1GYNA

Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
358
structure length
333
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGALYTQPEDVDYAYTELSKISPRFTIAASFGNVVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE II
publication title The Organization of Divalent Cations in the Active Site of Cadmium Escherichia Coli Fructose 1,6-Bisphosphate Aldolase
pubmed doi rcsb
source organism Escherichia coli
total genus 142
structure length 333
sequence length 358
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2002-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gynA00
3GB6A 4FX8A 1VPXA 3UD6A 3TU9A 1TV5A 1VS1A 1I2PA 1XBZA 3S5ZA 2CZDA 2YDAA 4XKYA 4HPXA 3W7DA 3PM6A 5FEZA 5AN7A 4O4VA 3LXBA 2G97A 3NG3A 2DZPA 4BI5A 2Z6JA 1EUNA 1LZOA 3U8GA 4JTIA 3TMLA 2QUVA 1P5BA 3Q37A 4DXVA 4DO6A 2W79A 2ZRXA 4PFMA 3IIOA 4LWWA 5G4WA 2YFOA 4LW7A 4LVAA 1JCXA 1I2QA 1XBVA 4AWUA 5G2WA 1Z41A 3QM3A 3UY8A 4OV4A 2JKPA 4K7VA 3EWZA 4RK8A 3SY5A 2C1HA 2VELA 3CPRA 3MJYA 3SGZA 2I9EA 2FDSA 2Z2UA 1F73A 3O07A 3FJLA 5FF7A 5D09A 1EX5A 1OFQA 2CLLA 5D05A 4UTLA 3I7SA 4JY9A 1LLWA 1X6UA 4MZYA 4CQ8A 2C14A 3BGJA 5EKYA 3CIXA 1Z44A 1WYIA 1XUUA 2OCZA 3NYZA 4O52A 2QJHA 3ZWSA 3TH6A 1KM3A 2XFWA 4OT7A 4UUIA 4KFNA 4O14A 5AC7A 3QPYA 4ZMGA 1FBAA 1B4EA 1K8ZA 3W7MA 3KRUA 3PAJA 2OX1A 3FKRA 3NQ8A 1OX4A 4N02A 3MI6A 5AC8A 4K8HA 4A21A 5C54A 3Q58A 1XUZA 3W2JA 3O6DA 1FWSA 4FIRA 5LKYA 3L0GA 3LXAA 1TMHA 1YDOA 4U28A 1R2TA 3LCHA 4O54A 3TAKA 4RZ4A 3HPSA 3W1AA 4JYDA 3C4UA 5FEPA 2Y7GA 1JCNA 2A85A 2W0UA 3K30A 4K36A 2E5BA 2C18A 1XXXA 4LU0A 3EXSA 3G8RA 4X3ZA 3W72A 1KA9F 3BW3A 2Q8LA 4UTHA 2CZEA 2G96A 2YZRA 1G7UA 3DKJA 1QAPA 1H7RA 1QPOA 1S5VA 2NWSA 2VFFA 3BARA 2A7RA 1A5SA 1W8SA 1XBXA 1I2RA 4S1FA 1G4SA 1LYXA 1OYAA 1OJXA 1PVNA 5C2XA 4JDBA 7TIMA 3NQMA 3NQVA 2VFIA 4YL2A 2V2HA 4IX0A 3G18A 4Q4KA 5CZTA 4YWIA 5EA9A 2B7NA 2B4GA 3NM1A 2OJPA 2GPTA 1TPUA 1OFOA 3EWWA 3NL6A 4NVTA 4PCFA 5HJLA 1HG3A 4JGDA 4ALDA 4ML9A 2DZXA 3WJYA 1RVGA 4XTIA 3T40A 1EIXA 3TW6A 3DFOA 3Q94A 2ISSA 1TO3A 3OHIA 3DFSA 3HGOA 3LLFA 3FIGA 1A5CA 3W7JA 3BG3A 3W1LA 3LRLA 3TW7A 3LHZA 3GVGA 4K38A 5I3FA 4E2DA 3TXZA 3IGUA 3SW6A 1EP1A 1L2UA 3WJSA 5HMSA 3S5YA 1LRQA 2NX3A 4NQ1A 1WV2A 4I7VA 2FIQA 3QPZA 4K8EA 1YDNA 4NX0A 4AMAA 2NUYA 4UTMA 3C56A 1GWJA 2J6XA 2E5CA 2NV1A 5CPNA 3C0JA 3FJ6A 3NA8A 4PEKA 3MHGA 4ADUA 3NQ6A 1M7OA 3E49A 4O13A 3VE9A 1EP2A 2QDHA 2CW6A 3GAKA 3HF3A 1F6KA 1IIGA 4LC6A 4MOZA 4C1KA 1DBTA 3L0NA 3P62A 4N4PA 3DH7A 3PULA 4GXMA 1PE1A 3TQVA 1WOAA 1I4NA 2A6LA 3IRDA 1W1ZA 4DO4A 1TTJA 1PHWA 3STCA 3W1XA 1FXQA 4DEFA 2PURA 2VENA 2Y7EA 1K8YA 2OMAA 4FF7A 4WX2A 2UV8G 1FX6A 5G5IA 4O0KA 3NQCA 3MP5A 3T7VA 3B8DA 3MW7A 5F2LA 3F03K 3GXNA 3RU6A 4IGHA 4UFHA 5CPLA 1TJRA 1ADOA 4O50A 2NV2A 2VFHA 3S42A 2WNNA 4D2JA 3VI2A 3GKFA 3UNDA 2ZRWA 3SIZA 3HGJA 3HQ1A 4UFMA 5HR6A 3H54A 6ALDA 1LOQA 4NZFA 3HPXA 3W85A 1MEHA 2WSYA 2C3ZA 1J2WA 4LV4A 4O1DA 3DKLA 1S5WA 4M6PA 3HGRA 4S2CA 2QDGA 4FIQA 5HR7A 2GVGA 1EWEA 2Y89A 1M6JA 3NQ2A 4Q32A 5G1TA 2ZRYA 3O6CA 3SFKA 4HNUA 3LLDA 4PA8A 2CZ5A 2GJNA 4IXHA 1G67A 5CGQA 1ZAIA 2Q8ZA 2Y7DA 3M9YA 3QMSA 1OX5A 1K03A 4XQ6A 3DZ1A 4RLIA 1KM1A 3LM7A 4LNYA 3V75A 4LRTA 2G5WA 3L66A 4BK9A 5BMXA 3W7IA 2PCQA 2QAFA 1TPVA 1X7FA 1I45A 3FYPA 1V7YA 3QSTA 4M6QA 5LNRA 1W5NA 3L5AA 1QFEA 4LRSA 3G8EA 1NVMA 5EPDA 4BR1A 2WKJA 1X1OA 3W84A 3QQ0A 4W9TA 1OFBA 2QEZA 1FWNA 4UNKA 1GYLA 1TV7A 2ABBA 1H61A 1VHCA 3UY7A 2DP3A 4GE8A 3TSBA 2QCCA 2X1RA 3PBUA 2HTMA 2H8ZA 4IMEA 1F76A 1IGSA 5F2MA 3R5EA 3MHUA 5D04C 2QCHA 4HN4A 1A53A 3O1NA 1O60A 4N9CA 3W7PA 4QIUA 5AHLA 1WQ5A 2YW3A 3PG8A 3W2NA 2ZQ0A 5DELA 3EX1A 4DF0A 1QMLA 1AMKA 2EGZA 2R91A 3F4WA 4HT3A 2FQIA 3N3MA 4JTSA 5CPOA 1FWRA 1IXNA 1YYAA 3TJXA 1VC4A 2TYSA 4X2RA 3PSVA 4UR7A 4JS3A 2GQ8A 6TIMA 3MP4A 3W83A 1R2RA 3L9CA 4RJEA 1VRDA 2DORA 3UWWA 1IXOA 1YPIA 3W88A 1RPXA 4CQAA 1RQHA 2A7PA 3CB8A 3VKJA 3OA3A 2VFDA 1DVJA 4GRSA 2HMCA 2P10A 1XM3A 3GKAA 4ONVA 2FFCA 3W1PA 4JD4A 2NXGA 3WJZA 3C3NA 2CLOA 1T99A 3KAOA 3S1UA 1W31A 2QKFA 5DXXA 1JCMP 5EY5A 3LCIA 2J9YA 3A21A 2RDTA 1H7PA 1R2SA 4Q33A 3DBPA 4XWUA 2QCEA 3PUEA 4DF1A 4IPJA 5I3KA 4K7YA 1VYSX 1K02A 2ZTJA 1GOXA 3ZR4A 1ML1A 1W0MA 4KFOA 2X1UA 5LGXA 4FEZA 1VLWA 5I3GA 2JKEA 1SZNA 3UZJA 5EMUA 3FS2A 3L5LA 5A8GA 2A6NA 2NLIA 3EX2A 3FEMA 1M5WA 1PL9A 1W54A 1Q3NA 1KFJA 3LHWA 2HSAA 2RHGA 3TIMA 1SSDA 3EKZA 4DO5A 2H90A 3NQEA 4A29A 1TRIA 4AF0A 1H5YA 2GQ9A 5LSMA 2QUTA 3W1NA 1O5KA 3W2MA 2CLEA 1K8XA 3N14A 3W3OA 3O63A 3QZEA 2WNZA 1FXPA 4O15A 1EP3A 1VZWA 4NUWA 2B7OA 4WY0F 3C6CA 2JKAA 1DKWA 4JY8A 2ZZ7A 2GVLA 3LDVA 3BW4A 1ZHAA 3NPWA 4HNNA 4JIQA 5CZ0A 4GUJA 4O11A 5AC6A 5K9CA 2WO5A 4MY8A 1RD5A 3MO7A 3NPUA 1B57A 3UPBA 1IIHA 5D2YA 3T4CA 4WUIA 3H55A 2ATMA 1GVFA 2WOQA 1W3IA 1HL2A 1YXYA 1DQWA 1OYBA 4XUGA 3UZ5A 1ZENA 3QMTA 3T44A 2E09A 1ME7A 3LI0A 3W7OA 2ALDA 5CZJA 1AK5A 3S0CA 3GXTA 2CLIA 3GX9A 4O17A 4KFPA 5GVJA 3LTPA 2C16A 3DI0A 1RQEA 4WD0A 3BLFA 1JRCA 4JTHA 2KZHA 3LCWA 3UPWA 1PCWA 5LNVA 3M16A 3WK3A 3MBDA 4GBUA 3R2GA 2A4AA 2EAWA 3R8RA 1A5BA 1LTDA 1FCVA 3FA5A 1TPB1 3S9YA 5EL1A 3S8HA 1HTIA 2V0TA 5F2GA 3M5YA 2B0MA 4MY9A 4FNUA 3TR2A 