2J6XA

The crystal structure of lactate oxidase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
370
Chain Sequence
DIEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.1 A Structure of Aerococcus Viridans L-Lactate Oxidase (Lox).
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords LACTATE OXIDASE
total genus 133
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.2: Transferred entry: 1.13.12.4.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2j6xA00
3CHVA 5K9XA 1H51A 2FTPA 2ISSA 1VS1A 5D04C 2CLKA 4CCCA 1F73A 4POCA 3EWBX 2Y7FA 2A7NA 1WOAA 3LOTA 1N55A 1A5BA 3LLDA 4WY0B 4AB4A 2H8XA 5KTLA 1KW1A 2A21A 1P5BA 5CZTA 1SZEA 4FHAA 3KRSA 3BLFA 3I68A 4NXSA 3PG9A 3MBDA 3W2NA 3CU2A 3TAKA 1QO2A 3B0VC 3M16A 3HBLA 3ZS4A 3BPWA 1A53A 4GWEA 5DCBA 5FF7A 3EKLA 1EUAA 3W1PA 4NVTA 2PC4A 4U4MA 4RJEA 1RQBA 2GQAA 1H1YA 1HUVA 4X3ZA 1O5KA 1KM1A 5D2XA 3N9RA 3PAJA 3MUXA 4TU1A 5AYYA 4UXDA 3LCFA 3C0JA 3GYEA 3TQKA 3QC3A 2R94A 1VYSX 4HNVA 3EX1A 3UWWA 4JTHA 1KV8A 3IVSA 3A5FA 3UPBA 2ZZ6A 2ZTJA 1W37A 2CZDA 2QR6A 4K6AA 4XQ6A 4CNOA 4FO4A 4HPXA 3LXBA 4X9SA 3DFPA 1VQTA 3S5YA 1SU5A 2NLIA 4RLIA 4FIQA 5EY5A 1H1ZA 1X1ZA 3W70A 1JULA 2GUUA 2JKEA 1ICQA 3NXFA 1XBXA 3B4UA 3LV6A 3NL6A 3VKJA 4LUJA 3BG3A 1Z48A 2ZA2A 4AHPA 4Z0JA 1I2OA 2V30A 1VZWA 3BW4A 3LHYA 3STCA 2ZFAA 1W54A 2PRMA 1YDNA 3A21A 1LDCA 3LTSA 1ICPA 4IOTA 3GXNA 2B0MA 2CW6A 4H6KA 4QIUA 4XBSA 4AMAA 5BW6A 1KLYA 3U8GA 4UTJA 1PCKA 3PSWA 1N7KA 3GR7A 1BWKA 3S1WA 1XUZA 1G7UA 4MZ8A 3PUDA 4BI5A 1NSJA 2V2DA 4FNSA 3INPA 1E51A 2BXVA 4LRSA 2YW3A 4FNTA 3FFSA 1FCQA 1H50A 2A85A 3O05A 2QKFA 1P0KA 4Q33A 3W1MA 2NWSA 4DF2A 4MKNA 3TC6A 3O63A 5DCDA 5MHBA 4DBDA 4IWWA 2YYTA 5CKSA 2B4GA 2EGZA 2QJGA 4BFAA 4YCPA 1GVSA 5LNVA 5HMSA 4Y8FA 3MMTA 1FDJA 1WBJA 5KZEA 1U5JA 1S5WA 4XKYA 4OBTA 1TQJA 2CU0A 4QNEA 3TMLA 3LTYA 2VOMA 3NQ6A 4O57A 4R34A 3SR7A 1QR7A 3HPXA 3SGUA 1EP2A 1G4PA 3OHIA 3EX2A 2Q8ZA 2V2HA 3TJLA 4QAIA 1GWJA 5H2ZA 2BLEA 1W5QA 3S5OA 1SR9A 3W2JA 2B7PA 2GVGA 4O52A 2X1TA 4RK8A 4HKPA 1G4EA 4N6FA 3PBUA 4ZVJA 3WK3A 3NZRA 3W7PA 4ORMA 4WOQA 1T8XA 1JR1A 3G22A 4O50A 1GOXA 2GJLA 3P80A 3S1XA 1LROA 1H7XA 3R5EA 1H62A 1VPXA 2YZRA 1R47A 5C54A 4UFJA 2P10A 3M0ZA 2JBMA 3T55A 4FNUA 3W76A 1YLVA 4ZL1A 3B04A 4KWVA 3W1UA 4FF7A 4XTDA 1G6CA 5CPMA 4LC6A 5SWUA 3FJ6A 4Y96A 1SO3A 4MPQA 1TRIA 3C2OA 3EXTA 4NJJA 4E2DA 3DAQA 3W7JA 5ABTA 4MY1A 5FF4A 1OJXA 2QUVA 1RQEA 5AHFA 3IIXA 4LVFA 4R7JA 5FEPA 3ZR4A 2HS6A 1TPC1 5BMWA 1HO4A 3TSBA 3H53A 3QSRA 2QCLA 2LLEA 2C3ZA 4MLJA 1RQHA 5E1QA 4X2RA 4AAJA 1OX4B 3A24A 4PA8A 5AN7A 5AYXA 1LBMA 5KSWA 3MP4A 1SZFA 1X6UA 3TU9A 4O53A 3R8RA 3SSJA 1I4NA 3GLCA 1TCDA 3W3OA 3W2LA 3G18A 3IV3A 3M41A 5DY2A 3PSVA 3G0XA 5FI8A 1JCLA 3L2IA 3AO0A 2QJHA 3R13A 1NEYA 1SZGA 4LT9A 4TIMA 1OABA 3NVTA 1GZGA 4ZMGA 3F1QA 2JK2A 3PR2A 2X2GA 2NV1A 1G4SA 2B7NA 2FJKA 5A5WA 3N3MA 3GAYA 2QDHA 1IGSA 1ZCOA 4P61A 3M47A 4G1KA 2FPTA 3IGSA 2H90A 4K36A 1KV5A 5I3JA 3W7KA 3T44A 1TQXA 4RZ5A 3JS3A 3AJXA 2IQTA 3UWYA 5FESA 3DGRA 1L2UA 4P2VA 1AL8A 1SO5A 2E5BA 2XN0A 3ATYA 5BNKA 4ZZ9A 4IPJA 1NF0A 3NQ2A 4UFLA 1TPH1 2NXIA 2P0OA 3TSDA 3HG2A 1X7FA 2VFFA 3W7NA 2KZHA 1SFJA 2VEPA 3BGJA 4NJKA 1BTMA 3LM7A 1K8XA 1B9BA 1HG3A 2Q3OA 1VCFA 4FNRA 2Y88A 3STGA 1VRDA 4EOUA 1SZNA 2HSAA 3MWAA 5AFDA 1QO5A 3W23A 3W6YA 1WQ5A 2WNZA 4DO5A 4PODA 1QWGA 3FYPA 4PEKA 4YCOA 1TIMA 5HUPA 1HFBA 4QSHA 1OFRA 5L9FA 2F84A 3QZEA 2QCDB 1LTDA 3B8DA 5DBTA 5KITA 4WD0A 3WK1A 1NAL1 3L67A 4UTMA 4QM1A 2RDWA 1FWSA 2RDTA 4Z1DA 4IGHA 4O17A 1W3IA 3GK0A 5F1VA 2V5LA 3DI0A 4GUGA 3HF3A 3NL2A 4LVBA 4AHOA 1Z42A 3DFTA 3M7WA 4L4MA 5F1UA 1GVFA 3W7DA 3LXAA 2VENA 2Z0IA 3LLFA 3G8EA 2V81A 4UTHA 4WJEA 1K02A 4BK9A 1TTPA 4LRTA 3MI2A 3W87A 4UMCA 3HO8A 1W56A 4R53A 2I9EA 4O13A 1KFCA 3IGXA 2ZDRA 3O07A 3CEUA 8TIMA 1B4KA 3PBVA 2PCQA 1F6PA 3C2RA 2G96A 4I9AA 5LHEA 3U2OA 1ZHAA 2GPTA 1FDZA 3C8FA 3CB8A 4JICA 1LORA 1JUKA 1OVDA 2Y70A 3BW2A 1IXQA 1UCWA 1SW7A 3O16A 3QMTA 5LHFA 1ME8A 1GVQA 1UASA 4PL1A 1EEPA 1C9DA 4OGZA 2WSQA 1W5MA 3OVRA 1VHNA 4C1LA 3KOFA 4GNJA 2ZTKA 5F4SA 2D73A 1MEIA 3KVMA 1UBSA 3ATZA 4LS1A 4UTUA 3Q94A 4OV4A 1QPQA 4WQ6A 3K30A 4UFKA 5HWMA 2E6YA 1XDLA 3P62A 1TTJA 3GZ3A 4QISA 3OVPA 4QJ1A 1H7RA 3G0UA 2FB2A 5IBXC 1XM3A 1Y0EA 1MZHA 4HNNA 1PIIA 4AEOA 2E68A 3DI1A 4NZJA 1IIHA 3HG5A 1UJPA 4DBEA 3CEPA 3VI2A 3THQA 2C6QA 4IUOA 2ISVA 1W3NA 1VHCA 1TV8A 5T26A 1GTEA 3P74A 1I2RA 3C4UA 1W3TA 2ZZ7A 5C2XA 5HNRA 5I3KA 5J5DA 4LC8A 1UUMA 3WJWA 2CLIA 2ISWA 1AG1O 5H91A 4XWUA 3PWAA 3EWXA 1QMLA 1EX5A 1TV5A 5CSSA 4RCXA 1EB3A 3KRZA 4DPQA 2ZA3A 3TDFA 2CZEA 3QQ1A 4XZ9A 1DQXA 3GXTA 3RNDA 1HL2A 4OV9A 3SIZA 3OVQA 1FWWA 2EAWA 5I3GA 1EPXA 1O95A 1S3HA 2X1RA 5EPDA 3NQAA 3DHDA 3GDKA 3T78A 1SUXA 1P0NA 1L6WA 3Q37A 4JTFA 1X1OA 4EWND 4YMZA 3IRDA 3NQFA 3TIMA 3MHGA 3N73A 5G1YA 4M5PA 4FNQA 3W7EA 1YDOA 3KVLA 3NG3A 2XN2A 2EF9A 4MFEA 3MP5A 3VE9A 1VGAA 4O4WA 3LGEA 1XUUA 4FB7A 3IIOA 3B06A 2OT1A 3LRLA 1KFBA 2J6XA 5AB3A 3ABOA 4MYXA 2H6RA 5G2WA 4O16A 3O6DA 2Y61A 2BTMA 3V1PA 3NPVA 3KRUA 2DZSA 3NQ8A 1ME9A 1QPNA 5HR6A 3DENA 2I1OA 4JIPA 5TIMA 1U83A 1FY6A 1DBTA 3CIWA 2PE4A 1M7PA 3L0KA 3W7HA 