5CSUA

Disproportionating enzyme 1 from arabidopsis - acarviostatin soak
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
518
structure length
518
Chain Sequence
ISVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
total genus 179
structure length 518
sequence length 518
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csuA01
1YHTA 4B9YA 1W1VA 1KXTA 4UZUA 2E9LA 4H8UA 2ZXDA 4KGJA 2AMGA 3GTNA 4ACYA 1QNPA 2BS9A 1B3XA 4HZ8A 9CGTA 4E8CA 1ZU8A 1JG9A 4PTVA 1LL7A 3ZM8A 2WMJA 1HXJA 5DFAA 5I24A 2VX7A 2VCBA 2V5DA 2D1ZA 1A47A 1XCXA 1E71M 2GJPA 3TP4A 4U31A 1QVBA 3AIBA 3K8MA 4W7VA 5A8MA 1EHNA 3VIPA 4KWUA 1TFVA 4PN2A 1DWIM 4GI8A 1D2KA 4DWSC 3MSGA 2QF8A 3AJ7A 4UFIA 3G6MA 2GUYA 2JALA 4PYSA 2J77A 4JFSA 2WB5A 1KR0A 1B90A 2D3LA 3UG3A 4GIAA 2Q8XA 2WMHA 1EQPA 3AYSA 4FF5A 1E6NA 5ABEA 3L4XA 4WKFA 2VMFA 1UD6A 3KL3A 2Y8KA 4ATDA 1CBGA 2WKLA 4C7GA 1VEOA 4U3CA 3IK2A 4AZCA 2ZXBA 1E5NA 4WSJA 1OIFA 4AZ5A 8A3HA 1ISXA 1L0PA 2ESCA 2XYLA 2Y2WA 4WJXA 4JKKA 4GQRA 5DT7A 5D9PA 3VX1A 1DWHM 5A1AA 5A2BA 1WP6A 3WNPA 3KEHA 1V3IA 1ZBCA 1ESWA 4K68A 2JEPA 3GBDA 1XYZA 2RGMA 4FLOA 4PMOA 1US3A 3WBEA 2BVTA 5EMYA 5CJ5A 2YDQA 3EBVA 4D1IA 4HZ7A 3E1F1 2D22A 3AMGA 3VDCA 3VGBA 4MB4A 3LMYA 2CIPA 4LX4A 2UY5A 1XC6A 2ZUMA 1UWTA 4RL3A 2J75A 4W8AA 4GZEA 1HKMA 3MMDA 3ZR5A 2YLAA 5I3DA 1BVNP 2GJRA 2YL8A 1OIMA 5E0FA 3VIOA 2FH6A 3UG5A 4UFKA 1EHAA 5A6BD 4LYQA 2NT1A 2VZVA 4UQEA 1UD8A 3WBAA 5IXEA 1QNSA 3WMSA 5CPSA 3VO0A 2W92A 4GI6A 3M7SA 1J0JA 1UR8A 4HPHA 1OCQA 3VPLA 2QMKA 3UCQA 3VGDA 1G9HA 3FNDA 2E3ZA 3SEPA 1ZS2A 4OJYA 1GHSA 4AD1A 1XSJA 2CETA 2ZUSA 3AMLA 4AIEA 1OT2A 2GSJA 3WKZA 5BYWA 2WWCA 2WVSA 2X0YA 3VOCA 4FMVA 4UQ9A 3O2LA 4WSKA 7A3HA 2VURA 2WBGA 1UA3A 5CPQA 1W9DM 2EPKX 4GKLA 3BAYA 1M01A 5I5RA 1E3ZA 1BQCA 1CGYA 3WNLA 2EQDA 4U2YA 4XX6A 5A8NA 2IXVA 2VVSA 1JDDA 1XCWA 1KCKA 3AQUA 1W9VA 1E4IA 3L4TA 3B9DA 2V3GA 3VDAA 3II1A 4B3LA 2WHMA 3RJYA 2QPUA 4QAWA 1VJZA 3WMCA 6A3HA 2YBTA 1H2JA 4YPJA 1TVPA 3CH9A 5ABFA 5EFDA 3S2CA 3CUGA 3IAQA 4QLLA 3AIVA 5CGTA 5IHSA 1E56A 3CLWA 1MW1A 3N11A 2JIWA 3LPPA 3WQ5A 2G4FA 1NQ6A 2XVGA 1J0ZA 4BQ4A 1F4HA 1ECEA 1UWUA 1R87A 1E6SM 1E73M 4D1JA 4M80A 3A47A 3WDRA 1UA7A 3BGAA 4MTVA 3SCSA 2DH3A 1VFUA 1FHDA 2OLHA 4A3YA 3MO4A 1B3VA 1HVQA 1GVYA 1NWUA 1E3XA 4D72A 4PUEA 4FLQA 1WDRA 1C91A 1ZJBA 4TXEA 5BRQA 4GINA 1B31A 4ACZA 1BG9A 3OGSA 5HPOA 3UERA 1UQYA 3VIJA 4R27A 4CCCA 2YJQA 3GH5A 2PI6A 2BV9A 3BAXA 1CLXA 1GOMA 3NSMA 4AEEA 3EMQA 2VQUA 3M07A 4LYRA 1BF2A 2ZWZA 3GH4A 1UWRA 1LJYA 2E9MA 2DSZA 2XSAA 4KRTA 4ZFMA 3SCOA 3CZGA 3F5KA 4JKLA 2BHYA 4J3SA 1E0XA 2CXGA 4GZJA 1JFXA 5LYRA 3I3EA 5A6KA 1V0KA 5FOOA 2OSWA 5BXRA 1WZLA 2PWGA 3AXXA 3NDYA 1WKYA 3CHFA 2CBVA 5IHRA 4Z2GA 3AZRA 1ZJAA 1Z32X 4TVCA 4X9YA 3IJ8A 1BYAA 1C8YA 5D9OA 5HBFA 3WH5A 4Y7EA 1MXGA 1M04A 1KB3A 5TD4A 4UFJA 3NSNA 1MVYA 3AOFA 1J11A 1WB0A 1HF6A 2YKKA 4M56A 1MW2A 6TAAA 1OT1A 5GQBA 1TA3B 1JF6A 4AYSA 4H8HA 1HJSA 3AISA 3O6AA 1B9ZA 1PEZA 4J3WA 1QHOA 3VGGA 4D6EA 4RE3A 3WENA 4AZGA 2YDRA 5A2AA 4PMUA 1FHLA 3BSGA 3AHVA 1Q4NX 1WDQA 2GVYA 4GQQA 5ABHA 3L4VA 1E1EA 2ZUVA 4JFTA 3SCTA 5A3HA 7TAAA 4HMEA 1GOKA 4U2ZA 2FH8A 2VVNA 4TTGA 5A6LA 4QDMA 4TTUA 4MPKA 1HKIA 3VD9A 1JIBA 2VRKA 4NI3A 4JL1A 1JYXA 1UKOA 2GFTA 7CGTA 3BLPX 4M1RA 4W88A 1MQPA 3WSUA 1CIUA 3WUFA 1JF5A 4ZXOA 1EXPA 3AYRA 1FP9A 3ZO9A 3THDA 1NWRA 4R5EA 2CHNA 4L4OA 1GQLA 3B8SA 3AXIA 3WY1A 4JFWA 2EEXA 5BWFA 4N42A 1K9FA 1JI2A 4F9DA 1KQZA 2A3HA 2JE8A 4MADA 3BAKA 5DO8A 4DWSA 4X0NA 4CD6A 3PZGA 4QP0A 1CNVA 4AIOA 3WFZA 3KL0A 2EO7A 4AZHA 1HJWA 4W7UA 5AYIA 2VI0A 3WFLA 1KQYA 4MNMA 4EANA 2ZWYA 3THCA 2WW5A 5BCAA 1VRXA 1KWGA 1DWJM 4AD2A 1WO2A 3W37A 3A4AA 5ECUA 3VUPA 3U7VA 2ZX9A 2DEPA 2J74A 1KXVA 1UWSA 4PMRA 2F2HA 4PTWA 1IZKA 2CEQA 1CXIA 2BFGA 3TONA 3VIFA 3ARRA 4ZE5A 1D7FA 5DF0A 1JL8A 4GO9A 2WVVA 4P7RA 5A8PA 3BC9A 4RE4A 3CPUA 2FHFA 3VINA 1V3JA 3EMCA 2J78A 3HMCA 1RP9A 5A6SA 2J7DA 3QOKA 1JYVA 3W38A 3VGFA 4AZIA 1BSIA 3L4WA 3WNKA 3WELA 1J10A 2WCAA 3N1AA 4V28A 3UG4A 2J79A 4CN1A 3L2MA 1CDGA 3RPMA 4IM4A 2A3EA 2NSXA 1JYNA 4PUDA 3AROA 2VZSA 4JIEA 3BAIA 2CBUA 5A2CA 1JGIA 2Z1SA 1X6NA 2O9OA 4MJ2A 1WNOA 2TAAA 4UFMA 3OGRA 3MU7A 3MKKA 4KMQA 1B30A 3VM7A 1KGUA 3VIMA 3WMBA 1AMYA 1U30A 5I0DA 1C93A 2WC4A 3WNMA 1CGWA 2QHAA 2PBOA 3VGHA 3T0BA 3RM4A 4OZOA 3T09A 1VAHA 3K46A 3MUZ1 4IPNB 2FGLA 3NUKA 2DH2A 3PZQA 2YA1A 4P8WA 2CCRA 2CERA 3A6OA 3AIUA 1E4MM 2XVKA 1H09A 3GXIA 4HPGA 4D6HA 5M3WA 3SURA 2DSKA 2G3NA 1XH2A 4OIFA 3CUJA 1JZ5A 2CPUA 5BXPA 4YHEA 1GORA 1QNRA 4CU6A 3ZJ7A 5BRPA 2WC3A 2J62A 2ZOXA 1B3ZA 2CBJA 1C92A 1J12A 1LLOA 5A6MA 3L4YA 4FLSA 2W61A 1MQRA 2ZUNA 1V03A 3OG2A 5BROA 3BH4A 2ZX7A 4ZXLA 4CVUA 3RCNA 1CGTA 2V3EA 1ZBKA 2XGBA 1XV8A 4W85A 1E6XM 1XGZA 4BA0A 4GZIA 2VOTA 1JZ2A 1HT6A 3W24A 4BCEA 2VX6A 4P7QA 4E2OA 4L4PA 