1GYNA

Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
358
structure length
333
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGALYTQPEDVDYAYTELSKISPRFTIAASFGNVVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE II
publication title The Organization of Divalent Cations in the Active Site of Cadmium Escherichia Coli Fructose 1,6-Bisphosphate Aldolase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 142
structure length 333
sequence length 358
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2002-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gynA00
2VKZG 4BF9A 2E6FA 4JTJA 5BOOA 3L2IA 3AJXA 1HO1A 1G67A 3S1VA 4XZ9A 1UCWA 2I1OA 1AG1O 3EKLA 3TE9A 3M44A 2Y88A 1A5CA 2F84A 3DGRA 3NOEA 4BI6A 1B3OA 5G1YA 4OU1A 3TQKA 3G22A 3LERA 1LOLA 1JCLA 2A7PA 4AF0A 4QAIA 3UYCA 5J5DA 2G97A 3S9YA 1XBVA 1YTDA 5FEXA 4K37A 2X1SA 3LBCA 3G0UA 1H7RA 2A5HA 2VXNA 4GBUA 4JNMA 3NM3A 1V7YA 1VHNA 2V9DA 4O8RA 1GYNA 2B0MA 4PEKA 5K2ZA 4IQLA 4HSOA 3S8HA 1TPB1 3LCWA 5FF0A 3DBPA 3GDMA 3ZWTA 4K39A 1KFLA 2OJPA 4UFMA 2NUWA 3LRMA 1JUEA 4JICA 4H6KA 1ONRA 3FYPA 4RXGA 3EWUA 1F6PA 1OF8A 5LGZA 2Y7FA 3PR2A 4FNRA 1HG3A 1TCDA 1NSJA 4LRTA 3HGSA 3UY7A 1PVNA 4NUWA 2J6XA 2DZPA 4JTSA 4HNVA 2ISSA 1OHLA 1TPUA 3FYOA 5KSWA 5J5RA 3S42A 3N34A 4MFEA 1JRBA 2YZRA 3NL2A 3W1PA 3MP4A 3A24A 3G0XA 4CNNA 5D37A 3L9CA 1MEWA 2V8ZA 1LRNA 3S6DA 1R2TA 4O14A 3NVTA 4S2CA 3I7SA 1DL3A 3ATYA 4UTHA 1EP1A 5D2XA 1TMHA 1V5XA 3LV5A 4FHAA 5MHBA 4DF1A 1YDNA 4NT0A 1HO4A 2Z6JA 1VRDA 4HIBA 2DJXA 3AO0A 5F4SA 1H61A 2PE4A 1GJPA 1OVDA 3CIWA 5C2XA 5HJLA 3HBLA 1LBMA 4O0KA 2YSWA 3DFOA 5DBUA 3CWNA 3NL6A 4R34A 3PBYA 2ZRVA 2TPSA 5DY2A 3GDTA 5DBTA 2JKAA 4O18A 1XUUA 1EP2A 1O4UA 4A2RA 5CZ0A 3W7QA 3LRKA 4UUIA 5HMSA 1GVRA 4NNCA 1LP6A 4ORMA 4ONVA 3LTPA 5KTLA 3I7QA 3WK2A 1FDJA 3MI3A 1KA9F 5I3FA 5AYZA 3NNTA 3MBDA 1THFD 3S1UA 3TMQA 2QCEA 4O57A 2NZLA 1EP3A 4XBKA 1UB3A 3BW3A 2YW3A 4UFIA 3PF3A 3GYEA 2XN1A 1RPXA 1XFBA 2ZQ0A 1EA0A 3SZ8A 5D30A 3C2FA 3GNDA 3DXIA 3I7RA 4KFPA 1M7OA 3BW2A 4BWLC 1LROA 3EKZA 4Q32A 4JTEA 4I9AA 2DP3A 1GVFA 5G2IA 1P0KA 3EX6A 2B7QA 2CZFA 1J5TA 4IMDA 2DJLA 3HGOA 1G7UA 3BGJA 1TTJA 1PV8A 2PCQA 3DAQA 3F03K 3B0UX 3P81A 3HOJA 1W37A 2E6DA 4FNPA 5EMUA 2FPVA 3RFAA 4RJEA 5EPDA 1FBAA 3TJXA 3EWZA 2NWRA 3NM1A 4NQ1A 1F05A 5G4EA 3G1FA 1Z44A 2V5LA 1S3HA 2QCDA 3L5MA 1AW1A 3W3OA 3NG3A 4NJGA 2EHHA 1G4TA 3RLUA 4TX9A 1J4EA 5I3GA 3W7NA 4WJEA 3QC3A 4WY0F 4HT3A 3T44A 2OT0A 4IXHA 1I2PA 3HG3A 4M6QA 1Q6RA 2CZ5A 3W1MA 1WDWA 3NGJA 4W9TA 4Z1AA 1VJIA 4AH7A 5HR7A 3W1TA 2QAFA 2PRHA 3BG5A 1YTEA 1FWNA 4NVTA 2VEMA 1W3NA 2VOMA 3PG8A 4BFAA 4IUOA 5KITA 4XWUA 1W5PA 3HGRA 5DY3A 1J2WA 3G24A 4JIPA 1B4EA 1X7FA 1RV8A 1QMLA 3R12A 1EEPA 1LOQA 2VFHA 3KVLA 3N9RA 3S5YA 3TAOA 3H53A 4O1DA 1EUAA 1PHQA 5AHFA 5K7JA 1RQEA 3L66A 1UBSA 2Z1BA 1OABA 4H4IA 3G0SA 3MI6A 3D0CA 3W83A 2GOUA 4KFOA 3W7RA 3IEBA 2WO5A 1KM0A 3N2MA 3Q37A 2KZHA 3M5XA 3TH6A 4FIRA 2A4AA 2HSAA 3P8IA 1K3UA 4QJ1A 5CGQA 4JY8A 4O53A 4NJIA 3QQ1A 3W1AA 1XBZA 1YDOA 2A6NA 2BWGA 2VFGA 4ZQMA 2EPHA 1IIGA 4JTHA 4DQWA 5K9CA 2ATMA 1Q6QA 1H7XA 2DZTA 4I7UA 5IM51 3GR7A 1JCXA 1KTCA 4JDYA 1TPH1 4R53A 5C5YA 5F4XA 4OWGA 2Y85A 4LRSA 2YX0A 2VEPA 3TU9A 3VE7A 5AFDA 4Z1DA 2W79A 1SR9A 4IMEA 4UFJA 5KZDA 1DHPA 5F4WA 4NNBA 3BK0A 3SIZA 4FEZA 1K7XA 1LLWA 3RNDA 2QEZA 3QMRA 5HUPA 5K9XA 1SZGA 4ICNA 3E02A 3FS2A 4A22A 4ZMGA 1SU5A 1YXYA 5LNUA 4AB4A 1OX4B 5AYYA 3W6YA 5D09A 3LTSA 2YXGA 3TNOA 1TV5A 1LYXA 4MUZA 3MP5A 1TYGA 4FB7A 4JTIA 3TIMA 3W1NA 3MI2A 5D2VA 3LI1A 3B8DA 5CKSA 3EXRA 3WFAA 3NZ1A 4LVAA 2WNNA 4JIQA 3FKKA 3P84A 1DJNA 4PH6A 4LS2A 1SFLA 3IIZA 4JS3A 3TW7A 3W7MA 4A21A 3NQEA 1VCFA 3LI0A 4HHPA 1OX5A 3Q94A 2AAMA 5KMYA 1RD5A 3L5AA 2ZCGA 4CCDA 3S1WA 3W2KA 2BX7A 3LXCA 2RFGA 3KFTA 1W3TA 1A53A 1C8VA 4JTTA 1GVSA 1TPFA 4GWEA 3DI0A 1EUNA 1PS9A 4UMAA 1ME9A 1KFCA 2QCNA 3OG3A 3HQ1A 3RU6A 3W7PA 1M7PA 3HJZA 3INPA 1E51A 3G1HA 3MP3A 2VENA 4JYFA 4AWSA 3W71A 1XI3A 5E0KA 3MMTA 2V82A 3CEUA 4HSNA 1PHWA 3SFKA 1OFDA 3RMJA 4NJJA 1CX9A 1GT8A 2E6YA 1YXCA 2QCLA 1JUBA 2P1FA 1XXXA 1FDYA 5CPMA 2WV8A 2QCGA 2RKXA 2YPIA 2GQ8A 3GNNA 3M47A 4GC4A 3LBMA 4XKYA 3N9SA 5LNVA 2A0NA 1A50A 2J9YA 2IQTA 4ZL1A 4Z0SA 1W31A 3UWQA 4HN4A 4UNKA 1PE1A 1VHCA 3IIOA 1OFQA 7TIMA 3QSRA 4O17A 1TIMA 4IOTA 1FWTA 4YXGA 1GG1A 1I8JA 1OK4A 3PUDA 1ME8A 1VCVA 3BLIA 2PRLA 4AMAA 4PODA 3UWWA 1HUVA 1KBJA 4FF7A 4XBSA 1F7BA 3P62A 2XN2A 4JGDA 4LWWA 2ZFAA 3QPYA 2ZYFA 2LLEA 3JR2A 1LBLA 2X30A 1NFBA 3TW6A 2ABBA 2BLEA 2Y61A 3KVJA 1OX6A 1ZHAA 1K8XA 3C3NA 3C2EA 3DFSA 5TBOA 1ADOA 2HS8A 2I9EA 2Q8ZA 2CFFA 3O16A 3STCA 5BMWA 2QF7A 3JRKA 1QPRA 1WA3A 1QPQA 3G1YA 3KVKA 2YFNA 5AHEA 1I2RA 3MW7A 3NAVA 3B05A 3PAJA 3T4CA 4ZQOA 5I3JA 1KM2A 2B7PA 1DJQA 1G4PA 2Y7EA 2ALDA 1YPFA 5F2GA 1PIIA 4FNUA 5HINA 3TKFA 4A2SA 5HWMA 1WBHA 3I6RA 3G1VA 3P61A 3O6CA 1FDZA 3O15A 3DENA 1LCOA 1TO3A 4TMCA 1KM3A 3T7VA 1B57A 1MZHA 2R91A 3TQVA 5C54A 4MY9A 1SO5A 2YFOA 2ZRZA 4O1BA 2E5DA 4N9EA 2GPTA 1H1ZA 3M5ZA 3BLFA 1U83A 5LHFA 2DORA 1Q6LA 2Y7GA 2NXHA 3P5ZA 4O52A 3UXAA 4EVZA 3QJAA 3STFA 3GXTA 1EWDA 2A7RA 2H8ZA 4PA8A 4WY0A 2WSQA 3W7EA 1FXQA 1XBXA 