1GYNA

Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
358
structure length
333
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGALYTQPEDVDYAYTELSKISPRFTIAASFGNVVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Organization of Divalent Cations in the Active Site of Cadmium Escherichia Coli Fructose 1,6-Bisphosphate Aldolase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE II
total genus 142
structure length 333
sequence length 358
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2002-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gynA00
2QUUA 3NPUA 5AHLA 5DLCA 1O95A 1ICQA 4WXYA 2QCEA 3MI3A 3TX9A 3VI2A 5K4XA 3WJXA 4QJ1A 4N9DA 2EAWA 6TIMA 1G69A 1ALDA 3QQ0A 3A9IA 3W1QA 2ATSA 3ABQA 3U8GA 4DQWA 3E02A 4JY9A 2JKPA 3NQMA 4IXHA 4Y90A 5SWUA 3T55A 2C15A 1DV7A 2R91A 1LOLA 2ATMA 2H3DA 3SZ8A 2WNNA 2OT0A 3UWZA 1TTIA 1HG3A 5L6UA 4HNVA 1FCVA 2V5LA 2V2CA 4XKYA 4B5NA 2VEIA 3KVKA 4X22A 4CQAA 1A5SA 3O15A 1M6JA 1H50A 1PVNA 3STEA 2QCNA 3HOJA 4OV9A 2A21A 3N73A 4ORIA 3W1XA 3O05A 3RF9A 1X8FA 2ZRVA 3STCA 1VYRA 4K7YA 4QSHA 3TKFA 3W7DA 1BEUA 2FPTA 5TQLA 1A53A 4RZ4A 1KFKA 4JS3A 3SW6A 1B4EA 1XKYA 3GX9A 1D3HA 2QJGA 3W7LA 3HG4A 4JX6A 1VLIA 4S2CA 4FHAA 5K9CA 3CPRA 5FEXA 1QPQA 2OT1A 4BWLA 5FF2A 1VRDA 1GVRA 3L67A 2CLEA 4RR4A 4QNEA 3S5NA 1K02A 3UWYA 4RXGA 3T4CA 1ME8A 3DKLA 3EKLA 2QAPA 4LNYA 4ONVA 2X16A 3NR0A 1NF0A 3G3MA 1RR2A 1ONRA 2V81A 2QEZA 3DU0A 3TCEA 5KTLA 1EP2A 3NQ7A 5KITA 4DBDA 5DBTA 1I2OA 1KBJA 4UFLA 1YXYA 2C0AA 3W76A 3O63A 1H1YA 3P8JA 4JYEA 1XM3A 2CZDA 3W7GA 2ZQ0A 4UTTA 4DXVA 2QCGA 1MEHA 1SFLA 5CG7A 6ALDA 3DI1A 5HWMA 3M5ZA 5K9DA 1FX6A 3GXNA 4LRTA 1GVQA 4O18A 2YR1A 3GDTA 4LC6A 1JCNA 5TBOA 2GPTA 1VPXA 4UTWC 2DJXA 4JTKA 1GTEA 2A85A 1W5QA 3E49A 4IX2A 4UFIA 3T78A 3W1RA 3GR8A 1VS1A 3S9YA 1KTCA 3C2VA 1JCJA 2E6YA 3GK0A 3THAA 2CWNA 3LBCA 1NFBA 1ZENA 5I3KA 4GRSA 3JS3A 1QPNA 5D09A 1KA9F 3EXRA 3W88A 4JYDA 1EX5A 4AWSA 3CWOX 2JKAA 1K8XA 3L0GA 3CU2A 1TCDA 2FPYA 2OJPA 4LUIA 2WKJA 4WD0A 4XBKA 3GLCA 3HMJG 3TC7A 3C2FA 1FQ0A 1FDZA 3NZ1A 4O15A 3B04A 2ZZ6A 3WK0A 2FB3A 2AGKA 3W2KA 1HL2A 2O7QA 5DN1A 3CHVA 5DY2A 3C4UA 4O1DA 4UNLA 2Y62A 1VYSX 1W0MA 1PIIA 5J5RA 4QAIA 2WSRA 5T26A 2CW6A 4R53A 3R89A 1D9EA 2NX1A 1G4SA 2E6DA 2WNZA 3UD6A 2DZWA 5LGZA 1XI3A 2VFEA 1SO6A 2V30A 3L65A 3NNTA 3ABSA 2G5WA 1OYBA 3PUEA 4GUFA 2O7SA 3W71A 3FOKA 4FNQA 1HO4A 3PB0A 2NXHA 5D2TA 2Y89A 5AHNA 1L9WA 2GVLA 4NJJA 4UR7A 4GE8A 3PAJA 3TE9A 4QITA 3S5ZA 1K8ZA 3B0PA 5AC7A 4ZQNA 1I2PA 4UIOA 1TJRA 3W2JA 3G1XA 1IXPA 4CCDA 4LUJA 1FCUA 2BLEA 2CLIA 1MEIA 3R2GA 2E5CA 3W83A 3W1LA 2ZRZA 4UTKA 4EOUA 4P61A 5LHEA 1VR6A 3SSJA 2Y7EA 4L4LA 4KWWA 3I6RA 3TW6A 1Q6OA 4CQ8A 3S1UA 3UY7A 3G8RA 3EWYA 1O5KA 5AFDA 2I14A 2YZRA 2Q3OA 5HMSA 3L0NA 5HWJA 2A0NA 3P8IA 4O16A 1ZAHA 5ABTA 5HR7A 1IF2A 2TPSA 3LOTA 1NAL1 3N2XA 4IGHA 1WQ5A 4K39A 3JRKA 3P74A 1F2JA 3QW4B 3IIXA 5G2HA 3QW3A 3L21A 4CNOA 2BTMA 5F4SA 4NJGA 1FY6A 5D2YA 4NT0A 2J24A 4XQ6A 1WYIA 3S1XA 3C2OA 3HG3A 4RJEA 4YCPA 1KLZA 3W1UA 3IV3A 4LV4A 3MHGA 3RMJA 3UY8A 3INPA 4R33A 1KW1A 5C55A 2NV1A 2VFIA 1BWKA 3NVTA 3W9ZA 2EPHA 2H3BA 2H90A 7TIMA 3EX3A 5D2WA 1TSIA 4YLWA 1TPEA 1WAUA 2QDHA 1J4EA 3SGZA 4A2SA 4DO4A 3EXSA 4MPQA 4N4QA 2E09A 2E6AA 3BLEA 1SZFA 4OQVA 3HO8A 1N7KA 4KFOA 3NQVA 3N2MA 3TSDA 4JXCA 2Q3RA 3AO0A 1RQHA 2V82A 2ZFAA 1QR7A 3L5AA 4QQ3A 1OFAA 1TTJA 4AF0B 3CLMA 5CPMA 3FLUA 1LLWA 1DQWA 5L9FA 3QZEA 1DJQA 3U6WA 2V9DA 4P2VA 4ZQRA 4NNCA 1X1ZA 3I7QA 2JBMA 4PL1A 1FWTA 4GWEA 1EIXA 4A2RA 3CTLA 4ZL1A 2Y7DA 3L66A 5DBUA 2OCZA 4N9BA 5G2IA 5D2VA 3ANYA 1CI1A 3UPWA 3E12A 3B0VC 3G1HA 2C14A 2QCDA 4EVZA 3IVSA 1FXPA 1OK6A 5U7SA 1F76A 4UTLA 2E68A 2WO5A 4POCA 1OYAA 3R13A 3IIPA 2B0MA 3C6CA 4DF0A 3G1YA 3OVRA 3RLVA 1QDSA 4BK9A 1KM5A 1DKWA 4BWLC 2UV8G 4LU0A 1RPXA 4OHQA 2GQ8A 3EWXA 1XBZA 3FKKA 1LLZA 3DGRA 3R5EA 3TAKA 4FIQA 4ML9A 1VGAA 1OYCA 4BI7A 1T96A 2HS6A 3RLUA 1KM3A 4N6EA 3PBUA 4LS2A 3BGJA 4JTUA 5LNRA 3NQGA 3ABRA 3OG3A 3TXVA 4R7JA 4BR1A 4N6FA 1R46A 4YMZA 3BVJA 3VNDA 2GOUA 1EA0A 2RDWA 1OFBA 3MO7A 4RZ6A 5D37A 3QSTA 5EBUA 1KM2A 3TU9A 4XZ9A 4UTTC 5D38A 1GQNA 4UXDA 3FJ6A 2VENA 2G96A 5HJLA 5D30A 4U4MA 1B4KA 5C2XA 4IUOA 1Q6RA 3LCFA 3W2NA 4N9EA 4CNNA 1VZWA 1TPUA 3O06A 3OEXA 3O16A 3IIVA 4PEKA 2X30A 5AHIA 3N9RA 1WBHA 3NQ2A 3NM1A 5D05A 1GJPA 2C19A 3CC1A 3GAYA 2HTMA 4NQ1A 1QNVA 5DCEA 1YTEA 1ZCOA 1BKSA 2TSYA 3GNNA 2QJIA 3LTYA 5HUOA 3M5YA 4NVTA 4PC8A 4QM1A 2FTPA 3GB6A 2ZZ4A 3C52A 1X6UA 3LRLA 4MLJA 3MYOA 2NUYA 3GIYA 4UTWA 1KTBA 4Q32A 3LTSA 3LBMA 3IGUA 3Q94A 5EA9A 4ZMGA 3NPVA 4M7TA 1TMHA 5E0KA 3A22A 3UYCA 2D73A 2Y61A 3E96A 2R94A 4ADUA 1JCMP 1JCLA 4AB4A 1JR1A 1TV7A 1DBTA 1GPWA 3M0ZA 3F1QA 1N8FA 3RNDA 1J2WA 3NL6A 1I2QA 1L6WA 1V7YA 3ABOA 3UWQA 3I68A 3R8RA 3W1NA 1WXJA 3NG3A 1V5XA 3P61A 5K4ZA 3O1NA 4NJHA 3E0IA 1C9DA 3NA8A 4PH6A 1HTIA 3GAKA 1IGSA 1G4EA 4MJZA 2CU0A 3GR7A 4MUZA 1SFJA 1H7XA 1LZOA 2QCDB 2NXGA 1NVMA 3DENA 4NXSA 3TQVA 1JRCA 3KRUA 1XC4A 2LLEA 3FFSA 3PWAA 1I8JA 4LRSA 2XN1A 2VC6A 3BG9A 4OV4A 2R14A 4JNMA 5TIMA 4JTIA 3DXIA 1UCWA 1H7PA 4NJKA 4M6PA 4AWTA 5HWNA 5K9XA 1W54A 5LNWA 1S3HA 2GUUA 4NNBA 2OZ0A 3NOEA 