2J6XA

The crystal structure of lactate oxidase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
370
Chain Sequence
b'DIEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTATE OXIDASE
publication title The 2.1 A Structure of Aerococcus Viridans L-Lactate Oxidase (Lox).
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 133
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.2: Transferred entry: 1.13.12.4.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j6xA00
3SGUA 3QMTA 1MEHA 4ZQPA 1H1YA 4NQ1A 1FWWA 1Z41A 5LKYA 1SZFA 4GJ1A 4JX6A 4QQ3A 1KLYA 2YYUA 2GQAA 4DPQA 1K8ZA 2RDTA 1DORA 2GVGA 3NQVA 4UMBA 4AWUA 4K7YA 3UXDA 4O17A 4O0KA 4MJZA 1T96A 4MY1A 2A4AA 1O4UA 1QPQA 3LHZA 5CZ0A 3LM7A 4ZQRA 3NR0A 1JUBA 3P8JA 1U83A 4DF2A 1IXNA 3Q2DA 2J9ZA 4BI5A 3NOEA 1S5WA 3O15A 1XKYA 3LRLA 1OJXA 4MKNA 3FOKA 3G0XA 4IMFA 3GAKA 5HULA 2WQPA 3KHJA 4L4LA 4A21A 2W6RA 3MP5A 1R30A 3CPRA 2CLHA 4ADUA 1V5XA 1PCWA 4IOTA 1YYAA 4JGDA 2Y7DA 4HNNA 4ZQMA 3MJYA 1J4EA 1EIXA 4O1BA 1IXPA 2QCDA 3C2VA 4BFAA 2YR1A 3L5AA 4UTJA 1UJPA 3LCHA 3QMSA 3MUXA 1R2SA 1OFBA 1ALDA 1EP3A 4PFMA 1XDMA 4WY0A 4AH7A 4FNQA 2E5CA 4GWEA 4R34A 4IMGA 3OVQA 1YDOA 2QJIA 3E49A 3N2XA 3UZ5A 4AWSA 1O94A 2E1DA 2ZRZA 2ISSA 5CPOA 5DXYA 4AF0A 1YTEA 3BW2A 3P8IA 5HR7A 4LRSA 1VZWA 2EKCA 3TJLA 5LGZA 3LHVA 3MI2A 1ME8A 1T0OA 5AC8A 2QUTA 3HOJA 2AQWA 1XDLA 3N14A 5I3GA 4TX9A 4WX2A 1J2WA 3VFLA 3FKKA 1EX5A 1T8XA 3NZ1A 3SSJA 3TUUA 2Z1BA 5AFDA 4O53A 4ZVJA 1AMKA 4E0CA 4MVAA 4ZQOA 2FB2A 3WJWA 2I14A 3W1NA 4ADTA 4AAJA 3DI1A 4RZ6A 4MYAA 3L2IA 4FHAA 3DU0A 4GUGA 3KRSA 1F05A 3C52A 3PM6A 1KBJA 1KTBA 1ICQA 2VEPA 3NPUA 4WUIA 3STCA 5EPDA 5D02A 1ZAIA 1PHWA 1ZENA 3IVSA 3GVGA 5C55A 3DKLA 3C3NA 4FIRA 3W1LA 1FCVA 4IMEA 4NVTA 5HINA 2PC4A 1QAPA 2E6DA 3LXBA 5FI8A 3A5FA 3TQVA 2C16A 3KX6A 2ZZ3A 1I2OA 1SR9A 3R12A 3BG3A 1K7FA 4A29A 5HNRA 1RR2A 3DAQA 1D3GA 2QCFA 2FB3A 3ABOA 3W1TA 3TMLA 1ICPA 3E96A 4JX4A 2ZZ2A 3E0IA 2E09A 5A5WA 4K8EA 3TDFA 1OX4A 3L68A 3W75A 3KAOA 1F74A 4DF1A 3ZR4A 3LCIA 4AHOA 3GDTA 2V82A 1VS1A 4YXGA 4NJIA 4GC4A 5D38A 2Y7FA 2ZA1A 4DXVA 3QPZA 3O06A 1SO5A 4TU1A 1Z42A 3FEMA 1Q45A 1VPXA 2ZRVA 2O7QA 4NJGA 1XL9A 2V9DA 4JTFA 4MY8A 3UWVA 1FDYA 3DFNA 1ZCOA 5AC6A 1I2PA 4AEOA 5FEZA 2GJLA 1EA0A 1ADOA 1K7XA 1W5NA 2Q3OA 3M6YA 4POCA 5FF7A 4CNPA 1KA9F 1UB3A 3VE9A 5K4XA 4IWWA 4O1CA 3M47A 1LOSA 3EX3A 1R2RA 2EAWA 4ONVA 2QDHA 2CLKA 5DBTA 1Z48A 4BI6A 5F2GA 1A5BA 4NJHA 1LM1A 2I1OA 4FF7A 4FX6M 4JTJA 1BEUA 5AC7A 2XN2A 2X1SA 4Q4KA 4RLIA 4LS2A 3PG8A 4XKYA 3HG3A 3LHWA 4FO4A 3UY7A 1TYGA 4KFNA 2DZPA 1YDVA 2FTPA 3DI0A 3QQ1A 3SIZA 5FF0A 3LI0A 4W9TA 1KFLA 1KFBA 2H3BA 2ZA2A 2Q8LA 3U8GA 2NV1A 1W3IA 4LVGA 2X30A 4OWGA 3ZWTA 3LLDA 1G67A 3DHFA 1H7NA 2CLMA 2FDSA 2QAFA 2TYSA 2ZCGA 4MIMA 2QCEA 4Z0JA 2UV8G 4NUWA 2Z2UA 1PCKA 2E68A 2ZRWA 2EGZA 4N6EA 1P0KA 3ABQA 1WV2A 5AHIA 1F76A 3Q37A 5G5IA 1P5BA 3B8DA 3M5VA 2PRMA 4QM1A 2GPTA 4MFEA 2XFWA 1XCFA 2B0MA 5AHFA 3I68A 3CU2A 1W5QA 2HS8A 4IGHA 3CC1A 1ZHAA 3KRZA 3GXNA 1H50A 1R46A 3JRKA 1XBYA 4HIBA 3FA5A 1UASA 1XFBA 2R94A 3QQ0A 3HG2A 2ABBA 4RX0A 1S3HA 1YTKA 1RD5A 5BMXA 2F84A 1F6PA 1SPQA 4EF8A 1A50A 3PB0A 3L0KA 1H63A 3DFOA 2V30A 5AHNA 2E6AA 3F4WA 1UCWA 3PBUA 3W2KA 3S0CA 2ZA3A 3B06A 1VYSX 1LBMA 1DKWA 3A21A 3TSMA 3LGEA 4J9JA 4FIQA 4PTNA 3W2MA 1DJQA 1FCUA 3LCXA 4ORIA 3W85A 3PSWA 5KZMA 4LRTA 1FBAA 2OMAA 3NGJA 4DBEA 2NLIA 3LHUA 1RQHA 3RLUA 3RU6A 3FIGA 4UMAA 1W0MA 3NPVA 3KXQA 3LCLA 1VGAA 2X1UA 4GBUA 1M7PA 4HNUA 1PHQA 2A7NA 1LBFA 4Z08A 3DFTA 1Q6LA 3NQAA 4M6QA 1W3TA 3FYPA 2YFNA 1H7RA 3O16A 3WJSA 2VENA 1DOSA 1G7UA 2YGYA 4MZ8A 2QUUA 3SECA 3B03A 1X6UA 2CW6A 3W87A 1FY6A 1O5KA 1A5CA 4RZ4A 1OFRA 3KVKA 2J88A 4FEZA 1B4KA 1DVJA 5F2LA 3PC0A 1I4NA 1MEWA 1ZAJA 5FEPA 5CSSA 2DZXA 3PAJA 4CQAA 2A0NA 5E0KA 2H8XA 3BLIA 4MZYA 4QAIA 3DBPA 5LNSA 3I7RA 3HF3A 1QFEA 1D3HA 1SSDA 4OQVA 2QCGA 3MP4A 5LGXA 3PBVA 3DZ1A 3W7DA 2WKJA 5KZDA 3W2LA 4OGZA 3VI2A 4XWUA 1TTJA 1H61A 3O07A 2BX7A 1RQEA 5E1QA 3TE9A 3LRKA 1K7EA 3BW3A 3IGXA 5L6UA 1WOAA 3QZEA 2J27A 5CZSA 2Z6JA 4LW7A 1SZNA 2Z0IA 3M16A 4O1AA 3NZRA 3L21A 1N8FA 3LXAA 3LXCA 1LRQA 3NVTA 1H7OA 4IPIA 3ZWSA 4O8RA 1YXYA 5E93A 4Z1BA 4LOCA 1BWKA 3M41A 1JR1A 1YDNA 1P0NA 4MZ1A 3SI9A 4CLMA 1YPFA 1T99A 3LRMA 2F7FA 2QCNA 1HTIA 4LUJA 4JIQA 3IIZA 3TXZA 2YCEA 4K39A 2C3ZA 3TIMA 4JD4A 4UCGA 4Y9AA 3O1NA 3NQ8A 5EY5A 3LLFA 4K36A 3GDMA 1VCVA 5LSMA 3N19B 2V81A 4M6VA 5HQEA 3RMJA 3GX9A 2EPHA 1W5OA 4KFOA 3CQ0A 4NZFA 2RHGA 1NF0A 3IVUA 2JBMA 4I7UA 1F5ZA 4WOQA 3LERA 2C0AA 1W5MA 2CZDA 1KM1A 2ZZ5A 2ZYFA 2QR6A 4HSOA 4CCEA 2QDGA 2G97A 4IUOA 3CEPA 4JTSA 1S5VA 1LP6A 3U2OA 2Y61A 3BLFA 1GVQA 1X1ZA 4O28A 1MSSA 1FXQA 1AW2A 3EX1A 3JS3A 4C1LA 3LV6A 3NPXA 3TFXA 1WXJA 4JR5A 1GQNA 1O60A 5AN7A 5F1UA 2YSWA 1ZNNA 2H6RA 2Q8ZA 1QCWA 3IGUA 5HWNA 1JCLA 3QSTA 5D2XA 1KV5A 3BW4A 5HMSA 4A2RA 3W7OA 1X1OA 1HUVA 1JUKA 4O0ZA 4XBSA 3UWZA 4UFLA 2CZFA 3DFPA 1GVFA 2PE4A 3V1PA 1JVNA 4O16A 5HJLA 4NNBA 4S2CA 3ZS4A 5DN1A 2DORA 4FNTA 4N9EA 3VNDA 1HG3A 3T55A 4HKPA 2GVLA 1FQ0A 3N9SA 4M6PA 4JTHA 4YL2A 3NAVA 4XZ9A 4YMZA 4RXFA 3W7KA 3EX2A 3ZFHA 2V2CA 5D2WA 2Z6IA 3HGSA 4K37A 