2J6XA

The crystal structure of lactate oxidase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
370
Chain Sequence
DIEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTATE OXIDASE
publication title The 2.1 A Structure of Aerococcus Viridans L-Lactate Oxidase (Lox).
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 133
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.2: Transferred entry: 1.13.12.4.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j6xA00
3FA5A 1YDVA 2X16A 3SW6A 3HPXA 3L5LA 3SGUA 3CQ0A 4GXMA 3EWZA 3FYPA 3YPIA 2DZSA 2GQ8A 4FNQA 2C14A 4WQ6A 3VE9A 1A50A 2VFIA 3W9ZA 2QCCA 2VFHA 3EWYA 4Z1DA 3W87A 5SWUA 1Q3NA 2Y70A 2NLIA 1TTJA 2ISVA 2Q3OA 2GJLA 3MO7A 3UWZA 1KTBA 3HG4A 1N7KA 1O95A 4XBKA 1SO4A 1QPNA 1UCWA 4Y96A 3HG2A 1BEUA 1RZMA 3PB0A 4M5PA 3LXBA 2TPSA 1L6WA 4KFPA 3L2IA 4ZQRA 4ZQPA 1GPWA 1AMKA 4LVGA 1N55A 1TB3A 1TPFA 7TIMA 5KZEA 3F1QA 2WO5A 3L9CA 3L67A 1GWJA 5CG7A 1JQXA 4PCFA 4LNYA 3S5OA 4WOZA 3LHTA 3N9RA 3HG5A 3WK2A 1YPIA 3LLFA 3R13A 1Q6QA 5CPMA 2PE4A 5G4WA 4JDYA 4RR4A 5KMYA 5LNSA 4JTUA 4O1CA 1GYLA 1EWEA 1B9BA 1OG0A 3PS7A 5DY3A 3NPWA 3TH6A 1OYCA 3Q2DA 4JTKA 3GB6A 1GTEA 1YTDA 4A21A 3CWOX 2B7NA 1OVDA 5KINA 2E77A 4MLRA 4BWLC 2V2HA 3QMTA 5AYXA 1W54A 1VCGA 3DHFA 2H8XA 4TR9A 3MHGA 1W3TA 1QMLA 3IGXA 2E09A 1KTNA 1PE1A 5CPLA 2V30A 3BLIA 2Q8LA 3NO5A 1ICQA 4LV9A 5D2YA 3GKFA 1V7YA 4ALDA 2CLFA 2NWSA 3BGGA 4B5NA 3BGJA 4R53A 3A5VA 1M7PA 3WJZA 2G5WA 4MYXA 3W7KA 1F73A 1LBLA 1UUOA 2DZWA 3QM3A 4TIMA 4XTIA 1H51A 5LHEA 4NU7A 3N19B 3B03A 1O5KA 3CEUA 4N2YA 4WY0B 5K4ZA 1U83A 1P5BA 4ZZ9A 3BW3A 3PR2A 1KM0A 3NEVA 2FB2A 4PL2A 3BG9A 3P8IA 5CKSA 3GX9A 3DGRA 4IJBA 3O6CA 4RV8A 5D09A 3Q58A 2RHGA 1XL9A 1LRNA 2H3DA 1MZHA 1XC4A 3TE9A 5K4XA 3TU9A 4JTTA 3E49A 4O52A 2JKEA 1GVFA 1FWTA 1ICPA 4WX2A 4LW7A 3DFNA 3EXRA 3OIXA 2C0AA 4UCGA 5IBXC 4O16A 4N9BA 1VGAA 4AF0B 3W7OA 1IXOA 1W1ZA 4IPIA 3W3OA 5D03A 3W72A 1WQ5A 3W85A 4M6PA 2O7SA 1MEWA 5C54A 2GJNA 3GR7A 1B4KA 3NPVA 2O7QA 3U2OA 3VCRA 3TUUA 1DJQA 1KM1A 4JX4A 1K7XA 3G1HA 1H7PA 1YLVA 5K9CA 2NXIA 1SFLA 3UWVA 1FY6A 2YCEA 1QR7A 1CW2A 2B7PA 4K37A 3TW6A 4EF8A 4MUZA 1SW3A 2V9DA 1G4EA 1W5MA 3C8FA 3LCXA 1OFAA 3UZJA 1TPWA 4BK9A 1LORA 3T78A 3GNDA 3GDRA 4HN4A 3DFOA 1PVNA 3MI2A 4FNSA 1GEQA 4WZHA 4WY0A 4JYEA 2CFFA 1SUXA 1X1OA 3LTYA 2YFNA 4HPJA 1JCMP 4S2CA 2Y62A 3P62A 3GYEA 4M7SA 3H55A 5AHLA 1KBJA 3W7RA 3HJZA 1G7UA 2ISSA 1QCWA 1QWGA 2C19A 1HUVA 5C55A 2V5LA 1PS9A 1W0MA 3TA6A 3NXFA 5CSSA 1VPXA 4NXKA 4NJGA 4UTWC 1BKSA 4MY1A 4H3DA 1XUUA 2Y63A 4JTJA 5AN7A 2FLIA 3QPZA 2CLOA 3TAOA 4NVTA 3NL2A 1GVRA 4IGHA 2H3BA 2RFGA 3G0SA 3HGRA 3PF3A 4TMBA 1O4UA 4PL1A 4AF0A 3NQAA 1GVSA 1Z42A 5D2XA 1H7XA 1ONRA 4RXGA 3NQEA 5LKYA 3TKFA 3M16A 5C6MA 4AB4A 2Y7GA 2YDAA 2A85A 3WK1A 3C3NA 5LZLA 3TSMA 3BK0A 4CNNA 1WV2A 3KVLA 1GVQA 3TJXA 3S1VA 2QJGA 3SY5A 3O15A 1WBHA 3DFTA 3H53A 4O10A 3CLMA 1XBVA 1FDYA 1HO4A 1P4CA 4ORMA 2Y61A 2V2CA 1RV8A 1D3GA 4QNEA 3ATZA 2G96A 5FF2A 4GFSA 4JY8A 1O60A 1PCWA 5EMUA 2CZ5A 2WOQA 1RQBA 4UMAA 1VC4A 5TQLA 1K8YA 3WJYA 3IGUA 1H61A 2DJLA 2E5DA 3C2OA 4ICNA 5AYYA 1HL2A 3G1XA 1XUZA 4LV4A 1DVJA 3NQ2A 3QQ1A 4BI6A 3O1NA 1ZFJA 3W84A 2A6LA 1NEYA 1F7BA 2B0MA 1XBZA 5IM51 1HFBA 4PH6A 4AEOA 4YCPA 1TQXA 3PB2A 1VH7A 1OYBA 2VOMA 1YADA 3M7WA 1TV7A 5D32A 3NQMA 4GE8A 4UR8A 2W79A 1WX0A 2BLEA 3R89A 4UFKA 4UNKA 4DO6A 4UTLA 4MZYA 1FQ0A 2R91A 4DBEA 1A5CA 2OT0A 5BW6A 1GOXA 1P0NA 1K03A 4MFEA 3GAYA 2ZYFA 3ZWSA 4XQ6A 3EX4A 2X1SA 3W7JA 1R46A 1SW7A 1JJKA 2H90A 3G1YA 3W1RA 2QAPA 4EWND 4EF9A 1H60A 1NF7A 1TCDA 1IXNA 2F7FA 2B7QA 1DBTA 3GR8A 5E93A 5K3VA 5AHFA 4DPPA 5CZTA 5D04C 1SO5A 1SZEA 2Y88A 5AHMA 2CZFA 4ZL1A 2ZA3A 2R14A 2P10A 3TQ0A 1FWSA 3W6YA 3ABOA 2YYTA 1BWLA 2OZ0A 3A24A 3VNDA 4C1KA 5HWJA 4BR1A 3UD6A 4O12A 3QMSA 1DKWA 3UNDA 3RK8A 1CX9A 1EB3A 3ABQA 2ZRYA 3DAQA 2RDTA 3AO0A 1NF0A 2CLHA 3DFPA 2ZZ4A 3EX2A 4HT3A 2QUVA 4DF0A 1QOQA 3ABRA 2A0NA 4JTLA 2ZDRA 4NQ1A 1OYAA 2VFFA 3G1VA 3M0ZA 3GIYA 3P5ZA 3FKKA 2X1TA 1ZY9A 3Q94A 3ZWTA 5I3IA 1WA3A 3TIMA 3W2MA 3GZ3A 2P0OA 3E0IA 4D2JA 3S5NA 5BRBA 2A5HA 5G2WA 4NJIA 4OHQA 2C15A 1LCOA 4UR7A 3T44A 5A8GA 5FF3A 3MHUA 1PHWA 1OJXA 4UTTC 3W7LA 4JD4A 4DO4A 2R94A 4O53A 3NOEA 1FWWA 2NUYA 5K9XA 2QAFA 4GBUA 3QYQA 3E02A 2V82A 2QUUA 5KZDA 2JKPA 3W22A 1SSGA 4XBSA 4R7JA 5F1VA 4CQ8A 4YLWA 2BWGA 2C13A 2LLEA 1C8VA 2ZZ6A 3IEBA 4IXHA 1A5SA 1TPH1 3PWAA 3VE7A 4HHPA 1DORA 3HPZA 2VEMA 1L6SA 3PVFA 2GUUA 2QEZA 3CPRA 2VFDA 4Q32A 3PSWA 3N34A 2ZRUA 4PEKA 3LX9A 1LRTA 1YTEA 4OV4A 4XKYB 5CZ0A 2WSRA 2EGZA 4AH7A 4LVDA 1EA0A 4JTHA 3RLUA 4K6AA 1VYSX 3PSVA 4JIQA 3LCGA 3FKRA 1A5BA 2V0TA 1YXCA 4JTSA 3NYZA 1W5QA 3C52A 3STEA 2ZRZA 1LOSA 1LLZA 4UC5A 1ZENA 3W1QA 4WJEA 4BFAA 3LRLA 1TIMA 4RK8A 3PG9A 3QRHA 3CC1A 4OV9A 2W0UA 1R2RA 4GUGA 1KV5A 3W7EA 2VC6A 4AHPA 5LSMA 1O5XA 3F03K 4AAJA 2YZRA 1N8FA 3PBUA 4ADTA 4KWWA 3A9IA 5I3JA 3DKLA 1DL3A 4JYDA 4NNAA 1EX5A 3C0JA 5F4WA 2X1UA 1FWRA 3O05A 3GKAA 3I7QA 3P74A 1TPEA 3UY7A 3M43A 2J9XA 1YTKA 2XN1A 1ZCOA 1LOQA 2QR6A 3FFSA 3C2EA 1FCBA 4ZMGA 1E51A 4ZVJA 3P67A 1DJNA 4IOTA 4LTSA 1KTCA 4IX0A 3LCFA 2ZZ2A 4Y8FA 1KLYA 3C2RA 4HSNA 