1SO6A 3FJLA 3ZWSA 1XL9A 3N9SA 5J5RA 2C15A 2PURA 1TRDA 3QQ0A 4LWWA 2CZ5A 1A5SA 1F2JA 5DXXA 4K38A 4D2JA 2X1SA 2JKAA 3SJ3A 1ZNNA 3TKFA 5AOUA 5FEZA 3KVJA 1OFPA 2ZZ2A 2VEKA 2V2CA 4FX6M 3UD6A 1AMKA 1JCNA 3L65A 4HN4A 1QDSA 4AH7A 1KM5A 4GFSA 4FX8A 3KXQA 3F4NA 4M7TA 1YYAA 1AW1A 3NOEA 3LI0A 4O54A 1H63A 2JGYA 4NT0A 5FF3A 1WYIA 3WFAA 4TMCA 3RU6A 3MJYA 5CSRA 2B7QA 3QW3A 4JXCA 2Q8LA 4CQAA 1RD5A 1TJRA 1L6SA 5KZDA 1G7VA 1AW5A 3A5VA 2WNNA 5LNUA 3E0IA 5G4WA 5U7SA 1QPOA 4ZQPA 1TPB1 3NPUA 1RZMA 3WJYA 2Y7GA 1LRQA 2A7PA 3FKRA 1KBIA 5HR7A 3UYCA 1FCVA 5CZ0A 1OFQA 1UUOA 1THFD 4S2BA 2VELA 1ICSA 5I3FA 3TROA 5DY3A 4Y90A 4WY0F 1A5CA 3SY5A 1H7OA 1LLWA 1QOPA 2V5BA 4TR9A 4IMCA 4O8RA 2DZWA 4UTWA 5K3VA 1QPRA 3LHZA 3KX6A 1Q3NA 4ML9A 3OBKA 1B57A 5D02A 1T99A 1TPUA 2TMDA 1I8JA 5AC6A 2GVJA 4I7WA 3DZ1A 3PC0A 5CGQA 4OWGA 2GQ8A 4Z1CA 1HTIA 3KAOA 2C13A 3DFSA 5K9CA 2O7QA 2OT0A 2VXNA 1DHPA 1IIGA 3L66A 3TMQA 2X30A 3M9YA 4LV9A 1EA0A 1LOSA 1ZJIA 3L0GA 3SW6A 2CLLA 1PL9A 1FUYA 4NJGA 1FBAA 1TTQA 3CT7A 4IMGA 2WPBA 1KTNA 4UTLA 4LU0A 3TFXA 3FA5A 3G3MA 3LHTA 3W85A 3LBCA 3EWWA 3TA6A 4NZFA 3S9YA 2RH9A 4O1AA 1F5ZA 4N6EA 5C6MA 4N9CA 3OA3A 4RR4A 1WV2A 3M6YA 3QRHA 4DEFA 5D09A 3R12A 3F4WA 3TSMA 4WY0A 3M44A 4AWTA 4A2RA 2CFFA 2V8ZA 5DCEA 2C14A 3L5MA 3P5ZA 5K4XA 3DFNA 3G0SA 5I3HA 1GYLA 4NNCA 3NDOA 1OFAA 4DO4A 1L9WA 1LRTA 3B0UX 3UPWA 2OX1A 2C16A 2WSRA 1DKWA 4ALDA 4KKXA 3NQGA 4IPIA 2NX9A 4JNMA 1FX6A 1DVJA 3I7QA 2YXGA 4A3UA 2E6FA 5U4NA 1YXCA 3RLVA 1NF7A 3LCXA 2RDUA 1A5AA 1KBJA 2EHHA 1JRCA 3C6CA 3LRKA 3NM1A 5EYWA 2FFCA 3O1NA 1ZENA 1O60A 5DLCA 4O19A 5HQEA 3VCRA 1OFEA 1KFLA 1VLWA 3FOKA 4Q32A 3NQMA 1GT8A 4ZQRA 4MJZA 4UUIA 3W74A 2C18A 3I7RA 3W7MA 3FIGA 1RV8A 4N4PA 2Y7DA 1KM2A 1SW0A 1ZALA 1SPQA 2W6RA 3T40A 3D0CA 3NPWA 3MYPA 3NO5A 4UMBA 2ZZ1A 3O8AA 5F4XA 5LGXA 5G1TA 4BI6A 4HPJA 4XBKA 3E49A 4FEZA 5D2WA 3G24A 5G5IA 1SSDA 3UZJA 4YL2A 3PUOA 1ZFJA 3LB0A 1PV8A 4MVAA 5AHIA 2OJPA 2CLOA 3ABQA 1R2RA 2H3BA 4WX2A 3PBWA 3NL5A 2YR1A 1XBVA 5HWNA 4HT3A 4RKAA 3TV8A 4TMBA 2VFIA 4WZHA 3N19B 4PFMA 2DU2A 4GXMA 3LBMA 3QH2A 2I14A 4XKYB 4NUWA 3Q2DA 3P67A 1XBYA 3EEGA 2DZVA 1IXNA 1OFDA 1WX0A 1PS9A 4IMDA 1LYXA 1Z44A 4PTNA 4JYEA 2WJZA 3BLEA 3TJXA 5CZSA 2BSLA 2G95A 1OG0A 5I3IA 1FXPA 3TK7A 4AWSA 3LHVA 1P4CA 4N2YA 2VEMA 2G5WA 3G3DA 3LCGA 3UY7A 1K7XA 4JGDA 1BEUA 1DV7A 5F4WA 1V7YA 2V0TA 4NJHA 1QFEA 1C29A 4QQ3A 1AK5A 2YFOA 4QITA 2Z6JA 5EA9A 2YYUA 5D2YA 4IQLA 4UTWC 5GVJA 1S5TA 2AGKA 2Y62A 5FF0A 4O0KA 4JTJA 5AC8A 3LXCA 1D3HA 1YXDA 4GBUA 3W7OA 3UWVA 4Z1AA 2DZXA 1T0OA 1K7EA 1JCJA 4WXYA 3TR2A 2ZRUA 4UMAA 4I7VA 2CLHA 3C2VA 3I65A 3M5YA 3DFQA 1F7BA 1WOBA 4CNPA 4O10A 4L4LA 3QMRA 2A6NA 4N4QA 4CQ9A 4A22A 2J9ZA 1WBHA 1WXJA 3O6YX 1G69A 4MFDA 4RZ4A 4JX6A 4J9JA 4Z1BA 2WOQA 1OYBA 4EVZA 5L6UA 1IXPA 3LCIA 1KM6A 2TYSA 1KTCA 1JCMP 1GPWA 4GUFA 5D37A 4HNUA 3LERA 3W1NA 3W83A 4A21A 4DF1A 1ZAIA 1FXQA 3CTLA 3NM3A 5E0KA 2TRSA 3NGJA 2YGYA 4O1DA 1VJIA 3FYOA 4ADUA 3WK0A 1TYGA 5K9DA 1VR6A 3M1ZA 3HPSA 3G1XA 3STEA 4MY8A 5TQLA 5KINA 3P60A 3LV5A 5K7JA 1DJNA 4IXHA 4TO8A 5D30A 3G1YA 5AC7A 3QW4B 2ZA1A 2E6AA 3LI1A 1LM1A 4ZQNA 4JTLA 2R14A 3KFTA 2ZRVA 3MP3A 1EUNA 4NJIA 1RR2A 3KVKA 2ZZ5A 4JDYA 1YXYA 1T96A 1TMHA 3S5ZA 4UFMA 2RHGA 2DJLA 3A22A 4K7YA 1F74A 3M43A 4O4VA 4UTKA 1OF8A 5CZJA 2FPVA 2V82A 5D33A 2J27A 4N9DA 2E77A 3YPIA 1DORA 4JTGA 4OT7A 2A2IA 3SI9A 2FLIA 4O18A 5C55A 2ZQ0A 4Y9AA 5A8GA 4PH6A 3LDVA 5D2TA 1TJPA 4LVAA 3W73A 3S1UA 3C61A 3A23A 3S1VA 3PULA 4JTUA 2E6DA 1EWEA 1KFEA 1G4TA 3UXDA 1OK6A 4H4IA 1Q6RA 3DKLA 2GJNA 4O1CA 4UFHA 3NA8A 2NUXA 4HNTA 1OX6A 2A6LA 5AHMA 3WJXA 4NQ1A 3EXSA 3I6RA 1KFJA 3VFLA 5F2MA 4ADSA 1JQXA 4DPPA 2VEIA 1LLZA 3ABRA 5AYZA 4JYFA 4M7SA 1XBZA 2Y89A 4O28A 4MY9A 4JS3A 5EMUA 4AXKA 3VE7A 2NWRA 4UR7A 3CIXA 3LCHA 2Y6ZA 1K7FA 2VKZG 1I2PA 3HGRA 1XKYA 5DXYA 1W5PA 2QEZA 1JUEA 1V5XA 2ZRZA 5CG7A 3CLMA 3MW7A 1BWLA 2NX1A 2NZLA 1KLZA 3EX4A 2HS8A 3NNTA 4GC4A 3DH7A 2ABBA 3PBYA 4Z0SA 3MI6A 5CPLA 1OYCA 3NQCA 1ME7A 4JYDA 2QCDA 3GDRA 4JY8A 1PVNA 2WV8A 3IVTA 2X1UA 2TSYA 3GR8A 2O7SA 1OX4A 3LHUA 3PVFA 2HTMA 4M19A 1KTBA 2RFGA 2OMAA 2Q3RA 1TSIA 3T4CA 4JIQA 3GKAA 3QPYA 4FNPA 3W1LA 2GQ9A 4JD4A 3I7SA 4CCDA 4K39A 3L21A 1K8ZA 1FWRA 1H7PA 3DBPA 3P82A 4WXZA 3NPXA 1OF6A 1O94A 4IX2A 1W31A 2JKPA 1KFKA 4NU7A 1D3GA 4XUGA 2NUYA 3P8IA 3GB6A 1R46A 4IMEA 2RKXA 3ABSA 4GUJA 2WQPA 5HINA 1MEHA 1OFBA 3MYOA 3C2FA 2VFEA 4EIVA 1Q45A 4NX5A 4MJMA 1OK4A 1GG0A 3W84A 3G1AA 4JTKA 2QAPA 1KA9F 2FPYA 2CLFA 1QCWA 2QJIA 1GYNA 3DHFA 2WSYA 5LKYA 4HHPA 2YX0A 3S5NA 1TB3A 4JTTA 1OFOA 4JEQA 3LRMA 4LTSA 1FWTA 3W71A 2VFGA 3N2MA 1ONRA 4FXRA 2YSWA 4S1FA 3GXPA 3M5XA 3SFKA 1SSGA 2TPSA 1JJKA 1XCFA 3NQEA 3GKFA 3OIXA 1MEWA 3HB9A 3LCLA 1K03A 3BLIA 1L6YA 2JGQA 2HMCA 2ZBTA 1DJQA 5HULA 3NAVA 4JY9A 3FLUA 5C5YA 1NVMA 1VC4A 2Y7EA 2Z1BA 3EX6A 4Z08A 3GAKA 4ADTA 1B4EA 2J88A 3NQDA 3O6CA 2BX7A 2W79A 1YTDA 4RX0A 3L0NA 2J9YA 3LTPA 2WKJA 1I2QA 3NQ7A 3PUEA 3EX3A 3H55A 4GJ1A 3O06A 1GTHA 3BARA 3DKJA 4I7UA 4IMFA 3DFOA 3IIPA 3L5LA 2R91A 3S42A 4CLMA 3QEZA 1PCWA 1SW3A 2C0AA 3ANYA 2WO5A 1W0MA 3QF0A 3W1RA 1EP1A 2E1DA 4N9BA 2QCFA 4W9TA 3MI3A 5AHLA 