5C2XA 1JCMP 2B7PA 4DELA 1H7XA 1NAL1 4JY8A 5F2MA 3NL5A 4ML9A 1OFDA 2VFEA 4JS3A 3TKFA 2OJPA 3TAKA 4YCPA 1A53A 1MO0A 3TX9A 2B7NA 3SY5A 1QPOA 4AHPA 1G6CA 3OBKA 4N02A 3C56A 2Y7GA 2VEKA 3CEUA 5H91A 3QYQA 5DLCA 3TH6A 4MLJA 4RXGA 3ABSA 4Z0SA 1KM2A 4JTUA 3UY8A 5K9DA 4H6KA 5D33A 2NXHA 3E12A 3S1WA 4UR7A 1XUZA 3LHYA 3PBYA 3TK7A 1P4CA 1ZALA 2DU2A 3EX4A 3IIVA 3MO7A 4XUGA 4O14A 3LDVA 1VYPX 4E38A 4OBTA 5K9CA 4ZQNA 1IXOA 3MYOA 4JTEA 4NU7A 4P61A 1ME7A 3QRHA 1TMHA 3C4UA 4IXHA 4ZZ9A 3VKJA 3GDRA 1QWGA 3PBWA 1IIHA 5CZJA 3W83A 4DPPA 5D03A 3MP3A 1KLZA 1TQJA 3IIOA 4A3UA 4FNUA 3S9YA 4N4PA 4BK9A 4K6AA 2ATSA 3B05A 1SU5A 2RFGA 2B4GA 4RK8A 3E02A 5DCBA 4UTWC 1PVNA 3G1HA 2WNNA 1OFOA 2FIQA 3Q58A 3EXRA 3BARA 1GTEA 3LV5A 5AB3A 4TIMA 1GOXA 2H3DA 1IXQA 3M0ZA 1KBIA 3M5ZA 2FJKA 2CLFA 3HBLA 3M44A 3KRUA 4GUFA 1M6JA 4EF9A 4MOZA 4LC6A 1GVSA 4TMCA 5I3FA 4WY0F 4NX0A 1B57A 3UNDA 1TJRA 3D0CA 2DZWA 4CQ8A 5G4WA 1OX6A 2ZZ6A 2X1TA 4HSNA 3TSDA 1RZMA 4CCDA 4JTLA 3HG4A 3NQEA 2NZLA 1FCBA 1RV8A 1TO3A 1TPWA 3MW7A 1ML1A 4HPXA 4JDYA 3BGJA 2PCQA 4JTIA 4JTKA 1TPFA 1SO6A 4JICA 1M5WA 3IGSA 1GYLA 1YXDA 3H55A 1YXCA 4O19A 2E5DA 2WV8A 4XQ6A 1G4EA 1K8XA 3INPA 3TAOA 3M5XA 4BI7A 2YW4A 1I2NA 2CLIA 3GNNA 3NQDA 2QCHA 4LVFA 1EPXA 2ATMA 1QPNA 1OVDA 2QCCA 2ZBTA 3QF0A 1ICSA 1MXSA 3G24A 1RVGA 2V8ZA 5F4XA 4KWVA 4O4WA 4CCCA 5G2HA 2ZZ7A 2A85A 2WJZA 5EMUA 3NQ2A 2QEZA 3LTPA 3N9RA 4OV4A 3WJZA 3S1UA 1LOLA 3W72A 5HUOA 5BNKA 4IX2A 2WSRA 1FX6A 5D05A 3UPWA 3BGGA 2YW3A 3P80A 2E77A 3BO9A 3LBMA 3EEGA 4U4MA 6ALDA 5J5DA 4QISA 3DFSA 2E6YA 1VRDA 2V5LA 1DQXA 1WDWA 3QJAA 3SGZA 1QOQA 5LNUA 3L65A 4WOZA 1OF6A 4GFSA 4JTGA 1OYAA 4DBDA 1JJKA 3QH2A 3QW4B 4QIUA 1FWNA 4FNRA 1EP2A 4DO5A 1F7BA 3PSVA 4N9CA 2IQTA 3H54A 2ISWA 2YYTA 2DJLA 3C2RA 2JKPA 2G5WA 1KM3A 1LLZA 5A8GA 2VEMA 1TV5A 3G0UA 5F1VA 3TR2A 3PVFA 5FEXA 2W0UA 2R14A 3N73A 5K2ZA 2QKFA 4O50A 2O7SA 2ZDRA 4Y96A 3O6DA 1OYCA 1Q6QA 4Z1DA 3T44A 1I45A 3G1SA 4E2DA 4UTLA 3S5YA 1HO4A 1B3OA 8TIMA 1YADA 3SJ3A 3HO8A 3QPYA 1CI1A 3LTYA 4LU0A 5D09A 2CWNA 3TU9A 3GK0A 1LCOA 4K7VA 1VQTA 1C9DA 3EWWA 3NYZA 3PF3A 5FF2A 4PODA 3C8FA 4UMCA 1BWLA 4BF9A 2GQ8A 2Y6ZA 3O63A 3W7QA 1KFJA 4QNEA 1JCXA 2JGYA 4IQLA 1LORA 3CB8A 1SSGA 4DO4A 2DJXA 3RK8A 5CPNA 1Z44A 2VFGA 4N4QA 3FYOA 4I7WA 1XBVA 1Q6RA 5D2YA 1JCNA 1L2UA 1FWRA 3UWYA 3QC3A 3C61A 1OFEA 2DP3A 3O6CA 1NFBA 2HS6A 2FQIA 2V0TA 1KM6A 1GG1A 4JNMA 1HL2A 2NXIA 2BTMA 4UTKA 3B04A 4O10A 5KINA 3NM3A 2NX1A 4O57A 3TW7A 4Z1CA 2TMDA 1MZHA 4AXKA 4B5NA 3KFTA 5LHEA 3VCRA 4AMAA 5CZTA 3OHIA 4EIVA 1K03A 2R8WA 3PULA 5KZEA 3TA6A 1RQBA 1FXPA 1YLVA 2PRLA 3NDOA 3F1QA 4DQWA 1TRIA 2VEIA 4OT7A 4AWTA 3SR7A 2H90A 3IIPA 5D30A 5SWUA 1HO1A 1TPB1 4JIPA 5HUPA 3BG5A 1W37A 1SO3A 4YWIA 1C8VA 4IXXA 1RPXA 4AB4A 3C6CA 4AHQA 3GAYA 2NUYA 5D04C 5KMYA 4O18A 3HB9A 2RH9A 3OA3A 1GJPA 3M1ZA 3A23A 3SZ8A 3O6YX 5LNRA 5MHBA 1UUMA 3MHFA 1VLWA 3GKAA 4MFDA 3UD6A 1HFBA 4TR9A 3GKFA 4NXKA 2H8ZA 4N6FA 1VYRA 4FXRA 3S1XA 2J24A 2VKZG 1NSJA 2A7RA 1H62A 5H2ZA 1N55A 4BWLC 3DGRA 1WA3A 1PL9A 3G8RA 4NX5A 1LOQA 2YFOA 3NPWA 4QSHA 1XC4A 3GB6A 1TIMA 3I7QA 1UBSA 1WX0A 2QJGA 3W3OA 4JEQA 2HSAA 1SZEA 5IBXA 2R91A 4Y90A 3P62A 5CKSA 1OFPA 4MUZA 3WK3A 5G1TA 3UYCA 3W7MA 3G1YA 3G1FA 3OVRA 4PC8A 1U5JA 2ISVA 4LT9A 4ADSA 1SUXA 5FF4A 1TTQA 1H51A 2EF9A 1SFJA 4MJMA 2YDAA 3EX6A 2WNZA 5BRBA 3BK0A 1Q3NA 1QO2A 3MWAA 1FDJA 3QM3A 4R33A 3M7WA 5CGQA 4O1DA 4LVBA 3STFA 3LCGA 4CQ9A 3HJZA 2DZVA 1G4PA 3L5LA 3LX9A 1W31A 4LWWA 3A5VA 2X16A 3W1QA 1FWSA 5AHEA 3S5NA 1TPUA 1IIGA 3FJ6A 4A2SA 1MEIA 2VFDA 2ZQ0A 3P61A 1VLIA 3W6YA 1H1ZA 1VH7A 2DZSA 1G69A 1VCFA 3TQ0A 5EBUA 3WFAA 2C14A 1KFEA 3G0SA 4MPQA 1A5AA 3L0GA 4NNAA 4RZ5A 3W86A 1GPWA 3JR2A 4XTDA 1F2JA 4A22A 1OFQA 1F6KA 2D73A 3L5MA 5AYXA 3AO0A 1TTIA 2I9EA 1Q6OA 1SQ7A 1CW2A 4X3ZA 3G3DA 4MYXA 4WQ6A 3HGRA 3GYEA 3LBCA 4N2YA 5G4EA 3UZJA 2HTMA 2A1YA 2NV2A 4JYFA 4LVAA 3RNDA 5HR6A 4QITA 3HQ1A 3M5YA 4S2BA 6TIMA 1P1XA 4EWND 1ME9A 2A2IA 3EKZA 3SW6A 1GTHA 1X8FA 4HNTA 1PE1A 3WK0A 3WK1A 4O13A 4WJEA 2WPBA 3W1XA 4WZHA 1B9BA 4UTWA 1KM4A 5F4SA 3MBFA 1H5YA 3R89A 1JCYA 3S42A 4I7VA 1KFCA 3W7JA 2AGKA 2Y89A 1XBZA 1VHCA 1ZFJA 2LLEA 3QFEA 3FJLA 1TPDA 2Y88A 3LCFA 1W1ZA 5G1YA 1W3NA 4O12A 3P5ZA 5IBXC 5DCDA 2RKXA 3EWBX 3CM4A 3UWQA 3PG9A 3BVJA 2VFIA 1QDSA 3GDLA 1TQXA 3HPSA 1EUNA 4IJBA 3TNOA 2V2HA 2VFHA 3LOTA 3P81A 1KFKA 3TSBA 2XN1A 3NQMA 4Z1AA 1KTNA 3NA8A 3ELFA 3C2FA 3UWUA 1I2RA 1LDCA 4DO6A 3G3MA 1AW1A 3O8AA 4PH6A 3BPWA 2PURA 3S5ZA 3W9ZA 1TPH1 3HPXA 4D2JA 4LS1A 1TRDA 2QCMA 1G4SA 1TCDA 2ALDA 3NEVA 3ANYA 1QR7A 3I7SA 2C13A 1E51A 5CSRA 4JXCA 5D2TA 3TW6A 3G1VA 4Q32A 3STEA 1DBTA 1SFLA 4Y6GA 4RCXA 4IMCA 1N7KA 5TQLA 1DHPA 3W7HA 4YCOA 5I3JA 1W56A 3W7PA 4HPJA 4H4IA 4UNKA 5G2WA 3NQ6A 2CZ5A 3SFKA 4DEFA 3RF9A 1KTCA 1R2TA 3NQ7A 4ALDA 4IMDA 1AW5A 1TREA 3TV8A 3HMJG 1KM0A 1IF2A 5BW6A 1FWTA 7TIMA 4PA8A 3TFCA 4N9DA 3STGA 4UXDA 3W7GA 4MLRA 3IEBA 4UNLA 1EP1A 3CTLA 1VCGA 5C54A 2A5HA 3T78A 2QAPA 3GR8A 4GXMA 4WD0A 3L66A 3L9CA 1DQWA 2DZTA 1VJIA 2NUXA 3KOFA 3HGOA 2ZRUA 1H60A 4UTUA 4MY9A 3EWUA 3C0JA 3KVMA 3W70A 2ZZ1A 2PRHA 2Y7EA 2WOQA 3NL2A 1JQXA 4GUHA 2JGQA 2J6XA 1L6SA 