1F7BA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL-NEURAMINATE LYASE
molecule tags Lyase
source organism Haemophilus influenzae
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
total genus 127
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f7bA00
2KZHA 3MP4A 1UCWA 4L4LA 2YGYA 4Q33A 2NWSA 5FEWA 3W70A 4FNPA 2QCMA 4R7JA 3UWVA 2YPIA 1K8YA 3TXZA 4K8EA 1MEIA 4X3ZA 2QCHA 5CSSA 4UTTC 4E2DA 3NM1A 4O28A 1TPUA 3BGJA 3KFTA 4QM1A 5D30A 3BW2A 3MP3A 3SGZA 3L2IA 3OG3A 3LBMA 4Z1AA 3LGEA 3NR0A 2E6FA 3R89A 1JCLA 1YTDA 3G24A 3N9SA 4JTEA 3LI1A 3L5AA 4A2SA 3NYZA 2NUXA 2UV8G 4XZ9A 4IJBA 2PRHA 3F03K 4CQ9A 2E5BA 1VRDA 5K4ZA 3SFKA 1DL3A 3LM7A 3CC1A 1QFEA 3PSVA 1YDVA 2QF7A 2H8XA 4JICA 4K6AA 4BWLC 1P5BA 1ICPA 3QZEA 4EWND 3W1PA 4UC5A 4DO5A 4Y6GA 5FF0A 1KFLA 3C6CA 3TW7A 1LRTA 3TJXA 4ORMA 2V2HA 4JTKA 3LHYA 3EXTA 1LOQA 3NQVA 4NT0A 4UCGA 4ORIA 2V0TA 3GVGA 3CPRA 2Q3RA 2FFCA 1TPWA 3FJLA 3A9IA 1OYCA 1XDLA 4MY8A 4BF9A 4K7YA 4JTUA 2J24A 2C18A 1TPH1 1GTHA 2GQAA 3N14A 2RHGA 1H7NA 3GDMA 5E1QA 1HUVA 4IQLA 3FOKA 4CQAA 3NM3A 5AOUA 1EP3A 4AWUA 2X2GA 4WUIA 2B7PA 4K7VA 1GG1A 3QSRA 3UWWA 4KWVA 4ZVJA 3LHVA 2BTMA 3QC3A 4UIOA 4Z08A 2WO5A 1DBTA 3PVFA 4LY8A 6ALDA 4JN6A 1QWGA 1EA0A 3H55A 4AF0A 4JY9A 4UFIA 5G2HA 3C61A 4JDYA 5BW6A 3HQ1A 1H7RA 3RFAA 1L6WA 4DPQA 3T40A 1N55A 1XUZA 1YPIA 2JKPA 5F4WA 4UTWC 2OX1A 1ICSA 1W5MA 4O19A 3UY8A 4JY8A 4ML9A 4Y96A 2A7RA 3ZFHA 1K03A 4DBEA 3VKJA 1LOLA 4G1KA 2R14A 3NPVA 3W7PA 3MWAA 3CWOX 4OHQA 1KLZA 1W1ZA 5LKYA 3IVSA 1GT8A 5BMXA 3TMQA 3L21A 1ZAHA 3MI3A 3QQ0A 3H53A 2ZZ5A 3JS3A 4B5NA 2RH9A 2WSRA 3HJZA 4ALDA 4JTGA 4UMBA 4JTJA 3GX9A 3CTLA 5FF2A 4UTLA 3BO9A 1SR9A 2GPTA 2Q8ZA 1XXXA 3GKAA 2ISWA 3LB0A 1KBIA 2HSAA 4IXXA 5D38A 4UXDA 4DO4A 1QAPA 1ZALA 1THFD 4TMBA 5H2ZA 3KOFA 4UFJA 3HMJG 3LDVA 1FWNA 1VGAA 2CWNA 1ME9A 1IXNA 4LVAA 4CNNA 3L0NA 1SW3A 5G1YA 1H60A 2NX3A 1VS1A 3C2EA 4HPXA 2DZUA 5I3KA 2VFFA 3BLIA 3PY2A 2FB2A 4O53A 3W7GA 5D2YA 3N9RA 3OVRA 2V8ZA 2YXGA 5TBOA 4MIMA 3W83A 5D2WA 3IIOA 2DORA 1F73A 3G1AA 1F2JA 4O13A 3NL6A 5FF4A 5HULA 4TR9A 1XI3A 3DFOA 3FKRA 1JR1A 5EPDA 3WJXA 2QAFA 3Q2DA 3TMLA 3LXAA 2NV1A 1LZOA 1C29A 3GXPA 2ZRWA 1HL2A 3M5ZA 1LP6A 1FUYA 2FTPA 1LM1A 1OYBA 4RKAA 2QDHA 5DN1A 4WXZA 3ANYA 5DCEA 3TDFA 4E0CA 1A50A 4TIMA 1TJPA 5LGZA 1LORA 3HBLA 3M43A 3W86A 1H1YA 3B03A 1EWEA 4ZMGA 2VC6A 4Z1CA 5U7SA 3W2KA 2FPTA 4QISA 3UQNA 3MHFA 3W1AA 2DZTA 3AO0A 1G69A 1NEYA 5F2IA 5KITA 1L6SA 4O1BA 4ZQCA 5CZ0A 2XFWA 3QRHA 4OWGA 3N2MA 1ZNNA 3CEUA 1T96A 5CSRA 3G0SA 3NZRA 3S9YA 3G1XA 1SFLA 3W88A 3B0PA 3PBWA 1F76A 3W74A 1RD5A 3W7CA 1PVNA 1L6YA 1VZWA 3W1UA 1JRBA 2WKJA 3UWZA 3E0IA 2I9EA 5EA9A 2CLMA 3TCEA 2CZFA 3NQ7A 3P82A 5EMUA 4RLIA 4O4WA 3QH2A 2C14A 2WNQA 1OX6A 1XDMA 2GOUA 3ATYA 3S1UA 1O5XA 3DI0A 3I6RA 4NJKA 3W1TA 4JXCA 4LW7A 1LCOA 2YW4A 1KFBA 1YLVA 2NX9A 3B05A 3DU0A 4K8HA 3MYOA 1N7KA 3HGOA 3S5ZA 1F7BA 5F1VA 4WY0B 4IXHA 4ZQRA 1O94A 3HF3A 2QUTA 2G5WA 4CCDA 1TRDA 3O16A 4I7UA 1Z48A 3TFXA 1QCWA 1WOAA 3KAOA 4WOZA 4XTDA 1ALDA 2BXVA 3U6WA 1I45A 3QQ1A 3KHJA 3PF3A 4O1CA 1R2TA 1R46A 1BWKA 5LHEA 3O07A 1EP2A 3DXIA 5EYWA 2P0OA 3A23A 3S1XA 3T78A 3NQGA 4AWSA 4N9EA 4IUOA 1FCVA 3NOEA 2VEPA 2TSYA 3AJXA 2E6YA 3GKFA 3SY5A 1HG3A 2VFEA 5K9XA 3NQ8A 1F6PA 3OVQA 1G67A 2V82A 3A21A 3ELFA 2OT1A 3MJYA 1P0NA 3P80A 4PCFA 1QO5A 1Q6QA 4IWWA 4LS0A 2CZDA 1K8ZA 3EX6A 4IMCA 3FS2A 1MEWA 1JQVA 3C2RA 3UYCA 2TMDA 1G7UA 3PUOA 1AW1A 4LVDA 4P2VA 2OMAA 4NJJA 3S0CA 2C6QA 3O1NA 3W85A 2V5BA 3TIMA 3LBCA 2XN2A 2I14A 3QW3A 1A5BA 3C0JA 1QOQA 2EHHA 3HG3A 1FX6A 2WOQA 3GDKA 3CLMA 1K3UA 1R30A 4ZQOA 1LLZA 3WFAA 2V30A 2Y7EA 5KZMA 1KM0A 1Y0EA 3TU9A 1DJNA 3PM6A 4LV4A 3DKJA 5HUOA 3R8RA 1M7OA 3GDRA 3MUXA 2Z0IA 3N19B 1R2SA 3IV3A 3NQ6A 1EUNA 3LHTA 1SUXA 1JCJA 3M16A 4RV8A 3W1LA 2NZLA 3M47A 3NQ2A 4KFOA 1DOSA 5D02A 2V9DA 4ADTA 2R8WA 4AHPA 3O6DA 4JTLA 3FFSA 1JUBA 2C0AA 1TMHA 1Z41A 4AAJA 2NUYA 3P8JA 1I2RA 1IF2A 3PB2A 3T4CA 1AW2A 5FF7A 2PCQA 3BARA 3MBFA 4TX9A 4S2BA 1EPXA 3G1VA 3GZ3A 2O7SA 3W1MA 5EKYA 2YX0A 1SW7A 3LI0A 3L5LA 3E9AA 1FBAA 4CQ8A 4LRSA 4LS2A 1KM1A 4JTSA 1FCQA 3PC0A 1RQEA 3C3NA 2HS8A 2FDSA 1OFRA 3O06A 3TAKA 4LV9A 2CLFA 1H7XA 1Z42A 3PB0A 1Q6RA 1UUMA 4BI6A 5D03A 2X30A 2E5DA 2CLKA 1A5AA 4MJMA 1VCVA 2A85A 4M6VA 3HIJA 3MI2A 4UFHA 4EOUA 2JGYA 3THQA 5G5IA 4XBKA 4JS3A 2FLIA 5EBUA 4MPQA 3PUEA 2A0NA 4OGZA 1ME8A 3LERA 3W3OA 3G3MA 1H50A 1QNVA 4JX6A 3IRDA 4RCXA 4GXMA 5A5WA 3BG3A 4IMEA 4ZQMA 1ZAJA 5K2ZA 1ICQA 3L0KA 3TQVA 2V2DA 1YYAA 4LOCA 2EF9A 4OBTA 4DQWA 3FYOA 1P1XA 2P1FA 1KW1A 1VHCA 2DZXA 2W6RA 4MY9A 3WK2A 4Z0JA 3HB9A 1A5SA 3Q58A 2NX1A 3CM4A 2RDTA 3S5NA 3HGSA 3KRZA 1LLWA 4Y8FA 2JKEA 3LOTA 5LNVA 1G4PA 3NA8A 3W73A 3W22A 4K37A 3W71A 4O54A 1V7YA 1LYXA 4N4QA 5HMSA 4NNAA 3GNDA 1RV8A 4QNWA 4N6EA 3U2OA 1FWWA 4PL2A 4UNKA 1TO3A 2Y7FA 4NVTA 1YADA 3BV4A 4NZFA 2TPSA 4Y90A 1WV2A 3B8DA 3M7WA 5FF3A 3TJLA 3GDLA 2NXGA 1LRQA 1GVOA 5D09A 4W9TA 4IMDA 3M5YA 4ADSA 4Q32A 1K02A 1MEHA 2Y85A 3W2LA 1LBMA 3W1NA 1KV8A 2W79A 3IGSA 1QPRA 1VYPX 2GVJA 5CZJA 1SO4A 1Q3NA 3G0XA 3WJSA 3VFLA 3W7OA 1ONRA 2HTMA 3QMRA 1TQJA 3BVJA 