2YCEA 3PBUA 5DLCA 1CW2A 1TTPA 3M6YA 3G3DA 4AVFA 3P74A 3C61A 4D2JA 4XTIA 3W87A 4NJHA 2R94A 1O60A 4GNJA 5T26A 3A5VA 1Q3NA 3KHJA 4IMCA 3TXVA 1WOBA 4PTNA 4MZ8A 3QW3A 3TV8A 1W3IA 2WSYA 2C13A 1SW7A 4GUIA 5I3KA 1OYCA 3OVPA 3P8JA 2P10A 2HS6A 5EL1A 4L4MA 1TTIA 5AHMA 1FX6A 1TPC1 2PRMA 1JJKA 1QPOA 3TSBA 1KLYA 4IMGA 3O6DA 3ZWSA 3GB6A 1XKYA 5D04C 1IXNA 4DF0A 5I3IA 5F1UA 5SWUA 1GVQA 2QDHA 1ICPA 1QOPA 1DV7A 4UIOA 4O28A 1A5AA 5LHEA 3DFPA 4AHQA 1SUXA 4Y90A 2NUXA 1G69A 1FCUA 2QAPA 4QM1A 3T78A 3LCIA 3UWVA 5HULA 4AHPA 4UFKA 5DXXA 1WOAA 2X2GA 3FJ6A 5AN7A 2BSLA 3M16A 4JD4A 1C9DA 3H54A 4LS1A 1OF6A 3NQ6A 5G5IA 3C56A 4UTUA 3FA5A 5DCBA 1QR7A 2C18A 1TJPA 4RK8A 1ICQA 3PSVA 2CLFA 1TPVA 4YL2A 5K4XA 2E5CA 2FLIA 3QSTA 4QNEA 4E2DA 3N73A 3IRDA 3LOTA 4MKNA 5LNRA 1L6YA 1X1ZA 4MJZA 2A85A 3LCHA 3PBVA 3P7YA 4DF2A 4ORIA 3L0NA 5EBUA 3KRSA 4O11A 5TIMA 2EAWA 4JX6A 4E38A 4DO6A 1LLZA 3M1ZA 4K38A 2CLLA 3BO9A 4OV9A 2AGKA 2DZWA 4O10A 2CWNA 4Q4KA 1L2UA 1NF0A 4A3UA 1AL7A 3NQFA 3DFTA 5G2WA 1ZAJA 4M7SA 5LGXA 1ZAHA 2CW6A 3UZJA 3S0CA 4KFNA 3N14A 3UNDA 3SJ3A 3EB2A 3HF3A 1W5QA 3ANYA 4I7VA 3W7KA 2VFFA 3FLUA 3C52A 4Q33A 3W2UA 1S5TA 1JQVA 1VYSX 5HUOA 4GUGA 3FKRA 3W7LA 4DEFA 1H1YA 4JXCA 1F2JA 4CCEA 2WSRA 1KFBA 4GUFA 3LCLA 5CPLA 1W56A 1Q45A 3SI9A 3S1XA 1TPWA 1TV8A 5AHNA 1JCNA 3LGEA 3GKFA 4QSHA 3G18A 3QFEA 1OK6A 1P1XA 3CQ0A 3LHUA 2QKFA 4BWLA 1YPIA 3U8GA 3YPIA 2G5WA 3KAOA 1F5ZA 3C2VA 3W1RA 4XUGA 4N6EA 4QISA 1OJXA 4UNLA 4X9SA 4N02A 3Q58A 5HR6A 4PL1A 4LVGA 3WJSA 1WYIA 4JYDA 1BKSA 3HMJG 5AC6A 1LZOA 5A8GA 1D3GA 2Q8LA 3BLEA 1OFBA 2QCDB 2UV8G 3GVGA 1GPWA 4BR1A 3KXQA 3CEPA 2EKCA 6ALDA 2ZTKA 3B4UA 3M41A 2WNQA 3P60A 2FTPA 4Z1CA 2O7QA 3UWYA 3GKAA 1BWLA 4IPIA 4JTFA 1ZY9A 1KM1A 3TSDA 3OEXA 3QYQA 4KWVA 4CQ8A 3ZS4A 2YGYA 3GX9A 3M7WA 1FWSA 3NQDA 4M19A 2I14A 1PL9A 1F76A 3P67A 4NX5A 4MIMA 4LT9A 2QCMA 1EIXA 3L67A 3GZ3A 3BGGA 1ME7A 4HNNA 2V0TA 3W7DA 3G3MA 4HNTA 2HMCA 3GLCA 3LCXA 3QMSA 3L5LA 2CLIA 3PM6A 3RF9A 1XDLA 4GXMA 4DBDA 5U7SA 2Z2UA 4GFSA 5K4ZA 2VFIA 2ISVA 2J9XA 3EWXA 1GTEA 3ATZA 1TREA 3ABQA 4G1KA 2R14A 4FX6M 4S1FA 4O0ZA 3NXFA 3RLVA 2V2CA 3TR2A 3UD6A 2ZZ7A 3HO8A 4RV8A 2FDSA 3IIVA 4K7VA 2W6RA 4NXSA 2GVJA 3TK7A 3VFLA 3I68A 4ZZ9A 3M0ZA 1KBIA 2Y6ZA 3S5ZA 4NX0A 3O05A 3UWZA 3NQGA 5AC7A 4E0CA 2ATSA 4UC5A 4GJ1A 4FXSA 4O1CA 4OGZA 3UPBA 3F4NA 2OT1A 1R47A 1XBYA 3VE9A 1K03A 1SZNA 1VC4A 2E77A 4C1KA 4Z0JA 5FF4A 4UCGA 1GVOA 2FPYA 4IGHA 5D02A 5LSMA 4KKXA 2E68A 5LNWA 3HPZA 4MYXA 3EX1A 4JY9A 3OIXA 3W1QA 4HKPA 1SZEA 2ZZ4A 4LC6A 4O4VA 4RZ5A 2FIQA 3DKJA 1KFKA 3MHFA 5FF2A 3EX2A 1W5OA 4I7WA 3HG4A 2J88A 4PL2A 1XUZA 3KX6A 1ZENA 2FJKA 2TYSA 4DELA 3NEVA 4X3ZA 2RHGA 2PC4A 4HPJA 5DCEA 4IX2A 3H55A 2NWSA 3NR0A 5D03A 3BG9A 4TR9A 4WOQA 4DO4A 3EXTA 4X22A 2H3BA 3E12A 4UTWA 2Y62A 4UTIA 1YTKA 1ZJIA 4UFHA 3W85A 4UXDA 4MZ1A 2Y70A 3LTYA 2TMDA 1QFEA 1QWGA 2PURA 1TSIA 1XC4A 3GIYA 3UPWA 3CTLA 2CU0A 3C2RA 3QZEA 3TJLA 4CQ9A 1OFAA 3UXDA 4HPXA 2EF9A 3IGSA 3NQVA 2GJLA 2H8XA 4N9CA 1IXPA 1A5SA 1OYAA 5BW6A 3CM4A 5IBXC 3G8EA 3L65A 1B9BA 3STEA 1Z42A 1Z48A 2DZXA 4CCCA 4JX4A 5F1VA 2ZA1A 1W1ZA 4GUJA 1KFJA 2GQAA 3E0IA 3PB0A 4WD0A 2QCCA 3CLMA 1KW1A 4O19A 4PFMA 3W23A 3WJWA 4DBEA 1H7OA 1N55A 1VH7A 3W7HA 3W74A 2NV2A 2GVLA 3LHWA 3BG3A 3SECA 2VELA 2CLHA 4N2YA 1JUKA 3ZR4A 1S5VA 2Y7DA 5DN1A 1O5KA 1VYRA 1JR1A 2ZA3A 4MPQA 3KVMA 3ABRA 5EYWA 3A21A 3G1XA 1SSDA 3FIGA 2DZSA 4AWUA 2OX1A 5D2TA 4IJBA 3I65A 1R2RA 4HNUA 1FUYA 4M7TA 2GVGA 4PC8A 2YDAA 2WPBA 4YMZA 3M43A 5G1TA 5E93A 2OCZA 3EX3A 3QQ0A 1I4NA 1LTDA 2DZUA 1DQXA 5FI8A 5GVJA 1R2SA 3N19B 1HTIA 1SO3A 1I2OA 4XKYB 1O95A 1YYAA 3TROA 3L68A 3W73A 4QNWA 3NPWA 2ZZ2A 4TO8A 3ABOA 2E5BA 3QRHA 4LVBA 3JS3A 2A21A 5L6UA 3SR7A 3DHDA 4WZHA 3NDOA 1AMKA 3E49A 1UJPA 3G8RA 1RQHA 3WJYA 5HQEA 3EWWA 5C6MA 2BZNA 2GUUA 4FIQA 2Y63A 1SSGA 4XTDA 2ZZ3A 2DZVA 1NEYA 5CSRA 4UTTC 2O7SA 4UTKA 1DQWA 1QOQA 1H7NA 4GRSA 2C16A 1AW5A 4TIMA 1VGAA 3ZFHA 5G4WA 4YWIA 3W1XA 3SGUA 4JTGA 1W0MA 4K36A 2TRSA 1WX0A 2H6RA 3LHZA 3MJYA 3TMLA 3HIJA 3DHFA 4FX8A 2X16A 3PUEA 4LC8A 3TCEA 4RR4A 4Z08A 1IIHA 1ZAIA 4FNTA 5FF3A 5LZLA 4RKAA 1JRCA 1NVMA 1QCWA 2C3ZA 3NQ8A 4FO4A 4N9DA 5ABTA 1LM1A 1N7KA 3GR8A 3WK3A 3QPZA 3IVSA 4E2BA 5CG7A 2RDWA 3VCRA 4P2VA 1KTNA 1EB3A 1ML1A 3GAYA 2WOQA 2NLIA 2X1UA 3P80A 5EA9A 3LRLA 1F73A 4AAJA 5AHLA 1WQ5A 2VFEA 2QUVA 2Y89A 3NQ2A 1OFRA 1IXQA 1YXDA 2RH9A 1GWJA 2QCHA 1T96A 4BI7A 3T55A 3N3MA 3CPRA 4O13A 3CT7A 2X1RA 4POCA 5BNKA 2B7NA 5HWJA 2RDTA 2VEKA 3S5NA 4WOZA 1XM3A 3K30A 4LNYA 1ALDA 4JN6A 1GOXA 3NA8A 1JVNA 4NZJA 4Y8FA 4O4WA 3THAA 1F74A 3W7OA 3LX9A 3O63A 4WY0B 1SQ7A 3PC0A 4GUHA 3DI1A 3MO7A 4AF0B 2R8WA 1H62A 3M5YA 4M6PA 1LRQA 2NX1A 1FXPA 1TV7A 2Q3OA 3QF0A 1SW3A 1QNVA 3GDRA 3L0KA 1GTHA 3CC1A 3LM7A 1HL2A 3P82A 3GK0A 2A1YA 1L9WA 3LB0A 3W1LA 2J9ZA 3TC6A 3F1QA 3C2OA 1W54A 4FX7A 2JGQA 4OT7A 5DXYA 2E6AA 1YADA 3DFNA 5AOUA 4ML9A 1UUMA 1TQJA 4Y6GA 3W9ZA 3SY5A 5L9FA 4JTLA 3B04A 5FEZA 4P61A 3OA3A 4B5NA 1IF2A 1LBFA 1W8SA 4DXVA 4RCXA 1H63A 3PULA 2ZTJA 3Q2DA 1EWEA 3OBKA 5FESA 2OZ0A 3O6YX 4MJMA 2YYTA 1LORA 3QEZA 5D33A 4ADUA 2YYUA 3O1NA 2J24A 2ZRYA 2B7OA 1YDVA 3DU0A 4MY8A 4UMBA 3HPXA 