2J6XA

The crystal structure of lactate oxidase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
370
Chain Sequence
DIEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LACTATE OXIDASE
publication title The 2.1 A Structure of Aerococcus Viridans L-Lactate Oxidase (Lox).
pubmed doi rcsb
total genus 133
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.2: Transferred entry: 1.13.12.4.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j6xA00
2EF9A 3W7IA 2ZA2A 5KSWA 4DBEA 1UUOA 3LI1A 2VEKA 3MI6A 1ICQA 2VFHA 1SO5A 1TTIA 4C1LA 4TX9A 1SR9A 3S6DA 4GUGA 4LUJA 1XXXA 3O16A 3GNNA 4PCFA 2XFWA 3PUDA 4UUIA 2GUUA 3C56A 3W72A 3QRHA 3ATZA 4K6AA 2HTMA 3DENA 1OFBA 3M5XA 1KM4A 4CQAA 3G1VA 2YYUA 4UC5A 5AC7A 1KM1A 4XZ9A 5I3FA 2ZA1A 5G1TA 3C4UA 4K8HA 3TJXA 1W3TA 2ZZ6A 5I3KA 1I2QA 2QUTA 3L0GA 3T40A 4O52A 1ZALA 4XTIA 2ZZ7A 3WK3A 3N9RA 1TPC1 2CZ5A 3W84A 3MP3A 2VFIA 4KWWA 2E5DA 1PS9A 4JTHA 2VFDA 3LLFA 4XUGA 4PEKA 1QPNA 3TQKA 4YLWA 4JD4A 4IMEA 2X2GA 5AYXA 1TJPA 3WK1A 3TW7A 1AG1O 4TMBA 2BXVA 2H3BA 1KFLA 4JDBA 5D02A 3JR2A 4LRSA 4UTWA 1LP6A 1GPWA 5CPOA 2WSRA 3FJLA 3TIMA 1SZFA 3Q2DA 3HPSA 4IOTA 3P61A 1MSSA 3W2KA 1B3OA 5K2ZA 3CWOX 3ZS4A 2XN0A 1F6KA 3USBA 5KITA 1SPQA 4UMAA 1KV8A 3EX4A 1BEUA 3FKKA 2QUUA 2W0UA 5LGZA 1IF2A 3IVSA 1F6PA 1IIHA 3L2IA 1H51A 4RR4A 5HQEA 1GTEA 4Y90A 4O57A 4EOUA 4TO8A 2DJXA 2C19A 3P82A 1TTJA 3HJZA 3W1PA 2YDAA 3DBPA 3LTSA 2QCMA 2ZDRA 1H1ZA 4UFMA 5FF2A 4JX5A 3W7DA 3N34A 4EWND 1ZHAA 4ONVA 1TPB1 3U2OA 3DI0A 5LZLA 4XTDA 3INPA 1D3HA 2C18A 4ADTA 2ATMA 5HR6A 2TMDA 1CI1A 3HBLA 3UZJA 4UTLA 3TMLA 4HT3A 5TBOA 4L4LA 3CIWA 2ABAA 2RDWA 3RLVA 3G1AA 4JYDA 4MUZA 1R46A 1TRIA 5F4XA 3BG9A 2DZUA 2NUXA 4GUFA 4O4VA 2B4GA 4UNLA 2QAFA 3TSBA 4MY8A 3AO0A 5SWUA 4NZFA 2PRMA 3N73A 2F84A 5TQLA 5D2XA 3HMJG 1T0OA 2YYTA 3EX3A 5LKYA 5LNUA 4WJEA 1W5OA 1EB3A 4O12A 2TYSA 5HWJA 5K9DA 1W8SA 3L0NA 1EWEA 2Y62A 1X8FA 4QISA 1S3HA 1OX4B 1W31A 2QJGA 1OVDA 5EPDA 3E12A 3ZFHA 1W1ZA 4JGDA 1SU5A 1L2UA 2VKZG 4GWEA 3T4CA 3PB0A 4M6QA 3W3OA 1P1XA 3LGEA 3EXSA 4G1KA 3UXAA 5G5IA 2RKXA 3STFA 3A5FA 2J88A 4IMDA 2RDTA 2X30A 3OVPA 1OX4A 3HPXA 3CQ0A 3L5MA 3W75A 4FNSA 3MYOA 1SO4A 1XKYA 2E68A 1WOBA 2YR1A 3MYPA 3TKFA 1DQXA 3KOFA 3WJYA 3L5AA 1QO5A 3MO7A 1SQ7A 2V8ZA 4JDYA 3L0KA 4N2YA 2A21A 1FDJA 3W2MA 1IXNA 1YDVA 3NQ6A 1PL9A 3G8RA 5LSMA 3MMTA 2LLEA 1THFD 2H90A 4BI5A 4OBTA 4Z08A 3W2UA 3DFQA 3B04A 3BLFA 1VQTA 3GVGA 1YDNA 4QAIA 1QPOA 1VH7A 1XCFA 2PURA 1N8FA 1G4SA 3Q94A 4R53A 2E77A 1GG0A 2B7NA 1LLWA 3LB0A 2P0OA 4ORMA 1C29A 4ADUA 4NT0A 1H61A 1LZOA 2V5BA 4YL2A 1JRBA 4WD0A 3TJLA 3PAJA 3CB8A 3PS7A 1A5AA 4HPJA 4S2BA 1G4PA 1QPQA 4WQ6A 2Z6IA 2J6XA 2RDUA 5KMYA 3GR8A 4JTSA 2A5HA 4O28A 4MZ8A 3W1NA 5GVJA 2VELA 3BLIA 4X22A 1W3NA 3QMSA 2WSQA 5F4WA 3UWUA 3W22A 3EWWA 2QDHA 4OE7A 3P5ZA 5H91A 1TV7A 3HG2A 4OV4A 1UUMA 4BI6A 1G4TA 3TXZA 4NUWA 3E9AA 3W70A 4JR5A 1RR2A 1XUUA 1XDLA 1VHCA 2V5LA 1DJNA 4GJ1A 1KM2A 5LNSA 5DBUA 1MEWA 2GJLA 4FNUA 2C6QA 4NJKA 3DI1A 3O06A 3STGA 4N9BA 3W2LA 3PC0A 3IGXA 4QITA 3YPIA 3IGSA 3TCEA 4MJZA 2Q3OA 2HMCA 4O54A 3QM3A 3NQDA 4FNPA 1JRCA 4MLJA 1NAL1 1K8YA 1QCWA 2QCDA 1GTHA 2GJNA 3KHJA 4S1FA 2B7OA 3ABQA 4KFNA 4O15A 3EWXA 2WV8A 1G4EA 3WK0A 1MEIA 3N2MA 1OF8A 4MJMA 1VGAA 2CU0A 1F76A 3IVUA 3C2OA 3M43A 2C3ZA 3NPWA 3TC7A 1SZEA 1GJPA 5FESA 4HIBA 1DORA 1QAPA 4BWLA 1FDZA 1FUYA 3G22A 1IXQA 3ZWTA 5DCBA 4BFAA 2OZ0A 3EWZA 5DXYA 3G8EA 2JK2A 1JCMP 2JBMA 5LNRA 3DFOA 1GVQA 3EEGA 3NL6A 4N6FA 5LHFA 2TPSA 3LCWA 3UWQA 1QPRA 1U5JA 2PRLA 4FNRA 2E6YA 1TV8A 3QW3A 3Q58A 4JYFA 4K37A 3NYZA 3BPWA 1LOSA 1O95A 1I8JA 1IGSA 4CCCA 4PFMA 1YXDA 3IIXA 2C14A 1UCWA 5ABTA 5AC6A 4CCDA 4QJ1A 2CZEA 5AHIA 2ZZ4A 4RK8A 5CSSA 2C13A 2R94A 1NVMA 2ZTKA 2Y89A 1EIXA 4UMCA 1HL2A 3TFCA 2ZQ0A 2C0AA 1Q6QA 2C15A 1ME8A 2JKPA 4PA8A 4CCEA 5CPNA 4B5NA 5F1VA 3S1UA 1D3GA 1RQBA 4FXRA 4JX6A 1J2WA 1U83A 5AC8A 1KLYA 4LS1A 2OX1A 3PBWA 4ZQRA 4M7SA 5BMXA 2WJZA 4RXFA 4JTGA 3WJSA 2C16A 3HG3A 3ABSA 3P7YA 3QQ1A 1DQWA 2GQ9A 2X1UA 4UTUA 3HF3A 5EYWA 3SGZA 2OCZA 2OJPA 1HUVA 1L6WA 2A7RA 3LXAA 1Z44A 2R91A 5EMUA 3LCLA 4DO6A 1TJRA 4Z0SA 1K7EA 4AWUA 3A22A 5F2IA 4XKYB 1UBSA 4WX2A 3NL3A 4CNNA 3LV5A 4CNPA 1Q6OA 3ABRA 3P81A 2ZRYA 3SGUA 3LDVA 4LUIA 3W7LA 1JCYA 3G0UA 3PULA 4ZVJA 1QFEA 3GAKA 4M5PA 3NQMA 4RX0A 5HUOA 1YDOA 3W2JA 4MKNA 4A21A 1QMLA 1W54A 4LTSA 1ME9A 1I4NA 1QWGA 4FNTA 1YPFA 4YMZA 3R2GA 2BZNA 4N9DA 4I7VA 3CEUA 3DKJA 3MBFA 1F5ZA 3PG8A 1DV7A 3P62A 3QPYA 3LM7A 1PV8A 1KW1A 1LRTA 4JEQA 3LXCA 2ZZ2A 2VENA 4N4PA 3A23A 1EX5A 4RKAA 5FEZA 5DCEA 2A1YA 3QC3A 5C2XA 3QMRA 5AOUA 1F2JA 1BWLA 3M1ZA 2DZWA 4IQLA 1JJKA 2JGQA 4NX0A 1M7OA 5HULA 3NO5A 3R5EA 3UD6A 4YCPA 1EP2A 1VLWA 1EUNA 1LORA 3PBUA 3OBKA 3NQ7A 2W79A 4Y6GA 4LS0A 3T44A 1CW2A 3R13A 5AFDA 1T99A 2CLFA 1W0MA 1P0NA 2NZLA 2CLEA 3MUXA 3QSRA 1H7NA 1YXYA 3L68A 1RV8A 5HWMA 3DU0A 4FHAA 4DF0A 1K3UA 1HG3A 2NV1A 3ZR4A 4UNKA 3C61A 4QNEA 1Z41A 4HN4A 5F2MA 3E02A 1C9DA 4UR7A 4X2RA 2TRSA 1S5WA 3Q37A 4AB4A 3JRKA 1EP3A 2A2IA 2Q3RA 4JY9A 4WY0F 4RJEA 2BWGA 2Y63A 3TFXA 4GFSA 4HNNA 3UXDA 3VFLA 1F74A 2DZPA 4UFIA 2FFCA 3I68A 1GYLA 2G5WA 4KKXA 3HIJA 