4FNSA 5AYXA 4JNMA 3PBYA 4JX5A 4QJ1A 4HSOA 1FWSA 3NVTA 3SSJA 1OK6A 1RQHA 1YXDA 4NUWA 5AC7A 4R53A 1GOXA 1XBVA 2B4GA 4O14A 1GVSA 5AB3A 1OABA 2AQWA 4LS1A 3G18A 3SZ8A 4POCA 2H8ZA 1XL9A 1O95A 3MP5A 4LUIA 5FI8A 1RPXA 1CX9A 1E51A 5G4EA 3LRMA 1XBXA 3EX1A 1W54A 2C13A 3FIGA 3JR2A 4O11A 2NV2A 2C15A 5KSWA 3QPZA 2YFNA 2WSQA 3DHFA 4Z1DA 2A6NA 4DF0A 1AL7A 3W7MA 1NF7A 3THAA 1RQBA 1OFDA 2DP3A 2FPVA 3LLFA 4M5PA 2ZRVA 1VH7A 4GUIA 4O52A 1ZJIA 2WJZA 3IIZA 1AG1O 4QAIA 2PC4A 1ML1A 1TV7A 3STEA 2A5HA 2Y89A 5EL1A 3M41A 3B0VC 4RXFA 1FCBA 2RFGA 3DHDA 2E1DA 1TPB1 4LTSA 3RK8A 2X1UA 4YXGA 3BG9A 3PBUA 4UTJA 5TIMA 2R94A 3VE9A 2VELA 1TB3A 3QMSA 3C52A 1CW2A 3NPUA 1H61A 1BEUA 1I2PA 1VCFA 4N02A 1PCKA 3T55A 1CI1A 3A5FA 2FIQA 5AN7A 1SO6A 2J9ZA 5E0KA 2V5LA 4GUGA 4M6PA 3EKZA 2OCZA 4I7VA 3P5ZA 3I65A 3STFA 3W7DA 2QCDA 2A21A 3R13A 4GNJA 3HPSA 5I3FA 4O0ZA 5LZLA 3EB2A 4X22A 7TIMA 3GK0A 1PS9A 3L67A 5HUPA 2Z6JA 4JR5A 3UNDA 3W7HA 3QM3A 4HKPA 1X8FA 3NQMA 3O6CA 1SFJA 4FX8A 5K9CA 3TNOA 1UB3A 5FEZA 3TC6A 1EIXA 4O0KA 2YCEA 1SU5A 1S5VA 2BWGA 1EX5A 2J88A 3W75A 3A24A 3QFEA 5T26A 4TU1A 1OJXA 3PUDA 4UR8A 2J9XA 5G1TA 1VQTA 5HINA 3DBPA 4HNVA 2ZZ4A 2EAWA 2E09A 1OG0A 1TPEA 2X1TA 4LT9A 3FYPA 4O16A 3TSBA 4XKYA 4MLRA 5D37A 4U4MA 3S6DA 4J9JA 1G7VA 1JRCA 5L9FA 4XQ6A 2ZRXA 2VEMA 3M9YA 3QSTA 1WBJA 1TRIA 3NO5A 4DF2A 4FNUA 4WD0A 4X9SA 4X2RA 3M1ZA 3S42A 5G2WA 4FIRA 1GYNA 5HWJA 1XKYA 3WJZA 3L9CA 1KTNA 4MFEA 4XUGA 2NXIA 3NNTA 4OT7A 1IXQA 3WK0A 4UFLA 4RZ5A 1QDSA 2V2CA 1OFPA 1GWJA 4NU7A 3UY7A 1QPNA 1VJIA 3UXAA 3O8AA 4UFMA 5K3VA 4WX2A 2J27A 1M6JA 3UZ5A 2EPHA 4XKYB 4CNPA 4PH6A 1TIMA 3FLUA 2VOMA 4RJEA 5D04C 4MUZA 1PCWA 3P84A 4U28A 3W2JA 3EWBX 4JYEA 3TC7A 3KVKA 4GUFA 2Y62A 3HOJA 2CLHA 3MHUA 1NFBA 3NPWA 5AHFA 1Z44A 2ZDRA 3EKLA 3DENA 4LVGA 4UTHA 4JGDA 2QCGA 1G4EA 2QEZA 1T99A 1PE1A 5I3JA 1OX4A 4NZJA 1W37A 1RR2A 2VFIA 4JTIA 3IGUA 4O12A 5LGXA 2ZCGA 3M0ZA 2X16A 4BFAA 5DCDA 2BZNA 3LRLA 5LHFA 2Y6ZA 3GDTA 1OF6A 5CPLA 1SPQA 1VHNA 1BWLA 5F1UA 1AMKA 3ABRA 1W56A 5MHBA 4O50A 3TW6A 1BTMA 1RZMA 2B7NA 2QCDB 3SI9A 1JCYA 3W76A 1M7PA 2FQIA 1L9WA 2CLLA 3NGJA 1ZAIA 1G4SA 4JYFA 3C4UA 1I2OA 3GXNA 4Q4KA 3KRUA 1WXJA 1WQ5A 1DORA 2Q8LA 3UWYA 3G1FA 4LUJA 4WQ6A 2WNNA 5G2IA 2B7OA 1XM3A 4M6QA 2ISSA 4OE7A 1TTPA 4IMGA 3DFNA 1JJKA 1QMLA 2GQ9A 3IEBA 3TROA 2GQ8A 4N9DA 3UWUA 3K30A 1LBFA 3NQAA 2X1SA 5CPNA 5C55A 2GVLA 6TIMA 1O4UA 3DFPA 1TPFA 1WA3A 3BPWA 1OX5A 4MFDA 2VFHA 1I2NA 2CW6A 3UPWA 3O6YX 1SZGA 2XN1A 1OK4A 4EVZA 2DZPA 4M7TA 4Z1BA 4JDBA 1XCFA 3LXCA 3MI6A 2CZEA 1KFJA 3STGA 3CIXA 3TKFA 4R34A 4QQ3A 1HFBA 4S1FA 4L4MA 4PL1A 2ALDA 3NZ1A 1KM6A 4QIUA 2VENA 1YDNA 4HPJA 1SZNA 3G1DA 4MZ8A 5DY3A 2QR6A 4I7WA 1R2RA 1SW0A 1TV8A 3OEXA 2ZZ6A 3E12A 1Q6OA 2ZA3A 1F74A 1NVMA 3W6YA 1P0KA 4WZHA 3S1VA 2A1YA 4HNNA 1F6KA 1TJRA 1W0MA 1PV8A 2HS6A 4A21A 3W7KA 1K7FA 2JKAA 2YSWA 2DZSA 3SECA 4DBDA 3FEMA 2A2IA 1T0OA 3G1HA 5BMWA 1KLYA 1FDYA 3LCWA 4UUIA 2CZ5A 2GVGA 4LC6A 1KM4A 3WJYA 1LRNA 1ZENA 1NF0A 1S3HA 1OF8A 1GPWA 1OFOA 3GR7A 2RDWA 3BG5A 1H7PA 2DZVA 3N73A 3BLFA 2VKZG 4HSNA 3QYQA 4UR7A 1TYGA 2ZA2A 4DXVA 3W1XA 2BX7A 3NDOA 3UD6A 1VLIA 1QO2A 4OV4A 1B57A 4MZ1A 4ZZ9A 1K7EA 2W0UA 5F4XA 4RR4A 3GXTA 3EX4A 1GVQA 3WK3A 3SW6A 1J5TA 3N3MA 4FEZA 3U8GA 4XWUA 1Q45A 1DQWA 4C1KA 1TPC1 1B4EA 5SWUA 3KX6A 3RLVA 3O05A 4AXKA 1P4CA 1U83A 2JBMA 3S8HA 3W87A 3G1YA 2ZA1A 5AYYA 3C2VA 5F2LA 3TSMA 3FJ6A 2P10A 3FA5A 4FB7A 4NJGA 4JTFA 3NL5A 3R2GA 5HQEA 4MYAA 5D2TA 4LRTA 3HPXA 2Y70A 3SJ3A 1M5WA 3NL3A 5C5YA 4IX2A 4DF1A 4TMCA 1GVFA 5E93A 4PA8A 1TSIA 5CPMA 4DELA 2YFOA 4CLMA 2PE4A 3LCGA 2DJXA 5HWNA 4NNCA 4YLWA 2GJLA 4ZQNA 5K7JA 4FF7A 1KTCA 4RZ6A 3EWUA 4M19A 3W7QA 3CT7A 4FIQA 3EWXA 3LTYA 3KXQA 1ZY9A 3LCFA 3W1QA 2AAMA 2AGKA 4YCPA 3HG5A 3TE9A 5FEPA 1WOBA 4O17A 5L6UA 1PIIA 5DCBA 1LBLA 4NX0A 2CLEA 2QCEA 4FNRA 3KVLA 1H7WA 3NQDA 1GEQA 1MSSA 4UTWA 3ATZA 1JCXA 1LROA 1JQXA 4MJZA 1C9DA 3O15A 1H1ZA 5KMYA 3TQ0A 4M7SA 4O1AA 1JCMP 4H3DA 3BW3A 3W7JA 3INPA 2PRMA 3B4UA 4NJIA 3KVJA 1D3HA 3UWQA 1VYRA 4LWWA 3TR2A 1VPXA 3UPBA 1SQ7A 5HR6A 4MOZA 4ICNA 1DQXA 1W3NA 3PWAA 3W23A 3TX9A 3V75A 3ZWTA 1TPVA 1C8VA 1FXQA 3B0UX 8TIMA 3LX9A 1IIHA 4IX0A 2E77A 3DI1A 5DXYA 1SO5A 5AHLA 3IIVA 1YTKA 4A22A 1EP1A 2B0MA 2E5CA 2NXHA 1PHQA 1X1ZA 1VYSX 3NL2A 2VFGA 5CGQA 4AWTA 1XBZA 2ZZ3A 3BGGA 3N2XA 3G0UA 3GIYA 3PULA 4C1LA 1YXCA 2QCFA 3BK0A 2H6RA 3QW4B 5DLCA 3ZR4A 3NG3A 2Y63A 4H6KA 3GAKA 2X1RA 4A3UA 1YDOA 4EF9A 2ZFAA 4NJHA 5DY2A 1Q6LA 1FCUA 3BLEA 1KFEA 3IIXA 5F4SA 4RZ4A 3UZJA 1I4NA 3RF9A 4JIPA 1W3IA 2NWRA 3QPYA 3MYPA 2BLEA 2OZ0A 3EWYA 4FXRA 1FXPA 4MLJA 3BW4A 1J2WA 1SZFA 3P60A 3PG9A 4K36A 4GBUA 2QUVA 3I7RA 3W1RA 3CQ0A 1B3OA 3OBKA 1H51A 3PR2A 4GUJA 5KTLA 5CPOA 5I3HA 1GYLA 3LV6A 3CIWA 1DV7A 4UTUA 3A5VA 4MVAA 4E2BA 4N9CA 3HGJA 4OQVA 4HNTA 1XC4A 4GE8A 5K9DA 1JUEA 5KZEA 4LC8A 4O10A 3LCLA 4LU0A 2DZWA 4JTTA 5BRBA 1H62A 4WY0A 2YR1A 3W72A 5I3GA 5AHIA 1XFBA 3TAOA 3W7IA 4GWEA 3E96A 3QF0A 4HT3A 3E49A 3KVMA 2C3ZA 3VI2A 5AHNA 4N9BA 3EWZA 1FDZA 4CCEA 1SO3A 3HG4A 5C2XA 1B9BA 3TXVA 1KM3A 3LHZA 2I1OA 1OFBA 2RDUA 3QEZA 3LLDA 3OVPA 4AEOA 1V5XA 