4M7SA 4PEKA 1A5SA 3P67A 1NF7A 3PUEA 3W07A 3DHDA 3R13A 3G8EA 2C1HA 1OG0A 3GLCA 3M9YA 1GG0A 1D9EA 3CIXA 4YLWA 3UWWA 1OFAA 2BXVA 5CPLA 3OVPA 3TXVA 2GUUA 3EWZA 5EKYA 1L6YA 5DY3A 3R8RA 5C6MA 3THAA 4UTTC 2B7QA 2ZRYA 3YPIA 3H53A 2CLLA 3CT7A 3BLEA 2FPVA 3MBDA 5TBOA 4P2VA 2ABAA 4CNNA 1J5TA 4LVDA 4JDBA 4TO8A 3W1MA 2C18A 4JYDA 3IV3A 4PL1A 3HGJA 1YTDA 1KV8A 1JRCA 3IRDA 1EB3A 3W76A 5AHLA 3MYPA 5LZLA 2QCDB 1Y0EA 3P84A 4JYEA 1LROA 2Y63A 2A6LA 3UXAA 3NM1A 2J9XA 4G1KA 1SO4A 2J9YA 3UPBA 1QMLA 4I9AA 4NNCA 2CFFA 4WY0B 2WO5A 2V5BA 3M43A 4R7JA 4UUIA 4WXZA 4O4VA 4H3DA 2WSQA 1I8JA 3W1UA 2KZHA 3G1AA 5AYYA 1AL7A 2OZ0A 2QJHA 4AF0B 1DV7A 4XTIA 1TB3A 1VR6A 1TTPA 3W1PA 3EWYA 1JRBA 4UFHA 1GYNA 4UFIA 2AAMA 2XN0A 4JTTA 5DY2A 4FNPA 2BZNA 4M19A 4TMBA 2GOUA 2ZTJA 5EA9A 3OG3A 3PY2A 2TSYA 3NQFA 3PUDA 3B0UX 5K9XA 2C19A 3PWAA 4GUIA 1DL3A 5U7SA 2BWGA 3G1XA 1EEPA 3W2NA 1VHNA 5DXXA 4RV8A 4UFJA 3WJXA 3CWNA 1QPRA 3RFAA 1ZAHA 1TV8A 4LNYA 3MHGA 3R5EA 2E6FA 2NWSA 2BSLA 4OU1A 3MMTA 2C15A 4UFKA 1R47A 3MI3A 4UIOA 3N3MA 1ZY9A 3UQNA 1OX5A 1LYXA 4NJKA 3FKRA 3GZ3A 3WJYA 3KVLA 3NQCA 1OF8A 3B4UA 3EXSA 3W2JA 4GE8A 3T4CA 3FLUA 1IGSA 4NJJA 3USBA 2G95A 3K30A 3GDKA 3PUOA 4S1FA 1EWDA 2CU0A 3DENA 3C2OA 3G18A 3P82A 4OV9A 1TPC1 5AYZA 1B4EA 2RDUA 4LTSA 2P10A 1G4TA 4O15A 5U4NA 5BMWA 1JCJA 3TC6A 1FDZA 4XBKA 3S6DA 3A22A 1ONRA 3L0NA 3RLVA 3W7RA 2Y62A 4BWLA 4PCFA 3N34A 3B0VC 1OX4B 1WBHA 2NUWA 3TC7A 1OABA 4ICNA 4CNOA 3EB2A 1KM5A 2VC6A 4Y8FA 3EXTA 3NQGA 5G2IA 3HG5A 1QO5A 4NZJA 3KVJA 4O52A 4JN6A 2GQ9A 4X9SA 4EOUA 2Y70A 3L67A 5TIMA 5D37A 3HPZA 3P74A 4HNVA 2TPSA 3LCWA 5AOUA 3THQA 1X7FA 1LTDA 5K7JA 5BOOA 5K4ZA 3TROA 1GVRA 4FX7A 4LC8A 3TCEA 1UUOA 3E9AA 3PR2A 1WYIA 4X22A 3GIYA 3CWOX 1LLWA 1W54A 5C5YA 1GVOA 1AG1O 1L6WA 4GUJA 5D2VA 2CLOA 4ORMA 2BLEA 1G7VA 3CLMA 4FXSA 3W7NA 2OX1A 1XXXA 3NNTA 5EYWA 2JKEA 1FUYA 2DZUA 2OT1A 2VFFA 3GXTA 1OK4A 2OT0A 3DKJA 2NWRA 4LUIA 2WNQA 3W7IA 1V7YA 1SZGA 4HHPA 3G1DA 3S8HA 2NX3A 1GWJA 3A24A 4C1KA 4XKYB 4X2RA 3P7YA 3DFQA 3DH7A 4FX8A 3IVTA 4L4MA 3LB0A 2RDWA 1BTMA 3V75A 3LHTA 4KWWA 3FS2A 1GEQA 1NEYA 4FNSA 4AVFA 5T26A 2OCZA 5CG7A 4ZQCA 5IM51 2HMCA 4PL2A 4U28A 1M7OA 1ZJIA 4O54A 4RR4A 5EL1A 2Y85A 3ABRA 3HIJA 5FESA 4EVZA 1JQVA 1K3UA 1LRNA 2GVJA 1YPIA 3N2MA 1TJPA 1LRTA 4N9BA 2TRSA 1L9WA 2NXGA 1GZGA 1SW7A 2YZRA 2W79A 1OK6A 2VOMA 4LS0A 1QOPA 3BV4A 3LI1A 2NX9A 3FFSA 5DELA 1TV7A 4E2BA 4JX5A 4ZL1A 3PB2A 1LZOA 2FFCA 4WXYA 4NT0A 4LY8A 4M5PA 4RKAA 3QEZA 1S5TA 3W2UA 3G22A 1WOBA 4QJ1A 4DF0A 2FPYA 1THFD 2C6QA 3EWXA 5FF3A 2GJNA 5F4WA 4HN4A 4KFPA 5FEWA 5LHFA 2FLIA 2VELA 4KKXA 3TJXA 5KSWA 4UFMA 2Q3RA 3IIXA 3NL6A 1W8SA 3S1VA 2ZZ4A 3EKLA 3VE7A 4HT3A 5AHMA 3T7VA 5L9FA 1PIIA 1K02A 1TSIA 3QMRA 3LTSA 5KITA 2X2GA 5F2IA 3W74A 3W73A 3AJXA 5DCEA 4OHQA 1WAUA 1C29A 3MHUA 2A6NA 2WSYA 3U6WA 4QNWA 3GR7A 1XM3A 1VC4A 2QCLA 3NG3A 3W71A 2X1RA 1H7PA 1O5XA 4IPJA 1NVMA 4UR8A 2YXGA 1FCQA 4O11A 1SW0A 3MI6A 1XUUA 1EUAA 1JULA 5HWJA 3NO5A 3W7EA 4UTHA 5LNWA 3Q94A 3CIWA 3W1AA 2YX0A 3NXFA 4ZMGA 5DBUA 3I65A 2B7OA 3ATZA 5I3IA 1XBXA 4BR1A 1K8YA 3WK2A 5LNVA 4LV4A 1WQ5A 5GVJA 1AK5A 2JKAA 4GNJA 1GT8A 3S5OA 3TMQA 2A7PA 2VXNA 4OE7A 3DXIA 2YPIA 5HWMA 4IX0A 4GRSA 2ZFAA 5D32A 1EWEA 4K38A 3OEXA 1O95A 1LBLA 5J5RA 1CX9A 1WBJA 5I3HA 5KTLA 3R2GA 3B0PA 2ZRXA 2CZEA 2QF7A 3W7CA 4JY9A 5I3KA 4K8HA 4RJEA 1PS9A 4UC5A 3P60A 5K3VA 2P0OA 2G96A 3TQKA 1BKSA 3W23A 3C2EA 1PV8A 3ATYA 2V2DA 3BG9A 3O05A 1KW1A 2A21A 1QNVA 1H7WA 1I2QA 4R53A 3GXPA 2P1FA 5CPMA 3T40A 3P5YA 3W84A 3I6RA 1TPVA 1OHLA 1W5PA 1F73A 1SW3A 2QUVA 2E5BA 1JUEA 4UTIA 3PS7A 3F03K 4NXSA 3GNDA 1TPEA 4FB7A 3NL3A 3F4NA 4LV9A 3CHVA 3W88A 3QW3A 1XI3A 2EHHA 3W22A 4UTTA 4Q33A 4UTMA 5ABTA 4M7TA 1OYBA 1DJNA 3QSRA 2ZTKA 1AL8A 2FPTA 3W7LA 3A9IA 3W1RA 2CLEA 3OIXA 2JK2A
chains in the Genus database with same CATH superfamily
3QMTA 3ZYZA 1H1YA 4NQ1A 3ZR6A 1W1YA 1KLYA 2GQAA 4NZ4A 1CEOA 3H21A 3VDCA 3G5EA 4O0KA 1IT7A 4MJZA 1T96A 1O4UA 1QPQA 4WVXA 4ZQRA 3VIKA 4D1IA 2XH0A 1JUBA 1U83A 3ZOAA 2J9ZA 1RY8A 3RUBL 3NOEA 1OJXA 4MKNA 2R1NA 3VNLA 4LFYA 2WQPA 4L4LA 4AC7C 4W88A 2YL5A 2PU0A 1D7FA 4A21A 3TTEA 1B2YA 3Q4DA 1B9ZA 3MP5A 3VGDA 3BSMA 3CPRA 2CPUA 4IOTA 2WMJA 4HNNA 1ESWA 4WK9A 3MJYA 2AQVA 4O1BA 2E8YA 4AZ6A 3UZWA 4UTJA 3DHPA 4BQ4A 3LCHA 5EFDA 3SDOA 1NQ6A 2OSWA 3ZVHA 5BU6A 3MUXA 1J18A 1R2SA 1EP3A 5HK4A 4FNQA 4GWEA 3WLHA 2PD9A 3PZIA 4PTXA 1YDOA 4JIEA 1O94A 5DXYA 2ISSA 5CPOA 1A0DA 1C91A 3QHNA 4H9UA 2FKPA 1F4HA 3P8IA 3TJLA 4PEEA 5AC8A 5I3GA 3OYZA 3QBUA 1J2WA 3VFLA 1EX5A 5EGRA 3KBWA 1Z6KA 2Z1BA 2JALA 3WBYA 4ML4A 4O53A 1T40A 4PCTA 5REQB 3FVDA 2YBTA 4ZVJA 3GU9A 5XIAA 1XLMA 4ZQOA 2FB2A 4ADTA 1QI4A 1SFSA 1XRFA 1ONWA 4QE5A 3IRSA 1UROA 5HQLA 1KBJA 1JPKA 3VMOA 3WKZA 1O1ZA 1ICQA 2VEPA 1XF0A 1DWIM 1W2PA 1A80A 4CN1A 1ZENA 2PP1A 3QHOA 1AQ0A 2VR2A 1I0DA 4FIRA 3W1LA 3RR4A 2CESA 4HYRA 2WMIA 1QAPA 2E6DA 3LXBA 5FI8A 3TQVA 3SCTA 3SCUA 1SR9A 2FMOA 2BFGA 3H2AA 3R12A 3BG3A 1CXEA 3VGEA 5BXSA 4A29A 4BKNA 1DQUA 3W1TA 3TMLA 1ICPA 1PO9A 5ABGA 2CITA 4JX4A 3IJ6A 4C5ZA 2E09A 1WDRA 1QNQA 4B16A 2WJDA 1GORA 3TR9A 1F74A 1E6QM 3DERA 4DF1A 3ZR4A 4AX7A 