1QR7A 1ME7A 2OT0A 5I3HA 1VZWA 1VYPX 4O0ZA 3U6WA 3BO9A 5D32A 2Y6ZA 4O53A 2G95A 1DVJA 3TW6A 4HSOA 4PL1A 4Q4KA 1H62A 1OFAA 1WYIA 3IIVA 4AWSA 5FF4A 1VCVA 1RQEA 3B03A 5F2LA 5AYZA 3O6DA 1R2TA 2QAPA 4M6PA 1AW2A 1W56A 1TB3A 3NQFA 4JTKA 4H3DA 4X9SA 1QOQA 3O15A 4WOZA 1OJXA 3QH2A 7TIMA 4ALDA 1T8XA 4M6VA 1ZAHA 3U8GA 1OFDA 4Z1CA 2QJHA 4DBDA 3QYQA 3IIZA 4NXSA 1XDMA 2Z1BA 1I45A 1KTBA 3BVJA 4IMFA 1N7KA 4FB7A 5H2ZA 3BGJA 3NQCA 3N9SA 1YTDA 3VCRA 1O4UA 2V82A 4N9CA 4JICA 2GQ8A 3S5NA 3S5ZA 3TV8A 1BKSA 4NJHA 2X1TA 2YZRA 3TX9A 3QF0A 3M5ZA 4TMCA 1JCNA 5CZJA 3GDRA 4PC8A 1F05A 1A50A 4L4MA 1F73A 2Y70A 4K38A 3HGOA 3NPVA 2VEPA 3G24A 1TRDA 5D2YA 1KFBA 2RHGA 3BG3A 4ZL1A 2I9EA 2ZRUA 4HSNA 3UPBA 1VYRA 4Y96A 3RMJA 3NA8A 5U7SA 3S1VA 3BGGA 4JTTA 4K36A 1RPXA 2AQWA 4UTMA 3HQ1A 1SFJA 2G97A 2PCQA 2J9XA 3W7CA 2R14A 1L9WA 4BR1A 2DP3A 4FF7A 2YW4A 3NEVA 3LRMA 3W7RA 5A5WA 4UFJA 2QJIA 1FX6A 3W7HA 4U4MA 2ZZ3A 4E38A 2WPBA 1WDWA 4DO5A 2PRHA 3VKJA 5IBXC 3OIXA 5G2WA 5HR7A 4BI7A 4DXVA 3W7OA 2Y61A 2VEMA 2P10A 4IXHA 4WXYA 3TAOA 2ZZ5A 1A5SA 1NFBA 4O8RA 4ZQOA 1K8ZA 5BNKA 4LS2A 1X6UA 3TMQA 1KFKA 4IWWA 1WQ5A 2VC6A 3L67A 4Q33A 1LM1A 3TQVA 4FIRA 5TIMA 3W7GA 5DLCA 4ZZ9A 2EPHA 5DCDA 3LHYA 2FQIA 3EX2A 3W07A 1NF0A 1TQJA 4MFEA 3CWNA 3W1UA 3W7JA 1R2SA 3L21A 3I65A 4M7TA 4K7VA 3S9YA 5KZDA 3M5YA 5G2HA 4DEFA 1JCJA 4H6KA 2H3DA 2A85A 5HNRA 3C0JA 3IVTA 3LCGA 5EA9A 1PCKA 4A3UA 4LOCA 4QNWA 1KLZA 1RD5A 4R33A 3G1FA 5D05A 3LCFA 1DKWA 3KX6A 3SJ3A 4ZQNA 4OHQA 2ATSA 3DHFA 4BF9A 1TPUA 1H63A 4WXZA 2E6DA 3O1NA 3EWBX 1UB3A 2CLKA 4NU7A 5I3GA 1FBAA 1OK4A 2Q8ZA 3BLEA 4NX5A 3GXPA 4POCA 3HGJA 1Z48A 1ONRA 2FJKA 2NXIA 1JULA 3NAVA 4IX0A 3LX9A 3CEPA 4LVDA 2ZTJA 4ADSA 4KFOA 1SO6A 4K7YA 4ZMGA 1LLZA 5K7JA 5DY3A 5CZ0A 1HO4A 1Q6RA 4XBKA 3V75A 3W86A 3C2EA 4RXGA 3QQ0A 2WO5A 2CZFA 5D38A 1JQVA 2X1SA 1QO2A 1KTCA 2FPYA 5MHBA 1I2PA 1PCWA 5G1YA 5G2IA 1WAUA 4A2RA 1OF6A 3HO8A 4ICNA 4D2JA 2CLHA 1FCQA 3C2RA 1OYBA 4E2DA 1OHLA 4UCGA 4R34A 2NXGA 4FX6M 1LOLA 3BARA 3EWYA 3SY5A 1LRQA 3AJXA 3KVJA 4IX2A 2XN2A 4MZYA 5CPLA 5K4ZA 1ZCOA 1SW7A 2FB3A 3LHVA 1W5QA 2G96A 3IIPA 2Q8LA 5FEPA 3THQA 3MI2A 1SO3A 4UTKA 3HG4A 3EX1A 3TXVA 1K02A 2HS6A 3A24A 2DZTA 1YTKA 3FS2A 3OG3A 1EWDA 3DH7A 2QCDB 2IQTA 2RFGA 1AK5A 6ALDA 3G18A 1M6JA 3QFEA 4WZHA 1O60A 2X16A 4FX8A 2E09A 3GZ3A 4UTHA 4CNOA 3NZ1A 3NOEA 1ZNNA 3LCIA 2Y7DA 3W76A 2HS8A 3P8IA 4UFHA 5BRBA 2E1DA 3M41A 1J4EA 1TREA 2DZSA 1TPWA 2NX3A 3L65A 3GDKA 5D03A 1Z42A 2YPIA 4XQ6A 3TDFA 3G0SA 4OGZA 1MEHA 4ORIA 5K9XA 5K4XA 3A21A 5U4NA 1K03A 3KFTA 3I7SA 4HHPA 4HNUA 1XUZA 2WSYA 1EA0A 2H8ZA 3C2VA 4O1BA 1V5XA 3NDOA 3JS3A 3L5LA 1KFEA 1TPH1 3RFAA 3NQAA 4NJIA 5D2TA 5KINA 3QZEA 3OA3A 5A8GA 3HB9A 1Q45A 3ATYA 2QCNA 3PR2A 5J5DA 3S0CA 3FLUA 2O7QA 2TSYA 3GYEA 1E51A 4OQVA 2V30A 3W1QA 4EF9A 4HPXA 2YGYA 4UR8A 1OFQA 3IIOA 3OVRA 4O14A 3GLCA 2ZA3A 4BK9A 1PHWA 4LV9A 4MY1A 4PODA 2Y7GA 4H4IA 5CZSA 1MO0A 4CQ9A 5D2VA 3NM1A 1A5CA 1KFCA 1WBHA 2VEIA 2CLLA 3LHTA 3F4WA 4GXMA 3MJYA 2ZCGA 5AHMA 4YWIA 4LU0A 5G4EA 1JCLA 1FWTA 3N14A 5CSRA 4O11A 3B06A 3WJWA 1AL7A 1VC4A 3EKZA 1O94A 4U28A 5F4SA 3P8JA 4KFPA 1UASA 3P74A 5AHEA 1DBTA 4R7JA 3DFTA 1PIIA 1KM5A 4O17A 1FCUA 2ISVA 1JVNA 5C5YA 3B0UX 5KZMA 5AHNA 2ZFAA 3MP4A 3O07A 2QCFA 3UY7A 2QCEA 1H7XA 4K8EA 1XL9A 4TIMA 5AN7A 1G7VA 1X1OA 3PY2A 1GT8A 1VRDA 5D37A 3TNOA 3SZ8A 3TA6A 1KA9F 3R8RA 2VFFA 3DKLA 3S8HA 1VS1A 3A9IA 1B4EA 4HKPA 2FDSA 2JKAA 5FF7A 4LWWA 4IMGA 4JXCA 1PE1A 2B7PA 3T55A 2WNNA 1KBJA 1H7PA 2DU2A 2QUVA 5CG7A 5C6MA 2V2DA 4I7UA 3SI9A 1R2RA 3UY8A 4E0CA 1FXQA 3QSTA 5G4WA 3UQNA 4S2CA 2BLEA 3CU2A 3SSJA 4WUIA 2NV2A 3S5OA 1LRNA 2NWSA 4N4QA 5LNVA 3KRZA 1EUAA 4IPIA 1XI3A 3NG3A 4DELA 1JQXA 1DL3A 4AMAA 3QW4B 3KRUA 3E96A 4XBSA 2QDGA 3FFSA 4ZQPA 3N19B 1O5KA 4JS3A 3LRLA 5IM51 1UJPA 1LOQA 1B57A 1LCOA 3GXTA 3EXTA 5CKSA 4AAJA 3W7KA 1FXPA 3CTLA 1K7XA 1FWRA 1XBZA 1J5TA 4JTIA 4UTWC 4MYXA 2C1HA 3O6YX 1G67A 2QEZA 3ABOA 4O19A 1OFPA 2YCEA 4GBUA 4MFDA 1FWSA 3OEXA 3W1LA 3GDMA 4DF1A 1LBLA 1N55A 3W7MA 4MYAA 4Z1AA 1TPFA 5HWNA 3M16A 5DY2A 1HO1A 1P5BA 1OX6A 1Q6LA 1GG1A 4LVGA 4NXKA 5CGQA 5CPMA 5C55A 3LXBA 1R47A 1S5TA 4RZ6A 4A29A 1DHPA 3H53A 1YXCA 3TK7A 3C6CA 1VPXA 3WJXA 3LLDA 1FCVA 1YLVA 1YYAA 2J27A 2NXHA 4KWVA 3VI2A 3G1XA 4CLMA 1OK6A 3NPUA 5HUPA 3GKFA 2O7SA 2ABBA 2KZHA 4AHQA 5I3IA 1SZGA 2ZBTA 2YW3A 1P4CA 3SFKA 1WOAA 3MI3A 3DAQA 4JNMA 4O1DA 4JIPA 4PTNA 3ELFA 4JTLA 1H1YA 4AEOA 1OYCA 2ALDA 2I1OA 3PUOA 5F2GA 2EHHA 1M5WA 3CPRA 3NQEA 3W7QA 4DPPA 1KTNA 4TU1A 1FDYA 3V1PA 1GWJA 3FKRA 1H50A 2QCCA 5K3VA 1VYSX 3M9YA 2Y7EA 4IPJA 3RLUA 4A2SA 2ZRWA 1RQHA 3DGRA 2ZRZA 1TPVA 3PB2A 1B9BA 2EGZA 2B0MA 3B8DA 3O63A 4MZ1A 4UFKA 1G69A 1XBXA 2DORA 3SECA 1ZFJA 2AAMA 1TQXA 1QOPA 1SFLA 3DFPA 4LC6A 2NX1A 3G3MA 1DJQA 3EXRA 3R12A 2ISSA 1GVFA 1VLIA 3LRKA 3PG9A 3N2XA 3UWVA 3IV3A 4PL2A 1TO3A 4FO4A 4JTEA 4Z1BA 1GVSA 3M5VA 3CC1A 1FWNA 1JUKA 3B0VC 4YXGA 4I9AA 3W85A 1H5YA 1K8XA 3NNTA 4IGHA 2NUYA 4O50A 4NNBA 3HPZA 2CLIA 2Z6JA 2E6FA 4P61A 1Q3NA 1CX9A 2JGYA 5I3JA 4O1CA 1RVGA 1XBVA 1B4KA 4RV8A 4FIQA 3GKAA 3UWZA 1OG0A 1MXSA 2R8WA 2FIQA 3E0IA 2J9ZA 5T26A 2X1RA 2QR6A 1AMKA 