1OYBA 4XQ6A 1T99A 2FQIA 1H7WA 3C6CA 3CU2A 1H60A 5FF7A 2QDGA 3LLFA 3PS7A 4K6AA 1WAUA 3E96A 4O12A 1VQTA 4UTJA 2VEIA 4JDBA 4Y96A 2C19A 3G1DA 5I3HA 1G4EA 3O07A 1Z41A 4AWTA 4JTKA 1D9EA 1R46A 3IIPA 3KRZA 3WK0A 3F4WA 3PUOA 3PBWA 1VR6A 4BK9A 2E1DA 3IV3A 4FNSA 1FCVA 1QPNA 1NF7A 2QUTA 1B4KA 3G1AA 3THQA 3A22A 4MZYA 5D2WA 2JBMA 2QJHA 4QQ3A 1ZALA 3B03A 3NPVA 1DVJA 3W2MA 2ZZ5A 1BEUA 3BARA 4JEQA 3W75A 1KV8A 3LCFA 4H3DA 3NL5A 1DKWA 3W1UA 1SPQA 3TXZA 3EX4A 3W88A 1TPDA 3DZ1A 4L4LA 4ZQNA 1GYLA 3TSMA 4TMBA 3W70A 2AQWA 3W76A 4NNAA 1MO0A 3VI2A 4LW7A 3G1SA 1JCMP 3MUXA 1F6KA 3NQCA 2ISWA 2WQPA 2Z0IA 3WK1A 1FWWA 2X1TA 1VZWA 1MEIA 2HTMA 2FFCA 2Q3RA 5KZMA 3GDLA 3SSJA 5U4NA 2QR6A 3C8FA 3TX9A 4N6FA 4KWWA 4MY1A 5CZSA 3P5YA 4DPPA 4YLWA 2V2HA 1X1OA 3LHVA 3PG9A 1SZFA 4DO5A 1IGSA 1SO6A 1TJRA 3HG2A 4QIUA 3LV6A 3WJXA 2CLMA 1FCQA 2ZA2A 1VCGA 3B0VC 1TTQA 4IXXA 4NXKA 3U2OA 1WBJA 5KINA 4LS0A 1KM6A 1ZFJA 3FEMA 3IGXA 1G7VA 1Y0EA 4MOZA 1OG0A 4IMFA 1FWRA 1GG0A 2Z6IA 2QJGA 3O8AA 4LVFA 5TQLA 3S5OA 3VKJA 1XL9A 3QM3A 4ZVJA 4U28A 1GQNA 5BRBA 4LTSA 5H91A 5AC8A 3SGZA 3HB9A 2CLKA 1HFBA 2H3DA 1TRIA 4LV4A 3LHTA 1VS1A 1XCFA 1M5WA 1TB3A 1RQBA 1DOSA 4ADTA 3UY8A 1I45A 1GEQA 3R2GA 1K8ZA 4UMCA 4O1AA 3U6WA 5BMXA 3R5EA 1JCJA 2J27A 3TAKA 3USBA 3NPXA 2ZZ6A 3ABSA 4X2RA 3SW6A 2GJNA 4TU1A 5LKYA 4OHQA 3W7GA 1KM4A 1H7PA 1UASA 4LOCA 1RR2A 3BV4A 4EIVA 1AK5A 3R8RA 4WUIA 5HNRA 2CZDA 1H5YA 4UTLA 3MWAA 3HPSA 4UFLA 5AB3A 4AXKA 5CPNA 3GAKA 2FB3A 2QCFA 4UR7A 5FEPA 1L6SA 4OQVA 4LU0A 2WJZA 2WKJA 3RK8A 2VC6A 4AHOA 3PVFA 1FY6A 2WNZA 3KOFA 4CLMA 1TQXA 3MYPA 1H51A 1K7EA 3LCGA 3TA6A 4K8HA 4O54A 4O16A 4WXYA 3WJZA 3DFQA 4NJKA 5D05A 2A2IA 1DBTA 2A7NA 5F2LA 2YR1A 2TSYA 2XN0A 2ABAA 5F2IA 1I2NA 5E1QA 1N8FA 3FJLA 2V5BA 1O94A 2V2DA 3O06A 2ZRXA 1MSSA 4EF8A 2A6LA 4Y9AA 2NXGA 3TFXA 2C1HA 4MVAA 4RXFA 2EGZA 3C4UA 2NX9A 3W84A 1UUOA 4JX5A 3EWBX 3CHVA 4NZFA 5D38A 2ZBTA 4JR5A 4U4MA 4O15A 4OBTA 4LUJA 1H50A 6TIMA 3OVQA 1ZNNA 3EWYA 2FPTA 2BTMA 3DH7A 4K8EA 3LXAA 4CNPA 5EY5A 1SW0A 3TDFA 4CNOA 4MFDA 1QO5A 2CLOA 4ZQCA 1VLIA 5CSSA 1GZGA 3IGUA 5AHIA 4C1LA 4UTWC 4RZ6A 1EX5A 1X6UA 1RVGA 3PWAA 3UQNA 2GQ9A 1T8XA 3B06A 1LRTA 2NV1A 4FNQA 4UR8A 1R30A 3R13A 1ZCOA 4A29A 4O50A 2ZRUA 5K3VA 2DU2A 1I2QA 4R7JA 3UZ5A 3DKLA 3OVRA 1OX4A 1K8YA 3MHGA 3NO5A 1AW2A 3HGJA 3BW4A 1OFOA 4JTUA 4MYAA 2VFDA 5AYXA 1WV2A 1VPXA 4LUIA 3C0JA 4MLJA 5F2MA 2E09A 5A5WA 1JULA 1KLZA 2BXVA 3GDKA 1T0OA 2OMAA 3L0GA 2G95A 2V81A 4MLRA 3T40A 3W7JA 1FQ0A 4LVDA 2ZRWA 4CQAA 1X8FA 3TUUA 1TRDA 5KZEA 2G96A 1KTBA 3W86A 5CPOA 5IBXA 4WX2A 3V1PA 4EF9A 2XFWA 1OFEA 3EEGA 2CZEA 3TFCA 1IXOA 4ALDA 1P4CA 4M5PA 4IX0A 1LDCA 2NXIA 2ZZ1A 3M9YA 3TQ0A 3LXBA 2D73A 1M6JA 1P0NA 1K02A 1QAPA 1LOSA 1QO2A 5CZTA 2C6QA 4RLIA 3BVJA 1C29A 3QW4B 1Q6OA 4JYEA 3MYOA 2C0AA 1PCKA 4J9JA 3W07A 3CB8A 1YLVA 4EOUA 1S5WA 1FCBA 4N4PA 1VYPX 4QITA 4R33A 1MXSA 5G2HA 1OFPA 1W5MA 3LHYA 3A9IA 1KV5A 4ZQRA 3W72A 2F7FA 3HG5A 4K7YA 2JK2A 4YCPA 5DCDA 1U5JA 1KFEA 3ELFA 4NU7A 3LLDA 2V30A 3W22A 3CIXA 3NYZA 8TIMA 4GE8A 1P5BA 3M5VA 3W7IA 5CZJA 4ADSA 1QDSA 4IWWA 1JQXA 3B0PA 2H90A 3EXSA 3L21A 5EKYA 1NAL1 2C14A 1G4SA 2C15A 3W7CA 3TC7A 5FEWA 4FXRA 3N2XA 1PCWA 3NPUA 3FFSA 4M6VA 4ZQPA 4AEOA 1L6WA 1ICSA 2JKPA 3PY2A 4N4QA 5K9DA 1CI1A 1JCYA 3VNDA 2FB2A 3NQMA 3NQ7A 2JKEA 4UTMA 3NZRA 1K7FA 3NQAA 4BI5A 5C55A 3FOKA 3W2JA 1SO4A 3KRUA 1O5XA 3NL3A 4UTTA 5LNSA 1BWKA 1AL8A 2CLEA 5HWNA 3A5FA 1EPXA 3GXNA 3MHUA 4LY8A 2ZDRA 3IVTA 1G6CA 3OHIA 3W2NA 1D3HA 3IIXA 3GXPA 2P0OA 1KM5A 3IVUA 1RZMA 4N9BA 4RX0A 1SFJA 2NUYA 3CWOX 1A5BA 1VLWA 1BTMA 2B4GA 3PSWA 4IPJA 5DELA 5D2YA 1WXJA 3UWUA 2NX3A 3LDVA 5D32A 3PB2A 3STGA 3W2LA 4EWND 3QH2A 1TPEA 1XDMA 3BPWA 3A23A 2QJIA 3QMTA 2JGYA 1W5NA 1DORA 4YCOA 4OE7A 1MEHA 5H2ZA 3E9AA 4DPQA 4OV4A 2YW4A 4RZ4A 4S2BA 2RDUA 3V75A 4PCFA 4Z1BA 4WXZA 3MBFA 2W0UA 4LV9A 2QUUA 4WQ6A 3R89A
chains in the Genus database with same CATH superfamily
4J2MA 5BOOA 1F3EA 2J75A 3TWAA 3AIWA 4F79A 1OINA 4NRRA 4GPNA 1AG1O 3TE9A 2Y88A 1T5AA 3RM9A 3ALFA 5G1YA 3TQKA 2FHCA 3HV9A 3KUMA 2A7PA 4QAIA 5JBFA 4UB9A 4GZIA 2PDYA 2NLYA 3TQPA 1B5TA 1EYEA 2EXOA 5C9XA 2A5HA 2VXNA 4GBUA 4UOJA 1V7YA 4R7WA 1MW3A 4O8RA 2B0MA 4UOZA 1DJZA 5K2ZA 2QQ6A 3ZIZA 5FF0A 3OB8A 2VWTA 3M0YA 4X0NA 1JUEA 4ZEPA 3K1GA 3VGHA 4DBWA 3FYPA 4RXGA 3EWUA 2QXWA 3N17A 2X7VA 1CGUA 4L1GA 3DFYA 2WJFA 3U5UA 4UQ9A 3GXMA 3PR2A 4I9TA 4CD6A 4FNRA 4MKVA 1TCDA 3NXLA 3MMWA 4NUWA 1AQHA 3H4WA 3RAOA 3CLWA 5KSWA 5J5RA 1LWIA 3A6OA 4RDYA 2YZRA 3W1PA 3B8VA 3MP4A 3C5QA 3HURA 3GG0A 2E67A 3QR0A 4CNNA 2V8ZA 1X7IA 3V0SA 1JL8A 2O92A 1DL3A 1VENA 2GJPA 4B90A 3KOWA 4UTHA 1TMHA 4P8XA 4FHAA 5CSUA 2EJ1A 1QI0A 3RO8A 1JFHA 3AMKA 1VRDA 4HIBA 4KRTA 3CIWA 1GJPA 2PP1A 2W27A 3VAVA 1R8LA 4RDZA 3D47A 4L1WA 2WVSA 4G5DA 3NTYA 3S46A 3WF1A 2Y4SA 3FYYA 3VKCA 1RXOB 4UUIA 1KB3A 4GVGA 4NNCA 4PR4A 3O0KA 2WMGA 4ORMA 3H2FA 1ITQA 3VINA 3ZYZA 1C7SA 1NDZA 3MI3A 4BA0A 1S39A 4HU0A 3WF4A 2C0HA 3NNTA 4GZJA 1THFD 1XRTA 2NZLA 1UB3A 2GOKA 3BW3A 1I60A 5LIXX 4JIEA 2XN1A 3FJNA 2ZQ0A 4CQDA 4DLMA 1Z9AA 3C2FA 3DXIA 2PP0A 3UG8A 5EMMA 4XAZA 1M7OA 5I3DA 2PWEA 1J6OA 2R1KA 4GYJA 4QJ5B 2WXDM 