2WPGA 1UR9A 3N9KA 3GNPA 3PTKA 4NZCA 2IUZA 4W5ZA 2HISA 5IDIA 2CYGA 1UH4A 2YA0A 5AY7A 3PTMA 3WUBA 3UR8A 3AIRA 1FP8A 3MUAA 1CGXA 3PN8A 1V02A 5A69A 1QBAA 2YLLA 3EMZA 1HIZA 2D23A 4JCLA 5DEZA 1UD3A 2ZX8A 2BY3A 2WVTA 5AC5A 2FDMA 3CO4A 3AIEA 2WK2A 4A4AA 1C7SA 2ZUUA 1ZB5A 4MB3A 2J7EA 3ALGA 1GOWA 4Q22A 3GNRA 3VKKA 1K6AA 1KBBA 2E8YA 2V3DA 3U57A 3SCQA 1G1YA 2BY1A 1L8NA 5KZ6A 1KGWA 4JL2A 1B3WA 4ZENA 4B16A 4CN6A 3FXYA 3F5JA 1ODUA 1E70M 3GBEA 2E8ZA 4HP5A 2XWEA 1Y7VA 1UOKA 4BS0A 3GM8A 3ARQA 1UYQA 5I2UA 4CD8A 4PEEA 4CKQA 3W26A 4B3KA 3VNZA 4P7LA 4AISA 1XH0A 4Q7NA 2FHCA 3W4RA 4M29A 4PMZA 3MMUA 1I1XA 3ZT6A 4W89A 2XHYA 3A4WA 1EO5A 2W91A 5GPRA 3FY1A 2UY3A 5A6BA 3BAJA 2C8NA 2FGZA 1ISVA 1OGSA 2OYKA 2WM0A 3K8KA 3WQWA 4BQ3A 1UKPA 3WD2A 1IV8A 3MUY1 3DYOA 4MAZA 4FLRA 2WCSA 1JZ6A 2WSPA 1BVZA 1H0IA 3GZAA 2GJXB 1HL9A 3QHNA 3VD5A 3WEOA 5I78A 2WCGA 3U5UA 1OWQA 4CU8A 1EGZA 3ZT5A 1ZBWA 2ZIDA 3CUHA 2J25A 1U33A 1HVXA 1IZJA 1HN1A 3T0AA 1WPCA 1FOBA 5E09A 3WDIA 1LWJA 4GXPA 1SFSA 2NT0A 4EKJA 2WXDM 2VO5A 5D8ZA 4CVWA 3RIKA 3MMWA 3QHOA 2DSVA 2O9TA 3VD3A 1HX0A 2PBGA 2YL5A 4HMDA 1E43A 1BGGA 1PPIA 4YHGA 1J01A 3WH8A 1E0VA 2C7FA 2JF6A 3EDDA 1V6UA 4PMXA 3W82A 3JUGA 3W6LA 1LG1A 2CHOA 1W9PA 3ARTA 1E72M 4UFLA 5C70A 5CPTA 3OGVA 4HTYA 3GXMA 3M6DA 1UR1A 2CKSA 1HP5A 3EDKA 5BXTA 3ZOAA 1RD6A 2X0HA 4DUXA 1VEPA 4DWSD 5A6JA 4J3UA 2A3CA 2XJ7A 3AHYA 2ZX6A 4S3KA 4JHZA 3DC0A 2WHLA 2YIHA 2AOSA 4MDOA 3UESA 3WF2A 1MW3A 1GOQA 1J18A 1VBUA 3IAPA 3VIKA 4UQDA 1JYWA 4Z2HA 1R8LA 1AQHA 4U3AA 4W87A 3TTSA 1H5VA 2QPSA 1Q6CA 3GDBA 4CD5A 3KWXA 1UWQA 2WVVB 4J28A 1EO7A 3CIVA 3T0DA 2XVNA 3AMKA 3IANA 3ZT7A 1UZ1A 3B9EA 2WC7A 1GPFA 2MANA 1QBBA 4F79A 3NDZA 3UR7A 3WDQA 3GH7A 4UNIA 4M24A 3N17A 1QNOA 4PBGA 4LGXA 4IUGA 4UOQA 3ARWA 4UTFA 3ZSTA 3N04A 1HKKA 4KH2A 2G8ZA 3TTOA 2J7GA 1XD1A 5D9MA 4MNKA 1OGGA 3BSHA 3FAWA 5ABFB 3DHUA 4OOZA 4TX8A 3MV01 1WZMA 1CZ1A 5A95A 1SMAA 5JIPA 2WMIB 1OSEA 2VC9A 2OWXA 1V3HA 1V3KA 5HXMA 4AD5A 3PZNA 3ALFA 4D6FA 2G3JA 2PC8A 4LPCA 1XD0A 2VZOA 4NRSA 3CTTA 4QCEA 2D24A 5CSYA 2GK1A 4BQ2A 1WDSA 1JD7A 3FN9A 3WL1A 1H11A 1UKSA 1VBRA 2RGLA 1ISZA 3SUTA 3AI0A 2ZXAA 2DT2A 4QLKA 3AS0A 4HA4A 1UR2A 4UQBA 5I79A 1JZ4A 1KCLA 4GPNA 4BZYA 2BHUA 2WWDA 1CYGA 1H41A 3I3BA 4DWSB 2ZXQA 3L4UA 1J0IA 1VFOA 1G94A 4XZWA 3TOPA 4NF7A 2G41A 1TZ7A 5CZKA 1BAGA 3DYPA 2FHBA 2D0HA 1X6LA 1E9LA 1PX3A 1E4LA 5C71A 3VD7A 3POCA 3WQ8A 2DIJA 4AMCA 2F8QA 3SUSA 3DHPA 1OM0A 3WF3A 1W9UA 5C8BB 1HJVA 1C90A 4HU0A 3FHAA 1UHVA 1QHPA 2YDSA 1LL4A 3AS3A 4TX6A 3ZIZA 1J0YA 3GNOA 1CPUA 4QLJA 2OYMA 2OSXA 2XVPA 3IJ7A 1DP0A 5BXSA 3ZSSA 3WL0A 4MAVA 1MXDA 2EXOA 4V2XA 2Y8VA 1V6XA 2XWDA 1J0HA 3VILA 2V3FA 1RP8A 2EPOA 1HL8A 2Z1KA 3VDBA 2PWHA 3ECQA 3A4XA 1RH9A 5E6YA 4CGTA 1W2VA 1JI1A 3L4ZA 1EH9A 1R7AA 1Q6EA 4HZ6A 4Z2IA 3RJXA 1PZ2A 4HA1A 3VGEA 5JBEA 1QI2A 3PZMA 1VF8A 3GXFA 1QW8A 5I6SA 3ZR6A 2VT0A 4DM2A 1UR0A 2OYLA 2O9RA 4XV0A 2W67A 2VX4A 3MV11 3WH7A 2OWWA 2DT1A 3OB8A 2VTFA 3WD4A 3OLGA 2CBIA 5DMYA 1UD4A 2YL9A 3ZJKA 4DUVA 1GVIA 1EQCA 3PZOA 2WZIA 2WLZA 1UUQA 5EFFA 3ARYA 1BGAA 4CD4A 1WCGA 3SCRA 2JF7A 5A8QA 1JAEA 3N18A 4UFHA 1JZ3A 5A94A 3VD4A 4LQ1A 2YA2A 2DIEA 3RM8A 3WD1A 4AZBA 2XPKA 3AMCA 1EDGA 3TTQA 2VRQA 1E40A 1XRVA 4C7DA 4PSRA 2V5CA 2ZUTA 1QI5A 4B9ZA 2XFRA 4PMVA 1VFMA 3MS8A 1JNEA 3CBWA 1LF1A 1DTUA 1C8XA 5D8WA 3WD3A 1UKQA 4S3JA 3N15A 2CKRA 1BYCA 1JDAA 3BAWA 3WN6A 2VQTA 4CU7A 2VR4A 2E40A 4AWEA 4V27A 5LA1A 1CENA 3U7BA 1N82A 4X0VA 5FIPA 1AQ0A 1UH2A 3APGA 3WQVA 4MNJA 1UG6A 2D0FA 1HKJA 1JNDA 3AZSA 4EK7A 3LPFA 1OD8A 1E6PA 4A3HA 4DM1A 1LQ0A 5AC4A 3VTRA 4AC1X 2GJXA 3LPOA 3UETA 3OZPA 3WUEA 2HVMA 1PJ9A 3BMVA 1MWOA 2X8RA 1SYTA 1VIWA 4H04A 4AZ7A 1GQKA 3N12A 3CZEA 1DWFM 2A3BA 5DT5A 3WUGA 3WDPP 5CG0A 4OKDA 3BXWA 4JFVA 4HOWA 5I23A 4F9JA 3VDHA 3VMOA 1W2PA 1OB0A 2B31A 5EBAA 1BPLB 4EE9A 3CHEA 1K9TA 2EBNA 5D4YA 4U5KA 4M82A 1QNQA 4MDPA 4P8UA 5HOSA 4PMNA 4JCMA 3PHAA 4AD0A 4OOUA 2VL4A 3RDKA 1W1PA 1A3HA 4JAWA 1NP2A 1GJUA 5IFPA 2F61A 4D6DA 1JZ8A 3PZTA 2NW0A 3EDJA 5CQ1A 1H3GA 1U2YA 3MUIA 5FCZA 1CXHA 4UQAA 1FFQA 4ACZB 1QPKA 3RMEA 3NIYA 2BY2A 3U5YA 2Y4SA 4D71A 3TA9A 2WANA 1NWTA 2JEQA 3GXDA 4AD4A 4LXFA 3CUIA 3WH6A 1XYFA 3PZ9A 2DDXA 2G3IA 3FAXA 3AS2A 2VCCA 4AEFA 2BY0A 2ZICA 3F4VA 1JDCA 1W1YA 2WLYA 3CZKA 3FHQA 1CGVA 1QI0A 1ODZA 6CGTA 5ABGA 2W66A 3T2OA 1V3MA 2G3MA 3ARVA 1TCMA 2CNCA 5KEZA 1XHGA 1HP4A 2AAAA 1IT0A 1X1NA 1KBKA 1PIFA 1BFNA 1GONA 4U33A 1TUXA 1B0IA 1AQMA 1VJSA 4EAMA 2DSUA 2C0HA 2DPEA 2O9PA 1S46A 5HNNA 5F7UA 2VZUA 4F8XA 1JFHA 1GQJA 1AVAA 4C7FA 1NOFA 2DQXA 3UEQA 3CMJA 1BHGA 1BLIA 4PSPA 4NRRA 5E9AA 4AXNA 1DEDA 2XFYA 2WAGA 1GW1A 3OLIA 2J7CA 3W29A 3OA5A 5JBDA 2VRJA 3VNYA 1V6WA 3AHZA 3W25A 5JIWA 3SCWA 2ZX5A 2WZEA 1W9XA 2X2YA 1W3HA 3NSXA 5JBFA 1C7TA 4E4PA 1ITCA 4JKMA 4OUEA 3K8LA 3VM5A 