3TNOA 4OGZA 1EWDA 4XKYA 4G1KA 5AOUA 4R33A 3OG3A 4MY9A 3W7CA 2B4GA 4UFLA 5BMXA 3WFAA 3UZ5A 2GVLA 3R12A 2EAWA 4KFOA 4N02A 4H4IA 1X7FA 3QZEA 3FJ6A 1JULA 1OFRA 2NZLA 2QCGA 3KRSA 4FNPA 3WK3A 2Y89A 3CT7A 3NQ8A 4O11A 5I3KA 1DV7A 1TREA 2HSAA 4GUHA 1Z44A 3KRZA 1I8JA 3W07A 2CZDA 1GVOA 1T99A 3DI1A 1UASA 3EWXA 3TW7A 1W3IA 3W75A 4KFNA 3BG5A 3MHFA 1S3HA 3MW7A 3LBCA 4FNRA 2E5BA 2W6RA 3LHWA 2J27A 1V5XA 2Z0IA 1J2WA 2ZTJA 5FI8A 4HPXA 3HMJG 3S0CA 1Z48A 1JCJA 5D30A 4FXRA 4UTJA 4DF2A 1AL8A 2QJHA 4IMDA 4OE7A 1OFOA 3KX6A 4ADUA 2X30A 1H1YA 4RXFA 1G4SA 1THFD 1UUMA 3W1NA 2PRMA 1JVNA 3W1TA 3MI3A 3LRMA 4PODA 3WK0A 1FCQA 1LBMA 2EF9A 2TYSA 1EP3A 2NUXA 3NA8A 1W31A 3L0NA 1ZJIA 4GC4A 3A22A 4O18A 3UXAA 5FEZA 2ZTKA 2QCLA 2GQAA 1X8FA 2RDWA 3M5VA 3QF0A 4BI7A 4XWUA 2R8WA 1XM3A 2C1HA 4GUIA 3MUXA 3BW2A 4DEFA 1VHCA 2Z2UA 4N9DA 4MLJA 1P0KA 1H7WA 1OFBA 3W1PA 1F6KA 1OK6A 3UWQA 2E68A 4AXKA 4MJMA 1GG0A 2FIQA 2VXNA 5KITA 2ATMA 1L2UA 1I45A 3KVJA 3P8JA 5KSWA 1KM5A 4GJ1A 3DHDA 3W1UA 4N9CA 3SJ3A 1UJPA 3A21A 2V81A 4OBTA 4JX5A 1VQTA 5LNUA 1RD5A 3FOKA 1ZNNA 3NQGA 1HG3A 2E6FA 3QW4B 4K36A 3VFLA 4P2VA 5HMSA 1Y0EA 3TXZA 4RLIA 3GDMA 6TIMA 1GJPA 1K8XA 1XI3A 2H8ZA 2XFWA 2AGKA 4A2RA 3GXTA 1VR6A 3EWBX 4N6FA 1JCXA 3HG3A 3THQA 3LCLA 4JDBA 2C16A 1YXYA 1AW2A 4IXXA 2BX7A 4QITA 4NJHA 3E96A 2A21A 1TV8A 1B4EA 3NQFA 3N2XA 1FCVA 1H7NA 1A53A 2VFGA 4DF1A 2FTPA 1TQJA 2YXGA 1DHPA 3STCA 3TSDA 3C2FA 3G1FA 1HTIA 1ICSA 1R2SA 2YX0A 4O4WA 2V2DA 3LCWA 4FXSA 3PULA 3F4WA 2OT1A 3DENA 1TV5A 1QO5A 3BLFA 3CIWA 3MI6A 1G67A 4NT0A 3KHJA 4O19A 3S42A 2ZZ7A 3QPYA 4TMCA 5AHNA 3DZ1A 1W3NA 4O50A 2JGYA 4DXVA 4XUGA 1SZGA 3LCHA 2WV8A 1H63A 2JKAA 3BV4A 5E0KA 3IIOA 4KWVA 4DBDA 3O16A 4GUFA 3EWWA 1OF8A 2ATSA 3CHVA 4O4VA 3W1MA 1JQVA 1G69A 4QM1A 2WNNA 1RVGA 3HOJA 1ML1A 4QISA 2DZTA 1LLWA 1C9DA 3LERA 4NNCA 1WOBA 1QNVA 5LNVA 3QC3A 1R47A 4CNPA 3MYPA 1L9WA 2DP3A 4N4PA 2NUWA 4Z1AA 1F6PA 1F5ZA 3GNNA 3W7PA 5EA9A 4KKXA 3C6CA 1KFKA 3B0VC 3G0UA 2NV1A 2QCHA 1FXQA 4A3UA 3CTLA 5KTLA 4DELA 1T8XA 3WJXA 1I2OA 3L66A 4NX5A 4EOUA 3M6YA 2ZQ0A 1JRCA 1BWKA 1GZGA 4ZQNA 3S1XA 3TC6A 3IVSA 4O1DA 2V5BA 4Z1CA 2AAMA 2QUTA 2DZVA 1TRIA 2CLIA 3CWNA 1PL9A 4I7VA 4CCEA 1QO2A 2DZPA 3NQ6A 2QCMA 3TFXA 3HIJA 3D0CA 1SZFA 4BWLA 1ME7A 3HO8A 4HNVA 1KFEA 3W2NA 2RDUA 3EKZA 1H7OA 3IIPA 1PIIA 2WQPA 4JTGA 2VEIA 3WJWA 1WOAA 1AG1O 5F2LA 3G0XA 3BPWA 5HNRA 4R34A 3NL3A 1TSIA 3EX3A 4HNUA 2BXVA 1OABA 1YXDA 4DO5A 4S1FA 3B4UA 3L5AA 3LRKA 5U7SA 2QDGA 3S8HA 2QKFA 4EVZA 5DY2A 1VLWA 3HBLA 4QNWA 1PCKA 1TYGA 4RZ6A 5EY5A 4O54A 5CZSA 1FXPA 5FF0A 3TFCA 2VENA 4I7WA 1ZAJA 3M5ZA 4K38A 4JXCA 3K30A 2Z6JA 5DXXA 1XCFA 3TQKA 3W7QA 4ZQOA 3W2LA 5CGQA 4NUWA 1SO3A 3TCEA 4XTDA 2GOUA 1G7VA 3E12A 3GDKA 3JRKA 3P61A 3B05A 2DZUA 1OHLA 3C61A 4JTEA 1ZAHA 1IXPA 5F2MA 2AQWA 1DOSA 3DXIA 4PA8A 4O57A 2DU2A 1SFJA 2QCEA 3M5YA 1YDOA 3L5MA 4IMCA 5T26A 5G1TA 3M41A 3W70A 3I68A 8TIMA 2QCNA 2D73A 3W7MA 3EKLA 4AHQA 5BMWA 3W1XA 1TTIA 3M44A 3P81A 1FUYA 4FIRA 1IIGA 2Y85A 4QSHA 1KV8A 5D05A 5AB3A 2E6YA 2GQ9A 3W76A 4X22A 3UPBA 4JX6A 1O94A 2G97A 3Q37A 3OHIA 3W83A 5HUPA 3T55A 3O06A 5U4NA 3NQVA 4RCXA 3DFQA 1NSJA 1TO3A 4LRTA 5D2VA 3RF9A 4LS2A 2FB3A 5BOOA 1JR1A 2J9YA 3QFEA 5CSRA 3T4CA 5HULA 4IMGA 2YFOA 2C6QA 4FIQA 3MJYA 3O63A 3TSBA 3I65A 4LU0A 1WBJA 3KOFA 2DZXA 2Y7FA 3KAOA 2QJIA 2TRSA 2Y7DA 3KXQA 3TC7A 3TDFA 4NJKA 3G24A 4LVAA 5G2HA 3G1SA 1FX6A 4LUJA 3P7YA 4UTWA 3PM6A 2VFEA 2I14A 4X2RA 1KM6A 4JYFA 3T7VA 3TROA 1FWNA 3LHYA 5E1QA 1FBAA 3ZS4A 4L4LA 1SO6A 3THAA 3L0GA 2A7NA 3NNTA 1EUAA 3PUEA 4EIVA 3L65A 1DQXA 4L4MA 5A5WA 3ZR4A 5BNKA 5F2GA 3FJLA 3UWUA 1VCVA 4UTIA 1K8ZA 4M6VA 5CPOA 5J5DA 1MO0A 4M7TA 3C4UA 3E9AA 3N73A 4Y9AA 4DPQA 1ADOA 1VHNA 2GVJA 1W37A 3O6YX 5AC8A 3DI0A 1EPXA 1OFQA 2H6RA 4RKAA 3T40A 1LM1A 1JRBA 4UMBA 1T0OA 1LZOA 4JGDA 1XDLA 2V8ZA 1L6YA 3P5YA 4HNNA 4WXYA 3SECA 1WDWA 1OF6A 3OEXA 2CLMA 3C2VA 3GDTA 3NZ1A 2YGYA 3QW3A 3IVUA 2C3ZA 4HKPA 3PUOA 1F05A 3KRUA 3S6DA 3RNDA 1C29A 3LM7A 2NX1A 2HTMA 3NGJA 1K3UA 1JUBA 1W8SA 3HGJA 1UBSA 3L68A 1YDNA 1EEPA 5HQEA 3TQVA 1KFJA 3LOTA 3B04A 1TPB1 3LCIA 2QCDB 4YWIA 1J5TA 1JCNA 2ZRVA 3UPWA 3UWWA 4GRSA 1G4TA 3BARA 1HO1A 2WSYA 4JIPA 6ALDA 3KVMA 1OFEA 4RZ4A 4UFJA 2FQIA 3I6RA 3HQ1A 3LDVA 4FNUA 1I4NA 1X6UA 3ABSA 2VKZG 4O13A 5G4EA 4CQ9A 4UTKA 3NZRA 3LLDA 2PCQA 3TXVA 4E2DA 4O8RA 3STFA 2ZZ3A 3OVQA 1I2NA 5EPDA 2J24A 5L9FA 3MMTA 2A7RA 3P82A 2Y6ZA 2I1OA 1OX6A 2PRLA 4NZFA 2NXHA 2KZHA 4Z0JA 4GWEA 5DBUA 1R30A 1Q6OA 4LRSA 3TJLA 4ZQCA 4Z0SA 1EIXA 2ZCGA 2VEKA 3RFAA 3LI1A 2ABAA 2EPHA 1JUKA 3QEZA 2DJXA 1W56A 4O0KA 5DCEA 1IGSA 1ME9A 3NPXA 1QFEA 3EX6A 3NQDA 4FO4A 3PG8A 3DU0A 4UFHA 4NNBA 1W5OA 5H91A 2WNQA 2VELA 2QCDA 2F84A 3QMRA 5EL1A 1RQEA 5TIMA 4HSOA 3SZ8A 4LOCA 5C5YA 2HS8A 1SW0A 3LHZA 1XXXA 3W7GA 1D9EA 3N9SA 5DLCA 5LHFA 4TX9A 5EBUA 1LDCA 3F4NA 2A6NA 1XKYA 1RQHA 4K39A 5GVJA 3TAKA 3LXAA 1GYNA 2E1DA 1GT8A 4LS0A 4A2SA 1FDJA 4HNTA 3FS2A 1K02A 1WYIA 1JCLA 4LT9A 2OX1A 1OX4B 4UFIA 4K7YA 3NL6A 3MWAA 5D38A 2CLLA 3A5FA 2JBMA 3MYOA 2E5CA 2ZA2A 1KFLA 4X9SA 5DXYA 5AC6A 1NAL1 4E2BA 4UTTA 1PV8A 3LGEA 2OMAA 2C18A 3LTPA 3IIZA 3CEPA 1M6JA 