1FTXA 2OLAA 4C1NB 2D0GA 3GDBA 3BWWA 2YA2A 5E6YA 4U3AA 3F03K 1MI3A 2DDXA 3HOJA 1Y5VA 2VVSA 4RE4A 4NASA 4RJEA 1FBAA 4YHGA 4NQ1A 2YKKA 5G4EA 1Z44A 1S3HA 2QCDA 3V5FA 1K9TA 4E8GA 4BJHA 3W3OA 5GNYA 2EHHA 5CJNA 1G4TA 1UZ4A 1RP9A 2QIIA 1J4EA 3W7NA 4O8AA 3QC3A 3HG3A 2DSVA 1PUDA 3CB3A 2CZ5A 4Z1AA 1VJIA 2BV9A 3L4ZA 1Q7QA 3OLGA 2D24A 3NIYA 3BG5A 3W82A 2E9LA 1W3NA 3LGDA 3F2DA 2JIWA 3NO3A 3MU7A 5H8PA 3HGRA 1RCQA 4JIPA 4ZOAA 5T8GA 3M0MA 3UG4A 1J0KA 4RV3A 3J7HA 1X7FA 1E6PA 4L9ZA 3VKBA 4EXBA 2VZUA 1S46A 3CHCA 3E5PA 5E9AA 2EPMX 2VFHA 3KVLA 3WDQA 3N9RA 4O1DA 1EUAA 3UJFA 1IE7C 4FMVA 2Z1BA 3L23A 4PB3A 2QMKA 2QT3A 2O9OA 3G0SA 3VX0A 3ZO9A 4QX4A 2IKHA 1CGTA 1VBRA 1KGWA 3FK4A 2W63A 4DZIA 2KZHA 3TH6A 1LUCB 2A4AA 1BF6A 3NURA 1EPVA 4NJIA 2PEVA 5JQ9A 3SFWA 2BVDA 4C65A 1BLIA 3V7PA 2A6NA 1YEYA 2EPHA 4ZOBA 2XVLA 1H7XA 1UD2A 3N1AA 8A3HA 4JQAA 1ODUA 3WN6A 5IDZA 4B5XA 1F61A 5C5YA 5F4XA 5HNTA 4OWGA 4FK9A 5ABHA 2HBXA 3TU9A 4HPGA 4NAEB 4UFJA 3OJGA 3EOOA 4NNBA 1UD3A 4HPHA 1LLWA 1YPXA 1SZGA 3WLPA 1SU5A 4OOUA 4FLOA 4TTGA 1W1B1 5AYYA 3W6YA 4S3KA 3TN4A 3LTSA 2BGQA 1TV5A 3T1GA 2ZVIA 2JEPA 4HMCA 3U4AA 1UKPA 5J04A 2J7CA 4MWAC 2F38A 3MI2A 5D2VA 3LI1A 1O12A 4MWAE 1RCXB 3EXRA 4LVAA 4JFVA 3BLPX 2J8FA 4MWAB 4PB4A 1HNYA 3BH4A 5BCAA 4LS2A 3IIZA 4JS3A 4QEHA 2V3EA 2NW0A 1PTAA 3NQEA 4Y7EA 1VCFA 1BHGA 2AMGA 2WM1A 4G7FA 2WC4A 3UXLA 2OSYA 2AAMA 3SN0A 1UC4A 3CUJA 1P48A 4NZ1A 1KWKA 3S1WA 4EXQA 3DHUA 4RW3A 2BX7A 4PUMA 3LXCA 4ZO7A 2RFGA 2QV5A 3GG1A 1XLCA 3OODA 3S83A 1EGVA 1Y5WA 1XGZA 2YL5A 1KFCA 1ZTVA 4NI8A 2BNJA 1E0TA 3W7PA 1J8VA 2Z7GA 3O6AA 4HSNA 4GYPC 3TTSA 1XV8A 1EXPA 5FA5A 2P76A 2P1FA 1XXXA 2GWGA 2WV8A 4H6RA 1FH9A 5IFTA 4MDPA 2GQ8A 1EDTA 1QT1A 3GNXA 2QJJA 3LBMA 3BC9A 4JOMA 1W1IE 1OM0A 2E40A 3T8QA 1MRAA 3KZSA 3OLEA 2QJNA 1VBUA 1R3WA 1UROA 1PX8A 4QCFA 1TIMA 4IOTA 1IR2A 1SJCA 4GY0A 4PMXA 5BZAA 4GA8A 2PDKA 4YXGA 1EFZA 5HANA 1GG1A 1IEXA 1ME8A 4I5XA 4JIIX 3B4YA 1Q6DA 4W7VA 2FVLA 4FOJA 2G3NA 1F7BA 3VOIA 4AD5A 4WR3A 2BLEA 2Y61A 3KVJA 3DERA 1K8XA 2ODOA 1JI1A 3C3NA 3QZAA 4YHEA 3C2EA 2PMQA 2I9EA 1C7TA 4J40A 4I5RA 1T7LA 5BMWA 1DWIM 1WA3A 1QPQA 1XLLA 4XIAA 3T4CA 3WFLA 3N2BA 5B7ZA 2Y7EA 2BXZA 3HQNA 5HINA 1WBHA 1AH0A 3I6RA 4IGSA 2D23A 3O6CA 3DENA 4AX6A 1TO3A 4TMCA 1KM3A 3T7VA 1MZHA 1O5RA 4HCLA 1E4IA 2ZRZA 3K8KA 4DJEA 1JNDA 6XIAA 3BCDA 4B3ZA 3QN3A 1Q6LA 2NXHA 3P5ZA 5I03A 1OC5A 3STFA 1E4LA 3RR4A 4ZTYA 4MF4A 3V5OA 1FXQA 4C6OA 3D6NA 4Y2WA 1TTPA 3M6YA 3P74A 1G1YA 2OB3A 4XTIA 2GYIA 4NJHA 2R94A 1EJWC 4IMCA 1PPIA 3TXVA 5TD4A 3TV8A 2AKZA 4ZGYA 1SW7A 4GUIA 5I3KA 5J8LA 1OYCA 3AC0A 3OVPA 3VOFA 2P10A 5EL1A 2OGJA 1E9ZB 1EL3A 2DSZA 4REQA 1TPC1 5FAGA 1LQ2A 1E5JA 3ARSA 2VX5A 3TSBA 4IMGA 2J78A 4M6UA 4NAFA 4PUUA 4ZE4A 3EGJA 5D04C 1MNSA 2WMHA 1NIUA 3MY9A 5FSDC 4Q4SA 3PANA 4O28A 1FWGC 3VTRA 1A5AA 5LHEA 3CH0A 2NUXA 3IACA 2HPMA 1G69A 1RHCA 3FVDA 1FCUA 3VGDA 2QAPA 2PF8A 1XC6A 4AXNA 3WNOA 5HULA 4AHPA 5DXXA 5A6LA 2GGEA 5AN7A 4Y9OA 3LSBA 1JXKA 2INFA 1L6FA 3WENA 2NQ5A 3UZYA 1ICQA 3N25A 2CLFA 4XD3A 4YL2A 4YTUA 2E5CA 2FLIA 2PDLA 2ZKMX 2UWFA 2V5KA 4QNEA 4E2DA 2I16A 2EPLX 1Q13A 3VD7A 4H6QA 1X1ZA 4MJZA 3LCHA 2P53A 3P7YA 4DF2A 3L0NA 4EP8C 1TG7A 3C0LA 3VU2A 3KRSA 2BY3A 1XYAA 2EAWA 3GH7A 4JX6A 3C3UA 2PDMA 4L5ZA 1XYBA 2OZ3A 4HJWA 4GD0A 2AGKA 2DZWA 4O10A 4Q4KA 1RP8A 3KEHA 3POCA 3NOYA 4A3UA 1WB0A 4YNGA 4YVPA 2VCBA 1W17A 3POHA 4ATDA 2WBGA 2CW6A 3WMLA 4H6EA 1V0KA 2ZX8A 3H6OA 2Z28A 4KFNA 4PSRA 3VNIA 1CECA 1W5QA 2PDXA 2XIOA 3IJ6A 5CC6A 3ANYA 1WDQA 3RYSA 5HAOA 3FLUA 1OD8A 2X05A 4Q33A 1VYSX 5HUOA 4GUGA 4RNHA 4GHRA 4JXCA 3LPFA 2XTKA 2VR4A 1IWPA 3WDHA 2WSRA 1QOXA 1KCKA 4GUFA 1W56A 3KRBA 1Q45A 1EGZA 3SQSA 3SEPA 5I09A 4PTWA 3PFMA 2GDQA 1UQYA 3F4VA 3GKFA 3G18A 1P1XA 3S2MA 2WVVA 3VIFA 4WSJA 3KAOA 3C2VA 3UR7A 4LBRA 4WDUA 1A3HA 4YTRA 1OJXA 4X9SA 1A3WA 4LVGA 1U33A 1WYIA 1BKSA 2PTYA 5AC6A 1JZ3A 5A8GA 4XISA 4NP7A 5T9CE 2V5CA 4GI4A 2OOGA 3VGEA 4BR1A 4IIBA 1RBAA 4GH3A 3GYCA 3N11A 2O7QA 1M68A 3UWYA 2J8TA 1BWLA 2PGFA 4IPLA 2OWCA 5KZ6A 3O9NA 1V3KA 1A5LC 4CQBA 2ZUNA 2I14A 1KRCC 1F76A 3L67A 3GZ3A 3BGGA 4GCXA 2V0TA 3W7DA 1V6XA 2WC7A 4HNTA 2HMCA 2YDRA 3LCXA 2HNEA 3ARYA 3LMYA 3PM6A 1UW9A 1PIFA 4GXMA 4DBDA 5U7SA 4GFSA 5GQBA 4IG2B 5A94A 2ISVA 4C90A 1XQLA 1XHGA 4FX6M 8CGTA 1NOUA 4O0ZA 3TR2A 3UD6A 3MKCA 3MCOA 2FDSA 3R0KA 4FLSA 2W6RA 1BKHA 4GX8A 3UG5A 1E71M 3G6MA 3Q45A 2RGLA 3M0ZA 3AOFA 4IGMA 3S5ZA 3NQGA 1XSKA 5AC7A 3CQIA 2BGNE 4GJ1A 2E3ZA 1VIWA 1CGVA 1R47A 1BVWA 5CAHA 3UCCA 4C1KA 3AISA 1DTUA 4UCGA 5HMDA 3PZNA 5LSMA 3C8NA 2DVXA 3TLLA 2CBUA 4AD3A 1EOKA 2E68A 3HPZA 3A4WA 4Q3MA 3UR2A 1XP3A 1LUCA 4JY9A 4UZSA 3KP1A 1DJWA 1POJA 4HKPA 2ZZ4A 2ZUMA 3P93A 4AYGA 1A5OC 3DKJA 1J18A 1Q8JA 4I9JA 5DQPA 4I7WA 3P2VA 2I56A 3PZUA 2ESCA 4DUOA 1UOKA 2HVOA 2TYSA 1E9LA 4AZBA 2PC4A 4HPJA 3WY1A 3H55A 2NWSA 3BG9A 4TR9A 3QLDA 2H9AB 2P3ZA 4NAEA 3FV9A 2OO0A 3CO4A 4NI3A 2PF0A 1UYQA 1FWBC 2Y70A 1HJXA 1MDLA 3SCRA 2HXTA 3TJLA 1OFAA 1W9PA 4HPXA 3IGSA 1KO0A 1IXPA 1A5SA 1QWKA 1V79A 3D3FA 3QHOA 2OODA 4A8RA 3MSRA 1B9BA 2IQDA 1Z42A 5LIKX 1Z48A 3RXZA 3IS4A 4BKNA 1NTHA 4OFCA 4HZ6A 3HM7A 3Q67A 4MWAA 4GUJA 3PB0A 2A3LA 