1RD5A 5EMUA 2PRLA 2ZRWA 4AF0A 3HGJA 3MMTA 2B4GA 5KZDA 3ZWTA 3EX1A 3UWWA 2V8ZA 3HG5A 2NX3A 1AMKA 3CB8A 3P84A 3QPZA 2YCEA 1QOPA 3TMQA 3S0CA 3MBFA 1B9BA 4M6VA 5CPNA 3NQ6A 1W37A 4MY9A 3SFKA 5I3JA 4BI5A 4FNUA 5HNRA 3M41A 3CQ0A 4RKAA 1ICSA 1K7XA 1X7FA 1IIGA 1XBYA 3HGRA 1O5XA 4JTJA 4OGZA 4A3UA 4LVDA 3W22A 5FEWA 3TW7A 3W2UA 4WXZA 3KAOA 4O1CA 1P4CA 1RVGA 1AW2A 1TQJA 4E0CA 2PRMA 2CLHA 1JUBA 5F1UA 5I3FA 2J9ZA 1OX4A 3P5YA 5F4XA 1EPXA 4ZQOA 4W9TA 4FX7A 1C8VA 4UFJA 5FF3A 4UC5A 3BW4A 2RKXA 2ALDA 2VEMA 5EPDA 3TJLA 3KFTA 1SR9A 2YYUA 1Q6QA 3QC3A 1SZNA 1UUMA 2WPBA 2AQWA 3AJXA 4HNTA 5IM51 4MYXA 2ZZ7A 1ZAIA 4C1LA 1KFCA 4ZQPA 2DZXA 2CLKA 5EYWA 5D02A 3M47A 3LXCA 4FNSA 1X1OA 5FF4A 4WOQA 3EWWA 1EP1A 1L6SA 5D03A 4MJMA 3G0XA 1R2SA 1AL8A 3LXBA 3W7IA 4O10A 1XDLA 2QJHA 4U28A 2VEKA 3HGOA 3NEVA 4O57A 4YWIA 8TIMA 5G4WA 2VXNA 4Y96A 1GYNA 1XUZA 3W1PA 2VKZG 4LS0A 4O1BA 4A21A 3HBLA 2V2HA 5DCDA 3W85A 1EWEA 3DFOA 3OVQA 3TDFA 4MIMA 3A23A 3SECA 3MWAA 4ZQCA 3NQAA 4O17A 2H6RA 3B05A 1SSGA 1SW7A 2ISVA 3W3OA 1Z48A 3NM3A 4ADTA 4L4MA 1TPVA 5LNUA 3VE7A 1G7VA 3FIGA 4N02A 4I7UA 1TPC1 2HS8A 1KM1A 3MP5A 1ZJIA 1ME9A 2BXVA 5FF7A 2AAMA 4UTJA 1YXDA 2E5BA 3NDOA 5E93A 3A24A 1Z44A 1WBJA 3LCXA 4HKPA 4JIPA 4DELA 5KINA 2ZA1A 2W79A 1ADOA 2VFHA 3T40A 3STFA 2Z6IA 1H62A 3M5VA 3NZRA 4JD4A 5CPOA 1LM1A 3W7EA 4HIBA 1M5WA 2BZNA 4FX8A 3EWUA 3QPYA 4LVGA 2X1RA 3ZWSA 3PSVA 3BPWA 3G1SA 2NV2A 4O0ZA 3I7RA 4K38A 3ZFHA 4M5PA 3HGSA 2B7QA 3NQEA 3EXTA 3Q37A 2VFFA 1L6YA 4IMFA 1RV8A 3MHUA 4IWWA 3U2OA 1VHCA 2ZTKA 3H54A 2HSAA 3LI0A 1OFEA 3UQNA 2NX9A 3OHIA 5BNKA 4LV9A 4IQLA 1LRTA 3E9AA 2NUXA 4Y6GA 3BG5A 1YDNA 2QF7A 1UBSA 3TK7A 3DBPA 4NXKA 3GZ3A 3A5FA 1GT8A 1W5PA 1OX6A 1YXCA 4K7VA 3P60A 3WK3A 4Z08A 1G4TA 3FKRA 1O94A 1DQXA 1DOSA 3DFNA 3L0KA 5LGXA 2J9YA 2VFDA 2X1SA 3T7VA 1R2RA 3TSMA 4UMAA 1PHWA 1RQBA 3LM7A 5GVJA 3QMRA 2A7RA 3MP4A 1TPWA 1ZNNA 1K8YA 4NU7A 3RK8A 3LX9A 3MUXA 2H8ZA 1XL9A 2PE4A 4DF2A 1GVFA 4JTTA 2YYTA 3PBWA 4QNWA 3LERA 5D2XA 1G6CA 3PVFA 1HUVA 4FXSA 4AMAA 3BO9A 4UMBA 1TV5A 1VQTA 3IEBA 3QFEA 4MKNA 4FXRA 2C16A 3L9CA 4XBSA 1PV8A 1KTNA 4NUWA 3EX4A 3NGJA 4ICNA 3ZS4A 2CLFA 3NL2A 3W73A 1A5BA 4MZ1A 4TU1A 2TMDA 1JCXA 3GXTA 3HQ1A 3JR2A 1FWRA 2QR6A 4H6KA 1WOBA 1LORA 4UTIA 2QCHA 4XKYB 1O60A 1F7BA 5LZLA 2DORA 3SIZA 1YADA 4WOZA 1EEPA 1FWWA 3W74A 2ISSA 2RH9A 2I1OA 1IXQA 1KV5A 1VC4A 1QMLA 3PG9A 1YTDA 4ZVJA 4HPXA 1WA3A 4UUIA 3LV5A 4PL2A 1FBAA 2ZZ5A 2YX0A 5HR6A 4GUIA 3P7YA 3A5VA 4NJIA 4KFPA 4K36A 3V75A 3PBYA 5HULA 3G22A 3GKFA 2P1FA 3HJZA 2RFGA 1S5VA 1SU5A 4WY0A 1G67A 1SO3A 1GYLA 1K3UA 3DAQA 3I7SA 4FNRA 4GUGA 1F74A 5G1TA 2FPVA 4O13A 3NXFA 3PM6A 1KFBA 1LTDA 3KHJA 3S5YA 3NAVA 5DY3A 3W1TA 2XFWA 3RU6A 1Z41A 2FQIA 1ZALA 3LCGA 2NUWA 5BMWA 3OIXA 3R12A 2NZLA 4UTUA 3PSWA 4O14A 1W31A 1TPDA 3N9SA 4ZZ9A 3LHWA 4JTSA 5C5YA 4NNAA 1P5BA 2X1TA 4UTHA 2DU2A 5F2MA 3M44A 4FNTA 5E1QA 1JQVA 2DZUA 5CZJA 1GWJA 3TFCA 4O11A 3LDVA 1OFRA 5AHMA 2P10A 1VH7A 1OFOA 4QISA 4LS1A 3TROA 4H4IA 1U83A 4MZYA 3PG8A 3HG2A 3CM4A 4JTHA 2ABBA 1YYAA 4A29A 3BARA 1ZHAA 4FF7A 2DZTA 5C54A 3PUOA 4FEZA 2E6FA 3MBDA 2WV8A 4AHQA 2VFGA 1T99A 3USBA 5D33A 1UUOA 2GJLA 1WDWA 3DFSA 3WJWA 3M5XA 1PS9A 5CKSA 3WJSA 3B03A 4NX0A 2ZDRA 3W7MA 4X9SA 1TTPA 4LVBA 1VYPX 3M7WA 2NLIA 4JICA 2BX7A 2JKEA 1NSJA 5AYZA 4N4PA 1R30A 5K7JA 3CT7A 4PFMA 4Z0SA 4UFMA 3B4UA 2BWGA 3G1FA 3H53A 3THQA 1AL7A 5FEZA 5F2LA 3LCLA 3WJYA 2YFOA 3CEPA 2Q8ZA 4IOTA 1TPB1 3P80A 1KM4A 3G24A 1TIMA 4XUGA 4K8EA 2DZVA 2QUTA 5H2ZA 1H63A 3B06A 3UPBA 2YGYA 4JY8A 3GYEA 4O4VA 1OX5A 1P0KA 3IIZA 5F4WA 4AAJA 1KBIA 3CEUA 4ALDA 2P0OA 3NL3A 4ZQMA 3W7JA 4JTGA 4O53A 5DXXA 2CLLA 1ICPA 1XXXA 1W3NA 3W7RA 3GNDA 1LBMA 3B8DA 4GC4A 1GTHA 1N55A 4IX0A 3TV8A 3WFAA 2VELA 3LTPA 4AVFA 3W70A 4M19A 1OFQA 4N2YA 3W7KA 4D2JA 3G8EA 5LNVA 1SSDA 1SO4A 3G3DA 1YPFA 1OJXA 1ZFJA 1C29A 1QPRA 4O28A 3PR2A 1GG0A 1NEYA 1KV8A 3GDLA 5BRBA 3W1MA 1TPFA 4UFKA 3QJAA 4MY1A 3LCIA 3Q58A 4KWVA 1S5TA 1TRDA 4LVAA 1H7OA 3C2EA 2PCQA 3W7OA 1OABA 3DFTA 1QO2A 3P81A 4OE7A 2V2DA 3KOFA 3NO5A 1I2NA 3BW3A 5DCBA 2FDSA 3QH2A 4O0KA 4CCCA 1FDJA 2GJNA 3IVTA 4LY8A 2EHHA 1H7NA 4G1KA 3C0JA 4WUIA 1W5MA 2RDUA 1JUEA 5EKYA 3L68A 3LI1A 2Y7GA 1OK4A 4TMCA 3TQ0A 1T0OA 4Q4KA 1HO1A 1MSSA 4AH7A 3W75A 2FIQA 3HPZA 4O50A 3TR2A 2A1YA 2OMAA 3TQKA 3N19B 2WOQA 3SJ3A 3W86A 3N34A 1ML1A 3W87A 3MHFA 2W6RA 3GVGA 1GG1A 3TC6A 2B7NA 1LP6A 3UXDA 2YXGA 1H1ZA 4RLIA 3GDRA 3EX2A 3F4WA 5A5WA 1VHNA 1VCVA 1VLWA 1UB3A 5EY5A 1EWDA 1U5JA 1XBXA 1JUKA 2RDTA 1XUUA 5CZTA 1YLVA 1IXNA 2Y85A 3UXAA 5G1YA 1SO5A 1QO5A 2WSQA 3IIOA 3W6YA 1NF7A 1DHPA 1AW5A 1L2UA 5F2GA 1LBLA 1FWSA 4LC8A 3N3MA 5DELA 5F1VA 3I65A 1K7FA 3EKZA 4IMGA 3PUDA 3M16A 3C2RA 2PRHA 3DH7A 3SY5A 3DHFA 3HPSA 3ATZA 2BSLA 3QQ1A 5FESA 5AHEA 4DF1A 1KFJA 1JVNA 2A6NA 2Z2UA 3LHUA 5KZMA 3RFAA 3MI2A 3FS2A 4HPJA 3TMLA 4IJBA 3BG3A 3FA5A 1OHLA 3NYZA 3O07A 4EIVA 3KRZA 2FLIA 1QWGA 2E5DA 1KM6A 2ZRYA 3KVLA 1H51A 1VCFA 5MHBA 3EEGA 3G1DA 4RV8A 5BMXA 3QMTA 2QAFA 2I9EA 4IXXA 3VFLA 4JX4A 3K30A 3W72A 3MYPA 3W2LA 4IPIA 3OVPA 1MO0A 5CSSA 4PA8A 4JX5A 4O8RA 2NWRA 4WX2A 2YPIA 5AC6A 1PE1A 4MZ8A 2Y70A 4M7SA 1F6PA 4AWUA 2X1UA 