3EDFA 3BCDA 3W0KA 1E4NA 1E6ZA 1EOMA 2DT0A 3AMDA 4H2CA 2X1IA 4HMCA 1W3JA 4ML4A 1M53A 1W9BM 4HU8A 1VFFA 1E1FA 4BQ5A 1DHKA 1UWIA 4OBSA 2VCAA 4UR9A 2XTKA 4CCEA 2ZE0A 4JHOA 4M8UA 1CXFA 4MB1A 1NWSA 2BNJA 3CMGA 3CHCA 4U5IA 5CLWA 3SIMA 1MQQA 4UZSA 4J3VA 2E9BA 2XGIA 2W4XA 1V3LA 3B9AA 5CSUA 1GCYA 2WMIA 4MB5A 4PTXA 3WQ4A 2YL6A 4PMQA 3SUVA 3MSDA 1XSIA 2XUCA 2XIBA 4P7NA 4IISA 4XB3A 1TG7A 3ARUA 1KXQA 2J8GA 3L2LA 4KGLA 1WAWA 1KFWA 1OGBA 1R86A 1C8QA 4J7RA 1NOWA 2WBKA 3N13A 3DYMA 1UZ4A 4CN4A 4M81A 1HJQA 4AZ6A 4W86A 3OLDA 3TTYA 3ARSA 2IXUA 1CTNA 2PWFA 4W7WA 3W6MA 3EDEA 4B15A 1EA9C 2DSWA 4UOZA 3HU7A 1ITXA 1VB9A 2VX5A 2J7BA 1LL6A 2Y5EA 4W84A 4N0RA 2YBUA 1GHRA 1DWAM 1FH7A 3T08A 1CGUA 1SR0A 4WIWA 3OBAA 1R85A 2WMGA 3VIGA 5FL1A 1Q6DA 3SCPA 4PTMA 2GDUA 1V6VA 5FD0A 2BHZA 3ZMRA 4XUYA 4E8DA 4D6CA 1DWGM 2XM2A 1JD9A 4PCSA 4P8VA 3F5LA 4WKAA 4UOJA 2XSBA 2DGAA 1FH9A 2BVDA 4YN5A 2WVUA 1TA3A 1I75A 2XVLA 3OLEA 1ISYA 5GNYA 5CXPA 4D6IA 2E4TA 4CCDA 2EPLX 1CXLA 3CUFA 5I77A 1H49A 4Z2LA 5LA0A 5GNXA 1YQ2A 2EJ1A 4JZ5A 4H8VA 5M03A 3CZLA 3KL5A 1WE5A 4MNLA 2UWFA 4H7VA 4PRWA 3VIIA 1W3KA 2PWEA 2OWCA 1BYBA 1EDTA 4RE2A 4FK9A 4HA3A 2GK1B 3VVGA 1VEMA 4W93A 1UD2A 2ZUWA 3K1DA 4AIUA 3WQ6A 5HPCA 2VJXA 1QI3A 3EYPA 3WEMA 1WZAA 3S6TA 1H4PA 1WZKA 2JFEX 3D3AA 3WF0A 1OD0A 3I3DA 5CLTA 3WEZA 4ATWA 3HJEA 1CECA 3CZJA 3BCFA 4NSBA 1GZJA 4TVUA 1QW9A 5FL0A 2WYSA 3NYDA 2BXYA 1JXJA 5E0CA 1Q6FA 1E5JA 3T2PA 4DUWA 3ARXA 1PIGA 1GQIA 3ZJ8A 2D0GA 2J7FA 4P8XA 1B3YA 1I1WA 3SCNA 1W32A 2EPMX 3WDJA 1OBAA 2Y24A 2CESA 4GO8A 2W62A 1HJUA 3SCUA 2OSYA 1B2YA 4MJ4A 1MFUA 3AFBA 1FH8A 4Z2KA 1PX8A 1E6RA 1H1NA 1KGXA 1V0NA 3FW6A 1ISWA 1MFVA 3WF4A 1J0KA 3IJ9A 1PAMA 3W28A 2EPNA 3J7HA 5HDRA 3W81A 2QLYA 3CHDA 1V6YA 4CUCA 1NP0A 2BXZA 5AYBA 3BMWA 4CD7A 2XFFA 3OIHA 4W5UA 2GDVA 1W3LA 1XSKA 5CGMA 2BVYA 2WHJA 2WZHA 1EDQA 4PCTA 1CLVA 3NJ3A 1BG4A 1F4AA 3KZSA 4WKHA 3AS1A 1FA2A 3POHA 3AXHA 3MANA 3PBGA 1MYRA 4TUFA 3QR3A 1EOKA 1PBGA 3WNOA 1PX4A 4W8LA 3D5HA 3K4AA 2XG9A 4UQCA 2J8FA 3RM9A 1UR4A 3VMPA 5A6AA 1M7XA 2WMFA 1W91A 2WMKA 4XZBA 2J7HA 2QV4A 1LG2A 2VNCA 4IPLA 1M03A 4QCFA 1V0LA 4HOZA 2D3NA 2A3AA 4LYPA 1XH1A 1US2A 1KXHA 1HJXA 1GNXA 2WNWA 3ARPA 1TE1A 3GYCA 2QMJA 3A3HA 3KE0A 3W53A 5IFTA 1JAKA 1J9YA 3ARZA 4WK9A 1K9DA 2PB1A 1UQZA 3BLKA 2D20A 1TR1A 4W8BA 4PMYA 5E70A 3AIQA 3CGTA 2JIEA 2W63A 2V38A 3QOMA 2PF0A 3AICA 3WH9A 1D3CA 4UCFA 4KRUA 3K4DA 4QFUA 1PZ3A 3AZTA 2UY2A 3OZOA 2CITA 1VENA 1O6IA 2X05A 1W1TA 1CWYA 3QHMA 4OBRA 1QOXA 2D2OA 1BYDA 4TOQA 3WIJA 1NH6A 1P6WA 2J47A 1LWHA 3PZVA 1CEOA 5M17A 4HOXA 2WKGA 1UH3A 1V0MA 3QGVA 1NOUA 3DECA 1QI4A 2O92A 3WD0A 3AIWA 3PZUA 4ZE4A 4PMDA 4H41A 3SUUA 3ZJ6A 4J27A 1UD5A 1G01A 2WHKA 2W5FA 3ZQ9A 3VIHA 1OINA 3W27A 4D6JA 3SCVA 4Z2JA 1EIBA 4TVDA 1NARA 3PTQA 1B1YA 3VMNA 3M46A 1NM9A 3RILA 3G6LA 3O9NA 3VX0A 3AHXA 1BTCA 4WF7A 1GOIA 4BF7A 1QHZA 1CXKA 4WLCA 1MW0A 4P7OA 8CGTA 3SUWA 3VU2A 4ATLA 5JUVA 2J4GA 1O7AA 1ZBVA 4AY1A 2YOCA 1TVNA 1G5AA 4J3XA 5A8OA 4AD3A 1UKTA 2VR5A 3LPGA 2WSKA 5LA2A 2XIIA 2X09A 1V08A 5E6ZA 1TMQA 1RPKA 3HN3A 2E0PA 1K9EA 5FKYA 1GJWA 1R7OA 4F66A 2UY4A 1FFRA 1GOOA 1H0GA 1C3FA 2XM1A 5EB8A 3RO8A 3T2QA 5GNZA 1Q6GA 2VZTA 1GUVA 1E15A 4ZEPA 1ZL1A 4GI9A 3PZIA 5M5DA 2DT3A 4JFUA 4J3TA 1HNYA 1G0CA 1SMDA 1WDPA 3AHTA 1E55A 3WNNA 1JXKA 4AZCB 1E0WA 3CZ8A 2VUYA 1E6QM 1KR1A 1KWKA 4URIA 1CXEA 1JZ7A 3WF1A 3WDHA 4AW7A 3NCOA 5D9NA 2PWDA 1V02E 4D6GA
chains in the Genus database with same CATH superfamily
3M9YA 1YPXA 1DQWA 3BANA 4Y96A 3LV6A 3IS4A 1VP5A 2ZXDA 5DRIA 1VPXA 1SFJA 2QYGA 4L64A 3F1QA 2BS9A 6XIMA 1ELSA 9CGTA 4E8CA 4GACA 1T8XA 1HXJA 3T44A 2QGHA 1E1CA 2D1ZA 2DP3A 3FS2A 3AXKA 3MYOA 4Q4MA 3TP4A 4U31A 2D2HA 4KWUA 4PN2A 1IXOA 5LIWX 2NUYA 3G6MA 4EPDC 2GSHA 4PYSA 1TX2A 4XZIA 4QROA 4GIAA 2Q8XA 5I7GA 3O6YX 2J9XA 4ML9A 4ZODA 3HBLA 5ABEA 3L4XA 2VMFA 3INPA 3KL3A 2AL2B 4YJ5A 1YPFA 2WKLA 3BURA 4U3CA 3IK2A 1E5NA 2AL1A 1VPQA 3TEVA 4XWUA 3ME3A 1ISXA 4B2DA 2DJLA 4GXWA 3MO7A 3E0FA 2XYLA 4WJXA 4JKKA 3V0SA 3GNNA 3PWGA 4LVGA 3VX1A 5A2BA 3I65A 3KEHA 4HHMA 1ESWA 1K3UA 2JEPA 3CV6A 4JIHA 1POKA 3LSBA 1RA0A 3WBEA 5EMYA 2ZZ5A 5ENLA 1NAL1 4D1IA 1TTJA 2DZAA 3RAOA 3VDCA 3E3HA 3VGBA 4RZ5A 3NO5A 3DN5A 4DELA 3GY1A 3LMYA 2CIPA 2UY5A 2QVHA 1QPOA 1R6WA 2ZUMA 4Q32A 2J75A 4HT3A 3MMDA 3ZR5A 5I3DA 5C9WA 5F2IA 3GXTA 4NNBA 1OIMA 3HPSA 3UG5A 1MSSA 2X42A 4IP5A 1S2WA 1BWLA 1WUFA 3AAMA 4XISA 1ZRQA 4F0LA 5DXYA 3MCNA 1J0JA 1LYXA 2YCEA 5C9ZA 2HE8A 4ECLA 1X98A 4N02A 3VPLA 3VGDA 1G9HA 3NO3A 3QW4B 4E38A 1XSJA 2Y7DA 1W1A1 3HB9A 1OT2A 2GSJA 2WWCA 4S2CA 1Z44A 3VOCA 1ICSA 5K9DA 4WY0A 1AD1A 1FWIC 3KXQA 1AJ0A 3ONCA 2WBGA 1UA3A 2EPKX 3KP0A 4GKLA 1PWLA 5REQA 3TCSA 1M3UA 3M5ZA 2DORA 2NLIA 3WX7A 4U2YA 2YR1A 5C9RA 1JDDA 3H21A 1XCWA 1RQEA 3AQUA 1E4IA 3DG3A 3B9DA 3QKEA 