3W7RA 5HWMA 3R5EA 3STCA 4O15A 5AYZA 3T44A 2WNZA 2A6LA 3DKLA 1QR7A 1LOSA 3L68A 2QCNA 2ZTKA 1LTDA 2RKXA 4PODA 2E6AA 5CKSA 1D9EA 2GJNA 1KFKA 4JX4A 3USBA 4A29A 2H3DA 3B06A 3PSWA 1T8XA 1W5PA 1IIGA 4MKNA 4UNLA 2HMCA 1H63A 1KA9F 1I2QA 3RNDA 4K39A 3YPIA 1EB3A 3LXBA 4NX5A 3VE7A 2ZBTA 2Z6IA 3I7SA 5AHMA 4HNUA 5LNUA 3QJAA 4EIVA 3D0CA 3GYEA 2H90A 3E02A 3NAVA 3LCHA 1IXPA 1W8SA 3PS7A 2WQPA 5IBXA 2CLIA 2QJHA 2F7FA 1W3TA 2PURA 3MW7A 4WJEA 2XN0A 4IMFA 2V81A 2ZZ1A 3IVTA 4UTIA 2EGZA 3ZS4A 2WSYA 1FQ0A 3GLCA 1TV5A 3TK7A 4QITA 2WV8A 3L0GA 4GFSA 3Q37A 4UMAA 5K4XA 2LLEA 2QCLA 3T7VA 3P62A 4Y9AA 1F5ZA 1YPFA 4EF8A 4KFPA 1TTIA 3IVUA 4CCCA 2OT0A 1WBHA 3RMJA 3WJWA 4ONVA 3CB8A 4IPJA 1OVDA 4BK9A 3TV8A 1KBJA 2C19A 4PEKA 2CLOA 2ZYFA 3JRKA 3HPZA 2Y7DA 4FHAA 1JUKA 1TREA 3C8FA 5CZSA 3S5YA 2G95A 3DZ1A 3EWWA 4O1DA 5J5RA 1RVGA 1MXSA 3GB6A 1OHLA 2C1HA 3KRSA 4FX6M 4N6FA 2J9YA 4XTIA 3TA6A 1SSGA 1W5NA 4FNTA 5KINA 2OJPA 4S2CA 1L2UA 4UTKA 5FESA 2TRSA 2D73A 5DELA 3MHGA 3M5VA 3HG2A 1R47A 2QKFA 1JCNA 1YTEA 1EUAA 1GG0A 2YYTA 1FWTA 3PAJA 5LNSA 2VEKA 4P61A 4AHOA 3IIPA 1FDJA 1KM2A 4JTHA 3G8RA 3F4WA 1J4EA 2ZZ7A 3L65A 2ISVA 4YWIA 3CU2A 1KV5A 1G6CA 3MMTA 3P7YA 1O60A 4O57A 4XBSA 4ZQPA 2FB3A 4AHQA 4AH7A 1ME7A 4GC4A 4CNOA 1UUOA 2ZTJA 3C56A 4YMZA 5FEXA 3TUUA 2A7PA 4AF0B 2E68A 2ZRUA 1H7OA 4WXYA 2YW3A 4DPPA 5F2GA 3GNNA 2Z1BA 1W5OA 3VNDA 4AB4A 4NXKA 2H3BA 3H54A 1GJPA 3DGRA 2QDGA 5U4NA 4RK8A 3LTPA 1VC4A 5D33A 4OU1A 3QMTA 3G22A 5ABTA 5DBUA 1ZCOA 2F84A 2YYUA 4K38A 5I3IA 3MBDA 3W2NA 1U5JA 1FWRA 2VXNA 1AK5A 1G4TA 3W7LA 3GR8A 3W7EA 1QOPA 1TQXA 4BI5A 1GZGA 2TYSA 5GVJA 2CFFA 3NQCA 1VCGA 2ZZ2A 3LCXA 5CZTA 4AVFA 2NLIA 3PG8A 1H5YA 1UASA 1DJQA 3F4NA 4BR1A 2R91A 4DEFA 5G4WA 5HJLA 4QSHA 2FPYA 2QCCA 1DHPA 4UMCA 3P5YA 4MZYA 3TSDA 2Y88A 2FJKA 4ZL1A 1X7FA 1B4KA 1IXOA 4NNBA 4N2YA 3EEGA 3DFTA 1W31A 3W84A 3S1WA 5HR7A 3DFSA 5KZDA 4GUHA 3A22A 4YCOA 2GUUA 3OHIA 1BKSA 2ZRYA 4PFMA 4IOTA 4N4PA 1DVJA 1PL9A 2J6XA 3GAYA 1KFCA 4HHPA 1FY6A 4E38A 4PTNA 4O8RA 2PRLA 3G1SA 3NXFA 3EX3A 3W7NA 4BI7A 1QPQA 3SIZA 4H4IA 4HN4A 3MO7A 2ATMA 4JD4A 2E6DA 3C2OA 3R12A 4IGHA 3OA3A 3Q94A 1IGSA 1S5TA 4MY1A 4Z0SA 1OYAA 2Y7GA 5AFDA 1ZHAA 4OV9A 1I8JA 4FXSA 3CEPA 2G96A 3LCIA 1VLWA 2O7QA 3EXRA 3LRKA 2YZRA 1GVRA 1XBYA 4ADUA 1UBSA 1VR6A 1AW5A 2B7QA 2DU2A 3RU6A 3NEVA 5IBXC 1A53A 3HO8A 5EY5A 4JIQA 4WOQA 1HO4A 1WYIA 2IQTA 1JVNA 3G8EA 5AHEA 3ZWSA 4UTTA 3I7QA 5BOOA 3TFCA 1HTIA 1PHWA 4RXGA 4O18A 3UXDA 3W2UA 4A2RA 5AC8A 4GJ1A 3CHVA 5BNKA 4I9AA 1X1OA 3EXSA 1LDCA 3LHUA 3M5XA 5TQLA 2A4AA 5C54A 5D2XA 3O63A 1OFAA 3FKKA 5LNRA 4TO8A 3RLUA 2QAPA 3SR7A 5AC6A 2YDAA 4KKXA 5DBTA 1F05A 1OX4B 1QPOA 1TTQA 3CWNA 3TQKA 3I68A 1TCDA 4JYDA 2G97A 2VEIA 4R33A 2Y61A 2DJLA 1WAUA 4AMAA 1MZHA 1TPDA 3ABOA 1EEPA 4LVBA 3LHWA 3DH7A 3P61A 4LVFA 3W07A 5CG7A 3DFQA 1O5KA 1NSJA 2QUUA 4MYXA 1HO1A 2BSLA 4UTMA 5IM51 4YL2A 2QJGA 1S5WA 1MO0A 3N34A 2Z2UA 1XUUA 1YXYA 1GQNA 2Q3OA 2ZQ0A 1GTEA 1DKWA 1SSDA 1OFQA 2NUWA 3HGRA 4PC8A 5HNRA 1AL8A 3DAQA 4UFKA 2A7NA 4FNQA 3NQEA 3SGUA 4KFNA 2ABBA 4NQ1A 1K7XA 1WX0A 2JK2A 3LV5A 1KM5A 4BWLA 4FX7A 3W2MA 5LSMA 1UJPA 3ABSA 2QJIA 1N8FA 5H91A 2CU0A 3M6YA 3EX2A 3OIXA 1WDWA 1ZFJA 3NQFA 4RX0A 4WY0F 2ZRZA 5A8GA 3TH6A 3P74A 1JULA 3P8IA 4IPIA 5C6MA 4KWWA 4FO4A 4QNEA 2JGQA 3P67A 3G3DA 1KTBA 2VFDA 4DO6A 3F1QA 2C16A 5D2VA 3PBVA 1OFEA 1W5QA 3C2FA 4NXSA 5D32A 4D2JA 3LTSA 2WPBA 3NPXA 4LNYA 4JEQA 3V1PA 2ABAA 5LNWA 3P81A 1X6UA 1SZEA 1K8XA 3L66A 5F2MA 4HIBA 4O4VA 5D05A 3WK1A 3VCRA 3M44A 2ATSA 3B04A 5DXXA 1EWDA 3L5MA 3S5OA 2EKCA 1NAL1 1A5CA 3IGXA 3W9ZA 1TTJA 3ABQA 5J5DA 1D3GA 4GRSA 1ADOA
chains in the Genus database with same CATH superfamily
1J96A 3SAZA 4AIUA 3NIYA 1UCWA 4KMQA 4FNPA 3AHVA 3WLPA 4R7JA 1Q6DA 2YPIA 3TXZA 4K8EA 4MGGA 2QCHA 4E2DA 1RJPA 1X6NA 4O28A 4PB4A 4MWAA 3H70A 5D30A 4B2DA 1XS2A 3BW2A 4MDOA 1SJDA 4PUJA 1HP4A 3IJ6A 4DIAA 1I9CB 4JTEA 1VBRA 4A2SA 3PZIA 3NYZA 1JNDA 1VF8A 2O9OA 1Q7QA 4CQ9A 1VRDA 2FHBA 1QFEA 4EPKA 2GSJA 2CCRA 4K6AA 1OSEA 3O2LA 1YBQB 4GC3A 3DFYA 2ESCA 4UC5A 1PUDA 5FF0A 3SADA 2VGIA 2JEQA 3LGDA 3TJXA 4CNUA 3LHYA 2QLYA 1LOQA 2F38A 3NQVA 4O0QA 4DHGA 2Q3RA 1N2VA 1TPWA 5IHRA 1OYCA 1B90A 3WN6A 2F8QA 3ARPA 4MY8A 4F2TA 4K7YA 4JTUA 2R1PA 2C18A 1OQFA 1XIMA 2GQAA 2RHGA 4LXFA 3F2BA 4S3FA 3AAMA 4U31A 1VPYA 3GDMA 4FLQA 2X8RA 3CH0A 1HUVA 4IQLA 5HPOA 5EFDA 4JIIX 4HNLA 1JFXA 4K7VA 1GG1A 3IK4A 3QR1A 4ZE4A 4KWVA 4PTMA 1ONXA 3LHVA 3IACA 4Q8NA 1M01A 3HMCA 2DIEA 3HURA 3PVFA 4A3QA 3EOSA 2V3GA 2YB4A 4AVNA 1VD6A 1EA0A 3H55A 4JY9A 4UFIA 5I06A 2QPSA 2RJHA 3TZFA 3HQ1A 1H7RA 1E6XM 4IL0A 2PZNA 2X0HA 4PSRA 4H00A 2PP3A 2V63A 1CECA 2VCAA 2HPMA 5D4YA 3KLKA 3WEOA 1BFNA 3A4WA 3L4VA 3P6LA 1PO9A 3QN3A 3F5LA 2E0PA 4JY8A 4ML9A 4Y96A 3ZFHA 3VKJA 4G1KA 2R14A 3ARZA 4HA1A 3NPVA 3BMWA 3W7PA 3VGBA 2AL2A 4NZ4A 2YA1A 1HNYA 4N0RA 4YN5A 3R25A 3MSDA 4B5NA 2WSRA 5E70A 2YL9A 3HJZA 1I6NA 4KCVA 5FF2A 5JUVA 1W9UA 4L9ZA 2GPTA 2ZE0A 4D6DA 4AUBA 1KBIA 2HSAA 4GQRA 5D38A 3PFRA 4UXDA 4DO4A 1QAPA 2IS7A 2DIKA 4CD5A 5H2ZA 3UBPC 3LDVA 3OIHA 1IEWA 2Z1SA 4MB5A 5E9XA 4DNMA 3SDOA 2ZX8A 2E7FA 