4QDWA 3QN3A 4U5IA 2GJXA 5LIYX 1RH9A 1O5QA 3GDTA 1VS1A 4JQ2A 4GC4A 2ZA1A 4QS6A 3QPZA 4TU1A 4Q8UA 4K68A 1Q45A 3VIFA 4B5SA 3I10A 4Q22A 1NOUA 4MY8A 3SCRA 1ZCOA 2IPFA 3BV7A 1O12A 4I3GA 4P7RA 3N12A 3V16A 2X05A 1EA0A 1EL3A 5FJJA 3E6EA 3KCJA 1EC8A 1W5NA 3M6YA 4POCA 5GNXA 1K1DA 4A05A 1UPMB 4DWDA 5K4XA 4JHOA 4O1CA 2A3AA 4KS0A 3M47A 1E6ZA 1KWGA 1LOSA 1R2RA 2EAWA 3GC5A 4ONVA 4BI6A 3EEZA 3PZ9A 4NJHA 2Y0FA 1HKWA 1LM1A 2I1OA 3SADA 3QOKA 1RALA 1XINA 4WR3A 3VGGA 3WLKX 1H0IA 1K9TA 1XYLA 4XKYA 4FO4A 3M0KA 3UY7A 3QV8A 3R43A 2X0HA 2WVSA 4D8AA 4QS5A 4PN2A 4MNMA 2WVTA 4GH1A 2H3BA 3CMJA 2OWWA 1XISA 3AS3A 1JF6A 1R3WA 3ZWTA 3LLDA 5DRIA 1U5VA 1F8MA 3CJPA 3KOXA 1BG4A 2ZUMA 2TYSA 1GVIA 2PDWA 2QCEA 3KL0A 4NUWA 5CBBA 2Z2UA 2EGZA 1FH9A 3ZT7A 3GUWA 4R9XA 2VOTA 1EEXA 1VBGA 4BEQA 3A3WA 2PRMA 3BE7A 1P1MA 2XFWA 1XCFA 2OZ8A 4RE2A 3V5FA 3E3HA 3HJEA 1QI0A 3CU2A 2HS8A 3CC1A 5C8BB 1P6BA 3KRZA 2R9RA 1H50A 1O5RA 1XBYA 4HIBA 1UASA 5LYRA 3W28A 2ABBA 1S3HA 4H7VA 5I07A 3MO4A 2F61A 4MADA 2F84A 3TW9A 3GQYA 4JFUA 2NT0A 2FYMA 1H63A 3DFOA 3S2CA 3ANVA 5M1TA 1A5LC 1UCWA 1CPUA 7XIMA 2ZA3A 4WDWA 1ZBCA 3BLPX 1J0KA 4QE1A 3LGEA 4PTNA 1PDZA 3WF4A 3LCXA 3EDKA 1W9XA 2OMAA 1AZ1A 4WKFA 2NLIA 2QZRA 3NGFA 1UR4A 3LCLA 2X1UA 4GBUA 5D9MA 1V03A 3DGBA 4KESA 1Q6LA 3ZR5A 3CHFA 3FYPA 3DG6A 1EXPA 1FWEC 2EPKX 1XH0A 2Z1KA 4ROQA 3R94A 4RDZA 1O5KA 2PS2A 4CD7A 3MMWA 2QF8A 2VGIA 2VDIA 1I4NA 1TVLA 3UXLA 3GG8A 5CSSA 2DZXA 1FKWA 1GUVA 3PAJA 2XFRA 4B3ZA 3W6LA 4MZYA 1V6XA 5LNSA 1SSDA 3WNMA 2DY3A 5RUBA 3W2LA 3VD4A 4OGZA 1FWJC 3HM7A 4JFSA 1XV8A 2W91A 5C9WA 3CZJA 3BW3A 4J28A 2G50A 5L6UA 1WOAA 4MWAE 1E4MM 2R24A 3FJ4A 1RUSA 3HTWA 1CIUA 3LXCA 3WNKA 2PGEA 3WF0A 4WLCA 1H7OA 1YXYA 2WYSA 4Z1BA 4LOCA 3TEVA 3M41A 5GJNA 2HBXA 4MZ1A 4UZSA 4DNHA 3KBMA 3LRMA 1MQQA 2F7FA 4GXWA 3G6MA 4JIQA 4QEEA 3QLDA 4JL2A 4GOAA 1Q6CA 1V6TA 3WD1A 4JD4A 3SUVA 4UCGA 4Y9AA 1SM9A 2FGLA 3AXXA 3DFHA 1VCVA 5HQEA 4NZFA 4PMUA 5H8MA 3CV6A 3GW0A 4AYSA 3NDYA 4I8YA 1KM1A 2CC0A 2ZYFA 4HSOA 2G97A 3KBNA 3E2SA 1RCXB 1H1NA 3U2OA 3KOWA 1V0KA 1O68A 1HKKA 2XVLA 1OCJA 3JS3A 3WEMA 4DJEC 3DC0A 1GNXA 1DJYA 1O60A 3TZFA 2PWUA 4QP0A 3OIHA 1QCWA 3RCMA 1PZ2A 1JCLA 3QSTA 5HMSA 3W7OA 1E70M 1L6GA 2VP8A 3B40A 3FV9A 3LENA 2PLJA 3GH7A 1JVNA 5HJLA 4NNBA 4L65A 5DN1A 1MXGA 3I6EA 1R8LA 4JTAA 1JPHA 1XLJA 3N3TA 4M6PA 3VFCA 4FS9A 4QG8A 4S3JA 3WDRA 4ZO8A 2V2CA 5D2WA 4M80A 5MKGA 4KERA 1KCZA 3R79A 2I9UA 2V63A 2WW5A 3KCOA 5F2MA 3VMNA 1OIFA 2VFEA 2OJPA 5I79A 4EWJA 2B7NA 2PF0A 3H70A 3VXGA 1R9YA 1G6CA 5E9AA 2VEKA 4HOWA 3LPPA 3CEUA 3QYQA 1CZ1A 1S1RA 2HRWA 4MLJA 1RBAA 1YNPA 1R3SA 5DLCA 4JHZA 2IW0A 3TH6A 4RXGA 4YYCA 1VPQA 3V1HA 1V7AA 1B31A 5XIMA 3UY8A 5K9DA 1ZSXA 4H6KA 5HPOA 1EH9A 3PBYA 5REQA 3IIVA 4XUGA 2C1IA 1MYRA 2BHUA 1VYPX 4OBTA 3F7JA 4NASA 2UBPC 4ZE4A 3QRHA 3C4UA 4ZZ9A 3VKJA 3GDRA 4HMEA 1XYBA 5CZJA 2OXNA 1BYAA 1Y65A 1KLZA 4FNUA 1RY0A 5B7ZA 3IGHX 1MWOA 2ATSA 4BF5A 2RFGA 4RK8A 4UTWC 1PVNA 2H3DA 4EP8C 1IXQA 3E5BA 3M0ZA 1PWLA 1JDEA 4D9PA 2FJKA 3RCNA 1XLBA 2ZUWA 3M44A 2QV5A 4AMCA 3BLKA 3W6MA 2QUNA 2NT1A 4HNOA 3QY8A 1EJXC 1LG2A 3KDNA 2R1LA 4IF2A 2JE8A 4L4OA 4FF5A 4H8UA 4JQ3A 1X96A 4HYVA 4HSNA 1RZMA 3O6AA 4HZ7A 3ECQA 2HEJA 2IKGA 3BXWA 3NQEA 3GH5A 1RV8A 3SRHA 4XSMA 4AW7A 1QI5A 3BGJA 1PKLA 1TUXA 4IUGA 5FKYA 3UG3A 2RGMA 1YXDA 1YXCA 1Q4WA 4KEMA 2E5DA 5HNNA 1G4EA 1UWAA 1F61A 3M5XA 2YW4A 5CC6A 1Z3NA 2JIWA 3NQDA 3J7HA 2VD9A 2A3HA 4QDPA 4DJED 1QPNA 5GNZA 2O0TA 3FGCB 1QK0A 3KEHA 2ZBTA 3GVRA 2VL4A 4DVOA 3G24A 2AGTA 1RVGA 2V8ZA 4DIAA 4ERIA 1TE6A 4CCCA 3R0KA 2FZBA 2PWDA 5EMUA 2QEZA 4R5EA 3WJZA 4FOUA 1PUDA 1JDDA 3BMWA 2ON3A 1ODUA 3P80A 1V51A 3LBMA 1FWFC 1XCWA 4Y9OA 3SUTA 2Z27A 1OSEA 2E6YA 1VRDA 4ZOEA 4IFKB 4GFSA 4ZO9A 4GVHA 3BCDA 4EACA 1YBQB 3LBOA 1L8NA 2P50A 1EP2A 3EMQA 1OZMA 2IQTA 2F38A 3VIGA 3WLIA 2YYTA 2DJLA 1KKOA 4YVVA 1KM3A 4NF7A 3VPLA 1TV5A 8XIAA 2WJFA 3POCA 3N73A 1R86A 4Z2IA 5K2ZA 2QKFA 3T44A 1H4PA 1Q6QA 4KEZA 4Z1DA 5C2CA 3U4AA 1V6UA 3KZSA 1YADA 3SJ3A 3S2LA 3VIIA 1CI1A 4LU0A 4O1EA 2XSXA 3QOMA 3GK0A 1KO0A 1VFSA 2BP1A 4UZUA 4K7VA 1VQTA 3B0YA 3EWWA 1REQB 3IAPA 3UA4A 3NYZA 3PF3A 3W29A 4MGGA 4PODA 1M65A 4LAOA 2Z1XA 4IQJA 4BF9A 1QU4A 2GQ8A 3HU7A 4CD5A 3O63A 4LALA 1A5OC 2QMJA 3AICA 3U9IA 2QDEA 1KFJA 4QNEA 1JCXA 4IQLA 4DO4A 1WUFA 5CPNA 4EE9A 4YTSA 3GVQA 4N4QA 4Q7BA 1V3JA 3WH9A 4IIHA 2YZ5A 3OODA 3RMEA 1L2UA 2PAJA 2GFTA 3WLNA 3RYSA 4DYJA 4HA4A 3O6CA 2HS6A 4YN5A 1U33A 4JNMA 1KNWA 2BTMA 4CD8A 2OTDA 5ECVA 1B3WA 4K1GA 3TW7A 4IGMA 3LGDA 1QASA 4G7FA 1H0GA 4H83A 5LHEA 2WANA 5CZTA 4C7DA 2EPLX 2EG8A 4V33A 1K03A 3PULA 4E4PA 3TA6A 3CWHA 5T9CE 3PPHA 1QW7A 2YL8A 1FWBC 4DQWA 2JEQA 1UW9A 3SR7A 3IIPA 4HHHA 7A3HA 3H7VA 4MB1A 5HUPA 1XPYA 4M1BA 1W37A 1Z7AA 1XLLA 2V3DA 4YWIA 3F4CA 2C71A 1GOOA 3KHDA 1C8VA 2OO0A 3C6CA 1XD1A 2NUYA 4K1WA 4CKQA 1C92A 4BY3A 4B9YA 2C91A 2DW6A 4L6DA 3T9PA 1UUMA 1VLWA 4Z2GA 4E8CA 2GGGA 3VAVA 4MFDA 1BGGA 1HFBA 1UUQA 2G3IA 1X38A 4N6FA 3D3AA 2TODA 1S2CA 3AISA 2V3GA 4AD0A 2YFOA 3NPWA 3WQ4A 3C2YA 3GB6A 6PTDA 3OTRA 1TIMA 1Y7VA 4C90A 1RVKA 1MFUA 1WX0A 2HSAA 1JEZA 3H24A 4P8UA 1JI1A 4Y90A 3P62A 5CKSA 2F6XA 1OFPA 