1YADA 1KM0A 5G4EA 2DJXA 3BVJA 1HO1A 3TX9A 1J4EA 3EXRA 4PCFA 5DBUA 3GVGA 4B5NA 2CLMA 4KFOA 4E2BA 3W72A 1J2WA 3W86A 4MZ1A 3B03A 1GVRA 5FEXA 3C3NA 1XC4A 4Q4KA 2ATMA 3PY2A 4K7VA 3W75A 1J5TA 1QAPA 3P7YA 3H54A 3HQ1A 3HGSA 5KMYA 1YTKA 1R2TA 3W7QA 4PL2A 5CPNA 3G1DA 1SO4A 1NFBA 1RVGA 3IIZA 2FB3A 3LCWA 3W7IA 3EKZA 1QNVA 1CW2A 1JCYA 3W22A 4OHQA 2F7FA 4BWLA 1VLIA 4E0CA 4ZQOA 3QPZA 1H5YA 1TPVA 3U6WA 3QM3A 4MOZA 5F2GA 1Q6LA 3B0PA 5F2LA 3RF9A 4UTTA 5EKYA 2OCZA 1Q6QA 4K8EA 4EF8A 4RV8A 4MIMA 3G1VA 3S0CA 1X8FA 4C1KA 3RMJA 1GQNA 1IF2A 3W9ZA 2DZPA 1AL7A 1W5NA 3THAA 1SFLA 3N2XA 4CCEA 3A9IA 2ATSA 4JX5A 1OYAA 4GE8A 3S8HA 1D9EA 3L5AA 2DP3A 3EB2A 2QDGA 4IJBA 1TPWA 3NQVA 2AQWA 3LHWA 4UCGA 4FX7A 3UXAA 3CM4A 2ZRWA 3TW7A 4M6QA 4FXSA 3TQ0A 4AWUA 1H7NA 5LNRA 4N9EA 4LVGA 3FS2A 1K8YA 4CNNA 2NUWA 4O14A 3UWZA 2XN1A 3W7CA 3G8RA 4LVDA 3LX9A 3ELFA 3P61A 3E96A 1M5WA 3R89A 3OG3A 3VNDA 4JR5A 5LNSA 1ADOA 3UZ5A 2Y63A 2DZUA 5LNWA 4R33A 1F6KA 4RXFA 2Z2UA 5IBXA 5DN1A 3NZ1A 2ZRYA 3WJZA 2XFWA 3B05A 4IX0A 3UNDA 3TNOA 1ZAHA 2WNQA 2QCGA 2C1HA 3BGGA 7TIMA 5KZMA 2QCNA 2W0UA 1VYRA 4DELA 4PC8A 2V9DA 4UC5A 3GIYA 4O12A 5E93A 4UTIA 2QCCA 3GNDA 3GDLA 5BRBA 4WOZA 1VH7A 2ZZ4A 2NXGA 4HIBA 4ZQCA 1O4UA 4K8HA 3IEBA 3PF3A 1AW2A 1LOLA 3TE9A 2A5HA 1GVOA 1R2SA 4JN6A 5HJLA 3UY8A 2P1FA 3MO7A 2G97A 2Z6IA 5K2ZA 4OE7A 3NR0A 1TPDA 4UTTC 4K37A 1G67A 1I45A 1PE1A 4IXXA 4X22A 1M6JA 4ZQMA 3GDMA 1LOQA 3FEMA 4OU1A 3BK0A 5D03A 1TO3A 3JR2A 4MLRA 1UB3A 1LRNA 1WAUA 4DO6A 5LSMA 3CWNA 4Y6GA 1YPIA 1H60A 1WA3A 2DZTA 1S5VA 4NX0A 2ZCGA 4YXGA 3C56A 5DELA 1FWNA 4LUIA 4UR8A 1LZOA 4UFIA 1KM3A 4KWWA 3OEXA 3QJAA 3W88A 3HIJA 3W1XA 1KM4A 4RZ6A 4WUIA 3QYQA 3PB2A 1F76A 2ZRXA 4MUZA 4AF0B 2J24A 1F05A 3MHFA 3STFA 3SECA 4ONVA 1FCBA 2YDAA 3RFAA 3L68A 2FIQA 4EF9A 3N14A 3BW3A 3QFEA 4LOCA 3UQNA 3DU0A 1JVNA 3T7VA 1I2NA 3BG9A 1LBFA 3SZ8A 1FDYA 2Y85A 1P1XA 2QF7A 2NX3A 2H3DA 1MSSA 3MHUA 2UV8G 2E09A 3W1QA 4LNYA 4O15A 3W7LA 5D38A 1QOQA 2R8WA 3W7RA 4UNLA 4CQ8A 1RPXA 2YCEA 2EPHA 3HOJA 4NNAA 3PM6A 1JUBA 3P8JA 3WK2A 2QUTA 4AVFA 1YTEA 4HSOA 4NXKA 2VFDA 4LW7A 2FDSA 2ZYFA 4YLWA 3TFCA 1A50A 3HG4A 1SQ7A 4FIRA 2E5DA 2YPIA 3M5VA 4O11A 3PG8A 4S2CA 4BWLC 2PRHA 4UIOA 1R30A 3TQVA 2FQIA 3P5YA 4LS0A 4QNWA 5FEWA 2VC6A 3R2GA 2BWGA 4ORIA 3GX9A 4HSNA 3NEVA 2C19A 3IVUA 4O0ZA 2ALDA 1IXOA 1XDMA 3TCEA 4MYAA 2AAMA 3HGOA 3EWYA 3UWUA 1MO0A 3UWQA 1C8VA 2YFNA 1H7WA 2YW4A 1LCOA 1XXXA 2E5CA 3USBA 4OQVA 5G2HA 2A0NA 3L9CA 3S6DA 1M7OA 3TXVA 4JDBA 1MXSA 5BMXA 1GJPA 5IM51 2B7OA 1DOSA 3QSTA 4JTIA 5TBOA 1Q6OA 1YDVA 1TPEA 3TUUA 4AHQA 3PS7A 3EWZA 4H3DA 3W07A 4U28A 5F2IA 1ZAJA 4BI7A 2QCHA 3O15A 1FQ0A 3W2MA 3E9AA 1XI3A 1W8SA 2J9XA 2ZZ3A 3E02A 3P81A 4UNKA 3E12A 3TXZA 3W2UA 3BG5A 5CPOA 1LBLA 1VYPX 3CQ0A 5LZLA 3DXIA 1PHQA 2GVLA 3V75A 1OHLA 4M6PA 4BR1A 4JX4A 4M6VA 5EBUA 1TREA 3RLUA 3TAOA 3JRKA 1LP6A 5AHEA 2CZFA 3RK8A 2EKCA 4E38A 1W5OA 4LS2A 1TPFA 4YWIA 4JTSA 2OZ0A 4N02A 3NYZA 1CX9A 1H61A 3IGUA 2CLEA 3ZWTA 4GRSA 5HUOA 2DORA 3IIVA 3C2EA 3HMJG 4ICNA 3W2KA 1XFBA 2A4AA 3CPRA 3G1HA 2QCEA 3CWOX 1CI1A 2VFHA 2X16A 3W1AA 3HG3A 1N8FA 3HGJA 1W1ZA 1TV7A 3G1FA 1ZY9A 3QMSA 4MZYA 2QUUA 5HWJA 1EIXA 3KHJA 4LY8A 1ML1A 1GEQA 1GG1A 4LV4A 2A1YA 2PRLA 1DQWA 2GOUA 4BF9A 5D2VA 4DXVA 3M5ZA 3BO9A 4KFNA 1JRBA 3PB0A 4XTIA 3EWUA 3BV4A 2ABAA 1BKSA 3WJSA 1B3OA 4JTEA 6TIMA 1FCUA 3W1TA 1DL3A 4GUHA 5K4ZA 3Q58A 1JQVA 3NL3A 4GUIA 2QAFA 4RXGA 1Z41A 3MBFA 5D05A 3ZFHA 2BZNA 4DQWA 4O1BA 3TW6A 1K3UA 1OX5A 4A29A 1O5XA 4KFPA 2CWNA 2H8ZA 1PHWA 3GNNA 3W7GA 4A2SA 4NNBA 3G1SA 5FF2A 5G2IA 6ALDA 3HPZA 4DF0A 3CC1A 3GDTA 5EL1A 3HJZA 3TH6A 3F03K 1VCGA 4AF0A 1VCVA 1JCXA 5BOOA 5D32A 2A7RA 1ALDA 4TX9A 3TC7A 3C52A 1TTIA 1EP3A 5LGZA 3FKKA 1WDWA 1EWDA 3SGZA 5AHNA 1YPFA 2NV2A 2QCMA 2NXHA 3N34A 3P84A
chains in the Genus database with same CATH superfamily
2PGWA 5CJMA 1J9YA 1BGAA 2ISSA 3EMQA 1VS1A 5D04C 4CCCA 3LY0A 4QR6A 1QHPA 2VZTA 1F73A 2Y7FA 1WOAA 1X8CA 1E73M 5A69A 1NM9A 3S83A 1IWBA 2I7GA 2H8XA 3PZ9A 1XRFA 1UR9A 3AHVA 4FHAA 5CZTA 4JHOA 5C0QA 1CPUA 1HW6A 4LUTA 3PG9A 3MBDA 2F2KA 1KCZA 3KDNA 3W2NA 4G7EB 3WBXA 1QO2A 1EC7A 2G0WA 4LEQA 3BPWA 3W53A 2X2YA 1A4LA 4QGCA 1JZ8A 3W1PA 3QFWA 1Y65A 2BDQA 2GQAA 1TV4A 1ZJAA 3WNLA 1HUVA 1K4GA 4GJJA 3GG8A 3PAJA 5AYBA 5AYYA 1XLMA 3LCFA 1HNYA 3KBNA 1XGEA 4HZMA 4JTHA 4C5YA 2ZZ6A 1R3SA 1S2AA 4K6AA 4XQ6A 5A6JA 1ZZMA 4LAMA 4HPXA 4KF1A 3O0FA 3VM5A 1X1ZA 3WBAA 1PKMA 4Q8QA 5BCAA 3WMBA 3CH9A 3B4UA 1RSCA 1TA3B 3VKJA 3TTQA 3WEOA 1Z48A 3PZVA 4AHPA 1US2A 4JCMA 3STCA 1T8QA 5FJJA 4PUNA 1UKSA 2ZFAA 1SJAA 1W54A 1EBGA 1YDNA 4IOTA 1ICPA 3N15A 3JZEA 1WZKA 2NW0A 4H41A 4QIUA 3PN8A 1KRMA 4JN8A 3ZOAA 3M0VA 1PCKA 3B9OA 4KCUA 3OIHA 3WF3A 3PSWA 3GR7A 1RD6A 1BWKA 1XUZA 1VPYA 4MZ8A 3PUDA 3INPA 2BXVA 2YW3A 4GPNA 1Z69A 1XV8A 2W9MA 4R27A 4HA3A 3W1MA 1P0KA 1J0ZA 2OWXA 3N6QA 2YBUA 4QJ4B 2NWSA 4F0LA 4DF2A 3O63A 4IP5A 5DCDA 1MRQA 3T08A 1XICA 3H2CA 5CKSA 2VGGA 2B4GA 2PWDA 2QJGA 1PXGA 4I5XA 2YBTA 5LNVA 5HMSA 4YCPA 2VX5A 5M5DA 4PMQA 3CZLA 1R7AA 1S5WA 4OJYA 4DO7A 1SJBA 1QR7A 3SGUA 3BDKA 2VR4A 5ENLA 1AVAA 3T0BA 5BU9A 3EWCA 3GG0A 5H2ZA 5HMFA 3VIKA 