2PD9A 1SW3A 1E4MM 1E40A 1QI2A 2DEPA 5M3WA 1VS1A 1EQCA 2FGZA 5I3KA 2Z27A 3AMGA 3KTSA 2YXGA 3B4YA 4P7LA 3G1AA 3NL6A 1T6MA 5HULA 3TTEA 1CBGA 1JR1A 1KR1A 1WDQA 1LLOA 2MANA 4XX6A 1LZOA 1N8IA 3GXPA 3BSGA 3ZO9A 3DEQA 4H04A 1FUYA 4OIFA 1LM1A 3ITCA 2QDHA 5DN1A 2OU4A 2OWWA 3TDFA 1A50A 4I5UA 3R0KA 4QCEA 3E5PA 2ONEA 3WQEA 1CLKA 3GXFA 1V6YA 2FPTA 3QR0A 4H83A 2XFYA 2DZTA 3PZOA 3AS2A 5F2IA 5KITA 4ZQCA 1E71M 5CZ0A 1PKYA 2XFWA 3QRHA 4I6KA 4OWGA 3L4YA 3N2MA 3CEUA 5A2BA 3MTWA 3WBEA 3VKCA 2PWFA 1BKHA 1DPMA 5FIPA 4DUVA 4D6GA 2C91A 1XLFA 3RO6A 1SFLA 3W88A 3PBWA 2C8NA 2WMHA 2J7FA 4X0NA 3W7CA 1VZWA 4GI6A 4LAMA 2WKJA 2CLMA 1DIEA 4Q4QA 1E1EA 3KZSA 2YXOA 3M0MA 3ZYZA 3UR8A 1D2KA 3D3FA 4XAPA 4PRWA 3BLPX 3WQ6A 3S2CA 3DI0A 1EOMA 1V6UA 1RY0A 1F61A 4LW7A 2YW4A 1KFBA 1ZP3A 2PWVA 2VYOA 3DU0A 3E6EA 1N7KA 4TVDA 4CGTA 4ZQRA 3GS6A 1KBBA 2QUTA 4MNJA 3F2CA 4NIRA 2FTYA 1G01A 2YDQA 1BVZA 4BY3A 4RNFA 4M24A 4Q8UA 3UWEA 1UIPA 3VGGA 3WLIA 2VZSA 5JBFA 1FWEC 5I7GA 1ALDA 1O5RA 2J47A 2XFRA 1TA3A 5A6KA 1R2TA 1BWKA 2BVTA 3SCPA 3DXIA 1CXKA 1XX1A 3S1XA 4AWSA 1KBKA 3ABZA 3SY5A 1HG3A 2VFEA 3OVQA 3S2MA 1LUCB 2R82A 1G67A 1A49A 3ELFA 3ZQ9A 1H0IA 1J0JA 3AIRA 4ZODA 4IWWA 4IMAA 4B5UA 3EX6A 2J7GA 3GFXA 4IMCA 1OIMA 3C2RA 4GZ7A 3VCCA 3UYCA 1G7UA 4LVDA 2OMAA 4XZBA 4CD6A 3W24A 3CZGA 2B31A 3VZZA 2I14A 1A5BA 3WNPA 3C0JA 1AH3A 1RALA 2EHHA 2VR5A 4A05A 3GDKA 2HE5A 3CLMA 3WLQA 5HNTA 3PNZA 1LLZA 5EMJA 3VIFA 2J25A 3PM6A 4PYSA 5FSDC 1E15A 3MUXA 2Z0IA 1HIZA 3IV3A 3OLEA 1EUNA 2QJMA 2VRQA 1F3EA 4J5NA 4LUYA 4GYPC 9CGTA 1VFSA 3QC0A 4GABA 3TJIA 3AIVA 3OZMA 2V9DA 2QQ6A 1HJQA 4AHPA 3O6DA 4JTLA 2C0AA 2P3EA 2VVSA 4AU0A 2DSKA 3MVTA 3P8JA 1IF2A 3PB2A 4CKQA 3VDHA 1KGWA 4TX9A 1AFSA 1EPXA 3AI0A 2NT0A 2FKPA 3QV9A 3TYBA 4RDYA 3R79A 5EMMA 3BLKA 3WL0A 3E9AA 1FBAA 3M0YA 1Q6CA 4U3CA 2IQ0A 2E3ZA 3W82A 1FCQA 3PC0A 4TXEA 4N42A 1ZL1A 1OFRA 3QKZA 5EU9A 3TAKA 4XD4A 3V35A 4CU8A 3PB0A 4ACZB 4AEFA 1JGIA 5D03A 3VA8A 3EDJA 2OQHA 4MJMA 2A85A 3B9OA 3MI2A 4U2YA 4Q8QA 4UFHA 4L80A 4EOUA 4GVGA 5AVHA 4XBKA 3VGDA 1XIGA 5EBUA 4OGZA 1JGMA 1AH4A 3RRAA 2XH0A 4Y8EA 3G3MA 1H50A 1TJ0A 1PIFA 3AHYA 1AJZA 3BG3A 4NL1A 4C6MA 3S46A 3RM4A 3AIUA 1LT7A 1ICQA 1WZAA 4M29A 1NTHA 1JPHA 3K13A 2V2DA 1EJVC 2REQB 4J35A 1P1XA 3R94A 4P7QA 2W67A 3ZLFA 1VHCA 2DZXA 4FXJA 2G50A 4GHRA 4MY9A 4Z0JA 5I03A 1KXVA 3GM8A 1GONA 3S5NA 1PTAA 3RLHA 2WMFA 2OLSA 4WRHA 3BMVA 3LM3A 3AS1A 3WNLA 3AQUA 3W22A 4K37A 3W71A 4O54A 1V7YA 1E0VA 4US5A 1RAKA 4NNAA 4DYKA 5LIYX 5DMNA 3BV7A 1X39A 2J8TA 4S39A 4PL2A 1AJ0A 3MO4A 1YADA 3BV4A 1LF1A 1U5HA 1BGAA 1J2BA 1Q2SA 5CH9A 1CZ1A 2PF0A 2AGTA 1ZP4A 3V3WA 1W8GA 1DTUA 2IKJA 4QGCA 1TIWA 4Q32A 3TWAA 1KV8A 3IGSA 3C3UA 1H4PA 1Q85A 1H0GA 3W7OA 1TQJA 4QJ1A 4HSOA 1YXDA 3L4XA 4C5YA 1R9ZA 1OABA 2AQWA 3ORWA 3G18A 3SZ8A 5DEZA 1XL9A 1O95A 4H9XA 2YCLA 3MP5A 1U1HA 1E51A 1XBXA 3EX1A 3TLQA 1W54A 3FIGA 4O11A 1QU4A 1I60A 3NDYA 1MNZA 1X8CA 3WQOA 4QRNA 4RNHA 4C6QA 2HNEA 3THAA 3LLFA 4GFIA 2VC5A 1VH7A 4CQCA 2WJZA 5ABHA 1E0WA 3TN4A 1VFUA 3L4WA 4AZ5A 1EGZA 1A0EA 3M41A 2WLYA 5MKGB 4RXFA 2RFGA 2V6AA 3N1AA 3BG9A 3BQ6A 3RX3A 1R5YA 4X60A 2I5IA 5H6HA 3VGFA 4IH3A 3WL1A 1A5NC 3W0KA 4AZCB 4N02A 2E67A 4HOXA 1NJJA 1IV8A 3T55A 4AFYA 4GQGA 4GYJA 2FIQA 5AN7A 4NZ5A 3RU8X 3AMCA 1UBPC 2V5LA 4L61A 4M6PA 4EAMA 4J3WA 2HROA 4OECA 3I65A 2QCDA 4GNJA 4O1FA 4D9PA 4M1BA 5I3FA 2H9AB 4X22A 7TIMA 3GK0A 5CCZA 1MDLA 1PS9A 3URQA 3M0IA 3H7VA 5HUPA 1V3MA 3O6CA 4PRRA 3ZZ1A 1VFFA 4MSSA 1SFJA 5K9CA 4AY8A 3DN5A 3UVAA 3TEVA 5CJ5A 2YCEA 1SU5A 3WQGA 3CT2A 3W75A 1C3FA 3A24A 3DESA 5T26A 1UW9A 4XZNX 4JOMA 3PUDA 4JHOA 4UR8A 4AD5A 1VQTA 4DRSA 3TYCA 3DBPA 3SQSA 2GSEA 2ZZ4A 1QWKA 3ZMRA 1OG0A 4XKYA 1YIXA 3QLLA 2PWGA 3S6TA 2V68A 3S6DA 4XQ6A 3QSTA 1EC7A 4JQ2A 1F8MA 3L23A 2FVKA 4J7RA 3A4AA 4LYKA 5HWJA 1XKYA 1KTNA 7A3HA 3WQ8A 3LSBA 1IXQA 4OT7A 4DN1A 1S46A 4RZ5A 1UH3A 1QDSA 3UY7A 2YLAA 4UFMA 1XHGA 4LAUA 2EPHA 3IGHX 3BJFA 5D04C 4MUZA 1OT2A 3TC7A 3XIMA 2VZUA 2Y62A 1BAGA 3THDA 4L56A 1QT1A 2ZDRA 4YTQA 4AC1X 1RCQA 1QRQA 4HYRA 4JGDA 4JFUA 2QCGA 1PE1A 5I3JA 2FVLA 1OX4A 2IMRA 4B2DD 5EB8A 1W37A 1UR8A 4JTIA 4O12A 2ZCGA 2IW0A 4LAKA 4BFAA 3LRLA 1MDRA 5LHFA 2Y6ZA 1OF6A 1AMKA 3IUHA 3ABRA 2EKGA 3W76A 1KCXA 2FQIA 1V0KA 4GVIA 4IJRA 3WELA 3C4UA 2CKRA 3GXNA 3KRUA 1WXJA 2Q8LA 1VIZA 4LUJA 2WNNA 4QTGA 2ISSA 2AL1A 4OE7A 1TTPA 4PBGA 3AYVA 2PLCA 4IMGA 2GQ9A 1CXEA 1E6PA 1BRLB 4GY1A 2D69A 1LBFA 1S2AA 4B5XA 2OGJA 1PZ0A 2EJ1A 4MHBA 2PAJA 5DMYA 3FXYA 1NDYA 2BHUA 3ARXA 3DYMA 1FHLA 5FJRA 1XH2A 2J7DA 3BOLA 1O12A 1XCFA 3MI6A 2VGBA 4KW2A 3C86A 3I10A 3CMFA 4HSHA 5D9OA 3W6MA 1YPXA 2ALDA 3CUIA 3H7RA 2VENA 3G1DA 4JNYA 3URNA 4OBSA 3VKAA 1SW0A 3IJ9A 3WQDA 3V0SA 4C6FA 3KOZA 4QQUA 1F74A 1GOQA 1P0KA 3JU2A 1ZJBA 4GZJA 5D9NA 1F6KA 1BF6A 1XIIA 3LMYA 2HS6A 3W7KA 2JKAA 1LQAA 1GOOA 1S1PA 1T0OA 1BSLA 3G1HA 3N4FA 1JZ6A 5BU6A 1EEXA 3H2MA 3HM7A 4LC6A 1KM4A 1ZENA 1NF0A 1S3HA 2X40A 3GR7A 2VCCA 2RDWA 3B9DA 2JFEX 1H7PA 7XIMA 4MB4A 4OOUA 3W1XA 2BX7A 5JIPA 2JF7A 3NDOA 4C1NA 3UD6A 3IAQA 3GW3A 3S1GA 4OV4A 5GNZA 4MZ1A 2NQJA 4CNTA 1K7EA 2W0UA 5F4XA 1UR4A 