1QO5A 2TRSA 3P8JA 4QSHA 5C55A 5K7JA 4CCDA 3I65A 1GVRA 1VCGA 3UWQA 2I14A 1D9EA 1JULA 5HINA 3TC6A 1TPWA 2NX1A 1HUVA 3TJLA 1GG1A 2BWGA 2QJGA 3O15A 3LGEA 2I1OA 3RLUA 5KTLA 5DY3A 1MSSA 1N8FA 5L9FA 4MY1A 2Z6IA 3EXTA 1ME8A 4ZQOA 4GWEA 4UTTA 3W87A 3TSDA 4RXFA 1SZEA 5DXYA 3NNTA 1FCBA 3U2OA 3LHYA 1W5QA 3IIPA 4ZQPA 4BI7A 3QJAA 4PODA 1XCFA 2E68A 3N2MA 4O1BA 1FUYA 2WV8A 1OFAA 3HGSA 1HO4A 3A24A 4Z0SA 5HWMA 3NEVA 3S1VA 3W1RA 2WJZA 1OFDA 4WXYA 2X1SA 1TSIA 1ZAHA 3KXQA 4O8RA 3TNOA 4Z1CA 2QCDB 4IMFA 4MYAA 3HG3A 2HS8A 3C2FA 1WAUA 2NWRA 4RZ5A 2V5BA 4WZHA 2J27A 1XBYA 1R47A 2YSWA 1CX9A 3LCLA 2PC4A 2X30A 3VNDA 2RH9A 1FWTA 4FNQA 1SW7A 4UTTC 1GQNA 2QF7A 3I7RA 4AWSA 5A5WA 2DU2A 5AYYA 1TQXA 1MEWA 2ZRVA 3LB0A 4CNOA 4X22A 5D03A 1L6SA 2V81A 3JRKA 4X9SA 4RXGA 3E12A 1SO5A 1VQTA 3IVUA 1O95A 1AW1A 1GTEA 2VEPA 3TXVA 4AB4A 1D3HA 2AAMA 5LHEA 3GK0A 1SZFA 3QW3A 4S2BA 4UFLA 1WBJA 3NL5A 4M7SA 1TIMA 2E6FA 3M6YA 4EF8A 1I2OA 1G6CA 3H53A 3RFAA 2V8ZA 5H91A 3W7CA 4QAIA 5HWJA 2C6QA 4A2SA 3DHFA 4HSNA 1WA3A 4IX2A 3ZS4A 1O5XA 3TQKA 3PB2A 1H7WA 3HOJA 3LV6A 4EF9A 1IF2A 2TSYA 1MXSA 1NFBA 4AH7A 1EWDA 3IEBA 1KV5A 3N9SA 4IUOA 3G1DA 3W2LA 2V5LA 5KSWA 5AOUA 1FY6A 3HG4A 4C1LA 4NJHA 3P82A 2WSRA 1G4PA 2NXIA 3N73A 2A5HA 3B04A 3LCFA 3PC0A 3LTYA 1SW0A 5IBXA 1SZGA 5D30A 3VFLA 3MWAA 2O7SA 4OBTA 2WPBA 2Z0IA 1Q6RA 4AHQA 4MYXA 4OGZA 3NL2A 3S1XA 4POCA 5D32A 1TV8A 4LOCA 4DELA 3B4UA 3VCRA 3WFAA 1KBJA 1ZY9A 5F2IA 3E96A 1YDVA 5FF2A 5J5DA 1JCLA 4O4WA 4PC8A 2EHHA 4Z1BA 1BTMA 4RV8A 1YXCA 4LS0A 3W86A 4A2RA 3TE9A 1H7NA 2V30A 3PF3A 5LNSA 1LOSA 1KM2A 2G95A 5T26A 3KHJA 4N6EA 1GG0A 2PE4A 2ZFAA 1LCOA 1OHLA 5IBXC 1HO1A 2ZZ6A 3PUDA 4AVFA 2ISVA 3FOKA 3L21A 1J4EA 1OK4A 4JYEA 4B5NA 3HBLA 4DF2A 3DI1A 1L6YA 1H60A 4WJEA 5D02A 4NNCA 1U83A 2VFEA 3W6YA 2Y7FA 4FNPA 1M7PA 3FYOA 3USBA 4BFAA 2V2DA 3W7NA 3THQA 4N9EA 5K9XA 3NQGA 2J9ZA 4RCXA 4RX0A 5AHMA 1UBSA 5LNUA 1GPWA 3EX4A 3MYPA 3DFPA 1KM4A 3S5NA 3W7KA 2FPYA 1UUOA 1TPC1 3N9RA 3SECA 3BVJA 1Q45A 3G1SA 3SSJA 3KX6A 2IQTA 2A2IA 1H7XA 4DBEA 4QITA 3OVRA 2Y85A 1G7VA 1TPEA 4RZ6A 4ZQCA 4TR9A 4ZQRA 3HPZA 4LVGA 3BK0A 1Z42A 2QCMA 5K9DA 3G24A 4WY0B 3G22A 3G0UA 3C52A 3OIXA 2VXNA 3GZ3A 1QPNA 1P0NA 2ZRZA 1SW3A 2NZLA 5HUOA 1YADA 1KLZA 1YTDA 2QJIA 2E6AA 3S1WA 2ZA1A 1UUMA 3NDOA 3IV3A 3I68A 3PVFA 1SR9A 2E5DA 3TCEA 3CC1A 4HNVA 3QRHA 4CCCA 3M5ZA 3UQNA 3I6RA 3MUXA 5U4NA 3TQ0A 1KLYA 4O19A 5H2ZA 4IMGA 3QMRA 2FJKA 2Y62A 3LERA 2PRHA 1C9DA 4FHAA 3STFA 5DY2A 3RLVA 1EA0A 1GTHA 1VLIA 1AW2A 1GVQA 1W56A 3OEXA 4JIPA 3PWAA 5G2IA 5DN1A 3NZ1A 3W9ZA 3NGJA 2CWNA 3M41A 5K4ZA 4J9JA 4N6FA 1DQXA 4JR5A 1SQ7A 3NOEA 3W2UA 4K37A 3CHVA 3W1UA 4IOTA 4N4QA 3GDTA 4TU1A 4TIMA 3CM4A 3EXRA 3B05A 3G1FA 3KVJA 3MP3A 4ICNA 4TO8A 3PY2A 1TJPA 3A22A 5HWNA 3SZ8A 3W70A 2VFGA 3HJZA 1I2NA 4JDYA 4LS1A 1OFPA 2R8WA 1F74A 1UCWA 3GDMA 1FQ0A 3IGSA 1AL7A 3HO8A 4WXZA 4HPJA 4BI6A 5DCBA 4NX5A 4JTJA 3LHTA 3MHFA 3O6YX 4CQ9A 4IPIA 4AHOA 1TQJA 4BF9A 2BTMA 1J5TA 2BLEA 4BWLA 3TSMA 1DJNA 4O18A 3TFXA 4YXGA 1KTNA 3WJXA 4UFKA 2FB3A 1ME9A 3P84A 3T55A 4LVBA 2JGQA 3GR7A 4FX7A 3NL3A 1LOLA 1AG1O 4PH6A 1RQBA 3HG2A 4FXRA 4ORIA 5D37A 1G69A 4XBKA 5D33A 1LBLA 3P81A 2VOMA 3B0PA 3KOFA 4JX4A 5CPMA 1SU5A 3A5VA 4NU7A 4MZ8A 2ZZ3A 3PS7A 2FB2A 5K2ZA 3LBCA 5BRBA 4BWLC 1XKYA 4L4LA 8TIMA 5FF0A 4P2VA 1K7FA 3QQ1A 1YTEA 4MPQA 3TC7A 1ALDA 2WQPA 1SPQA 4UMBA 5D2XA 3BGGA 4GFSA 1PIIA 3HMJG 4TMCA 2DJXA 1TPFA 3LV5A 2WNQA 4WOZA 3STGA 1R30A 2Y63A 1QOQA 1PS9A 4AXKA 2H6RA 3P74A 4H4IA 1F2JA 5DLCA 3UYCA 3NQFA 4QM1A 4JXCA 3EWXA 1NF7A 1ONRA 4XKYB 1GT8A 3Q2DA 1SFJA 1NEYA 4YLWA 4UTWA 1PV8A 3ABQA 3PR2A 3QH2A 3W23A 3VE7A 4MFDA 3P7YA 4A22A 1KFCA 4JTFA 4I7UA 2FLIA 4EOUA 3KVLA 3W7QA 3M47A 4I7WA 3TROA 3GR8A 1JUKA 1VGAA 3C61A 3A5FA 3LBMA 3A23A 5E93A 2R94A 2YFNA 5DBTA 4MUZA 1F7BA 4JYFA 4UFIA 4UTUA 1NSJA 2GQAA 5HUPA 3DAQA 2F7FA 3L65A 3KRZA 4UMCA 1AL8A 2LLEA 4O1CA 5HNRA 1OX6A 2EPHA 4UFJA 1XC4A 3W73A 2E6YA 1G4TA 1RR2A 1FCQA 3SJ3A 5SWUA 4UTWC 4M19A 3EX6A 5FF4A 1OVDA 3CIWA 1KBIA 3S5OA 2V9DA 3DXIA 1SO4A 4MJZA 4GJ1A 3W74A 1OABA 3KVKA 2CU0A 1GJPA 3W1TA 3M0ZA 2Y6ZA 3F1QA 4Y9AA 3ZWTA 1SFLA 1I8JA 3M7WA 5CZSA 4UTIA 3RMJA 3B03A 2GVJA 2ATSA 4UCGA 1GVSA 1Y0EA 1OX4B 5U7SA 4HSOA 1FWWA 2R14A 5DCDA 2D73A 1H7OA 3C2EA 2DZVA 4NJIA 4LS2A 3NAVA 2P1FA 3GNDA 1GVOA 2Q3RA 1ZJIA 3LI1A 3C2VA 4PTNA 1UB3A 5AYXA 2Y88A 3W7HA 2YYTA 3W76A 4A3UA 1N55A 4PL2A 5F4XA 2XN2A 2GUUA 4MZ1A 1H51A 3P60A 4NJKA 3EWYA 4OQVA 1F05A 4E0CA 3NR0A 2J88A 4GUIA 3OVPA 4UTJA 2QCLA 3G0XA 2QCNA 1WBHA 4Z1DA 3PSWA 4M6VA 4OV9A 5AHIA 1DJQA 3SI9A 4CNNA 1ZAJA 4CNPA 1K7XA 4AEOA 1GEQA 1KV8A 1JR1A 1TREA 3DFTA 1LP6A 1DOSA 2ZA3A 4EWND 4NJJA 3PBWA 4FO4A 1LRNA 4Y96A 1P0KA 4M7TA 3BLEA 4JICA 4AHPA 2RDWA 5D38A 4Z1AA 3B0VC 5BNKA 2FTPA 4NZJA 1QPRA 3STEA 3B0UX 3TDFA 1TPDA 3DGRA 1OFEA 3D0CA 5F4SA 4O0ZA 1OF6A 5G1YA 2OZ0A 1L6WA 4GNJA 3IIZA 4FNTA 4KKXA 4O28A 4RKAA 1W5PA 4IJBA 3TAOA 3GDRA 4FNSA 4KWVA 4H3DA 2O7QA 4OU1A 3SR7A 1FDYA 1SO6A 2DZSA 4GUHA 3P61A 3P8IA 2BZNA 1VYRA 1JUEA 4ZVJA 2YCEA 3O8AA 2VEIA 4LVDA 2C0AA 2ABAA 1VR6A 1KFLA 1F5ZA 5KITA 2ISWA 3LXCA 4AAJA 3LRKA 3W22A 1S3HA 3CWNA 1A50A 2BSLA 5MHBA 