3NPUA 4Q33A 4UTMA 1TMHA 1F76A 1TRDA 5EKYA 1I2RA 2J88A 3BVJA 4LVFA 2OJPA 5LNWA 1ZHAA 3STGA 5CZJA 5F1UA 2J6XA 4RZ5A 4MFDA 1CI1A 4NXSA 4NJJA 3SIZA 1VZWA 3RMJA 5K2ZA 1T96A 2A4AA 4OU1A 4NZJA 3SGZA 4CNOA 4CLMA 1F74A 3G18A 1AL7A 4WY0F 1Q45A 5DELA 2G95A 3W2UA 1JUEA 3G3DA 1LTDA 1SU5A 3HGOA 3W71A 5HWMA 1IXQA 2VEPA 5HUOA 2CZEA 3G1DA 3W1AA 3DKJA 1SQ7A 2GPTA 1KW1A 1X1ZA 4IWWA 3AJXA 1B3OA 3PAJA 1OX4A 3W7IA 1LYXA 2ABBA 3ZFHA 3LV5A 4CCDA 3W74A 4LY8A 3M47A 4PC8A 2ZBTA 1XDMA 3LB0A 1KFBA 3W2KA 1H1ZA 5FESA 3NDOA 5HR6A 1GG1A 1AW1A 3EWUA 3H54A 4JTFA 4JS3A 3M9YA 4BI5A 3PBWA 2CWNA 3SR7A 4MYAA 5FEWA 1QPQA 4Y90A 4FX7A 2B7OA 2NX3A 1LP6A 1P1XA 3LXCA 4U28A 4MZ1A 5FF4A 2PURA 4UFMA 4X3ZA 4ADSA 4XZ9A 2A7PA 3OVRA 1PHQA 5HWNA 1G4PA 5FF7A 3FIGA 2NX9A 3G1AA 1SSDA 1TTQA 5F4XA 4WXZA 3CM4A 1J4EA 4O1AA 2QF7A 2BTMA 4YXGA 1ZALA 5AFDA 4JEQA 3QH2A 3TV8A 5K7JA 4UIOA 3V1PA 3O6DA 4FB7A 1JCYA 4JY9A 1KM4A 1R2TA 4IMEA 4JICA 2X1RA 4IPJA 4MPQA 2FDSA 3GLCA 1OX5A 4POCA 3V75A 3LBMA 3B0UX 1KFCA 4MZ8A 3W88A 3S5ZA 1S5VA 3DFSA 5G1YA 5C2XA 1VJIA 4ML9A 2OCZA 2A2IA 2X2GA 3R8RA 3BG3A 5FEPA 3QJAA 3UY8A 5HR7A 2P1FA 1VCFA 1Q6RA 2YSWA 1S5TA 3JS3A 1H5YA 2XN0A 3PC0A 5KZMA 3W73A 1QPRA 3GK0A 4IMFA 3MBFA 1ZAIA 4AWTA 4QIUA 3W7DA 1VRDA 2CLEA 2DORA 1NVMA 3IRDA 1SPQA 3BO9A 1LOLA 4ORIA 1Q6LA 3TMLA 4FF7A 1BTMA 3MP5A 5D33A 5J5RA 2ZRXA 3U6WA 4Y6GA 3B8DA 3W7HA 5D2TA 1W5NA 2BZNA 1LROA 3EB2A 3A23A 4UTHA 3CIXA 1OK4A 5K9DA 4FX8A 4NX0A 1LRQA 3IIXA 3W2JA 2FFCA 4K8HA 4O0ZA 1K7FA 2ALDA 4CQAA 4AVFA 1EP1A 3N2MA 1VLIA 1OFDA 5TBOA 2RH9A 4UXDA 1QOPA 3NQ7A 3FLUA 2HS6A 1TTPA 4JN6A 3ELFA 3S1WA 5HINA 1U5JA 3O8AA 3G8RA 2E6AA 4O28A 1NFBA 4E38A 2WSQA 3UWYA 1DQWA 3GXNA 1G6CA 3L0KA 3INPA 4A29A 1YPFA 5DBTA 4JTIA 4QQ3A 1FDZA 5D2WA 1IIHA 1MEIA 2PRHA 3GVGA 4LC8A 4AWUA 4Q4KA 5LNRA 3TMQA 2HMCA 2NWRA 4MIMA 5F4SA 3W7NA 2CU0A 3OBKA 4TO8A 1D3HA 4AWSA 3GAKA 1WAUA 5AHIA 4QAIA 4OQVA 3IIVA 4Z1BA 1KA9F 2TSYA 3R2GA 3C56A 4O14A 4J9JA 3EX1A 5D02A 4N6EA 5I3GA 3PBYA 1TJRA 2JGQA 3NAVA 3W86A 1K7EA 2ISWA 4S2BA 2RKXA 5IBXA 5HJLA 1IF2A 1XBXA 1SZNA 4W9TA 1A5AA 1FCUA 2TMDA 2NV2A 3HPSA 1QPOA 3NR0A 1YYAA 2YR1A 4K7VA 3TX9A 3S1UA 3KFTA 5I3FA 3B0PA 3EEGA 1XBYA 4OT7A 3IVTA 1ME8A 3LI0A 4MJZA 4GUJA 3I7SA 2XN2A 3ANYA 5AHEA 3MP3A 4ONVA 2Z6IA 2YW4A 5G2IA 1EUNA 1WXJA 3LTSA 4UUIA 5EYWA 3M5XA 2J9ZA 3IV3A 5DN1A 3USBA 3G8EA 1M5WA 4TU1A 3TR2A 3RLVA 4RX0A 3UQNA 3OVPA 4H6KA 1XFBA 1I2QA 4N9EA 1TPDA 1M7OA 3QSRA 2FJKA 3UXDA 4E0CA 4JR5A 3ATYA 4FNTA 3G3MA 4IQLA 1TPVA 2UV8G 3PBVA 2E6DA 3FYOA 3SSJA 3SFKA 3PY2A 4YCOA 3CB8A 1QAPA 1W5PA 4IX2A 3HF3A 3I7RA 5I3HA 1H50A 2ZZ1A 1GQNA 2QCFA 4LC6A 5F2IA 4A22A 3WJSA 1VS1A 1ALDA 3NVTA 3S9YA 3KVKA 4UTUA 3FEMA 3NQCA 4FHAA 4JNMA 4BF9A 3NL5A 4M6QA 1AW5A 3N14A 1KBIA 3MBDA 5AC7A 5LGZA 3JR2A 1LBFA 2FPTA 1MXSA 3SI9A 3O07A 3U8GA 3VI2A 2FPYA 3HB9A 4MY8A 3B06A 3QQ0A 4WD0A 5MHBA 3G22A 3EXSA 3PUDA 1S5WA 4FEZA 3CU2A 4LVBA 3BLEA 2WKJA 3DH7A 5ABTA 1B57A 3W23A 3DBPA 3NM3A 1VYPX 4HIBA 4CCCA 2ZFAA 3LHVA 2WPBA 4I7UA 4MKNA 2ZZ5A 1Z41A 5CPNA 3W1LA 1MEHA 3HGSA 2WJZA 5L6UA 2WNZA 1SR9A 4UNLA 4QJ1A 5D37A 3LV6A 1RPXA 3GDLA 4IUOA 4Z08A 4WOQA 4AMAA 4N4QA 4YL2A 1KM3A 3BW4A 4YMZA 2QDHA 4O1BA 2YW3A 3LHUA 4O17A 1TPUA 3QSTA 4MVAA 2IQTA 5DCDA 2ZA1A 1VYRA 3OA3A 3P80A 4LS1A 1I2PA 4GNJA 1KM2A 2CLKA 4PTNA 3R5EA 5G5IA 1QDSA 1TJPA 3VKJA 4O15A 3MP4A 1KLZA 2A1YA 2BSLA 5H2ZA 5LGXA 3P84A 1UB3A 2GVGA 2YPIA 4LWWA 2EHHA 4FX6M 3N3MA 2Q3RA 2CW6A 1AK5A 4K8EA 4AHOA 3P60A 3S5YA 4I9AA 4P61A 4LUIA 4WUIA 2Y7EA 4OWGA 2ZRWA 3NG3A 3GXPA 3NM1A 3UYCA 4PFMA 1RR2A 1EP2A 1H62A 4RJEA 5FEXA 2EKCA 2YYUA 3RU6A 4DQWA 1OFPA 4ZQMA 2JK2A 1H7RA 3IGSA 5DCBA 2Z1BA 4MOZA 4M19A 5AYZA 3EXTA 3L21A 2Q8ZA 4C1LA 1MSSA 2PC4A 4U4MA 1F2JA 1TPC1 1GTHA 4UMCA 3TK7A 2NXGA 2I9EA 2FPVA 3M1ZA
chains in the Genus database with same CATH superfamily
3FA5A 1YDVA 1DTNA 2AQOA 3II1A 3EWZA 1Q7ZA 3VGHA 3W4RA 3WMSA 4KH2A 4ZEPA 1HF6A 3VE9A 2XYLA 1EO7A 3EPOA 2QCCA 4S3GA 4Z1DA 3EWYA 2GFTA 2DSVA 4Y9OA 3T9PA 2NLIA 4HJWA 4A8NA 2GJLA 1DP0A 1RJRA 3MO7A 3F4VA 1UCWA 4Y96A 2Q09A 1O7AA 3HG2A 5LIWX 2GJXA 2XDFA 1N55A 2PGWA 3L67A 4LNYA 2XVLA 1EDTA 1XWYA 3N4AA 4J27A 1KXVA 2OSXA 3J7HA 6ENLA 3IJ8A 5DEZA 2PB1A 4J1OA 5G4WA 9XIMA 5LNSA 4JTUA 3OHMB 4AD0A 1GYLA 4JFWA 1J9YA 3GB6A 1GTEA 1UROA 4JFVA 1FHVA 2XIBA 5KINA 1ADDA 4MLRA 3W25A 1W54A 2H8XA 3L4XA 2OX4A 2WVTA 1MXDA 1W3TA 1GQKA 3GTIA 1PE1A 3T8QA 2V30A 5E6ZA 3MTWA 1E4IA 2WMGA 3ZZ1A 3NO5A 3GKFA 3NO3A 3T2QA 1EGZA 1W9VA 2YXOA 1I60A 3CYJA 3BGJA 4CNSA 4R53A 3N17A 3WJZA 5PTDA 5DRCA 3PP7A 3B97A 3CAWA 4HB7A 1LBLA 4XTIA 5BXRA 5LHEA 3N19B 3CGTA 3B03A 1PYFA 4JL2A 4ZZ9A 3NEVA 2FB2A 4PL2A 3DGRA 3WLTA 4AWEA 4WGHA 5JU6A 2BMBA 3B8WA 3PPHA 1XL9A 3OBEA 1E0XA 4LUSB 5K4XA 3TU9A 2J75A 3E49A 3SY1A 4ASTA 4I5UA 5C70A 2JKEA 3MVTA 2WKGA 3N29A 1RJPA 3EXRA 3G2GA 1L8NA 4O16A 3WMBA 4LCRA 4ZCWA 5D03A 2BGQA 2WCSA 3GQYA 1WQ5A 3LN3A 3W85A 4M6PA 3CV2A 2VP8A 1ZBVA 2QV5A 2XGBA 1ISYA 3G1HA 1H7PA 3U2CA 5K9CA 2BP1A 2J79A 4Q4SA 2YCEA 4MTVA 1QR7A 2BASA 3IWPA 3WF3A 2B7PA 5DT5A 1S5MA 4TX6A 1CECA 1BAGA 3EDEA 1G4EA 1XLLA 4HTYA 4BK9A 3T78A 3WKZA 3AJ7A 4Q4OA 