3GXTA 1GVQA 3WK3A 1VAHA 6PTDA 1KGUA 1X1NA 3GW0A 1TPC1 3SM0A 1BXCA 2G3IA 1B4EA 5SWUA 1QNQA 3KX6A 2DSZA 3RLVA 2PTXA 6XIAA 5BXPA 3G1YA 3UJRA 3QOKA 4HK6A 5LIKX 2J79A 4LX4A 1PTGA 5GNXA 3MV11 4FB7A 4QBXA 3R2GA 3AXXA 1F6YA 4MYAA 1LL4A 2Y70A 3SJ3A 4IX2A 3GXDA 1WZLA 5TF0A 4K2SA 3IARA 4PMXA 1E5NA 5AVNA 3KBNA 1X6LA 4GIAA 3T1GA 4GINA 2QJJA 3V16A 4RZ6A 3EWUA 1T41A 4PUWA 1V3LA 3POHA 1QW8A 4KEMA 3KXQA 1ZY9A 3LCFA 2PDIA 4AY1A 1KWKA 3WQFA 2AAMA 1S2VA 1JF5A 3HG5A 3WYZA 4QG8A 4O17A 4RV3A 4WLCA 1PIIA 3BLDA 1ZRQA 1BG9A 4WSHA 2QCEA 1TE6A 5JH2A 2VO5A 1GEQA 4M80A 3GVRA 3ATZA 2Z24A 1LROA 4A3RA 4GACA 2GGEA 4M7SA 2BOFX 1EBGA 2FMNA 1JCMP 1XD0A 2ZXAA 4NP7A 5C70A 3INPA 1XYZA 2GGJA 1ISWA 4NJIA 3KVJA 1VYRA 3TR2A 4QE5A 5E09A 3UPBA 1SQ7A 3NSMA 1H2JA 5C9RA 1W3NA 3ZWTA 4XD3A 1S2WA 2X2YA 1FXQA 4DUWA 1RA0A 4CEXC 8TIMA 2G3FA 1IIHA 8CGTA 3KS6A 4UZSA 1SO5A 2Z28A 1WXYA 3IIVA 1YTKA 5RUBA 1VYSX 3VGHA 3G1RA 2VFGA 1MQPA 3WF2A 5FACA 3WKZA 2F6KA 3GIYA 4CD4A 1FKWA 1YXCA 3EDDA 3MCMA 2B81A 4EP8C 2FH6A 1RP8A 1HQTA 4F2UA 4Q8PA 2PCEA 3PZGA 4KRUA 1K6WA 1ZTVA 5DY2A 1OGSA 1H41A 1SZRA 3KL3A 5F4SA 1I4NA 1DXFA 1W3IA 5FJUA 5TD4A 4FXRA 1ITCA 5BOEA 3BW4A 1JL8A 3MC5A 4YTRA 5AECA 3RPDA 4ICCX 4BA0A 2QUVA 3I7RA 1IQ8A 3OBKA 3LV6A 1L6FA 3LMZA 5CC3A 1EJ7L 1T5AA 4IISA 2WC3A 4LC8A 4UOJA 2F6UA 4LU0A 4JTTA 3PZMA 1T8QA 2QVHA 3WD3A 3Q65A 4RW5A 5AHIA 3PZUA 5LIUX 3TAOA 3K8LA 1SVDA 1EXPA 6XIMA 3H2FA 3VNKA 4N9BA 3WMCA 1PKLA 1FDZA 5C2XA 1DEDA 5G4HC 3ECQA 1D3CA 4EXAA 2XZ9A 4DVOA 5D9PA 5CLWA 3U0HA 1XLLA 1V5XA 1LG2A 4I90A 4L9YA 3R5EA 2G4JA 4UOZA 4PUMA 1B2YA 3CV1A 2Z2AA 3TW9A 4ZFMA 1QI5A 1LOSA 3ITVA 2QCNA 1X38A 5XIAA 4S3JA 5A6BA 5CAKA 5CKSA 2E6AA 2Y1HA 2GJNA 3E3HA 3MZNA 1KGXA 1KRAC 2VHLA 3I4KA 1W5PA 4KIEA 4H7CA 4MKNA 3BXWA 1KA9F 1DP0A 3ZVHB 3L4ZA 4TTUA 4ZB2A 4G1NA 3UT0A 3CL6A 3LXBA 5A94A 4EAYA 4NILA 3QJAA 1EC9A 2OX4A 2H90A 4LEQA 5AYBA 3H23A 1W8SA 3OW1A 2WQPA 3WH9A 2CXEA 2CLIA 3VMNA 3M0VA 4XVDA 4IMFA 2V81A 2ZZ1A 3SCOA 1VFLA 5AYIA 3CPGA 4KWOA 3RO8A 3TK7A 2WV8A 2Z00A 3L0GA 2LLEA 2QCLA 3OVGA 6ENLA 3ARTA 5A6TC 3ITLA 3T0BA 3GC5A 1HX0A 5AZ0A 1MW3A 4CCCA 2OT0A 4F0LA 4W4QA 3RMJA 4HU4A 2W27A 4ONVA 1XPYA 1OVDA 3T2PA 4PRTA 1XSIA 2C19A 4DM2A 3GVWA 2QULA 2Z1KA 2ZUMA 1C93A 2Y7DA 4C6NA 3B8UA 1BXBA 3A4JA 1TREA 3C8FA 2YL6A 5CJNA 3KE0A 2Z7KA 2G95A 1G0CA 1EJRC 5D8WA 3CUHA 3GB6A 2Y5JA 3RPTA 2BODX 3KDOA 3TWBA 2UY2A 4ATWA 3KRSA 4U10A 2CITA 3BAKA 3WG6A 4FNTA 1L2UA 4BQ2A 5FD0A 4PMQA 4YNGA 3SCNA 2QKFA 3VNJA 1JCNA 3UP8A 2GUBA 4CQDA 2HRWA 2VEKA 3ZT5A 1KM2A 4DI9A 2ZDSA 1E72M 3L65A 4NAEA 3CU2A 3IRSA 3ZR5A 1E6ZA 2J7EA 1O60A 2NSXA 3T0AA 2ZWZA 4PCNA 2FB3A 3AZRA 2Z26A 1YE6A 3OGVA 1UUOA 1AVAA 1OD0A 3FEQA 3C56A 4YMZA 3TUUA 2ZRUA 4WXYA 3OLIA 1E9LA 1XLHA 2Z1BA 3VNDA 3R0DA 7TAAA 4W86A 3DGRA 3PTKA 5U4NA 3BAYA 4RK8A 3UNTA 5ECUA 1P7TA 1UMYA 5GJMA 5DBUA 4QG9A 3GG1A 2V3DA 4GA8A 1F9CA 3WQ5A 5I3IA 1JDAA 1TX2A 1FWRA 2VXNA 1AK5A 3PHAA 4NZ3A 3W7LA 5HDRA 2WZTA 3GR8A 4ZSTA 2ZUNA 4I5XA 3B9EA 1TQXA 4BI5A 4WIWA 2TYSA 5GVJA 4HZ8A 4AVFA 1UASA 3ENLA 3IJ7A 1A0DA 3A3HA 4QSHA 2QCCA 2TODA 4M0XA 1R3WA 1DHPA 2OKOA 4MZYA 3S2JA 4N2YA 3AYSA 3EEGA 3JZEA 1M7JA 4RE2A 2ZX5A 5KZDA 1X7IA 3UJEA 2ZRYA 4IOTA 2QDEA 4N4PA 1DVJA 2DQWA 1VP5A 2J6XA 3GAYA 1KFCA 1FY6A 4HHPA 4O8RA 2PRLA 3NXFA 3FDGA 4H4IA 3T0DA 4EXQA 2ATMA 4JD4A 3R12A 1FWGC 4IGHA 3THUA 4W8BA 1VFOA 2ZUSA 3MQTA 3CPUA 1J11A 2OSYA 1YNYA 1BRLA 2G96A 5CBIA 1JDCA 2ACSA 3QPEA 4ADUA 5M5DA 1O66A 5DO8A 1AW5A 4KBXA 3E0VA 3NEVA 5IBXC 1CYGA 1QHPA 4IG2B 3HO8A 4QROA 4JIQA 2IQTA 2PLMA 2YBUA 2I57A 1K4HA 2DW7A 4CU6A 3TFCA 4PMDA 2XH4A 3UXDA 3W2UA 1UWRA 2RJGA 3RDKA 1LDCA 3WQPA 1XSJA 3O63A 4GXPA 1Q6GA 3BZGA 3GTFA 3S3GA 1OFAA 2J4GA 2OZTA 2PWHA 5LNRA 4WDXA 5AC6A 5DBTA 1F05A 1OX4B 1TTQA 5HANA 1RBAA 1E0UA 1PX3A 3ZM8A 2PDNA 4ZO6A 1BQCA 4R33A 3TLLA 2V5CA 1MZHA 1TPDA 1DWAM 3JVAA 4LVBA 1TJ1A 3LHWA 3KTXA 5CG7A 3W07A 3O7UA 3DFQA 3SGGA 4MYXA 1E9YB 2BSLA 3REQB 1GOIA 2FZNA 4YL2A 1S5WA 1MO0A 4DI8A 2Z2UA 4GKLA 1YXYA 1KRMA 3AWOA 1GTEA 1DKWA 1ZS2A 4PB3A 1FFQA 3QGVA 3GWQA 3HGRA 1TE1A 4MKSA 2WLZA 4FNQA 3TN3A 4YYCA 4IP5A 3APGA 1K7XA 4F8XA 1EYEA 3SY8A 3L7RA 1B0IA 5EFFA 3WH7A 1HF6A 3GH7A 3W53A 2CU0A 4DWSB 3OIXA 3TYDA 1ZFJA 3NQFA 3W28A 4Z1YA 3KCOA 1GVEA 2OB3A 3LN3A 2OYMA 1A5OC 3P74A 3REQA 4GY0A 2P50A 2AKZA 3P67A 4HQVA 1KTBA 4RNJA 4DO6A 5D2VA 1W5QA 3BGAA 4BHYA 1CNVA 1UR1A 2FGLA 1XIHA 1SZEA 3S9ZA 3H4WA 4HIBA 1NH6A 2PGWA 2I16A 4PEEA 3NZGA 3CAVA 3AXIA 4WSJA 2BY2A 1UA7A 4E4UA 2ZE3A 4OJYA 2H9AA 3LENA 3BANA 2EKCA 4QHRA 1DJWA 4H1ZA 3NEHA 1JZ4A 1D3GA 4X9YA 3SFKA 1ADOA 1YQ2A 1GJWA 2PGEA 1EZWA 1GQKA 1OM0A 1GKPA 2NWSA 3W70A 1J93A 1CGTA 3K8KA 4X61A 3VDBA 4UTTC 3CZLA 3KFTA 3SGZA 3MP3A 3LBMA 1PPIA 1XLDA 2C79A 4DY1A 4F66A 3G24A 3N9SA 3M0LA 5CEWA 4YVVA 1QNSA 2NUXA 4V2XA 1BLIA 1VJSA 3F03K 5C2CA 5K4ZA 3CC1A 1BYAA 3UR7A 3G77A 3N18A 1RJQA 1ICPA 2XVNA 1U33A 3F4VA 3GQYA 5A6LA 4WGHA 2GYIA 2Z25A 3F5KA 1IYXA 3UR5A 2AOSA 5HJYA 3SN4A 1SJCA 2RDXA 3C5QA 3DC0A 3V36A 4ORMA 4JTKA 3EXTA 4ZOBA 2YJQA 1HJSA 4NT0A 4UCGA 3T05A 3CPRA 2D2JA 1AZ2A 3FJLA 3A9IA 3TQPA 4F0SA 2IXUA 