3ZT6A 5D9PA 3UYCA 3W7MA 1XLAA 4FLSA 3N1AA 4MHBA 5FF4A 2EF9A 2QNEA 3UG5A 2YDAA 1HP5A 3GHRA 1JD9A 4RPQA 3EX6A 4AZIA 3P2VA 3MWAA 4Y9MA 1IQ8A 1HKJA 5FA5A 3M7WA 4XZIA 3BUVA 1RHCA 5DO8A 4LVBA 4XVEA 1EA9C 1P7TB 1G4PA 4PMOA 1IR2A 3A5VA 3AIBA 5FAGA 2X16A 3W1QA 5TAOA 3CHCA 3W37A 2P0IA 4GQ0A 4EPBC 1EJWC 2ZQ0A 2WHLA 3W0KA 2OODA 3W6YA 3E2QA 1EC9A 1VCFA 1VBJA 1W3LA 2C14A 4WIWA 1P0DA 3L0GA 4NNAA 3T0AA 3ARYA 4XTDA 5KZ6A 2VC9A 1LL7A 3A9BA 3AO0A 1TTIA 3VIOA 1SQ7A 1B30A 3PFRA 4MYXA 2F8QA 4L9XA 3TTQA 3GYEA 3LBCA 3EMCA 3DG7A 2HTMA 3QXBA 1PAMA 4LVAA 3FA4A 5DX7A 2G4JA 3M5YA 3VKBA 3SIMA 4RPPA 1P1XA 4IL2A 2PTDA 1ME9A 4IGNA 3RX2A 1MUCA 1O66A 4GYPC 4WJEA 3W1XA 2VR5A 2YCIX 1K6AA 3S42A 5LIWX 4A6GA 1F3EA 3VINA 2XH2A 4FR1A 1UR9A 3P5ZA 3ITTA 2RKXA 3CM4A 3UWQA 4PMXA 2MNRA 3PG9A 3LQGA 1E6PA 1TQXA 4ZOAA 3TNOA 4ZBCA 4ZSUA 2VFHA 1KFKA 3NQMA 1KTNA 4GVGA 1CB7B 4GX8A 3IJ7A 1I2RA 4F2TA 8XIMA 1QWKA 1W91A 2GYIA 3SQSA 3S5ZA 3W9ZA 3HPXA 4F66A 3TOYA 2ALDA 3NEVA 2NVDA 3H2FA 1XLGA 2WMGA 1IEIA 5AVHA 3CPGA 3ZJKA 1GHRA 2C13A 5CSRA 3TJ4A 4JXCA 5D2TA 2Y5SA 1QBBA 3ZMRA 4ZFCA 1IT0A 1KXVA 3CQJA 3PTMA 4C6FA 1J93A 1RPKA 4HYWA 4AC1X 1SFLA 4GI9A 1SJDA 2ALRA 4HSHA 4S3KA 5I3JA 1NDZA 4HPJA 4Y8EA 4H4IA 5G2WA 1WE5A 3T42A 1KTCA 4ALDA 3DYPA 5E5CA 2HZGA 3BQ6A 4QHRA 3TV8A 3UP8A 2QXWA 1PSCA 1CCWB 2WAGA 4AXNA 7TIMA 4WKAA 4PA8A 2DIEA 3TFCA 1FH7A 2XZ9A 3BGAA 4N9DA 4REQB 4HU4A 3W7GA 1R3RA 1I60A 5C54A 2A5HA 4H8HA 3L66A 4GABA 1DQWA 4QQUA 1E9LA 3KOFA 2ZRUA 1H60A 2DSZA 3WIJA 4MY9A 2ZZ1A 3KTXA 2WHKA 3OJGA 3NEHA 1EGMA 3BAXA 4LYPA 4E8DA 4GXPA 2Q09A 3CAVA 1DWJM 3W07A 1QATA 3DHDA 3EKGA 3GG7A 4PUDA 4FZIA 3AIEA 1SMDA 1D9EA 3CIXA 5JQ9A 3M0HA 3URBA 2BXVA 1XICA 2GUUA 3EWZA 1M9HA 1FH8A 3CT7A 2CLPA 1ECEA 3CPUA 2FPVA 3IJ8A 1E0UA 4GLEA 4AVOA 4XX6A 2BVYA 5A95A 3GIQA 4TO8A 1T6MA 1B3YA 4E5TA 4IFKA 3F2CA 1YBQA 2X8RA 4KEVA 4ES4A 4LEQA 1TG7A 4JYEA 4M51A 1LROA 4EKJA 1SO4A 2HWGA 4HGXA 5JIWA 1P0BA 3UGVA 1V77A 4WY0B 4R7JA 4O4VA 5HNUA 4GVIA 3W1UA 1IWBA 3HN3A 3K5XA 1EJVC 4I5XA 1JNDA 4AF0B 5A6SA 3N11A 1XLEA 4GI6A 4TX6A 2QGYA 3G1RA 1JRBA 4UFHA 1R3VA 2XWDA 3PAOA 4ACZB 1PTGA 1AUSL 3MSGA 4PUWA 4FNPA 1REQA 4AG0A 2ZTJA 5FJIA 5CEWA 1V0NA 3PUDA 3W01A 1OGGA 5U7SA 1FFQA 3OBEA 2XVPA 3V5CA 4UQDA 1UR2A 3FN9A 4X0NA 3N18A 2E6FA 2NWSA 1V0LA 4DJFA 4V1XA 4UFKA 1GJWA 3UVAA 4CGTA 1XIBA 1GOQA 4JNZA 4H19A 3W2JA 4GE8A 5T9BG 3RJXA 3K30A 4C7GA 2CU0A 2VO5A 3WCZA 2HNHA 3P82A 4OV9A 2VURA 2WM1A 4BCEA 3F5JA 1AZ2A 3IPWA 2RDUA 4LTSA 2P10A 1G4TA 1WO2A 4S23A 1A5KC 2E8ZA 4R85A 3ARXA 1FDZA 5BZAA 3S6DA 1Q7MA 2Y62A 3WLRA 4G2DA 4LCRA 2EBNA 3TYEA 3N34A 1XLHA 2X09A 1Q6DA 4ATDA 1GCYA 3VD5A 3BAWA 3EB2A 3FA3A 4Y8FA 1J2BA 1JI2A 2GUBA 3NQGA 5G2IA 1DEDA 4GIAA 1QO5A 4O52A 1YIXA 3RN6A 4X9SA 2Y70A 2XZ7A 2VCBA 4HZ6A 4LQ1A 2PTZA 4N0RA 4HNVA 3E0FA 3LCWA 5AOUA 1LTDA 2Z2BA 3MC5A 2ZADA 2OSXA 5K4ZA 1XS2A 4FX7A 4B2DD 3TCEA 3E9AA 3GIYA 2A3CA 3CUIA 2Z29A 1GVOA 3WLTA 3NSNA 2BLEA 4FXSA 2OELA 3W7NA 5HMEA 4PRWA 3AYVA 1LWHA 3PHAA 3KS5A 3JVAA 2OT1A 2VFFA 3DKJA 2NWRA 4S38A 3GTFA 3AMKA 1GGOA 3S8HA 1GWJA 2D69A 1NH6A 3P7YA 3DFQA 1K6WA 1CLVA 4P7NA 4LF1A 3FS2A 2BODX 2XIQA 4CQDA 3OLIA 3RRXA 4L7ZA 3AHTA 2Q02A 3OG2A 1CTNA 2HROA 4PL2A 1P7TA 1M7OA 4RR4A 4H00A 3ABRA 3HIJA 5FESA 1K3UA 3MQTA 1JYVA 3N2MA 4LJ3A 2YZRA 1RLCL 3VGBA 3BV4A 3FFSA 3B8VA 4JX5A 4ZL1A 1EF3A 1LZOA 1UBPC 4LY8A 3OYXA 4RKAA 3RLGA 3L4WA 1J0JA 4Q7IA 4DF0A 1JPMA 2BOFX 4YJ5A 5FEWA 2FLIA 2VELA 3DN5A 3WQPA 2Z1WA 3S6TA 3NL6A 1XLDA 3EKLA 2CERA 3EDJA 1QNOA 4PR4A 2Z00A 1UA3A 1DJHA 4DBWA 2X2GA 5I09A 1RXOB 5F2IA 3W73A 5BOEA 4JEJA 5DCEA 1C8XA 1Z9AA 3EA3A 4O1FA 2X2YA 3GDBA 2QIWA 1VC4A 3CHEA 1UIOA 3UJ2A 3NG3A 4IIGA 2P88A 4UQAA 1NVMA 4UR8A 1EZ2A 1VRXA 1EUAA 4GKLA 1JULA 2XIJA 3CIWA 1KBBA 3I65A 2B7OA 4HP5A 3UG4A 2RJGA 1XBXA 5I3IA 1K8YA 2Y4SA 3WK2A 5LNVA 4XO7A 4LBUA 4Q6XA 1GT8A 4XD5A 2VXNA 4OE7A 1UPPA 5DFAA 2YPIA 1Q6FA 4R7WA 5D32A 4K38A 1V02A 4KRUA 3B9AA 5J5RA 1WBJA 5I3HA 2X41A 2CZEA 1OWQA 5EFFA 2WZMA 2E40A 4XIAA 1GW9A 4CN6A 4P8XA 4RJEA 2XVGA 1X7IA 3CAWA 3NDZA 3P60A 5K3VA 1BKSA 2QJJA 4XIMA 1EJRC 1US2A 3O05A 2HBVA 4QE4A 5FJPA 3V18A 1QNVA 1H7WA 2QJNA 4PSPA 5AZ1A 4BA0A 5CPMA 4WRHA 3P5YA 4RE0A 3W84A 1YE4A 4IGSA 1EF2A 1W5PA 1F73A 1HJUA 1VBHA 3GD6A 5E0FA 3V5OA 3H6OA 4R27A 4ECLA 3R1ZA 1B90A 2P3ZA 3KZPA 2BOEX 3NCOA 4RNHA 3GBDA 3CHVA 4REQA 1IHIA 4IQDA 5ABTA 1QK2A 3GM8A 1WUEA 3B9DA 3KP0A 1YRRA 2IUZA 3OIXA 1WKFA 3NWRA 1BVNP 1GOKA 3H12A 3SGUA 5E6YA 3AWNA 1SZFA 4JX6A 2WVUA 1CB2A 3OOQA 5J04A 4QQ3A 2YYUA 3PJUA 4W84A 5CGMA 1DORA 2GVGA 4O17A 1GJUA 3MANA 1WKEA 1V93A 1AQHA 1Y8BA 4O0QA 3MMDA 1UZDA 5C2GA 1GQJA 3GE7A 3T81A 4XISA 1DWAM 3Q2DA 4GYJA 4BI5A 3ZXWA 2PTXA 1UWQA 4A3QA 2BGQA 1XKYA 3LRLA 3CQKA 3FOKA 1PYMA 3FSTA 3GAKA 1R0MA 3KHJA 4W93A 2D2OA 4H9ZA 5A6MA 2CLHA 3MSYA 1V5XA 3PZMA 2OU4A 4YPJA 4GNKB 3APTA 3UJEA 3R6IA 4C65A 3QYSA 1IXPA 3OHMB 1UH3A 3MPGA 4RDYA 2J7CA 3CO4A 2HXUA 3Q65A 1HW6A 5KEZA 2IXVA 4PFMA 2I17A 1TA3B 4WY0A 4AH7A 3SUSA 2X40A 2FH8A 4IMGA 3N2XA 4K3ZA 2I5GA 3BSHA 4AF0A 1YTEA 4CVWA 3BW2A 5HR7A 1X39A 4LRSA 3KWXA 2EKCA 3MI2A 1ME8A 4FR6A 4ILSA 2AQWA 4PB3A 1V3HA 4TX9A 