4LY8A 3W1MA 4P2VA 4NQ1A 5EKYA 2BTMA 4Z0JA 4AXKA 4JTFA 3TU9A 5D09A 2H6RA 4UXDA 3PBYA 1HFBA 3W73A 2DZVA 1H7RA 3KVKA 1VCFA 5FI8A 1JUBA 2NWRA 3PVFA 3W83A 2VFEA 3TR2A 3SW6A 1YTEA 3VE7A 3GNDA 4MY9A 1MZHA 1H7OA 2YX0A 5L9FA 5DN1A 1A53A 3TAKA 1KM0A 2BSLA 3UZ5A 3UWYA 1JCXA 3EB2A 4GUIA 1Y0EA 1ZAJA 3FIGA 1L6SA 3W23A 1EEPA 5FF3A 3HOJA 3NQ2A 1PVNA 4GNJA 2GOUA 2WNQA 3M7WA 3G1YA 4NNAA 3TE9A 5K9CA 1TPEA 2NX9A 3LCHA 2DJLA 3BV4A 4A22A 1SW3A 3C8FA 5AHFA 3TC6A 4MLRA 4OT7A 1F7BA 3E49A 2GVJA 1W5NA 3LBCA 4QM1A 3PBVA 2QF7A 3VE9A 3F03K 4Y9AA 3BW2A 3NQ8A 4O1AA 3ZWSA 4LVBA 5DXXA 3MHFA 5F1UA 1TSIA 2E6AA 2J24A 1DOSA 5CZTA 1NSJA 2FB2A 4UIOA 1FWWA 3W7PA 1GYNA 3UWWA 3KXQA 3IEBA 2QCLA 2Z2UA 2E5CA 3LBMA 1G6CA 1W5MA 1OABA 5EY5A 4NNCA 4OWGA 5HJLA 5BMWA 3KRSA 2F7FA 4O16A 3CM4A 5HINA 4JTJA 3G1HA 2JKEA 3O05A 4IMCA 4GC4A 5D33A 4N6EA 3G0XA 2VFGA 3M44A 4IJBA 4IXXA 3LHZA 3C3NA 1ICPA 1WV2A 3KAOA 1TCDA 3LTYA 4QIUA 4K39A 3FJ6A 3S1XA 3HG5A 3H54A 4HNVA 1GVRA 4MPQA 3WFAA 4I7WA 2WNZA 1PHQA 3KVMA 3W1RA 2CFFA 4AH7A 5AB3A 2VOMA 3PF3A 3S1WA 2XN1A 4XWUA 5EBUA 4EIVA 3PSWA 3P60A 4CQ8A 2FPVA 1RZMA 4BWLC 3GR7A 3MHGA 4JIQA 2YXGA 1ZJIA 3P5YA 3L9CA 3NQVA 3MBDA 1SW0A 3PUEA 3GIYA 1YPIA 3BW3A 3NR0A 3GX9A 4LC8A 3GAYA 5J5RA 2RH9A 3W87A 3LCXA 3LOTA 6TIMA 4Z1DA 1OFEA 1IXOA 3NQGA 4DPQA 3N3MA 1KV5A 4E2BA 3GDTA 4EF8A 3CLMA 1ML1A 3QPZA 2WKJA 2E5BA 3W74A 4RZ4A 4W9TA 3DXIA 1O5XA 1GZGA 3DFSA 4LVFA 3M47A 3EKLA 4LRTA 2ZRVA 5D30A 1FCBA 1S5VA 1LTDA 3L66A 1X1ZA 1W5PA 5IBXA 2VXNA 2AGKA 2FLIA 1HTIA 2A6LA 1KM6A 4TR9A 1VJIA 2ZYFA 5FEXA 2HSAA 4AWTA 4QSHA 5DELA 3S42A 3DFNA 3NL5A 1AL8A 2BX7A 3TUUA 3EWUA 1ICSA 4WOQA 4C1KA 1FQ0A 3W7EA 3BW4A 4NJJA 4UTJA 5D2WA 2WQPA 3LHUA 3QEZA 3W1AA 1XC4A 3W7NA 4LVAA 3I6RA 3B4UA 3NZRA 1VR6A 3S5YA 3QMTA 2A7NA 1G7UA 1NEYA 3LV6A 3T78A 1M7PA 2GPTA 2GVLA 4FNQA 3HGSA 4FEZA 3QJAA 4FX7A 4YCOA 3W1TA 1H7WA 4UFLA 5LNWA 1LYXA 2Y85A 2FPTA 1SSGA 1LBMA 3G1DA 4DO4A 3UPWA 3BK0A 3B05A 5FF0A 3CHVA 3OHIA 3O8AA 3MWAA 2YFOA 3W71A 2V81A 1IIGA 4O18A 3WJZA 4AVFA 1KBIA 1XM3A 1X7FA 4O13A 4M19A 5KTLA 3MP5A 4MIMA 1W37A 1SUXA 4JX4A 4N02A 1LBFA 2Y88A 3TSMA 3T7VA 5LHEA 2ZRXA 3G1SA 4O10A 4ML9A 4JN6A 3IRDA 3RNDA 1ADOA 2QCGA 8TIMA 4JY8A 4DF2A 4FXSA 1VCGA 5E1QA 4Y8FA 3LI0A 4WY0B 1OFRA 4DQWA 1SSDA 2PE4A 1I2RA 5AHLA 2PC4A 3RK8A 1WBJA 3HGRA 1QNVA 3GXNA 3NGJA 2EKCA 4J9JA 2OMAA 2Y7FA 2UV8G 3CT7A 2DZXA 2W6RA 3R89A 4AF0B 5HMSA 2CLOA 3MHUA 1TPDA 1TYGA 2Z0IA 5D04C 5DBTA 4OV9A 4OU1A 4WY0A 4NVTA 3W1XA 3DZ1A 2QCHA 3FA5A 4NZJA 3P84A 3THAA 3O6CA 4EVZA 3GK0A 4Q32A 3M6YA 3STEA 2A6NA 5L6UA 3CIXA 2H8XA 2I14A 4AF0A 3NL2A 2FTPA 1LROA 2EAWA 4ZQCA 1R30A 3FYPA 4UTTC 1OYAA 2NLIA 3M0ZA 3TSDA 5KZEA 1XBYA 4PH6A 3GDLA 1JR1A 3TROA 1I2OA 1ZY9A 3MW7A 1EP1A 2A4AA 5BOOA 5AYYA 1TIMA 2CWNA 3UYCA 1GVOA 2P1FA 2YSWA 4NJGA 4LT9A 1L6YA 2ISWA 4O0KA 4MOZA 2A7PA 3P80A 3RU6A 2D73A 3GB6A 3W88A 4GUHA 2B7QA 1OFOA 1H60A 3WK2A 1QDSA 3LHWA 1AW5A 1K7FA 2WOQA 1TTPA 4N9EA 3FEMA 1V7YA 4GE8A 1LDCA 1SZNA 3PSVA 4AHPA 1IXPA 3B0PA 1OX5A 1TTQA 3DHDA 1WXJA 4IUOA 3PWAA 4RZ5A 3PM6A 1FY6A 4QQ3A 1TMHA 3F1QA 2V0TA 4O4WA 4XKYA 1ZAIA 4UMBA 3IGUA 3LTPA 1VHNA 3C52A 3NM3A 1XFBA 1KFJA 1C8VA 2CW6A 2ZZ1A 4UTIA 4JYEA 1GEQA 4ZQMA 4LNYA 1W3IA 4GUJA 4LV4A 1BWKA 3RF9A 2V2CA 3NVTA 2A0NA 4X3ZA 2V9DA 4JTUA 3TH6A 3NPXA 1BTMA 1KM3A 3SR7A 2GVGA 5EL1A 1YADA 4RCXA 1JUEA 1EPXA 1AW1A 3H55A 1P0KA 4RLIA 3NXFA 3W2NA 5E93A 2GQAA 2QKFA 1ALDA 2NUWA 3KVLA 3FYOA 2CZDA 3LERA 3BG5A 2V2HA 3G3DA 4AHOA 3TQ0A 2CLMA 3OVQA 1WX0A 3SIZA 5C54A 1T96A 5E0KA 3D0CA 1ZENA 3W6YA 1NF7A 4HNTA 3FOKA 5LGXA 4MVAA 1D9EA 3STCA 2YFNA 3UNDA 3W9ZA 3I7QA 3A5VA 1TV5A 2OT1A 3EX6A 3I7RA 3VNDA 1WA3A 1GQNA 4GRSA 5BW6A 3ANYA 3C2FA 1I2NA 3F4NA 3P67A 1A5BA 3K30A 4LW7A 1GOXA 4UTTA 2J9YA 5FEWA
chains in the Genus database with same CATH superfamily
1Z7AA 4ZXLA 5GJPA 2VFHA 3QR1A 1SO5A 3AMDA 3V0UA 4V33A 1NWUA 1WNOA 1KXTA 3WLRA 4PCFA 2XFWA 5AZ1A 4QG9A 4UUIA 2GUUA 3VNMA 1E1EA 2VR4A 4R9OA 1TG7A 2VEFA 2ZX8A 1R9YA 1PZ3A 1OFBA 4JCMA 4CQAA 2YYUA 2FHCA 4IFKA 5AC7A 3CTTA 4XZ9A 5CPQA 5I3FA 5IFTA 3C4UA 1QWKA 4K8HA 1S2WA 5CQ1A 3T2QA 1I2QA 4AIOA 4GCAA 3T40A 4O52A 3PAOA 3B8TA 1V51A 3WK3A 1TPC1 2CZ5A 5A6BD 4NILA 2ZX5A 4KWWA 2XFRA 3FK4A 3FGCB 4JTHA 1F61A 3RMEA 2O56A 3VM7A 4XUGA 1HN1A 4PEKA 4YLWA 1K1DA 1A5LC 2X2GA 2BP1A 2G3NA 4RL3A 3VC6A 5D02A 4LRSA 4UTWA 5CC3A 1EOMA 3T05A 1A5KC 4IOTA 1TWDA 1B3OA 5K2ZA 1M7XA 1KV8A 3EX4A 3VIFA 1VFUA 3FKKA 3U3HA 1IF2A 3CL6A 3MSYA 3WEMA 1IIHA 3ZQ9A 4RR4A 5A6KA 5I77A 3OQ8A 3UEQA 3IJ8A 3QLLA 1UR9A 4HK6A 3HJZA 3DBPA 4BQ5A 3CZKA 3LTSA 1EL3A 2ZDRA 1H1ZA 4JX5A 3ZOAA 2W5FA 3N34A 4ONVA 3WD4A 3EPNA 1TPB1 2X42A 3BMWA 1D3HA 2C18A 4GH1A 2QZRA 2WMIB 1AUSL 3VX1A 3UZJA 3NWRA 3TC3A 4UTLA 3RCYA 3GIPA 4L4LA 2VZOA 4IIHA 3UR5A 3WUGA 3WENA 2INZA 4M82A 4JYDA 1EH9A 1XHGA 2DZUA 4IZGA 3ITTA 4UNLA 2QAFA 3I4KA 4MY8A 1NWRA 4GVHA 2PRMA 3N73A 2UY4A 1UQZA 1T0OA 3UJRA 3VGBA 3SFWA 2PGRA 5A8MA 3W6LA 5HWJA 2TYSA 1GW1A 2X41A 2WHKA 5EPDA 3E12A 3BAIA 3OLDA 2HNEA 2XIIA 3MWCA 3AICA 4GWEA 1IV8A 4P8WA 3BXWA 1CGXA 2VGGA 3STFA 1VBUA 3TTYA 3EBVA 2X30A 1OBAA 1D3CA 4GABA 4FNSA 