3S5OA 3RMEA 2GVGA 4IPLA 3VIHA 3PBUA 3BAIA 3OLEA 1QPKA 2IPFA 3WK3A 1RJRA 1S2WA 4ORMA 3Q4DA 2PD5A 1JR1A 1GOXA 3P80A 1E6QM 1JL8A 3S1XA 1XR2A 1H7XA 3VZYA 1H62A 3MY9A 3ZT6A 3ITVA 2G4JA 4UFJA 3TNBA 4V1XA 1BF2A 3M0ZA 3LNMA 2INZA 3T55A 4ZENA 1Q4WA 2GVYA 2CERA 3B04A 1U2YA 3W1UA 1G6CA 3FJ6A 3VUPA 2Z4GA 3C2OA 3TEVA 3EXTA 3MSGA 1E4NA 4IQJA 1OJXA 1RQEA 2IPJA 3QXBA 1CXIA 3ZR4A 1CCWB 1NTHA 3QSRA 2UWFA 2LLEA 4LUYA 4MLJA 4Q4QA 5E1QA 4AUBA 4AAJA 4L4OA 4HMNA 3ARQA 2JIEA 5AYXA 5AN7A 3EYPA 3IPWA 4OOZA 4S3JA 3THDA 4H01A 1SZFA 4BQ2A 2A3CA 3II1A 3ARPA 3R8RA 8XIMA 3GLCA 3W2LA 1UR4A 2ISDA 2FZ9A 2VC5A 5DY2A 1DJIA 1GJWA 2PWGA 2PF0A 5EMYA 3R13A 4MWAB 4V1YA 2XH0A 3NVTA 3ZLHA 3FV9A 3UG5A 3VILA 1XH2A 5A6TC 4NYUA 2NV1A 2B7NA 3GTIA 5HNTA 4KPLA 4P61A 3VOIA 1W3JA 3IGSA 5CBBA 5CPQA 3PJTA 4AX6A 2YL9A 3T44A 1ECEA 2IQTA 3UWYA 2DQXA 4WVXA 1Q6DA 4P2VA 2Z7GA 1ZL1A 4DWDA 1UWIA 2WVTA 2XN0A 2W5FA 4IPJA 4H04A 2Y4SA 1TJ0A 1NF0A 1TPH1 3NQBA 4QJ3B 4QS6A 2VEPA 2QYGA 1MVYA 3BGJA 2OQLA 2NVAA 4NYYA 1V93A 1ITQA 3ARTA 3KP1A 4DZHA 3AIVA 1IEWA 4HCLA 1B9BA 2Q3OA 4FNRA 1BHGA 3XINA 4MTVA 1AQ0A 4W88A 2ANUA 4EOUA 1UZ4A 2V68A 4TVDA 1V6XA 5CH9A 1A3WA 1W1TA 4IL0A 3GW0A 3WNNA 1MW2A 4RNHA 1OFRA 2F84A 1D7KA 4M81A 1LTDA 5KITA 1W1IE 3H2NA 5JIWA 3WK1A 4QM1A 2WW5A 2RDWA 2F6XA 4DJFC 3UF9A 4JTCA 4WIWA 3ANVA 1ENUA 3F5LA 2D1ZA 3CAVA 4AHOA 4AZBA 1PWLA 1C90A 2GDQA 2HPIA 3VAVA 3LXAA 2VENA 2WLZA 4Y7EA 2XZ9A 3BJSA 2D0FA 1BQCA 3GHTA 1K02A 3AUOA 4B5VA 1TTPA 4C5ZA 3EA1A 4UMCA 2ZUVA 1XH1A 1P0DA 3AMKA 3FY1A 1C8XA 3KS6A 2CIPA 1EDQA 3WQWA 4E8GA 1B4KA 8TIMA 2BGQA 2XDFA 4GXPA 2HV5A 1AMYA 4H8NA 4I9AA 1AJ2A 3PBGA 3DUGA 3AXXA 3GR4A 1OVDA 2Y70A 1IXQA 3WMSA 3K1GA 1Q2SA 4GY1A 1DWAM 2QQ6A 3O16A 1ONEA 5LHFA 1ME8A 4HA0A 4HYVA 3L2MA 4L7ZA 4OGZA 4H00A 2HWGA 3VIGA 3OPSA 1UBSA 3ATZA 4P7QA 4XV0A 1QPQA 4UFKA 3DFHA 2E6YA 3P62A 4US6A 1V3IA 2Y0FA 4C6CA 3EMCA 2Y24A 2D22A 1Y0EA 2E68A 4KCWA 2EG8A 3VI2A 2NQJA 2C6QA 3EOSA 2IQ0A 4ACYA 3THCA 1JYVA 4J27A 1GTEA 3EMZA 5C2XA 4GISA 3PWAA 1EX5A 1PTDA 2RDXA 5EFDA 3EDEA 3AMLA 2XVGA 4LFYA 3KRZA 4HYWA 3MCNA 1A5MC 4LEFA 4US5A 4AZ6A 3GH5A 2DDXA 1E0WA 4C65A 2V6AA 4LJ3A 3GXTA 3RNDA 3QKEA 4JNZA 3GXMA 3I3EA 3SIZA 2A79A 3QVQA 4IP7A 4WSHA 1KCXA 5EU9A 3ZZ1A 1KXVA 3GDKA 5T8GA 4S3DA 1O1HA 5JH1A 3AHXA 1L6WA 5G4HC 4JTFA 4YMZA 4YS1A 2A3HA 1ZCCA 3N73A 3DBNA 4M5PA 5I6SA 1J96A 4OUEA 4MFEA 2INEA 9CGTA 1XUUA 4WDUA 3DG6A 3GTXA 4M51A 3RX2A 3TWBA 1CDGA 1S2CA 1TWSA 3T0TA 5AB3A 4TX6A 1KXHA 2H6RA 4ZOEA 5I06A 1RCXB 3ITXA 2Y61A 5BRQA 5CSYA 5DRCA 2HZGA 1WUEA 2G3MA 2PDBA 3NPVA 3F2DA 3NQ8A 1ME9A 2ZX9A 1QPNA 1M3UA 3DENA 3VD4A 5TIMA 1U83A 3CIWA 2PE4A 3L0KA 1PEZA 3FJLA 4QG6A 2C15A 1H0IA 4A05A 2PDQA 5D8WA 3EPMA 2CZ5A 2PTWA 4AD0A 1F2JA 4J40A 5DXXA 3BOXA 2NQLA 4D2JA 3CL6A 1E1CB 1UD5A 3ITTA 3FJ4A 2DVTA 3TWAA 4H2HA 2JKAA 4AIEA 1KGWA 4H9TA 3KVJA 5E5CA 4HHMA 4J3XA 3RDKA 4X0VA 1I1WA 3EOLA 4WRHA 3BH4A 4HTBA 1SYTA 3Q65A 4FX8A 3KXQA 4M7TA 1YYAA 5KZ6A 4AYGA 1R3WA 1OADA 5FF3A 3SDOA 3WFAA 3MJYA 5A94A 1W9DM 3UP8A 4CQAA 1TJRA 5KZDA 3VDGA 1HJXA 3FAWA 4X61A 4ZB2A 3ZJ6A 1QPOA 3BQ5A 2CHOA 3KBJA 4ZSUA 3WJYA 1M53A 1R85A 3FKRA 3H2OA 3UYCA 2VX7A 3B3DA 1FCVA 1UBPC 3QR1A 1UUOA 1ZBWA 4AEFA 2BB0A 4D8LA 3A4AA 1BSLA 4GQGA 4AU0A 4D9PA 1H11A 4OVXA 2C79A 1LLWA 1JF6A 4ZGYA 4UTWA 3EB3A 2JEPA 1CGUA 1QPRA 3KX6A 1E55A 1Q3NA 4PN2A 4H6RA 3OBKA 3R1ZA 3T6CA 5D02A 1T99A 3WYZA 2IW0A 4DYKA 1TPUA 2GVJA 2XVPA 3ISIX 3MSYA 1H3GA 4FLQA 5CGQA 1K4HA 2GQ8A 5HAOA 3DEQA 2AQOA 3DFSA 2PTZA 1XSJA 3CLWA 3CH0A 1YNYA 2V3FA 1IIGA 3TMQA 3W27A 3SW6A 1ZJIA 2PGRA 2VCCA 3CJPA 6ENLA 4HZ8A 1C8YA 3O6AA 1FBAA 4DB7A 1FWEC 1XCWA 3H22A 3FA5A 3OYXA 4B3LA 1LL4A 2WVUA 4M0XA 1ECQA 3RXZA 3WUFA 1MXDA 2RH9A 4QFUA 1V0MA 4EE9A 5C6MA 1AODA 4TVUA 4RR4A 2P5NA 2HCVA 4DEFA 2XUCA 5EGRA 3V36A 4WY0A 4KQNA 3N2BA 2GJXA 2GFTA 5A6SA 4TTGA 2V8ZA 3P5ZA 5K4XA 4Z2GA 2X0YA 2J7BA 3UJRA 3NDOA 2VDIA 3B0UX 3UPWA 2WSRA 1DKWA 4ALDA 4KERA 3NQGA 3RX4A 3MZ2A 4PCNA 2NX9A 1FX6A 4AXNA 3MKVA 3MDUA 4X0NA 1CWYA 1XLHA 4Z17A 3LCXA 2RDUA 1KBJA 4HCDA 3LRKA 4DVOA 2FFCA 4YJ5A 2EQDA 2VUNA 2QJMA 4FOUA 5DO8A 1VLWA 1K9DA 3VZXA 4ZFMA 3V5CA 4LCSA 3W74A 1KWGA 4GJIA 3FIGA 1RV8A 3FJNA 3VKKA 2OQHA 5BXSA 1ZALA 4R9XA 3MU7A 4Y9PA 3RLGA 5E9XA 5JVLA 3LZ5A 3NPWA 4I9MA 3MYPA 3NEHA 4UMBA 5LGXA 1UWSA 4BI6A 4XBKA 3LPPA 4ZO9A 2FJUB 1TWIA 1WDQA 2YB1A 3UZJA 3USZA 3BLLA 3U2EA 3WF0A 3NL5A 3VIFA 4HT3A 2R1MA 4JZ5A 4WZHA 1JZ3A 4GXMA 4NAFA 3T2OA 1L8NA 5I03A 2I14A 2VVNA 3KBVA 3OW1A 4NUWA 3H2FA 3P67A 2DZVA 3TOYA 1AQFA 1OFDA 4P8UA 4IMDA 1VIZA 1W3HA 4Q8NA 3EDDA 5FL1A 4PTNA 3BLEA 2PAJA 1JAEA 1IR2A 3TN5A 5C7HA 5I3IA 3U5YA 3A6OA 1PX4A 1Q63A 1BEUA 1DV7A 3VOGA 1V7YA 2V0TA 4G9PA 3MUZ1 1QBBA 4NJHA 4IIEA 3S2CA 1V77A 1UQZA 4PMJA 2YFOA 1Y7VA 2WVSA 3DCPA 4IQLA 1NIUA 4O0KA 2OLSA 1D3HA 1EBHA 3UWVA 1T0OA 1S1PA 3OHMB 1JCJA 4WXYA 1WKFA 1EXBA 1Y5XA 3KZPA 1J0KA 2G41A 1XC6A 1DWJM 3SN4A 2PTYA 3NDYA 2IMRA 3DFQA 3ID7A 1ZPTA 1WOBA 2ZUWA 3GFZA 3CPGA 3GU2A 4MB3A 5E9AA 2E9LA 3G2GA 5BZAA 1EJRC 2NQ5A 5M2FX 4AD5A 4EVZA 3AWNA 2TYSA 2C7FA 5D37A 4Q4RA 4HNUA 3LERA 3W83A 1Q4NX 4DF1A 3B9AA 1M1BA 3CTLA 3NM3A 1GQJA 