1ESWA 4FNSA 4CU7A 4PMRA 3LTYA 2YFNA 4HPJA 1JCMP 1IT7A 3GHSA 3TVAA 5GNXA 2VDIA 3W7RA 1QWGA 5H8MA 2AL1A 4IMAA 1RCXB 3FAXA 2W92A 4F9DA 4LUSA 5CSSA 1BKSA 1E0TA 3WQEA 4YNGA 1JYNA 1DE6A 2WW5A 1K6WA 3WO8A 1DHKA 3VDCA 4NVTA 4GXPA 3NL2A 4L6DA 3WLRA 3SCQA 2D2GA 2H3BA 2O0TA 4AEEA 4C6QA 4GIYA 3A13A 3NQAA 1QU4A 1Q6DA 1K4HA 1PX3A 1XISA 4P8WA 2YDAA 5LZLA 3VO0A 2WMKA 4DYJA 1WV2A 1P6WA 3TYZA 3S1VA 3OGSA 2QJGA 3O15A 5JBEA 2J62A 4EE9A 1E1FA 1P4CA 4ORMA 2V2CA 3UR5A 3SRHA 1F61A 3B8SA 4EP8C 1EF2A 4US5D 4GFSA 3EOOA 1O60A 4TV6A 1IWBA 5EMUA 1OIMA 1UZ4A 2PDMA 2WOQA 3MDWA 4QHRA 1CXHA 3NZPA 4B3LA 3MB9A 2X42A 2OWXA 3ITYA 3WJYA 3UCCA 3EPNA 2OWWA 4GYJA 1XUZA 3S2JA 4LV4A 3E5PA 1R7AA 3W0KA 3NQ2A 1ZFJA 5IHSA 2O9RA 1Q66A 3W84A 2PS2A 3V7PA 3WZ0E 3IV8A 1JL8A 3FCPA 1OYBA 3K1DA 3M7WA 1TV7A 3NQMA 4UR8A 2BLEA 4MZYA 3PZGA 1A5CA 2OT0A 5BW6A 1GOXA 1P0NA 1RAKA 4K1WA 4MFEA 2ZYFA 4XQ6A 2VVSA 1JJKA 3W1RA 3G1YA 3FN9A 4AIBA 4D6GA 4ATDA 4U2ZA 1SJBA 4PULA 2F7FA 3GR8A 5E93A 1M9HA 4NAFB 2WK2A 2YA1A 4S3CA 1L6GA 3FHQA 1A5KC 2PWHA 3OLGA 2ZA3A 1YNYA 2R14A 4AZCB 3ARVA 2YCKX 1NIUA 3TQ0A 1E0WA 3ABOA 1BWLA 3HV8A 3A24A 4Q8VA 4AFYA 3SN1A 3VD5A 2PWGA 4O12A 4LX4A 4FPSA 3QTGA 2PD5A 3T8LA 3ABQA 4OBSA 2RDTA 3A3HA 2ZUVA 3AO0A 2ZZ4A 4XB3A 5FL1A 4GIEA 2YB4A 1QOXA 1TV4A 2A0NA 2HK1A 4BEUA 1HKVA 4YWSA 3ZJ8A 3DESA 2XIMA 1BLIA 1NTHA 1ZY9A 3ARZA 2VDHA 1J6OA 5I3IA 2OOFA 2EQDA 5F7UA 1DXIA 4P7NA 2GDQA 2R82A 2E67A 2GVYA 1XD1A 3BAKA 1MUMA 1NDVA 4H6RA 3ITLA 4JKKA 5A8GA 3MHUA 5BRQA 1OJXA 3W7LA 1F3XA 2POZA 3NOEA 1FWWA 2FHBA 1XD0A 1X1NA 5K9XA 1XC6A 3QYQA 2PDLA 4NAFA 4JFSA 2JKPA 3W22A 3SRFA 1SSGA 5JUVA 4YLWA 2C13A 3CZ8A 4AZCA 1A5SA 3VE7A 3OU8A 3PVFA 4M24A 1EHNA 1GW9A 3SY8A 2VFDA 1QATA 3PSWA 3N34A 1E4MM 3VOHA 2PBOA 1LRTA 4Q4MA 4XKYB 2VR5A 2EGZA 4W85A 4C6BA 1EA0A 4DUWA 4K6AA 4YU1A 1OBAA 2PWUA 1NWUA 3FKRA 2ACRA 3CPUA 1BVZA 1OGBA 1ZP3A 1ZENA 3ECQA 3RAOA 2DVTA 3LRLA 1X98A 1XP3A 3FY1A 3QRHA 1A47A 2HQAA 2XSAA 3B8TA 2W0UA 1Q4NX 4WF7A 3MUCA 3F03K 3FJNA 1U5VA 2DV0A 4AAJA 2YZRA 1N8FA 4E4FA 3PBUA 4D6FA 3CHFA 1YRRA 2VZUA 1FWRA 3ZIZA 1TWDA 3NSNA 2VURA 1GJUA 1R9ZA 1A5UA 1FCBA 3QY6A 1XKJA 3F5LA 4ZMGA 5A69A 4F4RA 4ZVJA 3P67A 1UR8A 2PFHA 5C8BB 1NP2A 1E43A 3H7UA 3WD0A 5I24A 1OM0A 3FVMA 2QDEA 1QI5A 3P3BA 2W4XA 4XKYA 5H8PA 4WKAA 1B90A 4UFLA 1JZ6A 3U2ZA 2FFIA 5BMXA 5AYIA 1UC4A 4GX9A 3WFAA 4PMVA 3R12A 4KFOA 1ONXA 2Y4SA 1X7FA 3VX1A 3GWQA 3QZEA 2VX7A 3FJ6A 1JULA 2NZLA 1XLHA 4MB4A 5DMMA 5I3KA 3ARUA 2ZUMA 1DV7A 1TKKA 4AXNA 3WLJA 2I5IA 3KRZA 4FOKA 4QE5A 3DI1A 5M3WA 2BS9A 3CAVA 4M1BA 1F8IA 1HN1A 3VOJA 1AH4A 2W61A 1R7OA 4WSHA 3MHFA 3SCSA 1UWAA 2CEQA 3GHUA 3OIHA 4ZFMA 4LGXA 4DLMA 5MF5A 1UP3A 2J27A 3N25A 4ZB0A 4P5UA 2ZTJA 5FI8A 5TF0A 4HPXA 3HTWA 2ZX9A 3DECA 3W38A 1AL8A 3UCDA 2XISA 1OFOA 3KX6A 3SDOA 4LBRA 4IIGA 1KKRA 3LD5A 1G4SA 1M01A 3WCZA 2D0FA 3PZMA 2WZTA 4C6CA 3MI3A 4PZVA 3WK0A 1K9FA 2NQHA 3SM0A 5J8LA 1ZB5A 2TYSA 2VCCA 5EU9A 3R1ZA 4H9YA 3L7RA 4GC4A 3UXAA 2ZTKA 5DT7A 2RDWA 2Z1SA 2J6VA 2IQDA 4BI7A 1OZMA 3ARPA 4JIRA 3MUXA 4N9DA 3OB8A 3EOUA 2DZAA 2NVAA 1F6KA 3JVAA 3UWQA 3VKKA 2E68A 4MJMA 4H2HA 3KBVA 4HHMA 4F0SA 2XH0A 3WQFA 1KM5A 3RPDA 1Q8AA 4NASA 1CXLA 1P1MA 3UZXA 3SJ3A 3A21A 3AWOA 2V81A 2ESCA 4JX5A 4EKJA 1KCKA 1HG3A 5HMSA 4RLIA 1KBLA 1GJPA 1VBGA 4A2RA 1L0PA 2J7HA 3WDQA 2PI6A 1JCXA 2E28A 3HG3A 4JDBA 4IFRA 5CXPA 2P8CA 1YXYA 2VC7A 4NJHA 3KUMA 4QEHA 4EPEC 1TV8A 3VOFA 3KS6A 1QI0A 1H7NA 3G6LA 2VFGA 4ZXOA 4W86A 3UERA 1DHPA 2J7CA 1WZAA 3G1FA 1HTIA 3HURA 2YX0A 4M82A 3K8LA 4JTCA 3CUZA 1P7TB 3P93A 3DENA 3CIWA 3B9DA 5CH9A 2ZXDA 5A6LA 2FH8A 3QPYA 4HYVA 3PTDA 3LCHA 4GQRA 1H63A 1WB0A 3BV4A 4HZ6A 2NLYA 3CAKA 4HK7A 1PIFA 1A49A 3EWWA 3QFWA 4QFUA 4O4VA 4DJEC 1JQVA 3L23A 4QM1A 1ML1A 2ASHA 2WJDA 5HBFA 1U5HA 4YTSA 4W84A 1DIKA 3CQJA 1XYMA 1R47A 3MYPA 4H04A 1L9WA 2DP3A 2YXXA 3WLSA 2QW5A 2DQWA 4Z1AA 3W7PA 4M51A 2IQ0A 3K4AA 4KKXA 4L80A 5BCAA 1KFKA 2NV1A 2OZTA 3CTLA 2V3GA 4KERA 1ELSA 3QGKC 3WJXA 1PAMA 4EACA 4NX5A 1PUDA 1P6CA 4NZ5A 2INFA 1UR4A 3S1XA 1V08A 3MUY1 5C9UA 3ISIX 2AAMA 4BF7A 2D3LA 4I7VA 3B8VA 3NQ6A 2QCMA 1P7TA 1ECEA 1ME7A 4QXIA 3AIEA 2VGIA 2Z1KA 3BWWA 2BHYA 2WQPA 1VF8A 3G0XA 3BPWA 4PCTA 3L2MA 3CIVA 3EX3A 1KR0A 1XICA 4PR4A 1OABA 1W9DM 2EPMX 3SRDA 2PLCA 3B4UA 3L5AA 3LLXA 1J79A 3GTFA 4QNWA 1WNOA 1TYGA 5EY5A 3SCTA 3VIPA 1FXPA 4GCXA 1IQ8A 3M0HA 5DXXA 4OTKA 3TQKA 4ZQOA 1BF6A 5IOBA 2IKGA 4JHOA 1BXCA 3CZGA 2AL2B 2FJUB 3B05A 2PUZA 1R3VA 1LL6A 1OHLA 3C61A 1ZAHA 3N18A 1VEMA 4DXKA 1VPYA 3DN5A 3UJ2A 3BGAA 2DU2A 2D1ZA 2I9UA 4R3UA 3H22A 2IPGA 3I68A 3HA1A 4YN5A 5I07A 3W1XA 3BCJA 3P81A 2F8QA 1FUYA 4QSHA 1KV8A 2OEMA 2VQUA 4LCSA 1FKWA 1R3SA 2UY4A 2DQXA 2E9LA 1KGXA 1TJ2A 3W83A 4IP4A 3VPLA 4Y7EA 2D20A 3T55A 3AMDA 4PMNA 5U4NA 3W81A 1NSJA 3RF9A 5BOOA 1TG7A 4IMGA 2PD9A 2IMRA 2VUNA 2C6QA 4FIQA 1PTGA 4C6PA 1TV2A 3S4TA 5ABGA 4F40A 3M0JA 2AL2A 1AZ1A 1XF0A 3WLOA 4A05A 2E8ZA 3G1SA 1HGYA 1V3LA 1GVEA 4KMQA 1R5YA 1K9DA 4U5KA 1MXGA 1KM6A 3T7VA 3TROA 1KRAC 4B5TA 2OQLA 5FACA 1GORA 2XM2A 1HKMA 3ORWA 3PWIA 5A5WA 3ZR4A 3FJLA 3UWUA 2HNEA 1VCVA 3VTRA 2KX9A 3BXWA 4UTIA 3E6EA 3TN5A 1K8ZA 1V3MA 