4Z1AA 3W7CA 4AHPA 1B57A 1KFLA 3W07A 2QDGA 2B7PA 2X2GA 2EKCA 4JGDA 2H8XA 4O12A 3QM3A 3IRDA 2E1DA 5AYYA 1FDYA 2Y7FA 4K37A 3F03K 4WZHA 5CSRA 4X2RA 1GZGA 2F7FA 3N14A 1LCOA 4GBUA 2FB2A 1MZHA 3TA6A 4TMBA 3DFPA 1TB3A 1VJIA 3NPWA 1PCWA 1OFDA 2YSWA 1TPH1 4I7VA 1GVOA 3ZR4A 2OX1A 4OU1A 1H5YA 4I7WA 5LHFA 3LRKA 4HNNA 4UNKA 1TV8A 1AG1O 2CFFA 3LB0A 1OF8A 1ME7A 2QKFA 4CCEA 3A21A 1EB3A 1F5ZA 4UMCA 1SQ7A 1QPOA 4PTNA 4JR5A 3TFXA 3S42A 4YL2A 4RXFA 3W7HA 2C3ZA 4HHPA 1CX9A 4EF8A 1H7WA 1P1XA 2CZ5A 3EB2A 1I45A 3P5ZA 1MXSA 3TAOA 1WOAA 1KLYA 1GEQA 1OFPA 4E38A 3L5LA 4DEFA 3M6YA 3UWVA 2YDAA 4BI6A 4CQ9A 2C13A 3C8FA 1LRNA 3QMSA 4TIMA 4XTDA 3M43A 1KFEA 1W1ZA 5LSMA 4IMCA 4CNPA 3UWUA 3LHYA 1XDMA 2JK2A 1W3IA 4FIRA 1Y0EA 5G5IA 5FF0A 4RK8A 1PHQA 2CZFA 4TX9A 3LCWA 2XN0A 3MW7A 1W5OA 4RZ5A 1TYGA 2ISWA 1T8XA 4OT7A 2HMCA 3FJLA 1XFBA 1FCQA 3UZ5A 3P67A 2Y6ZA 1IXOA 4JEQA 5DXYA 5IBXC 5G2WA 1HFBA 3STGA 4GXMA 3W7QA 3BGGA 3WK1A 3VKJA 3T44A 5G4EA 2CZEA 3LV6A 2ZZ2A 1SZGA 1DVJA 2CLMA 3PS7A 4OBTA 2V0TA 1PL9A 1PCKA 5I3GA 4S2BA 1W3TA 4I9AA 1UASA 3NQDA 4WY0B 4JTLA 3G0SA 1TQXA 1FXQA 2C1HA 1K03A 4HT3A 2FFCA 3EWBX 5EL1A 5C6MA 1XBVA 4Q33A 2DZSA 2J9XA 5HINA 2GVJA 4C1KA 1B3OA 3FYOA 3VE9A 4YXGA 4WJEA 1S5WA 3TXZA 5K2ZA 1QFEA 2W0UA 1A5CA 3H55A 2ZZ1A 4MFEA 5J5DA 2ZRUA 1Q45A 2A5HA 3C56A 4IPJA 4CLMA 3S8HA 1TJPA 4NX5A 4QIUA 3KXQA 1JCYA 5CZ0A 2EF9A 4LTSA 4Z1DA 5LNSA 1MEWA 1OX4B 2G95A 1JQXA 4Y8FA 2RHGA 3SR7A 1LOSA 3VCRA 2QCCA 5KMYA 3B0UX 3M9YA 4GNJA 1YPIA 2Q8LA 4GFSA 4MFDA 4OWGA 4JTFA 1W56A 3PY2A 5HUPA 2VOMA 3GDKA 1TRIA 2XN2A 3LHTA 4JTEA 2QCLA 1P0NA 3L5MA 3W2MA 2Y63A 2WJZA 1SZEA 3TH6A 3DFQA 3TUUA 3SGUA 2IQTA 1LOQA 4Z1CA 4DO6A 2G97A 3IGSA 5FEPA 4K8HA 3TNOA 3LRMA 3NL5A 3P82A 1QAPA 1W5NA 1DJNA 1TO3A 2QCFA 1CW2A 1BTMA 1E51A 1RQEA 3CIWA 3QF0A 5AHFA 5AYXA 5A8GA 1Q6LA 1G7UA 4WQ6A 2YW4A 1JJKA 5K3VA 2GVGA 2QUVA 3PC0A 4TO8A 2ABAA 1BWLA 5AN7A 4GUJA 1EP3A 5U4NA 4LW7A 4A22A 4UFHA 2YFNA 3FYPA 2JGQA 4XTIA 1OVDA 5IBXA 1IIHA 5HQEA 4HSOA 3TSBA 3QYQA 3MJYA 1GOXA 1M7OA 4NZFA 4BF9A 4ORMA 2A7NA 2ZZ3A 3O6CA 1TTQA 3W84A 2WQPA 2PURA 2ZYFA 3LCHA 3O6DA 2C6QA 4UR8A 4HNUA 1YDOA 1GVSA 2C18A 4N9CA 4IMDA 1A50A 3LXAA 3S1WA 3OBKA 1R2TA 3KRSA 3D0CA 3HIJA 5H91A 1VCGA 3CIXA 3UZJA 4MY8A 3NQCA 3F4NA 3PBVA 4TR9A 4YCOA 1RZMA 1G4PA 4K6AA 4O1AA 4DPPA 3DKJA 2R8WA 1JULA 3KVJA 4KKXA 1O4UA 5CZSA 2ZCGA 2B7OA 4AXKA 5CGQA 4Z0JA 3KVMA 3NQFA 1SW0A 3HPXA 2WNQA 3PF3A 1QOQA 1D3GA 5LKYA 3TIMA 4XWUA 3GKAA 3PULA 3QSRA 2ZA3A 2Z1BA 4FB7A 3V1PA 1Z42A 4S1FA 4AHOA 4IMEA 4MLRA 3C3NA 3BLIA 1YDVA 1H61A 4LT9A 1LROA 2Z6JA 1ZAJA 1OG0A 4ADSA 1YTKA 4WY0F 3MP3A 4MVAA 3L2IA 4E2DA 1H7RA 5I3HA 3Q2DA 3W23A 1W8SA 5D04C 1UJPA 4JDBA 2NXIA 1SUXA 2WSYA 2PC4A 3BV4A 3LLDA 3YPIA 4RCXA 2ZTJA 4H3DA 5KSWA 1AW1A 4LOCA 2A4AA 3G1VA 4JDYA 2E77A 1QCWA 1FCBA 5CPLA 1DL3A 5I3IA 2V5BA 4PODA 3KX6A 2JGYA 2Z0IA 2A6LA 1DORA 2ZA2A 3IVUA 3O8AA 2DZPA 4BFAA 4HSNA 3NQ8A 5KZEA 1EUNA 1SW3A 4NZJA 3M1ZA 4X3ZA 5FI8A 3BK0A 3G1AA 3ATYA 4Z1BA 2A2IA 1I4NA 3S1VA 4EF9A 2EGZA 3CWNA 3LLFA 3DZ1A 4O52A 4FX6M 1M7PA 1A5AA 4AEOA 3LGEA 2A7PA 4GJ1A 4LVFA 3IGXA 2TRSA 4JIQA 3EX6A 4JN6A 3DHDA 3G0UA 1THFD 4FNPA 3W7PA 3G18A 4R34A 2F84A 4UTMA 3W1AA 1J5TA 4GUHA 3S5OA 4DBEA 3QRHA 5BW6A 3SI9A 1R47A 2Y88A 5AC8A 2CLOA 2KZHA 1F05A 1SPQA 2FJKA 1LDCA 1KM0A 3C61A 2ZRXA 4KFNA 4PCFA 4DO5A 1K7EA 1LBFA 4O19A 4M6QA 5AOUA 4EWND 3DI0A 4O4WA 3GDMA 3TJXA 1LRQA 3WK2A 3OA3A 4Y9AA 4HN4A 4JYFA 2J88A 3UNDA 5BOOA 1EUAA 1ZY9A 3ELFA 2DP3A 1OF6A 2QCMA 1H60A 3QEZA 1Q3NA 4MOZA 5D32A 3HB9A 4FO4A 3O6YX 2TYSA 3GXPA 1WX0A 3W7NA 1FUYA 1JRBA 4J9JA 3MI6A 4E2BA 4UCGA 1XCFA 1WV2A 3BW2A 1F6KA 4O54A 3EWZA 2ZBTA 3LHZA 3NPXA 1LYXA 2J27A 5F2IA 3PB2A 3HF3A 2DJLA 4RX0A 2YW3A 1I2RA 4LWWA 4DPQA 3BLFA 2NWSA 2GQAA 3P62A 1TREA 1FWNA 3LHVA 1AK5A 3FEMA 2J6XA 4MYAA 3WJZA 2GQ9A 3S6DA 5AB3A 2VEPA 1F73A
chains in the Genus database with same CATH superfamily
1XIDA 1F3WA 3FHAA 3NPUA 2VDGA 4YHEA 4L5ZA 2VC7A 1UR0A 1BGGA 2KAUC 3MVTA 4WXYA 4IH3A 3VI2A 1X97A 5DT7A 1VBJA 3QXBA 3F5LA 4NZ3A 3B3DA 3ME3A 4N9DA 2EAWA 1WO2A 4US6A 3II1A 3T0AA 3AWOA 1EBHA 3QQ0A 5H1WA 2ATSA 3A47A 2HNEA 3LENA 3W0KA 1ZB5A 2OT0A 1Z6KA 2HBXA 1HG3A 4AUBA 1FCVA 2V5LA 4B5NA 3F4CA 4X22A 1M6JA 2POTA 3M0HA 2QCNA 3VIIA 3L4UA 4IIDA 4DYKA 3RF9A 1KCLA 2XVGA 3OP2A 3TKFA 3W7DA 2FPTA 1XRTA 1KFKA 3B0YA 3B9EA 3DC0A 5E0FA 3GX9A 4V33A 1D3HA 3Q45A 5GJNA 4F2BA 4JFSA 4JX6A 4V27A 2PLMA 2VEFA 3NZGA 3GTNA 5FEXA 4W89A 3R25A 1GVRA 2WQDA 3KLKA 4HZ8A 3C0SA 2ICSA 1C90A 3A4WA 3SN4A 4QNEA 3DOPA 4QG9A 2WVSA 1ME8A 3DKLA 4RZBA 4LNYA 1CIUA 2OX4A 3G3MA 4NILA 5A3HA 1VFFA 3NZPA 1KWGA 2ZC1A 3W82A 3GH5A 3TCEA 3DU0A 5DFAA 1XQKA 3KHDA 1QW8A 1I2OA 4UFLA 1YXYA 2C0AA 2BS9A 1WUFA 3T08A 4LEFA 2CEQA 3E0WA 1S46A 2QCGA 4XD3A 2HVNA 5CG7A 4DZAA 4GINA 3FN9A 3PZ9A 3M5ZA 3WQ6A 4GLEA 4JQ4A 4J28A 1FX6A 1E1EA 4TOQA 2HISA 1LT7A 1JCNA 3TR9A 4NP7A 1EGZA 1VPXA 4UTWC 3PNUA 2VX4A 1GTEA 3E0VA 4IX2A 3T78A 3UW6A 2GFTA 1KTCA 1JCJA 1R7OA 4HYRA 4WDUA 1NFBA 3MUY1 4GRSA 1QPNA 1EX1A 3W88A 3GHUA 3CWOX 3L0GA 1EBGA 3CU2A 5LYRA 2FPYA 3PTDA 3IAQA 4FAMA 4LUIA 1F3XA 1EKOA 1QNRA 4LUTA 3HMJG 3B97A 