5A6KA 4EPDC 2BHUA 2NV9A 1X6LA 1J0HA 4G7FA 3WD0A 1VR6A 2IUZA 1RK6A 4MY8A 4BZYA 5TQLA 3P60A 4Q8UA 1HN1A 2REQB 3AU6A 1P48A 2PWUA 3VGHA 4YVXA 4V28A 3S9IA 1OC7A 2E6AA 4ZQNA 1RLDA 4JTLA 2O9RA 4MADA 4NZ4A 1I75A 5LA0A 1EZ2A 1WDRA 1YXYA 2Z28A 4FP1A 2DJLA 1F74A 4O4VA 4F0SA 3UCQA 2ZDSA 3H4WA 2J27A 1J2BA 1DORA 1L6FA 3SI9A 5FL0A 1UZ1A 3LDVA 1ODZA 3A23A 3PULA 3NZGA 1W2PA 1KFEA 3H8AA 1JZ5A 3UXDA 1XLKA 1JDFA 3W0KA 4QE1A 2Z7KA 4H4IA 1UOKA 2GJNA 4UFHA 4GIAA 3H7UA 4HNTA 5AHMA 1FFQA 3EXSA 1AQMA 1JPDX 1KFJA 4K2SA 1K6AA 2EG6A 4DPPA 5AYZA 4JYFA 3QHMA 1QNOA 1O5QA 1VB9A 2NWRA 4UR7A 1K7FA 1UP3A 1XKYA 2O56A 3L4YA 2XGIA 3H6OA 1JUEA 3I4EA 5CG7A 3MW7A 1BWLA 2NZLA 4L65A 3SCWA 2HS8A 1CLXA 4UZUA 3NQCA 4I9TA 3GDRA 1PVNA 5CBIA 1X96A 2X1UA 3GR8A 2CYGA 3WFLA 2ZKMX 4PCTA 4XVDA 1FVPA 3BLOA 4OKDA 1KTBA 2OMAA 3CGTA 3T4CA 1OCJA 3FVMA 3QPYA 3SRFA 4IZGA 4IIFA 4FNPA 3W1LA 2X0HA 2W92A 3BMWA 4FSAA 1XIHA 3P82A 1Q7QA 3RLHA 1OF6A 4XD5A 3RPTA 1O94A 4BEUA 3HQOA 1R6WA 4BA0A 1QNPA 3CPUA 3W6MA 4ZFCA 3IS4A 2CCRA 1R46A 4IMEA 3H23A 2DT0A 3ANUA 3ABSA 5HINA 3CXOA 1XFCA 1OFBA 3VIMA 3C2FA 4JTQA 4EIVA 1DHKA 4NX5A 1E5NA 1MDLA 3W84A 1GG0A 1OK4A 4JFVA 7CGTA 3LQGA 2QAPA 3N4FA 3UYIA 1R3YA 1GYNA 1NDWA 2QF8A 4FALA 1KKOA 5LKYA 3MT1A 4JEQA 3AZRA 4RL3A 1ONRA 2YSWA 3RPMA 3U7BA 3M5XA 1XLBA 3GKFA 1LUCA 4XIAA 6XIAA 3LCLA 4ZO7A 4LUSB 2WJFA 2QW5A 2NQ9A 2R1LA 2Z1BA 4Z08A 3GAKA 4ADTA 3ITOA 3ZMRA 1E5JA 1E6RA 3SCTA 1CZ1A 3WUEA 2WKJA 1V3HA 4L6HA 1I2QA 3NQ7A 3OLIA 1EJWC 3EX3A 3V5FA 3CAKA 3DKJA 3L5LA 4QG9A 3GVVA 2C0AA 3ANYA 1IEQA 1QW8A 4PUWA 3W1RA 1HIZA 5HK4A 4W9TA 2FYMA 3WKZA 1G5AA 1Z89A 5DBUA 2J7FA 3GVGA 1HP5A 4AX7A 1Z3NA 3WQ4A 2OYKA 1GVRA 3HQNA 3N25A 4MB5A 1RPKA 4Q4KA 5HA7A 2ATMA 4K7VA 1QAPA 3P7YA 1POJA 1XG3A 2P53A 3H54A 3HQ1A 4INFA 5HOSA 2IPWA 3VGGA 5CAKA 1SO4A 2WM1A 1NFBA 5FCZA 2UBPC 3EKZA 3QYSA 2D23A 3UEQA 3IK4A 1FH9A 5REQA 4BWLA 1ESWA 3QBUA 1MNZA 5ABHA 3QPZA 2X40A 1RUSA 3QM3A 2PDUA 2PU0A 1W9UA 2BASA 3OTRA 2PBOA 4EF8A 1OCNA 1MZRA 4UQBA 2EPOA 3GM8A 2CEQA 1X8FA 1YIXA 4S3AA 3V16A 4C1KA 4DJDA 4XAPA 4P7RA 3FCPA 3WLMA 4CCEA 3A9IA 2ATSA 1QJWA 4GOAA 4GE8A 2IKJA 4LBRA 3S8HA 2I57A 1OGBA 2NSOA 2E67A 2AQVA 4NI8A 3SUSA 2YCJA 4DYEA 2VQUA 4WHBA 4N0RA 1OIMA 3L5AA 4I3GA 3QV8A 2QDGA 3LHWA 1Q66A 4FX7A 3UXAA 4AVOA 3VCCA 4M6QA 4BEQA 1FH7A 1H7NA 3WZ0E 3LX9A 4E4PA 3R89A 4XAFA 4B91A 1AZ1A 1FWCC 3M0JA 3UZ5A 3CHEA 4YTTA 5E70A 1HJSA 3QOMA 2DZUA 3N6JA 4R33A 1F6KA 2XSBA 5CC5A 2ZRYA 3B05A 5EB8A 3UNDA 2J7GA 2PDPA 3BGGA 7TIMA 2PEVA 2QCNA 3AUJA 2W0UA 3K4AA 3EOOA 2OLHA 2CBVA 3T4WA 1HT6A 3GIYA 4O12A 2DVXA 2VC9A 2OO0A 2QCCA 1GORA 3F5JA 4OECA 1E71M 4WOZA 4LCRA 1VH7A 3RPDA 2FHFA 1GKRA 3IEBA 4FLRA 1E6PA 2FMNA 3TE9A 2A5HA 4PEEA 1I6NA 1RBOB 2D2OA 3GVRA 4KBXA 2W3ZA 1PDYA 4F3HA 4TVCA 4OUIA 1I45A 4IXXA 4ZQMA 4QCFA 1LOQA 4LY4A 5FOOA 3F4VA 1EJXC 4J3SA 3A9BA 1TO3A 3JR2A 2WSKA 1VRXA 3K2GA 1HKVA 1UIOA 4MLRA 4W8BA 2PGFA 3SUUA 4YN5A 1UB3A 1LRNA 3CWNA 2XM2A 3SN1A 4KWUA 2ZCGA 4YXGA 4PMVA 4PCSA 5DELA 1JPMA 3WF2A 1LZOA 4MAVA 4UFIA 2DT1A 3IUHA 1E1EA 3WLPA 1ISVA 2WZMA 4HU4A 3QJAA 3S9ZA 3W1XA 2XWEA 5BWAA 3CZ8A 1SMAA 1ZBCA 2ZRXA 1JEZA 4MUZA 2CHRA 2J24A 1PSCA 1A5OC 2VRJA 3STFA 5CAHA 2WCSA 3RFAA 2HNEA 1TE1A 3QFEA 4LOCA 3PFMA 1JVNA 3UW6A 3O3RA 3BG9A 4LGXA 4MG4A 4UNIA 2Y85A 3GBDA 4GVFA 1Q6FA 3W1QA 5A6BD 1F6YA 4LNYA 3VMOA 4QSFA 1X7IA 3W7RA 4HK6A 5CC6A 2YCEA 4NNAA 3VFCA 4J3UA 2YDRA 3SSZA 3WK2A 2INFA 3URBA 3QV9A 4UQDA 4UQEA 1PUDA 6TAAA 2YPIA 3VNZA 4O11A 2XG9A 4S2CA 3GS6A 4LS0A 4MHBA 2BWGA 4ORIA 4HSNA 4AW7A 3IVUA 4O0ZA 1IXOA 1XDMA 2WZIA 4MYAA 2AAMA 3VDCA 4AZHA 3UWUA 3KOWA 1F61A 4AD2A 1EDGA 4R3UA 2PTXA 5G2HA 2F8QA 5M03A 2A0NA 3S6DA 3TXVA 3N2OA 1M01A 3PNZA 2B7OA 5TBOA 1U1UA 1QNQA 3VOCA 4NAFB 3RILA 4AHQA 1XIMA 2ZX6A 2HNHA 2DW6A 3UU0A 4AD3A 2FKPA 3W2MA 1W8SA 3NSXA 2J9XA 3E12A 3N4AA 2GDVA 3BG5A 5CPOA 3M4HA 1BG9A 3DXIA 1PHQA 3V75A 3W81A 2D20A 4M6VA 1TREA 2XU2A 3CUXA 3JRKA 4E38A 2NSXA 4U33A 4LS2A 1TPFA 5FSDC 1ZJBA 4B5WA 5RUBA 4N02A 1UMLA 1H61A 2R24A 5MKGA 3IGUA 4JIIX 1Q7ZA 5EFFA 3HMJG 3IIVA 4ICNA 1EO5A 4ZE4A 3MMDA 2QCEA 8XIAA 1EL3A 2I5QA 4BJHA 1ZY9A 3E2QA 2GK1A 2W61A 3VNLA 4J7RA 2ZICA 4J3VA 1QUMA 1GG1A 5IDZA 3KOZA 4BF9A 4DXVA 3KBWA 3C0QA 1XSIA 1PKYA 4XTIA 2WQDA 4OFCA 2ABAA 1BKSA 3WJSA 1B3OA 1FCUA 4Q22A 1PKLA 4KCTA 4M1RA 2EPLX 3LBOA 4GUIA 2QAFA 2BZNA 4O1BA 1LG1A 4HHHA 2HK0A 1DE6A 5J04A 4NI3A 2H8ZA 3GNNA 1ODUA 4NNBA 3HN3A 1Y8BA 1QU4A 7PTDA 6ALDA 1KKRA 3GDTA 3HJZA 1Y5VA 3WO8A 3DHPA 1UC5A 4KRZA 2FHBA 2QUNA 3VKCA 5BOOA 1E9IA 1EHNA 1ALDA 5FA5A 4TX9A 3TC7A 3ZIZA 1V3LA 4BHYA 2Z1XA 3M46A 3WNPA 5FJOA 2WAGA 2WZTA 1UH3A 2NV2A 1OEPA 4MAZA 1HKWA 4K1GA 1D3CA 5K9XA 7REQB 4I90A 2OSXA 3ARYA 3SO7A 3BTNA 5A1AA 2VHLA 2PDIA 5KTLA 2A21A 1SZEA 1MUWA 2UZ9A 3I68A 1XRSA 3TTOA 4BCEA 3TAKA 3B0VC 3M16A 3FNDA 3AOFA 1UP0A 3ZVHA 3AS1A 1V6YA 1FFRA 5FF7A 3EKLA 2JQXA 4NVTA 2PC4A 4U4MA 3WDPP 2VP8A 3Q45A 4S3GA 3GIQA 4X3ZA 1B31A 5D2XA 3MUXA 4XAZA 3MSRA 1X38A 2VMFA 1PPIA 2WMGA 1BPLB 3TQKA 3QC3A 2R94A 1VYSX 4HNVA 2WJEA 4QAWA 5BWFA 2WZHA 3B8TA 3PZMA 4WGXA 2ZTJA 2CZDA 3JVAA 2QGHA 2VO5A 2PWHA 4FO4A 4A3HA 4OOUA 