1VCVA 3LTSA 5D2VA 1EB3A 2DZTA 2J9XA 4ADTA 1PHQA 1WX0A 4R33A 3PB0A 3ZFHA 1W3NA 4GC4A 4Z0JA 3OG3A 5C5YA 1KFBA 1T8XA 3F4NA 4OHQA 3W7GA 1ICSA 1KM5A 3UWUA 3R89A 3S6DA 3O16A 2FPVA 3ABSA 1ICPA 3MI3A 4JTEA 4UNLA 3W07A 2H8XA 4E2BA 2ZZ2A 4HHPA 2QUUA 4DPQA 2VEKA 2QR6A 1FDJA 1A5AA 4QISA 4MVAA 1DL3A 4O10A 4NXSA 2NUXA 4GUFA 2A0NA 3EX3A 2VKZG 3G1HA 5TIMA 5EBUA 1JVNA 1B4KA 3PUOA 1KTBA 4Z08A 3P5ZA 2X16A 3DFNA 3OVQA 1JCJA 1AW5A 2PRMA 3NPVA 3E9AA 4M5PA 4TX9A 5K3VA 4QJ1A 5LZLA 1BWLA 3AO0A 3LHUA 5G4EA 2NXHA 4MJMA 3NM3A 3BLIA 5LGZA 1IXPA 3HG5A 4JTUA 1XDMA 3TV8A 4K39A 3W1MA 3DU0A 3ATYA 4N9BA 3DHDA 3LOTA 1YTKA 2C13A 2Z1BA 2V2CA 3SGUA 4K6AA 1LBMA 1XI3A 2QCDA 1LM1A 5FI8A 5KZEA 2B7PA 3M43A 2JBMA 2DZWA 4MKNA 2BX7A 5CSSA 3T78A 3L5MA 3WJWA 1JCYA 2V82A 4PL1A 3RNDA 2CLHA 1DHPA 4OWGA 3AJXA 2B7QA 2ZRUA 5ABTA 2Q3OA 3DFQA 2ZA2A 5AHEA 2E1DA 5BOOA 1QCWA 2J24A 2ZTKA 4UXDA 3W7LA 4H6KA 3GNNA 4G1KA 1LBFA 3NXFA 2XN1A 5TQLA 4IMDA 4R53A 5LHFA 3G1YA 1UASA 4U4MA 1TYGA 1GZGA 4NJGA 5AB3A 1N7KA 1NF0A 4LUIA 4GUGA 2GJLA 4IWWA 1MO0A 1H63A 2CLFA 3NPXA 1KTCA 1VHNA 1YXDA 3TMQA 3LHVA 1YLVA 3M5XA 1BKSA 5AFDA 1ZFJA 2OT0A 2H3BA 4FXSA 2RDUA 1JQVA 4DBDA 1TB3A 3GDLA 4UMAA 1RZMA 5AYZA 1T96A 3DENA 4Y90A 4L4MA 5KMYA 1KFEA 4JN6A 3E0IA 3FLUA 1L9WA 2YPIA 3INPA 3L67A 1H62A 1X1ZA 4P61A 4MLRA 3V1PA 4DPPA 4UTKA 4LY8A 4ZL1A 2VEMA 3CLMA 3KVMA 1KM6A 1LORA 2OT1A 4JX6A 2NUWA 4RR4A 3CT7A 1O94A 2AGKA 3NVTA 1H1ZA 5CSRA 2CLKA 1QWGA 3BV4A 1OYCA 2RFGA 3NQAA 1Z48A 2NX9A 5LNWA 3CEPA 3N34A 3M5VA 4JEQA 3ATZA 4NNAA 3LCGA 2Y61A 1THFD 3LCXA 3M44A 4QQ3A 2A7NA 2CFFA 2XN0A 2JK2A 5E1QA 3QF0A 1RV8A 1W37A 1TTQA 1H1YA 1SSGA 2E77A 1C29A 3G0SA 3W7RA 3NQ7A 4R7JA 4LVFA 1LRTA 3GDKA 4ZQMA 1G4EA 1T0OA 4FB7A 3LX9A 3IVSA 4IQLA 1Q6QA 2YX0A 3MI2A 3L0KA 4XTDA 4JX5A 3NO5A 5J5RA 3G3DA 3FKKA 3IIXA 4AWTA 1F6PA 5D2TA 3WK1A 3G1VA 2P0OA 1BWKA 3W75A 4HKPA 1JJKA 4R34A 3BPWA 4WOQA 2YW4A 2ZZ1A 3E02A 1TTIA 1WDWA 3CTLA 5K4XA 1ZCOA 1VYPX 3BG9A 1JUBA 1O4UA 4YCPA 1JRBA 1CW2A 3ABRA 4LC8A 4QNEA 2EF9A 3EB2A 5IM51 3WK0A 4LTSA 3GXPA 1TRDA 4KWWA 1ZALA 3ANYA 1KFKA 3I7QA 1QR7A 4O12A 3EWBX 1QPQA 3CU2A 2C15A 2VC6A 1KM0A 3R12A 1LLZA 2QAPA 1LROA 1FDZA 2HS6A 4JNMA 1Q6LA 4LV9A 2ZZ4A 4WY0A 5KZMA 3NQDA 1V5XA 3WK2A 1WXJA 5F1UA 3C2OA 3UWVA 3IGXA 1EPXA 4Y6GA 3QYQA 4AF0B 3EKLA 3TK7A 1DV7A 5I3JA 5I3HA 4CLMA 2QCFA 3IVTA 3C8FA 3TUUA 1EEPA 1QNVA 2CZFA 2DZUA 2EKCA 2FPTA 3B06A 4E38A 4HIBA 1TPH1 3O06A 4UIOA 1K7EA 3QC3A 4YMZA 2A21A 3CEUA 4ADSA 4I9AA 4XZ9A 1C8VA 1NAL1 1BEUA 5TBOA 1SUXA 3TFCA 4IMCA 3W71A 3N2XA 1XL9A 1ICQA 1TTPA 3KFTA 4XBSA 3L2IA 5FEWA 3RK8A 2A1YA 3UWYA 3BG5A 1WOBA 1E51A 3ELFA 3QSRA 4ORMA 2YR1A 3GYEA 2CLMA 1W3TA 3PBVA 4OE7A 3PG9A 3JR2A 3MYOA 4N9DA 3TX9A 1XFBA 3EWUA 3O05A 1PCKA 1R46A 3KRSA 4ZQNA 1OFRA 1Q6OA 4N2YA 5AHNA 1OG0A 3HIJA 4JTLA 3RF9A 3W1QA 2ZYFA 2RKXA 5KZDA 3QEZA 2BXVA 1K3UA 2DJLA 2YYUA 2AQWA 4MFEA 3W2KA 3G3MA 4JTGA 2E6DA 1D3GA 3A9IA 3GIYA 4NNBA 1VH7A 2TPSA 4MIMA 3MBFA 4DQWA 4Y8FA 2X1TA 5DCEA 1VJIA 2WSQA 5EYWA 4O1AA 1B9BA 3GAYA 1P4CA 3NZRA 3C2RA 1U5JA 1GYNA 2GOUA 5AHFA 4FNRA 5KINA 5F4WA 2W6RA 4NXKA 5L6UA 4JTKA 1H50A 3TKFA 1VCFA 1JQXA 1QDSA 1S5TA 3BO9A 3FFSA 4O16A 5FEXA 3L68A 3P80A 3P5YA 2PRLA 3U6WA 1KW1A 2JGYA 5E0KA 2Y70A 4JTTA 1OF8A 4LT9A 5DBUA 5FF3A 1QOPA 3G1AA 1QO2A 3HB9A 4O53A 2QCGA 1W5MA 5C6MA 3ABOA 2TMDA 3G1XA 1XDLA 4MLJA 3THAA 3IIVA 3CQ0A 3PBYA 4WQ6A 1YPFA 5HQEA 3W7EA 4HNTA 4NT0A 3QW4B 5BMWA 1IXQA 4FX6M 2ZBTA 1LDCA 5CKSA 4ZZ9A 5BW6A 3MMTA 5F1VA 4CCEA 4YCOA 1ZNNA 2YXGA 2F84A 1P1XA 1HFBA 3UXDA 3TA6A 4LUJA 2X2GA 5HULA 4UR8A 1OK6A 2ZCGA 3N19B 5I3IA 1FCUA 1DORA 1EUAA 3OBKA 3EEGA 2ZDRA 1B3OA 5G2HA 4TMBA 3R13A 1CI1A 5FESA 2H3DA 3UWZA 1MZHA 3GLCA 3BW2A 3CWOX 1TCDA 1UJPA 3JS3A 3P67A 4O57A 4UC5A 1W5OA 4IXXA 4QNWA 5D2WA 5CG7A 1MEIA 3LRMA 1SO3A 3UXAA 1X8FA 3M1ZA 2C19A 4EVZA 2ZZ5A 3QFEA 2YGYA 4EIVA 3YPIA
chains in the Genus database with same CATH superfamily
4NSBA 3N15A 1BKHA 1I2PA 1HF6A 1XBZA 2BB0A 2J8TA 4XKYA 1O5QA 5AN7A 4O4VA 2G97A 2YZ5A 2CHRA 5MKGB 1G5AA 3T8QA 1IGWA 2QULA 2CHOA 1GW9A 2PWFA 1Q7QA 1VEPA 1QU4A 3QBUA 3CS2A 3NXLA 1FHLA 2ACQA 4LAUA 5PTDA 4XD4A 2A3CA 1TELA 3UY8A 2JKPA 3OQ8A 4K7VA 3SY5A 4Y9PA 3SGZA 1JPHA 2FDSA 3ZO9A 1JYWA 4CU6A 5FF7A 5D09A 1E1FA 2GWGA 4CQ8A 1WYIA 2OCZA 3CV7A 3IUHA 4O52A 3G77A 2QJHA 4MGGA 4XZBA 3ZWSA 1KM3A 4UUIA 5AC7A 3RIKA 5EMJA 2QPSA 1JPDX 1K8ZA 4WR3A 3W7MA 3WQ5A 4YTUA 3CUZA 4QTGA 2L5HA 3J7HA 3HU7A 3L2LA 3VD3A 3F7JA 2DY3A 3HN3A 3MI6A 5AC8A 1ZLPA 4K8HA 1KC7A 2WKGA 1F3TA 4JL2A 3Q58A 4KEUA 3W53A 2DIEA 3W2JA 3O6DA 1FWSA 3RX3A 4PMRA 3SCPA 2J7FA 3AU2A 2AL2B 1JD7A 1JPIA 4XAPA 1NWRA 4G56A 1R2TA 4IM4A 4D6IA 1W6TA 3W1AA 3U3HA 3C4UA 4FPSA 4QLKA 5BRPA 2XSBA 3QQWA 1JCNA 4XUYA 3NGFA 3UERA 4QROA 2E5BA 4LEFA 2C18A 1XXXA 4LU0A 4INFA 3G8RA 1RA5A 2PDCA 4UTHA 2CZEA 3ARTA 1TKKA 3TWBA 4DLMA 3GVVA 2VFFA 1A5SA 1DYSA 3BQ6A 1PZ0A 1BFNA 2FVKA 1OYAA 5AECA 1UC5A 5C2XA 5HMDA 1UWQA 2VFIA 1YEYA 3EDEA 3N04A 1HZYA 1DE5A 3M0YA 4M3PA 3NM1A 4OBSA 4R9OA 4B5VA 1RUSA 1R9YA 3ISIX 4PCFA 1HJWA 4OOUA 3OBEA 4LF2A 4X61A 1S3TC 3B8WA 2DZXA 2BDQA 2HDJA 4XTIA 4H6QA 4PRRA 3GZAA 3TW6A 3DFOA 