2CITA 4B5UA 3GIPA 1ESWA 2QVNA 4AZHA 4MWAE 5A6LA 4L7ZA 3B04A 4H7CA 2OU4A 3PBGA 5A8QA 5DRIA 1CDGA 1HX0A 3W2KA 1HL2A 3MSYA 5DN1A 1CPUA 3CHVA 4UNLA 3AYSA 1W0MA 4AEEA 2D24A 3R10A 3QFWA 3VMOA 4R53A 4IFRA 3B8SA 1C9WA 1UC5A 1G4SA 2WNZA 5LGZA 4I6VA 2DZWA 5FIPA 3L65A 5I23A 3WEOA 4GUFA 2NXHA 5AHNA 1L9WA 3AXMA 3TE9A 6REQA 3QV6A 1Z8AA 4UIOA 1IGWA 3OQ8A 4QCFA 1JGIA 2CXGA 1IXPA 1WDPA 1FCUA 2E5CA 5G1MA 4UTKA 1VR6A 2R1MA 3WDQA 2EG8A 2Z29A 1Q6OA 4CQ8A 3S1UA 3WD1A 4XZMX 1TJ1A 4B3ZA 4QLKA 1DQUA 3QR1A 4HYWA 1JZ2A 1XG4A 1CNVA 1ZAHA 5ABTA 1UPPA 5HR7A 2TPSA 5CZKA 1WQ5A 4K39A 4H8UA 1QATA 3C3UA 3KZPA 4OECA 3QW3A 4CNOA 2ESCA 2BTMA 4NJGA 5D2YA 4NT0A 2IKJA 1HZYA 4XQ6A 1WYIA 4JKLA 3MA8A 4RJEA 1F4AA 1ITCA 1CXHA 3DC8A 3UY8A 4RW3A 1L6FA 4HNLA 1S2AA 1BWKA 2X0HA 3W9ZA 2H3BA 4H9XA 2H90A 5A6SA 5D2WA 4LH8A 7REQB 5HJYA 5I02A 1MI3A 2G41A 1WAUA 3AHYA 1SJAA 1R5YA 4S23A 3KOZA 4JEJA 4W87A 1MRAA 3CAVA 2E09A 3BLEA 4AD4A 2CHNA 3M0JA 1C92A 3QV9A 1E4NA 2CBJA 3AO0A 1RQHA 3VD7A 3RG6A 4HNCA 4QQ3A 1OFAA 4HK5A 3LGGA 5I06A 4LYKA 1DQWA 2VYOA 5HBFA 2V9DA 4P2VA 1NFGA 1H1NA 1X1ZA 3I7QA 5AVNA 1FWTA 4A2RA 2YCLB 3CTLA 3SCSA 1BQCA 5DBUA 2OCZA 5G2IA 5D2VA 3E12A 3G1HA 2C14A 3SGGA 1XIJA 1OK6A 1F76A 2D20A 4CNTA 3UPMA 4YNGA 3MSDA 3R13A 3TYAA 3IIPA 2AL2B 3SUUA 1QTWA 3GHSA 1QDSA 2R1PA 1KM5A 1V08A 1RPXA 1PUDA 3WEZA 3WLLA 3DGRA 3TAKA 4FIQA 4ML9A 4DJFA 2WC3A 1VGAA 4LPCA 4BI7A 3RLUA 4GXWA 1KR1A 3QTGA 3N11A 4RUBA 3VDGA 3EPOA 2C91A 5JH2A 4O8AA 2X09A 3RLGA 1Q2SA 2RDWA 4RZ6A 1UOZA 1TWDA 1H2JA 4XZ9A 2PBOA 3KWXA 5M3WA 1GQNA 3ITOA 2G0WA 2BBFA 3UEQA 1B4KA 4MJ4A 3LCFA 3WH5A 4CNNA 1FRBA 4QP0A 3O06A 1RJRA 5FJJA 3OEXA 3O16A 2OZ3A 2YCJA 3FJNA 4EE9A 5AHIA 1XDJA 2OO0A 4KPLA 3N17A 3CQKA 4OIFA 2OWXA 3GAYA 2HTMA 2WSPA 1QNVA 1LUCA 3M46A 5DCEA 1YTEA 3GH7A 3LQGA 3GNNA 2REQB 3M5YA 2E25A 5HAOA 3U7VA 1Q8AA 1J96A 4JCMA 3CPGA 3GU9A 1SYTA 1YKWA 2ZZ4A 4QE5A 1X6UA 3LRLA 3L4ZA 1O1HA 4J5NA 1KTBA 5DO8A 1R9YA 1JZ5A 1Q13A 3I3EA 5EA9A 1Q85A 4O1FA 1TMHA 2G3IA 1JEZA 3A22A 5LIUX 2D73A 3BL3A 3EBVA 2WMGA 1WAWA 4PB5A 4JFUA 4HSHA 3WBWA 5DX7A 3KOYA 2C71A 4FSAA 1JR1A 3EB4A 1GPWA 3F1QA 3RNDA 3F2CA 4HB7A 3EDDA 4EPBC 3CUFA 1J0IA 3W1NA 2J7BA 1V5XA 3VIOA 3P61A 4NJHA 1C9DA 3T2OA 1HTIA 2GWNA 3CZKA 1G4EA 4MJZA 2CU0A 3PPCA 4MUZA 2AKZA 1S5MA 4LBRA 3EDJA 1JRCA 1RAKA 5J8LA 1AZ1A 1MNZA 2R14A 4JTIA 4LEQA 5C70A 2W3ZA 3HN3A 3TQPA 5HWNA 4M6PA 1V0NA 3V1HA 1WUEA 4HCLA 5EFFA 1U33A 1GW9A 4GQGA 2B4GA 3U2EA 3ZWTA 5GQBA 3UWWA 1W9DM 3L2MA 2NX3A 4UCFA 1EQCA 1Q4NX 2YCEA 2Q09A 3KEHA 5EMMA 4S3FA 1NP2A 3CL6A 4AC1X 3NQ6A 1W37A 4IP5A 2O92A 4AMCA 3VNZA 5MKGA 1GORA 1D3CA 1HKVA 1XBYA 3HGRA 1O5XA 4NG3A 4A3UA 1HJUA 3TW7A 3W2UA 4WXZA 4O1CA 1P4CA 1RVGA 4H9UA 5F1UA 2OWWA 1EPXA 2FGZA 4ZQOA 1X38A 2INZA 2ALDA 2VEMA 3KFTA 1Q6QA 1UUMA 5IM51 2WHKA 4DJDD 3QY7A 5EYWA 3GTFA 3M47A 3LXCA 2HXTA 2POZA 3M0YA 1EP1A 5D03A 1SFSA 4C5ZA 1AL8A 3W7IA 3ZT7A 5C9XA 3T8LA 3VDBA 1ZUAX 4PZVA 4LYPA 1GYNA 1BG9A 3W1PA 1M01A 3VD3A 3GZAA 5A8NA 3VGFA 2CCRA 3TDFA 2CERA 3AMCA 3NQAA 4O17A 4C6JA 1SSGA 3AHVA 3NM3A 4L4MA 3W6LA 1XIFA 1TPVA 4CGTA 5LNUA 2A3CA 4F0SA 3VE7A 5D9PA 2Z25A 2HS8A 1UIOA 4BQ4A 1ITQA 2IPFA 5CG0A 3RR4A 2W91A 1EA9C 1XSJA 1QBBA 4HKPA 2ZA1A 3W6MA 5HOSA 1B3ZA 3NZRA 1LM1A 2VZOA 4HIBA 1IWBA 1EJSC 1R85A 3V5CA 3HA1A 3BCDA 2BY1A 2PGEA 1XRFA 2FZNA 4M5PA 4UQAA 2WM0A 3MHUA 4C6QA 8RUCA 1OFEA 1I6NA 3UQNA 1T8QA 2Y5SA 3E9AA 3BG5A 2Z7GA 3WO8A 4NXKA 4LYRA 3QV8A 3A5FA 3IK2A 1YXCA 3D3AA 2WBKA 1FKWA 3MMUA 2BHYA 4XZLX 3N6JA 1J01A 3P60A 2ZADA 1G4TA 3LPOA 1GZJA 1E72M 3TTYA 3SY8A 3J7HA 1PWLA 3GG7A 4BZYA 4AYGA 3TSMA 1E9LA 5GVJA 1BD0A 3QMRA 1W9PA 1K8YA 3W00A 4MHBA 2P50A 1GVFA 2DQWA 1XPYA 1VFOA 3UJEA 4OOUA 3URBA 3HQOA 5E09A 3AC0A 4AMAA 1V7AA 3SY1A 1QK2A 1VQTA 3FJ4A 3QY6A 4A3YA 4C1NB 4XBSA 1PV8A 1KTNA 4NUWA 1IZCA 1LWIA 4Y2WA 4ICNA 4KCWA 2CLFA 1A5BA 4MZ1A 2TMDA 1JCXA 3F5JA 3HQ1A 3T9PA 3QY8A 3GUGA 1O60A 4XD4A 1TJ2A 4AD1A 3SIZA 4WOZA 3U48A 1IXQA 4RE0A 3OZYA 4YPJA 3MCNA 3LV5A 3ABXA 1FBAA 2JIWA 3WMLA 4JFVA 3TP4A 2P1FA 1G67A 4GCXA 3CO8A 3I7SA 4NI8A 2FZDA 4U3AA 5C2CA 4QXIA 5G1TA 3VA8A 3GHRA 4OZOA 4ZTYA 4DXKA 1KFBA 1LTDA 1UHVA 3NAVA 2Y8KA 2XSXA 1Z41A 4IIEA 5BMWA 2VO5A 1GGOA 3OIXA 1G1YA 3PSWA 5BXRA 5CQ1A 1W31A 4PB3A 5IFTA 5C5YA 5LA0A 5I6SA 4TV5A 1EJUC 3V35A 1AZ2A 4O11A 3LDVA 4GJIA 3CHDA 2P10A 1VH7A 4WJ8A 3IV8A 3TROA 3SUWA 4H4IA 5CSUA 2BGNE 1U83A 4MZYA 3PZTA 5DRCA 3CM4A 3BUVA 2EPNA 2ABBA 4CQDA 4A29A 2HPMA 4FF7A 3NO1A 2DZTA 1OGBA 4AHQA 2VFGA 2O9PA 2GJLA 3EOSA 7TAAA 3DFSA 3WJWA 4GVIA 3WLHA 3M5XA 1GOOA 1M9HA 2J7GA 2OWCA 1JD7A 4QE4A 2GGIA 2G3NA 2ZDRA 3AIRA 3W7MA 1TTPA 1TV4A 1ISVA 1VYPX 2NLIA 1US0A 3T0TA 1IZKA 1QNSA 1R30A 5K7JA 4V2XA 2R1LA 5HJXA 3RX4A 3GNOA 5HA7A 4YTRA 2BWGA 3G1FA 3APGA 3TOPA 2ACRA 3THQA 1AL7A 3WD3A 5FEZA 3WF4A 1FVPA 1JPIA 3CEPA 3GU1A 2D2HA 3ONCA 4ZSUA 1UR3M 2OELA 4XUGA 2BMBA 1TVNA 1UD4A 2DZVA 2O56A 4Z2LA 1H63A 3MQTA 5M2FX 4JY8A 2BY2A 2VTFA 1P0KA 3IIZA 1AH0A 3FGCA 1BRLA 3WQ4A 2OOGA 4O53A 1LQ2A 1MQQA 2VRJA 1ZRQA 3VX1A 2QT3A 5HXMA 4UQEA 4DYJA 3MCMA 1POKA 3SCTA 3WFAA 2VELA 4FF5A 3SBFA 4M19A 1OFQA 4H8VA 4N2YA 3B8UA 4D2JA 3Q4DA 2L5HA 