1FH8A 3L4TA 4V2XA 3TLLA 1VQTA 1UOZA 2PLCA 4RLIA 4FIQA 1H1ZA 4E8CA 5A2CA 3QGAC 2GUUA 3MUCA 3NL6A 4F2UA 3BGAA 1GJUA 4LUJA 1XISA 3UWEA 1PZ1A 1CECA 3ZQ9A 2V30A 1VZWA 3KL0A 3LHYA 1AA1B 4HPNA 3CZGA 4GX9A 3HMCA 5GPRA 1XH0A 3NZQA 2ESCA 3GXNA 3QTPA 2B0MA 2CW6A 4H6KA 2XH2A 2V5CA 4AMAA 5BW6A 2YXXA 4QG8A 4B5XA 4RPPA 5I2UA 3IUIA 3S1WA 4ZO6A 1JPHA 4D72A 3LUTA 3FHQA 3T42A 3GUWA 1FCQA 1H50A 2A85A 2X09A 3O05A 2QKFA 4GIRA 4MPKA 4GKTA 4MKNA 3C5QA 4G2DA 5MHBA 4IWWA 2OKTA 2XJ7A 2YYTA 2PDWA 2EGZA 4BFAA 1EIBA 3MMTA 3POHA 1FDJA 5BXRA 4AZ5A 5DFAA 3WBWA 1GKPA 5KZEA 1U5JA 3IAPA 4OBTA 4XKYA 4QNEA 4ZOAA 2BMBA 2GLKA 4GD0A 3U4AA 3LTYA 4EP8C 3K1DA 3NQ6A 3SR7A 3LENA 3HPXA 4QRNA 3THUA 1VFMA 2WXDM 1G4PA 3EX2A 3TJLA 2DVUA 1GWJA 1W5QA 3S6TA 3S3GA 1BG4A 1E6XM 1F3WA 4GH1A 4W7UA 4HKPA 1A5KC 1SVDA 5BOEA 2PWEA 2XSAA 2E3ZA 2PCEA 3WDJA 1VPXA 5TNVA 1JDCA 1R47A 5C54A 3WDQA 1YX1A 3WD4A 3ARVA 5LXXA 4FNUA 4XK2A 1YLVA 4X9YA 3R11A 4KWVA 3EZ4A 5SWUA 2J7EA 1SO3A 4MPQA 4PULA 1IYXA 3DAQA 5FF4A 4JIEA 2YA2A 4LVFA 4AZCB 1TPC1 1HO4A 3H53A 2BNJA 4U5IA 3M0KA 2C3ZA 1Q7MA 1RQHA 3JZUA 3GU9A 4X2RA 4V15A 3G5EA 3NURA 1OX4B 3CHCA 4JQ3A 1LBMA 3UG3A 4GI8A 4F9JA 5KSWA 3MP4A 4CD6A 4ZTXA 1DQUA 1X6UA 1OZQA 4GI6A 4AD1A 3CWHA 3W3OA 1V03A 3ONCA 1EJUC 5G1MA 3PSVA 3G0XA 3BE7A 5FI8A 1BLIA 3AO0A 2QJHA 3PPHA 3SFWA 2WMKA 4JN7A 1WO2A 2V3GA 2XGBA 3VX1A 3DG7A 4XZBA 2JK2A 3PR2A 1VFLA 4GACA 1G4SA 2HE5A 4GCXA 3HV8A 1V6WA 2XSXA 3M47A 2FPTA 4ZSTA 5BROA 3UVIA 1TVLA 5I3JA 2CKSA 4GNVA 1TQXA 3JS3A 1AJ0A 1RJPA 5FESA 1L2UA 1WCGA 1AL8A 2E5BA 1UKQA 2OZ3A 5BNKA 3LMZA 3B8WA 4H6EA 3RUBL 2BOGX 1HXJA 1UA3A 4JCLA 3T07A 1A4MA 4UFLA 2OZTA 3MMWA 3ARUA 1X7FA 1JXJA 3HG2A 3CYVA 1TA3A 4AYSA 3WLHA 2Q8XA 3ORWA 4Q3MA 2OQYA 3JUGA 2BHYA 1FWHC 1V02E 1ZUAX 3LA4A 1DJGA 3STGA 4H9XA 3I10A 1CT5A 1VRDA 3GC5A 1SZNA 2HSAA 3LGDA 3MWAA 1LUCB 5AFDA 1TVPA 4DO5A 3V35A 5C9ZA 7ODCA 1YRRA 5AECA 5I5RA 4PODA 1Q5MA 1ITCA 4XAGA 4I9JA 3LPOA 3GRIA 4S23A 3U2CA 1QNRA 3OBEA 5ABFB 3W01A 2V3EA 3B8DA 3GU1A 3AMCA 3OO2A 1FWSA 1FHLA 3E5PA 3GK0A 2V5LA 2WNWA 1JIBA 2DV0A 4CU7A 1I0BA 4C6LA 5CGMA 3SIMA 1CXFA 2IS7A 1GVFA 1KR0A 3W7DA 2BXYA 3G8EA 2DH2A 4JPGA 1B54A 1BRLB 1MUMA 4PTXA 2BY3A 3WL1A 2JFEX 1GVIA 3GVQA 3W87A 3PZIA 3H2AA 4O13A 4Q6XA 1W1A1 3SY1A 3CEUA 4H9YA 4F48A 1F3EA 2PCQA 4G1NA 5LHEA 1FWBC 1PKNA 2GPTA 5HNNA 1FDZA 2YA0A 1ZB5A 1VFHA 1JUKA 3HA1A 2OWCA 3WQOA 4C6KA 1KC7A 1FWAC 3EAUA 1SW7A 1CXKA 3N13A 2CC0A 1UASA 4PL1A 5LIKX 3VINA 3P6LA 3V0TA 1W5MA 3OVRA 2Y8KA 2JE8A 4GNJA 2D73A 2E9MA 4LNCA 4OV4A 4WQ6A 3RIKA 3EBVA 5BOFA 1G94A 2X05A 1TTJA 3GZ3A 2ASHA 4QJ1A 3WQGA 1I60A 2EJAA 3G0UA 5IBXC 4DUWA 1EEXA 3WH7A 1R9ZA 7A3HA 3DI1A 4NZJA 4GBDA 3SGGA 2J4GA 3CEPA 3ITYA 3CQJA 1GZJA 3E74A 2J7DA 3UG8A 1JZ2A 1DXIA 3R7MA 4MB1A 3OU8A 5FKYA 5J5DA 5I3KA 4LC8A 2CLIA 4QXIA 2ISWA 2VTFA 5H91A 4XWUA 1OC5A 1U5HA 5CSSA 2PLJA 1GQKA 1QW9A 2ZA3A 2J8FA 3AQUA 4U2ZA 5D8ZA 3QQ1A 4UB9A 2CBJA 4CU6A 3R25A 1E6ZA 1WE5A 4H7VA 4XZ9A 2VRQA 1M68A 4YWSA 3FDGA 2TAAA 1GOKA 4OV9A 4V33A 1W91A 4TV6A 5I3GA 3BC9A 1EPXA 2X1RA 1HJVA 2J7HA 5FJUA 1EXPA 4L1GA 2CLPA 3ECQA 1P0NA 4FI4A 3BCDA 1WDDA 1M04A 2E25A 4JNYA 1BKHA 3WIJA 3MHGA 4M80A 4DWSA 1UQYA 2WM0A 3B9DA 3GDBA 1YDOA 3W7EA 5C7VA 2ZX8A 1FTXA 1TJ1A 1OGSA 2YB4A 1VGAA 3VE9A 3RM9A 3OB8A 4WLCA 5A2AA 1WP6A 3F4CA 4YVPA 2GDUA 3LRLA 2J6XA 3VC5A 4MYXA 4D1IA 1EJSC 4KGJA 3KS5A 1PZ2A 3DERA 1UA7A 3UCCA 1ZSXA 4GMEA 2VM8A 1CLVA 2DUXA 3I6TA 4JIPA 4NZ5A 1FY6A 1DBTA 1EH9A 3VIJA 1UWUA 1M7PA 4KGLA 1TUFA 1XL9A 3N9SA 7REQA 5J5RA 1HKIA 1TRDA 2PURA 1WAWA 3QQ0A 1N8IA 4FXJA 4K38A 4IF2A 2X1SA 4JQ1A 5HATA 1TWZA 2P8CA 2C71A 3SJ3A 4HMCA 5AOUA 2EXOA 1GOOA 1OFPA 1YNQA 2C0HA 4ZXOA 1UKOA 4FX6M 3B0XA 3UD6A 1AMKA 4F8XA 1JCNA 1DWIM 3H24A 4PSPA 3WX7A 3ALFA 1KM5A 3WELA 1SMDA 3F4NA 1AW1A 2CNCA 3MDWA 1KR1A 1H63A 4IIGA 1RBAA 3VNIA 5AC4A 3RU6A 4NAEA 4JFWA 5ECUA 2Q8LA 4RDYA 1GVYA 1RD5A 1R0MA 4HJFA 1G7VA 2J75A 3A5VA 2WNNA 5LNUA 4QTGA 7XIMA 3URQA 2D2HA 5U7SA 4ZQPA 3NPUA 2Y7GA 1KBIA 3QHOA 4HYRA 4C60A 3BAJA 1R7OA 4PBFA 1VFUA 3KTSA 2OU4A 2ZC8A 4LSBA 2XHYA 5DY3A 4WY0F 4L9ZA 3NTYA 2W66A 5TD4A 3FSTA 1DJZA 1E70M 2POTA 2HISA 4IMCA 1VEPA 3LHZA 4AZ7A 5FJPA 4JKKA 4ML9A 5LIUX 3DG3A 1YE6A 3VXGA 2E0PA 1QI4A 4QP0A 4LF1A 3DZ1A 1P0BA 1QI3A 4Z1CA 1HTIA 1V3KA 1BXNA 2C13A 4XD3A 2ZXQA 4TUFA 2O7QA 3PWIA 3UBPC 1DHPA 1WDPA 4IISA 1V0NA 2QJJA 1C8QA 2CLLA 1PJ9A 1PL9A 3B4YA 3CNYA 1FUYA 2FZ8A 4IGNA 2VWSA 1M7JA 4Z2KA 3CT7A 1A49A 4DBUA 1KTNA 4UTLA 3TFXA 3G3MA 1JDDA 1ADSA 4W4QA 4NF7A 4E4FA 1JD9A 2I16A 3S9YA 1W32A 3TYCA 1F5ZA 3CT2A 3M6YA 3SURA 1PB0A 3SCOA 3HQPA 3SQLA 5D09A 3W29A 4A8RA 4WJ8A 4AWTA 2HRWA 4PUEA 4A2RA 3SQMA 2E9BA 3BAXA 3L5MA 3IUDA 2GYIA 4WKFA 4X63A 5C9WA 3UR8A 1OFAA 3FK4A 1L9WA 3LZ3A 4ZO8A 2D69A 2OX1A 3WLRA 4Z2HA 3NUKA 3KUMA 1V6UA 4KKXA 2E7FA 1XGZA 4JNMA 2CXGA 1GW1A 2ALRA 4A3UA 2E6FA 3WH9A 1YXCA 1JZ6A 1P1MA 3WLNA 3AXHA 1A5AA 5I24A 4Q4PA 3AIWA 3O1NA 1ZENA 5DLCA 3VCRA 2FTWA 4GFIA 2CESA 4AWEA 4MJZA 1NWSA 3I7RA 1BD0A 3W7MA 2Y7DA 4G8TA 1KM2A 3D0CA 1GEHA 3UGVA 1YQ2A 3NO5A 2ZZ1A 5F4XA 5G1TA 2FGZA 4Y8EA 3E49A 2WKLA 4FEZA 1SSDA 4YL2A 2HVNA 1DXEA 1PV8A 