1ZJAA 4IHCA 2QCCA 3CLMA 1C8YA 3W7HA 2WKGA 3LHWA 3M4HA 1NOWA 2CLHA 4N2YA 1JUKA 1UWTA 1O5KA 3GC2A 3URQA 1M04A 1XRVA 1X96A 4MPQA 3CXOA 3KVMA 2I5IA 3A21A 2VX7A 1Q85A 2DZSA 4F0SA 1FKWA 4H9TA 4IJBA 1R2RA 4IQJA 4HNUA 2OELA 4PC8A 3DX5A 1PZ0A 5PTDA 5G1TA 2OCZA 3EX3A 3QQ0A 2VJXA 1B1YA 1OGGA 1LTDA 2DZUA 3VO0A 1E40A 2WHLA 2ZXAA 1ADDA 4NIRA 1UWSA 5FI8A 4US6A 4V28A 2IW0A 1TV3A 3N19B 1SO3A 4XKYB 4GYPA 1YYAA 3NPWA 1EXBA 3ABOA 3QRHA 3AS1A 5L6UA 2A21A 6PTDA 4H9UA 3SR7A 4M80A 3NDOA 3OZPA 2VRKA 2PSNA 1ONWA 2Z4GA 4HQVA 4NYYA 3SCSA 5I6SA 2NQHA 4MTVA 2DZVA 1NEYA 2I9UA 1TX0A 3PAOA 4JNYA 2O7SA 1DJHA 1OC6A 4EPEC 4JIHA 1VGAA 3ZFHA 1A4MA 2H6RA 3MJYA 5A69A 2XSBA 4RNFA 3PJUA 4W86A 1IIHA 1NVMA 2C3ZA 4N9DA 2YCIX 3GR8A 3IVSA 4B4FA 3VCRA 3OBEA 2DH2A 2FH8A 3AZTA 2FMOA 1EB3A 1RPKA 2NLIA 5EA9A 1V6WA 2J7BA 3BMVA 3K5XA 1ZBWA 1XLKA 3TJIA 2EJAA 1K1DA 2J4GA 1WQ5A 1Q2RA 4CVUA 5JIWA 1NY1A 5I0DA 3QHMA 1GWJA 3WH7A 5MKGB 3N3MA 1EJRC 4DVOA 4L64A 4DYEA 4POCA 3R7MA 1D3CA 1DHKA 4J35A 3UEQA 2RDTA 3TOYA 3WX7A 1XM3A 3K30A 1GOXA 1LF1A 4DRSA 4O4WA 3S1GA 2OKOA 4AG0A 1TR9A 3O63A 3EOUA 3MKKA 1UIOA 3MO7A 4TX8A 1R3TA 3R43A 2GWNA 3U9IA 2DZBA 4KCWA 1C92A 2CZVA 3M5YA 1RY0A 3VDGA 4PCNA 1LRQA 2Q3OA 3QF0A 1XYFA 2CNCA 1SW3A 5HK4A 4D6HA 1YHTA 1KWGA 4ZXLA 5HNNA 4RE2A 1HKJA 1BVZA 3GHUA 3L0KA 2F6XA 3LM7A 3TN5A 1C93A 3WF0A 3H2MA 3F4CA 2JGQA 3U7BA 2E6AA 4CEXC 4U33A 5AOUA 3K46A 1XCXA 1TQJA 3SY5A 4HNOA 5A2AA 4OUEA 2DGAA 3I3DA 4ZXOA 5A2CA 2AOSA 1H63A 2ZTJA 5FESA 3O6YX 1HXJA 3DBNA 1R86A 3WQ8A 3WLSA 2CC0A 3O1NA 4GYFA 3RUBL 1H0IA 4DZHA 4W5ZA 3ZT7A 4XZLX 4UMBA 5A2BA 1UKSA 5EB8A 4PUEA 4PE8A 3C6CA 2HCVA 3GIPA 5FF7A 3M6DA 3LLFA 1VQTA 1W9DM 3BL3A 3MUZ1 3TOPA 3ZQ9A 3SN1A 1S2AA 2YJQA 3B8IA 3SCTA 2F9RA 2Y5EA 3UG3A 1IEIA 1Z41A 4L6HA 4HP5A 3T09A 4HK6A 3KRZA 2WW5A 3WK0A 3PBWA 4BK9A 4MNKA 3K13A 1E1FA 3EDJA 4PGLA 2X1IA 4F0KA 4S3CA 3THQA 1TMQA 2QVHA 1O7AA 1S2VA 3AYRA 3BV7A 1V93A 1F6YA 4PMDA 3ZJKA 1QBAA 4I3GA 1VFOA 3AQUA 1GKQA 3W75A 1P0EA 4FF5A 2OWWA 3RIKA 2QNEA 1KV8A 4D6GA 3LCFA 7CGTA 4EK7A 1LWHA 3GQYA 3EX4A 4C60A 3DZ1A 4L4LA 2PAJA 4KCUA 3TSMA 4TMBA 4XKMA 1WXZA 2AQWA 2PD5A 4KRUA 5A8MA 4LW7A 3MUXA 1F6KA 1MUMA 2Z0IA 1MEIA 2HVMA 2REQA 4ZO8A 5KZMA 4AZGA 3TX9A 1R38A 4MY1A 1W9BM 1XDJA 3RR1A 1ITCA 2V2HA 2HVNA 3PG9A 4W8AA 4C6IA 1DIEA 1SZFA 1IGSA 5CJMA 4TOQA 3WJXA 1JPDX 3OQEA 3H24A 4NY2A 1RH9A 1UD6A 4IXXA 4NXKA 3U2OA 4F2BA 3OQ8A 5KINA 3QV8A 4DYKA 3RPMA 3T0AA 2PDNA 1G7VA 1Y0EA 3UU0A 3O8AA 4GNVA 3S5OA 1XRFA 4ACYA 3TWBA 4PTDA 4U28A 3QR3A 4FLQA 2ZUTA 5H91A 4E3VA 1FKXA 2CLKA 1XRSA 1BRLB 1TRIA 4LV4A 3W0KA 3LHTA 3UWEA 2RJHA 2VUYA 1XCFA 4TVDA 3GRIA 1TB3A 3MT1A 1NWTA 4G8TA 3UY8A 5BOFA 1SR0A 1K8ZA 3B0XA 2PFHA 1JCJA 2BODX 1A5MC 3GU2A 4ZENA 2ZZ6A 4X2RA 3GS6A 3L4YA 3WQ6A 1RR2A 4EIVA 1M3UA 2CZDA 1AH4A 3HPSA 3SCQA 4ZE5A 2QCFA 1V6TA 5FEPA 1L6SA 3R11A 3FNDA 2WKJA 2ADAA 4WIWA 3H2CA 3ZSSA 4XVDA 4UTFA 3HN3A 3W29A 3LCGA 3TA6A 2FZMA 2OYKA 3WJZA 4NJKA 3CPGA 4RPPA 1BG9A 4ACZA 2FTWA 3MS8A 3R8HA 1AJZA 4RDVA 3MZ2A 1N8FA 1XLHA 3O06A 2ZRXA 1MSSA 1U5HA 4TV6A 3RPTA 2A6LA 2NXGA 4G9PA 3V5CA 3TFXA 4RW5A 4H7CA 2OO6A 4MVAA 4D8AA 1FP9A 2DIJA 2NX9A 1UPPA 3OG2A 3PWGA 4YPJA 4JX5A 1TWSA 4DLFA 4U2YA 5D38A 4ERIA 1E3ZA 4JR5A 1ZRQA 3M0LA 2XM2A 1YIXA 4KRZA 1ZSXA 6TIMA 1C91A 2FPTA 3N9KA 2R1NA 4K8EA 3RJYA 3WLIA 3PZMA 1EGMA 4MFDA 4ZQCA 4C1LA 5XINA 4XD4A 1EX5A 1RVGA 2JQXA 3T05A 2GQ9A 2VT0A 1VFMA 1M01A 2NQLA 4IPPA 4FNQA 4ENLA 3PNUA 3GU1A 5BU9A 2PBGA 4S38A 5K3VA 2XFRA 2VMFA 3UZ5A 3OZMA 3WUFA 3W00A 3BW4A 4WF7A 1TX2A 7TAAA 1QK2A 4JTUA 1PIGA 3E0FA 1WV2A 1VPXA 4LUIA 3SUTA 4PB5A 5F2MA 3QYSA 3CPUA 1JULA 1EO7A 4HHMA 4LYPA 3GDKA 4IP7A 3H2NA 4E4FA 3IUDA 3L0GA 4MLRA 4LVDA 1BXCA 1R87A 4CQAA 1JEZA 3WQGA 3V1PA 1OFEA 3W25A 2CZEA 4LUSB 3HZ3A 4M5PA 4NZ3A 2NXIA 2ZZ1A 1B3VA 3ES8A 2D73A 4QROA 1A0CA 5BXPA 1WCGA 1WO2A 1WUFA 2C6QA 4JQ4A 4MB5A 1REQA 4YTQA 1C29A 4PBEA 1Q6OA 3CL8A 3LMZA 3MZNA 1YLVA 5GJMA 4PRWA 4B9ZA 1FCBA 1EBGA 4R33A 4K1GA 4MMWA 1W5MA 3LHYA 4ATWA 2F7FA 1RK5A 2JK2A 5DCDA 1U5JA 4LYQA 4US5D 6XIMA 1KFEA 3FXGA 3LLDA 3RPDA 2VQTA 4JQ1A 2UY2A 1XLJA 3B0PA 3EXSA 5DT5A 2YXXA 4B5UA 1NAL1 2PTZA 3EOEA 1H41A 4DUWA 2UY3A 4LYKA 3WD3A 4TTUA 2DW6A 2JIEA 1QW8A 3TC7A 4FXRA 3VA8A 2E9MA 4GC3A 1J9YA 2VVNA 1ICSA 2JKPA 5I5RA 3ZVHB 2G8ZA 1JCYA 3N4EA 2FB2A 3NQMA 3NZRA 2VGGA 3AIEA 2EQDA 3NL3A 5LNSA 1AL8A 2A79A 3K4AA 3GXNA 3WD2A 1RZMA 4RE0A 1SFJA 3NSNA 3T0DA 3FCPA 1XIJA 3I4KA 5LIYX 4V2XA 2B81A 4AZ7A 3LDVA 5D32A 3PB2A 1XQKA 4IFKB 3OLIA 3A23A 4W85A 1J10A 2JGYA 3R8GA 2HBVA 6A3HA 3LU2A 1DPMA 2YW4A 2QUNA 2GSJA 4PCFA 1NFGA 4A05A 3R89A 4AFYA 4LV9A 2ZICA 1KR0A 2E6FA 1W1YA 4P7LA 2I1OA 3SCNA 3M44A 3DGRA 3CZKA 5C9RA 4BI6A 5BXTA 1B3OA 1EF2A 1EJUC 4QHRA 1YNPA 3W4RA 7ODCA 1X8CA 3AZRA 4F40A 4MJ4A 1B0IA 1XBVA 1D7FA 3VGFA 2OYMA 2X1SA 2EBNA 4ROPA 1H7RA 3LZ3A 3RG6A 3A3HA 2UY5A 3NM3A 4W93A 2WZMA 1VHNA 3KS6A 3O3RA 1E6QM 4PEKA 4JNZA 4IQLA 1OB0A 4HSOA 4CD7A 4QQUA 2R1LA 1IZKA 3DBPA 3GDMA 2QJMA 3UZZA 2OJPA 4UFMA 4IFRA 3LRMA 3S2NA 1SJBA 4JICA 4IICA 4H6KA 1SFTA 1F6PA 5LA1A 3E0WA 1LG1A 4J3VA 1BQCA 1ZP3A 3G2GA 3GH4A 3OHMB 2VDHA 4L80A 1HG3A 1NSJA 