3II1A 3KP1A 2OODA 3R0UA 5DX7A 2QPUA 4QAWA 3S9IA 3WMCA 1JRCA 2YBTA 1WXJA 4YPJA 3I10A 1FRBA 1LWIA 2E67A 1WBHA 5GJNA 5EFDA 3KBVA 3CUGA 5IBXA 2Z1BA 1DV7A 3KZPA 4OTKA 3W1RA 1EC7A 2EKCA 2PDHA 3WQ5A 3T42A 2HVOA 2XGZA 4BQ4A 1LBMA 4FXJA 3G0XA 5D2TA 1ECEA 4XAZA 1E73M 3XINA 3VAVA 1UA7A 4DN1A 5FJTA 2QDDA 2DH3A 1VLWA 2OLHA 1UZDA 3R79A 4Z0JA 4QS5A 1NWUA 3N3MA 3QY7A 2C13A 2NUWA 4JQ4A 2YW4A 3KS5A 1WDRA 4GINA 1B31A 3EXTA 1V77A 3NQFA 3A4JA 3K2GA 1BG9A 4W4QA 3UERA 4Q7IA 4R27A 1VLIA 3MY9A 1TZ9A 3GC4A 1HFBA 1R9ZA 1CLXA 4C1NA 4JTTA 1DIEA 3NSMA 1IWBA 3I6EA 1XIDA 4E5TA 3ZFHA 3BG3A 4JPGA 1UWRA 1LJYA 2ICSA 5DBTA 1Q4WA 3H6OA 4AQLA 5LIYX 3KOZA 5HWJA 3CZGA 1XIJA 3S5SA 4R9XA 2R6OA 4GZJA 3UWVA 5KINA 1F07A 2A79A 4HK6A 5A6KA 5FOOA 1V0KA 1FQ0A 5BXRA 1WZLA 2QUVA 1S2UA 3SIZA 2QCCA 2CBVA 4LB4A 2ZDSA 2J9YA 3QM3A 5IRPA 4IGMA 4XBJA 2AMXA 3ONBA 4O19A 4H6RA 3HQPA 3W2KA 1XYAA 2PZ0A 5TD4A 4UFJA 2E6FA 4O1EA 3SB0A 4DB7A 1XLLA 3B0PA 3UT0A 2KZHA 3W2MA 3KLKA 3QSTA 4B91A 6TAAA 5FSEC 4ZOAA 4H8HA 2NV9A 2FMNA 7ODCA 4GFSA 1QHOA 2TYSA 5A2AA 4RXGA 3GIQA 2F9RA 3EEGA 4GQQA 2OOFA 1H7NA 2ZUVA 4MYXA 4JFTA 2PA6A 2E5DA 1UMYA 1I0BA 1GOKA 2YYUA 1IWPA 1EWEA 5DMLA 5LNUA 3U6WA 3WLPA 3GE7A 3S1XA 1FHVA 4TTUA 3W7KA 3VD9A 3WJXA 3QJAA 2DUZA 1UKOA 1A5NC 4L4MA 4UTJA 2HNEA 3GC2A 1MQPA 3WUFA 1JF5A 4ZXOA 1FP9A 3C52A 4R5EA 1DXFA 1Q6OA 2NX9A 2QS8A 1K8XA 3AXIA 3G18A 2WQPA 4LRTA 4JFWA 4PZVA 5FEXA 1K9FA 2H3BA 3R10A 2JE8A 3BAKA 4HNVA 3S9ZA 4UTTA 4ZVJA 3LHWA 4H8NA 4XK2A 3NM1A 4AIOA 4LAMA 4GVHA 3DENA 3KM8A 3NQAA 1TVLA 2OVLA 3QKZA 1DWJM 3T9PA 4LF1A 1SZFA 4QR6A 5ECUA 1M5WA 2DEPA 1KXVA 3PWIA 4PMRA 4LUYA 4Q8VA 3R8HA 5CSSA 4XAGA 3E38A 2Y89A 4GO9A 3G8RA 3BC9A 2FHFA 3SN1A 3VINA 3EA2A 1TWIA 3JVAA 2J7DA 3QOKA 3W38A 1V4YA 1N8IA 4AZIA 5I02A 4IQDA 3B0XA 1OX4A 3R6IA 3G3DA 3HPFA 4V28A 3UG4A 4LRSA 2J79A 1HGWA 1CDGA 3QF0A 2VFEA 2NSXA 4MUPA 5FF0A 2NUXA 2VZSA 5I3HA 2CBUA 5A2CA 2P3EA 2D73A 3KBJA 3DGBA 2Z1SA 2PDCA 4MJ2A 6REQB 4GISA 4NAEB 3QZEA 1KBJA 3VNDA 1N7KA 3PB0A 5EMLA 4GYJA 5C0QA 3HURA 1O1HA 2WC4A 3TJLA 1JQVA 2OZ8A 3T0BA 4AVNA 1R3VA 4OZOA 2FGLA 1XDMA 2DH2A 4P8WA 5F2LA 2CERA 4H7CA 6REQA 5M3WA 1ICQA 1YXDA 1F5ZA 4NXSA 1KLZA 2O7SA 4MLJA 1XH2A 1UJPA 1IXQA 2W6RA 1EJXC 1NSJA 2V5BA 2CPUA 5BXPA 4YHEA 1QNRA 4HIBA 5BRPA 2J62A 1HZYA 3S0CA 1JRBA 1G69A 3Q2DA 1MQRA 1Z8AA 1PCKA 3BH4A 3GHRA 3W2JA 9XIAA 3KVLA 1ZPTA 3L65A 3P60A 3OO2A 3RCNA 1LLWA 1ZBKA 3DESA 1LT8A 3U3HA 1XV8A 2WQDA 4W85A 5KITA 3RLHA 4RJEA 4B4HA 3IEBA 2PTDA 1VQTA 2PGRA 3B3DA 1QT1A 4BCEA 1QNVA 3DBPA 5AYZA 1UR9A 2Y61A 3O1NA 4NZCA 3O05A 1H63A 1S39A 2CYGA 3CIWA 3PTMA 3WUBA 1JCMP 3AIRA 3NQ7A 3F2CA 1EYEA 2YLLA 3EMZA 5L9FA 3APTA 3M5VA 1R30A 2WJDA 2WVTA 2XH2A 3PPFA 2WK2A 1YTEA 4GLEA 3PC0A 2J7EA 2DJXA 2RAGA 2YB4A 4JOMA 4D9PA 2I5GA 1K6AA 3HIJA 4R7JA 4GIEA 2V3DA 1AG1O 1YDOA 1AH3A 2RJHA 2V2CA 4B16A 1FDYA 4GGHA 3RX3A 3FXYA 3W7IA 2WNZA 1OYCA 2PGWA 2XWEA 1Y7VA 4RDWA 3OYZA 4JTUA 1OG6A 4CD8A 4CKQA 4LVBA 3W26A 3LNPA 2EPHA 3TNBA 4I8YA 4AISA 4O11A 4C6KA 1DTNA 3MMUA 1A5OC 4KPLA 4HHHA 1Y5VA 1EO5A 1R2TA 2CLLA 4HCDA 1WYIA 3UF9A 5A6BA 3GG7A 2ZE3A 4NG3A 3LEPA 3RPTA 1ITQA 3CQIA 2C16A 5LNWA 4AG0A 3WQWA 1YE4A 3CO8A 4BQ3A 4LBUA 1IV8A 3MUY1 4FLRA 4AU0A 2WSPA 1BVZA 1H0IA 3GZAA 3NR0A 1MEIA 2GJXB 1V93A 2GGEA 1HL9A 5I78A 1FWNA 1S2VA 1TYGA 1XR2A 2QDHA 3QY6A 2QIIA 1EGZA 3ZT5A 4D8AA 2J25A 3PVFA 1IZJA 2VUNA 4GXPA 2WPBA 3DHFA 1E0UA 2NT0A 4OGZA 1UC5A 3LCHA 1D9EA 3P82A 1ZQ5A 5D8ZA 3VI2A 1Z6KA 3DKJA 3W9ZA 3RIKA 3QHOA 2DSVA 2O9TA 3IGUA 2XZ9A 2PBGA 2YL5A 4NP7A 3LYEA 3PNZA 1E43A 3ELFA 1ZTVA 5PTDA 1PPIA 1RY8A 3B9OA 3EB3A 1Z3NA 3WH8A 3IRSA 2C7FA 2JF6A 2VKZG 1V6UA 3W82A 4D8LA 2CHOA 5FJUA 6PTDA 1CB7B 2FJKA 1XW8A 1A3XA 3SM0A 3W2NA 1PTAA 1DOSA 4H6EA 4REQB 3GHSA 1HP5A 4A3UA 1RD6A 4DWDA 4JX6A 4CEUC 4O1DA 4DWSD 5A6JA 1Y5WA 1D7KA 4S3KA 2V69A 1RZMA 1EBHA 2WHLA 1EJWC 2YIHA 4IIDA 1J93A 1OF8A 1GOQA 1GYMA 3I6TA 1OCNA 4BEUA 3IAPA 5LIUX 5EL1A 4UQDA 3G22A 3CL8A 1AQHA 3GO2A 2DZUA 3UWWA 4W87A 5KTLA 1K8YA 3L67A 4LS2A 2A7PA 4J28A 2ZZ3A 2V30A 3T0DA 1EX1A 4L9YA 1GPFA 2DUAA 3LA4A 4H2HA 4O1CA 4UNIA 4Q6JA 3WQOA 3FA5A 2VEFA 1J96A 3S42A 3CTLA 1J6OA 3N04A 4AX7A 1OYBA 4KH2A 1XD1A 6ENLA 4E4FA 5ABFB 4OOZA 3PBYA 5A95A 4C6DA 2HPMA 1LRQA 1KFEA 3R94A 5HXMA 4XD4A 1U22A 3PK7A 1XD0A 4DBUA 3CAKA 3CQ0A 3GR8A 1XF0A 3P5ZA 1QATA 2GK1A 1JD7A 1H11A 4PTNA 3WQFA 5EY5A 3PPCA 4O10A 7TIMA 1WXYA 4JTEA 4QLKA 5C2CA 4HA4A 1UR2A 4UQBA 2V67A 4GPNA 4YIWA 5TAOA 3L4UA 2H8ZA 4O54A 1J0IA 1VFOA 1G94A 1VYRA 4DQWA 4NF7A 1IWAA 5CZKA 3BOXA 4UTKA 2IW0A 1X6LA 1E9LA 2GOKA 1E4LA 1LRNA 3VD7A 3TXVA 2ZRXA 1NDYA 4INFA 3VE7A 3MP3A 1OM0A 5G1TA 1JCYA 2YCLA 1HJVA 2H6RA 5K3VA 1M6JA 5AYYA 5CSRA 1ME8A 1UHVA 2HROA 4TX6A 3ZIZA 3LERA 3DAQA 2OSXA 3IJ7A 3WL0A 4MAVA 2EXOA 2PFHA 1V6XA 3RXZA 3TXZA 2A7NA 