2J66A 3MANA 4MVAA 3L4XA 2OJPA 2CLOA 4O1FA 1XYMA 5HWNA 2B81A 2VFIA 2FVMA 2VX4A 3ZSTA 3CUFA 1JPKA 4F0KA 4GH3A 3Q2DA 3SRHA 2QZRA 3CMJA 3NFUA 2CPUA 4LUSA 1IXNA 1EGMA 1WZAA 1WX0A 4DWSB 4PCPA 1Z44A 3T05A 3UZWA 1XRTA 4JYEA 2WJZA 3I3DA 4P8XA 1CIUA 2G95A 4S3EA 2ZXAA 3P0WA 4AWSA 4N2YA 1K70A 3FX4A 2G5WA 3G3DA 1K7XA 2OEJA 4JGDA 4R7OA 1ISWA 3UNTA 2CHNA 1YBQA 3DIPA 4WR3A 5HBFA 1UR1A 4QQ3A 1KXTA 3A4JA 4QITA 3SADA 3BCFA 1M41A 3N3TA 4J5NA 2YYUA 5D2YA 3UGRA 3AC0A 2QULA 4UTWC 4A4AA 2C91A 2AGKA 2Y62A 4ES4A 2WLYA 1W8GA 4HGXA 4NIRA 5JBDA 2Y5SA 2V69A 4JKMA 3TR2A 1FWGC 4UMAA 3C2VA 2AAAA 2Z2AA 5DANA 3M5YA 5HJYA 3H7RA 1QK0A 3TN3A 2A6NA 4F66A 2NQZA 5FJTA 1WBHA 2QMKA 2MUCA 3AS2A 3NWRA 4J9JA 3PNUA 3TJ4A 1NU5A 3LCIA 2FZDA 3AWOA 1FWDC 2DQWA 1GPWA 4A21A 4A6GA 1XLDA 2TRSA 1C9WA 3NGJA 1T40A 5HANA 4DZ5A 2OXNA 1TYGA 2Z1VA 3BURA 5CQ1A 3M1ZA 3HPSA 3UPMA 3LV5A 1AQHA 4GYPA 1ISZA 3KL3A 2FGBA 4HOWA 3LI1A 2WHJA 3KFTA 2ZRVA 1UMYA 4NJIA 3KLKA 3WN6A 4IG2A 4XB3A 3CBWA 2XZ7A 4JDYA 1T96A 4YPJA 2RHGA 3A22A 5FJIA 4HVXA 3DFYA 4XIMA 5H8PA 5CZJA 4N9DA 1B1YA 4JTGA 2QV5A 3PZNA 4XVEA 4OT7A 3F2CA 3ZSSA 1RVKA 5C55A 2ZQ0A 2CETA 4D6GA 4L6OA 2OYLA 4ICCX 2VGFA 1W2VA 3C61A 4JTUA 3WLLA 2QIIA 1G4TA 4UTFA 4D6CA 3GG1A 1Q6RA 4O1CA 3RN6A 1CXEA 2NUXA 3WJXA 4QQUA 3CAWA 4XZMX 3PPFA 3VFLA 1AZ2A 1JQXA 4JFTA 1LLZA 1MW3A 4ACZA 2DT3A 2X7VA 3CL8A 2V5JA 2Y89A 2EPNA 3NO1A 2WMJA 3VE7A 4IFOA 5HPOA 3CIXA 3HGRA 1SFSA 2XH7A 5DXYA 1W5PA 2EKGA 3CLMA 2GOKA 1E0UA 2NX1A 1KB3A 1T6MA 4GC4A 4QROA 3DH7A 1IR1A 3KW3A 3PBYA 4Z0SA 3VUSA 4DN1A 2J25A 5CPLA 1ME7A 2QCDA 1R5YA 4XD6A 1S2TA 1Z32X 2O7SA 5CZKA 1OX4A 2PA6A 3AFBA 2HTMA 2HJPA 1BVWA 1TSIA 1FP9A 3D3FA 3VO0A 4HA4A 3VZZA 2QVHA 3UA4A 1KCKA 3I7SA 4JD4A 1K8ZA 1FWRA 2GWNA 1H7PA 2G37A 4R88A 3QY6A 4WXZA 2VD9A 1JYWA 3L4WA 4LBSA 4HMDA 3RRXA 1D3GA 3CO4A 1CGXA 2NUYA 2GGIA 2A3LA 2X0SA 1KNWA 1FA2A 1E72M 4Y9OA 4MJMA 1JD7A 1P6BA 1KA9F 4D1JA 1QCWA 2WSYA 1OFOA 4LTSA 4YNGA 3ITCA 4I5UA 3SCVA 2VFGA 3N2MA 3W71A 1OINA 3GFXA 4H6QA 1ZBVA 1SSGA 2TPSA 5I07A 1JJKA 1XCFA 3NQEA 3WLIA 4IFKB 1TE6A 3L23A 2DZAA 5TF0A 1K03A 1DPMA 3BLIA 2PDGA 4WDTA 2JGQA 2HMCA 2ZBTA 3UETA 4HCHA 2BXZA 1NVMA 2PFHA 1REQB 2Y7EA 3EX6A 3ARZA 2J88A 1OT1A 2YDQA 4HNOA 4KEVA 3NQDA 3O6CA 3VPLA 4J3ZA 1MNSA 2W79A 1YTDA 3S2NA 4RX0A 3L0NA 4JL2A 5T9CE 3S1GA 3PUEA 1VBUA 3FHAA 3M07A 2J47A 4IMFA 3VX0A 4WF7A 3IIPA 3SM0A 4CLMA 3QEZA 1PCWA 4QJ5B 4KRTA 3U5UA 2PS2A 3D3AA 3G1RA 3APYA 3QF0A 1EP1A 1U1JA 2E1DA 4N9BA 2WCGA 5AHLA 1XP3A 4PR4A 2P76A 3DYMA 4B4FA 3ME3A 1EJVC 1J2WA 3W86A 1NDZA 3HPFA 1XC4A 3HU7A 1JXKA 3QV7A 3PY2A 3W75A 1J5TA 1YTKA 3OODA 4PL2A 3RCYA 5A6BA 3T1GA 2PDJA 3IIZA 4L56A 1ITXA 3W7IA 1CW2A 1L8PA 2OGJA 1JCYA 4DUXA 3V7PA 1VJZA 2VZUA 4E0CA 1TPVA 2O55A 4A3QA 2BY0A 4MOZA 5F2GA 1Q6LA 1E3ZA 3MCMA 5E0CA 1UD2A 3LNPA 3G1VA 3QR3A 2WVVA 4C6DA 1X1NA 3RMJA 3MUIA 3W9ZA 3GZAA 1W5NA 4H9UA 3WNMA 1XYCA 4H9VA 4Q4OA 3GYCA 1OYAA 4LPCA 1RCQA 1MRAA 3R6IA 1W17A 3SRDA 4AD4A 1D9EA 3EB2A 2JF7A 4C90A 2R1PA 2AQWA 4U3AA 2I5IA 1C93A 3C0SA 2C1GA 3TW7A 4NG3A 4IFRA 2J62A 1GKQA 2NUWA 3G8RA 4LVDA 3P61A 4P8WA 1FHUA 1M5WA 2VGIA 3GD6A 1UR3M 5A95A 4TX8A 2Y63A 1J5SA 5LNWA 3SUVA 3IJLA 1YPXA 1JG9A 4TV5A 4B5TA 4RXFA 2Z2UA 4D6IA 2XFWA 4IX0A 3TNOA 4DBSA 2C1HA 4PUJA 3TA9A 4PMDA 2GWGA 1VYRA 3NXLA 3TVAA 4Y9MA 2ZUSA 3TN4A 2V9DA 6A3HA 3EDJA 4R5EA 4UTIA 2J77A 3P93A 3KBSA 3UCDA 3WQVA 3ARSA 3ALGA 3VOFA 4ERGA 3QV6A 1O4UA 4IIHA 3CASA 4K8HA 1AW2A 5XIAA 4GVGA 5HJLA 3TN6A 1JPIA 4OBRA 3NR0A 4UTTC 4DY1A 2XFFA 1G67A 1YKWA 4P7OA 2D2GA 3BQ6A 3FEMA 3M0XA 2Q02A 1M9HA 1GYMA 1V4YA 1K9FA 5CBJA 3D46A 6REQB 3MTWA 3L4UA 3N12A 3P0XA 3CTTA 5LSMA 4DBWA 3PWGA 1WA3A 2DZTA 4NSBA 3C56A 4MDPA 4UR8A 1WZMA 1B2YA 1TX2A 1TV2A 3IJ6A 4KWWA 4P7NA 3W88A 1BVZA 1GPFA 3FAXA 1NWRA 5IDIA 3VOJA 5CLWA 2X7WA 4LCQA 1F3XA 4RNJA 3MHFA 1P6WA 4GVIA 4LQ1A 4DJDD 3L68A 4S3BA 2DW7A 2CBUA 3JW7A 2YLAA 3UQNA 3DU0A 3PJXA 1J79A 3NSNA 1LBFA 1GW9A 2NX3A 2H3DA 3RYSA 3HPAA 1KRAC 5AY7A 1EOKA 3FGCB 2UV8G 4HA1A 2GGEA 5E0FA 2HVOA 3W7LA 3A3XA 1QOQA 4Y2WA 4URIA 4CQ8A 1W3LA 1US0A 4PRTA 3BMXA 3PHAA 3P8JA 1OD8A 2QUTA 4AVFA 4LBUA 4IICA 3G77A 4GZ7A 1K9TA 2W4XA 1DIKA 3VD7A 3WDRA 5LIWX 1PYFA 2FDSA 2ZYFA 1RA5A 2Y8VA 5JU6A 1HF6A 3HG4A 5D9NA 1GCYA 1SQ7A 4FIRA 3SCUA 1EGZA 3UR2A 2BG5A 4GYFA 2OR2A 4UIOA 5EMJA 3ARRA 5T91A 1NP2A 4QNWA 4DLFA 2VC6A 3H2MA 1GHRA 2YLLA 1J01A 3LYEA 1C8VA 2DGAA 1KFWA 1ZBKA 3COTA 1XSKA 2W63A 4J35A 3USBA 4OQVA 9XIAA 3L9CA 1JDAA 4D71A 5BMXA 4D8ZA 1A5UA 1KCLA 1Q6OA 2PC8A 4WGHA 3PS7A 3V0SA 3O15A 1FQ0A 2QIWA 1XI3A 2L5HA 1NOFA 3LPFA 3ZJ7A 3M0HA 1VYPX 2XFRA 4XBJA 4FR1A 3S2LA 3UJEA 4I8DA 2P50A 4JX4A 2AKMA 5EBUA 1AH0A 2A3AA 2D24A 3RLUA 1GZ1A 4LANA 5AHEA 4YWIA 2EG7A 4JTSA 3SUTA 4JL1A 5FSEC 4M3PA 4E8DA 9RUBA 1WB0A 2CLEA 4GRSA 3MUAA 3C2EA 4LXFA 1W3KA 1XFBA 2A4AA 4CD8A 1C91A 1MQQA 3BAWA 3D5HA 1CI1A 2X16A 3W1AA 4PE8A 1QI5A 3HG3A 3HGJA 3G1FA 1CGTA 3QMSA 4PTWA 1NARA 1EIXA 3KHJA 4LY8A 3IJQA 4LV4A 1YEYA 1DQWA 1VFFA 2Z29A 3UJSA 4KFNA 1JRBA 3PB0A 3BV4A 1PIGA 3QZAA 1DL3A 4GUHA 1XG4A 3VIOA 3NL3A 3ZFHA 3S5SA 2VGBA 1PTAA 3TW6A 3S2MA 1OX5A 2XM1A 3BJFA 3E2SA 