2HE8A 4A6GA 4BF9A 3GFZA 1NWSA 3N14A 1H7NA 3DIPA 2ZX9A 4I9JA 4LCRA 3FOKA 4AD4A 4CQAA 2C1IA 5AOUA 4AWUA 4WUIA 2B7PA 3K4WA 4INFA 3QSRA 3UWWA 4ZVJA 2Y5SA 1IT8A 4Z08A 1DBTA 4LY8A 6ALDA 1E6NA 5C2GA 3NUKA 4GQBA 4AF0A 5BW6A 3MSYA 3RFAA 2VJXA 1PX4A 4DPQA 4OFCA 3T40A 1EJSC 5F4WA 1XUZA 1YPIA 2JKPA 4KT2A 4Q4OA 3SUTA 2D0HA 3G6MA 4HOWA 4K68A 3ARWA 3K4DA 3IJ8A 2REQA 4GIYA 3LPOA 1ZSXA 3RIKA 4RDWA 1XYBA 1BG4A 1LOLA 1A5UA 2XJ7A 4H2HA 2OOGA 3WLOA 3MWAA 3B8TA 4OHQA 5BXSA 4GPNA 5LKYA 3RJXA 3EA3A 3TZNA 3QQ0A 2Y2WA 3JS3A 4H6QA 4P7OA 4AZBA 1TWWA 4UTLA 2C71A 1Q65A 3VVGA 1SR9A 2WW5A 3QQWA 2Q8ZA 3W4RA 3GKAA 1E6RA 3WD1A 4HPNA 1V6XA 1ZALA 4UFJA 4H9VA 1FWNA 4WJ8A 2VCBA 4KEVA 1VGAA 3IANA 1IXNA 3BOXA 1DHKA 3B3DA 5G1YA 2VFFA 3UPMA 2FB2A 2QZRA 3N9RA 3OVRA 4QSFA 3NWRA 5TBOA 2PDCA 3ZXWA 4DYJA 3IIOA 3HQOA 1F73A 1AQFA 2PTWA 3E2SA 4GGHA 1TZ7A 3C0QA 4DM1A 2DGAA 2PWDA 2OVLA 3TMLA 4AZ7A 3LXAA 2NV1A 5DRIA 4A8NA 2VURA 1OZMA 1HL2A 2AMGA 4PGLA 2WBGA 3FDKA 4WXZA 3ANYA 5DCEA 1SGJA 3BAIA 2Y24A 4B9ZA 5LGZA 3VKBA 4WGXA 5A6MA 1H1YA 1EH9A 1NQKA 3W2KA 1O1ZA 4QISA 3UQNA 3W1AA 3AO0A 1G69A 1NEYA 3DERA 1BPLB 4FLSA 1L6SA 4O1BA 4C6LA 1SJAA 1IT0A 2I56A 5A8OA 3FHAA 5CSYA 3S9YA 3G1XA 4UR9A 3B0PA 1F76A 3W74A 4FALA 4F9DA 1L6YA 4JHMA 4C6KA 3AHXA 1JRBA 3UWZA 1UP0A 3T6CA 2CZFA 1EPVA 4O8AA 5EMUA 4EK7A 1WNOA 2Q02A 2GZXA 1VEPA 4JN7A 4UQAA 1OX6A 1XDMA 2GOUA 1O5XA 3IUIA 3W1TA 1XIFA 4C6IA 3RX4A 2A3CA 1KRBC 2OGYA 1NFPA 4K8HA 1RD6A 1CIUA 4EE9A 1F7BA 5F1VA 3V0UA 4FSAA 4S3AA 3HF3A 1PZ3A 5CSUA 2G5WA 2HJPA 4I7UA 2Y8KA 3FJ4A 4XVEA 1AQHA 2VWSA 2XZ7A 1IEIA 4D6CA 1E3XA 4LUSB 4Q7BA 3U6WA 1I45A 1E6QM 3KHJA 2WVVB 1ADSA 4J3TA 2Z1XA 5XINA 1R46A 3H8AA 4GQ0A 4GNVA 1LWIA 3A23A 3H2EA 3NQGA 1FCVA 3D3AA 3IJQA 2MUCA 3AJXA 5K9XA 3NQ8A 1F6PA 4IIHA 2BY3A 3A21A 2I5QA 1P0NA 4L4PA 2X41A 3VK5A 1U2YA 4YU1A 4QG6A 5C9ZA 2FGBA 3LPFA 3CUFA 1OINA 3FS2A 4AX6A 1W1A1 3ZJ6A 3VNIA 2QPXA 2TMDA 1AW1A 3IAPA 2BV9A 4P2VA 4XKMA 3S0CA 1I0DA 1TZ9A 3W85A 4OZOA 2V5BA 1JXJA 4XIAA 2VOTA 4OUIA 4V28A 4AD1A 5E5CA 3HG3A 2E1WA 4Y2WA 4FR6A 1KM0A 1Y0EA 5HUOA 3R8RA 2HVOA 1M7OA 3GDRA 3URBA 3LHTA 1SUXA 2J78A 4B3KA 1JCJA 3M16A 3W1LA 3WO8A 3EA2A 2O9RA 3M47A 2WSKA 1VFHA 3NQ2A 1JF6A 1CXHA 2INEA 1BXNA 1GOWA 4J3XA 1RY8A 2NV9A 1W1TA 2FYMA 1I2RA 3SURA 1AW2A 1DWHM 1KCZA 4B90A 3VM5A 4M82A 3QY7A 1HT6A 2PCQA 3BARA 3CASA 3B8WA 3DG6A 4WF7A 3W1MA 4X0VA 2W5FA 4ZO7A 1SW7A 2DH3A 1OY0A 4PMVA 1WDPA 1O7AA 3SUSA 4ZTXA 4CQ8A 1XDJA 4LS2A 1KM1A 1RK6A 2GQ3A 2J66A 3DGBA 1Q6FA 1RQEA 3Q67A 4U2ZA 2CLFA 1Z42A 1TV2A 1Q6RA 4DWDA 2KX9A 4BI6A 3PZNA 2CLKA 4WK9A 1A5AA 1VCVA 3LG3A 1P0BA 3SBFA 4E8DA 1P0DA 3RITA 1V7AA 4LBSA 4JTAA 2JGYA 5G5IA 5BRQA 4PUUA 2FLIA 1IR1A 2QF8A 3F4CA 4OTKA 4MNKA 4CD7A 4JX6A 3IRDA 4KH2A 2E28A 4RCXA 4GXMA 3V7PA 4IMEA 1A5LC 2ON3A 1ZAJA 4YJ5A 3SEPA 1AZ1A 4LOCA 1DJYA 1KW1A 4F48A 3M0HA 1UWAA 2W6RA 2DZBA 4IIFA 3UA4A 3OHMB 1A4LA 1A5SA 4JN8A 1XF0A 3OPSA 5FOOA 3DECA 4GYKA 2QMJA 4M1RA 4XB3A 2JKEA 3LOTA 4JKKA 1KWGA 5LNVA 3W73A 2AMXA 1T7LA 5HMSA 4Z2LA 1UMLA 1RV8A 4QNWA 3U2OA 3MPGA 1SJBA 1JDEA 1TO3A 2Y5EA 3WH6A 3M0JA 4NVTA 4LBRA 4NZFA 3HPAA 1BYBA 2OPJA 5IFTA 4Y90A 1WV2A 3N4EA 1R0MA 3TJLA 2E9BA 3DUGA 4FI4A 5D09A 2Y85A 3W2LA 1SR0A 4JTRA 5CZJA 3G0XA 3WJSA 1O68A 2JIEA 4PTVA 3TR9A 3TVAA 2HTMA 4A4AA 5AYXA 4JNMA 4JX5A 4ACYA 3VOHA 4IT1A 1FWSA 1OK6A 4NUWA 4AX7A 4R53A 3ARSA 4QJ5B 1DJIA 1V4YA 4XISA 3WUGA 3CGTA 2XM2A 4OBRA 3NJ3A 4GX8A 1CX9A 2C13A 1KXHA 3H6OA 2NV2A 3SCSA 3MS8A 1XLIA 3QPZA 5FCZA 3Q4DA 2PPGA 2WSQA 2YFNA 1H11A 4QLKA 4DF0A 1AL7A 4MB3A 3W7MA 1UR9A 1NF7A 4HJWA 2J7BA 1GEHA 1OFDA 2PA6A 5AC4A 2FPVA 2WHJA 1BVNP 4L6DA 1AG1O 4ERAA 1TZZA 3ARUA 1GOMA 3FN9A 2A5HA 4ZOAA 1FCBA 3LY0A 3DHDA 1A47A 4LTSA 3ZSTA 1WUFA 4YXGA 4UTJA 3VE9A 2R94A 3QMSA 3VNZA 1BEUA 1I2PA 1PCKA 4W8LA 5JQ9A 2ACUA 1WE5A 2J9ZA 4TOQA 3EKZA 2X1IA 4I7VA 4TUFA 4W84A 3W7DA 1WKFA 3R13A 1FWAC 3HPSA 1V8EA 1UD2A 1JI2A 4O0ZA 3AISA 5T8GA 1PWMA 2XGIA 3L67A 3DX5A 4JR5A 3UNDA 1UP3A 3IPWA 4GYFA 3UG3A 5HQLA 1PXGA 4PTDA 1UB3A 4Q8VA 5FL1A 2J88A 4MTVA 1OJXA 3KWSA 5G1TA 3ERPA 4KRTA 3P14A 4MF4A 3FJNA 3FYPA 4HCLA 5D37A 4U4MA 1ZLPA 1G7VA 1JRCA 4GNKB 2YA0A 2ZRXA 2IPJA 1TRIA 1NOFA 4WVXA 1EHAA 2J74A 4WD0A 5CJMA 4X2RA 4HCDA 4C5ZA 4JTQA 4ZB0A 3ARYA 2QJNA 2PEVA 4R3UA 3QTPA 2QV4A 2NXIA 5HPCA 4MWAC 4UFLA 3T08A 1C7TA 1HP5A 3MKCA 2V2CA 4S38A 4D71A 3S83A 2ZX7A 1GWJA 4IQEA 3PZQA 1QPNA 1VJIA 2J77A 4E3VA 2VC7A 4YS1A 3HJEA 1M6JA 1MWOA 4L9XA 3ZT6A 2GOKA 2VOMA 6TAAA 4RJEA 2IUZA 3CS2A 2YL8A 3KVKA 9RUBA 2CLHA 1NFBA 3NPWA 1GW9A 5JIWA 3DENA 3G5EA 2G37A 4H8VA 3ONBA 4G7EA 1US2A 4NZJA 2VFIA 5LGXA 1TVPA 5I79A 5HQMA 1FHVA 2WM0A 4AG0A 1IGWA 3LYEA 5F1UA 3WQVA 3MMUA 1XIDA 4QE4A 3A4XA 3LZ3A 1OADA 3N3TA 4GGBA 3OQ8A 1V6VA 3D5HA 1I2OA 1WQ5A 1DORA 2CC0A 3UWYA 4IG2A 3G1FA 1R8LA 4M6QA 1M53A 1JPMA 2DSVA 4FF5A 3HQNA 3DFNA 1EA9C 3TROA 3TNBA 2PLKA 3SCQA 2XSXA 5MKGA 3KW3A 5KETA 3GNXA 4TTGA 5CPNA 5C55A 8XIAA 6TIMA 5JH1A 3DFPA 4M3PA 3L4TA 1TPFA 1WA3A 2WCAA 1OX5A 4FA3A 4LB4A 4MFDA 5FJTA 1I2NA 4K3ZA 2ZIDA 3O6YX 3LQLA 1EGMA 1OK4A 1VJZA 1OEPA 4EVZA 2EG6A 3O6AA 3NGFA 