5EMLA 3HGOA 2FTYA 3LLFA 1WDDA 3W1LA 1D8CA 1ZUAX 3NDZA 4CU7A 3WNMA 3GC2A 3PZ9A 3C2YA 4MAVA 3CUXA 2OU4A 3CUGA 3KBSA 2RGMA 3S5YA 1FHUA 1LRQA 2XDFA 4NQ1A 1WV2A 4ROPA 4MMWA 1V93A 2PDJA 3KOYA 4NP7A 4NX0A 4AMAA 1IQ8A 1X98A 3B8IA 1L0PA 2NV1A 5CPNA 4XIAA 3FJ6A 3VTRA 2BP1A 5D9OA 3E49A 3VE9A 2W3ZA 2HK1A 1EP2A 1HX0A 2CW6A 1F6KA 3RPMA 3TCSA 4MOZA 4CD6A 3FN9A 3S9IA 3REQB 4L65A 4NG3A 2Q71A 3IK2A 2PP1A 4BS0A 3L0NA 4JHOA 4Q4SA 1E3XA 2WZEA 2REQB 4F2BA 3TQVA 1I4NA 2G4FA 2PDWA 4J7RA 3IRDA 4UQAA 1H11A 1FXQA 4DEFA 3RX4A 4GI4A 3LPOA 2WVTA 2Y7EA 3GNPA 4FF7A 2PDPA 4WX2A 1DJWA 2UV8G 5G5IA 3QY8A 1C8QA 4CEXC 2H9AB 2YL5A 4ZXOA 1EL3A 1Z89A 1ADOA 3ZT7A 2NV2A 4NHVA 2JFEX 3UNDA 1UWSA 1XKJA 6ALDA 1XSJA 4UTFA 2PTYA 4GNVA 2OODA 3SCNA 3GTFA 1UKTA 4W5UA 1J2WA 2V5CA 4TUFA 3P3BA 1JYVA 1IWBA 3QV9A 3DKLA 1IZJA 1S5WA 4M6PA 3KOXA 1E73M 3UGVA 3M0JA 4W8BA 1TX0A 4Q32A 2CEQA 2QT3A 5FJIA 3BMVA 1PKYA 4IL2A 1RVKA 3RCYA 1KBKA 2CZ5A 3JZEA 5CGQA 2Q8ZA 1S2UA 3QMSA 1QNPA 1GOWA 1K03A 3DZ1A 4JPGA 2EPKX 3V75A 1UH2A 2G5WA 3L66A 4ZE5A 1M41A 2AAAA 2QAFA 1TPVA 3BZGA 4I8DA 2OSYA 3GC5A 3H2NA 3T0TA 5LNRA 2QPXA 3KWXA 4ATWA 4HP5A 1QFEA 1NVMA 4Y9MA 1EC9A 5B7ZA 3L4VA 3ZZ1A 1KCLA 4W9TA 1OFBA 3R0UA 4R7OA 2Y1HA 1GYLA 4ZGYA 1TV2A 2ABBA 5JIPA 1PXGA 5C70A 3PBUA 5DF0A 2EPNA 2O55A 4GINA 5D04C 1JAEA 3AAMA 2QCHA 1A53A 4N9CA 1O60A 3SUUA 4QIUA 1WQ5A 2XVGA 5DELA 4XZNX 3WNLA 2EGZA 1FH8A 2F2HA 1FWEC 4DAFA 5CPOA 4O1EA 4ICMA 1YYAA 4X2RA 3KLKA 4IFKA 3WQOA 1S38A 2AKMA 2WAGA 1W1TA 3DBNA 4QLLA 1R2RA 4MDPA 4MB1A 2GL5A 4RJEA 3HMCA 1RQHA 1ADDA 4FALA 1PDZA 4WDWA 4D8LA 3WDIA 8CGTA 3VD4A 5CXPA 2P10A 4LGXA 1CLVA 1BQGA 2D69A 4MF4A 3G5EA 5J04A 4H19A 5DXXA 3K5XA 3UJRA 3A21A 4W7WA 1UD3A 1VJZA 3PUEA 1HQTA 2Z1SA 2CNCA 3L2MA 4IPJA 5I3KA 1VYSX 5J8LA 3TJ4A 2DUZA 5DRCA 1ML1A 1W0MA 3PPGA 4KFOA 6REQA 4FEZA 5LGXA 5I3GA 2JKEA 1SZNA 1UOKA 4D9PA 4PR4A 5A8GA 4TXEA 3WNPA 3WG6A 1C7TA 1MW3A 1KFJA 4MHBA 2DH3A 3EPNA 3WBYA 4J3WA 1E9YB 4AF0A 1H5YA 2GQ9A 4DRSA 1IWPA 4GKTA 2WC7A 1UR3M 2VZSA 2Z24A 1EJSC 4AD2A 3SQLA 1UC4A 5E0CA 3WUBA 1E0XA 1W1PA 1HKWA 1AZ1A 1OG6A 2P0IA 3O63A 3QZEA 3MQTA 4O15A 3L4ZA 1VZWA 4NUWA 4M81A 3RO8A 4GA8A 1DKWA 4JY8A 2GVLA 4GUJA 4E4UA 3PTDA 2OZTA 4YWSA 1YHTA 3WSUA 4CVWA 4HU4A 4W86A 1J0ZA 2CWXA 3UPBA 1IIHA 3T4CA 1LL7A 3OYXA 2CZVA 1W3IA 2VZTA 2VR4A 1DQWA 2P3ZA 4XUGA 3T44A 3DC8A 3LI0A 2PCEA 2ALDA 5CZJA 4QEEA 2J7EA 4KFPA 3VDBA 3LTPA 4OJYA 4QG8A 3CXOA 1XFCA 1M53A 1RQEA 4BEQA 3BLFA 1JRCA 4JTHA 1WE5A 1B3ZA 4DJFD 3WK3A 5LNVA 2BG5A 1XG3A 2EAWA 2A79A 1BF6A 2Z1WA 3GR4A 1NWUA 2IKHA 1TPB1 4XAZA 3S8HA 1HTIA 2YB1A 3M5YA 1KRCC 4A8RA 3TR2A 2TRSA 4HA3A 3B97A 7TAAA 3WLTA 5K7JA 2WMJA 3VD7A 1GVRA 3W01A 2I14A 3NTYA 2V68A 1WZMA 3TN6A 2BWGA 3VIGA 3OGVA 3M6DA 5TF0A 1DWAM 1EXBA 1UWUA 1U2YA 1WUFA 4KCWA 2FVLA 1Q13A 1TE1A 4ZQOA 4UTTA 5A8MA 3GG7A 3VDAA 5BU9A 2C79A 1FCBA 1UKOA 5HMFA 4ZQPA 4BI7A 3QJAA 1XCFA 1JGIA 3GXFA 2FGZA 3HGSA 1HO4A 1LQ0A 3A24A 4HNOA 4JFWA 2CC0A 2WJZA 1ZAHA 2P3EA 3EMCA 2GK1A 1WAUA 1FWBC 4HA1A 4QQUA 4C6PA 2NQHA 4EAYA 4WZHA 1TMLA 2J27A 4ZOEA 1CX9A 3WL1A 2F6UA 4UZSA 5M17A 2QF7A 4AWSA 3N13A 4AEFA 1AJ2A 3BE7A 3CYVA 2HCVA 1BYCA 1TIWA 4GCXA 4Z2LA 5BU6A 4CD5A 2EG6A 3RRXA 2HVNA 1SO5A 1TR1A 2P5NA 1AW1A 1D7KA 1P48A 1UA3A 1Q85A 2PWUA 4AB4A 5LHEA 2J7HA 3WLQA 4UFLA 1ECEA 2E6FA 4CN6A 2CBVA 4AD5A 1A5OC 1I2OA 3H53A 2DV0A 1KRBC 3IARA 5HWJA 3AZRA 3AIEA 4A2SA 3QGVA 4NF7A 1V6VA 1WA3A 2C8NA 1OSEA 1V0MA 3HOJA 1JPMA 3DOPA 1IF2A 2TSYA 3IJ7A 1MXSA 1NFBA 2BXYA 1EWDA 3GNRA 1KV5A 4B3ZA 3N9SA 2HWGA 2XIJA 2V5LA 3V0TA 3ZVHB 3P82A 1Q6GA 1G4PA 4BHYA 3LCFA 5IBXA 2O7SA 4OBTA 2R1NA 2WPBA 3NURA 1Q6RA 3EMZA 4JQ4A 1S1RA 4MYXA 4E6MA 4V1YA 5D32A 4HK7A 4LOCA 2UWFA 3VKKA 3B4UA 3B9NA 5BXSA 4H9XA 4MAZA 5FF2A 4O4WA 1BXNA 2PDBA 2EHHA 3A9BA 1NU5A 4Z1BA 4GFIA 5CLTA 1BTMA 4KRTA 1AH4A 1CENA 4LS0A 3SURA 3VKAA 4A2RA 4EKJA 3L4WA 1DJIA 4Q4PA 2J66A 3KHJA 1YMYA 4N6EA 4Q4OA 1NARA 1YE6A 2PE4A 1XCXA 1JIBA 4C6DA 1VF8A 3CNYA 2ISVA 2Y4SA 1M04A 3B9EA 1UYQA 3K2GA 4ZODA 2VCAA 3CAVA 4DYJA 3ZT6A 5FIPA 1QT1A 1R3WA 2VD9A 3IANA 4OUEA 3S2MA 4DF2A 1UKPA 3H23A 1L6YA 1H60A 2OWXA 3IACA 4ASTA 2V2DA 2VC5A 3EA1A 3B0YA 1XCWA 4DJFA 4RX0A 3LNMA 1UBSA 4AMCA 9XIMA 1M9HA 1Q65A 2RGLA 2GUBA 3W7KA 3BJFA 4JCLA 1TPC1 4JL1A 1X1NA 1PKMA 3G1SA 4RE3A 1FWIC 4QITA 3OVRA 1UD5A 1RP8A 1XIMA 1R3VA 3CL7A 2Y5SA 2PS2A 3L4YA 4TX6A 3VFCA 1B1YA 4NAEA 3TTOA 4WY0B 3T42A 3C52A 3EKGA 2Y5JA 4E2VA 1SW3A 4E8CA 4YPJA 1KLZA 2E6AA 3G6LA 3PZIA 1W1A1 3GHSA 3MVTA 3KBVA 4HU0A 1BYBA 3V16A 1W9DM 3TCEA 3CC1A 3QRHA 5D8ZA 1UH3A 3S2CA 1JEZA 1KLYA 2BY2A 2DH2A 4DUVA 4CCZA 1B0IA 4L80A 1PTDA 4GI8A 3QMRA 4LCRA 6CGTA 4KF1A 3N2CA 1TWZA 4JNZA 1Z3NA 1GTHA 1VLIA 1WNOA 4RV3A 1Y5XA 3W9ZA 4LF1A 3AHZA 2CWNA 2OLHA 3ITLA 3E0WA 5K4ZA 1UPMB 3K1GA 4JR5A 3W2UA 1YBQB 4IOTA 3BANA 4N4QA 4L9XA 3N3TA 3CL8A 3OOQA 3UCDA 3QV6A 3G1FA 1BXCA 3MP3A 4ICNA 4TO8A 1Q66A 1EC8A 4MWAB 3GDBA 3W70A 2VFGA 1I2NA 3NJ3A 1OFPA 2R8WA 1HN1A 1F6YA 1UCWA 1FQ0A 4PMYA 3RR1A 3MHFA 3ZR5A 4G9PA 1TQJA 1R3YA 5KETA 1GORA 4KBXA 3OHMB 3MKKA 2IQDA 3PPCA 4YXGA 1JCTA 3BDKA 3KL0A 1ZB5A 4C6JA 1XISA 3EWDA 1K6AA 3OZMA 5I24A 4L4OA 3HG2A 