3ABZA 3VOCA 3UY7A 3MUIA 3QGAC 4HNVA 2ISSA 3EPOA 4ICCX 4LY4A 3S42A 1JRBA 3ISIX 4AEEA 5XIMA 2BVTA 3A24A 3GBDA 3GVVA 5D37A 1MEWA 1LRNA 1KD0A 1R2TA 1QI4A 2CESA 2EG6A 4S2CA 2Z25A 5C7VA 1IYXA 2W3ZA 4DWSA 2P8BA 1XR2A 4JTCA 1M03A 1T6MA 1V5XA 1JYNA 4ML4A 1HKKA 4W4QA 5MHBA 4DF1A 3DIPA 2Z6JA 4H7ZA 3ENLA 5F4SA 5C2XA 1M9HA 4O0KA 4Q8WA 3UT0A 3W53A 3B9OA 4KPLA 5DBUA 2WSPA 1O6IA 3PBYA 2TPSA 2ZADA 4U2ZA 1DEDA 4OECA 2PTXA 1VEMA 3W7QA 5HMSA 3USZA 1LP6A 2RGMA 3LTPA 5KTLA 3B3DA 1KA9F 4PTMA 5JUVA 3UERA 2ACSA 1J12A 1J96A 3MBDA 4O57A 1EP3A 4XBKA 2AL1A 4UFIA 1GHRA 3TZNA 2YBVA 3GC4A 1EA0A 3SZ8A 2E28A 5EMJA 3K8MA 5I02A 2RJGA 1LROA 1NDWA 3EKZA 2DQWA 3MB9A 4JTEA 3MWCA 3MV11 4HB7A 2DP3A 5G2IA 1J5TA 5AECA 1U1UA 3WMBA 5REQB 5CLTA 1VB9A 3P81A 2SFPA 2IMRA 5BYWA 1W37A 5EMUA 4L9XA 2ZUVA 1TELA 4P7OA 7ENLA 5FD0A 4Q4QA 2PS2A 2E8ZA 3VNKA 1V3JA 3A4AA 3DDMA 3NM1A 4A3HA 1F05A 3CMGA 2ZWYA 3OU8A 1AW1A 3SRDA 1MUCA 5HOSA 1OT2A 3KS5A 2FGZA 4TX9A 3M0HA 1DJYA 2YDQA 4IT1A 4WJEA 4HT3A 3T44A 1OT1A 4IXHA 1I2PA 1BRLA 5A6BA 1ITXA 3W1MA 1WDWA 4B16A 3R1ZA 5HR7A 1HL8A 3NSXA 2PRHA 4CD5A 1KCLA 1UD4A 1BYDA 1UH3A 3QV7A 1YTEA 3WUEA 1CWYA 2DUAA 1EC7A 5CEWA 1ELSA 5KITA 4XWUA 3A4XA 2WC3A 2QULA 2MUCA 5DY3A 2CBJA 1J2WA 4K2SA 3UNTA 4FR6A 1TZ9A 1Z7AA 3R12A 1EEPA 1LOQA 1R9XA 4JTAA 1BTCA 3TAOA 1LWJA 3H53A 1GOKA 1HJSA 2DT0A 1OIFA 1UBSA 1XG4A 4ZOCA 1EQPA 1ZP4A 1OABA 4JQ2A 1Y8BA 4QP0A 3MI6A 3RHGA 3D0CA 1PSCA 4DNHA 1GYMA 2FGLA 2GOUA 1Z8AA 3N2MA 3Q37A 4DJFC 2FHFA 3P8IA 5CGQA 4JY8A 3ES7A 4KEMA 2PCEA 5EGRA 1UKQA 3ERPA 1QU4A 4YJ5A 3W1AA 1XBZA 1YDOA 2VFGA 1PWLA 1TA3A 4CGTA 1Q6QA 4ZTXA 5A6TC 4JDYA 4R53A 6REQB 4B3LA 1A0DA 4PMRA 2DT2A 2VEPA 2W79A 1SR9A 4IMEA 3SB0A 1DHPA 1QASA 4FEZA 2QEZA 3QMRA 1GQJA 5HUPA 3WEZA 3TVAA 1A80A 3BQ6A 3LNPA 4J3XA 4F3HA 1WKDA 4OZOA 5DO8A 1CLXA 4Z2GA 3VZXA 4HZ8A 1YE4A 1LYXA 4MUZA 4LB3A 3TIMA 1ZU8A 2PDUA 1EZ2A 2WCSA 3P84A 1XIGA 4NZ4A 2FHBA 1DJNA 3KTXA 1SFLA 4A21A 4M1RA 3II1A 4D8LA 1NARA 2J8GA 1W2PA 3Q94A 1BF2A 2D22A 5KMYA 1QJWA 1VEPA 1XH1A 1EYWA 3CV7A 1A53A 1C8VA 2IPJA 2ZOXA 4JL1A 4JTTA 4XBJA 4DY1A 4PUKA 1EUNA 4FA3A 4DXXA 3R0UA 1UP0A 1A5KC 3HQ1A 1KC7A 1UC5A 3LQLA 3DGBA 1GOOA 3HJZA 3INPA 3G1HA 3MP3A 4F9JA 1XI3A 1RJRA 3CEUA 7REQB 1PHWA 1OFDA 1ONXA 4K8GA 1YXCA 2ZX9A 4XZMX 4A35A 2RKXA 4H8UA 3N9SA 3CL7A 4DB7A 1VJZA 3SSZA 1W31A 1WZLA 1RA5A 3KTCA 4UNKA 4HCHA 4XD5A 3UVIA 4OBRA 3IIOA 3BSMA 1TKKA 1QI2A 1HP5A 4X61A 4C6QA 1TJ2A 3QSRA 4O17A 3KE0A 3EDFA 3SUVA 4GO9A 2OX4A 1I8JA 1F8IA 3NCOA 1VCVA 2PRLA 4AMAA 1E4MM 4PODA 3UWWA 2CCRA 4AZ6A 3EWCA 1KBJA 4FF7A 4QLKA 4AW7A 1CXFA 2XN2A 4ZB0A 2D3LA 2XH7A 4LJ3A 4F48A 3OO2A 2ZYFA 4E4PA 5CXPA 4S3DA 3WNMA 4NZCA 1MVYA 1X6LA 2VTFA 2WWCA 7A3HA 1N8IA 2PLCA 5FJPA 3KZPA 5TBOA 2HS8A 2Q8ZA 2CFFA 1E1CB 3STCA 4DJDD 3JRKA 1QPRA 3CWHA 3GUWA 4U3CA 3A4JA 4RL3A 4Q8MA 5I3JA 2B7PA 1J2BA 1G4PA 3WF2A 2ALDA 2XUCA 5F2GA 4IF2A 1S2CA 4F8XA 4BQ5A 3G1VA 4TQTA 2IXUA 3KCOA 1B57A 4DZ5A 4KCVA 4UR9A 4W8BA 5M3WA 4MY9A 4L6OA 1GQKA 2YFOA 2ZE0A 4PMVA 4N9EA 3CHDA 1U83A 5LHFA 2DORA 1FHVA 1RLCL 2Y7GA 2C79A 3UXAA 3GXTA 2H8ZA 3B9AA 4PA8A 4B2DA 3ZXWA 2BDQA 3B8SA 1XYMA 3PBUA 2ZUSA 3G3DA 2J7HA 1JGIA 3VOGA 1F4AA 1F07A 4PMJA 3FSTA 3W87A 4KS0A 4GNJA 3A5VA 5HMFA 3KHJA 4PTNA 2P8CA 5C2CA 3QW3A 1R6WA 1KNWA 1W3IA 2WSYA 1TWZA 5ENLA 2ZIDA 3THUA 3SBFA 1AQFA 1HKWA 4ZBCA 3WDJA 3R6IA 3QGVA 1TTIA 4L4MA 4Q7BA 2POTA 4KWUA 4E8CA 3FA3A 3VIOA 2PRMA 5BXSA 1JJKA 3WQPA 1KLYA 3VOHA 1UR1A 4GY7A 2V68A 1NOFA 1XKYA 4CNTA 5I3IA 2VGBA 5F1UA 5IOBA 2QDHA 5DMMA 1QOPA 2P50A 3TN6A 4AHQA 1TV4A 4C5YA 1UG6A 2F8QA 2P88A 1FH8A 4ATLA 1L2QA 3DYOA 4GVIA 3SGGA 4QM1A 1PWMA 3M46A 2E9BA 3E5BA 1WOAA 2X2GA 1GHSA 1FWFC 3M16A 1EJXC 4HN8A 1C9DA 3H54A 2HISA 3IJ9A 4LS1A 3NWRA 1ZPTA 3PZTA 4RK8A 6CGTA 4CU6A 3CZ8A 2DVTA 3N73A 4MKNA 3W38A 5LNRA 3S9ZA 3HPAA 4ORIA 1UBPC 4O11A 1X39A 4DO6A 1LLZA 1K9EA 4K38A 1V3IA 2CWNA 1PKYA 2HV5A 2Z1SA 3ARVA 2X09A 1FWJC 1MXDA 1NF0A 2F6UA 3NQFA 4L56A 3DFTA 5G2WA 4M7SA 2PBOA 4HA0A 5LGXA 3S0CA 4Q8TA 5LA0A 8XIMA 3E0LA 2BY0A 1NP0A 3SJ3A 3HF3A 3AUOA 4I7VA 3W7KA 2DFAA 2EPOA 5DRCA 4ASTA 5ECVA 1JQVA 2Y5JA 3V1HA 1KCZA 4DEFA 1CLVA 4MNJA 2X0SA 1KGUA 4CCEA 1E6SM 2FMNA 5CPLA 3T9PA 4CN1A 3SI9A 3VNYA 5AHNA 1E43A 3QFEA 1D2KA 4PMOA 3LHUA 2QKFA 4ZSUA 2G5WA 2XGBA 3A9BA 3GIQA 4Y9MA 3KLKA 5REQA 3AMGA 4XUGA 3W24A 4QISA 2VP8A 4N02A 3Q58A 3GTFA 1IV8A 1CYGA 1LZOA 1ECEA 3BLEA 2BP1A 2QCDB 5GNXA 2IQ0A 3FA4A 1PKNA 1GPWA 3JZUA 3KXQA 1BSLA 1EJVC 3UJRA 3VD5A 4S3BA 3P60A 4H8VA 2FTPA 3GKAA 2E4TA 3STPA 4IPIA 4QJ3B 4X2PA 3TSDA 1P0BA 3ZS4A 3CUZA 5M1TA 4JTRA 1Y65A 4NX5A 2QCMA 1ME7A 4M3PA 4Z2KA 3WELA 3GLCA 3BAIA 1IT8A 5B80A 3S47A 2QVNA 3QMSA 3CHFA 2CLIA 7PTDA 3RF9A 3EPNA 5K4ZA 2VFIA 3C0SA 1UR0A 3F2BA 4DBUA 1TREA 3QV6A 4S1FA 3ZM8A 3NXFA 3RLVA 2V2CA 2FKPA 4PCSA 3IIVA 4H1ZA 3VFLA 4HA4A 3VABA 1SZRA 1EZWA 3D3AA 1LL7A 4QSFA 3GSMA 3LA4A 3UPBA 1XBYA 1U1JA 1K03A 3GNOA 1Q2SA 3OLDA 1SZNA 4Z0JA 5FF4A 4NSBA 3ZJ6A 1CNVA 3HU7A 2EG8A 2FPYA 3IJ8A 5D02A 1W91A 2VWSA 4KKXA 1F3XA 1RY8A 2FFIA 2WMKA 4AZCB 5I00A 4D1JA 4EPKA 3GG7A 3A64A 4DJFA 2FIQA 1KFKA 2WZHA 2J88A 4MJ2A 4GQBA 1VEOA 1X98A 1XUZA 2OR2A 