1RP8A 2EPOA 2Z6IA 3W1TA 1RLDA 2Z1KA 3JRKA 4EX4A 2NZLA 3M0KA 4S1FA 3IPWA 4BR1A 4FS9A 1Q5MA 1R0MA 1JI1A 4IIEA 1ME7A 1Q6EA 3BLOA 4Z2IA 5BU9A 3ITTA 4HA1A 3VGEA 4C6EA 4UBPC 1VF8A 3TR2A 2RDTA 3W1LA 2OYLA 4XV0A 1LBLA 2OFJA 4B3ZA 3MV11 3UVIA 2VTFA 1QJWA 4CLMA 2OX4A 5DMYA 2YL9A 1GVIA 4K37A 3GR7A 4S3CA 3FEMA 1YXYA 3ARYA 4CD4A 2JF7A 5A8QA 3DOPA 1JZ3A 5A94A 3QGKC 1JJKA 3GU2A 3VD4A 3TCEA 4LQ1A 4O12A 1EDGA 1XRVA 1PVNA 1Q7ZA 3TJIA 1QR7A 5F4SA 2V5CA 2ZUTA 1QI5A 4B9ZA 2V9DA 2XFRA 4KEZA 1LCOA 1EZWA 1C8XA 5D8WA 4IIHA 3VOHA 4S3JA 3N15A 2UV8G 2CKRA 2HNHA 4B5VA 3W7MA 3HJZA 4P5UA 3TN4A 3LMZA 3WN6A 4CU7A 3H2AA 4WJEA 1A5MC 1XQKA 2VGIA 1GEQA 2ZZ7A 3W00A 5LA1A 5FIPA 2Z29A 3WQVA 2XN0A 1OC5A 2D2JA 4G1NA 5DMNA 5EMJA 4XAPA 4IIBA 1UG6A 3QZ6A 5MKGA 1YLVA 3AZSA 4U4MA 5AN7A 4A3HA 1KO0A 3HM7A 4DM1A 4A6GA 1S5VA 4TQTA 3N29A 3LHTA 2GJXA 4FEZA 3IJDA 3TMLA 3OZPA 1RXOB 5B7YA 1SU5A 3H24A 2X8RA 1SYTA 2FVKA 3A64A 1VIWA 3VE9A 4N9DA 3N12A 1H50A 3CNYA 3CZEA 2A3BA 1TPC1 5DT5A 3FX4A 4FIRA 3NQMA 1PE1A 3CQKA 1ZALA 3W1MA 1W2PA 5EBAA 1BPLB 3SY8A 1RBLA 3ZLGA 2EBNA 3TFXA 3RITA 1QNQA 4KFOA 2VEPA 5HOSA 4PMNA 4JCMA 3MB9A 4I6VA 3ZXWA 3IRDA 3FIGA 3PZTA 2NW0A 1H3GA 4OVXA 3W7PA 5FCZA 1XUZA 1NEYA 1DYSA 3UCDA 3B4YA 1QOQA 4GYFA 3NIYA 5DCEA 2QF7A 4ZQPA 3P61A 4AD4A 2PTZA 1GZ1A 4LUJA 2DDXA 3W2UA 5CPLA 1EF3A 4LB3A 3GQYA 4C6MA 2CLOA 4GWEA 4O50A 4Y9MA 4AY8A 3MI6A 1CGVA 2BGQA 3W7HA 2CWNA 2A0NA 5GJMA 5F4WA 4DEFA 2Z1XA 1TCMA 4KWVA 4H6QA 1DQUA 3TNOA 1FWDC 1X1NA 1LLZA 1KBKA 1TUXA 1S2TA 1VJSA 1WAUA 2ZTJA 3CL6A 1S46A 5HNNA 5F7UA 3CYVA 1TX0A 4CNNA 1GQJA 5AVNA 4C7FA 4QE5A 1NOFA 3H12A 3VZXA 3UEQA 1BHGA 1BLIA 4NRRA 1DEDA 1UPMB 2XFYA 1GW1A 3OLIA 3TC3A 1S5MA 3FA3A 4H7ZA 2C6QA 3XISA 1QOPA 3W25A 3QR1A 1TQJA 3SCWA 1W9XA 4LCQA 4XSLA 1CX9A 4A3QA 3G1HA 4JKMA 4ZR8A 2GOUA 3CT7A 1UBSA 3IIOA 4H6KA 2HTMA 5L6UA 2F7FA 3SJNA 3AMDA 1S1RA 1W17A 1M53A 1VFFA 2ACUA 1E1FA 4BQ5A 3OVQA 2HK1A 3V7PA 3VZYA 4CCEA 1L6FA 1ZAIA 3REQB 1IR1A 2ZE0A 3W75A 3A9IA 3EKZA 2QUUA 1IEXA 4FNPA 4MB1A 3FKKA 2BNJA 3CHCA 1EL3A 5IBXC 2E9BA 2W4XA 4PBFA 3BE7A 4MB5A 2YL6A 4BF5A 1UP0A 4K2SA 3GTHA 1XBXA 3L2LA 4JQ3A 2FQIA 1OGBA 3NQGA 1R86A 1C8QA 3H4GA 1NOWA 4MGGA 3GZ3A 3IUHA 2XDFA 3DYMA 2QCGA 4CN4A 4M81A 2IPFA 3DX5A 1KV5A 4DF0A 4RDVA 4IICA 3TTYA 1IYXA 3G1VA 3UW6A 1VB9A 2A3LA 3H2OA 4X9SA 2J7BA 3R13A 2G5WA 1GHRA 4Q8MA 1O60A 2R1PA 4GYPC 3W85A 3A9BA 8XIAA 1KKRA 4MG4A 3VIGA 3W1UA 5FL1A 3CEUA 1T6MA 4MJZA 2Q02A 3FKRA 3T7VA 2I7GA 4KF1A 2PRMA 1LUCB 4KIRA 3ZMRA 1FWHC 3C5QA 2VEKA 3ES8A 3MHGA 3OOQA 3CT2A 4OQVA 4L61A 2YCLB 3UWUA 5BU6A 2BVDA 3MI2A 5HA7A 1JUEA 4B92A 1TA3A 2W27A 3OLEA 2V5KA 4NUWA 4DBDA 1D3GA 3TH6A 1XGDA 4DJFC 4DNHA 3CUFA 2QJGA 1EGVA 1YQ2A 1VR6A 1KBLA 2F2KA 4S39A 1WE5A 4MNLA 5HULA 4IIGA 2GJNA 3BLFA 4Q8UA 1EDTA 4RE2A 1SW0A 1M1BA 4U28A 3EPOA 2FJUB 1QI3A 3EYPA 4YCPA 3BQ6A 2PLKA 1WZKA 2JFEX 1QWKA 4NL1A 3G1YA 3R8GA 2FPYA 4A21A 2OU4A 3HJEA 1CECA 4NSBA 4C1NB 4H9YA 1V79A 4LANA 4TVUA 4IPPA 3FXGA 5E0CA 4QQUA 5HJLA 4E4UA 3MPGA 3KRZA 2VD9A 2D0GA 3RF9A 4FI4A 3PUDA 4I9MA 3GNDA 4GUJA 4UTUA 1R5YA 4LF2A 3SCNA 5CPOA 4Z0SA 4AWSA 2EPMX 2Y24A 5AOUA 1XM3A 5I3FA 3W1PA 1IXPA 4DF1A 1RR2A 3AJXA 4MJ4A 3AFBA 4Z2KA 3TMQA 5TF0A 1V0NA 2Y8UA 3TIMA 1CB2A 1MFVA 3GYEA 4DXXA 3CV1A 3IJ9A 1DJNA 3SAZA 1QPNA 4EPEC 3J7HA 4Q8TA 3W81A 3EPNA 1F73A 4GABA 1V6YA 1I8JA 1GGOA 2DZXA 4GQBA 1S38A 3UPBA 3BMWA 1FWRA 2FLIA 2OOGA 5CGMA 3L5LA 2WZHA 1EDQA 1CLVA 3NVTA 4TV5A 1XYLA 1P1MA 1ONXA 3N6JA 4GA8A 1EEXA 3AXHA 3MANA 3R5EA 1MYRA 3C2EA 1QXLA 4TUFA 3SRDA 3QR3A 3WNOA 1PX4A 4W8LA 2BX7A 3D5HA 2GWNA 3HQNA 2XG9A 2WM1A 2J8FA 2ZTKA 3RM9A 4HKPA 3VMPA 2WMFA 2WMKA 4DI9A 4XZBA 2J7HA 2DU2A 1LG2A 2R94A 3NQEA 1V0LA 4BF9A 2D3NA 2X41A 4BY3A 4C6LA 3VC5A 1GNXA 4ASTA 4GJ1A 3GYCA 3KE0A 4KWSA 3A13A 4F0KA 4WK9A 1K9DA 1XXXA 3S2JA 1FVPA 4UMBA 4M5PA 5E70A 4PMYA 4LV4A 3AIQA 1YW1A 4UTHA 2VFDA 1TE6A 5I3JA 5A8GA 3QOMA 3MDWA 1OX6A 4KS0A 1D3CA 1TJ1A 4DHGA 1MUWA 4FR1A 4QJ4B 2I9EA 2QCFA 3BZGA 4XZLX 4DYJA 5AC7A 3HGJA 2CITA 3EX6A 1XBZA 1CWYA 4NJJA 1BYDA 4TOQA 1P6WA 2C18A 2J47A 3PZVA 5M17A 3OVGA 1NOUA 3TDFA 1QI4A 2O92A 3V75A 2OQLA 1A3WA 1MDRA 4ZL1A 1ZHAA 2P5NA 3PZUA 3VOIA 1DXEA 3QW3A 4NNCA 1UD5A 3HF3A 1B9BA 2HK0A 3W87A 4A05A 3ZQ9A 5LIXX 3NQBA 3OP2A 1B1YA 3VMNA 3PS7A 1F6KA 1WA3A 1IXNA 4GY1A 3SR7A 3AHXA 4CNSA 3PWAA 3D46A 1GOIA 1QHZA 1ZLPA 3NXFA 2PDUA 1X6UA 4RCXA 5D2XA 1S5NA 3CM4A 3VU2A 1O7AA 3O16A 4AIBA 1GKRA 4DIAA 1TVNA 2X09A 1RCOB 3LOTA 3HN3A 3KVMA 1U5HA 1K9EA 2QJMA 1R7OA 1SZNA 3N6QA 4LUTA 3M4HA 3WBYA 1GOOA 1H0GA 5EB8A 3QMSA 3LZ5A 3T2QA 3EXRA 2NXGA 3TA6A 3H23A 1WDWA 3M0HA 4XD3A 3PFMA 4JFUA 4Q4KA 2FVMA 1WDPA 4KT2A 1XKYA 3PJWA 2GUBA 2QV5A 1KR1A 4WGXA 4Z1CA 4LAZA 5D9NA 4IMCA 1YNPA 3GUWA 5CAKA 5CZ0A 5DBUA 1KXTA 3B9NA 3LLFA 4MWAE 3TROA 4ZZ9A 1E0TA 