2E68A 3H12A 2XISA 3L5AA 1QO5A 1F07A 5E6YA 4LYKA 1CXHA 4W5ZA 3L0KA 4N2YA 3NTYA 1HXJA 2BS9A 2AKMA 1V3MA 1YDVA 2I56A 4DB7A 1HJSA 3MMTA 1K9TA 4Z08A 1UP3A 3DFQA 3OBEA 1RY8A 1W1A1 4MB3A 1QPOA 4UR9A 4NYUA 1NJJA 1Q6CA 4B5SA 4C1NA 3UBPC 3SCNA 4J7RA 1OADA 1GG0A 2Y2WA 2WJFA 4ADUA 5C7HA 4UWMA 1H61A 2WYSA 4YL2A 3FA4A 1N8IA 1JRBA 4B5XA 1EKOA 4WKHA 4Q3MA 3CUGA 4MWAD 1QHZA 4S2BA 4PFHA 4I9TA 4RE3A 4KRUA 3TN3A 3WLIA 3GR8A 4CEUC 3UA3A 2BDQA 1JYWA 4KQNA 1RCQA 4DZIA 1WDSA 3QMSA 2WSQA 3SRHA 5I03A 1TV7A 1CEOA 1C3FA 2WMGA 1QNQA 2VGFA 1TJ1A 1KXHA 1E43A 1XICA 1ZJBA 5BRPA 1UUMA 1UQYA 2V6AA 1RR2A 1XUUA 2PPGA 4V1YA 2VQTA 1JXJA 4GJ1A 1ZSXA 1KM2A 5LNSA 1PZ0A 1M03A 4FNUA 2OVLA 2OGYA 1B0IA 1W8GA 3KTSA 4RNFA 3O7UA 4QITA 2OEMA 3AJ7A 3TCEA 2Y5EA 3QM3A 1E0XA 4PMUA 4MLJA 1QCWA 1XYMA 4PUNA 2AL2B 1GTHA 2GJNA 3KHJA 4KFNA 4O15A 2WV8A 4HK7A 1MEIA 3VD7A 3AU2A 5D9PA 1JXKA 3KCJA 1F76A 3RCMA 5T9CE 3NPWA 2OWCA 5BYWA 4Q6XA 1ONXA 3UZXA 4L61A 1GJPA 3N6JA 5FESA 4HIBA 1QAPA 1FDZA 4O8AA 3DECA 4WLCA 4BFAA 3G8EA 1ZBVA 2PTWA 1JCMP 4NY2A 4LQ1A 4H2HA 2Z1XA 1RSCA 4GJJA 4IP4A 2GUBA 3NL6A 4N6FA 3BAXA 2TPSA 3E0LA 4FNRA 2O9OA 2PRLA 4S3JA 4YHGA 3TLLA 4LF2A 1LQ2A 1TV8A 3AIQA 3BPWA 1LOSA 1B9ZA 4CCCA 1YXDA 4AYSA 1IHIA 2GVEA 3CHFA 4FXFA 3LSCA 4RK8A 2J7DA 1NVMA 1V3LA 3JZEA 3GC4A 1EIXA 4NZCA 1XYBA 2ZQ0A 4MKVA 4Q8QA 1Q6QA 2HVMA 2E9MA 4JQAA 2PB1A 4JX6A 3T0BA 4JTRA 1U83A 5AC8A 4LS1A 2CITA 5REQA 4M7SA 2ZUSA 1POJA 4XZBA 3FJNA 3THUA 1DQWA 4G5DA 1E56A 3SRDA 1X7IA 2VR2A 4FS9A 3LXAA 5M17A 3FAXA 1Z44A 1TJRA 3L4WA 1K7EA 4AWUA 3U5YA 3LV5A 4TV5A 1Q6OA 2A3CA 3SCVA 3UNTA 4ZO8A 1UWRA 3WFLA 3AXKA 3LDVA 4LUIA 1JCYA 1XIJA 3EKGA 1LWIA 1QFEA 3GAKA 3M0YA 3NQMA 4A21A 4LTSA 2XG9A 3RPDA 1MUCA 1T7LA 2FMNA 1A0CA 1V3JA 2VEGA 1Q4WA 4ERAA 2Z29A 3ZSTA 3PG8A 4GI8A 3P62A 2NSOA 1XLEA 1PV8A 3MKCA 4Q4OA 4LGXA 2BY2A 3VNIA 2BOEX 4Z2GA 1G0CA 2J75A 4QE1A 1EX5A 4RKAA 5MKGB 5DCEA 2A1YA 3CT2A 3RX2A 4B3ZA 2DZWA 3ITVA 3EDFA 4IG2B 3E0VA 1L6GA 2D2HA 1M7OA 4DIAA 3SQMA 4V1XA 1VLWA 5A2CA 4GOAA 2W66A 1EUNA 4PB4A 3OBKA 4PBFA 4LS0A 1CW2A 3VCNA 2CBJA 2Z24A 2CLEA 1YXYA 1IGWA 3NGFA 3CZEA 1PB0A 3REQB 4HN4A 3L4XA 1YBQA 1S5WA 3A13A 3AXMA 2Q3RA 3G6LA 4RJEA 4MGGA 2Y63A 1I60A 3KBSA 4GFSA 2AGTA 4S3EA 3VFLA 3WD3A 1ZBWA 4D6HA 3BZJA 4UFIA 4CD7A 2XGZA 4KKXA 4S3CA 3HIJA 5I02A 5AKQA 1CGYA 2PSNA 3TTQA 3UG4A 1DJZA 3MCMA 4O53A 5FAGA 3TW6A 4HSOA 2G3JA 4PL1A 4QGCA 5HNTA 5D4YA 5FF4A 1GYMA 5AYBA 3B03A 4HOZA 1GJWA 1L8NA 5AYZA 1R2TA 4GZIA 4US6A 5CSYA 2F38A 2PDXA 2PDMA 1TB3A 3NQFA 1H41A 2D23A 1OJXA 4GQGA 1KCKA 4Y8EA 3WF4A 1T8XA 1ZAHA 3GNRA 3QR0A 1OFDA 4RDZA 1ISVA 2RGMA 1MFVA 3T07A 1KTBA 8XIMA 4ACYA 1N7KA 3CHCA 2ICSA 3I3DA 5H2ZA 3N04A 2QGYA 1UZDA 3N9SA 3QPEA 3VCRA 3F4VA 3OTRA 2GJXB 4DZ5A 1ODUA 5E5CA 3CZ8A 3UESA 3GU9A 3A12A 4IMAA 2OXNA 1V6XA 4REQA 6ENLA 5CSUA 4L4MA 2Y70A 2ZX7A 1HKWA 3HGOA 3KS6A 4PTVA 5LXXA 2CHRA 6REQA 3TP4A 2WB5A 1TRDA 5D2YA 2YA0A 1G9HA 3I3EA 3R7MA 2WLZA 4JNYA 2I9EA 4DJDD 3BGGA 4JTTA 4C6BA 2NVDA 2IPJA 4AD4A 4K36A 1NDVA 2AQWA 4UTMA 2PCQA 3AUOA 3W7CA 4RDWA 4L1GA 4GIEA 1BD0A 1VEPA 3E2SA 1RA0A 5A5WA 4UFJA 2QJIA 1FX6A 3ZVHB 1R85A 3N2BA 3W26A 3RITA 4D6IA 2WPBA 4E38A 1UMLA 4LXFA 3CUIA 3VZZA 2DFAA 3ARYA 1LUCB 1PYFA 1CYGA 2YOCA 3DG6A 2CPUA 3W7OA 4DXVA 5I0DA 4WXYA 4IXHA 3TAOA 1O1HA 1M65A 1WP6A 4NI3A 1NFBA 4ZQOA 1RHCA 4H6QA 1V6TA 2VC6A 1LM1A 1KRBC 3W7GA 4KEUA 3E0WA 3LHYA 2FQIA 1RLDA 3TVAA 1CNVA 2C1IA 4MFEA 3FEQA 1XH1A 3W7JA 3UR7A 1X1NA 4K7VA 3S9YA 4JL2A 1SJDA 3PZIA 4HU4A 1RUSA 5HMFA 3IVTA 1SJAA 1AQHA 7REQA 4A3UA 1OC7A 3GG0A 4IQJA 1KLZA 5EFDA 5D05A 3LCFA 1F8IA 3AAMA 1NWSA 2VR5A 4OHQA 2ATSA 2Q02A 3VKDA 3GFZA 3AS0A 3RGTA 2WVVA 1ZL1A 4WXZA 2E3ZA 2E6DA 2J79A 4ML4A 3MUCA 4F79A 3BLEA 1QU4A 1JF6A 1Q66A 3QY8A 4W4QA 1ONRA 2NXIA 2J25A 1JULA 3VABA 3LX9A 4DUXA 4ADSA 4KCWA 2J13A 3C3UA 1QUMA 4MSSA 4RV3A 5K7JA 1QBBA 3WQ4A 3TR9A 1V93A 3VIKA 1JPHA 1DPMA 3QQ0A 1QW8A 5D38A 2PFHA 2X1SA 1TUFA 3DYPA 5CJ5A 2PDBA 2VZTA 3AMLA 4A2RA 4ICNA 5I2UA 4D2JA 4IF2A 1KQYA 3C2RA 4E2DA 1K9EA 1OHLA 4NSBA 4FX6M 1LOLA 3ITYA 1XGDA 2E25A 1LRQA 2NQ9A 4J3WA 2QUMA 5CPLA 5K4ZA 2GFTA 4D8LA 3LHVA 2W92A 2Q8LA 4BQ2A 4D72A 3SUVA 3MI2A 1RP8A 5B7ZA 3HG4A 3SIMA 1K02A 2HS6A 3A24A 2ZUVA 3VOCA 5ABGA 2VT0A 3DH7A 5TAOA 3S2LA 4W93A 1GQLA 2IQTA 1S2CA 3G18A 2X16A 4FX8A 4UTHA 3NOEA 1LL6A 4AZBA 2VC9A 3ANUA 5I6SA 4ZO6A 3AFBA 1TPWA 2E1WA 3SURA 2EPOA 2NX3A 3OA5A 3WNMA 4XQ6A 4OGZA 5K4XA 3A21A 4C5ZA 1CGWA 2B81A 3I7SA 4HHPA 4HNUA 2WSYA 2YBTA 3NDOA 5JXQA 3SUTA 5DT5A 5CLTA 1KFEA 4UQAA 2CETA 1TWSA 3SAZA 5KINA 1NQ6A 3KL5A 3SBFA 3S0CA 2RAGA 2TSYA 2EJ1A 3CAVA 1QI0A 4BEUA 4OQVA 1J0JA 3DBNA 1GPFA 1EEXA 4QE5A 4LUSA 2V30A 5CJNA 3W1QA 1JI2A 1NH6A 3ARSA 1R9ZA 2Y24A 4O14A 3GLCA 1DWIM 3TJ4A 3GVVA 1JIBA 4H4IA 3ARTA 5D2VA 1TE1A 3NM1A 1A5CA 1NFPA 1DIKA 4HCDA 1QTWA 2CLLA 2YBVA 3GWQA 2ZCGA 4JQ2A 3HQPA 3W29A 3GNPA 1S38A 5G4EA 2PTDA 3OLEA 3EZ4A 4O11A 1AL7A 2J7BA 4TUFA 2E0PA 3P8JA 5HANA 4GYPA 2IW0A 3DFTA 3UJSA 5A6JA 5T9BG 2ISVA 3ALGA 1VJSA 5C5YA 5KZMA 4K3ZA 1IT0A 2ZFAA 5I23A 3E5PA 4K8EA 3AWOA 4ZGYA 1G7VA 3PN8A 2OYLA 3PY2A 1GT8A 3TA6A 1KA9F 1DIEA 3A9IA 