4PTWA 4FXRA 1JYNA 3CBWA 1G69A 2C1IA 1US2A 3I3EA 2PDQA 2VOMA 4GNKB 4KH2A 1JZ8A 4TOQA 5CPMA 1SU5A 3LGDA 4V33A 1UBPC 4NU7A 3BSGA 4XD5A 3KE0A 3LBCA 1B3XA 3PBGA 8TIMA 3DFYA 4A4AA 4WJ8A 1ALDA 2WQPA 1NELA 1XRVA 3VU2A 1GGOA 1AFSA 4TMCA 3PFRA 4S39A 3VOIA 3STGA 1V77A 2J8GA 4B5TA 1PS9A 4AZ7A 4AXKA 4XD6A 5IFTA 5KZ6A 3KCLA 1F2JA 3SRHA 4QM1A 1ONRA 4XKYB 1GT8A 3Q2DA 1SFJA 3N17A 4YLWA 3B8TA 4UTWA 1FTXA 4IIBA 1A49A 1E56A 2OQLA 4J3ZA 3UCCA 4F0SA 1T7LA 2BVYA 3OJGA 4JTFA 1IEQA 1DXIA 3W7QA 2PDYA 2PDGA 3GR8A 4UWMA 1J0IA 2YCLA 3A5FA 1RALA 1NH6A 3A23A 3HJEA 2INEA 4CEUC 1LG2A 5E93A 1T6MA 3ITTA 4QG6A 1ZJAA 3L65A 4GK8A 3TQPA 1OX6A 2DT2A 1EC7A 1RR2A 4GMEA 4Q8VA 4M19A 2Q01A 2RAGA 4FP1A 1KBIA 3S5OA 1ISXA 1SO4A 4GJ1A 3W74A 1OABA 2CXEA 3KVKA 2VO5A 3W1TA 4NAFA 4TQTA 1I8JA 5CZSA 1JD9A 1QI3A 1GEHA 2P88A 3GG1A 1ZCCA 3NSXA 1FWWA 2R14A 5I06A 2D73A 1A0DA 2WMIA 1A3XA 4NJIA 4EXBA 9RUBA 3NAVA 4DWSB 5CLWA 5CGMA 1GVOA 2Q3RA 1UB3A 2Y88A 3W7HA 2YYTA 3JUGA 3WMCA 1W3LA 2HPMA 1W9UA 4E0CA 3NR0A 3CV2A 3OVPA 3RDKA 4B5UA 1H41A 4OFCA 4Z1DA 3PSWA 4M6VA 5AHIA 4MUPA 4CNNA 2WZHA 1RBOB 4CNPA 4WJXA 4TVCA 2Z26A 1TREA 1LP6A 5I00A 3SQMA 1LRNA 1FVPA 1P0KA 4L4PA 2BFGA 4M7TA 3S47A 3AU6A 3BLEA 2RDWA 5D38A 3B0VC 3RILA 4NZJA 4HBKA 5HNTA 5A69A 1TPDA 3PWGA 2BS9A 5F4SA 4O0ZA 2I56A 3OTRA 4D8ZA 4LUTA 2OKOA 4GQGA 4FNTA 4KKXA 3ID7A 1XIIA 3T08A 4H3DA 1BPLB 1ENUA 3GTNA 1NP2A 3SR7A 1FDYA 2IKJA 2YKKA 1Q2SA 3O0FA 3ZIZA 1SO6A 3KLLA 1OD0A 2YLLA 3ITCA 2BZNA 1ZBVA 1VYRA 4ZVJA 4GX8A 4LVDA 2C0AA 7CGTA 2AL1A 2VYOA 1F5ZA 5KITA 1O68A 2ISWA 3LXCA 3LRKA 2E9LA 1XLBA 2FZDA 1FHVA 3MUZ1 1CDGA 4DUXA 3KHDA 2PMQA 2Q09A 3T09A 4QX4A 2DZTA 1GK8A 1I1XA 2Z2AA 4DO7A 1PHQA 1L8PA 1GOQA 1ADSA 1Z69A 1W3NA 4GC4A 4R85A 5C5YA 5FAJA 2XM2A 3F4NA 4KETA 1ICSA 3WD1A 4F2UA 3R89A 3QLDA 2D0HA 4C7FA 2NVAA 3ABSA 4HJWA 4BY3A 3T05A 2G3IA 3W07A 2H8XA 4PTDA 1DPMA 2ZZ2A 3IJ9A 4HHPA 3WUGA 3ZVIA 3TYEA 2JF6A 4DPQA 2QR6A 1FDJA 2PODA 4QISA 4AX6A 3FA4A 1B2YA 3EX3A 3G1HA 5EBUA 3TP4A 1JVNA 4H8UA 1KTBA 4GG9A 2WQDA 1CIUA 2ZIDA 4MADA 4TX9A 4DAIA 5K3VA 4QJ1A 1ZJHA 3S1GA 3QR3A 3LHUA 5G4EA 2F2KA 3KCOA 3NM3A 3BLIA 3CV6A 4GYPC 3WLSA 3DG6A 4OTKA 4F79A 5FACA 1W1VA 3P2VA 3LM3A 4U5IA 4N9BA 3LPFA 3QLLA 3SUVA 4EX4A 3ARVA 1LBMA 1V3JA 4IF2A 3TWAA 1XR2A 2Z7GA 1LM1A 1SYTA 1PIGA 2B7PA 3WENA 2DZWA 2WLZA 4MKNA 2BX7A 4H8NA 3ALFA 3CTTA 2IMRA 2V82A 1QNSA 1I6NA 1W9VA 9CGTA 4PBGA 4QG9A 3BOXA 1CGWA 1W9PA 4PMJA 2FGBA 1Y5WA 2QDEA 2DSKA 2OGJA 1LBFA 1Q4WA 4JKKA 3E6EA 4R53A 1TYGA 2YBUA 4NJGA 1FWDC 5AB3A 3KBMA 2PPGA 1S5MA 3FSUA 2IXVA 2VUYA 3AWOA 4HSHA 3HFYA 1ZBWA 5FOOA 2WXDM 4R3UA 4C6QA 2OOGA 2QGHA 1YLVA 1B5TA 1FKWA 1I75A 1ZFJA 4S3DA 2OX4A 4GJIA 5I3DA 1JQVA 1GKQA 3GDLA 1RZMA 5AYZA 3DENA 1RD6A 3COTA 4JN6A 1QBAA 1VIZA 4A8NA 2EEXA 1XH1A 2ZUUA 1V6XA 3U2EA 4P8VA 1H62A 1F4AA 4JFUA 4MLRA 4UTKA 1TV4A 5JBDA 5CPSA 2I5QA 4KERA 1O94A 4ACYA 1XLDA 4JFSA 1QWGA 3WKZA 3V4BA 2VX4A 3LQLA 4F0LA 4UOJA 1Z48A 3N34A 4I8YA 3M5VA 4JEQA 3VGDA 4UB9A 2BNJA 1THFD 2A7NA 1F8IA 4H9ZA 2JK2A 3ITVA 3AXMA 4IFKB 4AZ5A 1GVEA 4RPQA 2ODOA 2E77A 1E9IA 3JVAA 3EYPA 4A8LA 4PCPA 4FB7A 1DEDA 4IQLA 2YX0A 3MI2A 4XTDA 3BV7A 1JDDA 3NO5A 1DJHA 4DZ5A 3FKKA 3WK1A 2P0OA 1JJKA 4R34A 3ZXWA 2YW4A 2PGFA 1R7AA 3BG9A 1JUBA 4YCPA 3ARPA 4QNEA 3MCMA 3HZ3A 3EB2A 4BF7A 4IIDA 2IPWA 3GXPA 3I3BA 4NYUA 1F8MA 4C1NA 3CHEA 3B0XA 1ZALA 2EO7A 1SJAA 3I7QA 1YPXA 2WJDA 2C15A 2VC6A 4CNUA 1M68A 1FDZA 2HS6A 4JNMA 5KZMA 2C71A 2PBGA 2PDKA 5F1UA 4L61A 2XINA 3IGXA 4UOZA 4AF0B 2BBFA 4Q7IA 4TTGA 4L1GA 3WMSA 3IVTA 3C8FA 2XWDA 5GJMA 2EKCA 2FPTA 1TPH1 4JKMA 4UIOA 1UP0A 4DJEC 1EBHA 2OO0A 3CEUA 2ZADA 4J1OA 4XZ9A 3EZ4A 1SUXA 3UJSA 3IAQA 3N2XA 2R24A 2W91A 3KFTA 4NASA 4XBSA 3OBAA 2A1YA 1E4MM 2XGBA 3MSRA 1WOBA 1E51A 3CIVA 3QSRA 4CQCA 3PNUA 3GYEA 2CLMA 2AMGA 3H2AA 1DJGA 3AMGA 3PG9A 1REQA 3FV9A 1WAWA 3O2LA 2VT0A 4ZQNA 1OFRA 1YKWA 5IXEA 3HIJA 3WD3A 1VFSA 2ZYFA 1YNYA 5E70A 2R1PA 3KWSA 4MFEA 2FZBA 1D3GA 3GIYA 2VGIA 2W4XA 3VCCA 5E9XA 4YYFA 4MIMA 4W4QA 5G4HC 2D3NA 3MBFA 6XIAA 1B9BA 4DN1A 5AHFA 4FNRA 5F4WA 3HA1A 2W6RA 4NXKA 1AODA 4B5SA 2ZWZA 1A0EA 1QDSA 2OKTA 3QTPA 2PDIA 1V3IA 3M46A 2G3MA 3P5YA 2O4QA 3U6WA 1KW1A 1E71M 3AZSA 4ZSTA 5A95A 2ZXDA 2VZVA 5C6MA 3ABOA 1RLCL 4MLJA 3IIVA 2GDUA 4WQ6A 4HNTA 2ON3A 2GWNA 5BMWA 3WLKX 3DG3A 4ILSA 1EO5A 1LDCA 3KZSA 3MMTA 5F1VA 4YCOA 1ZNNA 4GBDA 3GNXA 2Y8VA 1XLHA 2F84A 1P1XA 4GO8A 3CHDA 4C60A 1YX1A 5ABEA 3KTSA 1V7AA 4UR8A 3VMNA 1YDYA 1FCUA 3H70A 1XLKA 2O4MA 2WMHA 2ZDRA 1B3OA 2VQUA 5FCZA 1T41A 5FESA 5JBFA 3GLCA 1DWFM 4MB5A 4O57A 3GIPA 4QNWA 5MF5A 2D2OA 3VO0A 4AX7A 1SO3A 4B9ZA 1X8FA 1FFRA 2IXUA 3M1ZA 2ZZ5A 3QFEA 2YGYA 4DZHA 4EIVA 4R9XA 1X6NA 3KDOA 4FX8A 1ODZA 2GK1B 1H09A 3WLNA 2YDAA 4HPXA 1H5VA 1CEOA 2DZPA 3W6MA 4BI5A 3MUCA 2Z6JA 3QOKA 4FXJA 3K8MA 4YVXA 2E67A 3VKDA 3TMLA 3M0LA 2QUVA 1P5BA 1PWLA 1EDTA 2GQ3A 1HJSA 4QR6A 4DXVA 1FH7A 3WD0A 2ZRXA 4PFMA 4GKLA 2YFOA 3H24A 1GKPA 1XIDA 1JCXA 4RE0A 4Q7NA 1I2QA 3MB9A 2YXXA 4XB3A 5G2WA 1NDVA 3QM3A 1W3HA 4HK6A 2WZTA 2C1HA 3CPRA 5HNUA 4EXAA 1OGGA 4IGNA 5JQ9A 3GC4A 2DQXA 5H8PA 2EG7A 2CLLA 3SO7A 1QWKA 5DFAA 3A4JA 4MZYA 4PMNA 2C14A 4IP5A 