3MW7A 1VBJA 2RDUA 1EFZA 1AH4A 1VBGA 1B3XA 1R38A 1JG9A 1LL7A 3ZM8A 2WMJA 5DFAA 2V5DA 1NF7A 1IE7C 4GQ0A 5E0KA 3AIBA 2F6KA 1EHNA 1EJ7L 3P74A 3L68A 1D2KA 4FXFA 1SO3A 4DWSC 2J13A 2FFCA 2GUYA 3PULA 2E5BA 3UG3A 3G0UA 1JR1A 4GCXA 4FF5A 1AFSA 1JCTA 1E6NA 4WKFA 2AGTA 1W6TA 5FJJA 1XICA 3AYVA 3GW3A 1MNZA 8A3HA 4A2SA 3TTEA 2ESCA 1AJZA 1ZZMA 1Q7QA 4FPSA 3O0KA 2VGGA 1BVWA 3WNPA 2NQJA 4S3AA 1V3IA 1ZBCA 1MEWA 3WLQA 3WK0A 4R7OA 4G56A 4WHBA 5F2GA 2IPJA 2QJJA 4GIRA 5AC8A 5CJ5A 1M9HA 5LNVA 4HZ7A 3SSZA 2ZFAA 3BJSA 3DI0A 2DQWA 1NFPA 1UWTA 3OJGA 4J1OA 5HAOA 4WXYA 5D37A 2YLAA 2GJRA 2HXUA 3KCLA 3I68A 2NQ5A 1BKHA 2PDYA 3JS3A 4LYQA 1JCXA 3OZMA 2VELA 1XYMA 5IXEA 1QNSA 4QNWA 4UUIA 3VYLA 4E0CA 5C2GA 3BG5A 3LCFA 4FZIA 5HR7A 2DIKA 4IL2A 4JX4A 1R3YA 2QMKA 1DJGA 1ZS2A 4OJYA 6TIMA 2GZXA 1GHSA 1FWAC 1XIMA 4AIEA 4EACA 3WKZA 2X0YA 4IPIA 7A3HA 4DJEC 4B2DD 3EWZA 1JPDX 5CPQA 1W9DM 2ALRA 1BQCA 5JQ9A 3V5CA 4ADTA 3WNLA 3WLSA 2EQDA 1T7LA 2GVJA 3N3TA 4C1LA 1NFBA 1KCKA 2I17A 1W9VA 3FGCB 5IM51 2EG6A 3VDAA 2WHMA 2Y88A 1FCVA 1H2JA 5CC6A 1TVPA 3BJTA 5ABFA 2QUMA 4N9BA 3VOJA 1EJVC 5CGTA 5HNTA 3L23A 1OG0A 4A3RA 4PB3A 4Z1AA 2CLFA 3TC7A 4AMAA 2JIWA 1UPPA 3LPPA 3LSCA 4MY8A 3LHUA 1NQ6A 2AKMA 3M44A 1W0MA 4ZSTA 5DQPA 4C1KA 3GUGA 1E6SM 4D1JA 4Y8FA 5K4ZA 3QV7A 4MF4A 1XLCA 4A3YA 3MO4A 3JZEA 4IJRA 4DZAA 4FLQA 4L6DA 4C5YA 1PTDA 1WKFA 4TXEA 5BRQA 4ACZA 1GVSA 1UQYA 5A6TC 1RV8A 1YX1A 2Y70A 5MF5A 5CAHA 3VIJA 2ZBTA 4JYDA 3KW3A 2YJQA 2ZRVA 2PI6A 1A5BA 3RRXA 4H9XA 3CC1A 4AEEA 3EMQA 1PIIA 1BF2A 2R82A 2ZWZA 3QGAC 2FPTA 4K8GA 2E9MA 4KRTA 4ZFMA 3F5KA 1ONRA 3UXDA 1ONWA 4ROPA 4Z1YA 3LRLA 3GDRA 1VD6A 4YVPA 4IMGA 2UZ9A 3F2DA 3NDYA 4YYCA 5I09A 5IHRA 3MDUA 4TVCA 4PCNA 4X9YA 4ICCX 3GS6A 3CWNA 5HBFA 3IUIA 4Y7EA 1MXGA 1KB3A 1MVYA 4LUIA 1WB0A 3DFNA 2FIQA 4NNAA 3G5EA 4RK8A 4WDTA 2R1MA 5EA9A 3BLEA 3IJ6A 2XH7A 3BUVA 2C14A 3CU2A 1PEZA 4J3WA 1XQLA 2VWTA 1EWDA 4RE3A 4AZGA 2R1NA 1FHLA 3QV6A 1F05A 4N2YA 1Q4NX 5ABHA 1E1EA 4U2ZA 2VVNA 1GVFA 1KCZA 5A6LA 2J66A 4MPKA 4FIQA 4GE8A 1JIBA 2VRKA 1O5XA 4NI3A 4JL1A 4M19A 1R3TA 1XPGA 4WDXA 3WLJA 2GFTA 4S3FA 7CGTA 3MUCA 1SZRA 2NV2A 3AYRA 3KOWA 5BMXA 2BP1A 3FJ4A 3GK0A 3FK4A 3THDA 4AY7A 3WJYA 2CW6A 3WY1A 3BJFA 5CBIA 5BWFA 4N42A 4M6PA 3R43A 4F9DA 2A3HA 5C6MA 4X0NA 2TRSA 3T05A 1J79A 3M41A 4HCLA 1HJWA 3OHIA 4W7UA 5AYIA 4GJJA 3WFLA 4YWSA 1TTPA 3A5FA 5BCAA 2FTPA 1KWGA 2ZDRA 3LCGA 1AD4A 5FJIA 3UY8A 3W37A 3ABSA 4PULA 1NF0A 3U7VA 1EXBA 3R58A 1A80A 1A5KC 1UWSA 1XC4A 4LYKA 4S38A 2CEQA 2J8TA 3UWEA 4LWWA 1O1ZA 4ZE5A 4FOJA 5DF0A 3LTPA 4UTWC 4JIQA 1IEVA 2VC7A 3G1RA 2WVVA 5A8PA 2EG8A 1V3JA 2YZRA 3EMCA 2J78A 1LM1A 3GC5A 4LUSA 2EF9A 2OEKA 5CZTA 1BSIA 4RZBA 4DPPA 1ADOA 1GW9A 4ZQRA 4IHCA 3ENLA 2OEJA 1T96A 3KDNA 3WELA 3IUDA 2WCAA 2BASA 5BOEA 4PA8A 3L2MA 1H7WA 4IM4A 2A3EA 4AC7C 1JYNA 4QG8A 3AROA 4PUKA 3QV9A 1WNOA 2PPGA 1W5OA 3OGRA 3MU7A 4KMQA 1B30A 3VM7A 1KGUA 1K7FA 4QJ5B 5JH1A 1AMYA 2A21A 1N8WA 4G7EA 3WMLA 2E28A 4LC8A 3R0DA 3T09A 3K46A 2PDIA 3MUZ1 4KEUA 3O06A 3PZQA 3S2MA 2YA1A 2PWVA 3UP8A 1DJWA 3GXIA 3SGGA 3CQHA 5D04C 2DSKA 3OBKA 1REQB 2G3NA 3BLLA 1Z41A 1XBVA 3PR2A 1MUMA 2A7RA 4K7YA 3ZJ7A 3UA4A 2WC3A 4IQEA 2ZOXA 1B3ZA 4OWGA 3WLMA 3O0FA 4QDWA 3SQLA 1C92A 3L4YA 2W61A 2ZUNA 1V03A 1R2SA 3WYZA 3TR9A 4UCGA 4ZXLA 5KZDA 2V81A 2BDQA 4CVUA 2PCQA 3E0VA 4A8RA 1VHCA 3KAOA 4BA0A 1E6XM 1XGZA 4AWUA 3TQVA 2VOTA 5JVLA 2VX6A 4E2OA 2WPGA 3BO9A 3N9KA 4JDYA 2NX1A 5AC6A 3CB3A 5LGXA 4W5ZA 5IDIA 1UH4A 5AY7A 1RA5A 3UR8A 1I2RA 3M0LA 3IIPA 2YDAA 1CGXA 1LZOA 4EPBC 5A69A 3WQPA 4YLWA 2ZX8A 2BY3A 3E0LA 2FDMA 3QPYA 2V68A 2OO0A 4A4AA 3ALGA 3BZJA 4Q22A 4XZHA 4AWTA 3LUTA 4ICMA 4UR7A 3SCQA 1G1YA 4NASA 3N2OA 1BEUA 4ZENA 2HCVA 1B3WA 1R9YA 3F5JA 3A21A 2E6YA 3TN3A 1W1B1 2P8BA 1PKMA 1QWGA 1Z89A 4OV9A 5EMUA 1UUOA 2NSOA 2VDHA 3GM8A 4U10A 5I2UA 1OY0A 1ZGDA 2TODA 3VNZA 3B05A 4YWIA 2YGYA 1UROA 4CQDA 1W31A 4PRRA 4JY9A 1XH0A 3QTGA 4M29A 1FWTA 1TMHA 1I1XA 4W89A 2XHYA 4ZO6A 3A4WA 5G2IA 3F4NA 2FKPA 5GPRA 3C61A 3Q4DA 3BAJA 1RD5A 2C8NA 2W79A 4KBXA 3L0NA 1OGSA 2PDLA 4FO4A 4DO4A 3K8KA 1RQHA 4MKVA 4IOTA 1UKPA 3WD2A 3ABXA 3TFCA 3O3RA 1SUXA 3H53A 2OGYA 4O17A 4RZ6A 3SECA 1I6NA 2WCGA 4C6BA 3UJSA 3U5UA 4H1ZA 3HG3A 1M68A 3TJ4A 5A5WA 3STEA 1X39A 4JTRA 1HN1A 5E09A 3D6NA 2HE5A 4AXKA 3WDIA 4KW2A 3P3BA 4ERGA 2ABAA 2PDNA 4EKJA 3TWBA 2F38A 3UY7A 3PTDA 4HBKA 2VO5A 1D8CA 3LLDA 3MT1A 1K77A 8XIMA 3VD3A 3PM6A 2I9UA 1BGGA 6XIAA 3EDDA 3V1PA 3CAVA 3LQGA 4PMXA 4NJHA 2G37A 3W6LA 4E2DA 4NT0A 4JTDA 4NXKA 3GXMA 3M6DA 4O4WA 3FFSA 4O18A 1UJQA 2SFPA 1GTEA 2CKSA 3ZOAA 2WOQA 5LIKX 2X0HA 1TCDA 4E3VA 3NQ2A 2ZX6A 2PDKA 3O63A 4JHZA 2QDEA 3DC0A 4H3DA 3WK1A 3EB2A 4FNTA 2CLIA 3ORWA 1VBUA 4UNKA 2AQOA 3UNDA 1DVJA 1MZHA 3VIKA 1JYWA 1EC8A 5ECVA 2VR2A 1DPMA 3ABQA 3LDVA 4A22A 1Q6CA 1RQBA 1B54A 