA 1EVTC 4KROC 2GJ6A 2VR3A 3UTTE 3A9BA 4DF2A 3N4FA 5I1AB 4TX9A 4W9CC 1JRHI 4R7VA 2ZVRA 1M2VB 1XCQA 5EN2B 4BQBA 3REWB 2PP3A 3KPLA 3VXOB 3DFYA 3QF0A 1IM3A 5T1DL 3CQKA 3EPOA 4DN4L 4FADA 2IAMB 4XTRD 2HJFB 1J79A 5EZJB 1M7PA 1OD8A 3N42B 3ZDXE 4A7QA 2A74B 2YFNA 1BBDH 3JV5A 1T1XA 4L1DA 5GRYA 1P7QB 4WFHE 4Q9RL 2FECL 2Z4TA 3UESA 1QO5A 1I9JH 3DO3A 4BWLC 1HU8A 3NJJA 3MV8D 4KXAA 3ZE0E 2CBUA 3O6CA 5HVFB 3QZWG 5CF3A 1E1CB 3TJ4A 4X0VA 4C60A 3ARGA 4L3EE 4CLMA 4P2RB 4MASA 5HYIA 4RRPM 5ANMA 1RHCA 4MYAA 4TUKL 3ZTNL 1CICC 5L2JB 5E8OB 1EJXC 4APQB 5AAPA 5G5DA 2J27A 2VFGA 5E9DE 4WVXA 5A5WA 1A7NH 4H0GA 2YK1H 4YX2L 2AMGA 4GSQA 3PN8A 2B1AL 1L6GA 3CZEA 4AZHA 5BNXD 5I5IA 2OSXA 3PGDA 2PMZA 5BRZD 4AQOA 3WNNA 3F01A 4XVJL 2EIKB 5I1HL 1SFJA 3JU2A 4BEQA 1FDYA 4DUOA 4Z3TA 2K3TA 3UBXA 5FSDC 1E50A 3HNTL 1IJ9A 1W9PA 3DMMA 1YEKH 2AK1H 3TQPA 4OCSH 1J8HD 3GUTB 4B4HA 1E42A 3HFTA 3L8QA 4K15A 3GRIA 4B15A 1TRIA 2IH9A 4I7WA 1R3SA 3F7VA 2F54A 5I5JA 4OU3A 2A3BA 3CBWA 3A0OA 3DHPA 3P61A 4PS4H 2VWSA 5T3XL 3MPGA 4TUFA 3AU6A 4PW3A 1CLOL 4JFEE 3SOTA 1EO8H 1CU4H 4HDIB 1FRGL 5F4XA 4HU2A 2VDPL 3WFEH 2YXVA 4YLBA 1MUWA 4BFIB 3LH9A 5DBTA 5KSBF 2JKEA 3IDMA 5H1WA 4HN4A 3S2NA 1XF3A 5C0DA 4FQCH 3VTRA 1U8KB 3EKGA 1RBAA 1SQMA 5AAWC 2VDHA 1N9PA 4ZMZA 1K8CA 3QPXH 4UTKA 3QEZA 1E4XI 3HAEG 1JUFA 3SDCB 2PRHA 4FJYA 5K7JA 1R3HB 2HTLC 1BD2B 1XBDA 5D1QC 4ZZFA 3GZAA 5I5RA 4D0DB 2BGNE 3TBSA 3L5IA 1OM9A 2FQIA 3C2FA 3C8KB 1VCGA 1D5MB 4ZPVA 3DV6A 4U3AA 4ZVJA 5IM51 3B40A 4ZW3A 4OZFH 3KTXA 3DX5A 5F0MB 2VLKA 3AM8C 4MMXB 1IHIA 4IIFA 4PUUA 1JUKA 1Z5HA 5LIYX 5FPIA 3N25A 1J1OH 2YGOA 1E9IA 2QUNA 1VFMA 2WW8A 5FJOA 1H41A 2ZPKL 1ADOA 3ONBA 5EA9A 2HH0H 3LCLA 3T3PE 4UQBA 3DG7A 4KHTH 5FA5A 4Z2LA 3RWDA 1Z3NA 1YJDC 1MG3C 2AQSA 2WB5A 5T26A 2D69A 4YHLH 3Q44A 4NZ3A 1LO3L 3L81A 4ZMXA 5EF0A 3TYEA 4R7XA 1TWWA 1AH4A 2NW2B 1GNXA 5JLZA 4WO4A 1RPXA 4OGAC 2IJ0C 4AZ5A 2X70B 3EJCA 1L5GB 4XN2A 1O6VA 3EBGA 1I8AA 1RUQL 5A2FA 5EU6D 4PTVA 3AS1A 3VIMA 5FEWA 2Y8VA 4LCCB 