1O5XA 3WG6A 3ZYZA 3WEZA 1PHWA 1JF5A 3G1SA 5FF2A 4MGGA 5G2IA 1OY0A 4B3KA 3CC1A 4LF2A 3TH6A 3QC0A 1VCVA 1EF2A 1TELA 5D32A 3C52A 3V4BA 1EP3A 3W28A 1D8WA 2ZE3A 3DESA 3PZTA 3LN3A 4EPBC 4C1NA 3V5OA 1YPFA 3FDKA 5AZ1A 3N34A 3CHVA 2PDFA 1H51A 2FTPA 2SFPA 2CLKA 2YCIX 3P2VA 3EWBX 1JNEA 1NY1A 2A7NA 5DMNA 3ZT5A 4S3FA 1XIEA 3KTCA 1J0IA 1KW1A 4GY0A 1P5BA 1TIWA 4NXSA 1S1RA 3CU2A 3HBLA 3ZS4A 1A53A 5BYWA 1QHZA 2UY3A 1V6TA 4LYQA 5CXPA 1YBQB 4HOZA 1FP8A 4DUOA 5HPCA 1KM1A 1V3JA 1ZU8A 4TU1A 2W62A 3GYEA 5IRPA 1R9YA 3EX1A 3FW6A 3UWWA 1KV8A 3IVSA 1R3VA 3GC2A 3OGRA 3RG6A 1W37A 4FAMA 3VDHA 4AY1A 4N7QA 4CNOA 3KEHA 1OZMA 5CSUA 3DFPA 3OZMA 1SU5A 4J2PA 5EY5A 1CXLA 3BWWA 1DWHM 1ICQA 3NXFA 1KQYA 3LV6A 1EO7A 2ZA2A 3IACA 3W82A 4Z0JA 1I2OA 2HQAA 3AISA 4GQ0A 3CIVA 3A21A 4JTRA 4AC7C 1D8CA 5JUVA 2OEMA 3QGVA 2BOFX 4YTRA 3U8GA 4UTJA 2J6VA 1LLOA 4ML4A 4HPGA 3SRKA 3AIBA 1G7UA 2DSKA 4W5UA 2V2DA 2XWDA 5C70A 4FNSA 4B5UA 5CC7A 1KBBA 3IRSA 3AMDA 3BAKA 1JI1A 3M7SA 4Q4MA 3TC6A 3K4WA 4DBDA 1MFUA 4FOKA 3VKAA 1FWIC 1GVSA 2ZXDA 4XZHA 2FVKA 1TQJA 2CU0A 1U22A 3TMLA 3N2TA 3GE7A 2VOMA 1V0LA 4O57A 3TYDA 4L1XA 3LG3A 5KEZA 2VI0A 1EP2A 3OHIA 2Q8ZA 3WCZA 2RJHA 4LYRA 2BLEA 3QLDA 1RH9A 2G8ZA 4A8IA 2E4TA 4O52A 2X1TA 1G4EA 4N6FA 3IK2A 2VDGA 3VMPA 3W7PA 4KEZA 1MQRA 4WOQA 3B8IA 1LROA 4DUVA 3AALA 4ERIA 2WJDA 2QS8A 2YZRA 3T9PA 3SQSA 3DOPA 3KDOA 5A8NA 2RUSA 1NWUA 1E4MM 2MNRA 4FF7A 3WF1A 4LC6A 5AZ0A 3QR0A 3WD1A 1TRIA 1ONWA 3CZKA 4NJJA 4YVVA 3W7JA 5ABTA 4GQQA 3MZNA 1J12A 4PUMA 3GIPA 3L12A 3R94A 5FEPA 4TOQA 4GO8A 5BMWA 4JOMA 3GTFA 4ATLA 2QCLA 2GJRA 1D7FA 2ADAA 1I4NA 2BY2A 4PB3A 3U7VA 4H8HA 1B0IA 4K1WA 3L2IA 1UIPA 4C6MA 4FK9A 4LT9A 1TMLA 3E2RA 1GZGA 3F1QA 2X2GA 2FJKA 5A5WA 3N3MA 3ZR6A 3GAYA 2QDHA 1IGSA 3G6LA 5ABEA 4ZEPA 3PAOA 4CN6A 4C6JA 1OT2A 2H90A 3RO6A 4FF5A 4K36A 5DF0A 1KV5A 1WNOA 3HFYA 4PUUA 3W7KA 4L1WA 4KWSA 3AJXA 2JALA 1IHIA 1SO5A 4RDZA 1RP9A 2PPGA 3ATYA 4F2TA 2V3DA 4PMNA 4ZZ9A 4HHLA 1VFTA 3N17A 2E8ZA 4AEEA 3NQ2A 1WPCA 2NXIA 1OD0A 3WH6A 1BYCA 4KIRA 3N9KA 4C1NB 3TTSA 4NJKA 1BTMA 4J1OA 1OG6A 1RY8A 3LM7A 3C8NA 1HG3A 3DC0A 2B31A 3RCMA 1KGUA 4G6CA 3OG2A 1BGGA 1QO5A 3W6YA 3LSBA 2WNZA 3SY8A 3VGDA 4QDWA 1GQLA 3K8MA 3WLTA 1QWGA 2GSJA 3FYPA 4PEKA 4YCOA 4JIHA 2RAGA 2ZC1A 1O12A 1TIMA 5HUPA 1HFBA 1IEVA 5L9FA 1YHTA 5GNXA 2WHKA 4ZCWA 6PTDA 4Z1DA 2XIIA 5F1VA 2X1IA 1J93A 5B80A 3DI0A 1V0KA 3E2VA 4YTUA 4ZBCA 4BY3A 5AVNA 2ZXBA 1Z42A 3AIUA 3IGHX 4NZCA 5LYRA 3KRBA 2YCLB 4KRUA 2Z0IA 1UD4A 2QUMA 4FR6A 3LLFA 1RXOB 2V81A 4WJEA 2IXVA 1VBGA 3PTQA 4PMXA 3VK5A 3CHFA 4BK9A 1CLKA 3ZVIA 4LRTA 2X41A 3MI2A 3HO8A 4R53A 2I9EA 1KFCA 2ZDRA 2P3ZA 1OQFA 1IV8A 4TQTA 3PBVA 1F6PA 1WZLA 3C2RA 4PTVA 1ZHAA 3GW3A 4W93A 3C8FA 4JICA 3SCQA 3BW2A 2ZWYA 5GJMA 3RJXA 3DGBA 1UCWA 4LAZA 4EXAA 5REQB 2QPUA 4ZA0A 4DM1A 4GXWA 3N4EA 3VD3A 1YE4A 1GVQA 2OPJA 3DECA 1Z7AA 1CYGA 1EEPA 1V3MA 3KWSA 4IMAA 4Q8VA 2FGLA 2WSQA 1VHNA 3GNPA 3UJ2A 4Z42C 3MO4A 1ZTVA 4LS1A 3CUHA 3TLQA 3K30A 1GNXA 5HWMA 3OZYA 4CD5A 2OEKA 1ITUA 1ISYA 3OVPA 5H8MA 1JZ4A 2FB2A 4LYPA 3TP4A 3GXDA 2WC3A 3LLXA 3A4XA 4REQB 3VM7A 2IKHA 4PUDA 1IIHA 2O0TA 5GNYA 1PBGA 4DBEA 3ZJ8A 3THQA 4JQ4A 1PAMA 1SFTA 2QDEA 5CJ5A 2QLYA 5T26A 3P74A 1I2RA 1W3TA 1DIEA 1GOWA 4H7ZA 5A8MA 1UUMA 3WJWA 1HJUA 2R1KA 1AG1O 1QMLA 1R3RA 1TV5A 4RCXA 1BSIA 1EB3A 3WQ8A 1O7AA 4DPQA 2D3NA 5H8UA 4IQDA 3B9EA 4L9XA 4DX3A 1MWOA 3PTDA 1HL2A 4IG2B 4QBXA 2VOTA 2EAWA 3C86A 1S3HA 1DE5A 3NO3A 5EPDA 3OQ8A 3NQAA 4PSRA 3NGFA 1UROA 3Q37A 2IQDA 1X1OA 3OYZA 3VNJA 4GIYA 3NQFA 5EMKA 3E0VA 5G1YA 3GNOA 4FNQA 2OODA 1Q6CA 3NG3A 2QT3A 4E3TA 1E6NA 4MM1A 5JH2A 2QDDA 1J6OA 4O4WA 3LGEA 2IXUA 4FB7A 1XDJA 3IIOA 1IWAA 1A5LC 2OT1A 3A4WA 5G2WA 4O16A 3O6DA 2EO7A 4E2OA 1GONA 2PLMA 4IPPA 3T8LA 1UC4A 2BTMA 2PMQA 3V1PA 1FRBA 1X98A 3KRUA 1XYZA 1IZKA 2DZSA 4UOQA 4E3VA 1XQLA 2IPGA 3WL0A 5HR6A 4PZVA 4KETA 4GHRA 3W7HA 3TZNA 2XIJA 4NAEB 1NELA 5A8QA 1OWQA 5CJNA 5JBEA 4LWWA 1OB0A 3H21A 3KHDA 2AMGA 2PWVA 2GZXA 4C7DA 4B9YA 1UYQA 4RE4A 3RHGA 3CHDA 5AYIA 1ZNNA 3TKFA 5FEZA 1K6WA 1G1YA 4B4HA 2VEKA 2V2CA 1BXCA 2WYSA 4H9ZA 5GNZA 4DAFA 1QDSA 4AH7A 4Q7NA 4GFSA 4XKMA 3ZM8A 4F79A 3TZFA 3TYUA 3B8SA 3NOEA 4ZR8A 3W37A 3WEMA 1KQZA 3GSMA 2JGYA 2ACUA 4C7GA 3BV7A 4AISA 1WYIA 5CSRA 1DJYA 2HE8A 1J11A 4JXCA 2ISFA 3ARXA 1AW5A 3TTYA 3PK7A 2BGNE 2WKGA 4PMOA 1V02A 2VNCA 1R9XA 1FKWA 3RR1A 4IGSA 3T8QA 1QW7A 3KLLA 1LRQA 2OTDA 5HR7A 1LG2A 3CV1A 5CZ0A 2WANA 1THFD 4NZ3A 3EWDA 1DJWA 5I3FA 1J0YA 1XLCA 4Y90A 2CBIA 1A5CA 2CKRA 1R8LA 5ECVA 3SY5A 7ENLA 1H7OA 4W89A 2FZNA 2VZSA 5HQMA 4M6UA 1DTNA 2QGYA 4IFKA 2V5BA 3IJDA 2YDSA 4O8RA 4X60A 3LU2A 4B5SA 1B57A 4BQ3A 1I8JA 3K46A 4I7WA 3PC0A 4OWGA 3TYEA 2D0HA 3WENA 3KBMA 5C9XA 5DMMA 2OT0A 1QNSA 3CUZA 3MSDA 2ZE0A 3GTNA 1E9LA 2X30A 4NHVA 4G56A 1EA0A 4FOJA 1Q6EA 2A3EA 1KBLA 3WQFA 3MJMA 4GIEA 4NJGA 3BZGA 3VMNA 1P6CA 4IMGA 3HURA 1MI3A 4LU0A 2BVTA 3EWWA 1FKXA 4YU1A 3TA6A 3UXLA 2Z2BA 4EKJA 4O1AA 3M0YA 6CGTA 3OA3A 4B2DD 3QRHA 1UKTA 3R12A 3F4WA 4Q8WA 1K1DA 3TSMA 1TV3A 3BAYA 2V63A 2O92A 4GX8A 4E6MA 4JIRA 5DCEA 2C14A 3DFNA 4WKHA 1GYLA 1B3YA 2RGMA 3U9IA 3VNYA 1LRTA 2ZX7A 4WSKA 2C16A