2FDSA 4BHYA 4C6CA 4LWWA 4IP7A 2B7PA 3L4YA 4CCZA 3ARVA 2BY3A 2DDXA 1OM0A 5CG7A 1ZJAA 4FLOA 4CD5A 3CK5A 3TTOA 1W9XA 1E9LA 1R2RA 3UY8A 4PMDA 4KMQA 4P7NA 8XIAA 1NDWA 3C0SA 3UQNA 3B8WA 4PCSA 3CU2A 3T0DA 2Z1WA 4IPLA 1ESWA 4PUDA 3PJXA 3OGSA 2XIOA 1EUAA 2OG9A 2PDHA 4IPIA 1XI3A 4JTAA 2CNCA 4S3AA 1JQXA 1DJIA 3CAKA 4Q8MA 3CV2A 3QW4B 4GY0A 2QDGA 4ZQPA 1O5KA 3WIJA 1XSJA 2CEQA 2EG7A 1LOQA 3WN6A 1GJUA 2ZUUA 1B5TA 3V18A 3EXTA 4AAJA 1MW2A 4C6NA 1AA1B 1VBJA 5DMLA 1UKOA 1JZ5A 3O6YX 1J0YA 3CV7A 4ECLA 3ZLHA 2YCEA 4MFDA 3ERPA 1BWVA 3GZAA 3W7MA 5JUVA 1O6IA 4W8BA 2QDDA 4Z42C 1GG1A 2V68A 4ZB0A 4JFSA 5CPMA 1K6AA 3GM8A 2EKGA 1YYAA 2NXHA 2BGNE 4P8XA 5E0FA 4MF4A 4KCVA 1J5SA 3ARQA 5BOFA 3DAQA 1KBBA 1KGWA 3A64A 4PTNA 3ELFA 4JTLA 4DRSA 1VFSA 3BCDA 3H70A 4AEOA 3WBXA 4QLJA 1M5WA 1WKFA 1KTNA 3NO1A 1DJGA 3GBEA 3NZQA 4H7CA 3QQWA 3SECA 2QJMA 4O1EA 5CH9A 2AAMA 1TQXA 1SFLA 2IPFA 4LC6A 3FCPA 1DJQA 2C0HA 2ISSA 2GVYA 4KESA 1VLIA 3PG9A 1PKNA 3BLDA 1PIGA 1RAKA 2VI0A 4FO4A 1RVKA 1F9CA 1GVSA 3LZ5A 3M5VA 4XAGA 2OOGA 5JVLA 4TOQA 1JUKA 4XZWA 2VCAA 4I9AA 3W85A 2NUYA 2PF8A 1YNQA 4OECA 1RBLA 2J6VA 2E6FA 1Q3NA 1CX9A 5LA0A 4RV8A 1HL8A 3UT0A 3UJ2A 3WL1A 2HV5A 2PDNA 3FSTA 1SMDA 2ACQA 2CKRA 3GXIA 3CL7A 3R4IA 2GL5A 4AXKA 1Z3NA 5D09A 3TU9A 3PBYA 4GLEA 1HFBA 4GQRA 4LYQA 4BQ4A 1XIDA 3IARA 2CBIA 2AL1A 3TR2A 4GXWA 7PTDA 1GK8A 3NEHA 3VE7A 1GVEA 4BEQA 3GNDA 4BF5A 2YCLB 3I6EA 2BVTA 3MUIA 3RYSA 3M46A 3OZPA 1A53A 4HPHA 3V0SA 1KM0A 3UZ5A 3UWYA 3EB2A 1Y0EA 2D69A 3FIGA 3LYEA 1REQA 4TVUA 4B9YA 3BOXA 1RXOB 4YWSA 1YMYA 1TR1A 3U48A 5FACA 4DLMA 3G1YA 5K9CA 1E5JA 1TPEA 1TMLA 2BGQA 1QOXA 2WZHA 2CIPA 4HA4A 2CCRA 5HQLA 3B3DA 4MLRA 3KCLA 2GVJA 3QYSA 2OZTA 3RLGA 1TE6A 4QM1A 2WMIA 3CGTA 2QF7A 5RUBA 4ZO7A 3ITXA 4Y9AA 3HZ3A 2WMFA 3AYSA 3MHFA 2J24A 4CEXC 5CZTA 4JFWA 2FB2A 4UIOA 1UWTA 3RO8A 1A5MC 4H1ZA 2W27A 3IEBA 3KCOA 3RCNA 3LBMA 4MM1A 4ZOBA 1G6CA 1KD0A 1OABA 5EY5A 4PZVA 1BYAA 4OWGA 3H2CA 5BMWA 4B92A 1W1YA 3SY1A 4JTJA 1V4YA 3PZMA 4YTQA 1B2YA 3UG5A 5BU6A 4DJEC 3DN5A 1HJUA 1EZ2A 4AZGA 1L8PA 3K8LA 1GGOA 3G0XA 3KWXA 2VFGA 3M44A 4IJBA 1WV2A 5C9WA 1KC7A 1JYXA 5FOOA 3GFXA 4MKSA 4HNVA 4I7WA 3MB9A 3QZ6A 4AH7A 2FZBA 3NCOA 1UKSA 1AJ2A 7A3HA 1W1VA 4JIQA 2BY0A 3L9CA 3NQVA 1SW0A 1YPIA 3EGJA 2ZUTA 3LNMA 3GAYA 5J5RA 2J8TA 4E4UA 4Z1DA 3W81A 3CLMA 1ML1A 4AY7A 3W74A 3P14A 4B4HA 1O5XA 3DFSA 2OKTA 1EDQA 2ZRVA 2PF0A 2BXZA 2WZIA 3VFCA 3KBMA 2R1PA 4H9TA 4GJIA 2A6LA 2O55A 1KM6A 4J27A 2O4QA 1VJIA 2ZYFA 4AWTA 3VK5A 1J12A 3AHTA 4QHRA 3S42A 2PAJA 3USZA 3NL5A 1ICSA 1MUMA 1K9FA 2GJPA 4C1KA 1Q6DA 4NJJA 3LHUA 1W2VA 3T9PA 5GNXA 5DRCA 4IJRA 3IGHX 3ITGA 2WM0A 1UWIA 3QMTA 4DM2A 2A7NA 1G7UA 4O0QA 3VD3A 4MNLA 1M7PA 4X61A 3SJNA 3HGSA 3AIRA 4GK8A 2PLKA 1DE6A 5HJXA 5ENLA 5LNWA 1SSGA 1LBMA 5FF0A 4HZ8A 4FZIA 4QAWA 1E9IA 3PK7A 2Y5SA 3ZJKA 3QZAA 4EPDC 4OOZA 1R86A 1IIGA 3WJZA 1PKMA 1V0KA 2V3EA 4ZOAA 4O13A 3PTDA 1KCLA 5KTLA 1RBOB 1RK5A 3LQGA 4WIWA 4WF7A 1JZ3A 1PTDA 2R9RA 4CNSA 1SUXA 1OZQA 3H8AA 3L4TA 4MHBA 3FW6A 4UOZA 2Y88A 4O10A 4ML9A 1ADOA 1B54A 8TIMA 4FXSA 1VCGA 4Y8FA 1KNWA 4Y7EA 5AY7A 1OFRA 3B9NA 1SSDA 2REQB 2OQLA 3E38A 3CQKA 4MUPA 3FSUA 5AHLA 2PWUA 1XD1A 2DT1A 4EANA 1WDQA 1Y5WA 2UV8G 5I7GA 3RXZA 1AQMA 2W6RA 3UVIA 2CLOA 4TQTA 2W67A 4L80A 3V4BA 2Z0IA 5DBTA 3S3GA 4OV9A 3RM8A 2DGAA 4NVTA 5AC5A 4I5RA 4NZJA 5FJUA 3QLDA 2FZ8A 2IKIA 4Q32A 2FGZA 2VZUA 3M6YA 3STEA 2XYLA 4ZXOA 3AS1A 5I79A 1LROA 3OVGA 4M0XA 3WLHA 1R30A 3FYPA 3JZUA 4IM4A 1DHKA 3TSDA 1JDFA 4IQEA 5KZEA 4PH6A 3ONBA 3GDLA 4MB1A 3SCPA 1ZY9A 1EP1A 1FRBA 5AYYA 1KKOA 4I9JA 2YSWA 2YKKA 5A6BA 4O0KA 4JIIX 4MOZA 1QI2A 2A7PA 2Y8KA 4PGLA 3W88A 4GUHA 1IEWA 4IPNB 4AX6A 4JZ5A 1Y5VA 3LHWA 4FOUA 3BOLA 2VX5A 4BA0A 1TTPA 4I8YA 4N9EA 4GE8A 1Q5MA 1SZNA 3N4EA 3GU2A 1M53A 1IXPA 3OO2A 1X97A 1OX5A 3DHDA 1BF2A 1WXJA 3PWAA 2ZXBA 3GS6A 3B9EA 1TMHA 3R58A 3TYZA 4DZAA 5CAHA 3GTXA 2BVWA 2DSUA 3LN3A 4DUOA 3LTPA 1KFJA 1C8VA 4UTIA 4ZQMA 5E6ZA 4LV4A 3RF9A 2VDHA 2A0NA 1H49A 4AWEA 3ARPA 3NPXA 2NQLA 3SR7A 4RCXA 4D8ZA 3EA3A 4CN1A 3H55A 3PWIA 3R10A 5AZ0A 3NXFA 3HPFA 2ACSA 3AUJA 3K8KA 4XZIA 5C70A 4ZEPA 4WK9A 1H09A 2VZVA 3BG5A 2V2HA 4XAYA 3QY6A 3WH8A 4J3SA 2E40A 3BDKA 1WKYA 3A47A 3T0TA 2C7FA 1NF7A 3HTWA 3FOKA 5LGXA 2GQ3A 2YFNA 3QGKC 1Q6FA 4Q4SA 1QATA 3I7QA 3L12A 1N8WA 5MKGA 3EMQA 4WVXA 3ZJ8A 1BYCA 1UR4A 3HFYA 3MSRA 4TTGA 2DSZA 1GKRA 1VFOA 3EPOA 5MF5A 4PULA 3HV9A 4C7FA 1XYAA 4NIRA 4IFKB 5KSWA 3LI1A 2VEKA 1ICQA 4J40A 1HIZA 4TX9A 1X96A 1OGBA 3S6DA 4GUGA 3KEHA 1KWKA 1VFFA 3GNNA 2ZUWA 3RM9A 1E6SM 3C56A 3QRHA 1I1WA 4K6AA 2OSYA 3DENA 3M5XA 1WDPA 5G1TA 4ZSTA 3TJXA 1UP0A 3CYJA 4XG1A 3L0GA 4LNCA 1IQ8A 1J8VA 2R1NA 3GYCA 4LAOA 3N9RA 2GK1B 3W84A 3VPLA 3MZNA 2VFIA 4LAMA 1QNSA 3RAOA 2H9AB 4PCTA 1HVQA 1KB3A 4TTUA 3LLFA 5FL0A 3RRXA 1GUVA 4M6UA 4ZB2A 5AYXA 3BLPX 1XYLA 1TJPA 1TVNA 3WK1A 1AG1O 4BS0A 1QPKA 2BXVA 1V0MA 3JR2A 4YPJA 5CPOA 2WSRA 3MKVA 3HPSA 3Q2DA 3A3XA 3P61A 3HJEA 1OG6A 5H8MA 3VIGA 4M8UA 3H4GA 4D6GA 2V3DA 3ZS4A 3FNDA 2XN0A 5KITA 1TVLA 1RP9A 4B16A 1MWOA 2QPUA 1AQFA 1BEUA 1N82A 1Q85A 2P88A 3IVSA 2Z00A 3L2IA 1H51A 4RUBA 4KEZA 5HQEA 4Y90A 1BYBA 