4JREC 3J7HA 4PUBH 3RUGA 4O11A 4O02H 1LG1A 2GY7B 4U31A 3NIFB 3LS4L 1KDIA 3KE0A 3VAEA 3VKAA 4UU9B 3S96B 4LSRL 2YOAA 3TO2B 3E0LA 2O5YL 4LHUB 3S8GB 2PABA 1XPGA 3NYZA 3LSOA 5HNTA 3HKFA 3D39A 4NO3B 3S3PA 3ZLGA 3VGGA 4JTAA 3PV7A 1QYGH 4ONOA 5CGMA 2E0PA 1KBIA 1NFDE 1TX2A 4F8LA 3E8VA 4JDZB 1QSEE 2FIKB 2TAAA 5DHVB 4PY7A 2FMNA 4B5TA 1F90L 1Z44A 2PUZA 1F3EA 1QLFB 1V4YA 1ZE3C 4YN3A 3VOGA 4BY3A 3TT3L 3CMOL 3AMKA 4ANXA 4C6NA 5KOMC 3TBBA 5K9OA 3HC3H 3AWFA 4EN3C 1TFVA 1I7RB 2OZTA 1VHCA 4UTAL 3S6CA 4I4WA 4XCFH 4A63A 2X4TB 5ITFB 3ARQA 4F58L 4PM1A 3IDXL 1ZNNA 5F21B 3P0XA 4AB4A 4PC8A 1IXNA 1AOZA 4OCLC 1XDMA 4JANA 3M7SA 4OZOA 3FO2A 3OGCA 3VA8A 2K1MA 1A6TB 1OF2A 5JMOC 1U8CA 2AI0H 4QRRB 2B39A 1JVOA 3MREA 1F1GA 3W74A 3UP1A 1NICA 2E7HA 2JJTA 3MLXH 3FBQA 2ICEC 2OYLA 1SR9A 3SRHA 3ITXA 4NOBA 2IQAA 4YUEH 3DX2A 2J6XA 4Q6JA 4WWKA 4ZUWB 3VG9B 3VXRB 3IEBA 4LLDB 4DVRL 5CXPA 4AUYA 2Y2YA 5I82A 3RFAA 4EAYA 3CX5K 4QXGH 4D9QE 4ZFZB 2OTUB 4JYFA 5E94A 1OINA 3ZRSA 1EZUA 3L5AA 1T40A 1BM3L 2F8QA 5CC5A 1V7AA 1EXUA 2QQKH 1E70M 2V17H 3WSUA 1M3UA 5HJ3B 2XWBB 4QT5B 1AO7B 4Y88A 2NSMA 3H9SE 5F9OL 4PBDA 4BWUA 1M53A 4WY0A 3ILDA 3P73A 4JHWH 4F7PA 3JYCA 3WHE0 4G7QB 1CLXA 4AYMC 5LXEA 5C9XA 3H3PL 3ULUC 1MY5A 1T89C 2QVKA 2FJKA 1D6VL 2XFRA 3LN3A 4IOTA 3RRXA 3D8MA 1NTHA 1C1EL 3WQGA 2V2HA 2GSGA 3BZ5A 1U58B 4EKJA 5FJUA 2ADIB 1FWAC 1V27A 3X3GH 4XMKL 5C8JA 3DTXA 3PUGA 1ZA3B 2BWGA 4MS8D 4ZMAT 1E4WH 3LZQA 1PWLA 4QQ3A 5FHAH 3IIXA 1CDHA 3S6OA 3QI9C 3F4NA 1GVIA 1KENL 2J43A 1EGZA 4PBWD 1QASA 3PV6B 3I2CH 1QCWA 5K9QI 1PY9A 3MUY1 2BSTA 4PJHF 2JI2A 4QRAA 3VXPA 5FF7A 4B92A 1CCWB 2D7PA 3VWJC 2GUOA 1JWUB 5DRXA 4HC1H 2R2CA 2AGJH 1JF5A 4DZBB 3PNUA 1ZT4B 2HKHH 1VRXA 1Z41A 3RLHA 3CNYA 3MV8E 4GJTB 4TO8A 3N1PC 1E6NA 2G5WA 2VYRE 1E6XM 2CKSA 4FQLL 4N1CA 1IC1A 5DHYA 1ZT1A 1C92A 5D4YA 3M07A 2P46B 2G2NA 3L95B 1S9YA 4JN1H 4LCWD 2J8UE 3U30B 5T3ZL 3LQAH 3U4BH 1JFHA 4GRMA 1G7QA 4AEEA 4LF1A 3ETSA 2PXYB 2W9DL 4NN5B 3LZOA 5HDBF 3WNIA 1SGJA 