4M7TA 3TYUA 1Q7ZA 4Z1BA 1YX1A 2CZEA 2R1NA 1NQ6A 3TKFA 3VABA 3GXIA 3R1ZA 4S1FA 4L4MA 1QNOA 1V3JA 1KM6A 1EJXC 2CBIA 5IFPA 1YDNA 5DY3A 1UWTA 2QR6A 3K4AA 1PKNA 3NCOA 3KDNA 2ZA3A 4PBEA 2PF8A 2XFFA 3W6YA 3GUWA 4J40A 4Q8MA 4JKLA 3TTOA 1FH7A 4GKTA 4TVCA 1VFMA 3U48A 5E6YA 1PV8A 1UD4A 4CQBA 3O9NA 1K7FA 1QBAA 3FEMA 3PNUA 1KLYA 4E8GA 4NSBA 3LCWA 4UUIA 3AZSA 4NZCA 3WJYA 5AZ1A 3MUY1 1LRNA 2GGGA 4CD8A 1OF8A 1GPWA 1TX0A 1NWTA 3BG5A 5HATA 2VR2A 3MY9A 3BLFA 2BY1A 1V03A 4J3UA 1TYGA 4DXVA 3HZ3A 3BOFA 3W27A 4KETA 2YBVA 3JW7A 4HN8A 4J27A 4RR4A 3EX4A 1R3TA 3UVIA 3U8GA 3RR1A 4XWUA 2RAGA 4QDMA 4C1KA 3R6IA 2QPUA 3UXLA 3BSMA 2JBMA 3S8HA 3W87A 3B97A 2HNHA 3IS4A 2NVAA 2PU0A 3R58A 3CLWA 1KCLA 3FJ6A 4IICA 1Y8BA 3CUZA 1AQ0A 4NJGA 1XIEA 3NL5A 4ZXLA 4HOZA 5HQEA 1XCXA 4LRTA 2XWEA 1M5WA 1CXIA 4TMCA 1KO0A 2W92A 5E93A 4LH8A 2PE4A 4J3ZA 4Q22A 3SCUA 4YLWA 4ZQNA 4LCQA 4M19A 1G9HA 2ZXQA 3U5YA 3UESA 3B8VA 4ZOCA 3TE9A 1RP9A 1WOBA 1MRAA 3S5SA 4NX0A 4JQAA 2VP8A 5DMMA 2R24A 2VD9A 3NQDA 3I3DA 3EDFA 1UH2A 4JFSA 2AAAA 4MJZA 3P2VA 3CWHA 1R38A 1H1ZA 3QFWA 3T8LA 2VX4A 1UC5A 4GZEA 4O1AA 1C7SA 1OCJA 4OKDA 3UF9A 3T2QA 2PRMA 4BQ4A 3RMEA 4QS5A 3WLHA 3B4UA 1A0CA 3KEHA 4IP7A 3IJIA 1D3HA 4I3GA 3T9PA 1EXBA 4YHGA 3MA8A 2A3EA 3UWQA 4LWWA 1MUCA 3TA9A 3VKKA 5HR6A 3BLLA 3OODA 2BASA 3DYPA 3QTGA 4YTUA 4G8TA 3V75A 4E2VA 3LX9A 3UERA 3DI1A 1D7KA 5DXYA 5AHLA 4J1OA 1RK5A 4A22A 1B5TA 2E5CA 4TX6A 5CGQA 4AWTA 2WBKA 3BMXA 3N2XA 1EF2A 3CIVA 3HV9A 4C1LA 2QCFA 2PBGA 3HFTA 1GNXA 2YBTA 3QW4B 3ZR4A 4L64A 3NG3A 2PODA 2Y63A 3VZYA 4MM1A 2XIBA 6REQB 4NF7A 2RUSA 1CTNA 2WSPA 1NP0A 1PDZA 1KFEA 1RCXB 1LUCA 3IIXA 3UZJA 4ERIA 2NWRA 3QPYA 3MYPA 2CBVA 4JKMA 1FXPA 1QI0A 3CHDA 4FLOA 1J2WA 3U57A 2IXVA 3EAUA 2PP0A 2ZC1A 1W3KA 4D6EA 3EMQA 4GQQA 4GBUA 2ZX6A 1E56A 4MWAD 1TVLA 3PR2A 4W89A 5KTLA 2EEXA 1UHVA 5I3HA 1GYLA 2CKSA 4UTUA 4MVAA 2GVYA 4N9CA 1CENA 2EQDA 3HGJA 4OQVA 4DAFA 2WK2A 1J5SA 1OIFA 6CGTA 1EBHA 1SYTA 1JXKA 3U9IA 4XD5A 2CPUA 3DG3A 1XFBA 4GWEA 4HT3A 3APYA 4Q4SA 2GK1B 5H1WA 2ISDA 3OJGA 1J0KA 4OVXA 2XUCA 3EWZA 3KL0A 4CN4A 3HG4A 1M68A 1XKJA 4AY7A 2PS2A 2I1OA 1OFBA 3OVPA 4AEOA 2FZBA 3M0KA 5HWMA 4O15A 5AYZA 2YIHA 3T44A 3SJNA 3DCPA 4JBRA 2WNZA 3LZ5A 1QR7A 2VR4A 1PZ2A 4UQCA 4GH3A 4GCAA 4W5ZA 5I78A 2RKXA 4PODA 4A29A 1KFKA 4CVUA 3B06A 1IIGA 4JL1A 3FVDA 5I07A 1H63A 1FWBC 1I2QA 3RNDA 3RUBL 3YPIA 1EB3A 1UD5A 4NX5A 5AHMA 2Z6IA 3H22A 4N7QA 4C6PA 2XIJA 4EIVA 4S3EA 4ZENA 3MUIA 3WF3A 1IXPA 3QBUA 2J62A 5TNVA 4B5SA 3EOEA 2CIPA 4WJEA 3MW7A 2GWNA 1H5VA 4I6VA 4UTIA 5REQA 2EGZA 3ZS4A 3GBEA 2WSYA 4FS9A 4UMAA 3T7VA 3J7HA 1UR2A 4DX3A 4Y9AA 2VT0A 3EWCA 2ZC8A 4XZMX 4DZAA 4KFPA 3OLDA 1WBHA 4UQDA 3CB8A 1KFWA 1AMYA 4BK9A 5H8PA 4L1GA 4PUNA 4PEKA 2PD5A 2ZYFA 3ZJ8A 1Z32X 3B0YA 3JRKA 3HPZA 2WNWA 5JBEA 1JUKA 2V38A 2WZEA 5CZSA 3DZ1A 3EWWA 5J5RA 4KEUA 2CZVA 3H12A 1I1WA 1QOXA 4Z2KA 1F3XA 2A3AA 2C1HA 1TJ2A 3GHUA 1XYLA 2DW6A 3PTMA 4FX6M 4LUTA 4N6FA 3SRFA 3VD3A 4G7FA 3KRBA 2OJPA 3ONCA 4DWSD 4UTKA 3N11A 4PFHA 3QKEA 1KXQA 3HG2A 1YTEA 1FWTA 2ZUWA 3E2QA 5LNSA 1XGZA 3BC9A 2VUYA 3G8RA 3F4WA 3M64A 1U1UA 5JVLA 2ISVA 1XYFA 4D6JA 2JQXA 4B16A 1GHRA 2JALA 1KV5A 3UJFA 2XGBA 4KS0A 2PC8A 3P7YA 4IPPA 1V6TA 4O57A 4RDZA 1GKQA 4XBSA 1V3HA 4AHQA 3UA3A 1QK2A 4HHLA 1ME7A 5I0DA 1K9TA 4GC4A 4CNOA 3VU2A 9XIAA 5FEXA 4AF0B 1H7OA 4NXKA 2H3BA 4P7NA 3RR4A 4ECLA 3PJTA 1GJPA 2QDGA 4AWEA 3WMLA 1US3A 1KKRA 1NDZA 3M0XA 3QMTA 2BFGA 2L5HA 3W6LA 2YYUA 1WUEA 3RM9A 4K38A 3MBDA 3W2NA 1U5JA 2PTZA 2VM8A 4EPBC 4IFKA 1QOPA 2V67A 2P0IA 3NQCA 2Q8XA 1WXZA 1XRTA 2ZZ2A 2NLIA 4U5IA 1G94A 1H5YA 1XLCA 4GX9A 1DJQA 1BF2A 3I3BA 4Y9NA 3S4TA 4UMCA 3VIMA 4JCMA 2FJKA 3I6TA 4ZL1A 4H7VA 1X7FA 4NNBA 1OBAA 4J4KA 5M1TA 2FFIA 3W84A 3PJXA 2WHMA 3CNYA 3DFSA 5HR7A 4YCOA 2GUUA 1H09A 2GFTA 3UXKA 3O0FA 2FDMA 3V0TA 1O1HA 2E8YA 4PTNA 3SIZA 1UWUA 4HN4A 3HN3A 1Y7VA 3LD5A 3H24A 2QIIA 2E6DA 1TUXA 4LALA 1EJWC 4XO7A 4Z0SA 1AODA 1E0XA 2QGHA 1ZHAA 1I8JA 3LCIA 1VLWA 3EXRA 2YZRA 1GVRA 1XBYA 2ZADA 1CDGA 3RU6A 4B5VA 1GUVA 2XVGA 1W1B1 1A53A 4HZ7A 4OUEA 4XZHA 1HO4A 3RPMA 5I6SA 3NYDA 3PPCA 4GOAA 4UTTA 3II1A 1UZHA 3ZT7A 1EJTC 1V77A 2J8GA 2OZ8A 4GG9A 4RXGA 4O18A 2YLLA 2BBFA 4A2RA 3CHVA 5BNKA 4LYRA 2G3MA 3LHUA 3JUGA 4GBDA 5D2XA 4REQB 5HMEA 2NQ5A 3AU6A 1XRFA 3AMLA 4MDPA 3GNRA 2QAPA 3RLUA 2YDAA 1EDQA 2HVMA 3WDJA 1TCDA 4JYDA 2DFAA 4Y9MA 3TYAA 2Y61A 2BGQA 2ZUUA 4LB3A 3NZPA 4WEVX 5CZKA 2WC7A 2BNJA 3FGCB 1NSJA 3WDQA 1HO1A 4W5UA 2QGYA 4UTMA 3WDPP 2EPKX 2EXOA 1F3TA 4FR1A 2WWCA 3NFUA 3WUFA 3NOYA 4DWSA 2Q3OA 4WKFA 3BQ5A 1R6WA 5A8MA 2NUWA 3D6NA 2PDHA 4IIBA 4BEUA 2G8ZA 2EG8A 2E40A 3WBYA 3VD7A 2V5JA 4PN2A 1HZYA 2ABBA 1B30A 2JK2A 1VFTA 1KM5A 4BWLA 3ABSA 1N8FA 3ZLGA 3HTWA 1DXIA 4AW7A 3M6YA 3EX2A 2CHNA 4W8AA 5KEZA 4KESA 4IGMA 2BGSA 2DQXA 4ZBCA 4QNEA 2JGQA 3CL7A 3G3DA 1WO2A 1EKOA 2PFHA 4W87A 1OFEA 4JAWA 4NXSA 2JE8A 4D2JA 3NPXA 4UOQA 3I4EA 3K46A 3T4WA 4LNYA 4F3HA 2ABAA 1UC4A 1HW6A 3DFHA 1TVNA 2PWEA 4JFTA 3L66A 5D05A 3EA1A 4DJFD 1E4IA 5C9XA 4US6A 3KCJA 4REQA 4HJFA 3HA1A 3WD4A 4AIOA 3TTQA 1HJUA 4H9TA 4P8UA 3IGXA 1A5CA 1TTJA 3ABQA 2XIMA 