4WX2A 5DT5A 4PCNA 2YA0A 3Q45A 6ENLA 3FKKA 4ACZA 4EANA 3HZ3A 1V08A 4LNCA 1KRBC 3SSJA 2ZVIA 4J3UA 3ABXA 5AFDA 1CECA 1WZLA 2IPGA 4GZJA 2CBJA 4M24A 4MVAA 1RD6A 3DI1A 4FHAA 3KRSA 4LEFA 1F05A 3C52A 3PM6A 2PBOA 4C6MA 4I6VA 2DW7A 9XIAA 3RO6A 3NPUA 3P14A 5EPDA 2BMBA 1ZAIA 3IVSA 4LYQA 1XYZA 3MU7A 1VFUA 4GPNA 2GK1B 3B8SA 4WSJA 5HINA 5I2UA 3NUKA 4GFIA 3WDJA 4DZIA 3A5FA 4L9YA 3KX6A 1I2OA 4S3DA 5HNRA 2F2KA 5A2CA 3E96A 4Z1YA 2ZZ2A 3E0IA 2G3FA 3TDFA 4F79A 2YIHA 1ZLPA 3UVIA 1ADSA 1U5HA 3LCIA 4AHOA 2V82A 1E0XA 4XK2A 4YXGA 2OB3A 3T2QA 3R0DA 1MRAA 3O06A 3COTA 2QIIA 1VPXA 2ZRVA 4WSHA 4JTFA 3UWVA 1FDYA 1BYBA 1OGBA 3K4WA 4C60A 5AC6A 4AEOA 2BV9A 1MW2A 3QC0A 2EJ1A 4NRSA 3KW3A 3WBWA 1K7XA 4H9VA 1CGUA 4IWWA 4Q7NA 3EX3A 1VBUA 2QDHA 4Q3MA 4LCQA 2CLKA 2VGFA 5DMMA 5FJTA 4FAMA 4FF7A 2WZEA 4H9XA 1BEUA 3CMFA 4Q4KA 2G0WA 3K4DA 3LHWA 5BWAA 1KXTA 4BEUA 2DZPA 1ODZA 2HCVA 2POTA 3O3RA 4W9TA 3FNDA 1KFBA 1BSIA 3KL3A 3PWIA 5FAJA 3ZJ8A 1W3IA 2XVKA 3PWGA 3DHFA 1XCXA 4AIOA 2HDJA 3SRKA 3E0VA 3I6TA 2ZCGA 4MIMA 4Z0JA 2J74A 3NZQA 5HAOA 4AU0A 3ABQA 1B3ZA 1WV2A 5AHIA 3LNPA 2BXZA 3OZMA 1UR8A 1NIUA 2CWXA 4FPSA 4KRTA 4HZMA 3M5VA 4QM1A 3AXMA 4TV5A 3SN4A 3U5UA 2J7FA 3VCCA 4RUBA 5E6ZA 1W5QA 4IGHA 3V4BA 1ZHAA 3LPOA 3VTRA 3RM8A 2QYGA 1QRQA 2Z1VA 4OTKA 3L4YA 1AODA 1C3FA 1XIFA 1V6WA 3EOOA 4RX0A 4JN8A 3O0FA 2ANUA 1A49A 5HMDA 2OZ3A 4J2PA 4LAKA 4U5KA 1TWDA 1F6PA 1LJYA 4EF8A 5IOBA 5HATA 8CGTA 2WJEA 3S4TA 5I0DA 3CYVA 4E3VA 2POZA 1BYCA 5IXEA 3TJIA 1T41A 3PBUA 3XINA 3S0CA 4PCPA 2PF8A 1M41A 3A21A 1FP9A 4KWSA 4J9JA 3CH9A 5A6LA 2PGWA 2Y1HA 4ORIA 3W85A 4IHCA 3WLSA 2DVTA 5KZMA 4LRTA 4I5UA 3RM4A 4H8VA 4C6NA 3RLUA 3RU6A 1JXKA 4V1YA 1VIWA 1PHQA 4KW2A 1AD4A 2FH6A 4J35A 1XW8A 3O16A 2VENA 2YGYA 3TYAA 3GHTA 1JPDX 1Y5WA 4MZ8A 2INZA 1HGYA 2OSYA 3S2MA 3KVKA 2OEKA 2DH2A 2NQ5A 1DVJA 1MEWA 3R7MA 1ZAJA 2W3ZA 3LZ3A 3WX7A 3KTCA 1Q6GA 1QJWA 4CQAA 1E0VA 5E0KA 1RBOB 4FI4A 2HVMA 3BLIA 2IPWA 1S2AA 1NFGA 3DBPA 1KXHA 3I7RA 1D3HA 5LGXA 4LB4A 3DZ1A 4C6BA 1KR0A 2DZAA 5FJOA 4CVUA 3UF9A 4XWUA 4MPKA 2HPMA 3FAXA 4GC3A 3SSZA 3IGXA 3QZEA 1FVPA 2Z6JA 2BY2A 4PUEA 3USZA 1DJXA 4O1AA 3NZRA 1CXLA 3L21A 4XO6A 1TE1A 2BHYA 3NVTA 4DZHA 5BXRA 3HQNA 4JIIX 5E93A 4RNFA 1KCXA 3O7UA 3WL0A 1YDNA 1RA5A 3VD7A 1A5NC 3PANA 1YPFA 4A8RA 3QPEA 3UU0A 3IIZA 3TXZA 4W5ZA 5A8MA 3CL7A 1DXFA 2OWXA 3TIMA 5FL1A 2O56A 3O1NA 1W2VA 2ONEA 3LLFA 1ISZA 4NSBA 1I75A 2OQHA 2V81A 1W5OA 4MF4A 1FWDC 3L2MA 2JBMA 4I7UA 4WOQA 3LERA 4WKHA 4LUTA 2WB5A 2GSHA 2ZZ5A 4GZ7A 1ISWA 5A69A 4ENLA 2QDGA 2JEPA 4IUOA 2D20A 4D1JA 1S38A 1M68A 1LP6A 4NZ5A 2VEFA 3BLFA 2VTFA 1X1ZA 4O28A 1MSSA 3EX1A 2ICSA 4AVNA 1ITXA 1R3TA 2ACUA 1GQNA 3LSBA 5F1UA 2YSWA 1ZNNA 3ZIZA 3IGUA 5HWNA 3KLKA 1OD0A 1UD3A 3VKKA 4CN4A 4O0ZA 4XBSA 3UWZA 3BJFA 2PE4A 3RX3A 2VQUA 4D6EA 1UA7A 1NM9A 2NSXA 4N9EA 3T55A 4HQVA 1KBLA 4L6HA 5EU9A 1FQ0A 1K9DA 3N9SA 4JTHA 4YL2A 4DJDD 3GNOA 4XZ9A 4G6CA 4RXFA 1UWIA 3ZFHA 4HA3A 1EFZA 3HGSA 4K37A 1E1CB 4TX8A 1TA3A 4DELA 4F0KA 3H8AA 2Q6ZA 4AY7A 3NL5A 1OFDA 1FA2A 2QVHA 4JS3A 4AZBA 1UH4A 2BB0A 2D3LA 4F48A 4YCPA 2PDIA 1MO0A 1IGWA 3SY5A 4AHPA 1FWCC 6REQB 3AWOA 3NXLA 3C56A 1F8IA 5H91A 4CU6A 2WLZA 2R1KA 1LL6A 1NP2A 3ABSA 4Z0SA 1KM2A 3PZUA 1H41A 4HMCA 3T0BA 3E12A 3M46A 4F3HA 1P4CA 3U57A 3VM5A 4IPLA 3WH8A 2BVWA 3C8NA 3LDVA 2WVVB 5K9CA 1IXOA 4Q8QA 4P61A 2GGEA 1TMHA 1UIPA 3QV9A 3OGVA 4IXHA 4U10A 2XHYA 4QLKA 1TQJA 2IKJA 2VQTA 3VDBA 1FWAC 3CUHA 4BK9A 4PULA 1K77A 4PMZA 5A1AA 2CETA 2GK1A 2B4GA 3E2RA 3E02A 1PJ9A 1YNQA 1W8GA 2Y5EA 1XX1A 4QTGA 1OCQA 3Q58A 5TD4A 3BARA 4MJ2A 4DLFA 3LV5A 5AB3A 4TIMA 1GOXA 3OA5A 1LQAA 3SURA 3QR3A 2P3EA 2PCEA 3EOLA 3M5ZA 1QI3A 1SJCA 1WB0A 2CLFA 4U2ZA 4OECA 5BOFA 2ASHA 1M6JA 4JTCA 4EF9A 3CQIA 3PJTA 4FLQA 9CGTA 1PIGA 4FP1A 5I24A 3K8KA 5I77A 3QGKC 3BOXA 5G4WA 3VDAA 4NKCA 2DT1A 1F4AA 4JN7A 1VIZA 2OKOA 3HG4A 1SVDA 4Z2KA 2NZLA 3VIMA 1PYFA 3OZOA 5HJXA 4AD4A 1OG6A 3IACA 3MW7A 2PCQA 2O9PA 5FIPA 2WBKA 1AH3A 3IGSA 1IZJA 4O19A 4GY7A 1MVYA 4WJ8A 4XQ6A 4UOZA 3BOLA 2JQXA 3TAOA 1KBKA 4BI7A 2PLKA 2QCHA 4CUCA 1EPXA 2ATMA 3GSMA 1BHGA 3HV9A 3MDWA 3QF0A 1GOIA 1RJRA 4W86A 4CQBA 3B4YA 2I16A 4F9DA 5F4XA 1D3CA 5FOOA 5DANA 3RX4A 1GQKA 1NDYA 2BASA 4Q8TA 1C7TA 2A85A 3MZNA 1KGWA 1S46A 3AHVA 1P43A 4OV4A 3S1UA 3W72A 2YJQA 5BNKA 5I5RA 4Q6JA 4ZR8A 1ZJHA 4IP5A 5D05A 3BGGA 1KRMA 3UPWA 2WMHA 2E77A 3EEGA 4E4FA 1H11A 1KC7A 3R8GA 2IMRA 3DFSA 2V5LA 3FY1A 1DQXA 1MUMA 1HJWA 3SGZA 2FTWA 3L65A 5I78A 4LYKA 1UP3A 1FWNA 2VR4A 1B3XA 4N9CA 3H54A 2JKPA 1EC7A 2G37A 3HFYA 1LLZA 4JNYA 1JDFA 4PB5A 3G0UA 5F1VA 3TR2A 5EMMA 2R14A 2C8NA 3GW3A 3GR4A 1XKJA 4ZXLA 1XIEA 2PDCA 3TYDA 5HBFA 4GINA 1HGWA 1OYCA 3EDFA 2QQ6A 3G1SA 4DX3A 2YB1A 4UTLA 1VFMA 4EXBA 1QUMA 1VFLA 3RRAA 4E4UA 4GISA 1LQ2A 3WQFA 1C9DA 2Q8XA 2VRJA 1UD2A 3B8WA 4B3KA 2VX6A 3C8FA 4YWSA 5A6BD 2E67A 3V0UA 3IJDA 4CEUC 3QVQA 3W7QA 5XINA 4J3XA 3LLXA 4ZA0A 3AJ7A 3CB8A 2DJXA 3RK8A 4JKMA 1XDJA 3TZNA 1N2VA 4I7WA 5D9OA 9RUBA 5D2YA 2CXEA 3UG8A 5D4YA 4QAWA 2XISA 3UWYA 3OP2A 3QC3A 4GKTA 1QPKA 4AZHA 1E4LA 1VF8A 3EPNA 1A3HA 1NFBA 2FQIA 2V0TA 3K46A 3OLGA 4MDPA 4J1OA 7PTDA 1BRLA 5KINA 2AOSA 