4AXKA 3TWCL 2GIMA 4M4RA 2YGQA 5BO1L 3R8QA 4C83A 1FFPA 1VERA 2NY4D 4E42A 2POZA 3NL5A 5A6KA 1Y07A 3BQVA 2NY5H 1KFGA 2DQEH 3OX8B 4AGMA 1EQPA 1QSED 1ZQ5A 3QUKB 4R7JA 2J8HA 3FAXA 4G6AC 4K9EL 4US6A 1ZWIB 5SWQA 3ITTA 1N59A 3BSZH 4GBXA 2OL3H 5I06A 1QI0A 3C4UA 4IT1A 3WFEL 4OLVH 2WLZA 1XIWB 5IBUG 3VXUE 4LH8A 4N90D 1QUNA 5D7LB 3S48A 3CUPB 1BG9A 1P5VA 2F9RA 3WFZA 1A6AB 1I2PA 3SIMA 1UXLA 3PZMA 1MCSA 1VFFA 1QNOA 3W7NA 4F79A 1ORSB 1QRQA 1LWJA 2HFEA 4XD5A 2FYMA 3V52H 3I7SA 1F4XH 1Q8AA 1RK6A 3X12A 4HPOL 2QSVA 4JYDA 4CMMA 5ESQA 4K8RD 3RL1B 5TH2B 1DIEA 3T0BA 2PUQT 1Q9LB 2LTQB 3AROA 3RPMA 2YMOA 3NFNA 1UASA 2M83A 4F5CA 5LBVA 2N59A 4UQ3B 5B3NA 1XDJA 1GHFH 4GW5B 2GBAA 4WEEA 1S3TC 1GS6X 3LU2A 2QUUA 1DSYA 1T0MB 3BIBX 3P3BA 4I1RA 2A9MH 1KFWA 2CZNA 2HVNA 4CJ0A 1E4XH 3QTGA 4ONGH 1SVDA 4K5LA 3E96A 5EC1B 3BD3A 4IOSD 1JULA 5IBLD 4LVFA 4AQ1C 1ZL1A 1MFUA 4XNDA 5ACZB 1F41A 5HI5D 5LAXA 2HH0L 1SQ2N 4GQRA 1QSEB 2EDQA 4LO9A 5I75B 1VCFA 2ZRWA 4U7KA 4J3ZA 3B2UC 3H6AA 2XTJD 1FNLA 3PP4L 2NLYA 4KBXA 4K3ZA 4B3KA 4IK7A 1JVNA 1UACH 3UZXA 2ED8A 4B60A 5IQMA 5IBXC 4KKXA 1MHHA 2D2OA 4OFKA 3IPEA 3GHBL 3CV2A 2DQ6A 1ZCOA 3GLDA 4U3CA 3ITYA 1RULH 1O6IA 4IU3A 4RGNE 1I45A 2VEKA 1E6JL 2H47C 3QRGL 3ZE1F 3CZSA 4JPVL 1BQHB 4KKPA 3ZKXC 1KTKE 4DKEH 5ADOL 2VR2A 3LV6A 3GBMH 3JT2A 4EPBC 4S3FA 1A3ZA 4M6MH 2I9EA 4NM8H 2AVGA 5F93C 3VOJA 4EXPX 4JHMA 4OM1H 3MZGB 4ELKA 4Z0JA 5AG8A 5KTLA 4WSKA 3BLDA 1GAFL 1BEXA 3PY2A 1T4WA 2YGYA 3KPSA 4Q32A 4LCIH 4FFYA 1W9UA 4C5ZA 1F4AA 1DQTA 2W9EL 4J1UB 4MJIA 1K5NB 1HNGA 1PY4A 3D18A 3VFSA 1HHKB 4B50A 4XKYB 1OP5H 4LNVA 4M5ZL 5EUOA 4KK9C 5KJ7E 4PRIE 3SCMA 4LYQA 2QLYA 4N1EA 1AANA 3WIIL 3C6SB 5DVNA 3C60A 3L5WA 3APCA 3T3ME 1LEKB 1W5MA 1LP6A 3FOKA 5HGDB 3IIOA 1J88A 1OX5A 1WXYA 5E9DA 2OGYA 1RSYA 4H7VA 2A74C 1AO7D 5CIPB 3PFMA 1IKNC 1V3LA 2IGFH 3QDGD 3QQ3A 5DJ8B 3A6CL 5IW1A 3IDXH 2L04A 2D2CC 4ZFCA 3RCYA 3FQNA 4HHWA 4N2HA 5KVMC 1OIFA 1NAMA 1XWYA 3MV11 3SKMB 3G6JB 1J93A 2W80C 1GVQA 4MTMA 4D6JA 1XGUA 