5CPOA 4JHMA 3MC5A 1Z8AA 4M7TA 3PZ9A 1A0CA 3DI0A 3R0UA 1OFQA 1JNDA 1UG6A 3DYMA 3MANA 5DX7A 1B5TA 1L6FA 4HD5A 3M4HA 2VT0A 3CO4A 4WXYA 3SECA 3GG0A 1OF6A 1FP9A 3NZ1A 3SEPA 2OFJA 5HATA 3W02A 1C29A 1IEWA 1EJVC 1K3UA 1JUBA 2HDJA 5HQEA 5AYBA 1B30A 1JCNA 4Q4QA 1G4TA 1JI2A 5E09A 2DDXA 3WNKA 2XG9A 4LANA 1S2WA 2FQIA 1QWKA 3LDVA 3F2BA 3H26A 1X6UA 1HNYA 3ABSA 4KEZA 2VKZG 1KGWA 1EDQA 2VX4A 1XLEA 3APGA 3LLDA 3M0YA 1HKJA 3WLIA 3A3XA 3BANA 4GIRA 4AMCA 4JOMA 5KZ6A 3TA9A 1HVXA 3STFA 3OVQA 4HYRA 3ZYZA 2A7RA 4WDWA 2Y6ZA 3VINA 2PDWA 2NXHA 4HCLA 3SJNA 2PTYA 2V3DA 1MUWA 1Q6OA 3FSUA 3S5SA 3CYVA 4RDYA 4O0KA 1ME9A 2FZMA 3NPXA 5HNTA 3WUGA 4WDUA 4ZBCA 3F4DA 4U2YA 3PG8A 2AQVA 4JCLA 4NNBA 1W5OA 3VYLA 3MMWA 4PRRA 2FDMA 3R11A 4W7WA 1K8CA 4GKLA 5DFAA 2J7EA 3UA3A 4TVDA 4DHGA 4HSOA 3ITCA 1E40A 1D9EA 3N9SA 5DLCA 5EBUA 1LDCA 2YBVA 3GTHA 1RQHA 5GVJA 1CGYA 3WQDA 4R27A 2QF8A 4O8AA 3BSHA 4LAKA 1K02A 2OX1A 4GIAA 3S9IA 1NP0A 4B3KA 5C0QA 3WBEA 1HL8A 5D8ZA 1V8EA 2Z25A 1QK0A 1F3TA 4X9SA 3R8HA 5AC6A 4E2BA 1PV8A 4QG9A 4PBGA 2BVTA 4PBEA 3LPPA 4H2CA 3IIZA 1M6JA 1Y5WA 4Q8WA 1UIOA 3RLHA 2BOGX 1R3QA 4LVFA 1ZHAA 4FOJA 4GYPC 2XZ9A 4MFDA 3GR4A 2ZC1A 2XZ7A 1H0GA 3OGVA 4NJJA 1XDJA 4JAWA 4PCPA 1VZWA 5K2ZA 3V0TA 2HISA 4NZJA 2HVNA 5E9XA 1UZ1A 2W67A 2PWEA 1F74A 4FLSA 1AL7A 2E9MA 3NCOA 4DZAA 3PPFA 1WDDA 1UUQA 3RUBL 4J3UA 1C8XA 1SU5A 3E5BA 4G8TA 2ACSA 2XIJA 1IXQA 2Q8XA 2VEPA 1PDYA 3GXFA 1HJQA 2GPTA 1UH2A 3E0VA 1B3OA 3PAJA 3W7IA 3R58A 2X1IA 1TWIA 1JPHA 3ARSA 2ZBTA 3BSMA 3LB0A 2UY2A 1G0CA 1H1ZA 3NDOA 3A4WA 1GG1A 3RM4A 3H54A 3M9YA 3OTRA 2CWNA 4I90A 4ZOBA 2GOKA 4MYAA 5FEWA 2B7OA 1C91A 2XSXA 3W24A 4U28A 1G5AA 5BROA 3WG6A 1N8WA 4UFMA 4X3ZA 1OD8A 3EGJA 5CBJA 2UZ9A 4IH3A 3FIGA 5AVHA 1PDZA 4V15A 5T9BG 3HPFA 4NG3A 2DSUA 3DBNA 1AFSA 1PZ0A 5AFDA 4JEQA 2BB0A 1ZP4A 4UIOA 1JCYA 4JY9A 3GFYA 4MPQA 1MQQA 1DWJM 3V75A 4POCA 4UOZA 3B0UX 2X0SA 1RCOB 3WFZA 2G4JA 4LYQA 1VJIA 2A2IA 1Q6EA 4KCVA 5G1MA 3WNMA 3ZVHA 1EYWA 3QV6A 4XBJA 1VCFA 1Q6RA 3RIKA 2YSWA 3MWCA 2HE8A 3DGBA 1V0KA 1RY8A 1ZSXA 3F2CA 3TONA 1DWHM 1H5YA 2XN0A 2VZOA 1J0HA 3PC0A 3LNMA 2YL9A 1ZAIA 4AWTA 5XINA 3EDFA 5A6BA 4QIUA 5TD4A 3KZPA 3IRDA 1NVMA 3AS3A 3BO9A 5LA0A 1EC9A 1BTMA 2V69A 2ZRXA 5D2TA 2BZNA 1LROA 4UTHA 4GVIA 1UD6A 2PF0A 3WF1A 2V63A 3NO1A 2HBVA 2FFCA 2GZXA 2HRWA 3URAA 3TTSA 3VKAA 3SCWA 3IACA 1EP1A 1OADA 1D7FA 1TTPA 3ELFA 1UKTA 2YB1A 5I23A 1U5JA 2J7BA 3O8AA 3IUDA 3MVIA 2WSQA 3GXNA 1C7SA 4JTIA 2VI0A 2PF8A 1FDZA 1HZYA 5D2WA 5MKGB 3GVGA 4LC8A 5LNRA 1W9XA 3TMQA 2VUYA 3WDIA 1GKQA 1IR1A 3OLEA 2PP1A 3OBKA 2ZXBA 5AHIA 4QAIA 5A6KA 1BYBA 3UR2A 3ERPA 4I6KA 4LF2A 3VMPA 1UD8A 4N6EA 4XD4A 3XINA 2JGQA 3UG5A 3EAUA 1K1DA 4MF4A 3ZT6A 2QVNA 5A1AA 1A5AA 3NR0A 1YYAA 3B9EA 1XBYA 1BVWA 3LI0A 4GUJA 2QMKA 3I7SA 4BCEA 4IT1A 4ZOEA 1US3A 1E3ZA 1EUNA 5CJ5A 3VKBA 3LTSA 4UUIA 4HN8A 3AXHA 5JMUA 1MZRA 4TU1A 3TR2A 4G7EB 1XFBA 1I2QA 4N9EA 1TPDA 4J35A 1VFOA 3WELA 3TYDA 3QSRA 1TA3B 3UXDA 3ATYA 3OODA 1O1ZA 4FNTA 2E8YA 2GGIA 3G3MA 4E8DA 1RALA 3NGFA 4IQLA 4HGXA 2UV8G 1VB9A 1UJQA 2VWTA 2QGHA 3PY2A 4ZB2A 1MW2A 1QAPA 4IX2A 1X6LA 3I7RA 5MKGA 2WCGA 2DW6A 3WH6A 1H50A 2UBPC 2ZZ1A 1GQNA 6XIAA 1VBJA 4LC6A 4B9YA 1ALDA 4JQ2A 1XIGA 3ARYA 1JPKA 1WXYA 3T2OA 2FZDA 4UTUA 1XSKA 5CAKA 3NL5A 4DJEA 1AW5A 1KBIA 3KEHA 4EWJA 2X7WA 1PPIA 3U8GA 1PBGA 2CHNA 4WKHA 1BSIA 3B06A 3VC5A 3RX3A 3KP0A 4Q4RA 1EC8A 5BOFA 2PDUA 4B5WA 2XFYA 3BLEA 3DH7A 4EX4A 1GHRA 3QLLA 5ABTA 1B57A 2WHLA 3RM8A 1W1B1 4S3AA 1VYPX 4HIBA 1XYZA 2WPBA 4I7UA 4MKNA 5CPNA 1QI3A 1AZ2A 3OQEA 2A3CA 4G7EA 4CVUA 3S1GA 1JYXA 2NT1A 1U22A 4QJ1A 3V5CA 1TA3A 4WOQA 4AMAA 4YL2A 3BW4A 4YMZA 3DC8A 3QSTA 5DCDA 3OA3A 1VYRA 2XIIA 1GONA 5E70A 4PMDA 2CLKA 1KGUA 2DIEA 1MNZA 3VOGA 4ERGA 5HJXA 3UXKA 1KKOA 3PTKA 3L4WA 1KLZA 3P84A 2XGZA 2YPIA 5AVNA 4PB4A 1IR2A 2Q3RA 2CW6A 1AK5A 4L6OA 4PTVA 1VEPA 3QV7A 4XSMA 4H7ZA 1W1PA 4WUIA 2IXUA 2ZRWA 3DHUA 3NM1A 4PFMA 1V93A 1W91A 2J4GA 3AIWA 1NQKA 2EKCA 2HZGA 4DQWA 4S3DA 5AYZA 3L21A 2X40A 2Q8ZA 4RL3A 1TPC1 5I79A 1GTHA 5IHRA 2KAUC 3TK7A 3ONCA 2NXGA 4Y90A 3UNTA 3FW6A 3CQ0A 1IYXA 4GXMA 3PJTA 2J8TA 4GD0A 4WQ6A 3WL1A 4GFIA 2VFIA 3WDHA 5SWUA 2B81A 3CL7A 1ZTVA 2W63A 4RPPA 2ISVA 4QG6A 3A3WA 4N7QA 1J8VA 1GJWA 2YCJA 3HG4A 4YIWA 5CPTA 1O95A 3LGDA 5A6BD 3TOPA 1VFUA 3PB0A 1X38A 1W1YA 3LXBA 3TW9A 4MB5A 5JQ9A 2TPSA 3H4WA 4ZQPA 3NQBA 1AMKA 4LVGA 3VOCA 1JNEA 1TB3A 1TPFA 5A8PA 3KDOA 2DY3A 1OD0A 4MKSA 3SQLA 1FWEC 3W26A 1UD2A 1W32A 3FYYA 3LQGA 3USZA 1EL3A 3PUGA 1YPIA 4ICMA 1Q6QA 1V0MA 4UR9A 1VFFA 5CPMA 4AC1X 5KMYA 1OCNA 5DY3A 3C8NA 3TH6A 1OYCA 1TZ7A 4JTKA 1CBGA 1ZJHA 2FYMA 1QJWA 3UESA 1V6XA 1O68A 3WEMA 3NZGA 3AUJA 4PGLA 2Z24A 1TUXA 3O7UA 3QN3A 1VCGA 3DHFA 4TR9A 2AAAA 2VCAA 3L4YA 1Q63A 1Q6GA 2I16A 2V3EA 5HXMA 1DIOA 4FF5A 1ICQA 4LV9A 5HPOA 2VNCA 3ZSSA 2VZTA 4L7ZA 3OYZA 3DYPA 2CLFA 3BGGA 3VNIA 4DBWA 3A5VA 3L4UA 3ES8A 2G5WA 3GW3A 4D71A 4XZBA 4I8DA 3AIBA 3W7KA 3T07A 3EB4A 4UZUA 3BCFA 3FK4A 1TZZA 4J3VA 3AZRA 4CN1A 2PDIA 2WCAA 3AMLA 4UB9A 1XGDA 5K4ZA 1U83A 3PR2A 1KM0A 2WMJA 2FGBA 1CCWB 3LEPA 3O6CA 5D09A 3Q58A 2A79A 3TZFA 1O12A 2RHGA 1RLCL 4W7UA 2H3DA 4KRZA 3D47A 