2I5IA 1MZHA 4RE4A 1Z89A 3MCMA 3RLHA 4F0LA 4AMAA 4EIVA 5KZEA 3MT1A 3ALGA 1QTWA 3NDOA 3AIUA 3F1QA 1TRIA 2OO6A 2WZTA 4OT7A 1EXBA 1ZCCA 3BLLA 5SWUA 4AD2A 3UPMA 1TPB1 1UMLA 5I6SA 3AIRA 1DJZA 3IUIA 1E56A 4IXXA 4H6EA 4GNVA 3HB9A 1A47A 1N82A 3OA3A 3A23A 4UQ9A 3SZ8A 4AIUA 3SB0A 3MHFA 3MVIA 1KKRA 2ISDA 3FX4A 3QZAA 3RPMA 2WC3A 4J5NA 1EZWA 4XD3A 2VZOA 3S1XA 2J24A 4JTQA 4J27A 3VNJA 4BZYA 2VKZG 4XZHA 2OYKA 4RE3A 3WMLA 3WQWA 3BSGA 1WA3A 4NX5A 5A8NA 1LOQA 4QSHA 1XC4A 2FHCA 3P0XA 3I7QA 4XSLA 2DZBA 1F3XA 4S39A 4JEQA 1R38A 3PP7A 2PI6A 1SZEA 3PJXA 3GXMA 4US5D 5IBXA 2R91A 2PC8A 3M0XA 4DWSD 1PEZA 2IQ0A 2ZX6A 1NQKA 2ISVA 1SUXA 3ARRA 1HIZA 1TTQA 4P7LA 1WDPA 4H04A 4B3LA 1SFJA 1BPLB 4WDTA 5FACA 2XWEA 4DHGA 4JKLA 2XYLA 1UP0A 3BK0A 1GONA 1ISXA 3ZJ7A 2OEMA 1AA1B 3BAKA 1QOXA 5CGQA 4O1DA 3LCGA 1BG9A 3HJZA 4BQ2A 3VNIA 4IL0A 1W1B1 2DZVA 3L5LA 5A8QA 2VC7A 2Z1SA 2J7HA 3FJ6A 2I7GA 1MEIA 3P61A 4ASTA 4PUNA 2DZSA 3WL1A 5EBUA 4IFOA 1A5AA 4RZ5A 3W86A 3JR2A 1F2JA 4X60A 1DIKA 1F6KA 5AYXA 1Q6OA 2QPUA 3WBAA 4X3ZA 1TV4A 3HGRA 3OBAA 4GIYA 1C9WA 4N2YA 4V28A 5LIKX 1Q8AA 3UEQA 3UZJA 1K70A 2V68A 2NV2A 1E1CA 4AISA 3E74A 4S2BA 6TIMA 2WSKA 3AXKA 1H09A 4C6LA 2BXYA 2NQZA 4OIFA 3AQUA 1EO5A 1DWHM 1FHUA 1X8FA 3GHSA 4HNTA 1PE1A 2P76A 3WK0A 3WK1A 6REQA 1EJSC 2WPBA 4A4AA 1E43A 3MBFA 5LA2A 4J3WA 4DYEA 1JCYA 4NY2A 3CV7A 2DDXA 3MSDA 2WXDM 4W8BA 4QCFA 2GGJA 3TTOA 4I7VA 1KFCA 1XBZA 1PX3A 3QFEA 1XGEA 2PLCA 3CV2A 3L4ZA 1SFTA 3LCFA 1LWJA 1UR1A 5G1YA 4DUWA 1FFRA 2VCAA 5IBXC 4FALA 2WVVA 4QFUA 2BG5A 4QBXA 3WDPP 2CNCA 3GDLA 3PTKA 3C0QA 3HPSA 1EUNA 4IJBA 4Z1AA 1YEYA 4RW5A 5JIPA 1QNSA 3WD0A 3W53A 4PRRA 2J8FA 8RUCA 4DO6A 4XUYA 2ZKMX 3QV6A 5C71A 1CGYA 3D5HA 4IIBA 3OO2A 3VABA 4LS1A 2QCMA 1G4SA 1TCDA 2ZWYA 1JAKA 1W17A 3ANYA 3VC5A 4ZXOA 1QR7A 2PDLA 5A8OA 2HISA 3VOGA 1TMLA 3TW6A 2CBVA 1M1BA 4D72A 4M3PA 2UY5A 3AHZA 4IQEA 1DBTA 1A4LA 2BY3A 3A47A 1N7KA 4KWUA 4JOMA 1GOWA 3W7HA 4YCOA 1XD0A 1VFTA 3S6OA 2DGAA 5MF5A 3WZ0E 4M8UA 3VYLA 1AW5A 1E6RA 4OUIA 5BRPA 1BD0A 3BMVA 3HMJG 1KM0A 5FSEC 1IF2A 2OOGA 1FWTA 3UFYA 3ONBA 4BS0A 3IK2A 4CNSA 4UXDA 3RO8A 4GVFA 1EP1A 4GX9A 3GC2A 4U3AA 4IT1A 1XR2A 1AQFA 3T78A 4GXMA 2FGBA 3AUOA 1W32A 2DZTA 2NUXA 3HGOA 3C0JA 3W70A 2BVDA 3MCOA 2PRHA 2Y7EA 3OB8A 1W1PA 1ISYA 3GNRA 1MDRA 5CLTA 1JQXA 2JGQA 2J6XA 1TZ7A 1L6SA 4M7SA 4PEKA 1X97A 1NF7A 2WWCA 3P67A 5GJPA 3PUEA 3TONA 2C1HA 3H2MA 1GG0A 2PP0A 5CPLA 1BF6A 3TXVA 4QDMA 2BNJA 5EKYA 3R8RA 5DY3A 3AYRA 3THAA 2B7QA 3ZT5A 1W1A1 3BLEA 3A4WA 2DSUA 5TBOA 4P2VA 2ABAA 4MB4A 1LUCB 3UJSA 1JZ8A 3I4KA 1UWSA 4JYDA 4M82A 4DWSB 3HGJA 1KV8A 4YIWA 3VD9A 3WNNA 4KIEA 3MYPA 1BLIA 5IFTA 2QCDB 4AD5A 4P5UA 3ALFA 5C9UA 2YLLA 3NM1A 5H8PA 3L12A 2J9YA 4D6FA 1QMLA 4I9AA 4NNCA 1D8WA 4H3DA 2WSQA 1A5UA 4PMDA 5AYYA 2F6KA 2D2GA 1JDCA 1V3MA 6TAAA 2W4XA 4C6EA 1B5TA 1HJQA 2YDRA 3T09A 1ZJBA 1US3A 2JF6A 1UD8A 3PZNA 1OCNA 3D6NA 1J5SA 1XP3A 5JUVA 4MWAB 4TMBA 1FHDA 5EA9A 1XC6A 3PY2A 4I5RA 1I9CB 3AHXA 4OOZA 4DJDA 4KF1A 2D22A 4GUIA 3PWAA 1DL3A 2ZDSA 2D2HA 4DI8A 3W2NA 4H41A 4LBSA 1VHNA 4XAGA 4RV8A 1QHPA 5LIUX 3CWNA 4GQBA 1ZAHA 1TV8A 3CZKA 3MMTA 2C15A 4GJJA 1R47A 3MI3A 4UIOA 3N3MA 1OX5A 1LYXA 3PZTA 2Y2WA 4AZGA 1OF8A 1WDQA 3FLUA 2OYMA 4NJJA 3PUOA 3ITVA 4O8AA 2VM8A 5I23A 1K9FA 3DENA 1ZQ5A 4ZB5A 3RXZA 1S1PA 4O15A 2YBUA 2HNEA 3M64A 4J3ZA 4EAYA 1PXGA 3A22A 4AWEA 3L0NA 4BWLA 4EXQA 4PCFA 4OBRA 3B0VC 1WBHA 2NUWA 4Q4OA 4CNOA 1KM5A 2WC4A 3EXTA 3HG5A 3KVJA 3WMBA 4B5UA 4EOUA 1BSLA 4B4HA 6XIAA 4DM2A 3P74A 4B90A 1XLIA 3IJLA 4M81A 3TROA 1GVRA 1GQIA 3RCYA 3TLQA 1UUOA 2GWGA 2ZX8A 1FKXA 1R7OA 1WYIA 5AECA 3CWOX 5HDRA 3ZVIA 1BGAA 2DT2A 2PMQA 4GUJA 4Z17A 1WAWA 3AU2A 4C6IA 2NQJA 2OX1A 1XXXA 5EYWA 2PGRA 1JIBA 2VDHA 4HMDA 3N04A 3DHUA 4PBGA 4W7UA 2OT0A 4LUIA 2WNQA 3T0CA 5CSYA 2OX4A 3AZRA 4EPDC 3SQLA 2XU2A 3FW6A 4X2RA 4GI8A 4EPKA 2H9AB 1SYTA 4LANA 4DI9A 2RDWA 5JBFA 4KWWA 3W4RA 1S3TC 1NEYA 5BRQA 5AC5A 1GEHA 3KS6A 3PN8A 1DWGM 3GBEA 3UJRA 3NSMA 3CZGA 4QR6A 1GZJA 1ZJIA 2J8TA 4KH2A 3UCCA 5I00A 4DXKA 1JQVA 5HOSA 2GVJA 1LRTA 4N9BA 1BKHA 2OZTA 2FGZA 2F2HA 3B8TA 3BCFA 2NX9A 4YHEA 5DELA 3RG6A 2A3LA 4INFA 2VDGA 3SRFA 3M0IA 3PB2A 4Y2WA 4WXYA 4NT0A 1S5TA 3W2UA 3S9IA 3U2EA 5FF3A 1UC5A 3HA1A 1J0HA 3EPOA 5LHFA 4KKXA 3TJXA 2ADAA 4UFMA 3MUCA 1G0CA 2ZZ4A 4HT3A 3KL5A 3T7VA 4DYKA 1K02A 1TSIA 1IR1A 2ZUTA 4FLRA 1E72M 2PDNA 1KFWA 5A2AA 1WAUA 2W67A 4MSSA 3MHUA 1E3XA 1XGDA 2A6NA 3U6WA 3N9KA 4QNWA 3GR7A 2CYGA 1XM3A 4TV6A 4OOUA 3W71A 2X1RA 3ARSA 1H7PA 3II1A 3GG0A 1EKOA 1FCQA 3MI6A 4XAZA 3TN6A 2ZOXA 3AOFA 1E73M 4NZCA 4UTHA 5M5DA 4C6KA 2VI0A 5LNWA 3Q94A 3W1AA 3VUPA 3CH0A 5DBUA 1UD4A 4LV4A 5GVJA 1HJVA 5IHRA 1C90A 3SCWA 4AZ5A 1J11A 2HVOA 4A35A 1K8CA 3SCQA 5HWMA 4GRSA 2ZFAA 1CGXA 4EAMA 2CKSA 3CT2A 3QQWA 3OEXA 5A6BA 2IPJA 1O95A 4G5DA 2DH3A 1UD5A 1U30A 1NJJA 5I3KA 3M07A 3WDHA 1LQ0A 3VOJA 1JAEA 4U2YA 2P0OA 2G96A 3AALA 5A94A 2KX9A 1RK5A 3N25A 3BG9A 1KW1A 2A21A 1LF1A 3GXPA 3PNZA 3T40A 4WGHA 3CHDA 4H2HA 1NTHA 1SW3A 2QUVA 2E5BA 1JUEA 4UTIA 4HA1A 3NL3A 1TVPA 2Z24A 2XM1A 4OVXA 5CXPA 3QW3A 1J0IA 2VRKA 3MWCA 3W26A 1XI3A 3W22A 3LZ5A 1DXEA 4B5VA 4UTTA 1UWTA 