3UTZB 3UA3A 3SJVB 43C9B 3R79A 3Q7JA 1DO5A 1BQHA 4LOEA 1WV2A 3QUXC 1LT7A 3RX2A 4G6FD 3STGA 2Y63A 1SJEB 3U6XA 5G55A 2CITA 4Y9BA 4IJBA 2QCHA 5SWZE 2CKNA 2ZX9A 4TRPH 1MCNA 4P46A 3ITVA 2BSBA 2P24A 4ZODA 2OP4H 2HV5A 3B9VA 1HYSC 3OA3A 5AYYA 2NY2D 2A7PA 5E95B 3V4BA 4LDCA 2VZVA 1IGCL 1HXMA 3JWOL 1E15A 5IDIA 1ZK9A 3TYFA 4FX6M 4PJIE 3IPWA 4X6DB 5IEHA 5C0EB 2VM9A 4ORIA 5ICYA 2OMBA 3US0A 1UT9A 2AEIT 1BWVA 2F0CA 3ZE2B 1CB2A 3DROB 4IMCA 4M0XA 3HMJG 3VSUA 4JQ2A 1V7NH 1EUNA 3DETD 1JNJA 4H01A 2BY2A 4YSEA 4LASL 3JTBA 4M6NH 3MMUA 3CFEB 1AZBA 4M6VA 1FZOA 3T42A 5I19H 1ZSHA 5E00A 1SJVA 1BWKA 4HX1B 4ROPA 3LQZB 3N2TA 3QWRD 1KBGL 3EJSA 1HJCA 1TETH 1IZJA 3I68A 3ZRCC 4ODSL 4KI5E 4WEBL 3HZYB 2PDGA 5D05A 4AY1A 1TJIL 3D5HA 2FUQA 4XIAA 3VE0B 3AHZA 2XQYA 3APMA 3WU1A 1FBIH 1I4FA 4DZHA 5FSEC 1BJMA 2J6WA 3FUDA 4CMMB 4YSOA 4M7JH 1OD7A 3DX3A 1IGYB 1P6FA 1MCHA 1Q9OA 2Y2WA 3MRFB 4M61A 1XIHA 3JRKA 4ZUSB 4R26H 4NAEB 5IHRA 3P30H 2CBPA 3BUBA 3L4VA 5DZPA 4BYHA 4PULA 2VDOB 1AHKA 4HIHB 1XISA 4JNYA 4HUKB 4XZNX 1ZS2A 4I18C 4OCXL 2X4OB 4IK6A 2XWZA 2RJHA 2XDHA 3GHSA 3LGGA 1H9VA 4E0RB 4MBOA 5KS9E 1FGVL 3NO1A 3P5ZA 2C16A 3E9UA 4JTRA 4LOCA 3P0YL 1W54A 4AWJC 4WUUB 3AO0A 2BP5M 1K3UA 1TV4A 4GGBA 1WOAA 4C1KA 1B4TA 1X7QA 1UPPA 5C3TA 5HI3D 5L2KD 2ZUVA 3EGXB 1G7QB 2CJ3A 4HC1A 5CJXA 1QWGA 1HHHA 3ITCA 4DYKA 3EJYD 3L95A 2KERA 1T66D 2WLMA 4MZIA 5GGQH 3E0FA 2QADB 1NCUA 1X6LA 5IW6A 4F3FB 1TVPA 3HO8A 4PTWA 1AQHA 2WCSA 1G1KA 1IC7L 2VW6A 1VRSA 3GJFK 3PWVB 1EP1A 1M71B 4U1KA 5ANHA 2NQHA 5DO2D 4P5TA 3GAKA 1NBCA 3VRJB 3WLLA 3RGVB 1I31A 4N0FA 2A6IA 5JW4M 1EMTH 1IX2A 4UFHA 4E4PA 1RIUL 3QARA 4DKTA 2Y3NA 5ICUA 1XC4A 3DIPA 3N6YA 5DD1L 4LLVB 3OSVA 1E0UA 5A2LH 4L4OA 1V10A 4TF4A 3BZFA 1MW2A 3GHTA 3MS8A 3OWRA 4PB9L 2BVOB 3PJWA 4C1NA 5IBUB 2PDYA 1LO5A 2J2ZB 1E4XL 5C0GA 2K70A 1P43A 4TVPD 1U8IA 2JQAA 4QD2E 2R1LA 3A3WA 5BWAA 4OGQC 4IGSA 3FVMA 1I8JA 3L12A 1KMGA 5DVKA 1ZGLM 3KYMB 3EIFA 4S1SH 4GKSA 3VQLA 5L8JB 3LV3B 4IDLA 2FZBA 2Z31A 4CD8A 