3G3DA 1OJXA 3O0FA 1C29A 1GG0A 1NEYA 1KV8A 3GDLA 3W1MA 5I3DA 4GG9A 2NVDA 4D6FA 3LCIA 2FKPA 3Q58A 1GQKA 4H9ZA 1S5TA 1TRDA 3UT0A 4NF7A 3C2EA 2QUMA 1OABA 1E55A 2DT1A 1LQ0A 2WJFA 3KOFA 3PJTA 3LMYA 5A8MA 3NO5A 5DMMA 5EU9A 1M65A 3WQ8A 5DCBA 2FDSA 4Y9PA 3P0XA 1F3EA 1FDJA 3IVTA 4LY8A 4TQTA 5IXEA 3E2RA 1O6IA 3B9OA 1H7NA 4PTMA 3DBNA 3KZSA 4H2CA 1W5MA 1JUEA 2YL6A 3SCOA 3UJFA 2EEXA 1VPYA 4JQ3A 3DG6A 1MSSA 1OC7A 3WBAA 4AH7A 2FIQA 3HPZA 4O50A 1X6NA 1VJSA 4PUKA 3SJ3A 1EQPA 3W86A 3N34A 1HNYA 1TZ7A 3UXDA 4FLSA 4W85A 4DWSC 1XCXA 1U5JA 1ENUA 2RDTA 2JQXA 5CZTA 1Q5MA 4CNUA 3VO0A 2Y85A 4I5RA 2XH0A 2F38A 3MDUA 2VP8A 2I16A 2WSKA 2WSQA 2IW0A 5I09A 2FHBA 2DVXA 1DHPA 2RUSA 1LWJA 3SJNA 4DUWA 1G0CA 2XIJA 3NDZA 2DEPA 3M16A 2Z2AA 3KDNA 3ATZA 5FESA 1KCXA 3C8NA 2WLYA 1I0BA 2DT3A 1JVNA 4F2UA 3UFYA 4WKHA 5KZMA 3FS2A 1XLCA 5CAKA 3FA5A 3IJ7A 4D1IA 2ZRYA 2ZE3A 1H51A 5MHBA 2XVKA 4RV8A 2QAFA 3DYOA 4ATDA 2NQJA 3VIJA 1H0IA 3OVPA 3GC4A 3M6DA 1Q7MA 1TZ9A 1KGXA 1C8XA 4H9MA 1H49A 2YPIA 1PE1A 4MZ8A 3RX3A 4U2YA 1KFLA 4MDPA 2B7PA 1D8CA 2H8XA 3QM3A 4JNYA 1BWVA 4HMCA 2E1DA 3GRIA 1E1FA 3F03K 1BYCA 1KRCC 4R7WA 1J11A 2YA0A 3TA6A 4H6EA 4TMBA 1BKHA 1OCNA 1RBOB 2NSOA 4QTGA 2MNRA 1PCWA 1OFDA 2YSWA 4AW7A 1UH3A 1K6AA 3RHGA 3ZR4A 4YHGA 4I7WA 3ZJ7A 3N4FA 3P2VA 4HNNA 1ZBVA 1C93A 1CXIA 4H6RA 1MFUA 1ME7A 4NL1A 4CCEA 4EXAA 3TWAA 4UMCA 1EB3A 4AISA 1SQ7A 4TVUA 3TFXA 4CU8A 3UJSA 4F4RA 4C7DA 3VKKA 3ZLFA 3JZEA 1MXSA 2QIWA 1KLYA 1GEQA 1E0UA 1S2UA 3RCYA 1ZSXA 3M6YA 3WDRA 4BI6A 2DDXA 4FOKA 1ECEA 4ML4A 3QMSA 2CHOA 4KH2A 4Q4QA 2WMFA 1KFEA 5LSMA 4IMCA 4ZO9A 2ONEA 3U2CA 3EB3A 3UWUA 1RY0A 3GW3A 1QBAA 1KGUA 3NGFA 5G5IA 1UZDA 4XVEA 4RK8A 1V3MA 3OYXA 1VP5A 2ISWA 2EJAA 1T8XA 2XFYA 1JYXA 2HMCA 3P6LA 3H2FA 3P67A 4WJXA 1EDGA 4PMZA 4QJ3B 5DXYA 1JNEA 5G2WA 1EGVA 2A3AA 1I1WA 2QPXA 4G1NA 5G4EA 4Y8EA 1B1YA 1Y5VA 1ISWA 1QI0A 1SZGA 2PTXA 3K4AA 3BQ5A 2V0TA 4AIUA 5KETA 1PCKA 2CWXA 1JZ7A 2ZC8A 5E9XA 3COTA 4JTLA 3VMNA 4JTQA 3V0SA 2C1HA 3CV6A 5C6MA 1XBVA 1HF6A 1BSLA 2GVJA 4ZO7A 4C1KA 5FJRA 4YXGA 1NJJA 4NASA 4MJ2A 5K2ZA 1A5CA 2ZZ1A 3RRXA 4MFEA 3MPGA 4IG2B 3IS4A 4QDMA 5D8ZA 3E2QA 4YVXA 3PFMA 4LTSA 1XIBA 3HU7A 1MEWA 4Y8FA 1KRAC 3UF9A 4W4QA 2XIQA 1R8LA 2RHGA 9XIAA 3SR7A 1NDYA 1LOSA 3VCRA 4HA0A 3F4VA 3FHQA 3B0UX 2Q8LA 1YPIA 4H9VA 5AYIA 1LL6A 1W56A 3TC3A 4ECLA 3L7RA 2C0HA 1EFZA 3KBSA 3VC6A 1P0NA 3L5MA 3BGAA 3RDKA 2Y63A 3N6HA 4P5UA 2B81A 3TUUA 1C7TA 3SGUA 1EF3A 2G97A 3BDKA 2X05A 2VGIA 3IGSA 5CGTA 3UVAA 5FEPA 1E70M 1EO7A 3LRMA 3NL5A 4WGXA 1BQGA 3P82A 2YDQA 1R3QA 1ISYA 1MDRA 1P1MA 3LGDA 3GO2A 4D6GA 5DMNA 3QLDA 1Q6LA 3BWWA 2ZWZA 2BVTA 4PCNA 5K3VA 2GVGA 1GVIA 3QGAC 1PEZA 2I5GA 5I0DA 2E40A 1QNQA 1NOWA 2OZTA 1BYDA 4B5WA 1RXOB 3OJGA 5HQEA 3R7MA 4XVDA 3TSBA 4A8LA 1KXHA 2F2HA 1PDYA 1TTQA 1UP2A 5BXPA 3BMVA 3LCHA 3O6DA 3Q67A 1GVSA 3GTXA 3ZT6A 4B3LA 2P5NA 2P53A 4HA3A 3GFXA 3CIXA 3IGHX 2VVSA 1C3FA 4G7EB 1HL9A 1IWAA 4CN4A 4K6AA 4O1AA 2RJHA 4X2PA 3RLHA 1JULA 3C5QA 1E71M 3WQOA 4IGSA 3LYEA 3PJXA 2GSEA 3KVMA 1QRQA 4DZHA 3I3BA 1K8CA 3PULA 4O0QA 4IL2A 4IMEA 5REQB 4UZUA 1LG1A 1YDVA 1H61A 4S3JA 1LROA 3I6TA 1ZAJA 1OG0A 4WY0F 5DQPA 4KGLA 5H8UA 4K1GA 2W9MA 1SMDA 5FSEC 5BRPA 3EZ4A 4S3BA 2PC4A 3AFBA 1ADSA 1E15A 4RCXA 3WQPA 4LOCA 2A4AA 3G1VA 4JDYA 1E1CA 1QCWA 5CPLA 2FHCA 5I3IA 4W7UA 1WXZA 2Z0IA 2A6LA 2P88A 4OFCA 1GUVA 1R0MA 4BFAA 1B30A 3NQ8A 1BXNA 4NZJA 5FI8A 1LQAA 3BK0A 4Z1BA 4ZOBA 3WNOA 3CWNA 3L4YA 2W5FA 3IRSA 3BAJA 2HVOA 1S2CA 2A7PA 4LVFA 4B5TA 3CMGA 2PDFA 3AU2A 3DHDA 3PWGA 1THFD 3W7PA 2PD9A 4R34A 3W1AA 1J5TA 1CXKA 1GKPA 4GUHA 3S5OA 1P43A 3WG6A 4DBEA 2Y88A 1HJWA 2CLOA 3HV8A 1F05A 3CZGA 1IYXA 3WLKX 4DO5A 2PTYA 4J3UA 2OVLA 4EWND 1MRQA 1CLXA 3TJXA 1LRQA 3VKAA 3OA3A 3MANA 4PB4A 1H4PA 5BOOA 1ZY9A 3ELFA 3BCJA 1P7TB 3FVDA 2QCMA 4MOZA 3R4IA 2DPEA 4GI9A 4FO4A 4H01A 2VGFA 4PBGA 1WX0A 3PWIA 1JRBA 1WV2A 4O54A 2Q71A 1D8WA 2ZBTA 6CGTA 4DJDC 5F2IA 5AZ0A 3PB2A 4PCPA 5HMDA 2NWSA 2GQAA 3P62A 2X41A 1FWNA 1AK5A 5CLTA 1XC6A 3FXYA 3WJZA 1TE1A 2QS8A 2VEPA 1HVXA 3S2JA 2QUUA 2Z2BA 2ZUWA 1E43A 1ICQA 3U4FA 4PULA 1PB0A 2PWUA 2VCAA 4QJ1A 3ZLHA 3ITVA 4DBSA 4MDOA 1G69A 1ALDA 2G8ZA 3UG5A 4EKJA 4H2HA 2ZUUA 4LANA 2DH2A 3E02A 3TTSA 3KP1A 2JKPA 3NQMA 3VIFA 5LIYX 2AKMA 2V5CA 4GVHA 4K1WA 3AIVA 2RGMA 2WNNA 1RY8A 4B16A 1AQ0A 3CBWA 1Q2RA 1TX0A 2VR2A 4CQAA 1FWCC 3STEA 3HOJA 4P8VA 3UCQA 4ORIA 4N42A 3O05A 1X8FA 4F48A 3STCA 2YBVA 2ZDSA 1A53A 5IDZA 2KX9A 1PDZA 4JL2A 2EKGA 4JS3A 1XKYA 4ZSTA 2QJGA 4IMAA 3S9IA 4S2CA 5K9CA 3QR3A 1VRDA 3L67A 4W93A 2VZUA 4AZCB 3MJMA 1UQZA 1OD8A 2NLYA 2XIMA 1X7IA 4RR4A 3SN0A 3S5NA 2QPSA 3UWYA 1K4HA 3GFYA 3H7VA 4RXGA 1V0KA 3BAXA 2QAPA 3W26A 4ONVA 3SUVA 3WH7A 5KTLA 1EP2A 1XLKA 3DYPA 3NQ7A 5KITA 2PA6A 5DBTA 4OUIA 1KBJA 4GX9A 3W76A 3P8JA 4JYEA 3MCOA 2CHRA 2ZQ0A 4ROPA 2FVKA 2DT0A 1JFHA 1NDWA 1XLGA 3FYYA 2YOCA 6ALDA 4I3GA 2G4FA 2C79A 4LRTA 4O18A 2YR1A 4PFHA 2W4XA 3L12A 2DJXA 4JTKA 3KBNA 2A85A 1E9YB 2QMKA 3GIQA 5GJPA 3S9YA 3C2VA 2E6YA 1E4LA 4W7VA 3LBCA 1IT7A 3NIYA 5I3KA 5A6BD 3JS3A 3DGBA 4X9YA 5CC7A 1EX5A 4C60A 2JKAA 1K8XA 2OJPA 1E6ZA 2WKJA 3DEQA 4BA0A 2PF0A 2WVVB 4H7VA 2W27A 3UGRA 5CAHA 