2KZHA 3CZ8A 3MP4A 2RGLA 7REQB 4Q33A 4R9XA 4Y9PA 1EO7A 3LQGA 1XWYA 3UWVA 1K8YA 3A64A 1J8VA 2GJPA 2WM1A 3NM1A 1TPUA 1UPPA 3CH9A 4QM1A 1EJUC 4XZLX 3PJUA 3OG3A 3D46A 3LGEA 2JEPA 2PDUA 4XZIA 3T81A 2E6FA 2YOCA 5M03A 3LI1A 4G9PA 3L5AA 5I09A 2WQDA 2UV8G 4XZ9A 2BHYA 4IJBA 3CMJA 2PRHA 4FZIA 2E5BA 1UWIA 1DL3A 3LM7A 1A80A 4I9TA 4ZO8A 1M41A 1QI3A 1WB0A 2H8XA 4D8LA 4JICA 3CHEA 1MUWA 3BL3A 1P5BA 1GCYA 3QZEA 4EWND 2YCLB 2OEJA 3W1PA 2HV5A 2Y0FA 2HQAA 3AALA 1LRTA 5F7UA 3HQPA 3CQHA 4HBKA 3NSNA 1K9DA 1YMYA 4ORIA 2V0TA 1UJQA 3GVGA 1R7OA 2FFCA 5ABGA 1XDLA 1XRSA 3R11A 4HK5A 2V3FA 2J24A 3KM8A 4GJIA 5A2CA 5I5RA 4NI3A 2HDJA 3H2OA 5E1QA 3MSRA 1W9PA 3NM3A 5A2AA 3AROA 4S23A 1LT8A 4H2CA 3QC3A 1W9VA 1F3WA 4J2PA 1TR9A 4IGSA 4HA0A 4JN6A 1QUMA 1F4AA 4M81A 1JCTA 1L6WA 1I0BA 1JYNA 1HXJA 8RUCA 2IKGA 1OC5A 4UTWC 3ARQA 2GDUA 1ZB5A 2OX1A 4FOKA 1GZJA 5T9CE 1ICSA 1W5MA 4O19A 2NQLA 2R1KA 3PPHA 3S2LA 2A7RA 1K03A 4I5RA 1NOUA 4HMNA 4LAZA 5JBDA 1LL6A 2ZVRA 2VQTA 1OCQA 5H8UA 5ABFB 3CWOX 2DDXA 5I02A 1GT8A 4GXWA 2OFJA 4HPHA 4L65A 1O6IA 4IPLA 1RBOB 4JTGA 1PEZA 4KIRA 3F2DA 4UMBA 4JTJA 3GX9A 3CTLA 1W2PA 1Q6EA 4NASA 1XXXA 2NQZA 4MNMA 3LB0A 4E5TA 4IXXA 1SMDA 1ZPTA 2PDWA 1FOBA 3KOFA 3E0FA 2PTYA 2CWNA 4CNNA 4JTDA 3TJ4A 2VEGA 1LQ2A 3ZJ7A 1FP8A 5HXMA 3SCVA 1XQLA 4HPXA 4FXFA 4R9OA 2OG9A 2DZUA 3BLIA 4J2MA 3PBMA 3PY2A 3W7GA 2VUNA 5FSEC 3W83A 4D8ZA 2Y8UA 4BF7A 1ZBCA 2DORA 1EQPA 3M07A 3WLMA 1R3VA 4FOJA 4TR9A 3DFOA 4CCZA 5EPDA 2QAFA 1S2UA 3CAWA 2ZRWA 1JIBA 3M5ZA 4DB7A 4F9JA 1XYMA 2FTPA 3T0CA 1OYBA 4RKAA 2QXWA 1JEZA 4TIMA 3ZLHA 1TJPA 3UG5A 1LORA 2Z1WA 3HBLA 1UKTA 2FJUB 3M43A 1EWEA 4ZMGA 4Z1CA 1WDDA 2WYSA 2Z2BA 4RPQA 3THCA 3CUXA 1XG3A 3ZVHA 1VB9A 1PJ9A 5CC6A 1ZNNA 4H8UA 5C7HA 1IEQA 2F6XA 2INFA 1RD5A 2IKHA 4B15A 1LWHA 2OO0A 2JF6A 2V5KA 1CPUA 3TCEA 3NQ7A 3P82A 4DZHA 3ES7A 3BICA 2QDDA 2VRJA 1Q13A 1TWSA 2D1ZA 2ICSA 1EOKA 3QH2A 5C71A 5HJXA 3S1UA 2GK1A 4NJKA 1LCOA 1Q5MA 3E2RA 3GUGA 3MYOA 1QI4A 2POZA 3CV6A 3S5ZA 2DIJA 3AIEA 4WY0B 3G2GA 1O94A 2DT2A 3T0TA 3O0KA 1TA3B 4CCDA 1TRDA 3V4BA 3O16A 4XV0A 2WVVA 4C6CA 1Z48A 3TFXA 2PDJA 1XINA 1NDWA 3UETA 1WOAA 4WOZA 2XVLA 1XRVA 1EF3A 1XLEA 2PWUA 3MUCA 5LHEA 4WCJA 1EP2A 3WUEA 2P0OA 3KP0A 3N2BA 1GPFA 3E1F1 1H3GA 3ME3A 4FOUA 3NOEA 4N9EA 3CV7A 2VEPA 2TSYA 4IUOA 2E6YA 5T91A 4AC7C 3V18A 4AISA 3OA5A 3HV8A 2AKMA 5FKYA 3P3BA 3VFCA 4RE0A 3MJYA 6REQA 2WAGA 3P80A 4PCFA 1M65A 1K8ZA 4Z42C 3QXBA 4JFVA 1MEWA 1Z89A 2OTDA 1JQVA 4XG1A 1DWFM 3PUOA 1NFGA 4NJJA 5CLTA 1XR2A 1J10A 3RN6A 1FP9A 3N04A 1YRRA 2WOQA 5FJOA 1F07A 4NRSA 1JFHA 3V1HA 1Q4NX 4HZ6A 2BMBA 5DQPA 4C90A 4OOZA 4ZQOA 1S3TC 2V30A 3WFAA 5KZMA 1DJNA 4LV4A 4K1GA 3DKJA 4C7GA 1A3XA 3LBOA 1R2SA 3B9NA 3NQ6A 4FK9A 3LUTA 3VTRA 3UCDA 4B91A 3QY6A 3U2CA 2CHOA 1DOSA 3CAQA 4ADTA 2OWCA 1P43A 3JZUA 3RJYA 2OKTA 1HGWA 3QY8A 3A3WA 3GHTA 1TMHA 3LPPA 1Z41A 3OTRA 1NELA 2NUYA 4KERA 2VMFA 2WWDA 5FF7A 1BD0A 4BS0A 1P1MA 3MBFA 3IUDA 2G3JA 4A8LA 3G1VA 1CXLA 2SFPA 2A79A 3BSHA 2YX0A 3LI0A 3L5LA 4GZIA 4LRSA 2QW5A 4GIEA 4JTSA 1FHUA 4E8CA 2HS8A 4TV6A 3O06A 3A9BA 1FFRA 4K1WA 1UUMA 2CNCA 2X30A 2E5DA 1PTDA 3ISIX 3HIJA 3S6OA 4AYGA 2OLAA 1JI1A 1Z6KA 4U33A 2CERA 4JS3A 4HU0A 2A0NA 3AXHA 2AL2B 3W26A 1PB0A 1Y5VA 4C7DA 1C9WA 1QNVA 3SN1A 1WCGA 1NU5A 4ZQMA 1RVKA 2WMKA 4Q8WA 1Q8JA 3L0KA 3NZQA 4PBFA 1YYAA 2GGIA 3U7BA 4OBTA 3FYOA 3SB0A 2P1FA 2BDQA 3NO3A 2UY3A 1W1PA 4XSMA 1XH0A 3WK2A 3HB9A 3PP7A 1Y5WA 2NX1A 3CM4A 2RDTA 3SCWA 4ZOEA 3KRZA 4Y8FA 4GYPA 2DSUA 4HHHA 1G4PA 3NA8A 1QPKA 1R9YA 3CB3A 1US0A 1ZUAX 4YTSA 4DO7A 4BEQA 3GNDA 1XIBA 4N6EA 1FWWA 1G5AA 4UNKA 2Y7FA 3WMBA 1UKPA 1EC8A 2UWFA 2TPSA 4AZIA 1ENUA 3FX4A 5FAGA 3GDLA 2NXGA 1LRQA 3FXGA 4BKNA 4W9TA 4IMDA 3M5YA 4ADSA 2FHCA 1GVYA 1K9FA 1LBMA 3W1NA 1M7XA 4UQ9A 2ZXBA 3N2TA 2CBJA 1K1DA 1J0YA 3QMRA 3BVJA 4FNSA 1XFCA 3PBYA 3MU7A 2Y4SA 1W91A 3SSJA 1RQHA 1UD3A 3T8QA 3SCTA 4O14A 3UXIA 1DIOA 4FMVA 4IPNB 1GK8A 3LRMA 1MMFA 1QJWA 5A8PA 3JR2A 3CQKA 3AUJA 2PLJA 5BXRA 2J7HA 3UG4A 5A6SA 3DHFA 4A3HA 4Z1DA 2A6NA 4PTWA 2NQHA 1YW1A 1RQBA 1LQ0A 4M5PA 2VD8A 2ZRVA 2D24A 4O52A 5EMLA 3GTIA 4E4PA 4QAIA 2PC4A 1ML1A 4ZEPA 1TV7A 4QEEA 5EL1A 3B0VC 3W00A 2E1DA 1D7FA 2VDGA 2X1UA 3PBUA 5TIMA 3KTCA 1AH0A 4DJDA 2VELA 2QUNA 3C52A 4RDVA 1H61A 2G0WA 1VCFA 3CBWA 1G1YA 5C0QA 4JEJA 3TTSA 3A5FA 3PN8A 1E70M 2G3NA 4S3BA 5E0KA 4GUGA 2INZA 4W7UA 3P5ZA 3STFA 4LJ3A 4YPJA 1TR1A 3UCCA 1S1RA 3KP1A 1W3JA 1TMQA 2ODOA 5LZLA 3LS9A 3EB2A 3WFZA 2CLPA 1LWJA 3GRIA 1S5NA 3W7HA 3QVQA 3QM3A 1X8FA 9XIMA 3T2OA 3NQMA 3VMOA 4FX8A 3TNOA 5FEZA 4PUDA 5JU6A 4O0KA 1M3UA 1S5VA 1EX5A 1ELSA 2DV0A 5CXPA 4M51A 3VOCA 2J9XA 5HINA 4S3CA 4KGLA 4GY7A 2EAWA 2X1TA 4U3AA 2D2OA 4LT9A 1GW1A 3TSBA 3P0WA 3DBNA 1PKMA 4MLRA 1GORA 4J9JA 1OC7A 2VEMA 3M9YA 1XLAA 2ZUTA 3DYOA 2XM1A 3NO5A 3VDGA 4FNUA 2A3LA 4X9SA 4UBPC 5MF5A 5G2WA 1IZCA 4ZR8A 3WJZA 5CC7A 4P8VA 4XUGA 3TYZA 2J8FA 3NNTA 3EWDA 3WLTA 4IL2A 4NU7A 4W93A 3UXAA 4WKAA 1UZ4A 3L2LA 5K3VA 4A3YA 2J27A 4HZMA 3UZ5A 4XKYB 4Y7EA 4CNPA 1TIMA 1HJWA 2HPIA 2VQUA 3P84A 2VI0A 4GUFA 1FH8A 3QGKC 5AHFA 1Z44A 3CUJA 4DBWA 2YA2A 3EKLA 4LVGA 2QEZA