5EKYA 4B90A 1Z44A 1XUUA 3NYZA 1XQLA 4G1NA 4OT7A 1Y5VA 3F4DA 4O14A 4EPEC 2IPJA 3NCOA 1B4EA 3KRUA 3PAJA 2OX1A 3NQ8A 2E7FA 2VGBA 4UQBA 5HANA 1EJVC 4A6GA 5ABHA 5LKYA 1V0NA 1KFWA 3HQPA 3QHOA 3CQKA 5GNZA 1TMHA 3OGRA 2Z1KA 4O54A 5XINA 4RZ4A 5FEPA 5AC4A 2A85A 4I6VA 1OADA 3N6JA 2P53A 4K36A 4AD3A 3PN8A 3EXSA 2BVTA 2R1KA 1LWIA 1BVZA 2G96A 4IIFA 1H7RA 2NWSA 3BARA 1J93A 1W8SA 4J4KA 2YCIX 2XIBA 4LXFA 2BV9A 3OLDA 3UFYA 4JDBA 4W87A 2HPIA 5FJPA 3W38A 4MJ4A 4BA0A 3U48A 2CITA 4IX0A 1UROA 4YWIA 3V3WA 5ABFB 3B40A 3BMWA 3UPMA 4WKAA 4J3TA 5HDRA 1OFOA 1DTNA 2HNHA 4NVTA 4PTVA 3UYIA 5A6SA 3WJYA 1RVGA 2GGIA 5BROA 4E4FA 1OY0A 2ACUA 3FIGA 3W7JA 3LRLA 3GVGA 4JN7A 3ITGA 1KKOA 1CECA 1E9LA 2HZGA 3AIBA 3WJSA 4H7VA 5HMSA 1E4NA 1IZCA 3NQBA 4A05A 3Q65A 2W27A 3A12A 4NAEB 1QNOA 4AY1A 1YDNA 1QNRA 1K77A 2NUYA 4UTMA 3I4KA 4MNMA 3LPGA 1GWJA 2J6XA 4HB7A 4C6LA 2PDXA 3NA8A 4FLOA 4ADUA 3D6NA 3SDOA 3C0LA 4D1IA 3GAKA 2X7VA 4LX4A 4NILA 1XRTA 3TN3A 1DBTA 1T5AA 2G3FA 4IQDA 3GY1A 4F8XA 3WLHA 3I3DA 2ZXBA 2X0YA 2VDIA 3BXWA 2DGAA 4LEQA 1WOAA 3R7MA 4DO4A 1PHWA 1ISYA 3WL0A 2ZX6A 3W1XA 3MUY1 1CGUA 4W89A 2PURA 2VENA 4DM2A 1K8YA 4D6DA 5C8BB 1R38A 4B4FA 5A2CA 1R86A 1S2AA 1A47A 1Z9AA 2IS7A 3FGCA 3T7VA 2ISFA 3MW7A 5F2LA 3UEQA 2FHFA 3GXNA 3FEQA 4V27A 4UFHA 4C90A 5CPLA 2OR2A 4AD0A 4HOXA 3OQEA 3S42A 2WNNA 1PKNA 4P8UA 2V5DA 2ZRWA 5HR6A 4UFMA 3H54A 1ZGDA 4NZFA 4QAWA 3W85A 2XSXA 3AXKA 2YB4A 1RCXB 3W00A 3L12A 2C3ZA 2I5IA 2J47A 2DPEA 4RUBA 2WMGA 1SFTA 1S2WA 4PFHA 4S2CA 4AZGA 3GTXA 3BAIA 3WH6A 4FIQA 3ES7A 1NOWA 4LYRA 3MSDA 1R5YA 1M6JA 3T0CA 1UOZA 3LGGA 5G1TA 4P7NA 4EK7A 2PF0A 2XH0A 4W84A 4HNUA 3LLDA 1O66A 2GJNA 4IXHA 1G67A 1V3HA 3M9YA 1OX5A 4F2TA 2XISA 3SCVA 5HQMA 4RLIA 3OPSA 3MSGA 5BMXA 4REQA 3WMBA 1X7FA 4M80A 2YCJA 1G1YA 4M6QA 4UQCA 4G2DA 4BR1A 5EPDA 5I77A 1X1OA 3W84A 3QQ0A 2JE8A 3P0WA 1O6IA 1TV7A 2G0WA 4XAYA 1EX1A 1VHCA 3UY7A 1G94A 2DP3A 4CQBA 2QCCA 3MMWA 1JF5A 2QDDA 1IGSA 3KRBA 1QHZA 3NSMA 4AU0A 4AEEA 3A4AA 4HN4A 1CWYA 4FI4A 1UZDA 4MG4A 2YW3A 3H26A 2QJJA 3GS6A 2ZQ0A 4H9YA 3EX1A 1AMKA 2DW6A 3GHRA 3E5BA 4JFVA 3BCDA 1VKFA 2R91A 3F4WA 2FQIA 3MDUA 4E3TA 1JFHA 1FWRA 2DQWA 3R6IA 1IXNA 4URIA 5HXMA 4JZ5A 3PPHA 3TJXA 1VC4A 3FW6A 2XU2A 4UR7A 4JS3A 3NO3A 1OT1A 3AISA 4QE1A 3L9CA 2DORA 4E8DA 1YPIA 3M4HA 4EXQA 3LPPA 2I7GA 2VCBA 4JTCA 5LYRA 4IFRA 3GG0A 5REQA 4FXFA 8XIMA 4GRSA 5HMEA 2KAUC 4JD4A 4LUSA 3C3NA 1UZ1A 4NAFB 4PYSA 4C6BA 4XVEA 2QKFA 4W8LA 5CC7A 3LCIA 1EHAA 2C0HA 2J9YA 1R2SA 1D7FA 2FHCA 3DBPA 2QCEA 2WMIB 1MXDA 4LYQA 2HROA 4DF1A 3CAQA 5B7YA 2WCSA 3FCPA 2ONEA 4K7YA 1BVWA 7ENLA 2Z1XA 2X2YA 4KWOA 5C2CA 1Q8JA 2X1UA 4MWAE 3R94A 4JQ2A 3QOMA 3FS2A 3L5LA 5H1WA 2W92A 1YIXA 1CGYA 1GVYA 2D0GA 3EX2A 1W54A 3LHWA 2RHGA 3EKZA 4CKQA 1VBGA 1X38A 1D8WA 2H90A 1TRIA 5C71A 4M56A 2QUTA 2INZA 1O5KA 3GFXA 3DN5A 1XWYA 5AYBA 3TYCA 3A13A 2CLEA 3N14A 3SCRA 4XVDA 3QR1A 1J8VA 3RPTA 1FXPA 1EP3A 1EXPA 4WY0F 1SR0A 2JKAA 3AFBA 3C6CA 3BLLA 3WLMA 3LDVA 1ZHAA 5DMNA 2WVVB 5CBIA 3PTMA 1X96A 4HMCA 1XYLA 4MPKA 4H9TA 3S2JA 5E9AA 3WLPA 3BAYA 1MNSA 2DUAA 4MY8A 1RD5A 3IGHX 3NPUA 2NQ5A 4DLFA 5D2YA 4WUIA 4US5D 5IDZA 1GVFA 1JL8A 1LJYA 3GFZA 2GDQA 1OYBA 5BZAA 2J77A 1ZENA 2R82A 2E09A 3W7OA 1W3KA 4KCTA 2CLIA 1MMFA 3CYJA 4PN2A 3DHUA 3S3GA 3LCWA 3MCNA 4BQ3A 3R2GA 2A4AA 3R8RA 3W27A 3U7VA 4QXIA 4WGXA 5EL1A 1HKMA 5CGTA 5F2GA 4E2OA 4FNUA 1E6NA 1IE7C 1DJZA 3P8JA 4QSHA 5C55A 1HNYA 3AS1A 4CCDA 4PCSA 4CNSA 1BD0A 2PBOA 4PUKA 2VX7A 3I65A 1VCGA 3UWQA 1JULA 5HINA 2NX1A 3TJLA 5LA0A 3T2PA 4M1BA 4WLCA 2O9TA 1JZ4A 3LGEA 1PJ9A 3CL6A 3T0DA 2XIMA 5KTLA 1EQCA 2Z6IA 4AIBA 1ME8A 3QV7A 5DXYA 2J75A 2CYGA 3IIPA 3AS3A 4PODA 4F0HA 3N2MA 4Q4RA 1OFAA 1AD4A 2ZDSA 4FR1A 1M7JA 3NEVA 1QPKA 1TSIA 3HM7A 3KXQA 4O8RA 4PBFA 3HG3A 2HS8A 4RDWA 3C2FA 1EDQA 3WBEA 2BVWA 2A3HA 3M0HA 2VMFA 1RK5A 3VZXA 5GQBA 1XBYA 1R47A 1UKSA 3W81A 5DMLA 2WLYA 2RH9A 4DUOA 4HHMA 4FNQA 4UTTC 5A5WA 2GYIA 4HK5A 2ZE3A 1JI1A 4WDUA 1TQXA 3LB0A 4X22A 5FJUA 3RHGA 2ZWYA 4KGJA 3TEVA 5D03A 1L6SA 2V81A 4RXGA 3CO4A 1E0TA 1GTEA 2PTXA 2VEPA 3TXVA 3UXIA 2VX6A 1SZFA 1V3LA 1OT2A 1E55A 3NL5A 3M6YA 1ESWA 4IGMA 2ACSA 1TJ0A 1BSLA 3RFAA 1GVIA 3W7CA 4HGXA 4WKHA 2XGIA 4Z42C 3ZS4A 1EFZA 3PB2A 3LBOA 1H7WA 1OGSA 3T2OA 2GOKA 3SN0A 4AH7A 3H7UA 5AOUA 4C1LA 3O7UA 3CJPA 5I79A 2WSRA 4B4HA 3VFLA 2PFHA 3DEQA 4V28A 2Z0IA 4O1FA 2XZ9A 2X1IA 1HL8A 3NL2A 1PPIA 2D24A 2WPGA 4DELA 3LUTA 2WSPA 1JNEA 1YDVA 1A5LC 2VWTA 2QW5A 3AS0A 4RV8A 1YXCA 3W86A 3MMDA 3MZ2A 4W85A 1JF6A 5LNSA 4JFTA 3TOYA 1UPPA 1KM2A 4CUCA 3LSBA 5TNVA 4US5A 5C9RA 1GG0A 3R1ZA 3VGHA 2ZFAA 4JKLA 1LCOA 5IBXC 5CC5A 2ZZ6A 3PUDA 2BMBA 2PGWA 1XV8A 2YA1A 1VFHA 4PMOA 2YL6A 2QIIA 4H01A 4HA0A 2FVMA 2PWEA 1CB2A 4S3JA 3WLRA 3SB0A 4D72A 3QKEA 1RXOB 2Y7FA 4ZB5A 1NIUA 1R6WA 3WF4A 2WJFA 3FHAA 3W7NA 4TVDA 4N9EA 3NQGA 3AIQA 1ISVA 1SVDA 1RJRA 3AWNA 3MYPA 4J3XA 5LNUA 1Q4NX 1QW8A 3HV8A 3CPGA 3ZJ6A 3RPDA 3U2ZA 2NV9A 3SSJA 1H7XA 3ZSSA 3PZQA 1UMLA 4RZ6A 1WZLA 1V51A 2OQHA 3HPZA 3MTWA 5EU9A 3SY1A 3R43A 2QCMA 4NL1A 3G22A 3G0UA 4Y8EA 3N2TA 1KRMA 1W17A 2NZLA 4DJFC 1YTDA 4ZTXA 4EE9A 1KXQA 3ICJA 1E1CA 3V5FA 4YS1A 1UR1A 2GVYA 1NWSA 3R25A 