1OT2A 4W86A 1QXLA 4BQ3A 1BTCA 3U57A 3WK0A 1AQMA 2AGKA 2J6VA 1JZ4A 1EJWC 3QR0A 5BOEA 3C4UA 4O1DA 3VU2A 3WYZA 5CC3A 1FP9A 2Y62A 2CW6A 1XWYA 4DJED 2QHAA 3E2SA 2NX1A 4Q6XA 3UD6A 1XI3A 1J79A 3WMBA 2WPGA 2O9TA 3ABSA 3GVQA 3MUCA 3PUEA 2P8BA 4GZEA 3WCZA 4FNQA 1HO4A 5D2TA 5JU6A 2GVLA 4ZOEA 4UR7A 4GE8A 1K8ZA 1RK5A 5AC7A 1H3GA 1I2PA 1TJRA 4E3TA 3BSMA 1SR0A 3CO4A 4GIYA 2BLEA 2J4GA 3W83A 1MEIA 3W1LA 2ZRZA 2ZUNA 3OLIA 4P61A 3SSJA 4BKNA 3ITLA 4HHLA 1YPXA 1O68A 4UQCA 2NQZA 4NZ1A 2F61A 3HM7A 3I6RA 4NAEA 4KRUA 4WCJA 4DM1A 4QGCA 1V3IA 2PLCA 3UY7A 1XIMA 2HE5A 3EWYA 2VVNA 4FOUA 3SADA 3S9ZA 5AFDA 4F66A 4IIBA 4QHRA 2Q3OA 3IUIA 5HMSA 3L0NA 3P8IA 3LN3A 4JFTA 2PDWA 4O16A 3TW9A 2XUCA 3AIQA 3EYPA 3N2XA 3E1F1 4I9TA 4IGHA 3N2OA 5DEZA 1F2JA 2O9RA 3LK6A 1MXDA 1XLDA 2D2OA 1D7FA 2R6OA 3UGVA 4EK7A 2F6UA 3S1XA 1I0DA 4M6UA 1F6YA 4YCPA 3IV3A 4LV4A 1P0EA 4ZBCA 2ADAA 1KW1A 3CUJA 2VFIA 2PDIA 3NVTA 2EPHA 3WUBA 2WWCA 1TSIA 4FI4A 1TPEA 1AMYA 1UWAA 3SGZA 3HZ3A 4XX6A 2YXOA 4KBXA 4N4QA 2PCEA 4MM1A 2WAGA 4M8UA 3HO8A 1BLIA 1UWSA 4KFOA 2BV9A 2ZFAA 3Q65A 1QR7A 3WLQA 3L5AA 1KKRA 5A8OA 4OOZA 5CPMA 3FLUA 1VBRA 4RNHA 3MMWA 3WLTA 3U6WA 4W7WA 4ZQRA 1EJTC 1EDTA 1X98A 3WF3A 4GWEA 1EIXA 1ZP3A 2ZUTA 4ZL1A 4N9BA 5BZAA 4A3QA 1XIGA 2QCDA 5MKGB 2VHLA 1A5NC 2Y1HA 3IWPA 4UTLA 2E68A 2WO5A 1OYAA 4GYFA 1J12A 3RITA 1TUXA 8A3HA 2B0MA 1UD6A 3G1YA 2PP1A 3RLVA 2PDYA 3CIVA 3BOLA 1UR4A 1DKWA 4BWLC 2G4JA 1V6YA 2GK1B 4R5EA 1XBZA 4HTBA 3R5EA 4PMYA 2PDUA 2VD9A 3V0UA 5AECA 2OSYA 1SJCA 1PSCA 4LS2A 5LNRA 1V6TA 4R27A 3OG3A 1XYCA 4BR1A 4N6FA 1R46A 3BVJA 3L4VA 2GOUA 4FXFA 3R94A 3QSTA 4XAPA 1KM2A 3TU9A 4BQ5A 4MAVA 2R1NA 4Y9MA 1PBGA 4UXDA 2I56A 3MB9A 3FJ6A 4F0RA 2H9AB 5D30A 1S2VA 4U4MA 5C2XA 4PUDA 4JCLA 5CPTA 4PEKA 1MYRA 2OTDA 1HGYA 1HP4A 4ACZB 3NM1A 1JCTA 1MNSA 1MMFA 3TN3A 4NQ1A 3CPUA 3MTWA 3PNZA 2TSYA 1NY1A 1C7SA 2HPIA 4NVTA 4PC8A 5A95A 3BXWA 2DSUA 2PDPA 1EJVC 1UH2A 1P6WA 1W1TA 4MLJA 3MYOA 2G3JA 3AYRA 3LBMA 3BAWA 4HNOA 1S2TA 3N29A 4P8WA 1G5AA 3UYCA 1GCYA 3AXHA 3E96A 4ADUA 1CGWA 1JCMP 4JFWA 1JCLA 2GGHA 1A0DA 6PTDA 1DBTA 2QLYA 1GJUA 3M0ZA 1BRLB 1K1DA 3GC2A 4PUJA 1L6WA 3AZTA 3B40A 3T0DA 1WXJA 3QGVA 3NG3A 4J3SA 5XINA 2PDNA 3TYBA 3OBAA 3GAKA 5JIWA 1CXLA 3R79A 3PPFA 1LZOA 2VURA 1NVMA 3TQVA 1V51A 3KRUA 1LG2A 3LZ5A 4IT1A 1R6WA 1I8JA 3PWAA 2XN1A 3BG9A 4OV4A 1OG6A 4JNMA 3H70A 4ZO8A 1UCWA 1BFNA 4AWTA 2HEJA 3AHXA 3BC9A 1W54A 3WFLA 1S3HA 1IEQA 1Y7VA 2AGTA 4NNBA 2OZ0A 2ODOA 3ZSSA 4PMQA 1RD5A 5EMUA 4AF0A 5KZDA 4PUWA 3A4JA 3HG5A 3STPA 3P84A 4QS6A 3QPZA 4MSSA 3RPMA 1QOPA 3M0MA 4EANA 1ONEA 3MBFA 5CCZA 5FL1A 2RDXA 5GJMA 1OB0A 1QI5A 2XVPA 4NZCA 3SFKA 4FNUA 3CQ0A 1N82A 3OGRA 4U5IA 2RAGA 2R24A 3W22A 2VQUA 4MADA 1TQJA 1UWUA 4J40A 3EDKA 5I3FA 3UYIA 3PZNA 1EHNA 3P5YA 4W9TA 1C8VA 5FF3A 4QJ5B 4UC5A 2YBUA 3BW4A 1CXFA 1VFSA 1SR9A 5JMUA 4AX7A 1EJ7L 2WPBA 4GABA 2AQWA 3QZAA 2YB4A 3UG3A 2ZZ7A 1HKJA 4C1LA 4ERGA 2OZ8A 2DZXA 2VWTA 4A35A 3KCJA 4FNSA 1X1OA 5FF4A 4WOQA 2PC8A 2ACSA 1W1VA 2VQTA 4MJMA 3OLGA 3G0XA 4HZ7A 2VDIA 4EWJA 2PWDA 1TZZA 2QJHA 8TIMA 1GQLA 4O57A 5G4WA 4Y96A 3T0CA 4LS0A 4C7FA 4MNKA 1TE6A 3TONA 3UWEA 2OYKA 3R1ZA 3SECA 3NYDA 4RE3A 3AS3A 1OCBA 2ISVA 3MV11 4Z2JA 2ZX5A 3D46A 4I7UA 4JIIX 1TPC1 4HA4A 1KM1A 3EMCA 4AD2A 1ZJIA 1K77A 2GLKA 2QPUA 2YKKA 2AAMA 4UTJA 3WH6A 1RA0A 4R3UA 1Z44A 1GEHA 2G3MA 1BF6A 4Q7BA 4DELA 2OLAA 2VFHA 4MNLA 4CVWA 5CPOA 2PDLA 3N15A 1UPMB 2G3FA 1NH6A 3VIKA 4IQDA 2VD8A 4XAFA 2X1RA 3ZWSA 1YNPA 3TWBA 3G1SA 3K13A 3KM8A 4QCEA 4K38A 4GZIA 3ZFHA 1Q66A 2J25A 2BDQA 4ZENA 4IMFA 4PTDA 3U2OA 1VHCA 2ZTKA 3CUXA 3LI0A 2OYLA 2HDJA 3IJDA 1HVQA 3UXIA 4ZB0A 2W67A 1GOQA 8XIMA 4Y6GA 2QF7A 4LFYA 2QULA 4CEXC 1GT8A 3E0FA 2DV0A 2AOSA 3AXXA 5DMYA 3WK3A 3VKCA 1QHOA 1DOSA 3L0KA 1TMQA 5CJNA 3T7VA 4UMAA 4AVNA 1KBBA 1QU4A 4GI8A 1BXBA 3USZA 3MP4A 1XINA 3LX9A 3MUXA 4Q4SA 2PE4A 4HHHA 4DF2A 4ZE5A 4JTTA 4ZA0A 3UBPC 3WQDA 4QNWA 1G6CA 2TODA 4FXSA 2YA2A 1M41A 3TYCA 4UMBA 1KXVA 1TV5A 4GIRA 4E8GA 4KRTA 4MKNA 2QZRA 3H12A 4CQBA 3BAIA 2C16A 1MW0A 4IIHA 2Y4SA 2IPWA 3S3GA 2CPUA 3ZS4A 3B9AA 3TN5A 3NL2A 3AISA 3W73A 4GNVA 1UW9A 3SB0A 3BLDA 2XIOA 3UNTA 1M7JA 2QR6A 3NOYA 4IQEA 1DJGA 4C7GA 2QCHA 4OKDA 3DDMA 5LXXA 1MXGA 2DORA 2DW6A 1EPVA 1EEPA 4D6CA 3QBUA 2ZVRA 1MZRA 1J2BA 1EEXA 1YTDA 1DJXA 1RP8A 4UUIA 4WHBA 3LPFA 2ZZ5A 4ZB2A 3QV7A 2DUAA 2FTYA 1QWKA 2XJ7A 1K9TA 4GUIA 4KFPA 3IJIA 2R9RA 1S5VA 4M0XA 3R11A 4WY0A 3C0LA 1A80A 1E0XA 2GDQA 3HQPA 1K4GA 4GOAA 3NXFA 5JXQA 3PM6A 1VEPA 1U22A 3UCDA 3CYVA 2D0GA 4LY4A 3VILA 3W27A 4PSPA 3NEHA 1B5TA 1TX2A 3LBOA 2EBNA 3W37A 4ZZ9A 3LHWA 4HPNA 4QQUA 4NNAA 1CECA 4UTHA 2DU2A 4MPKA 2QVHA 3M44A 3G1RA 1YQ2A 5CZJA 1GWJA 3DECA 3UERA 5AHMA 1OFOA 4LS1A 3SN1A 2PDCA 4S3EA 3WEMA 3ARTA 4QFUA 4JTHA 3ARUA 1VF8A 2I5QA 3PUOA 4GACA 3MBDA 1KWKA 3G6LA 3F2BA 3L2LA 1T99A 2ZXDA 4LUTB 4MB3A 3CLWA 5D33A 4HZMA 1WDWA 2Z27A 1PKNA 5IHRA 4B9YA 1PS9A 3KS6A 3WBXA 2WCAA 5PTDA 2D2GA 3BMXA 3EOUA 3WJSA 4NX0A 2J78A 4MB1A 5FAGA 3PZGA 4Q8PA 3M7WA 4GO8A 1HGWA 5AYZA 4H1ZA 4LAMA 4X0VA 2WB5A 4KCVA 5FAJA 4GVFA 3N04A 5I24A 5E5CA 5ABGA 3JU2A 3KL3A 4I9JA 4D72A 1ZBWA 3WJYA 2YFOA 4QJ4B 1TPB1 3GS6A 