1W2PA 3ARXA 1IEXA 3LENA 3AXKA 2V6AA 1GVFA 4UOJA 3GG8A 3DFNA 4DZHA 3VGBA 4Q8PA 4D1IA 1UC5A 3HU7A 4UCGA 5IBXC 4CN6A 4N9BA 5DRIA 1A5LC 3VFCA 1HKWA 1Q6CA 4AIOA 2V38A 2O7SA 4HK5A 2YDSA 2GJNA 2XM1A 4B15A 1B4KA 3NPVA 4CN4A 3U2OA 4AYGA 3VCRA 1OGSA 1DJQA 1KM1A 4PCNA 3MU7A 2NXIA 5CZKA 4DJED 5AKQA 1FY6A 5FJIA 2QUMA 4PTXA 3V5FA 3B9AA 4HK6A 2YL5A 4MUZA 3TJ4A 5CAHA 3TTEA 4GH1A 4JTRA 3C8FA 3UZJA 5I3DA 2VCBA 2G0WA 3GNDA 3GDRA 3DFOA 1VFMA 4QDMA 1GEQA 4WZHA 1FWJC 2CFFA 2VDGA 1SUXA 1X1OA 4F0LA 3AYSA 2JIWA 3P62A 3H55A 1HJWA 3UR8A 1S38A 1KR1A 1G7UA 2C19A 1A4LA 1HUVA 1E9YB 2QHAA 3TA6A 4NXKA 1XYCA 3R0KA 4MY1A 1RXOB 3TJIA 3KL5A 2FLIA 4E5TA 2J77A 3IJ6A 2CLOA 3ALFA 2WC4A 2P8BA 1GVRA 4IGHA 3HGRA 1OWQA 4PL1A 3PFMA 2ZX6A 1Z42A 3KOWA 1H7XA 1OC7A 3GC4A 3VNZA 5LKYA 3TKFA 4HU4A 2HV5A 3D3AA 3AICA 5LYRA 2Y7GA 3TSMA 4G6CA 3KVLA 1YW1A 2E1WA 1O1HA 3SY5A 1X6NA 3AIVA 2HVMA 1WBHA 1K6AA 4OJYA 4H6QA 2DEPA 3GNXA 1CGVA 1XBVA 4R88A 3LPGA 4PRWA 1RV8A 3CQKA 1JZ4A 3ARTA 3RN6A 1QT1A 5CGMA 3ATZA 1HJXA 3LYEA 3PNZA 3UZYA 1B3WA 1DXFA 2P50A 4MSSA 4QLKA 2VHLA 1QNSA 3G77A 2J8GA 3M6DA 1H61A 2DJLA 5AYYA 1QXLA 1HL2A 2XIOA 1EFZA 1A3HA 1DVJA 4C6DA 3QQ1A 2ZIDA 3UJEA 4GYPA 1NEYA 1F7BA 2B0MA 5IM51 4PH6A 1TR1A 1CLKA 4Z2LA 1TQXA 1VH7A 4C6LA 3WF0A 1YADA 3IS4A 5EMLA 4GQBA 4DB7A 4GE8A 3FDGA 1WX0A 1H11A 3LPOA 2EJ1A 4AZBA 3K13A 4UTLA 3W27A 4AC7C 2R91A 2GSJA 2OZ3A 4F0MA 3PZNA 4KCUA 3GAYA 4MB1A 2QAPA 3N1AA 4EF9A 1NF7A 1P43A 1PIGA 1IXNA 2GSEA 2GGGA 3OA5A 3TN4A 1XIEA 4MJ2A 1T41A 3H23A 4PBFA 4QX4A 1MDLA 1TR9A 3GBEA 3MSYA 1XIJA 1SZEA 1XRVA 2Y88A 3BMWA 1QTWA 3TLLA 3MUAA 3D5HA 4RNIA 1FWSA 3W6YA 2YYTA 1BSLA 1XYFA 1Y8BA 2O9TA 3HJEA 1R38A 3VK5A 1UP0A 3UD6A 4BQ3A 2GJRA 3QMSA 1DKWA 2F9RA 4DLFA 3RK8A 3AWNA 1EB3A 1ZGDA 3POCA 1DJZA 3DAQA 7CGTA 3DFPA 1XLMA 4PMQA 4HT3A 3WQOA 2QUVA 3KTXA 1UWIA 3ABRA 4JTLA 2ZDRA 2OSWA 1OYAA 3M0ZA 2V68A 4MJ4A 3QVQA 2FZ9A 1XIMA 3GZ3A 4D2JA 3S5NA 2A5HA 2GDVA 4OHQA 4L1XA 2BG5A 4UR7A 2CHRA 2IW0A 4PEEA 1OCJA 4DO4A 2R1NA 4O53A 3XIMA 1XCWA 4GVGA 1WKDA 1ZS2A 3BJTA 1GOMA 4U3CA 2QUUA 3EWCA 1J0ZA 2FMOA 2WB5A 4R7JA 2BWGA 1A3XA 1DORA 4HHPA 1L6SA 2IKHA 2QEZA 5FJOA 1A3WA 2ZRUA 2QIWA 1SJDA 3ZR6A 2WAGA 4OV4A 3KE0A 4LVDA 4JTHA 3PSVA 2V0TA 3NYZA 1W5QA 3C52A 1X97A 4LNCA 2XINA 4CEUC 1D8WA 1MRAA 2ZRZA 3UWEA 3MUZ1 4UC5A 4HMEA 3AU2A 1JZ3A 1TIMA 4OBRA 4GLEA 1EZ2A 3RCMA 1BGGA 1R2RA 4GUGA 5LSMA 1LL4A 1O5XA 2PDQA 3B4YA 2PDKA 4L1GA 3H12A 1BG4A 4GX8A 4NRSA 3WSUA 2P3ZA 1XIBA 4JNZA 5I3JA 3O6AA 3DKLA 1DL3A 1Y7VA 4JYDA 4NIRA 2X1UA 3O05A 4W8LA 3SADA 1ZUAX 1TPEA 2GGEA 1HX0A 3R6IA 3STPA 4X61A 3GG1A 1V6UA 3FVDA 2XN1A 4J2PA 4HHHA 2QZRA 1W1IE 2YKKA 2SFPA 4TQTA 3TYCA 1E51A 2R24A 1DJNA 4LTSA 1YDYA 3CASA 1KTCA 2D0HA 3U48A 1KLYA 3C2RA 3PWGA 4OGZA 3UCQA 8RUCA 2CLPA 2F6XA 2WSKA 4AD2A 4G1KA 4A3QA 3EA2A 3OG3A 2B4GA 2OELA 1X8CA 4IFKB 4K1GA 2GVLA 4DZ5A 4N02A 4LH8A 2HNHA 3V18A 2ZUNA 3NXLA 4FNPA 3WK3A 4Q7BA 1W3HA 3JZEA 3L4TA 6PTDA 4UQDA 1I8JA 4HU8A 1T99A 1UASA 2O56A 3R79A 1W3IA 1W2VA 1KXQA 3IPWA 1S3HA 3MW7A 4FNRA 2YA2A 2E5BA 1OT1A 3LHWA 1V5XA 4LEFA 4U33A 1XH1A 1V51A 3HMJG 2EJAA 2PZNA 4CVWA 2D2OA 1UKOA 1IWPA 3GHRA 3CLWA 1FWCC 4DF2A 3N6HA 1Q6FA 4MNLA 5HAOA 1RBLA 2ZWYA 4ADUA 1GOIA 3CZKA 2PDPA 1THFD 1UUMA 4DO7A 4A8IA 4M6UA 4Q6JA 2I7GA 4AEFA 5A6SA 1Z6KA 3KRBA 3W1TA 1KCLA 3H21A 4PODA 1FRBA 4ZO9A 4IFKA 4J3ZA 3NA8A 1ECQA 1ZJIA 2RUSA 3WH8A 2P88A 2GQAA 3M5VA 1H5VA 4XWUA 1J0KA 1NJJA 1FHUA 2QT3A 4NKCA 4GUIA 4DEFA 1VHCA 4I8YA 1OFBA 3W1PA 3MPGA 2IKIA 4IP7A 2VXNA 1L2UA 1I45A 3P8JA 4C6JA 4IGSA 4E8GA 3W1UA 3H4GA 4N9CA 6CGTA 3EMQA 3SUSA 3P6LA 1X96A 3ES7A 1VQTA 3KW3A 2BBFA 2AOSA 5LNUA 3FOKA 1ZNNA 2EBNA 4K36A 3VFLA 1HKIA 4W8AA 3T2PA 3TXZA 4AX7A 3PAOA 1K8XA 5I6SA 1XI3A 2AGKA 1CNVA 1VR6A 3EWBX 3NSXA 4L9ZA 1AW2A 1H49A 4IXXA 3M07A 2XWDA 2RDXA 3EZ4A 5A2AA 1ZJBA 2J13A 3SQSA 4W88A 2XPKA 1HQTA 1FCVA 1FH8A 1A53A 1IEVA 4L61A 4XVDA 1TQJA 1NOUA 2CNCA 4LAUA 3GRIA 3BJSA 2WKLA 4O4WA 2Q02A 4E6MA 4Q8UA 3WUFA 3LCWA 1GOWA 2XVKA 4GNVA 1KBKA 4Z17A 1QW9A 1QO5A 3N6QA 2PCEA 4Q3MA 1KWGA 2XFFA 4O19A 3S42A 4RW3A 3DZ1A 2JGYA 2CCRA 2WV8A 2JKAA 2DIJA 5E0KA 4B5SA 3IIOA 1E73M 2C1GA 4F0KA 1VD6A 1DXEA 3W1MA 5C9XA 1C9DA 3E2QA 3LERA 1VFTA 1EZWA 1AQ0A 1OCQA 3IK2A 4DJFC 1CENA 1F5ZA 3VD9A 4XAFA 1CXEA 3G0UA 4QJ4B 1NH6A 1XLJA 5KTLA 2PTXA 1T8XA 2G3MA 5LIKX 3M0IA 2A3BA 4EOUA 4R85A 1BWKA 1GQJA 2QJJA 3H2OA 2YDRA 1GZGA 3IVSA 1PX8A 2VJXA 2YCIX 4LCQA 1W9BM 2V5BA 4Z1CA 2QUTA 2DZVA 2CLIA 1PL9A 4B5XA 1QO2A 1VFLA 4NRRA 3TFXA 3HIJA 2GQ3A 2Z1WA 4GG9A 1H2JA 1C3FA 4HNVA 1KFEA 3W2NA 1H7OA 1WDQA 4JTGA 3WJWA 4LUTB 1FHDA 1CXIA 5C9RA 5HNRA 1J96A 4R34A 4P7LA 3NL3A 4KS0A 4IGMA 1EF3A 1BG9A 3EOSA 1OB0A 5GNYA 4HNUA 2BXVA 1YXDA 4HNLA 4S1FA 1XR2A 3UYIA 1KNWA 1DPMA 3SO7A 3S8HA 2QKFA 4EVZA 5DY2A 1PCKA 1A5MC 4RZ6A 1VFHA 4O54A 3KBJA 3TFCA 2HJPA 2VENA 1H3GA 4JXCA 4YTTA 3K30A 1M41A 4RV3A 2ZUTA 5T91A 1T5AA 2PWVA 3VM7A 1R87A 3W2LA 1SO3A 1P6BA 4FA3A 1G7VA 4IQJA 3GDKA 4W8BA 2DZUA 2VEGA 1RCQA 4F2TA 4JTEA 1ISZA 2Y5SA 3BZJA 2OQYA 1IXPA 3POHA 3GXDA 3BMXA 4GI9A 1GNXA 2XVGA 2QCEA 4QDWA 3DEQA 3L5MA 4OVXA 3IJIA 3W70A 1FFQA 2ZX5A 4J3WA 