4M7TA 4ZODA 4HCHA 1DJNA 3QSRA 2J25A 1L0PA 4OZOA 5I06A 3WLOA 1VD6A 4JFWA 1C7SA 1SGJA 1FWWA 5EBAA 3CIVA 1OB0A 4JTRA 4UBPC 2PA6A 3JZUA 3TA9A 3DECA 1K8ZA 4MAVA 3TLLA 4P8WA 2RDTA 1OQFA 2PSNA 1E1FA 4H7CA 5CPQA 3UXDA 4HMNA 4B92A 3KBSA 1TFVA 2A4AA 2F9RA 4U31A 1R3QA 3LM7A 3P8JA 3M7SA 1IXNA 3CB3A 2X0YA 3S9ZA 1S5WA 1TV3A 4P7OA 4GI4A 1KWKA 3G0XA 4PUMA 4IMFA 5HULA 1P6CA 2YA2A 3RILA 2J8GA 5LA0A 3UZYA 3ES7A 3AXHA 1LUCA 4ATLA 1CNVA 2A3EA 1R30A 3XISA 4ADUA 4DWSA 1YYAA 2BGSA 4KIRA 4JGDA 4PBFA 2Y7DA 4HK6A 4ZQMA 2ESCA 1EIXA 3REQB 1JYNA 3DUGA 3B8IA 2QCDA 4BFAA 3WH6A 2E7FA 1OM0A 2YR1A 3VD3A 4KETA 3T07A 3H22A 3QMSA 1ONXA 3DESA 2CIPA 1OFBA 1ALDA 1V3KA 1XDMA 4DZAA 4R34A 3DG3A 3TYZA 1XH1A 3OVQA 3U5YA 2QJIA 1T5AA 3UZ5A 1NWUA 1G5AA 2E1DA 2ZRZA 1VJZA 3QY6A 5LGZA 1EX1A 1T0OA 2QUTA 1XJBA 2FTYA 4QXIA 1XDLA 3N14A 3N2CA 2VZVA 5G1MA 5KETA 1T8XA 2P53A 5D8WA 5F7UA 4Q8NA 3EOEA 4MWAA 2ZXAA 1XSKA 4OBSA 2I56A 5C0QA 1AMKA 3WJWA 1U1HA 1XPGA 3W1NA 3IS4A 5BU9A 3WLMA 2VGBA 3L2IA 4KGJA 1JGMA 4Q8PA 3TVAA 1XHGA 3WLLA 3B3DA 3MSRA 2FDMA 3D47A 5D02A 1PHWA 1FCVA 2XGZA 4IMEA 3LUTA 4NVTA 3WELA 1Q2RA 2XSAA 4FK9A 2PC4A 3WQ6A 3ABZA 2VT0A 1W3HA 2VCCA 2C16A 2ZZ3A 4W89A 1JNEA 1K7FA 1XG4A 3DAQA 1D3GA 2QCFA 2Z26A 3WQVA 5A5WA 4K8EA 3WF1A 2E3ZA 3G2GA 2WQDA 1E9YB 3W75A 3S46A 1JZ2A 1CENA 2EPOA 3F2DA 3FK4A 5D38A 4PMJA 2Y7FA 2HE8A 4WHBA 4DXVA 4XKMA 1SO5A 1Z42A 4DNMA 2O7QA 3K2GA 3V0TA 3GRIA 4YTQA 1MQPA 5FEZA 2YA1A 3V7PA 1M01A 4QROA 2HV5A 2YB4A 1KA9F 1GVYA 4V27A 3VE9A 4G1NA 1B3VA 1XH2A 2HK0A 5DBTA 1Z48A 5F2GA 1A5BA 1ZGDA 1E0TA 3RGTA 4FX6M 1JZ7A 1FWIC 5AC7A 3BLOA 4C6QA 4PUKA 3VA8A 2CZVA 2VZUA 1EYEA 4TQTA 3HG3A 3F5KA 1OC7A 1CLXA 1DTNA 3JUGA 3T8QA 3QQ1A 5FF0A 2H9AA 4DAFA 4J3VA 4ZB2A 1KFLA 4DBUA 1XSJA 3D46A 3L4VA 2WKGA 3U8GA 4LVGA 4OWGA 4FA3A 3SCPA 1C8YA 2CLMA 2FDSA 3FXYA 5DMYA 2QAFA 1X6LA 1AFSA 2IQDA 1H5VA 3MZ2A 4MMWA 1PCKA 2E68A 4N6EA 1P0KA 1S5NA 4X2PA 3TN4A 1F76A 4W7WA 3UR8A 2HPIA 3CASA 2XM2A 1P5BA 3B8DA 1GKPA 2D24A 1Y5XA 1WKYA 4AEEA 4MFEA 5A2BA 2B0MA 3RDKA 3I68A 1PIFA 1XIMA 4KCTA 3GXNA 3GU2A 1R46A 3JRKA 1Q7QA 1K4GA 3FA5A 2R94A 2XGIA 4ZEPA 1EBHA 1VFHA 4IP7A 1QNRA 1TWWA 1EGZA 3DFYA 1AH0A 1XLCA 1FRBA 3Q67A 3BH4A 5BMXA 2GJRA 2PPGA 3BC9A 2VZSA 5M2FX 2DUAA 3TYUA 1SPQA 2Y8KA 1ITUA 1A50A 2PUZA 3PB0A 2DVUA 4AD1A 2V30A 5AHNA 4L4PA 2FVKA 2E6AA 3OU8A 3W2KA 1VYSX 1M53A 2OFJA 5T8GA 1LBMA 1DKWA 3HFTA 1PZ3A 1W9BM 3VDHA 4FIQA 3AYTA 1J8VA 3OVGA 1FCUA 4GY1A 2GSEA 3CUGA 3PSWA 3AIQA 4Y9NA 3PUGA 2PDHA 2PD5A 3NGJA 4Z2JA 3B9OA 3LHUA 5A6AA 1KCLA 3B8UA 4UMAA 3NPVA 3AU6A 3QTGA 3N15A 1VGAA 4LX4A 1M7PA 4HNUA 2A7NA 4XAFA 4RL3A 4HD5A 1R87A 3DFTA 4Z08A 4CU7A 3NQAA 4M6QA 1W3TA 4NP7A 2YFNA 4Q4PA 1H7RA 3VOIA 1KRCC 4AUBA 4CNTA 1G7UA 2V3FA 3SECA 4HU8A 1X6UA 2CW6A 3W87A 1FY6A 1A5CA 1W1VA 3SRDA 1OFRA 1E4NA 3FXGA 5CJ5A 4JAWA 4FEZA 2J88A 4PMNA 1RCQA 3LA4A 4M1RA 5FEPA 1OGSA 3GU1A 4IJRA 4J2MA 2RUSA 1EBGA 2AMXA 1JFHA 2A0NA 4P8VA 1TKKA 2H8XA 1PZ1A 3UA3A 5CC5A 3FHQA 1QFEA 3EAUA 5HA7A 2QCGA 3PBVA 3W7DA 5TF0A 3TP4A 2WKJA 1ELSA 5KZDA 1ZBVA 3VKAA 3VI2A 4YS1A 5E70A 4AD3A 1H61A 3O07A 5I02A 1AH4A 3TE9A 1F6YA 2NSOA 2J27A 1S2WA 5CZSA 4LW7A 1SZNA 1J12A 1EPVA 2ZC8A 4FMVA 1GQLA 4IPIA 3ZWSA 4O8RA 2XH7A 1BWKA 1UZ1A 1JR1A 1P0NA 2PWVA 1A0EA 3RAOA 4CLMA 2QCNA 1HTIA 2BS9A 1GW1A 4XB3A 4K39A 2C3ZA 2KAUC 4HTYA 1US0A 5CBIA 2PBGA 3B9EA 4QEHA 3S83A 3QFWA 3AYSA 3VZZA 2QS8A 2YKKA 1D7KA 3NQ8A 4XZBA 3ZJ6A 3GDMA 1CXHA 5LSMA 2ZXDA 4M6VA 3RMJA 3AROA 2EPHA 3MMUA 1P0EA 1NF0A 3IVUA 1TMQA 3ME3A 2C0AA 3UERA 1RJQA 2PTYA 4YTTA 1XIJA 1NWSA 2DV0A 4CCEA 3CEPA 4JTSA 1S5VA 2VNCA 1GVQA 4C1LA 3LV6A 3VGHA 1Q66A 4JR5A 2QVNA 3D3FA 5AN7A 3PTQA 4DRSA 3MVTA 4I9JA 1EHNA 1V8EA 4JBRA 3LD5A 2ZWZA 3GG1A 1JUKA 2TAAA 3DFPA 3S2JA 3V1PA 1EOMA 3PPGA 3HQOA 3WBXA 4O16A 1AD1A 4S3FA 4GIEA 4FSAA 4S2CA 4FNTA 1ZB5A 3VNDA 1HG3A 5FJRA 2GVLA 3REQA 2RDXA 4YMZA 4JQ1A 3W7KA 3EX2A 3H4XA 2J7BA 3H4GA 1V0MA 1U1UA 1HKVA 2QPSA 3WEZA 1W9PA 2O92A 2QPXA 1NAL1 4N42A 1XRTA 4IFRA 1BAGA 3TAKA 2Z25A 3LS9A 1A53A 3TX9A 1QXLA 4NAEB 1OEPA 1MXDA 3RJYA 1QPOA 2ACRA 2I57A 3OBKA 4JFVA 5FSDC 2Z4GA 5CJNA 3IARA 3H2CA 4JTUA 2WWDA 3K1DA 1VFOA 5D33A 2NXHA 3R11A 3LHYA 3TK7A 2OR2A 3EX4A 3MO7A 3SY8A 4O14A 4ZQNA 1M7XA 4DUVA 4JTEA 3AS2A 5M03A 3TN3A 3PBWA 3W83A 1UKQA 1DE5A 3IIOA 3S9YA 1ZU8A 1WDDA 5MKGB 3K13A 3APYA 4LB3A 4N4PA 1W3JA 1QVBA 1SU5A 3V0SA 5DCBA 3DX5A 3TC3A 2WNNA 1UC4A 4L1XA 4WDUA 3EXRA 3NVDA 2NV9A 2DIJA 4YTRA 4Q4QA 3FGCA 4PMVA 1IZCA 5JH1A 3IJQA 1DIDA 1GVSA 1EJTC 4XVDA 4TMCA 5I3FA 3URAA 4NX0A 2W27A 1B57A 4PTDA 3UNDA 1PWMA 2DZWA 3T6CA 4CQ8A 1JD7A 2AKMA 4XZLX 2FZDA 2OGJA 2ZZ6A 1TWZA 2CHRA 4CCDA 3LG3A 4C6CA 4F9JA 2FJUB 1IYXA 1OT1A 3LM3A 3ITYA 1ML1A 3GVVA 4HPXA 4JTIA 1XGZA 4JTKA 4V15A 2Q71A 1TPFA 4JICA 1M5WA 1DP0A 3UT0A 2Y24A 1KD0A 1WXYA 3H55A 4QJ4B 1XQLA 3NTYA 2WV8A 1YNYA 1K8XA 2W63A 3INPA 4C6DA 1I2NA 2CLIA 3VMPA 2X1IA 4LVFA 4GCXA 1JGIA 1ENUA 3QY7A 3LMZA 1ICSA 1MUWA 5CCZA 4O4WA 2ZZ7A 2HJPA 5IRPA 1W9DM 2WJZA 5HMFA 2PWFA 1WNOA 3JU2A 3GXIA 4U3CA 3S3GA 1LOLA 3G6LA 5HUOA 4IX2A 2WSRA 2BDQA 2VVSA 1FX6A 5BXPA 2YW3A 3BO9A 3PNUA 4U4MA 6ALDA 5J5DA