3G24A 5B80A 2DUZA 4G6CA 3JVAA 2QUTA 5H2ZA 4M3PA 3ARWA 3B8WA 4C65A 1S38A 3H24A 2YZ5A 3RAOA 3WDJA 3CEUA 4AZIA 3NL3A 3W7JA 1IR1A 3N25A 3REQB 3VPLA 1YBQA 2Q6ZA 1ICPA 1XXXA 1JZ6A 3W7RA 2F9RA 3FNDA 5I07A 2W61A 3F5KA 2FJUB 4M24A 4IJRA 3NSNA 1XSIA 1GTHA 1E3XA 3U4AA 2ACUA 3LTPA 2PGRA 3DERA 4LAZA 5I7GA 4WDWA 1H0GA 1XH0A 1QPRA 3PR2A 1NOUA 5BRBA 2I7GA 2E7FA 4LUSA 4MY1A 1JL8A 4B9ZA 5A6BA 2BOFX 4XO6A 4C6NA 4CNSA 4D71A 1IEWA 1WZLA 2OODA 2ZOXA 1R3VA 3DFTA 4AZCA 2CLPA 2QW5A 4AU0A 2V2DA 2BOGX 3A13A 4EACA 1I2NA 3BW3A 3QH2A 4E2OA 4CCCA 1Q63A 1O5RA 2GJNA 2WJEA 1DYSA 5I77A 1FKXA 1LL7A 4KMQA 4WUIA 2RDUA 5EKYA 3KLLA 1RVKA 4AD0A 3LI1A 4KEUA 4FOJA 4HOXA 1OK4A 3WELA 1AD1A 2JE8A 1UZ4A 2OMAA 2BVYA 5T9BG 1EXPA 1W3KA 1NU5A 4WGHA 4CU6A 1ML1A 3MHFA 2W6RA 3TC6A 4E2VA 2B7NA 3RYSA 1LWHA 2YXGA 4H41A 5C9ZA 3EX2A 3F4WA 1VHNA 3GXIA 5FD0A 3KP0A 1REQA 2V3DA 4AG0A 1EWDA 4JPGA 1XBXA 1JUKA 4IP4A 1XUUA 1CGUA 3WUFA 5ABFB 1YLVA 1SO5A 3VTRA 4LNCA 4BS0A 1OD0A 1AW5A 4A8RA 3GNXA 2MANA 3GG8A 1LBLA 1EO5A 1CT5A 3I65A 1K7FA 1E6NA 3GSMA 1W32A 3DH7A 3PK7A 2WMKA 3HPSA 4JBRA 2BSLA 4Z17A 3N2BA 1WDSA 4NIRA 5HPOA 2Z2UA 3ZO9A 1LF1A 3XINA 4LBUA 3TMLA 3BJSA 4C6FA 4IJBA 3BG3A 2BVWA 2FLIA 2D22A 2YDSA 1VCFA 5A6MA 3EEGA 4WKAA 4IGMA 3ARZA 5BMXA 4EXQA 1K9EA 3WQCA 4L64A 3WKZA 3EWDA 2WC7A 3K30A 4JOMA 1RALA 3PHAA 4PUMA 3HFYA 4BHYA 2UY3A 5EMLA 2OQLA 4X63A 4JX5A 3S5SA 1CGYA 1W17A 1WCGA 3RM4A 2INFA 4M7SA 3EA2A 4Z1AA 3VD9A 3W7CA 4AZ7A 2CIPA 1FTXA 3W07A 3CZ8A 4ZXOA 2PDHA 3VC5A 4O12A 2XWEA 4CN1A 3IRDA 3RO8A 2XZ9A 5AYYA 5H8PA 1L8PA 4A6GA 3GVRA 4X2RA 1GZGA 4GBUA 4IHCA 3EA3A 4I5XA 2PD5A 2FB2A 3MZNA 4JHMA 3GD6A 1WE5A 5RUBA 1TB3A 1VJIA 3OODA 3R0UA 2P8CA 1TPH1 2XIIA 1WKFA 3S1GA 3FEQA 4H9YA 4OU1A 5LHFA 4DBWA 4QDPA 3WNNA 1FH9A 1TV8A 1OF8A 4L6DA 4KRZA 3H2CA 3S42A 5ECUA 3W7HA 2C3ZA 4HHPA 3LY0A 1CX9A 1KXQA 1P1XA 3EB2A 4D8ZA 1IQ8A 5CLWA 3TAOA 3EOLA 2DH3A 3UA4A 1NDVA 1OFPA 4XZHA 4E38A 4HK7A 3VOIA 4CQ9A 2C13A 3AMDA 1RP9A 3IACA 1CLKA 3M43A 1W1ZA 4QRNA 2GL5A 1RA5A 3V5FA 1Y0EA 1X39A 3MW7A 2WZMA 4OT7A 3H2NA 1FCQA 1XYZA 4PN2A 3WQGA 2Y6ZA 4CQCA 1HFBA 2XSAA 2PP3A 3W7QA 2VI0A 3WK1A 1EL3A 2FFIA 1TFVA 3GUWA 3NURA 1HL8A 2ZXAA 3OPSA 4DJEC 2CLMA 3PS7A 4M56A 2VNCA 1UOKA 3OQEA 3WENA 3R0DA 1W3TA 2NT0A 5BXTA 3NQDA 1W2VA 1MW3A 3VIHA 4DRSA 3G0SA 5EL1A 1FXQA 3EWBX 1ZCCA 2ZKMX 2BHUA 2J9XA 1WKDA 1G94A 2DUXA 3VNLA 3U5UA 1B3OA 3FYOA 1P6BA 4WJEA 1S5WA 4S3KA 3UESA 1R3WA 3F4DA 3H7UA 4Q8QA 2JFEX 1XW8A 5BYWA 2ZRUA 1EDQA 3A4AA 4AY8A 3K8KA 4QIUA 1JCYA 4AYSA 2EF9A 2FH8A 1T6MA 2IKHA 3OLDA 4XZIA 4E4UA 1DWFM 2G95A 1TWSA 1DWAM 5KMYA 2QV5A 1IT8A 4MFDA 4OWGA 1RBAA 3CQJA 1CENA 4YTSA 1XF0A 1PX4A 3CS2A 3LMZA 5HUPA 1YHTA 3LHTA 2OG9A 3WDIA 4B5VA 4D6IA 3TA9A 3H8AA 2IQTA 1R9XA 4HU3A 1MVYA 3V5OA 2IUZA 4US5A 3AYVA 2E9LA 4ZFCA 1XSKA 1QPKA 1M3UA 1OZQA 3E2VA 1TWIA 1B3VA 3QF0A 4U31A 1QJWA 3BZGA 5AYXA 5A8GA 5CGMA 3CQHA 1IR2A 1JJKA 2OO6A 4S3AA 4UOQA 2GUBA 3PC0A 2WMJA 1BWLA 3N13A 2PU1A 4LW7A 5A1AA 3LSBA 3VAVA 4QSFA 3FYPA 3CNYA 3KL5A 4XTIA 4D8LA 3MJYA 3O6CA 1NWUA 1TIWA 4XUYA 1XYAA 2PURA 1EC8A 2GWGA 4HNUA 3ARQA 4N9CA 4E8DA 3LXAA 2CBVA 2EPLX 4PMUA 3KRSA 3D0CA 2PEVA 3HIJA 1XH1A 3CHEA 5H91A 1OIMA 3NQCA 3PBVA 1RZMA 1G4PA 1VBUA 1JAKA 2CZVA 3ZJ8A 3SSZA 3SFWA 4R7OA 3PTMA 4DUVA 2VRKA 2ACQA 3RM9A 1AH4A 3QHNA 5CZSA 1E3ZA 5CGQA 4Z0JA 3NQFA 3OLEA 2IS7A 3AIEA 3IJQA 2Z1WA 3ONBA 4YVPA 2FYMA 3OZPA 3TIMA 3ALGA 1R3RA 1UR1A 2INEA 3GKAA 4XWUA 3AZRA 6XIMA 3VGDA 3CAKA 2ZA3A 4L6HA 3CYJA 2Z1BA 4FB7A 3V1PA 4FK9A 4AZGA 3BLIA 3BQ6A 4PMDA 4LT9A 4ADSA 2PDBA 4JTRA 4MNJA 4WRHA 3FCPA 4E2DA 1H7RA 4ZOCA 3Q2DA 4BF7A 5FJOA 2NXIA 1SUXA 3WZ0E 3BV4A 2GJPA 3ORWA 2ZTJA 3SCWA 1YRRA 2E77A 4INFA 4JTAA 4IIGA 2B31A 2V5BA 4PODA 2JGYA 1J0ZA 1XGDA 5FJTA 3O8AA 3VDCA 3LNPA 5KZEA 1EUNA 5IHSA 3G1AA 3GBEA 3ATYA 4UBPC 3MUAA 2A2IA 1JDFA 3S1VA 2EGZA 2FMOA 3LLFA 5LIWX 4O52A 5A69A 4FX6M 1OEPA 5JQ9A 1M7PA 4XAYA 3ZR6A 4LCRA 4JIQA 3OGVA 4R9OA 3VNKA 4GA8A 4FNPA 4GVGA 1OSEA 4UTMA 1MUMA 2OQHA 5EMYA 2A3BA 4TX8A 4IPNB 2PWHA 5FKYA 5AC8A 2KZHA 4AZ5A 2GOKA 4MWAB 2FJKA 1N2VA 4KFNA 4HCDA 1K7EA 1LBFA 4TVDA 2QJNA 4DBUA 3AIUA 4M6QA 1OT1A 3DI0A 3GDMA 4GMEA 4HN4A 3BANA 3SURA 4DI8A 2J88A 4K8GA 1EUAA 2DP3A 4BJHA 1H60A 2TAAA 4JKMA 4FR1A 2VC5A 2ZVIA 3QEZA 3ZJ6A 3O6AA 4OTKA 3NXLA 2TYSA 5HNNA 1FUYA 4LXFA 1KBLA 1CB2A 3BURA 5E70A 3H4XA 5EFDA 3URNA 1JZ8A 4TTGA 3JZUA 2ASHA 3N2TA 2DJLA 4RX0A 2ALRA 1GVEA 5CSYA 4DPQA 3K8MA 3ITCA 4DI9A 4CCZA 3LHVA 1DE5A 2VX5A 1B3WA 4GH1A 4MYAA 3ITYA 3RPTA 1JYWA 2GQ9A 3S6DA 6A3HA 4JTCA 3EOOA 4IFKB 5AHLA 2FZ8A 2Q02A 2VGBA 6XIAA 3MI3A 3M0KA 3TX9A 5K4XA 1CGVA 2ZUMA 4Q4MA 1S1RA 6TIMA 3SO7A 4C6MA 3G2GA 5HDRA 2A3LA 3ABQA 3U8GA 1UKSA 4ATWA 4JY9A 4IXHA 4Y90A 4BQ2A 3AROA 5SWUA 2C15A 3M64A 5EGRA 4D6JA 2ATMA 3UWZA 2DFAA 1O7AA 4HNVA 2O55A 4J3VA 1KXTA 3KVKA 5CBJA 1B0IA 3SCVA 1H50A 1PVNA 3A9BA 4GH3A 4N7QA 3LSCA 4K7YA 5A6TC 3WQWA 1BEUA 5TQLA 2YCIX 3ES7A 4XIAA 3VOGA 3SW6A 1R9ZA 3TZFA 2X0SA 3W7LA 2XGBA 1TV3A 4LGXA 2WM1A 4G9PA 3CPRA 3CZLA 1RUSA 4AIBA 2OT1A 3AICA 3U5YA 2CLEA 1K02A 1Q65A 2HWGA 1FWGC 1D7KA 4U10A 1MQRA 5I2UA 1EJXC 2VX7A 2R1KA 2X16A 3NR0A 