4EOUA 2GYIA 2DJXA 2C19A 3M0VA 3OGVA 2YDAA 2QCMA 3PJWA 1UKQA 4QE4A 4QJ5B 3U2OA 4LAZA 3DI0A 3GR4A 1JDDA 3GBDA 5LZLA 2GJXA 3INPA 3GSMA 3WO8A 3ENLA 1XLHA 4S3KA 3SCQA 4FLQA 3SUUA 1UWAA 3TMLA 1BSLA 4HT3A 5TBOA 1AFSA 5C2GA 5CG0A 1P48A 1RCXB 3G1AA 5F4XA 4E3TA 3QV6A 1JAEA 2NUXA 4GUFA 5A3HA 5E9AA 3AO0A 4NZFA 1UWUA 5E70A 3CYVA 3N18A 4H8HA 5TQLA 3KOXA 1CXKA 1V6YA 3EX3A 4AZIA 1OGGA 3U4AA 2RGLA 1W5OA 1EB3A 5K9DA 1W8SA 3JVAA 4U3CA 2QJGA 3VA8A 4DBSA 1OVDA 2BOFX 4LCQA 3ZFHA 1OZMA 4JGDA 4X9YA 3U2ZA 1SU5A 4DJFD 1L2UA 2VKZG 1QHOA 2PTYA 1UR3M 3PB0A 1BLIA 3W3OA 3LGEA 2DSKA 3EXSA 4PUUA 1TIWA 3RUBL 1A5NC 1NY1A 2RKXA 3D3FA 2GSHA 2J88A 4V15A 4XD6A 4JKKA 1OX4A 5DF0A 3KBNA 3L5MA 2E8YA 1XKYA 4XB3A 1WOBA 1DQXA 3MO7A 4C1NB 1SQ7A 4JDYA 4JIHA 2VCCA 2VMFA 1S2AA 2IS7A 1U2YA 2LLEA 5A6TC 4BI5A 3RJXA 4OBTA 1R0MA 2HDJA 3GVGA 1HP4A 2QV5A 1YDNA 4F40A 4E3VA 3V3WA 1XCFA 2CWXA 1CT5A 4S39A 2PURA 1E70M 2WVUA 4GKTA 2E77A 2B7NA 5XINA 2P0OA 4NAFB 1LQ0A 2V5BA 1RK6A 1V79A 4WD0A 1J2BA 2NVCA 1M68A 2WC4A 2WBGA 3PS7A 4HPJA 1GOKA 1V02E 2PDJA 1W17A 5KMYA 4JTSA 2VC5A 1EHNA 1VFTA 1O5QA 4S3BA 5GVJA 2X0YA 1H0GA 4IUGA 4FP1A 2GUYA 2ACUA 3EWWA 4R88A 5CGTA 3KOYA 4ATWA 3P5ZA 1JFXA 4EACA 4W84A 1UYQA 3AOFA 1WXYA 1R9XA 3MUAA 1T8QA 1J0ZA 3VIIA 1XDLA 1VHCA 3CB3A 4GIAA 4G8TA 5GQBA 2VZSA 2DZBA 1JZ4A 1MEWA 1IZCA 1ZCCA 2G8ZA 2C6QA 3DI1A 1V77A 2DVTA 3STGA 3VD5A 2ZVIA 1I6NA 3QTPA 3S47A 3KL0A 3TOPA 3YPIA 2Q3OA 2HMCA 3T81A 1FP8A 4FNPA 1JRCA 1K8YA 4PN2A 4GZJA 1GQJA 4D8AA 1CZ1A 4JIEA 4S1FA 3QGAC 2B7OA 3FA3A 3WK0A 3N2MA 4KGLA 1F3TA 2J62A 1SFTA 4FMVA 3EOLA 4MDOA 3IVUA 1OSEA 3H2OA 3TC7A 5FSEC 4ZCWA 4HCHA 1DORA 1FUYA 4G6CA 2Q01A 1NDYA 2VUNA 3KZPA 4U31A 5DXYA 4D6EA 3BAJA 5LNRA 4ACZA 2YDRA 4FI4A 4CQCA 2ADAA 2VURA 3EEGA 1EJWC 4B5TA 3B8SA 1TKKA 4WR3A 2ACRA 1E9ZB 3UWQA 1FHUA 4K2SA 5HMDA 3Q58A 3SB0A 1IEIA 3TCSA 3LLXA 4HTYA 1I8JA 1TZ9A 4AZCA 1UCWA 3FXYA 3ARRA 5REQB 1ECEA 3H4WA 5AHIA 4JN7A 2QJJA 1HJXA 3L23A 2ZTKA 5CLWA 4NAEB 2C0AA 2PBGA 4GX9A 3XISA 4B5NA 5F1VA 1D3GA 8A3HA 4MWAE 1KLYA 2BXYA 1EOKA 5BMXA 3M0MA 2GZXA 2E9LA 4ZFCA 2C16A 3HG3A 1JZ2A 2WMKA 2ZWZA 3P7YA 4R9XA 3IANA 3KTXA 2GQ9A 4LAUA 3CMJA 5JIWA 3BAWA 5EMLA 2X1UA 5EMJA 2DH3A 4XIMA 1POKA 1X8CA 3N17A 1WDDA 3AMKA 1K6WA 5EMUA 3LCLA 4DO6A 1Z32X 3G77A 3A22A 2HVNA 3AI0A 1IT8A 2DZAA 4B15A 5FJRA 2WMJA 3P81A 4PMOA 3SGUA 3DG3A 4CD4A 2CXGA 3G0UA 4PTWA 3F5JA 4ZVJA 1R87A 3TYEA 1YDOA 3CNYA 4MKNA 2RJGA 3KLLA 1XWYA 4A3YA 2YL6A 1ME9A 4DJED 4J35A 1LQAA 1ISWA 1YPFA 1EJVC 5DMNA 2DT2A 4UBPC 1GKQA 1XLBA 2AMXA 3CEUA 1Z9AA 3DKJA 4DO7A 1PEZA 3QPYA 1PBGA 4QR6A 4UQ9A 4N4PA 3A23A 2D0HA 1QK2A 5FEZA 1IEQA 3UA4A 3QC3A 3QMRA 5AOUA 3VOJA 1F2JA 2V5JA 1P0BA 1DWGM 4DNHA 1JJKA 4DJDA 3UD6A 4YCPA 4JHOA 3N1AA 1EP2A 4DLFA 4K1GA 3Q65A 1FHVA 1S39A 2QW5A 3MDWA 4MAVA 5JH2A 1Q6GA 3QXBA 2WZTA 1QVBA 3PBUA 2HBXA 4DAIA 3T44A 3N6QA 4LEFA 5AFDA 4GI6A 2CLFA 1VIZA 5IRPA 1H7NA 2YJQA 4L7ZA 3HPAA 1RV8A 1EJTC 5HWMA 3DU0A 4FHAA 3UW6A 4DF0A 1K3UA 2DIEA 3G2GA 4XD4A 5BZAA 4IIBA 2PLCA 5F2MA 1C9DA 4UR7A 2J8GA 3H2MA 1WAWA 5EMYA 3K8MA 4Q6JA 3ZIZA 3TFXA 4HNNA 1F74A 2BODX 2G4FA 4LAKA 4CKQA 1GYLA 1PO9A 4YYCA 4V28A 1ME7A 1ZBKA 5I3HA 4AIUA 4W88A 3RLHA 9XIMA 2G95A 4CU8A 2ZADA 3NDYA 1H62A 1WYIA 3RILA 3FVMA 3HURA 1HJVA 4JL1A 3S2MA 4M6PA 3KTCA 4JTKA 4H3DA 1RBAA 4HTBA 2GGGA 1VPYA 1HJWA 3IK4A 1ADDA 2QLYA 3VUPA 4QJ3B 4C91A 4MNMA 1JZ8A 5IDZA 4DBDA 4KBXA 3PZUA 1J0IA 4NXSA 4OJYA 2Z1BA 3VMOA 1M3UA 3W24A 3LA4A 3MUZ1 4F0RA 4FB7A 1FFQA 4GX8A 4H7ZA 3BANA 3NQCA 2G50A 3VOFA 3RU8X 4C6FA 2V82A 4JICA 3ABXA 3S5ZA 6REQB 1BKSA 2YZRA 4ATLA 3WMCA 3QF0A 4TMCA 1EHAA 5CZJA 3SQSA 3GDRA 1F05A 4HNLA 1A50A 4KS0A 2PU1A 2V5KA 4PTDA 1ADSA 3WQ8A 2P0IA 4L1WA 2OYKA 2Y1HA 3K4WA 2FZMA 4PUEA 4DUVA 3UPBA 1BF6A 4HSNA 1W9DM 1VYRA 4Y96A 3RMJA 2GGHA 1TR9A 3S1VA 3N13A 3CH9A 2CHOA 1RPXA 1KRMA 2J9XA 1UZ1A 1MDRA 3B0YA 1C8YA 3I4EA 4S23A 2IXUA 4FF7A 4Y9PA 3NEVA 2ZDSA 1OD0A 3W7RA 3W7HA 3OW1A 4U4MA 1Y8BA 2WANA 3C0QA 4DO5A 2PRHA 4US5D 3VKJA 1C9WA 5AC4A 3DG7A 4IGMA 5HR7A 4QCFA 4BI7A 2VEMA 2P10A 1IZJA 4L6HA 1K8ZA 4HJFA 5BNKA 3P0WA 4LS2A 1WQ5A 3M4HA 2Z1VA 3L67A 2XTKA 3TQVA 1EC8A 3A3HA 1I0BA 3WNPA 7REQB 5M5DA 1R3YA 4C6KA 5DCDA 3W07A 4HU3A 4J3TA 3MC5A 2IUZA 3VDHA 2YB4A 2DUAA 3WUEA 1E55A 3M5YA 4DEFA 2H3DA 3B8VA 5HNRA 4KH2A 3NJ3A 5EA9A 1IWAA 4LOCA 1XLIA 4DWSC 3MQTA 3DC8A 3UR2A 3S6OA 3G1FA 2I5IA 3T42A 4BF9A 1H63A 3PZOA 2BFGA 5I3GA 4H9YA 1OK4A 4Z2KA 4POCA 2OU4A 4UQCA 3U2EA 1US0A 4H9XA 4XZMX 3CEPA 4LVDA 1H2JA 4KFOA 4L64A 1SO6A 2PS2A 3LG3A 2Y5JA 1PX8A 4V27A 1QI3A 2ZUMA 4E6MA 3U5UA 4KEMA 2WO5A 1HQTA 1F4AA 2CZFA 1XPYA 3UGRA 2P3ZA 4IH3A 4F9JA 1DWAM 5G2IA 1WAUA 1OF6A 2CLHA 1FCQA 1OYBA 1VPQA 1DWFM 2NXGA 4R34A 2Y8UA 3T08A 4YVXA 3EWYA 1QNOA 1AJ0A 4GYPC 4I8DA 1FKWA 2XN2A 5EMMA 3IIPA 5FEPA 3EWCA 1XYZA 1SO3A 1DTUA 1QW9A 4G7EB 4ES4A 1DJWA 2Z2AA 3W6MA 4HOWA 1YTKA 4JTDA 1ZS2A 1EWDA 3CAWA 2QCDB 5A8NA 2RFGA 1VBRA 1XLJA 6ALDA 1O60A 3NZ1A 2PDYA 1ZNNA 4QX4A 3LCIA 3ABZA 2HQAA 3B9AA 4JQ4A 3EB4A 4AEEA 5BRBA 1RJQA 1J4EA 2DZSA 4NHVA 4FOKA 4RDVA 2OWWA 4DNMA 1Z42A 2YPIA 5J04A 2EO7A 3TDFA 3G0SA 4ORIA 1XIEA 3S2NA 4DYKA 