3THUA 3H2NA 1OFBA 4HNOA 4N4PA 3V35A 3OZYA 1ZENA 3CIVA 3HMJG 3SO7A 2XVNA 3IANA 4X60A 4JY8A 2BTMA 1FDJA 1QW7A 3THQA 4F0RA 4Z42C 3C2RA 1QBBA 4F79A 1L9WA 2PWUA 4HVXA 3GH7A 1L6SA 3DFSA 4M24A 4PBGA 2VOMA 4ONVA 3GHUA 4IUGA 3ZSTA 4ZTYA 2BGNE 1WXZA 2ANUA 4MFDA 1OGGA 4MNKA 3BSHA 3T07A 3A3WA 3CS2A 3UD6A 3KBWA 5AB3A 5JIPA 3TQ0A 1B4KA 1DXIA 3V3WA 1J4EA 5CKSA 1OSEA 1POJA 4NZJA 5LSMA 1OJXA 1V3KA 1TTIA 4AD5A 3URAA 4LPCA 2HPIA 4JQ2A 4GVFA 4NRSA 3UJ2A 1W5MA 4QCEA 1YMYA 1OFRA 4BQ2A 1WDSA 3FN9A 3N14A 2C1IA 2PE4A 1UKSA 3MJMA 3U9IA 1VBRA 2RGLA 3SUTA 2ZXAA 2DT2A 2BXVA 1VPYA 5I79A 1XDJA 1JZ4A 2Z00A 2WWDA 3TW9A 1CYGA 1H41A 4K8EA 4LVDA 2ZXQA 3CASA 4XZ9A 2G41A 2XISA 4ICNA 2RFGA 2FHBA 5HUPA 1O95A 4XQ6A 4GZ7A 3GIPA 2V8ZA 1B4EA 3QFEA 4FX6M 2DIJA 3TLQA 4AMCA 2FFIA 3MZ2A 4KIEA 3DHPA 3M0VA 4ZBCA 2PZNA 4JTSA 4DJDD 5DCDA 3WK2A 1K03A 1QHPA 3AS3A 1J0YA 2RKXA 1CPUA 3GNOA 5G4HC 1ZCCA 1LBFA 3R7MA 2ZCGA 3UXAA 3B4UA 3PUEA 1SQ7A 3TW7A 4GNJA 2XWDA 5JH2A 1J0HA 3VILA 2NQLA 2POTA 3VDBA 2YBVA 3ECQA 1RH9A 5E6YA 3QC3A 3RCMA 1W2VA 1W5PA 1TZZA 4W9TA 1EH9A 1JEZA 1XINA 1XYBA 3KTSA 2V63A 1F6PA 4B5SA 4IGHA 3C2OA 1QW8A 4E8GA 4F40A 1LOSA 4FSAA 2O9RA 4DJFA 1OC7A 1AUSL 4L4LA 3WH7A 1FWFC 4N6EA 3WD4A 2CBIA 3N2BA 3RFAA 4DUVA 3S9YA 2HXTA 4PRTA 1OABA 1B57A 1P7TA 2ALDA 1BGAA 2XINA 2Z0IA 1JCJA 1WCGA 3PB2A 3SCRA 3T8LA 2QUTA 1T0OA 5KZMA 2DIEA 3VKBA 3AMCA 5FESA 3KCJA 5AYXA 2VRQA 4C7DA 1XIHA 3DUGA 3JW7A 3V5FA 2AL2A 1XCFA 3R8RA 1LF1A 2Z28A 3WD3A 4XUGA 1UKQA 1TMLA 3LI0A 1L2QA 3PANA 4C6IA 3BAWA 2VR4A 1NFGA 4MHBA 3GVWA 4AWEA 2E6DA 3W7JA 2QW5A 2FTYA 3UR5A 4OE7A 5F4XA 4EWJA 1CENA 4X0VA 2VC6A 3LHZA 2D0FA 4DAFA 5FSDC 8TIMA 1OD8A 4OUIA 3TQKA 3ANUA 2PAJA 4QDPA 4RE0A 4AC1X 3LPOA 4HQVA 3C86A 2HVMA 4RNIA 1PJ9A 4MMWA 1K70A 4DJDA 4AZ7A 4Y90A 3BPWA 1DWFM 1X8CA 2YFNA 5FJOA 3W07A 4QS6A 3WUGA 1XKJA 5CG0A 4OKDA 4JFVA 1DIOA 4HOWA 2E1WA 3IVSA 2B7NA 1OB0A 2YW3A 3WLNA 3W72A 5I03A 1EPVA 1GKPA 2QKFA 4MDPA 4P8UA 4FALA 4FNRA 3PSVA 1I2PA 3MQTA 4OOUA 4O1FA 3TKFA 2QAFA 1W1PA 1A3HA 1NP2A 1IGSA 3WLOA 3IK4A 1KFCA 4FX7A 3EDJA 4L1XA 3U4FA 1U2YA 1OCJA 1R46A 3Q45A 4IF2A 1QPKA 3SY5A 3NL3A 3S46A 2PDJA 4PUNA 1BRLA 4X22A 2PLJA 3W1AA 3PZ9A 3FAXA 5HQLA 3AS2A 2VCCA 4P61A 3I4KA 1GTHA 4Q4SA 3GHTA 5LNSA 5FA5A 3SGUA 5I00A 1JDCA 1DJQA 3LM7A 4XZNX 3BSMA 1KTCA 6CGTA 5ABGA 2VFHA 2W66A 2FGBA 4ZO8A 2C19A 3T4WA 2G3MA 3ARVA 3STCA 5KEZA 2JKEA 2AAAA 4IPJA 1PIFA 2OMAA 4DF2A 3SRFA 3ZWTA 5D09A 1AQMA 4EAMA 2DSUA 2GSEA 2O9PA 1GVEA 1IR2A 4IFKB 1JFHA 4G1KA 2DQXA 3VNKA 3CMJA 3L5AA 3AO0A 2WAGA 1XWYA 2WSYA 3W29A 4PCPA 2ZC8A 1BSLA 5JBDA 4E2VA 4I6KA 1W5NA 3AHZA 4WY0B 2PTWA 4K39A 1W56A 2WZEA 2X2YA 1W3HA 1UR3M 7PTDA 1VCFA 2H9AB 4QRNA 4P2VA 3TWAA 4CNPA 5JBFA 5REQB 1ITCA 4MOZA 2FDSA 2A5HA 3E5BA 4FB7A 4NJKA 3GTIA 5JXQA 1KM3A 3BCDA 4F2TA 1EOMA 1E6ZA 4IWWA 4GXMA 3W22A 4C90A 4HNCA 2HDJA 4HMCA 4ML4A 1SZEA 1RCQA 4LW7A 1W9BM 3F7JA 4HU8A 4HK5A 1U83A 4GYPA 3U2ZA 1DHKA 2VCAA 2DVXA 1F74A 4V1XA 2O4QA 1FBAA 4JHOA 3QY8A 1CXFA 4O0KA 3PNUA 3CMGA 2HBXA 4V1YA 1W8SA 1F2JA 4J3VA 4AB4A 4UTTC 5CSUA 1GCYA 4JNMA 4BEQA 3QLDA 4EXBA 3EOLA 3HPXA 4R53A 3GB6A 3MSDA 4PH6A 2W0UA 1OFOA 1SPQA 4LUSB 3ATYA 3GKFA 1YTDA 4GUGA 4IISA 4JTKA 5HNRA 1DJIA 4US5D 3QZAA 1L6WA 2IQTA 3LBMA 3L2IA 4KGLA 1GYLA 3LBOA 3LENA 4DNMA 1UZ4A 1XP3A 2PODA 1U1HA 1HJQA 4IQJA 3U2EA 1P4CA 4IMDA 3ARSA 2OZTA 4DYKA 2HEJA 4W7WA 4RV8A 1W8GA 3EDEA 3CXOA 1TWDA 2P1FA 3GDKA 4AAJA 4NILA 4B15A 1FCUA 4MM1A 2OXNA 4Z17A 2YBUA 2VEMA 1VYPX 1DWAM 3ITYA 3ZS4A 3B97A 1XUUA 3T08A 5C9XA 1R85A 2WMGA 4ADSA 3NWRA 3GG1A 4YU1A 1TIMA 4PTMA 3SDOA 2GDUA 3QV8A 3DFTA 3W73A 3V16A 2XSXA 3KTCA 3LGEA 4IJCA 4XUYA 4E8DA 3HZ3A 1I2OA 4LVAA 1DWGM 3KWSA 1KM1A 1BXNA 4GI4A 4PCSA 1XLAA 1VFLA 4US6A 4IP4A 3IIVA 4WKAA 1Q6RA 2DGAA 4HB7A 3OVPA 3QPEA 4I7WA 2HSAA 1I75A 4GUFA 3G24A 1WUEA 2NVAA 1CCWB 4CCDA 3FVMA 3W7GA 2Z6JA 4NAEA 1UIOA 3C0QA 1H49A 3FYYA 2EJ1A 3DH7A 3WQDA 4UMCA 4JZ5A 4H8VA 3GIYA 1YDNA 1LQAA 2HRWA 4NVTA 1VEMA 4PFMA 1UD2A 4ROQA 3K1DA 4AIUA 3WQ6A 3PSWA 4CEXC 4IX0A 4JQAA 4C91A 1AW2A 1BTMA 3D3AA 4GNKB 3WF0A 4YL2A 1OD0A 1PTGA 3WEZA 5CPNA 3LM3A 3CZJA 3RMJA 3O15A 5U7SA 4G2DA 3C8FA 4H19A 4HNLA 3W7RA 1GJPA 1E5JA 3T2PA 1S3HA 2Q71A 3ARXA 3UYCA 1PIGA 4WY0F 4G7FA 2I5IA 2Y7FA 4DVOA 3EGJA 1XLIA 2Q6ZA 1MXSA 1Q6LA 3DEQA 1I1WA 2OQYA 3N34A 3UYIA 3B8DA 3B8VA 3WDJA 3W02A 3W7DA 3UU0A 4B90A 1LOQA 1NELA 4GUIA 2OSYA 4NX5A 1FH8A 4H00A 3W1XA 1K8CA 3UZZA 1ADDA 2L5HA 3AU2A 4ERAA 2VFFA 3W28A 1TWWA 2C15A 1W37A 4RPQA 4GHRA 1NP0A 1VJIA 4CD7A 2DW6A 1TV8A 2XFFA 3OIHA 1WV2A 4QG9A 1XSKA 4Z1DA 4DXKA 2BVYA 2Y85A 4UC5A 3DFHA 3NJ3A 1BG4A 2HS8A 4E3TA 1FA2A 5FF2A 5J5DA 1TPH1 4I9JA 2G50A 4FHAA 3I7RA 4WCJA 2YXGA 2OZ3A 4LTSA 2Q3RA 4PTDA 2BOEX 1R47A 1U5JA 2B7OA 1UR4A 5KZEA 5A6AA 1EP3A 4WEVX 3MP4A 3N2XA 