3VIPA 4GZJA 1V4YA 2V81A 2NVAA 2QEZA 4G5DA 3P3BA 2WANA 4DBDA 2QF8A 3E5BA 2G50A 1XM3A 6REQB 2CZDA 4MNMA 3W7GA 2WYSA 3H22A 7PTDA 4UTTA 4DXVA 1MEHA 1SFLA 1N8WA 3DI1A 1BHGA 3VD4A 5K9DA 1Y65A 3GDTA 2VL4A 3ZOAA 1AH3A 5CPSA 1UMYA 3QN3A 1PZ1A 3CL7A 3V16A 4HJWA 1W5QA 2ZIDA 5GNZA 4D6HA 3DYMA 3VZYA 1WKYA 2CWNA 4G7FA 4EAMA 1ZENA 2YLLA 5CC6A 3DFYA 1PTAA 4FLOA 3EXRA 3FAXA 4JYDA 4OJYA 4IG2A 1TCDA 4XBKA 3RGTA 3CL8A 3C2FA 3H21A 1FQ0A 3NZ1A 3BZJA 4O15A 5HQLA 2XVNA 3CUZA 1XICA 3UR5A 3QZ6A 5EMKA 1E1CB 3ITTA 4MF4A 5DY2A 2Y0FA 1KKOA 3GXFA 2WJDA 2QGHA 4QAIA 3ENLA 2WSRA 5T26A 4B5XA 2BASA 3R89A 2PDXA 2J8FA 2NQ5A 2E6DA 3OTRA 3SIMA 1SO6A 4XG1A 2XVLA 1OYBA 1KNWA 1NWRA 2O7SA 4WDTA 4W84A 4KWSA 3PB0A 2V3FA 3VGBA 4QITA 4WSJA 2XYLA 3S5ZA 2E4TA 2QV4A 3L23A 5BU9A 3G1XA 2PWEA 1FFRA 2PDGA 1FOBA 3POHA 1CCWB 3D5HA 1AJZA 1PIGA 2X7VA 4YN5A 3VOJA 4GPNA 4EOUA 5LHEA 4JIEA 4J3XA 2PLKA 3KBVA 4L4PA 5IOBA 4WVXA 2C1IA 3PP7A 3TW6A 2Y8VA 4X0NA 3G8RA 3BLOA 4DWSB 1W9VA 4GNKB 1CBGA 2IMRA 2ZX6A 1Q6DA 5AZ1A 3H4GA 1EXBA 4GO9A 2PWVA 2E3ZA 1ONWA 3AMKA 4HPHA 4NKCA 1NAL1 3AIWA 4R88A 1YEYA 2IKIA 3JRKA 3P74A 2YCKX 1XPGA 1P7TA 1UKQA 3L21A 5F4SA 1GOIA 1O1ZA 2V5JA 2J24A 3HG3A 3CUHA 3D3FA 4UZSA 1KLZA 2HNHA 3W1UA 3GTHA 4DJFC 1GKQA 2YL5A 3MHGA 3RMJA 5EMJA 2WKGA 1MDLA 2DVUA 1RPKA 2NV1A 4ZE4A 2Z1VA 7TIMA 2PF8A 3EX3A 3TTOA 2Z00A 1HT6A 1J4EA 4Q8UA 4A2SA 4DO4A 3EXSA 2WBGA 2E6AA 3AS2A 4J35A 1SZFA 4OQVA 1N7KA 1A5OC 3RU8X 5A6JA 1KQZA 3NQVA 3TSDA 4JXCA 2Q3RA 2V82A 3UA3A 4AF0B 4WLCA 1ISZA 1LLWA 1HKKA 1D2KA 3NCOA 5T9CE 2E28A 1OCJA 1A0EA 3LQLA 4PCTA 2HROA 2JBMA 4PL1A 2SFPA 1RD6A 4M51A 1PKMA 2Y7DA 4DJEA 3CQIA 3UPWA 3ANYA 1CI1A 3I4KA 3OOQA 3V36A 3PZOA 4UQBA 4EVZA 3NSXA 1HW6A 4A05A 3QGKC 4POCA 4LSBA 4HU0A 4ERIA 4PBFA 3VGEA 2X2YA 1BVZA 3C6CA 3ALFA 4AZ6A 1OBAA 3V7PA 2P76A 1NFPA 4QROA 2PP0A 4LU0A 4OHQA 2VDHA 4ES4A 1F4HA 2GQ8A 3EWXA 3PZMA 1OINA 1LLZA 3FVMA 2HS6A 1KM3A 5A2BA 4N6EA 2WNWA 1NWTA 2OGJA 4KIEA 4JTUA 1K70A 3KRBA 3ABRA 3TXVA 4R7JA 4B15A 1W9UA 4LAKA 4YMZA 3EDEA 3U7BA 4ZGYA 3KBMA 1DTNA 3O2LA 1Q7ZA 1W3JA 5D37A 4F40A 5EBUA 2X7WA 4I5UA 3RJXA 3PZVA 3OB8A 3OIHA 2G96A 5HJLA 4MKVA 3H4WA 1FP8A 3OGSA 4IUOA 4LQ1A 1Q6RA 2BFGA 4GXPA 4L80A 3W2NA 4N9EA 1BYAA 3H2MA 1VZWA 1TPUA 2CBIA 3IIVA 2X30A 2DSVA 2OFJA 3N9RA 4IGNA 1WBHA 2V69A 4XBJA 3NQ2A 1GJPA 2C19A 3CC1A 3ZXWA 1WPCA 3MUIA 3OVGA 1BKSA 1TELA 3TJIA 7REQA 2DGAA 3GM8A 4QM1A 1CEOA 3GB6A 3MT1A 3C52A 1DJHA 3LTSA 1HJVA 3MKVA 1FA2A 3WLOA 1V3HA 4ZMGA 3NPVA 2C8NA 4M7TA 3RUBL 1V02E 2Q8XA 2HE8A 3VOCA 4XZNX 1WP6A 1JIBA 3GE7A 3URAA 2R94A 4HCHA 1YDYA 4LCQA 1QW7A 1JG9A 4RE4A 2OEJA 3EWCA 1E40A 1I2QA 1V7YA 3UWQA 3I68A 1XLLA 3R8RA 3MMDA 1UR9A 3E5PA 2GVEA 5HANA 1Q6GA 1IGSA 2HBVA 1FWHC 1DWIM 2NXGA 4QS5A 2ZX7A 3IAPA 3WD0A 1XC4A 1U30A 1UZ1A 2C7FA 4LRSA 4XKMA 3DXIA 1DP0A 1PIFA 5XIMA 4M81A 4AIOA 1E73M 1H7PA 3FSUA 3MDWA 1R3TA 1HN1A 5CPQA 2DVTA 2X40A 1L2QA 3W24A 1J0KA 3A3WA 4QEHA 2PRLA 3MMTA 3WLNA 4DNMA 3ZQ9A 2V8ZA 1AMKA 3CB8A 1OZMA 1JXKA 4EXBA 4CEUC 2FZMA 4D6DA 1B9BA 3NO3A 4GISA 4R85A 2NVCA 4M6VA 5CPNA 2IQDA 4MY9A 1V77A 1ICSA 1K7XA 1IIGA 5FEWA 3BMWA 4B90A 3VOHA 3KAOA 3TOYA 1AW2A 4E0CA 1XLJA 4F8XA 2VGGA 4GBDA 3W28A 4KS0A 3U3HA 4DAIA 4Q4OA 4W88A 4FX7A 2E67A 1OC6A 3CV1A 2XG9A 4B91A 4QR6A 1A49A 2RKXA 4KEVA 4RW5A 1SZNA 4HNTA 4MYXA 2IQ0A 1J6PA 1CZ1A 2CLKA 4ZXLA 5C8BB 1ZJBA 1ZLPA 1L6SA 1UQYA 1AJ0A 3IJ8A 3H7RA 1R2SA 1T41A 3WUGA 1UA3A 4O10A 4L1XA 3KBWA 4MG4A 4HHMA 1XDLA 2PFHA 3HGOA 3NEVA 4YWIA 2VXNA 4F0KA 1W1A1 1XUZA 1XKJA 1HJQA 2VKZG 1QW9A 4O1BA 4A21A 4YS1A 3HBLA 2V2HA 3W85A 1EWEA 1V6VA 4G2DA 3OVQA 3MVIA 4MIMA 3MWAA 2H6RA 3B05A 4J1OA 2J7EA 3QKZA 2DIKA 3UCCA 4PRTA 1VFUA 3FIGA 3WL0A 4PMNA 1WDQA 1C91A 2BXVA 1OGSA 4X61A 1H11A 1EF2A 1UD5A 5FOOA 5TNVA 1YXDA 3NDOA 2FZ9A 3A24A 1AD4A 3FSTA 4JIPA 4P7RA 4BEUA 3S6TA 1VIZA 3STFA 3UU0A 3M5VA 3O0KA 1TKKA 1H62A 2Z6IA 3TCSA 2XGZA 4H83A 1EOMA 1V3LA 3CT2A 1M5WA 2BZNA 1ZJHA 1VFHA 3EWUA 2BXZA 1PX3A 3QPYA 4LVGA 1IZJA 4D6EA 2Q01A 2D69A 1T7LA 3BPWA 2NV2A 5CXPA 4CVUA 4A8IA 4KCUA 3I6EA 2EG7A 3HGSA 2B7QA 3NQEA 4PMOA 1L6YA 1BSIA 4GFIA 1EYWA 4J2PA 1VEMA 4XAZA 3GR4A 3H54A 5H8MA 1BPLB 3UR2A 2GGGA 3OHIA 3MC5A 1HQTA 1FHDA 4IQLA 3SRKA 2NUXA 2YBTA 2CKSA 1YDNA 4OBSA 1VJZA 2J74A 1B9ZA 4Q4PA 2YJQA 1OX6A 5LXEA 1FHUA 2IPJA 4Z08A 3FKRA 3FA3A 1EIBA 1TV2A 3TTEA 5FJIA 2VFDA 3UZZA 3V3WA 2X1SA 4FXJA 1PHWA 1RQBA 3LM7A 3GU2A 1VFLA 2I9UA 3MU7A 4HOWA 4PMVA 3G6MA 2XDFA 4JHOA 1BYBA 3KOWA 9CGTA 3N3TA 2YYTA 1XGEA 3T8QA 4D9PA 4KERA 3LERA 1HUVA 3VGHA 2GUYA 1A5KC 4Q7IA 5A6AA 3BO9A 4MB4A 3QFEA 4FXRA 2Z7KA 2REQA 1XISA 2OXNA 3BSGA 3RO6A 3EX4A 4C5YA 1OWQA 3MWCA 1MUCA 4XD6A 3KCOA 4TU1A 4RDYA 3GXTA 1KRMA 4LAUA 5BOFA 3JR2A 1PJ9A 1FWRA 4H6KA 9RUBA 2HV5A 2FHFA 1TA3B 4XKYB 1F7BA 5LZLA 1V03A 3GYCA 1Y5WA 4Y9NA 1YADA 4DHGA 1FWWA 2ISSA 2RH9A 3L4WA 3RXZA 4ACYA 2I1OA 2JEQA 1KV5A 1QMLA 3PG9A 4HPXA 4GKTA 5EB8A 5AYBA 4FR6A 4UNIA 3WLJA 1KGWA 2YX0A 5HR6A 3GVWA 3A5VA 4NJIA 3VZXA 2RJGA 4KWOA 1R38A 4FS9A 2P3ZA 4CD8A 4K36A 3PBYA 3BCFA 3GKFA 3K1DA 2RFGA 3P0WA 4KCTA 1SO3A 1GYLA 1K3UA 4FNRA 2VZSA 4O13A 3W1TA 3KHJA 5DY3A 2HK0A 3VCNA 1XRSA 1XQLA