1MCPL 3HG2A 3T3MB 2CHRA 3AJXA 1RY7B 5FHBH 1KLYA 4YFEA 3TO4A 1KFKA 4GCXA 1EDYA 2CBJA 4XMZA 3QN3A 4J39A 1CW2A 3BFQG 1JMZA 5D1ZD 2EAEA 2WP3O 1A47A 3QQ4A 4XPFL 5D5ME 4X4YB 1VJIA 5EEWA 1NPUA 2QCFA 3LTPA 3ZHKA 2EDNA 3N4EA 5J57B 3BE1H 3SIKA 5TDOB 2YUXA 3SDAC 3X1NA 1GGOA 4NM4H 3A47A 4O2CB 2XTKA 4H2HA 1S3HA 3SECA 3W7LA 5BXRA 3T9WA 3S8FB 2JLLA 5D2LB 4CGUB 1KM4A 1GPOL 2BY3A 1INDL 1MJ7L 4IFRA 4E9LA 2WHKA 3AG3B 2QSTA 4K7PL 5MKGB 1MWAA 2GJZB 1M6UA 3PFQA 4YSDA 3ZR4A 3TN4A 5DQ9A 5JW3L 4G6ML 4DEWA 2BCMA 3CQJA 2NY3C 2WZAA 3IUIA 2DZEA 4DX3A 3LKRB 1B3OA 4B5EA 1S2AA 1KCWA 3OAYH 4L1WA 3VIFA 5IF0B 3GMNA 3STPA 1FQ9C 3U82B 4WZ9A 5DD5L 5HPCA 3M64A 1MW3A 3NQ8A 3H2CA 3V5HA 3GVQA 3Q6FB 2I9TA 1QMLA 2AJZB 4O4WA 1T7VA 4KKAD 1JYNA 3CFKB 2OR8A 1Q72H 1W72L 3P3UA 4X6CE 3AQXA 4XP5L 2DJSA 1H62A 2P50A 1J0ZA 4GJIA 4LDEB 2HTKD 4OIIH 5T5NG 4JRXA 1A7OL 5L2KE 4ZD3L 1SBBA 3TBVB 3TMLA 4OLUL 3T1WA 3UG5A 3MKCA 3WQCA 2BJMH 1FL5A 3FF7A 1URIA 1WF5A 3DK0A 1J0HA 1POKA 1XYCA 1CYGA 3VKDA 3FFCA 4QGTA 3TSBA 1EEQA 5FYKH 5I0WA 3OR7B 1W37A 4RMTA 1T5KA 2R4SL 1R19A 3O9WA 3GYCA 3SI9A 1EJOH 3LCYA 1Z42A 4JTEA 1UMYA 3KCJA 4FG6D 2IADB 1LO0H 4M3JA 4Y2WA 4GEIA 3WJLA 3CHCA 2QVHA 2P4AB 4ZXBC 1IBHA 3P4OA 4GIPD 2EVIA 1BVWA 5CR1A 4F37K 4OQTH 5I16A 3FEQA 2I5YH 1UUOA 3MCLH 5GSVA 4D3CH 1YN7B 2FWUA 2B0MA 4XBJA 3ZLHA 2AEQL 5JOEA 4KXZH 4PGDA 3A5FA 4OE7A 1FHUA 3WH9A 4ATLA 3QNYB 4V1DD 4CC1A 4W4OA 4YVUA 5FHAL 4J23A 4JDBA 1M7UA 2QIIA 1RZJL 1CGXA 4XP4H 5FGCB 2Q1EA 2FATL 4R7DB 5DTFB 5B39G 5KVFE 4ANVA 3OSKA 1WYIA 1Z89A 3TCSA 2E9WA 3AU1A 4MX7A 4WHCA 5I19L 4MY1A 2UUDK 2GHWB 3K1GA 5E8DL 4TMPA 4Y5XB 2CJUL 3M1CA 4HC1L 3C2EA 2WHLA 4KY2A 5FKPB 2IXUA 4QTGA 4FFTA 4FI6A 2O61A 3NCBB 1EWHA 4YHKL 3EX2A 4N5UA 5A3HA 3QNXA 1KKOA 3V55A 2G5BB 2CNYA 4H40A 3T6QC 4Z2HA 1NCIA 2E6YA 3QO1A 1E6RA 1UZGA 3W9EA 3T6CA 1MCCA 5I6KA 4DAIA 1X5MA 4AX6A 4KXZI 2DQGH 2OMZB 2N01B 5EU3B 3V0TA 3HG5A 5FM4A 1FNSH 4JFPB 3GT6A 2AEOA 3P30L 5LN8A 4DK5A 1FKWA 1TQXA 4A38A 5CKAA 3BPOB 