3I68A 2WMKA 3KOWA 4KS0A 2E5DA 2YL8A 5ECVA 4MB3A 2CESA 3EA3A 3I6RA 1QI4A 2BVDA 2WW5A 4O19A 2WANA 1DQUA 1HIZA 5H2ZA 1WZKA 3BCFA 2Y62A 2PRHA 3DFHA 4FHAA 3STFA 3KUMA 4X60A 1EA0A 2OWCA 1AW2A 4PMUA 3F4VA 3H2OA 4PRWA 2WBKA 3NGJA 3M41A 2ESCA 1VEMA 2UY3A 3AXIA 4J9JA 1REQB 4DUWA 2XVNA 3CHVA 4U5KA 4BQ2A 1MRQA 4NZCA 3WDRA 2IKGA 3CM4A 1JZ2A 3QHNA 3KEHA 4IP4A 3KCJA 1X6LA 4OIFA 3W02A 1HJVA 3A22A 5HWNA 4JQ3A 4DZAA 1XYZA 1BHGA 1LG1A 3ZT5A 4WXZA 5M1TA 4H6RA 5DCBA 3AI0A 4NY2A 1TX2A 4XD3A 2XVLA 1NJJA 3WDPP 1J5TA 1WDSA 3TSMA 1DJNA 2BASA 1HVQA 1KTNA 1A5NC 4AYGA 1J0YA 1CBGA 1XPGA 1ME9A 3T55A 3EMQA 2JGQA 3NL3A 1AG1O 2B31A 3ARUA 5TAOA 4GI9A 3SRDA 3AIVA 4EANA 3H2EA 5D37A 2QNEA 2CKSA 1X39A 1XLLA 2G3JA 3CWHA 4LFYA 3E5PA 3TNBA 3P81A 2HBVA 3S5SA 2VVNA 1R0MA 4ECLA 2DVTA 2GJRA 2DVUA 2YXOA 3PS7A 5HA7A 5BRBA 1XKYA 1PX8A 4L4LA 5C9WA 2EBNA 4MPQA 1QHPA 1SPQA 4UMBA 1E40A 3OG2A 3VYLA 3HMJG 4KGLA 1NOUA 2DJXA 4H8HA 1TPFA 1BGGA 2PTWA 3QTGA 3P0XA 4U2ZA 3LY0A 4HCDA 2YLAA 3P74A 4JXCA 1PAMA 1TUXA 1ZU8A 4CN1A 4G7FA 3QH2A 3VE7A 1ZSXA 2Y5EA 1XIEA 3P7YA 1QI0A 4HCLA 4B91A 4NRSA 1KFCA 4I7UA 3TTEA 2E9MA 2FLIA 4EOUA 2WZIA 3IPWA 4BEUA 1EYWA 1VPYA 4I7WA 1QASA 4XG1A 3TROA 4IG2A 2X8RA 3BGAA 1VGAA 3CUFA 2C7FA 3VNIA 3C3UA 5KEZA 2D20A 1OBAA 2R94A 2OEJA 4MUZA 4UFIA 4UTUA 1NSJA 2HNEA 3DAQA 1AL8A 2LLEA 3RYSA 2EPHA 1B3YA 4DBUA 4UTWC 3ZYZA 5FF4A 3OODA 5I23A 2V9DA 3DXIA 3II1A 4MJZA 5M5DA 4J3SA 2VZOA 1J0HA 4J5NA 3VKBA 1AQMA 1GJPA 4Y9OA 3IAPA 3APTA 2Y6ZA 2YDQA 4Y9AA 4LH8A 4LPCA 2CBIA 1JZ3A 1H3GA 2OB3A 3VOGA 2W61A 2BXZA 5U7SA 4PZVA 3BICA 3L23A 4HPGA 3C2EA 3PZVA 3RAOA 3GNDA 1ZJIA 3C2VA 1B3WA 3CAKA 5AYXA 3U2CA 3W76A 4A3UA 4PL2A 4HHLA 2GUUA 2O9RA 2EJ1A 3VNKA 1U5VA 2QCLA 2HE5A 5BYWA 2QCNA 1WBHA 4S3CA 4OV9A 4GPNA 3DECA 2VRQA 4L7ZA 3THDA 2VC7A 1KV8A 4FSAA 4B3KA 2DUXA 4EWND 4MM1A 1LL6A 1GYMA 1ITCA 3M07A 4S3AA 4QFUA 4JICA 1FKXA 3TTYA 1LT7A 2HK0A 2XHYA 4PB5A 3DGRA 2VZUA 4X63A 4L1XA 1L6WA 4GNJA 4IT1A 1W1B1 1K4HA 4RKAA 4IJBA 4CNTA 3NDYA 2PA6A 4HTBA 4M29A 4OU1A 1V0LA 1OC5A 2VCCA 4AZCA 1JUEA 3WFZA 1DWHM 3O8AA 3SN4A 1KFLA 2NT1A 1JYXA 1EBGA 1S3HA 3CWNA 4NYYA 3EDKA 1CXFA 1VCVA 2CCRA 4HMNA 1ECQA 1LWJA 3AHXA 4B3LA 4ADTA 4PMVA 2R1MA 3ZFHA 3H2MA 3GVRA 2PWVA 3BUVA 3MKVA 1KM5A 4Z2HA 4D6JA 1EPVA 1J10A 2ICSA 1C7SA 2OZ8A 1W2VA 2PP3A 1S2VA 3FXYA 3CK5A 2E25A 1Z6KA 1V08A 1HKJA 1ZS2A 2QUUA 2VEKA 1A5AA 1UD6A 1XLCA 4O10A 1NFGA 3WQ8A 2A3LA 4GIEA 3PUOA 3HQOA 4FLSA 3TZFA 4Z08A 2X16A 4WDXA 3DFNA 3BLDA 4YVPA 4PSRA 2WK2A 3I4EA 1J5SA 3AO0A 4JBRA 4JTRA 4JHZA 1JI2A 2TODA 3TV8A 1N8IA 3DU0A 5CC6A 1GOIA 3ATYA 3BSMA 1T40A 1JAKA 1YTKA 2C13A 1P0DA 3BQ5A 4RDYA 3IJQA 4L6DA 3OLIA 3C5QA 1IR2A 1PX3A 4XIMA 5FI8A 4M0XA 1DIEA 3M43A 2HISA 3WLOA 1XYBA 2V6AA 1S2CA 3T81A 4BJHA 4MB4A 1JCYA 2XG9A 3WUEA 1UA7A 2CLHA 5BWFA 3AJXA 1J01A 2ZRUA 2ZUSA 3N2OA 5AHEA 3FY1A 3WMLA 2ZTKA 4UXDA 4V15A 5FAGA 1Q7MA 2YOCA 5FJTA 2GGHA 4G1KA 1R3TA 4GD0A 1GPFA 1PYFA 4IQEA 4IMDA 1R9ZA 5A1AA 3NO1A 1UASA 4REQB 4GISA 5LIWX 3DERA 3CZJA 4IWWA 2RUSA 1KTCA 3WDJA 1YXDA 2FGLA 3F5KA 3TMQA 1J79A 3URBA 5IRPA 3T6CA 2X0HA 2OT0A 3ZM8A 4FXSA 4UMAA 3CQIA 3VGFA 4Y90A 3VUPA 2V5KA 3W4RA 3E0IA 3ZJ7A 3FLUA 3LNPA 1L9WA 4XZHA 2YPIA 3L67A 4P61A 1BRLA 4LY8A 4ZL1A 3HPAA 1XRFA 2WJEA 3CLMA 3KTXA 3KVMA 4FOKA 3PJXA 3U7BA 2OT1A 3QPEA 4HTYA 4PMDA 4ERGA 3POCA 2AGKA 4F40A 2BHYA 1XD1A 5D4YA 5BRQA 4D8AA 4I9JA 1OYCA 2RFGA 5LNWA 1JDFA 3N4EA 4KCVA 5E6YA 2Y61A 1E70M 2FFIA 2IPFA 3DYPA 2CFFA 3CLWA 3XISA 3SAZA 2WZMA 3EGJA 1RV8A 3N12A 3TYDA 1TTQA 3UR8A 1TZ7A 1C29A 3G0SA 3W7RA 3TA9A 4LVFA 1LRTA 3RO6A 4ZQMA 1GW1A 3AIWA 3LX9A 3IVSA 5A6JA 3I10A 3CMJA 4GIAA 2PDUA 4LAOA 1JZ5A 4P8XA 5J5RA 3VIIA 3IIXA 5REQB 3KBNA 4XX6A 5FA5A 1BWKA 2XJ7A 1IEWA 3H8AA 4WOQA 3E02A 3WO8A 1WDWA 3CTLA 5K4XA 1ZCOA 1VYPX 3ANUA 4LUSB 2H9AA 1SJBA 3E2SA 3JW7A 4X0VA 3E1F1 5IM51 4LTSA 2VVSA 1TRDA 1AA1B 3RLGA 5DO8A 3ANYA 2OPJA 1K9DA 4O12A 3EWBX 1QPQA 5JH1A 1OM0A 4GYFA 1E72M 5I07A 2QAPA 3AIUA 2CPUA 3F2BA 2QHAA 3L7RA 4QGCA 1Q6LA 3IRSA 3C2OA 3UWVA 4BF5A 3W6LA 1KCKA 4PUNA 1LUCB 4HYRA 2QCFA 1HXJA 4GACA 1M65A 5M3WA 1QNVA 1I0BA 3B06A 4DYKA 1E15A 4R27A 4E38A 3BMXA 1V6YA 3O06A 3VD5A 3QC3A 3DDMA 3M0XA 2PTDA 2A21A 4ADSA 4DJDD 1NAL1 4ML4A 1SJDA 1V02E 1QNQA 3KOZA 3GBDA 3TFCA 3WF1A 4IMCA 3W71A 1XL9A 2ASHA 2EJAA 1NQKA 1TTPA 2WCAA 4CVUA 3L2IA 4MDOA 4IL0A 4KRZA 4GIRA 3RK8A 4PUDA 4Y2WA 4DVOA 2JIEA 3WQCA 3FA3A 1W3TA 3IWPA 3QHMA 1C90A 1KXTA 3QC0A 3MYOA 4XO6A 4H9VA 1XIFA 1XFBA 3B8UA 3EWUA 4WRHA 1VFTA 3U4FA 1JXJA 1Z8AA 1Q6OA 3UBPC 3ARRA 3HV9A 3RF9A 1U1JA 3SRFA 4AFYA 4ZO7A 4G7EB 1K3UA 1K9EA 2AQWA 3BJSA 3VIMA 1NWTA 3A9IA 3EPOA 2WNWA 2X1TA 3H22A 2WSQA 3LMYA 3OA5A 1TR9A 3GAYA 1U5JA 1GYNA 3DGBA 3KS5A 2Z2BA 3DUGA 1GCYA 1JQXA 1TFVA 1XLEA 2MNRA 3WN6A 1FRBA 5HNNA 2OZ3A 1AZ2A 5FEXA 3L68A 1AQHA 1V6UA 2E3ZA 1OF8A 2QZRA 2HJPA 1QOPA 3G1AA 3RCNA 4O53A 1W5MA 4ENLA 3S83A 2TMDA 3G1XA 5BCAA 3THAA 1CPUA 5CZKA 1WKFA 3BLKA 3PBYA 3QW4B 3EOLA 4L6OA 1IXQA 4FX6M 4J3VA 1V3MA 2ZBTA 3WD2A 5CKSA 5BW6A 4CCEA 4IUGA 3SUWA 3CH9A 3UXDA 5CSUA 4EACA 1TWIA 3M0VA 4AIEA 2X2GA 1L6FA 1TJ2A 4PTXA 3EOEA 3URAA 3PFMA 5I3IA 1UWTA 3AHYA 