4YN5A 1BYCA 1OQFA 2RDXA 3NEVA 1ECQA 3ALGA 5DCEA 3MO4A 3NR0A 4DO4A 3B8WA 3EXTA 1FRBA 4X22A 2H3BA 3E12A 1WP6A 1IWAA 1S5NA 1M7XA 1Q6CA 2RAGA 3JW7A 3QZ6A 2WVTA 4MZ1A 3BAJA 3IV8A 4E8DA 1QWGA 3VNMA 3NZQA 4GQ0A 4D72A 1TSIA 3GIYA 2OLSA 3CTLA 2CU0A 5BWAA 2BY2A 2EF9A 3GUGA 4KW2A 3OZOA 3LG3A 2E0PA 1H2JA 5BW6A 3CM4A 2Y8UA 3EDEA 3AWOA 4RZBA 4V33A 5IBXC 2DZXA 3RMEA 3V18A 5F1VA 3WNKA 3ZLHA 1KFJA 2C91A 1EDGA 1MW0A 4O19A 4PFMA 3WJWA 5IDIA 5IHRA 3W74A 1DYSA 5HMEA 4MB1A 2NV2A 1OBAA 1YMYA 3BG3A 4I5UA 3SECA 5A8QA 1WZKA 3ZR4A 2ZX7A 1S5VA 3P0XA 1VYRA 1ISZA 2PWDA 2J74A 4N0RA 3KHDA 3PHAA 3ABRA 5EYWA 1E73M 3W26A 3G1XA 3FIGA 3PBGA 4ERAA 3M7SA 3BMWA 3A47A 4QBXA 3MMUA 1AA1B 1P0DA 3ZMRA 1JXJA 1VPQA 1V0MA 3AWNA 5ABGA 5FL1A 1SMDA 4IIDA 3LLXA 5EFDA 2A3HA 1HTIA 3TROA 4DWDA 2ZZ2A 4TO8A 4C6PA 3PUGA 4KEZA 1R3RA 4J5NA 2MANA 1UJPA 5HPOA 1PX4A 3BSHA 3EWWA 3FW6A 3VFCA 4KQNA 3GFZA 5M2FX 3ITYA 4AY7A 1E55A 4BCEA 2Q8XA 2C1GA 4UTTC 4GIEA 3AXXA 2XIIA 3DUGA 3ANUA 3VDBA 4GRSA 1E0WA 2VUNA 4YWIA 3SGUA 4K36A 1WX0A 3LHZA 3HIJA 4QRNA 1ZLPA 3GXFA 5JU6A 3DHFA 1X1NA 4LC8A 3WLTA 4ZB5A 3CJPA 4RR4A 1ZAIA 3ZSTA 5FF3A 3WLNA 4DM2A 2D1ZA 4RKAA 4WDWA 4FO4A 3NQ8A 3B40A 1UP3A 4A3QA 3QPZA 3F5LA 1KBBA 1EDQA 1DXIA 1NU5A 5CQ1A 5CG7A 4L61A 3FEQA 1ML1A 4WDTA 1DWHM 2VEFA 4AAJA 3L12A 5AHLA 3NDYA 3E0VA 1OZQA 2VFEA 2WMJA 3NQ2A 4V27A 1YXDA 1HVQA 2YL8A 1A49A 3K4WA 3CPRA 4B15A 1ADSA 3H7VA 1ZJHA 3BICA 2B7NA 5HWJA 4HTYA 5XIAA 2HQAA 2Z00A 1W3JA 4JN6A 4NZJA 3BJFA 1F74A 1OIMA 4JN8A 3LX9A 3VNLA 3EBVA 1NWSA 1JF6A 1SQ7A 9XIAA 1JZ8A 3TYDA 1JYVA 3DI1A 1JGMA 4KT2A 4IIHA 2ONEA 3EDKA 4CN6A 1GOMA 4PSPA 2NX1A 4RPQA 4XSMA 4L4OA 2WZEA 1TJ1A 1PB0A 4QE1A 1IT7A 4FALA 2ZX6A 3CV6A 2ZUWA 4GI9A 3P82A 1OSEA 3GK0A 4FOUA 4H2HA 3LB0A 5AYBA 3F1QA 4FX7A 1VJSA 4REQB 4OT7A 2WNWA 4GGBA 5C9ZA 2NQ9A 3ZR6A 2XWDA 1B31A 1YADA 2R6OA 3NEHA 4ML9A 1UUMA 4NAFB 4DIAA 2O9RA 3B04A 4M82A 4B5NA 4Z2HA 4LAOA 3PULA 2VRJA 3OBKA 1P6BA 2YYTA 1ENUA 2KX9A 3GM8A 2B7OA 1YDVA 3DU0A 2DT3A 4MY8A 1T8QA 2QDGA 3ITCA 4UTJA 2DUZA 5CGMA 1E0XA 2WZIA 2C19A 3G1DA 4XG1A 3O07A 4YVXA 1R46A 3GFYA 2PDQA 2UBPC 4QE5A 2OWXA 1FCVA 1V3HA 3FHQA 2VM8A 4IISA 1NF7A 4K68A 1VFTA 2C71A 1I0DA 4E3TA 2JBMA 4GKTA 4ECLA 1A0EA 4JKKA 1MWOA 3B03A 3L2MA 3W2MA 1BEUA 2OG9A 3QY7A 5AVNA 3BARA 3EA3A 3AHVA 4GACA 3PZQA 4D6CA 1SPQA 1JG9A 3ZZ1A 1TPDA 4ZQNA 4F2UA 1W3KA 1JAEA 3JVAA 1AH3A 4LH8A 1B9ZA 2VC7A 3W76A 4HOWA 1X38A 1HN1A 1LT7A 3VI2A 1VFUA 1FWWA 1IEWA 1VZWA 2P3EA 3IK2A 3RM4A 4HMEA 4HPNA 1PYMA 3K2GA 3TONA 3GDLA 3QKZA 4MAZA 3LGGA 5U4NA 1V0LA 2CBIA 1QUMA 5CZSA 4P8WA 4IMAA 2XDFA 1JYXA 3IAPA 1ZUAX 1X1OA 3WMSA 4DO5A 1SO6A 5CPSA 2PI6A 4QIUA 2WVVB 3LV6A 1B3XA 1JDDA 1XYLA 1Y7VA 2ZA2A 4V15A 1W3HA 1WBJA 4URIA 3OOQA 1MZRA 1W9XA 1KM6A 4CD4A 3VIGA 3IGXA 4MOZA 2VCCA 3GWQA 1PTDA 5TNVA 5TAOA 4XIMA 1V6VA 4HK7A 1XD0A 4KIRA 1P7TA 3NYDA 5E6ZA 3CUHA 1R3VA 3A12A 3E3HA 4LTSA 5AC8A 3TZFA 2J66A 3HB9A 1HFBA 4DI8A 3KCLA 4UWMA 1VS1A 2ACUA 1XINA 4N42A 2B31A 2RUSA 1M5WA 1DOSA 2GJXA 2QPXA 4ADTA 5HQMA 3FDKA 3TYZA 1JFXA 1GEQA 3R2GA 4UMCA 1AQ0A 3NPXA 3LBOA 3SCUA 3ABSA 1FA2A 2GJNA 3WQ4A 1C8QA 4LOCA 1D8CA 3KCJA 3WZ0E 4B9YA 4WUIA 3PWIA 1Q66A 4E6MA 3MWAA 3SURA 4UFLA 5AB3A 2HEJA 1HT6A 4UR7A 3LUTA 1X6NA 4LU0A 1DTNA 4U5IA 2ASHA 4HVXA 2X8RA 4DNMA 4AHOA 3PVFA 1GW1A 2IKJA 1FY6A 3KOFA 4KWSA 4BQ2A 4K8HA 1J79A 2ZUUA 5CGTA 4WXYA 3DFQA 2ON3A 2ZXDA 2V3FA 3B9DA 3WBYA 1DBTA 2A7NA 4M81A 2YR1A 4QDMA 4LB4A 1OD0A 5F2IA 3GHSA 2ZC8A 2V5BA 2V2DA 2Z1KA 3GW0A 2WYSA 3QOMA 3LYEA 4EF8A 1KQYA 4Y9AA 1ISYA 1J0JA 4S3JA 4IJCA 3T4WA 2W91A 4RXFA 2EGZA 3C4UA 3DG3A 1UUOA 3EWBX 3CHVA 5E0FA 4NZFA 3EPMA 4U4MA 2V63A 4O15A 3OGRA 4GJJA 3UESA 4AZCA 1ZBKA 1H50A 1ZNNA 1WE5A 3ITTA 3PTQA 5FOOA 3RJXA 4GI6A 4QEEA 5C8BB 3H2OA 1SW0A 4CNOA 1QO5A 1J11A 1VLIA 1GZGA 1H4PA 1Q8AA 3U5YA 1X6UA 4WGXA 5BU6A 1EJ7L 5CSYA 3IUIA 5FCZA 3UQNA 3SUSA 3SUUA 3KL0A 3WH6A 3RX4A 1LRTA 3VD9A 2NV1A 1KXTA 4UR8A 1R30A 1J93A 3PN8A 2ZRUA 4AIUA 3WSUA 2WLYA 4M1BA 3OVRA 4X60A 3N04A 3AFBA 1OX4A 3MHGA 3CUFA 1AW2A 1XISA 2VDIA 4LALA 1OFOA 1ZCCA 4MLJA 4J7RA 4PTVA 3WDIA 2E09A 5A5WA 4H2CA 3R25A 1KLZA 2PD9A 2DUXA 2BXVA 4FR1A 6TAAA 2FGBA 1T0OA 3WQOA 4ZA0A 2Y24A 3W7JA 1GORA 1FQ0A 4CD8A 2A3EA 1X8FA 1CENA 5KZEA 2G96A 1KTBA 1UWRA 4GK8A 5CPOA 5IBXA 4GJIA 4UQBA 3PFRA 2V5DA 1TZZA 1NM9A 3UJ2A 3IWPA 1F8MA 1P0NA 3CZGA 4F2TA 1QO2A 4NG3A 3BVJA 2HROA 3E74A 3DCPA 4WJXA 3L4TA 5EU9A 1K9DA 1PCKA 4J9JA 3W07A 1BD0A 2HWGA 2V5JA 1AZ1A 2Y0FA 4C6KA 2PA6A 1VYPX 3VILA 1MXSA 3W37A 3RM8A 1KV5A 1V6YA 4DJED 3HG5A 3CYVA 1M7JA 3IARA 1VPYA 5A6KA 5DMNA 3W22A 3CIXA 4CEUC 3W7IA 3BMXA 2ALRA 2CIPA 4IWWA 3U0HA 4FLRA 3MSYA 3R10A 4MM1A 3QFWA 1XX1A 3WQWA 4H9MA 1ZGDA 4JQ3A 1SYTA 1ZJBA 4OJYA 1PCWA 3FFSA 1P43A 4N4QA 1Q5MA 2E25A 3VNDA 4BQ4A 4ERGA 3WLQA 3H12A 3NQ7A 3CASA 2Z2AA 4G7EA 1K7FA 4G56A 2WLZA 4BI5A 3AU6A 3W2JA 3KRUA 4UTTA 1BWKA 2A3BA 2XU2A 2D20A 3A5FA 1Q7ZA 2GUBA 2WSKA 3IVTA 1ITUA 2YDSA 1D3HA 3UR8A 2GGJA 2P0OA 4HA3A 1A5BA 4GKLA 1VLWA 2VOTA 3N6QA 3UWUA 3QXBA 1WXYA 3CAKA 3STGA 3CAWA 2G3MA 3QH2A 4LX4A 3AROA 3N29A 3CH9A 2GL5A 4Q8QA 1U30A 3MSGA 3E9AA 4OV4A 4RZ4A 4CKQA 4Y8EA 2RDUA 