3W22A 3DX9A 3GSRA 4MRCA 3W00A 3CSTA 5DGQA 4N5EC 3VFMA 3FTWA 3TXVA 2WO4A 4AH2B 4EQ2A 4S2CA 4DVBB 4HMNA 5FYKE 2AITA 1OAQH 2AJ3B 1ZLSH 1MUCA 1D8CA 5C9JB 3PP3K 5I74C 4WIQA 3MMWA 4DETA 3AC0A 2AJXH 4S1DC 3D6NA 4LCYB 3V4PA 3CHPA 2JKSA 2EF9A 1KXQE 1NTDA 4JFPA 3I50L 2OSWA 3RVUC 1HDMB 3V4VL 4NZJA 5BRZB 2A3AA 2E40A 1JGLH 2Q01A 4ZX3A 4MNGE 3SE4C 4ES8A 1YEJH 3KPOA 2OFQA 4Q8UA 1RSCA 3HTLX 4M5PA 3VNKA 3X1GA 5DCCA 1NCHA 3EYUH 3C75A 3GSNH 5CEZE 3NO3A 3HG4A 4PN2A 4FJ6A 5HMSA 2DLGA 3AWEA 1P6CA 2WQDA 3HFYA 3BPCA 4AUBA 1IM3D 3HUJB 3NCWA 3ARUA 1G0CA 3OMNB 3B1UA 1TITA 5HBFA 3ZLFA 3RKDC 2PDWA 1MLCA 2DPKA 4MD5B 1TPXC 5CSGA 5H37G 4APQA 4H1LH 4DTGL 4GG6A 3WAKA 4HEMA 5REQA 3MT1A 3QHFL 3QYSA 2K4WA 1Q8MA 4LAOA 1VESA 2V67A 4TVCA 4PVNA 3ZHFA 3NN8B 2O5YH 2J1YA 2W9MA 3AXXA 3WD5H 3DBNA 1RZJC 4HYRA 2ZNWA 3UR2A 1VFUA 2DN7A 3OKMA 1A3HA 4ZQKB 4TNWK 1GGBH 2CLVA 4K3JH 4N6QA 3AY4C 2NXZB 1T4KB 1MVFA 2DTMH 2F2HA 2VC2L 4CJ1A 1OJXA 4HU0A 1QX1A 3NPSC 1U8HA 5EZIL 5MERB 5C2BL 1YYLL 4G8GB 3IM1A 5EWIL 3S1GA 2E74C 4MD5A 2YZ1A 4K94H 1OK6A 1NJ9A 4OOZA 1M2VA 2FDBP 5EN2A 5JHLA 4U10A 5C8BB 3D0CA 3WO3B 2NSOA 1Z9NA 3E8UH 2ADJB 4L48A 5CWSA 3SPVA 1YA5A 4FI7A 5IRPA 1B88A 2R39A 3FUMA 1AR2A 3K4AA 2ZUTA 4B9YA 4G6JL 5C08E 2A6KA 1K8YA 3B3DA 2QJIA 1RJZA 4K39A 4AU0A 5CSZB 2YZ5A 4LFHG 1UZ8A 1ECYA 4PGCA 5IQ7L 1DPMA 2IIJA 4N9DA 4XMPL 2CBVA 3EOOA 1PLGH 5EORH 1ZLVK 4PJ8A 4NWUL 4MWAE 3PHQB 1FTXA 1CR9L 2VSMB 2A2IA 3CC1A 3RVXC 3C8HA 3HE7C 3LXUX 3TM6A 3UTPE 4CVZA 1YTDA 4BJLA 4CBPA 5EF3A 4G6MH 3FJ6A 4UR9A 3QULB 4KRPD 4L8SC 1GIGH 3W2MA 2NXZD 5IB1B 4Z1DA 3OKOB 5IW3A 5GS2H 5LNSA 4EWJA 1QMUA 5LCVA 5HPOA 5KBDA 3V5CA 3FJTA 3N13A 5EU3A 4KGJA 3ZKXB 3QDGE 4ZGYA 4JHOA 5E5CA 3QR2A 2P48B 4JK0D 1T99A 2VJXA 5DXYA 2RQ8A 1Z66A 3ARGD 3RVTC 1NC4D 5HJGA 2VSCA 1SO3A 2YC1B 1EFZA 4CNOA 4NHUB 4OFVA 1EHKB 2G5BA 3U7VA 1QTYT 4Z8FL 1BTCA 5ECVA 2I60L 2Q3ZA 3MRRB 3TCLA 1TWZA 1QPKA 3CIWA 1MY7A 1OYAA 4L4JA 1RBOB 1QD0A 1NOLA 3EO9H 1NCOA 3MCKA 1NFPA 5ACMA 1C12B 