3URBA 1EJUC 8TIMA 3W7MA 1D2KA 4HHLA 4AZ6A 1EQPA 5EMMA 4LUTA 4FIRA 1IIGA 5D05A 3QR1A 2E6YA 3GH7A 2GQ9A 1FFRA 3AHZA 4B91A 1ODZA 2CITA 3UPBA 4Y2WA 3RDKA 1GPFA 5HUPA 4Z2GA 1WKFA 3O06A 1KO0A 4PUDA 3NQVA 3CS2A 3DFQA 1TO3A 4RCXA 4LRTA 5D2VA 3A47A 1NFPA 2J9YA 3WQ5A 3QFEA 5CSRA 2HROA 5HULA 1BYDA 1M3UA 4LF1A 4B2DD 2YFOA 2DSWA 3MJYA 3TSBA 3I65A 1EYEA 1MW3A 1WBJA 2DZXA 2WWCA 3KAOA 5HANA 2QJIA 1HIZA 3ZT5A 4Z2HA 2Y7DA 3TC7A 4LVAA 5G2HA 1FX6A 4B3ZA 4LUJA 2R9RA 3P7YA 1ZRQA 4HZ8A 2VFEA 2WQDA 1FWNA 3LHYA 2G3NA 4JFTA 1E0UA 3GDBA 5IXEA 4L4LA 1SO6A 3C0SA 4XAPA 3L0GA 2I5GA 3CZJA 3PUEA 4JNYA 3VMOA 3T6CA 1EJWC 4QROA 3L65A 1DQXA 5BNKA 4QRNA 2PWFA 2EXOA 1MDRA 4PMUA 4OUIA 4JIHA 1MO0A 4KGLA 3R0DA 3RCNA 2PDCA 3N73A 4Y9AA 1ADOA 3CPGA 1TWSA 1M03A 2NSXA 2H6RA 4RKAA 3T40A 4UMBA 3WF2A 1T0OA 1LZOA 3U7VA 1XDLA 2OODA 1L6YA 3QY8A 4HNNA 1MW1A 2QLYA 3BOLA 4TXEA 4LEQA 1NM9A 3GDTA 3QW3A 1UPMB 3RNDA 3LM7A 1BWVA 3HGJA 1UBSA 1YDNA 1TPB1 3K4WA 3LCIA 2QCDB 1AJ0A 3UVIA 2Y8UA 2ZRVA 3UWWA 3BLLA 5HQLA 2WSYA 4JIPA 2DT1A 4H8UA 1MMFA 3BL3A 2ZWZA 2OSYA 4RZ4A 4IL2A 4UFJA 3I6RA 3RU8X 3P0XA 1I4NA 4O13A 2OG9A 3BTNA 4UTKA 4WKFA 3NZRA 1WE5A 1UBPC 3VZXA 1GEHA 1QBAA 3TXVA 4O8RA 2DVXA 2QVHA 3GXIA 5L9FA 3P82A 3KBSA 4YYFA 5I09A 3Q4DA 1AQFA 3A12A 3VIOA 1KCZA 1UWSA 1R30A 4Q8QA 1QHPA 3RFAA 4TVUA 5E9AA 2PTDA 1H4PA 3NZQA 3QEZA 1E6SM 4RW5A 1W56A 4GKTA 2Z28A 3UGVA 1Q85A 3HM7A 1XFCA 3EX6A 3TYBA 1XIDA 4W7VA 1V0NA 2YIHA 2O9OA 2WNQA 1POKA 3M0MA 2VELA 2QCDA 3QMRA 3S6TA 1RK5A 3ZLFA 2X0HA 2VR4A 2GLKA 4J3SA 2WHKA 1OGGA 5C5YA 1NOWA 2PDXA 2CERA 3SN4A 1SW0A 1XXXA 1Y5VA 4H00A 1XKYA 5FJJA 2DSKA 4M8UA 2FKPA 3AIRA 4IPPA 3PANA 1JCLA 1OX4B 4UFIA 3NL6A 1WXZA 2WJEA 3KS5A 3MWAA 5D38A 3ZT7A 2JBMA 3MYOA 1KFLA 3GU2A 1NAL1 5A94A 1QI2A 1TCMA 1K77A 2PU0A 1TMLA 2C18A 3LTPA 3WD4A 4OOUA 2WZEA 1TMHA 1F76A 5AECA 4IIDA 1TRDA 5EKYA 3CBWA 1WZKA 2DIKA 1UQZA 4YJ5A 1XG3A 3AOFA 3E2SA 4MHBA 4HQVA 4U31A 2RGMA 1UR2A 4P8XA 3STGA 4LSBA 4AW7A 4RZ5A 1CI1A 2JEQA 4NXSA 5HMEA 4RUBA 1V02A 4CD8A 4OU1A 1PEZA 1FH9A 3LY0A 4JKLA 2WLYA 4CQBA 3G18A 3OLIA 1J2BA 4GABA 2JQXA 2G95A 1ISVA 1NU5A 3WH7A 1LTDA 3HGOA 3W71A 3UXLA 3DG3A 2XUCA 3MMUA 5HWMA 3CMJA 4WJ8A 2CZEA 2BVWA 2NQZA 3LMZA 1M53A 2F2KA 3FA4A 1WUFA 4XAGA 1OX4A 2ABBA 3LV5A 4CCDA 5H1WA 2HPMA 3M47A 3EDDA 3W2KA 1C9WA 5FESA 5HR6A 1C8QA 1M7XA 1J01A 4BI5A 1OC5A 1RLDA 3CWHA 1UA3A 2OB3A 4MMWA 1FWHC 1V6WA 4JZ5A 4GYKA 1LP6A 4NI8A 3CNYA 2QDDA 4DVOA 4FZIA 4MWAB 4XZ9A 4RDVA 3OVRA 1BKHA 1PHQA 4FLQA 4J3XA 2NX9A 3G1AA 4WXZA 4JN8A 1C92A 1Q4WA 3RCYA 4GVFA 2BTMA 3OG2A 1ZALA 1AUSL 1WUEA 1UR3M 3IAQA 1B54A 2VZSA 3GH4A 3TV8A 4V1YA 3M7SA 1KM4A 4C7GA 4IPJA 1F3EA 2FDSA 1OX5A 3LBMA 3RJXA 3WD2A 1WCGA 3AYRA 3GVVA 3S5ZA 1ITUA 1S5VA 5C2XA 1EIBA 4WIWA 4INFA 3V0UA 3OVGA 3VAVA 2XJ7A 2OOGA 3VABA 4MGGA 3T0AA 3VX0A 2CC0A 3JS3A 4ZOAA 3I6EA 4DWDA 3UR7A 1EX1A 1RA0A 2WBKA 3GSMA 3W28A 1EOMA 1QPRA 4IMFA 2DUAA 3MBFA 3RRAA 4XZNX 5I03A 1D7KA 4H9TA 3W7DA 4IL0A 1AVAA 1VRDA 2CLEA 2DORA 3DCPA 3GUWA 3UF9A 4JTAA 1LOLA 4ORIA 8A3HA 4FF7A 5EFDA 3RPTA 2F2HA 4HMDA 5IDIA 1NDWA 3N9KA 4MWAA 4Y6GA 3W7HA 2YZ5A 3E2RA 2VX5A 3EB2A 3CIXA 5K9DA 4FX8A 4IZGA 2CBVA 3IIXA 3N12A 4C6MA 3PZOA 2XGIA 2YA0A 3N2MA 1OFDA 5TBOA 1QOPA 3FLUA 3AMCA 1ODUA 5HINA 4AUBA 1V03A 3WUBA 1K9EA 4NZCA 4ROQA 1CPUA 5HDRA 2JEPA 1DQWA 1G6CA 4AD1A 3INPA 1B9ZA 1W3JA 1YPFA 4GPNA 1C7TA 5DBTA 2WVVB 3PJWA 1IIHA 4AWUA 3PJXA 3PTMA 4Q4KA 1XLCA 4Q6XA 4PN2A 2C79A 2Z7KA 2NWRA 4MIMA 4MNMA 2CU0A 5IDZA 4H83A 1WAUA 4PUMA 3SIMA 3IIVA 4DAIA 1KA9F 1B1YA 1UMLA 3R2GA 4XISA 3C56A 4O14A 4E4PA 1E70M 3EX1A 1AMYA 3G1RA 3WY1A 5D02A 1UZHA 5I3GA 3MCNA 3PBYA 3NAVA 2ISWA 4S2BA 5HJLA 5T9CE 3EEZA 3TEVA 4W9TA 3UFYA 4YTQA 1W9PA 1FCUA 2TMDA 3HPSA 4IIFA 1QPOA 4DUOA 3FJ4A 3B0PA 2NV9A 2VYOA 4D6HA 4MJZA 3ANYA 3MP3A 1E6RA 1LQAA 2OEKA 3E3HA 3UP8A 1OEPA 1YBQB 4XG1A 2HPIA 3F7JA 4CEXC 3RLVA 3UQNA 3OVPA 4H6KA 2DT0A 3B0XA 2I17A 4Q8NA 2FJKA 4JR5A 4ZODA 1WDPA 2ZVRA 4D72A 4HNOA 5FAJA 3PBVA 1ADSA 5CLTA 1GVIA 1MUCA 2WVVA 3NFUA 3ONBA 2WANA 5F2IA 3ITXA 3S9YA 3GS6A 3KVKA 3FEMA 2B31A 4ZR8A 4M6QA 4IIEA 4NL1A 3MSRA 1OT2A 3MBDA 5AC7A 5LGZA 4EPDC 1ZBKA 3JR2A 3T09A 1HW6A 1SM9A 1JGMA 3SI9A 4C90A 3VI2A 4DJFA 2FPYA 4MY8A 3ZVIA 2YL6A 4WD0A 2BDQA 4A4AA 3AC0A 4ZSTA 4TTGA 3G22A 2X09A 3S47A 4ECLA 4PUKA 3LG3A 1YIXA 3GU1A 4UOQA 1GQLA 2F61A 1UR0A 3NM3A 1UQYA 3B3DA 1H09A 4FLRA 2XH7A 5CSUA 3LHVA 1QUMA 3WQCA 1YBQA 3W1LA 1MEHA 1R3WA 1FP8A 3CMGA 1E5JA 1XV8A 2WNZA 1SR9A 1UMYA 2WMHA 3LA4A 1JZ8A 1E3XA 3LV6A 4CKQA 4IUOA 2QS8A 2YW3A 4O17A 3RLGA 4MVAA 2IQTA 4B5UA 4PMJA 3P80A 5HNUA 3T1GA 4YHEA 1M7JA 5XIAA 3JW7A 4A8RA 3HV9A 5G5IA 2DZBA 4IJCA 3M0KA 2BY1A 2Y0FA 4GK8A 2A1YA 5H2ZA 5LGXA 3ARWA 1UB3A 4W5ZA 3Q67A 4A35A 2X7VA 1XS2A 2EHHA 4LUYA 4FX6M 3VIHA 2IPFA 3N13A 3W53A 1A5NC 4K8EA 3QY7A 4AHOA 3RG6A 3S5YA 4P61A 4JN7A 2L5HA 1NFGA 1DJIA 3NG3A 2Z27A 3GXPA 3AHXA 4HMCA 4DNMA 3AZTA 1RR2A 4C65A 1W9UA 1LG2A 1H7RA 1UKSA 2Z1BA 4MOZA 3OZMA 4M19A 4Y9MA 4C1LA 3WMLA 5A3HA 1TZ9A 4YHGA 3PZTA 2I9EA 2GWGA 1TE6A 3VUPA 3CL8A 4E3TA 3HPXA 3L5LA 3SGUA 1WPCA 2GQ8A 2E40A 2C1IA 3QHOA 3VNKA 5HK4A 2C14A 