4Z1BA 4WXZA 2C1IA 2YIHA 2W0UA 2Y8VA 3VPLA 4S3FA 4PUDA 3C86A 3V16A 1HO1A 1M65A 1G67A 1UQZA 3S1VA 4XZ9A 1UCWA 1UR2A 1R7AA 1A5CA 1GVYA 4OU1A 1LOLA 4AC1X 3GTIA 4LF2A 4LUTA 5FJOA 1GVIA 4QGCA 3UYCA 4H9YA 3S9YA 1YTDA 4K37A 4LAZA 4A6GA 3G0UA 3CZLA 4PMUA 4CNSA 3T81A 2V9DA 5ECUA 2ZXBA 3VIJA 3S8HA 1TPB1 4C6DA 3LCWA 4GY1A 2VZSA 1R5YA 1XLEA 2NUWA 1AUSL 5A8PA 1ONRA 3F2CA 3PZOA 3VVGA 4R85A 1Q7MA 4LRTA 3HGSA 3GVQA 4HYRA 4JTSA 4C6EA 4UZUA 1OHLA 1TPUA 3CIVA 3FYOA 3LSCA 3NL2A 2WAGA 3G0XA 3OYXA 4GX9A 1XLBA 5CBBA 3S6DA 3OW1A 2J62A 4O14A 3NVTA 3ATYA 1QRQA 3VKAA 2TODA 4RNJA 4GIRA 1EP1A 4MB3A 4G6CA 3W81A 3N2CA 3TA9A 2Q02A 1HO4A 3KDOA 1XG3A 3HJEA 1TJ0A 2VNCA 3AO0A 2GLKA 1AD4A 1OVDA 1WDSA 3P0WA 1UR8A 2NT1A 3N6HA 3UR5A 1K4HA 2POZA 3HTWA 3DFOA 4HHLA 1FFRA 1VD6A 2BS9A 3CWNA 3NL6A 2O56A 4R34A 2ZRVA 5DY2A 1CB2A 2GZXA 2JKAA 3PZGA 4KEVA 1O4UA 1XLIA 5CZ0A 2OU4A 3LRKA 1AODA 1GVRA 3N6JA 4ONVA 3WK2A 4R7OA 1FDJA 3F5JA 3HQOA 2WHKA 4XK2A 5AYZA 2Q09A 1NQKA 1GOIA 3TMQA 1CGWA 2YW3A 1BG4A 3GYEA 1LQAA 4WRHA 2REQB 6ENLA 5A6AA 2BMBA 2YCJA 2XVNA 1K9FA 4BWLC 4Q32A 1EHNA 4Q6XA 3ONCA 2F2HA 9XIMA 4IMDA 3HGOA 1OGSA 1HZYA 1TTJA 1PV8A 3B0UX 4CVWA 4M24A 2FPVA 2D0FA 4XAGA 3LQGA 2WMIA 2WMFA 1V4YA 5EPDA 3TJXA 4R9OA 4PCTA 4C5ZA 3EWZA 3G1FA 2V5LA 4I9MA 3L5MA 1MUWA 2WBKA 1LQ0A 4GVHA 3NG3A 5BOEA 4KH2A 5I3GA 2AL2B 2EEXA 4AU0A 4QE4A 3W02A 4XAYA 1TVLA 2OT0A 2G3FA 1DJIA 1UOZA 1CXHA 4F0RA 4F4RA 2HNHA 3HQPA 1BXBA 5FACA 1Q6RA 4Q8PA 3NGJA 4W9TA 5HPCA 3PZVA 1XH2A 2BHUA 3W1TA 1W9VA 1Y5XA 1QHOA 4JFUA 3QBUA 5CC3A 3VD3A 4XVEA 1G5AA 4NVTA 1UKOA 4IIFA 4BFAA 3T07A 5GJNA 3S2JA 1W5PA 1R9YA 3WYZA 4JL2A 1PX3A 3G24A 3VZZA 3W01A 1B4EA 3EA1A 1S2TA 1FWDC 1RV8A 4AY1A 3S5YA 2HZGA 1XIBA 2C7FA 1UWIA 1MQQA 4ACZB 2V6AA 4MWAD 3A3WA 1CXIA 1D8WA 5BWFA 2GQ3A 3W83A 5HA7A 1C3FA 3W7RA 3IEBA 4HOXA 4XZHA 4JCMA 5E0CA 1MXGA 1GPFA 1UMYA 2HSAA 2BOEX 1K3UA 1HP4A 1YQ2A 1MDRA 3BTNA 5RUBA 3S4TA 3QQ1A 3WFZA 4JTDA 4XSLA 4H9ZA 4GFIA 3QC0A 4JTHA 4C91A 3FAWA 2DZTA 4JHMA 2Y5SA 1JCXA 1Q65A 3WLMA 3B8UA 5ABFA 2YX0A 4FP1A 4R88A 3VE7A 5KZDA 4A8LA 5F4WA 1UWUA 3BK0A 3SIZA 1UMLA 1O1HA 3RNDA 4EXAA 4A22A 4ZO6A 1OCBA 1QNQA 1YXYA 5LNUA 1JZ5A 4AB4A 4KIEA 1EJSC 4B5VA 1OY0A 4HU3A 3H2EA 3KBSA 4FB7A 4UOQA 3W1NA 2PC8A 3QQWA 2GK1A 3B8DA 3NZ1A 3H7RA 1Z32X 2I57A 1IQ8A 4PH6A 3TW7A 4C6NA 3W7MA 1XGDA 1HGWA 5DMYA 2PDPA 1P6CA 3LI0A 3CV2A 4JZ5A 1UD5A 4B5WA 4DM1A 3LEPA 2ZCGA 4CU7A 3KFTA 4BZYA 1W3TA 3AYSA 2FDMA 1GVSA 1TPFA 4GWEA 4WVXA 3ZT6A 1ME9A 3ARRA 3U3HA 1TR1A 2QCNA 3OG3A 1B2YA 2OPJA 3WD0A 1M7PA 3OYZA 3ICJA 2VZTA 1REQB 4AWSA 2VENA 4JYFA 1E0VA 5E0KA 3MMTA 2FH6A 8RUCA 3W28A 4NJJA 1CX9A 3AICA 2E6YA 1TVPA 2QCLA 1JUBA 4XV0A 1FDYA 2OEMA 1CIUA 2YPIA 3RILA 3RLGA 2OZTA 2A0NA 4R5EA 2Z1VA 2J9YA 1S1RA 3GZAA 4H9VA 3ITLA 4ZL1A 3UWQA 4HN4A 1VHCA 5C0QA 3BOXA 3MUCA 3U4FA 1MRQA 2XIBA 5D9MA 4WSKA 1FWTA 3UP8A 4HZ7A 2YA0A 3PUDA 3VMNA 1UHVA 2G0WA 4B5TA 4EAMA 1YW1A 2PDHA 1GJWA 3CAVA 3UF9A 1E6ZA 4Q8UA 4XBSA 1XIMA 1VF8A 1N8WA 3S6TA 4RNIA 3FGCA 2LLEA 3JR2A 1BAGA 2X30A 1KKRA 2ABBA 3TC3A 1OX6A 5FKYA 3WH5A 1ZHAA 1J6PA 1R85A 3PZ9A 2CITA 1PEZA 4ZFCA 3O16A 4OBSA 1CB7B 2DQXA 2QF7A 4WCJA 1KRMA 3G1YA 3KVKA 1QK0A 3NAVA 3B05A 3WLKX 1KM2A 1DJQA 1S3TC 1F3TA 3RN6A 4EACA 2YZ5A 1PIIA 4FNUA 1CXEA 1U1HA 4A2SA 4PYSA 1JDAA 3VIKA 1B90A 3TYAA 5M03A 3P61A 2BBFA 3QV9A 5I79A 1FDZA 1LCOA 3NSMA 2WJEA 1SO5A 1F3WA 3D5HA 1HJWA 2E5DA 2PGWA 5FJJA 2PUZA 1H1ZA 3E6EA 3KDNA 4GXPA 3BLFA 2L5HA 4O52A 4EVZA 3QJAA 4A3RA 4LPCA 2A7RA 3UGVA 4QFUA 4WY0A 2WSQA 2WM0A 2YCEA 4XZNX 4CQCA 3MDUA 1CW2A 2FVKA 4AVFA 1BGAA 4D2JA 3DEQA 1JPIA 5T26A 1Q3NA 3WNLA 4F66A 1WOBA 2AGTA 4MZ8A 2O4QA 2V67A 4AZIA 2C13A 1EH9A 4J27A 1EQCA 3PJXA 3GFXA 5AHMA 3RITA 4AIEA 3WH9A 1FX6A 3WUBA 3O6DA 3ZWSA 1US0A 2WCGA 1BYAA 4B91A 1E5NA 5FL0A 2R1MA 1IXNA 4DF0A 4AD1A 2CERA 3ZVIA 4S39A 3PNZA 5SWUA 1GVQA 1ICPA 1K6WA 3GHTA 2WJDA 1PTGA 1WPCA 3RO6A 1SUXA 3H21A 4Y90A 1GONA 2XIMA 3AMDA 1WDPA 3N2TA 2HRWA 2QGHA 3T78A 1IHIA 3LCIA 3UWVA 4TVUA 2PODA 3REQB 3FJ6A 3N4AA 3QR1A 4E5TA 4JD4A 4DWSC 2DT1A 1I1XA 2PDJA 1OF6A 3WQCA 3NQ6A 3C56A 4UTUA 1XICA 1FWAC 1QR7A 4KMQA 2C18A 1TJPA 4LGXA 1DP0A 4DWSB 5AZ0A 3TW9A 4KESA 1W3LA 3QSTA 3IRDA 3LOTA 4C6CA 1NELA 4DBSA 1IEQA 3DYPA 5EBUA 1UA7A 1FHLA 1ZBCA 1XLGA 2CLLA 3BO9A 4IH3A 3E2RA 4OV9A 5GJPA 1AD1A 3MUY1 1TWIA 1AL7A 3WQEA 1TE1A 3M0KA 5C7HA 4H8HA 2O9TA 5LYRA 4C6FA 1ZAHA 3GTNA 3URAA 2XISA 4H01A 4M8UA 1HL9A 4DO7A 3UNDA 2WZTA 3IPWA 4Q4RA 1E9YB 1N82A 2VDGA 2VFFA 3C52A 2HK1A 5AKQA 1VBGA 1S5TA 4MAVA 4LXFA 1UZ1A 3FKRA 3W7LA 2WVUA 1F2JA 4PEEA 3CUGA 1DWJM 3D46A 2FVMA 1KFBA 1Z6KA 2NV9A 4KETA 3SY8A 3VIHA 3S1XA 1TV8A 5D9OA 1JCNA 3R58A 2WKLA 4A3YA 3CQ0A 4AYSA 4JTQA 4BWLA 3GXIA 3IGHX 3U8GA 4IFOA 1FP8A 3R4IA 4N6EA 2W5FA 4WK9A 1D7KA 5C71A 1JPKA 4UNLA 4AD4A 2V3GA 4PL1A 3WJSA 1DIOA 4JYDA 4IM4A 3HMJG 1PYFA 3N12A 1D3GA 4ZCWA 2Q8LA 4JBRA 2DSKA 3BQ5A 1SFSA 2J6VA 1TUFA 3AIBA 3CEPA 3ZJ8A 2VX6A 4R3UA 3ARZA 2ZTKA 3M41A 2WNQA 2AL2A 4S3GA 2PDBA 2PZNA 4IIEA 3E38A 4JTFA 5D9NA 4C6LA 4KWVA 3M7WA 3NQDA 4M19A 3VKKA 4Z1YA 1QTWA 4LAUA 1EIXA 4HNNA 2XPKA 3G3MA 2XVKA 3WH8A 3ARPA 4H00A 3VKDA 1J01A