1NIBA 3HMXA 4BUGA 1B5TA 1E9YB 1GT8A 3SKNA 4Y5XA 3O4OC 3CFJB 4B5ZA 2EVJA 5TNVA 1JUBA 3RVXD 4NOFA 1CO1A 1ZHBB 3P9LB 4GRLB 1R2SA 3GWJA 1OVZA 2KZ1B 1IT9H 1FFOA 2PCPB 2FBRA 2AW2A 3QJHA 1A4KA 4GKZB 1F8MA 5A8OA 5LNEA 3HN5A 1PZ5A 1BXUA 3OAWA 2A9BA 1XICA 1I3RB 3SO7A 1U30A 1WHOA 4L1SA 2OYKA 3W53A 2PCXA 5IHUH 3W7HA 1MRDH 2P80A 5LIWX 4PRIA 1M04A 4US5D 4AISA 1ID5I 3D2UA 1UR8A 2B7QA 2VCAA 4Q33A 3RCMA 3N18A 4GKSB 1SEQH 1KYOK 3A24A 1U8JA 2E6JA 2IPUK 4IS6A 4G7VL 4NO0B 3QLDA 1KB5A 4XPBH 3S6DA 4U1SA 2A83B 3CGTA 4PV9A 2QQNH 2VWEE 3ILPB 4Q8TA 3KBSA 3FCPA 3QGKC 3ERXA 3VD7A 3U7YH 1UM4H 4DKFH 4KEUA 4LX4A 4CN6A 2ZWSA 4O02B 2E28A 5EMKA 4KS0A 3RX4A 1TETL 3I9AA 4XPHL 2GL5A 4JIHA 4MWAD 2BOCA 2GTWB 4HUCA 4Q6IC 3DVGA 1HJSA 3GU1A 1MJJB 4WI2A 4NQSA 3UADA 5IP4A 3DFNA 1MJ8L 5B80A 3SAZA 2X1XR 2XXGA 4N2CA 4OIBA 2OZ4A 1JD9A 4LU5L 2ZXQA 2V69A 3VXMA 1HYSD 2P0OA 4BF5A 3IVTA 4L7ZA 2L4OA 4MLJA 5M5DA 1VZIA 3O0RL 3KEHA 3EF7A 3RFRA 3QEUA 3VD2A 3CIXA 5AVHA 1JNDA 4AF0A 2DKMA 4OSUH 3KXFB 3BLOA 3TTEA 2ALAA 1KGWA 3QUMB 4OCMC 1IBYA 1P4BH 5SV4A 1ZKAA 4XOEA 5AW9B 3IJSB 1AO7E 1E9QA 3KCOA 3QYNA 3EJPA 3PL6A 3F83A 3QBTB 2CJTA 5F3HA 3ZMNA 1XV8A 1I75A 1EHXA 2FT6A 1RUKL 1DQVA 1UM5L 1KGIA 3U9PL 5LWYL 4W9KC 1FGNH 4YHZH 2FB2A 3ISIX 3KBWA 4H1LA 4WWID 2HRLA 4OD1L 2YBGA 4GY1A 1AS6A 3ARRA 4Q8BA 4RZCA 5F89A 5I1IH 2QADD 2GEEA 4JFYA 2BVYA 5TF0A 4MZ8A 2Q3OA 2JKIS 4QFUA 5FWRA 4XAKD 3W71A 1LWHA 3Q67A 1YPZE 4OZFB 3WUWA 4GA8A 3T2LA 1E4MM 4CDGC 3KTSA 3DYPA 3FN3A 4WU5B 4RZ4A 4XN1A 4UTTC 5MHSD 5AZ1A 1ED3B 3OJDB 2YA0A 4AD0A 1ZEAL 4BF7A 4C90A 4Q4IA 4BZ2A 2J6EL 5J7CC 1LROA 3NPWA 2CIKA 2BCKA 3AT8A 5DYOB 2FEDC 1G1CA 3QORD 4EDXA 1QWNA 5A7BA 2VERN 2GI0A 1EUUA 3EYFA 3OM3B 5DMGC 5FGBC 3CFNA 1OCJA 1CFQA 3LJ3A 5B1CA 1S2WA 4M6QA 4E41B 3W1ZA 4U7SA 4WDXA 1AIZA 4XAFA 3PRZA 2J55A 2YBVA 3HNSH 2IPGA 3TGXA 4GNKB 2PTXA 4ZTOL 3OBEA 1UKSA 1XX1A 2R1WB 1JNLL 3OHXB 4XBPA 3S4SG 2PTUA 5GZND 4LUJA 1NC2D 2ATMA 1MCLA 3H9HA 2A3LA 1S7UA 3PPCA 5HQMA 3KH4A 2ZRYA 