2ZE3A 3HZ3A 1IV8A 4P7OA 3W87A 1H41A 2DVUA 1LL7A 1BD0A 7ENLA 1TTJA 3T0DA 1ITCA 3H2AA 3L4ZA 3UWZA 1SMAA 3O0KA 1S2VA 1SO4A 1QPNA 1RP9A 3ARQA 3M0LA 3ZM8A 1BEUA 1VENA 4Q8MA 4X2PA 2PA6A 4H9MA 1GPWA 3GIQA 3WD1A 4C7DA 4XKMA 7TIMA 5KZEA 3F1QA 2WO5A 3L9CA 2PDBA 5CG7A 1PKLA 4WOZA 3THUA 1D8CA 2W27A 3N9RA 4Z42C 4IJRA 1PWLA 2CESA 3LLFA 3R13A 2PE4A 2ZE0A 4FK9A 2Q01A 1B9BA 3PS7A 2BGSA 2ZXAA 3RITA 3A6OA 1YTDA 3NVDA 2B7NA 2RAGA 3UPMA 3C5QA 3BDKA 3BQ6A 2V2HA 3QMTA 3MHGA 4YTUA 3QOKA 1QMLA 3IGXA 2E09A 1KTNA 5CPLA 3H2EA 2PDGA 3PZQA 1SGJA 3WBWA 3ITTA 3QXBA 3S2NA 2X0YA 1IT0A 2NWSA 4B5NA 4M56A 1CWYA 2I57A 3H2FA 3RJYA 5D4YA 4NP7A 1JDEA 3XISA 3EOEA 1UUOA 2DZWA 3COTA 3QM3A 1H51A 3VIFA 4L5ZA 5BU9A 1O5KA 3CEUA 3VMNA 1NARA 3BW3A 1CTNA 3A9BA 2QPUA 3BG9A 3P8IA 1J6PA 1P0EA 5A8MA 4IJBA 4RV8A 4I3GA 2VRQA 3K1GA 3VOIA 1XIHA 8CGTA 3QKZA 1MZHA 1XC4A 2FZNA 1NELA 4JTTA 4QAWA 4O52A 3GTNA 1KCXA 4XZMX 1ICPA 4PSPA 4LW7A 4IF2A 3OIXA 5CJNA 3PNUA 2TODA 3NTYA 3TOYA 3MKVA 1BQCA 1VGAA 4AF0B 3W7OA 1ZBCA 1W1ZA 1WKYA 3W3OA 1R9YA 1EGMA 5TNVA 2BGNE 3WEOA 1YQ2A 1P48A 1MNSA 3BMVA 3GR7A 3UG3A 4JX4A 1K7XA 4HOWA 1YLVA 4J7RA 3GE7A 4B5VA 1SFLA 4N0RA 2CZVA 1EO5A 3F5JA 1BYCA 2OR2A 1R86A 3TW6A 4AZGA 4EF8A 1SW3A 4GJIA 4DJFD 1RA5A 1BFNA 4ZFCA 1TPWA 1LORA 3K8KA 2REQB 1EGVA 4NYUA 2Y5EA 3MZNA 4MDPA 3IAPA 4QE1A 3MI2A 2NQ5A 3WEZA 4PUWA 2OKTA 1CGXA 3FEQA 3GYEA 1TV3A 4M7SA 1KBJA 1MW0A 4AY1A 5HA7A 2JALA 3HJZA 2ISSA 1QCWA 2PLKA 1FOBA 4C6FA 2CKSA 5C55A 2V5LA 1PS9A 1W0MA 4IFOA 4NJGA 3V3WA 4KW2A 7ODCA 4NILA 2Y63A 1RPKA 4B92A 2CBUA 3QPZA 3QHNA 4LXFA 1KB3A 2RFGA 4TMBA 1O4UA 4A3YA 4AF0A 4AYSA 1GVSA 3OZPA 4RNFA 1UOKA 5GJNA 3NQEA 3M16A 1V3IA 2VC9A 5C6MA 4AB4A 3ZLGA 1I75A 1VBHA 3M46A 3JUGA 1PTDA 3BK0A 5I0DA 3TJXA 5DO8A 2NQLA 3ABZA 1NQ6A 4WSKA 3DFTA 4O10A 3CLMA 1HO4A 5BXTA 1T8QA 2WVUA 1DQUA 2Y2WA 3GY1A 3VCNA 5FF2A 4JY8A 1E72M 4M29A 1PCWA 5LXXA 4WGXA 2REQA 4HCHA 1G9HA 4PFHA 4TX8A 4PB5A 4HZMA 5CC3A 3H4XA 2ZVIA 3C86A 4AISA 2HK0A 5TQLA 2RJHA 3W01A 4ICNA 5M1TA 4GYFA 5DMLA 5A8NA 4W5UA 4V28A 1JPDX 4U5IA 3O1NA 4H7CA 1B3ZA 3GZAA 2A6LA 3TN3A 4M81A 1XBZA 1HFBA 3W37A 2Z29A 3PB2A 3SAZA 3TNBA 5D32A 2W79A 1Z32X 4DO6A 1AJZA 4LB4A 4FSAA 4C5ZA 5JIWA 3ZWSA 2MNRA 3VGEA 1JXJA 1R46A 4EWND 1TCDA 4GC3A 4RE2A 4JTDA 4QTGA 5LIYX 1LG1A 1UR1A 3VD3A 2O4MA 3RX2A 2B7QA 2OLAA 1DBTA 4CGTA 3GFXA 2C7FA 3CUIA 5AHFA 2V5CA 4DJDC 4IP5A 5D04C 1KXHA 1SO5A 2V67A 2CZFA 4ZL1A 2XH4A 1CGWA 2HCVA 3PK7A 2OZ0A 1UHVA 5LIXX 3VNDA 4C1KA 4BR1A 4I9JA 3UNDA 1CX9A 4WDTA 1JZ5A 4LFYA 1NF0A 4MB3A 3GXMA 1EKOA 1KRMA 1C93A 3EX2A 3BLPX 1EXPA 2QNEA 2INZA 3CUGA 5BZAA 5CPSA 4NQ1A 2J8FA 4C1NB 2X1TA 2OVLA 1OG6A 3ZWTA 3KTCA 3IK4A 1WA3A 3TIMA 3Q65A 3KL0A 3E0IA 3TN6A 4EPKA 2PSNA 5BRBA 3I4KA 1XGEA 1DIEA 1CYGA 1QRQA 5FKYA 3T44A 5FF3A 1RY0A 4S38A 3OW1A 4UTTC 2R94A 4F0HA 1QPKA 3BE7A 4AD4A 5DF0A 2GWNA 4O1FA 1T6MA 2QAFA 3AROA 3LS9A 3NWRA 3F5KA 4GBUA 3E02A 3M0VA 5KZDA 4XBSA 2BNJA 5F1VA 2OWCA 3WIJA 2LLEA 3IEBA 3OQ8A 4IXHA 1TPH1 3PWAA 4FR1A 1CEOA 5GNZA 2VEMA 3EOLA 1HL9A 2BXYA 2VMFA 4HSHA 2R1PA 3SUWA 4Q32A 3LX9A 2WSRA 4GGHA 5H6HA 4KRTA 3UZZA 3LCGA 2ISFA 3CQIA 1A5BA 4JTSA 6A3HA 3RYSA 2E0PA 3KTSA 3STEA 4AZ5A 3VIKA 3ANVA 3BSGA 1LLZA 4C1NA 3W1QA 3WUEA 4E8CA 4XZIA 2CXGA 1JDCA 1FHLA 1R0MA 4ZO7A 1KV5A 3W7EA 4CQDA 2YDQA 4FOUA 2A3HA 3IGHX 1UD4A 1LF1A 1UW9A 4H6EA 4PRTA 1EX5A 3C0JA 2CXEA 5F4WA 1AQMA 3S83A 3I7QA 3P74A 3UY7A 3LSCA 1S39A 1YHTA 3PJUA 4G7FA 3MV11 3FFSA 2ACUA 2ADAA 1JF6A 3GNRA 4HYWA 4MADA 4HA3A 4C7FA 4IOTA 2VZVA 4AZHA 5JXQA 3LCFA 2ZZ2A 1EWDA 4F2BA 4GO9A 3GD6A 4PMXA 3MO4A 1V3KA 3BAXA 3ICJA 1V6VA 1HKKA 1XLKA 2BVYA 3VNJA 4R33A 4MY9A 3C3UA 2AMGA 1YNQA 4PB3A 2VEFA 1IZKA 2EAWA 3UXIA 2ACQA 4H4IA 5M17A 5HQMA 1EPVA 1OFRA 1E9LA 2QCGA 2Y89A 3NQ8A 4O11A 1TREA 3MJMA 1CB2A 2QYGA 5EMYA 3W07A 3BICA 1GVOA 1EHAA 4R9OA 3EWXA 3VKDA 2IKJA 2WXDM 4C6EA 3QGVA 5TAOA 3W75A 4FXJA 4GBDA 2NW0A 3BG5A 3H2NA 3AS0A 1Z3NA 3GHTA 3KCOA 1XW8A 3LBCA 4RPQA 2W6RA 5AC5A 6REQA 3C0LA 4YS1A 2Z0IA 3V5OA 1GKPA 1PWMA 1J2WA 3S0CA 2BY3A 1Z48A 4DUXA 1JCJA 3AFBA 1GUVA 2J7DA 1VJSA 3LZ5A 4QP0A 9CGTA 4UTJA 4KGJA 5LA2A 4OE7A 4J4KA 3AYTA 1PSCA 2PRMA 5C71A 4Y8EA 3W6LA 3LRMA 1NY1A 3TCSA 3NUKA 1FCQA 1W3LA 1LBMA 1NWSA 4X9YA 3E38A 1W31A 3F4CA 1E4LA 1GHSA 3A22A 3L0NA 3TC3A 1V3JA 2QCLA 2J78A 4A8LA 1XM3A 1REQB 3ALGA 1NDYA 1Y65A 4Z2JA 1OK6A 4AXKA 4RZBA 5KITA 2ATMA 5KSWA 4GJ1A 1Z7AA 3QR3A 5CLWA 1JD7A 1UJPA 3AMKA 4OBTA 5FA5A 3GFZA 2DUXA 9RUBA 3QW4B 2W3ZA 4E4UA 1NWTA 6TIMA 6TAAA 1QK2A 1VEOA 4AIEA 7A3HA 5ABHA 2EPLX 4N6FA 3THQA 3ZVHB 2V5JA 3GTXA 2C16A 2BX7A 4ZE4A 3BCDA 1O5QA 3N2XA 3OZOA 1ZU8A 2Z26A 4C5YA 4DF1A 1QASA 2FTPA 1XH2A 2YXGA 4QQUA 1RBOB 1R2SA 4XSLA 5A6AA 4DI8A 2V2DA 3PULA 1KD0A 2OT1A 3WNNA 2PDFA 3VZZA 1PX4A 1TV5A 3BLFA 1REQA 2FHFA 3KHJA 4UQAA 4TMCA 5AHNA 1W3NA 1VIZA 4O50A 4DXVA 4XUGA 1SZGA 3RM9A 1W17A 1J18A 4QG8A 2Y8KA 2G4FA 1R6WA 3CHVA 3FGCB 1FWDC 1RVGA 3HOJA 4QISA 3WMCA 2DZTA 2YJQA 4MNKA 3S9ZA 4NNCA 1XLBA 1F3WA 1QNVA 5LNVA 3I3EA 1A0DA 1VJZA 1YE4A 3GNNA 4HJFA 5EA9A 3L12A 3B0VC 3ITOA 1FXQA 4A3UA 2OEJA 3SUTA 4DELA 1GYMA 3M6YA 1IZCA 1Q7QA 2XSBA 4PMYA