2DY3A 1XQKA 4LFYA 4B3LA 1KR1A 5CBJA 1XUZA 2GDVA 3KL3A 3SEPA 2OFJA 4O1BA 1V5XA 3JS3A 4Z1YA 4GZ7A 3RFAA 1RALA 1C90A 4Q4MA 3AHYA 1I0DA 1N2VA 1HL9A 2VQUA 3OA3A 5A8GA 3HB9A 1Q45A 3S9IA 1CXIA 1EBHA 3PR2A 3NYDA 5D8ZA 5J5DA 1HJQA 4GPNA 2O7QA 3GYEA 1K70A 1XG4A 9CGTA 4Q8TA 1QASA 1QJWA 4J5NA 3GW3A 2F9RA 3IIOA 2O9TA 2ZA3A 4IHCA 3H7UA 3SY8A 4LV9A 4PODA 5CZSA 3WH6A 3APGA 3PJUA 1V08A 2I7GA 2E67A 1HKIA 2ZC8A 3HU7A 1E0VA 4U10A 3LHTA 4GXMA 4YWIA 1PYMA 3APTA 1VC4A 3P3BA 4U28A 5F4SA 4F0MA 1DJXA 4KFPA 2NT0A 1UASA 2UY5A 3BCJA 1OINA 3PANA 3OHMB 3GHTA 1DYSA 1UR1A 3UY7A 1KRCC 4E8CA 2HXUA 3CASA 4JKMA 5AN7A 1V3IA 4EE9A 1VRDA 3POCA 3V36A 3R8RA 2VVSA 3S8HA 3VDGA 1B4EA 1NELA 3CMFA 4HYWA 4U2YA 1PE1A 2C1GA 2XM2A 4CNUA 2WNNA 3Q45A 1KBJA 5JBDA 4WDUA 3O3RA 2V2DA 3STPA 3AIUA 2QQ6A 4XBJA 2EPNA 1PX4A 2ZOXA 3SI9A 3URBA 2PDLA 3WBEA 3DYMA 2FZDA 4S2CA 3DUGA 3SSJA 4WJ8A 2NV2A 3S5OA 3E0FA 2J77A 5LNVA 3G1RA 3VU2A 3NG3A 4H04A 3KRUA 4Q8WA 2PMQA 2X2YA 3GH5A 3LRLA 1B57A 2NQZA 3WLJA 3GXTA 2PDWA 4YS1A 5CKSA 3W7KA 1M41A 1VB9A 3TJIA 1K7XA 1XIGA 3SCUA 4QXIA 4Q8UA 4GD0A 2XFFA 2JFEX 1YDYA 1OFPA 3W1LA 2FGBA 1S3TC 3GDMA 4DF1A 1LBLA 4GHRA 1HVXA 4F2TA 4GNVA 4YU1A 1TPFA 5HWNA 1JZ7A 3M16A 5DY2A 1P5BA 2XVPA 1OX6A 2EXOA 4NP7A 1CBGA 1JL8A 4MNJA 2PD5A 4X60A 2OODA 3LXBA 3DOPA 4A29A 2OR2A 3C6CA 2IPWA 3LLDA 1ZZMA 3Q67A 2J27A 5DO8A 2J8FA 4E4PA 3G1XA 2DH2A 4QEHA 2ABBA 4MB5A 4AHQA 3GVRA 1NQKA 4HD5A 1FWDC 2WJEA 3SFKA 2FHFA 3R8HA 4JNMA 4XD3A 1H1YA 1T6MA 2FHBA 4RE4A 3PUOA 2I1OA 5F2GA 2EHHA 3NQEA 3V1PA 1GWJA 1ZTVA 3MS8A 1JYNA 1JAKA 2DUXA 4F9DA 4FSAA 4XZNX 3M9YA 1RCOB 2P50A 4BKNA 3BICA 5TD4A 1PWMA 3K4DA 1TPVA 1OD8A 3WDRA 1MQRA 3ZT5A 1B9BA 1YPXA 1VKFA 1XGZA 2B0MA 3B8DA 5EB8A 1UHVA 3I3BA 4MZ1A 4OBSA 1TA3B 1ZFJA 3W00A 2X0HA 3F5KA 2WAGA 3TTSA 3LRKA 3UWVA 2XPKA 3M0HA 2YXOA 2OPJA 4JTEA 1XCXA 4Z1BA 1E3ZA 3WG6A 3CC1A 3L2MA 4IIGA 3B0VC 4H9ZA 1H5YA 2HEJA 3NNTA 1TMQA 4O50A 4NNBA 3HPZA 1M1BA 3BC9A 3KBJA 2CLIA 2Z6JA 1IZKA 4Q8VA 1XBVA 4GYJA 1KKRA 4AVOA 2AAAA 2GK1A 1MXSA 4ILSA 4NZ3A 2H9AA 2J9ZA 2ASHA 4LY8A 3W1MA 1BVZA 5A6SA 1ITQA 1V6UA 2D20A 4G9PA 4UXDA 2ZXDA 3W73A 1REQB 5FI8A 2VFEA 1JPKA 2Z2BA 1A80A 1GVIA 4MY9A 3V16A 1H7OA 2YX0A 5L9FA 3QVQA 3MMWA 5H8UA 2XUCA 1UKTA 4ZBCA 1JCXA 3W23A 3AYVA 1B31A 3NQ2A 1JNDA 2IPGA 4XK2A 4KF1A 3NSNA 3EDKA 3M7WA 1E9YB 1CPUA 2P76A 4NNAA 4Y9MA 3TE9A 3PTQA 3A4JA 5I24A 2WQDA 7CGTA 3LCHA 4OUEA 3GHRA 2DJLA 3PHAA 3BV4A 3H6OA 4A22A 1SW3A 3EOSA 3AHZA 5HXMA 1PAMA 4HBKA 3WDJA 1F7BA 3E49A 1DEDA 1ZUAX 2ZX9A 3VE9A 2QIIA 3MSGA 3BW2A 3NQ8A 3QC0A 3R11A 1PUDA 2E6AA 1DOSA 4C7GA 1NSJA 1FWWA 3W7PA 4GCXA 3KXQA 4CN4A 2QCLA 4KRTA 4CN6A 2E5CA 1CGUA 5AVNA 2Z25A 1XS2A 4NNCA 2WNWA 5HJLA 3KRSA 4H19A 4O16A 4HYVA 3VTRA 2QS8A 2YLAA 4AD0A 2WKGA 4R5EA 5D33A 1CXEA 3LHZA 4A8LA 3K5XA 3LEPA 4K39A 3OYZA 1XYFA 3HG5A 2F8QA 4ZOEA 3SN0A 1AD4A 5HNNA 3B9DA 3LPOA 4IIEA 2PDPA 1PHQA 1NWTA 1XJBA 4LALA 1SJCA 2CFFA 4B5WA 2NQHA 5ABFB 5PTDA 5I07A 2XN1A 4EIVA 1VF8A 2JF6A 3RHGA 4CQ8A 1SFSA 1RZMA 4L9YA 2J66A 4BWLC 3H2FA 4FLRA 3MHGA 1CXLA 1ZJIA 4EPBC 1W32A 4DI8A 1MQPA 1T5AA 4MADA 2P3EA 2VD8A 3LCXA 3LOTA 3N4FA 3CS2A 3NQGA 3V1HA 3N3MA 3GDTA 3AC0A 4HA0A 2WKJA 3GE7A 6CGTA 1HGYA 4F2BA 1GZGA 2GDQA 3BLKA 3EKLA 4LRTA 1FCBA 1V03A 4NAFA 4C7DA 4G2DA 2G3FA 3L66A 2GGEA 1O7AA 1UR0A 1X1ZA 1W5PA 2PDFA 3MZ2A 2AQVA 3MV11 2OTDA 2VXNA 4LPCA 2FLIA 4HZMA 5FEXA 2HSAA 1ZU8A 3HA1A 2JALA 2BX7A 5LIXX 3WZ0E 4Q4QA 4RNIA 5D2WA 1BG9A 1R3WA 3B4UA 3NZRA 1E0UA 1VR6A 3Q4DA 1FWHC 3DCPA 1BSIA 3OJGA 1UWSA 3K46A 4N0RA 3U7BA 3DFHA 2ESCA 3QJAA 3NURA 1OY0A 1H7WA 1WDRA 5KEZA 4UFLA 3EA1A 3MKKA 3WLSA 3OGRA 4LY4A 1LYXA 1FWCC 2MANA 3PBMA 2FPTA 1R3SA 4M1BA 3BK0A 3ZXWA 3QV8A 3MWAA 4FPSA 2J7CA 3W71A 2C8NA 4O18A 3CUJA 1EJUC 1M04A 1KBIA 3C0LA 1XM3A 3WBYA 3WH5A 3VUSA 3GHUA 3R0KA 4JX4A 4LUYA 1E1CB 3UZWA 1GONA 3GXMA 1JGIA 3T7VA 5LHEA 4PUMA 4I3GA 4JN6A 3IRDA 3RNDA 1EC7A 4DF2A 4W89A 4LSBA 3VVGA 5HOSA 3RK8A 3HGRA 3GXNA 1T41A 3KP0A 4B3KA 2OMAA 3CT7A 2YA2A 2DZXA 4F0LA 3R89A 1Q65A 5HMSA 2FKPA 1CECA 2QPSA 4QDWA 2ZUNA 4WY0A 4AY1A 2QCHA 3P84A 4L9XA 3O6CA 4EVZA 1U1JA 3D3AA 2CXEA 1F3WA 2DSWA 4M81A 2A6NA 5L6UA 3CHEA 2I14A 4AF0A 1QBAA 1VD6A 3NL2A 2FTPA 4NYYA 2I5GA 3N15A 5CAKA 2HROA 1MNZA 3CUFA 4ZQCA 1OYAA 3PFMA 2HRWA 2L5HA 1XBYA 3TROA 3N12A 3MW7A 2A4AA 1VEMA 3MDUA 1FWGC 3GC5A 2HZGA 3UYCA 2P1FA 4NAEA 4NJGA 5I09A 2ISWA 3WF0A 2D2JA 1ZLPA 3CJPA 1EYEA 3VGGA 3P80A 4LH8A 2OZ8A 1ZGDA 2D0GA 3RU6A 1MUWA 1HNYA 3N25A 3ES7A 3QV7A 1H60A 3WK2A 1QDSA 1AW5A 3HQNA 5FSDC 3T4WA 1CB7B 1LDCA 1WUFA 3CBWA 4LF1A 1P1MA 2ONEA 4H00A 4YYFA 3B0PA 2GWGA 4IUOA 3WQOA 3PM6A 1FY6A 2NQJA 4RZBA 1LG2A 3PNUA 2B31A 3BAKA 1TUXA 4WKFA 4E8DA 3IAQA 1VENA 2ZICA 3C2YA 4UMBA 4DWSD 3KM8A 3NM3A 4GI4A 2ZZ1A 2YDSA 3RDKA 1W1IE 3TH6A 1FHLA 1BTMA 1JI1A 1KM3A 5EL1A 4HGXA 1EPXA 4XSMA 1AW1A 1EQPA 1P0KA 3MTWA 3OZOA 4IFRA 5E93A 6XIMA 3FYOA 3LERA 4CQBA 1OCQA 1R8LA 4ZTXA 2CBUA 1XINA 3OQEA 2X40A 3G3DA 3SIZA 5C54A 5C0QA 3GO2A 3D46A 4AC7C 3FHAA 4AMCA 2BVDA 3SRKA 4MVAA 1D9EA 1HKJA 1V3KA 3OODA 2ISFA 2PWEA 1MZRA 3A5VA 2GWNA 3U9IA 3ANYA 3C2FA 1C92A 1GW9A 4E2OA 4J3XA 