1PS3A 3ES8A 3TWAA 1IQWH 1EEZB 4S3DA 5AENA 4GYJA 1LYXA 2G75B 1U92A 2DYPD 5DHXB 1OSYA 1CBVL 4UQ9A 2L7JA 4BQCA 2WD0A 4LUSA 4O1BA 4LXFA 4PRPD 1WWBX 2Y7QA 2X1PA 2R29H 4TSCH 2BVOA 3BLFA 3BUVA 1EGJA 1QABA 1WBJA 3G1VA 1NOFA 4KAQH 3OKYA 5TPWL 4ZMQA 2FFIA 2PGWA 1T1ZB 2PS2A 3VI4A 4Z5RB 3N91A 2DTML 2VC2H 2WN2A 3LHVA 4LLVA 2AANA 2XG5B 4I2XE 1DN0A 2CHXA 1NWPA 5EPDA 4Z7QE 1G7VA 3O8XC 1JPST 3TVAA 2QDEA 1PSKH 2NXYC 2XQYK 4R4BA 3TYCA 1YNTB 2DZSA 3FT1A 2ATAA 3NGFA 5DUMH 4L6HA 2WOBA 4Y1AE 3I4EA 1PBGA 4H1LG 4B16A 2HSIA 1M3JA 1LTXA 3FFSA 4CVUA 5CBJA 4XZUA 3TIDA 1OGAB 1NP2A 3RYSA 1UWAA 1WAWA 2FSEA 1XL4A 2A38A 5EBMB 1V6TA 2J7CA 3FZUD 1JCKA 2GVEA 1KCRL 3EZ4A 1WA3A 4P8UA 4XV0A 3U1SL 4DO7A 1VGEH 2NX9A 3UPMA 3QQ9C 4TRPL 1AYRA 3BSZL 3EFFB 3H2EA 3BX7C 2MPAH 3H9SA 2Q76B 4WI7A 5IQNA 3UX9B 4A68A 2WO3B 1MZRA 1Q72L 4G6KL 1OAZH 2CAKA 2G3XA 1F3DJ 4JO3L 3U4AA 3GW3A 4XZBA 3GPEA 3ZVHB 5AB0A 4HNUA 2R7EA 3KDMA 3TA3A 4XAGA 5ACLA 1G94A 5KAQF 5F2MA 4JREB 1ADQH 3HMXL 1FN4A 3HA0A 3B7SA 4L37B 1ICSA 1V7NL 2RKXA 1KGCE 3SZKC 5E93A 4EUPG 2IDQA 4E0CA 3FU7A 2F7OA 3O8XB 1AG0A 3QEGH 4RA0C 3FFOA 1N6QH 1QFUH 3BQUB 3UTQA 1YEYA 2I60H 1MFNA 3N42F 5F71A 4BQ8A 4JTHA 4ZPTB 1I85C 4OB5H 2FZDA 2A9ML 4MNQB 4OF8A 1NGYB 3GSOA 3V5KB 2R8SH 4GE8A 5IJVB 5L0QB 4JM2A 1L0YA 1QFWI 3V2AR 1R0AL 3GNOA 4DWSA 2H3NA 2VXTH 1QG3A 1EFXA 1WRFA 5EU6B 4NFCA 3CHRA 1X5HA 1MHHB 4P2QD 4UDTA 4INFA 1ZAGA 5IFAH 1LUCA 3KL3A 1YTEA 1EEYA 2DQWA 4M7JL 1OARH 2W59A 1JL8A 4GG9A 5F2LA 2H4EA 4IGHA 5AYQA 5IMOB 3SFKA 1FC2D 2YD0A 4GQ9H 5AOLA 2VW7A 4QROA 1I8IB 4EEEA 3SO3B 4X6DA 5IEHB 3AFLA 4GPVA 1EO5A 1DUYB 1EGJL 3HCVA 2Y36L 3QGVA 4N25A 3D52A 3SBRA 3PWUB 4ALAH 1EC9A 2A0NA 1EBHA 3G5XA 1JFXA 2QV5A 4O15A 3CDZA 4G7VH 1OT4A 1XIBA 4LEQA 1CTNA 4KVPA 1QQDA 2H2SC 5C2UB 3RIAF 3EEZA 4MADA 4ODTL 4YLWA 3UC0H 3D50A 1UA3A 3CZGA 2PE4A 3DK2A 1AS8A 4JZJB 1DJQA 1GYWA 1FJ1B 1UR1A 3KRBA 1UM4L 1SPQA 3M5VA 5ALCL 1E30A 3NJFA 3EYOB 4GAYB 4OIFA 4CAGA 1A4JA 3MRIB 5J6GA 1BQHG 4GS7C 3BURA