1AQ0A 1EUAA 3VOHA 1M01A 1CI1A 5DX7A 1MZHA 2D23A 5IDIA 4YU1A 1O1HA 4N0RA 3P67A 1W5OA 2XUCA 4IXXA 4ZFMA 3VD9A 3MMUA 2Z25A 1XIGA 1PBGA 2R6OA 2PLKA 3WH7A 3S6OA 3GB6A 1CTNA 3ERPA 1VPXA 3UD6A 1P6CA 3W7DA 4NZ1A 3PM6A 3B9AA 3LXBA 2QS8A 4PB3A 1DXEA 1SFSA 3K1DA 3U8GA 4JTIA 1ZL1A 2P8CA 3MT1A 4LYKA 4DO6A 4I3GA 2W79A 4LWWA 3E0LA 5G4WA 4GXWA 2IPGA 5AC5A 4LVAA 4ZBCA 1JFXA 1XBVA 4AWUA 2G41A 3H6OA 4AXNA 4OV4A 4LY4A 1GNXA 3TYZA 1MZRA 2W5FA 3ENLA 2Z2UA 4Z2GA 1F73A 3O07A 3Q45A 1PSCA 1FWHC 1OFQA 4DI8A 5D05A 4UTLA 4A35A 5DMYA 4JY9A 1X6UA 3CIXA 2PZ0A 3GU1A 1WKYA 3CAWA 5XIAA 2E4TA 4Q8UA 3EDFA 4D1JA 4KFNA 1O12A 4JAWA 4LANA 3QPYA 4ZMGA 6TAAA 1FBAA 5IHSA 5ABGA 4QDMA 1U33A 4WSJA 3ABZA 4AIOA 1I1WA 3FKRA 3EA2A 3CHCA 4LYPA 4N02A 1J6PA 4GZEA 5C54A 3VIFA 1XUZA 2E9BA 4DJDA 2BOFX 4WIWA 3VUSA 1RBLA 1ZP3A 3L0GA 5E5CA 3UT0A 3H12A 4JYDA 1E6ZA 2POZA 2W0UA 2EKGA 2VR5A 2J7BA 4CQDA 1MUCA 4B2DA 2Q8LA 4U31A 4H7ZA 2YZRA 5CCZA 1G7UA 3DKJA 3EOUA 1GJUA 1QPOA 2D22A 2A7RA 5HJYA 5JMUA 1JG9A 1DTUA 1XBXA 4S1FA 1G4SA 1LYXA 3UG3A 1GZJA 1CB7B 7TIMA 1TJ1A 2WB5A 3NQMA 3GVQA 2PP0A 1PYMA 1F4HA 5AVHA 2PDHA 3WFLA 3SCSA 5EA9A 2B7NA 2B4GA 1M03A 3P6LA 2OJPA 2GPTA 4ZEPA 4C5YA 3EWWA 3NL6A 1D2KA 2EPLX 4OBRA 2QV5A 4RNHA 1FHDA 5HJLA 1A3WA 3Q94A 1TO3A 1A5UA 3OHIA 3ARXA 3DFSA 1V3KA 1FWJC 3TW7A 3LHZA 4K38A 5I3FA 5FJJA 1EP1A 1L2UA 3VC5A 1KBLA 1EYEA 1XG4A 3GM8A 4I9MA 2Y2WA 3GW0A 5FD0A 2NX3A 3KL3A 1JZ6A 1E0VA 4HPHA 3QPZA 3N4AA 3UGRA 2WWDA 1CZ1A 2E0PA 2PUZA 3VGEA 1E1CB 3C0JA 4BZYA 2OYLA 3NQ6A 4ROQA 3VX1A 4AC7C 4O13A 6ENLA 1E5JA 1RP9A 1K4GA 1IIGA 4LC6A 4C1KA 3E2VA 1XLMA 4GZ7A 3Q67A 3P62A 1WZAA 3DH7A 3PULA 4GXMA 4N4PA 1PE1A 2PU1A 2A6LA 4HD5A 1X97A 1W1ZA 5A3HA 3BCJA 1TTJA 2XFFA 3AMLA 3STCA 3NZQA 2PSNA 1QBBA 3CUIA 3WLJA 4J35A 1FX6A 3ONCA 3ZVHA 3RXZA 3NQCA 3B8DA 3G6MA 1B31A 1CXHA 1PZ3A 3RU6A 3KBWA 1NOFA 2VM8A 3CV1A 4RNFA 2VFHA 2QQ6A 3GKFA 3V18A 2PDLA 3HGJA 1AH0A 3HQ1A 3LN3A 2ZKMX 2D2HA 4F9DA 2XM1A 3WNOA 3HPXA 2WSYA 2X42A 5HK4A 3CGTA 3WH5A 4X2PA 1L6GA 4PCTA 4J27A 1WDPA 4O1DA 4AD4A 2UBPC 4HU8A 2QDGA 1IR1A 4JTQA 3NQ2A 5IHRA 1XC6A 3O6CA 3SFKA 3ZLGA 4PA8A 4BCEA 4K1GA 5CC3A 2ZVRA 1UKQA 1BVNP 4XQ6A 1IT0A 3UXKA 1KM1A 3O9NA 1UUQA 4LNYA 4BK9A 3W7IA 2PCQA 3DESA 3MSYA 3UZWA 6PTDA 1EDGA 3FYPA 1V7YA 4XK2A 3LG3A 3QSTA 2RDXA 3L5AA 3OB8A 1EH9A 4GHRA 4P7QA 2VRJA 2OTDA 2QEZA 1FWNA 3L4XA 2ZXQA 1WB0A 1IWAA 3ZMRA 3AJ7A 2X1RA 2QVHA 4IMEA 1F76A 4ZSUA 5F2MA 3R5EA 1R85A 3MHUA 3V0UA 4RPPA 4H2CA 2O0TA 3UJ2A 3O1NA 3N6HA 1RJQA 5AHLA 2D3LA 7ODCA 1XGEA 3W2NA 3GTHA 4DF0A 1A5KC 3OP2A 5HQLA 4GY0A 2DSWA 3TYUA 1XHGA 5LXEA 4QLJA 3N3MA 4I5UA 3VNJA 4JTSA 4IG2B 3V5CA 3TONA 1F3WA 3PSVA 4GCAA 1VRXA 4P7OA 3QV8A 4JHMA 4KT2A 4DWSD 5I02A 3S2NA 1RCOB 1VRDA 3UWWA 4H9MA 4C6FA 1RY0A 3W88A 1QI5A 1BXBA 4CQAA 3JZUA 3LENA 3VKJA 1RK6A 3OA3A 4NI3A 1W2PA 1DVJA 1AUSL 1MW1A 4XZMX 2HMCA 1XM3A 2V3FA 3T1GA 4HYWA 4RE4A 3VINA 1H4PA 1IHIA 3ZJKA 1XLJA 3OIHA 1JDEA 1JZ7A 5CBBA 3GSMA 1T99A 5JIWA 1O1ZA 3S1UA 1W31A 4P8WA 3ZLFA 1NDYA 4MWAA 1ELSA 3CO8A 1GOXA 4KEMA 1L2QA 4IP7A 2PDNA 1VLWA 3UZJA 3OGSA 3FEMA 3WUFA 1DIDA 1PL9A 4I90A 3TIMA 4DO5A 3NQEA 2G50A 5GNXA 2OFJA 3UJEA 3MZNA 5LSMA 1B3VA 3C8NA 1EJ7L 4DBWA 4HU3A 1A3HA 3VZYA 1E0WA 1FA2A 2VJXA 4B5WA 1MW0A 4ACZA 5BWAA 1V6TA 5LXXA 3FXGA 4AW7A 2XYLA 2ZZ7A 1H0IA 1V0KA 3BW4A 3NPWA 1OZMA 3AYSA 5A6BD 4JIQA 4RNJA 4U3AA 4O11A 5AC6A 1UR4A 3V1HA 3MO7A 4HQVA 1B57A 4PUJA 3R8HA 4AZCB 1Q6DA 3NZPA 1R87A 5I78A 1GZ1A 4H7CA 2OLSA 1VJSA 2WOQA 3UP8A 5A94A 1PB0A 1HL2A 4CD7A 1YXYA 4XSLA 3UZ5A 3QMTA 2YBVA 3AICA 2VGFA 2XWEA 1ME7A 4G6CA 4QS5A 3S0CA 3GXTA 4CU8A 2OG9A 1WPCA 2C16A 4F4RA 1FWCC 3VM7A 4Z2IA 1WXZA 1C8XA 1PCWA 3MBDA 4GBUA 4W7UA 1A5BA 1LTDA 4DXKA 4AYSA 4Z2JA 2E1WA 2NQJA 1BLIA 2B0MA 1W3JA 1TWSA 1DJXA 3TC3A 4IPPA 4XSMA 3UR5A 1AVAA 1EJRC 4LCSA 4ZXLA 1TPWA 1HUVA 1ZPTA 1W9XA 3ALGA 3UZXA 5DY3A 1N8FA 4MY1A 4XKMA 1CLXA 4GWEA 2WKLA 3W87A 3EWCA 3TSDA 1SZEA 4IHCA 4M51A 2J7GA 3LHYA 5I2UA 4O1BA 3FJNA 1FUYA 2WV8A 1OCBA 4DWSA 1HJQA 4Z0SA 5HWMA 3SN1A 4K8GA 3SJNA 2X1SA 4RW3A 4Z1CA 4IMFA 4MYAA 1YNPA 2NWRA 2MUCA 3PP7A 1HKIA 2V5BA 4TVUA 2CHNA 2I16A 1FFQA 2PC4A 2V63A 4YIWA 3VNDA 4IH3A 3RR4A 3TN5A 1SW7A 1EKOA 1GQNA 3I7RA 2VOTA 1C93A 1SMAA 5LIUX 2CBUA 2VR2A 5AYYA 2J13A 3AXXA 2WHMA 1WKEA 2ZRVA 4CNOA 3EB4A 2Y8KA 3CZGA 3H7RA 4X9SA 4XAFA 3E12A 1BTCA 3KZPA 3T4WA 1NTHA 3IJ6A 4MKSA 3GK0A 3QW3A 4S2BA 4HZ7A 3WEOA 4M7SA 2NVDA 3UG8A 1MQQA 1G6CA 2V8ZA 5H91A 2VP8A 4HOZA 4ZTYA 2C6QA 4ATLA 5AZ0A 5LA2A 4JQAA 5FL1A 2G3NA 3DHFA 1MW2A 3LZ3A 4HSNA 4IX2A 1EGMA 5JUVA 1O5XA 1EF2A 3MCOA 3SCQA 3LV6A 5CG0A 2CETA 3STPA 1JXKA 2OYKA 3IEBA 3G1DA 3W2LA 5KSWA 3HG4A 4NJHA 1SMDA 3N73A 4US6A 3B04A 3PC0A 3LTYA 4S23A 4GI6A 1SZGA 3VAVA 2WC4A 3WBXA 3D5HA 2PLCA 1VAHA 2X40A 5M03A 1KNWA 1BRLB 4POCA 2P50A 3UETA 3WQPA 2FZNA 3EPMA 4H2HA 5EFDA 1KBJA 5F2IA 2PDFA 5A6BA 1E4IA 1JCLA 4PC8A 4AY8A 3PPFA 1K70A 1UP2A 1U1HA 2DT0A 1H7NA 2EG8A 2WM0A 3PF3A 3MWCA 4EP8C 3Q4DA 4WSHA 4AVFA 2YDSA 4HYVA 1VFLA 3FOKA 3L21A 3E2QA 1HJUA 5AKQA 2VNCA 5IOBA 1KR0A 4JYEA 3DI1A 5A8OA 5D02A 1PWMA 4NNCA 2VFEA 3ANVA 3W6YA 1M7PA 4BFAA 3VDCA 1BG4A 1AQFA 3THQA