3UCDA 1AODA 1XLKA 3UXLA 3K30A 4UTTA 1GOXA 2CBVA 2J9YA 4LANA 4PYSA 5FEWA 3W7IA 4DBEA 1UUOA 3BQ5A 3I10A 4C1LA 2WW5A 4LUJA 1NP0A 1XXXA 3PUDA 1GZJA 3RM4A 4C6QA 3W72A 3ATZA 2HTMA 3DC0A 4UC5A 2PDQA 2ZA1A 1CENA 2W9MA 4U5IA 4FAMA 1WPCA 2ZZ6A 5I3KA 2QUTA 2DIKA 1JFHA 3WBAA 1BXCA 1IR1A 1ZALA 1ISYA 3AIBA 1CWYA 2ZZ7A 2VRQA 2SFPA 1WB0A 2E5DA 3W25A 1PS9A 3T8QA 1JDCA 1M9HA 4RW5A 4Q8PA 3H4XA 1P6BA 1QPNA 3TQKA 4IMEA 1W9BM 4MWAB 4W8AA 1ZB5A 1US2A 3JUGA 4EXQA 7XIMA 1LP6A 1GPWA 3FJLA 3HV8A 1UIPA 3WF1A 1GHSA 3DFYA 3O2LA 1NOUA 1F6KA 1Z8AA 3USBA 2W91A 4UMAA 1U22A 1O5RA 3MJMA 4LCRA 1GTEA 7ENLA 3LSBA 3H2EA 4ROPA 1UIOA 4QS6A 1Y5XA 4DBUA 5GNZA 4QLLA 1ZHAA 1UOKA 3KZSA 1OIFA 4XTDA 5TF0A 1A4LA 2OSWA 1WUEA 6XIAA 4ADTA 2R24A 4WKAA 2PDUA 3UCQA 2TMDA 1CI1A 1GQIA 4KGJA 4D1IA 4QEEA 1J10A 2CZVA 4YTTA 3A4XA 4P7LA 4ZA0A 3GG1A 4R7OA 3BL3A 3ZJ7A 2ABAA 3RLVA 1CDGA 3WMLA 2WZMA 3UXIA 4M24A 4MUZA 1R46A 1S5MA 3BG9A 1OGSA 2B4GA 2Z1SA 2BHZA 2F84A 5D2XA 2UBPC 5BRQA 4IPPA 2YYTA 3MVIA 3F5LA 1UA7A 4H7VA 4KT2A 4IQDA 4CVWA 2F2KA 3LZ3A 4WSKA 2TODA 2WHMA 3AWNA 4O12A 4ERGA 5T91A 2Y62A 1OX4B 2O4MA 4ZSUA 1R3QA 2XM1A 2P8CA 2WCAA 4XX6A 3W4RA 2WK2A 3LBOA 2W4XA 3IK2A 3T4CA 3MY9A 3PFRA 2G3IA 1X98A 4ERIA 4Q7NA 4Q8OA 4OTKA 4H83A 4G1KA 3UXAA 1XRVA 4UQBA 4IMDA 2RDTA 3OVPA 3HPXA 3CQ0A 3KDOA 4AEFA 3WX7A 3MYOA 1P7TB 1SO4A 2XGIA 4WSJA 3K4AA 3WJYA 3C5QA 3QOMA 2V8ZA 1YHTA 2A21A 4C6OA 1FDJA 4S3DA 5BXRA 1PKYA 3NQ6A 1PL9A 3G8RA 2BNJA 5XIAA 3F2CA 1US3A 2H90A 3W2UA 3B04A 3BLFA 3MMDA 3VGDA 1VQTA 4C6DA 2HJPA 4A3HA 1VH7A 3F4CA 2VDIA 1N8FA 1G4SA 3Q94A 2G0WA 2WMHA 5J8LA 3LB0A 1C29A 3AHXA 1LZOA 4NKCA 2WJDA 2EPLX 3CB8A 3BJSA 3QBUA 2JIEA 3IJQA 3KBWA 1G4PA 3FN9A 1TZ7A 3S2JA 2YL9A 2A5HA 1O68A 5IFPA 1OWQA 1C8XA 3VIJA 4MZ8A 2VRKA 4AIBA 1XKJA 2VELA 5FKYA 1UOZA 3IS4A 3LU2A 2WSPA 3VINA 1BGGA 4AZ7A 1OT2A 5F4WA 3UWUA 1J0KA 1X6LA 1XIBA 3HG2A 2FZ9A 3LGDA 2EG8A 2DVUA 1CLKA 3AXHA 1TV2A 6A3HA 1A5OC 4BI6A 1G4TA 3TXZA 3E9AA 1U1HA 3T8LA 4PB5A 1DJHA 1HKKA 2FGLA 3ITCA 3XINA 2WLYA 2QVNA 3BMVA 2GJLA 3WD2A 5FJIA 3WD1A 4ENLA 4NJKA 3RPMA 3RRAA 2Z7KA 1TZZA 3O06A 1C7SA 2C71A 4GVFA 5CXPA 4N9BA 2X7VA 3W2LA 3TZNA 3IGXA 1DXIA 4G7EA 1XISA 4XZLX 2XSAA 3W28A 3WQ5A 1HGWA 4O54A 1ITUA 1XLMA 1EDGA 2I17A 3H21A 3ARXA 1BRLB 2QCDA 4IICA 3OOQA 1XIHA 1OF8A 4MJMA 1VGAA 4ACZB 2CU0A 2ISDA 1RD6A 2IQ0A 3C2OA 3M43A 2C3ZA 1J96A 3T0CA 4L56A 5BWFA 3R8GA 2HPMA 3G22A 2DT3A 1EIBA 5E09A 4YTRA 5DQPA 2OZ0A 3UXKA 4EX4A 1ZP4A 3EWZA 1ODZA 4L9ZA 2JK2A 3O6AA 4AZCB 3DFOA 3LUTA 1F8MA 8RUCA 3WUBA 4J3UA 4F0HA 3UZZA 3LCWA 4B2DD 4EK7A 1S2VA 3AALA 3R0UA 1U5JA 1RY0A 2E6YA 4BJHA 3DYOA 4MJ2A 3NYZA 4DBWA 3N29A 1OEPA 2DSVA 2VD9A 1D8WA 2VYOA 4KW2A 2Y4SA 5ABTA 1UC5A 4QJ1A 1W3HA 2CZEA 5CSSA 4GQ0A 4KPLA 1H1NA 2Y89A 1Z69A 4Q7IA 1HL2A 1JZ6A 4BF7A 4XIAA 3AQUA 2C15A 2YCJA 2JKPA 2ZX6A 3QKZA 4PA8A 1PPIA 3S1UA 1RQBA 1QXLA 1UH3A 4RXFA 4JTGA 3ABSA 3QQ1A 4HA3A 4XAFA 1K8CA 5BXSA 3PZVA 4AYGA 4UTUA 2VHLA 3HF3A 4NRSA 1UUQA 5EYWA 3SGZA 2OCZA 2J4GA 2OJPA 3UYIA 1L6WA 2A7RA 3NFUA 3T6CA 4F66A 5D8WA 4Z0SA 1J79A 3I6TA 5F2IA 2CLPA 2HBVA 1X39A 1XPGA 4XKYB 1AMYA 1UBSA 4CNNA 4P8UA 3CUZA 4CNPA 4DN1A 3B40A 3P2VA 1AZ1A 3ARWA 4FK9A 4QBXA 4GIYA 2HVOA 5GJMA 3PULA 4DJFC 5HUOA 2PWHA 1MVYA 2PU0A 4GGBA 1I4NA 4HHLA 1FH9A 1QWGA 4MB4A 2OO0A 4FA3A 1J18A 4YMZA 3CZLA 4C90A 2V5CA 3ZT7A 1PZ2A 3TONA 4AZ6A 2GSJA 3MBFA 1DV7A 1E5NA 1G94A 3M0LA 4HSHA 1KW1A 4RE0A 4JEQA 2BY1A 1AH4A 4C5YA 4D6CA 2ZZ2A 4H8VA 2J7EA 2VENA 2Q6ZA 3LPPA 4TX8A 5C2XA 3BJFA 4L65A 3CMGA 3SCSA 5GNYA 2A3AA 5HULA 4GYKA 1DIDA 3AROA 2BGSA 2QT3A 4I5XA 1BPLB 1GQKA 1C8QA 3IJIA 4XVDA 1LORA 3NQ7A 2C79A 2W79A 5BOEA 4AZ5A 4TX6A 3WYZA 3MUXA 3QSRA 4ZTYA 3KOWA 3L68A 4XUYA 2NV1A 4US5A 4OBRA 4EXBA 4QNEA 2W3ZA 5LA1A 1HX0A 3E02A 4X2RA 1E0WA 1OT1A 2TRSA 2X0SA 3UU0A 1TVPA 2V5DA 2A2IA 4WY0F 2V3FA 3ARUA 4HCLA 1XLCA 2R1LA 3V35A 3ANVA 3UXDA 1B3VA 1LJYA 2DZPA 3N2TA 2DV0A 2QGHA 4C6JA 3OG2A 3CUXA 1QR7A 1VZWA 1Z6KA 3AIEA 4O0ZA 4IIFA 3M0XA 3U6WA 2DW7A 3C86A 3W38A 1PX3A 2J78A 4MMWA 1NTHA 4LEQA 4Q4KA 3WNKA 2GLKA 4AWSA 1JPMA 3WLKX 5F2LA 1FWBC 2X7WA 2QAPA 4QJ4B 3GQYA 4WGHA 1P0EA 4W7WA 1AW2A 1W56A 1O1ZA 1D8CA 3QH2A 7TIMA 4M6VA 3CZGA 3U8GA 4Z1CA 4IP5A 1MW1A 3WQCA 4Z2IA 2PTXA 1TA3A 3VMPA 3QYQA 1XDMA 1I45A 1Q7ZA 1EXPA 3TN6A 1XLLA 3BGJA 1L0PA 1E6QM 4J3VA 4Y2WA 5ECUA 3SCRA 1EGZA 4NJHA 1WKEA 1KR0A 1J01A 3TLQA 3DHPA 3T1GA 2XVLA 3B0XA 3VZYA 3H22A 1VEOA 3WLNA 1JDAA 1UH2A 4EAYA 1UKPA 4LB3A 4R7WA 2I9UA 4RNJA 2WSKA 5BROA 5CGMA 2DEPA 3CZJA 2XHYA 4AVNA 4DHGA 4B9ZA 1Y7VA 4QCEA 5DMYA 4ZE4A 2R14A 4EP8C 1UD5A 4AIEA 4DX3A 3BJTA 4BR1A 2DW6A 5I5RA 2YW4A 1NOFA 3TTEA 3SADA 3LRMA 1K9DA 1EFZA 2W62A 1UR2A 1JEZA 1V0LA 5HMEA 5A6MA 1BXBA 2XVKA 5IBXC 3OIXA 4MTVA 2XGBA 2ZZ5A 3BURA 1A5SA 1ONWA 4O8RA 4HB7A 4P5UA 1K4HA 3A3WA 3WH7A 1E71M 4Q33A 4KCUA 4FIRA 4M56A 5TIMA 3MCNA 4ZZ9A 2EPHA 2PA6A 1TQJA 3CWNA 1R2SA 3L21A 1EC9A 3I65A 4M7TA 3LQLA 5KZDA 5G2HA 5A2AA 1MW0A 1JCJA 2A85A 3C0JA 2HE8A 1E4MM 3MCOA 1PCKA 4GH3A 5DEZA 3AHVA 4NL1A 1P6CA 3URQA 1RD5A 4R33A 4ZOCA 3D5HA 1DKWA 3KX6A 4ZQNA 2PWDA 1BYDA 3DHFA 3NZGA 2HPIA 2ZE0A 4W85A 1TPUA