3P84A 2DZTA 2OKOA 2V5JA 2OR2A 1PZ0A 1KXHA 5F1UA 2WNWA 3ARPA 2IS7A 3IJQA 4X61A 3W53A 1JAKA 1J9YA 3C4UA 2PB1A 3BLKA 2D20A 3A23A 4NX0A 4W8BA 3HGOA 2JIEA 4N6FA 2PF0A 3DFQA 3AICA 3WH9A 1OFDA 3OU8A 1PO9A 2CZ5A 3FGCA 3NPXA 1EBGA 4V33A 3K4DA 4O52A 2FMOA 3PF3A 3GFYA 3OZOA 5D03A 5FAJA 1TRIA 4I8DA 2X05A 1K7EA 2G0WA 1GWJA 2QCMA 1QOXA 5HMFA 1BWVA 1ZUAX 2WKGA 1W3IA 4XIAA 3WD0A 1RBAA 4HU3A 1IEWA 4PMDA 3FEQA 2DZBA 2DZPA 4JN6A 4B5UA 1G4TA 5B80A 1UP3A 4RUBA 3VIHA 3W23A 4D6JA 4Z2JA 1EIBA 5H91A 1O66A 3BW4A 4NYUA 2EGZA 1CW2A 3LX9A 3PTQA 3M46A 1NM9A 4QHRA 3G6LA 4OT7A 4WF7A 1VRDA 4NY2A 2GQ3A 4RW5A 3VA8A 1LUCA 3TAOA 3HV9A 1TUFA 2BG5A 4WLCA 3HQOA 2QIWA 1YEYA 1U1JA 1GVOA 2J4GA 3E2RA 2ACQA 2FZ9A 3LG3A 4AY1A 1K02A 1G5AA 3MYPA 1EJUC 4AD3A 1UKTA 5D30A 1AODA 4I5RA 1O68A 3GFXA 1TMQA 3D3FA 1E9YB 3GTXA 2E0PA 1UOZA 2XIQA 3TJXA 5AZ1A 4MWAB 1MMFA 1YDYA 3QQWA 4UWMA 3S5NA 1C3FA 1MRQA 5CC3A 3D47A 1E15A 4M6UA 1ZL1A 1F9CA 3PZIA 1S2CA 2WKJA 3W74A 3NZGA 2I57A 2CZDA 1G0CA 4XKYA 3OQEA 3WO8A 3WNNA 3KFTA 4AZCB 3CZ8A 1AL8A 2VUYA 3LTSA 4YTRA 1ZFJA 2G4JA 5HQMA 4TMCA 3PPHA 3ZVHB 3SQSA 3KOYA 2E9LA 2QVNA 3M6YA 4KGJA 3XIMA 2PDGA 2AMGA 1PL9A 4ACYA 2IKIA 3VC6A 1JDEA 4PBEA 4MY9A 5CH9A 4FP1A 2ABBA 3T1GA 4HZ8A 4C6FA 1ZU8A 1US0A 3IJIA 4H83A 1H1YA 3A22A 4LS0A 1RUSA 1O12A 5I24A 2VX7A 4S3DA 2CLKA 1E71M 5K9XA 3K8MA 4W7VA 5A8MA 3UFYA 3VIPA 5BRBA 1EJRC 4XAYA 1TFVA 2B7QA 4C5ZA 1WOBA 4NZ5A 2FVLA 2DVUA 4Y9NA 3MSGA 1EKOA 4A8LA 3UGVA 2XZ7A 4ZMGA 2J77A 3UCCA 1B90A 1RSCA 2ISFA 2DZWA 4GKTA 3NAVA 2WMHA 3EX3A 4RNFA 4BHYA 3T4CA 2Y62A 4FA3A 3DIPA 4ATDA 1CBGA 4C7GA 3NZ1A 4QSHA 1KRCC 3H22A 4WSJA 1OIFA 4AZ5A 2NXIA 4HYRA 1HTIA 2INEA 3I4EA 1BRLB 5D9PA 3IARA 4HNUA 5A1AA 4LALA 1WP6A 1VS1A 3TZFA 5C2XA 1Q85A 4J9JA 1G4SA 3IV3A 3UJRA 3WZ0E 4IMAA 3EAUA 3GBDA 3IGHX 2Y6ZA 3S2NA 2RGMA 3M64A 4WZHA 1QRQA 5G2HA 4JTLA 3BW3A 1HO1A 2BVTA 5M2FX 1F8MA 3EBVA 2UBPC 2D22A 3AMGA 3SFWA 5K2ZA 4QIUA 4MB4A 3KLLA 1UC4A 4LX4A 1XC6A 3AWOA 4WXZA 4DAIA 3UWZA 3H7VA 2RDXA 4RL3A 3GG8A 3W71A 1OFAA 1HKMA 3T40A 4K3ZA 3ISIX 4I90A 2X1UA 1T41A 9RUBA 2YL8A 1RVKA 4X2RA 5E0FA 2FH6A 1EHAA 5A6BD 1KRBC 2NT1A 1UD8A 3CYJA 3DKLA 4XG1A 3WBAA 4WOZA 4JDBA 1XI3A 1M65A 3VO0A 2W92A 4F2UA 3VNJA 4JYFA 5D32A 4HPHA 2ZA2A 3RGTA 3UCQA 2NQZA 3FNDA 3SEPA 4FAMA 1BF6A 5T91A 4YNGA 4AD1A 2B4GA 4AYGA 3AMLA 2CFFA 5J8LA 3WLLA 2E09A 4I7VA 2QQ6A 3F4CA 5BYWA 2BWGA 2Z2AA 4FMVA 4UQ9A 3UJFA 1XRTA 3MCOA 3TC6A 3O2LA 1I2NA 2XIMA 3EX4A 4M7SA 1FUYA 1S3TC 2PDMA 2PU1A 4E2BA 1AQFA 4L1WA 3BAYA 1E3ZA 3OEXA 2QR6A 3E02A 3L12A 1CGYA 4NZ4A 3NM3A 1TKKA 4J2MA 4XX6A 3WLKX 5A8NA 2P0OA 2OTDA 3YPIA 3N4FA 2V3GA 4L6HA 4B5NA 4B3LA 2ATSA 1VFHA 4H9TA 1X38A 3PY2A 5C5YA 4QJ3B 1TPB1 4NI8A 4F2BA 3APYA 3Q58A 5DN1A 4JEJA 3L66A 1ZNNA 3CJPA 4HSNA 3LXCA 1SO5A 3S2CA 3IAQA 3I6RA 4QLLA 5AHLA 3HPZA 1RPXA 1TSIA 2XH0A 1PV8A 4DRSA 1E56A 3TYEA 3N11A 3BG9A 4IJBA 2BLEA 2HVNA 3NOYA 4FNQA 2G4FA 1F4HA 2VC5A 1IZCA 2QJNA 1J8VA 1UWUA 1GVQA 4M80A 3WDRA 1OX4B 4MTVA 3SCSA 1VFUA 3VXGA 2XN2A 1E3XA 1YYAA 4PUEA 1LTDA 3N2TA 1NDZA 3OGSA 5GVJA 5HPOA 1F61A 4CQBA 4CCCA 3GH5A 3KS6A 3WCZA 4GVIA 5G4EA 7ENLA 3M07A 4LYRA 4K8HA 3GH4A 1R3SA 1YXCA 2DSZA 3SCOA 2P0IA 3RK8A 4J3SA 4F0MA 1SW3A 1JFXA 1R3WA 4UB9A 5BOFA 4H4IA 2YPIA 2OSWA 1ZCOA 2OO6A 4EWND 4OHQA 3CHFA 3AZRA 1MDLA 1YE6A 2E5CA 3IJ8A 1V5XA 2QDGA 4REQA 1C8YA 3HTWA 5D9OA 1XIFA 4TR9A 5AHEA 3UWYA 3NSNA 3AOFA 1J11A 1TV5A 3NPUA 3TSMA 1HF6A 2YKKA 1GZGA 1MW2A 4MPQA 1TA3B 3O6AA 3AISA 2JK2A 2Z25A 1SSGA 3EWUA 1B9ZA 4ZSUA 2Y63A 5TQLA 4RXFA 4D6EA 1TV3A 2PP3A 3UXLA 4RX0A 2YDRA 4PMUA 3T0CA 4DLMA 1XLGA 3L4VA 7TAAA 5A3HA 2P8CA 4HMEA 2FH8A 1H62A 4HN4A 1ONEA 3N19B 5K7JA 4QDMA 2X1RA 1HKIA 3FSUA 9XIMA 3COTA 3AU6A 1VIZA 4MZYA 3E6EA 4Q8PA 2GJLA 4J5NA 3BLPX 4W88A 4OECA 3DFOA 5LXEA 3E49A 2VM8A 5C7VA 3ZO9A 3C8NA 1QPQA 1YBQA 4L4OA 4QE4A 1FTXA 4R7WA 3KX6A 4DO6A 1JI2A 1OHLA 3NA8A 3S47A 3ANVA 4DWSA 3LXAA 4QP0A 1DQXA 4K7VA 1QASA 3WFZA 2Q09A 4XZMX 2EO7A 2GGGA 2VI0A 3R12A 5EYWA 2VDGA 1KQYA 3M16A 1W54A 4BFAA 2VXNA 4JBRA 4MNMA 4YXGA 4EANA 2ZWYA 1QTWA 4RR4A 1WO2A 1HKWA 3A4AA 4DX3A 3P8JA 3TSBA 1J5SA 2ZX9A 3TLLA 4KEMA 2J74A 5T26A 4Q8NA 2CU0A 2F2HA 2ZZ2A 1IZKA 3ARRA 3R1ZA 4DBEA 1JL8A 2FZ8A 4P7RA 2OKTA 3NQ8A 3CPUA 3P93A 5D2VA 2A2IA 3ITXA 3HMCA 3AC0A 5A6SA 1B5TA 4XVDA 1RLCL 5G1MA 3KCOA 1J10A 4ZQMA 1EGMA 2IKJA 3O07A 3UZJA 4PUDA 3BAIA 5EGRA 2P53A 3NL6A 1UCWA 2O9OA 4CNUA 5FF4A 4Y9AA 1MRAA 4UFMA 3KBNA 3MKKA 3P5YA 4DO7A 4HD5A 2EHHA 3VIMA 3WMBA 4JIRA 3S5ZA 1EPXA 5DANA 1U30A 3WJWA 3MSYA 1C93A 5I0DA 1CGWA 1Z69A 3DFYA 3VGHA 7REQB 3RM4A 1VAHA 2FZNA 3NUKA 4OBTA 3VZZA 1TPEA 1WQ5A 4BWLC 1MO0A 1A53A 1E4MM 3U8GA 2XVKA 4HPGA 5C7HA 4D6HA 3SURA 4M6QA 2Z4GA 1A5AA 5HJYA 2QUNA 3CUJA 1G4EA 2QZRA 6ALDA 1KA9F 4ALDA 1ZAHA 2I16A 2QT3A 4DJED 3RG6A 3DBNA 2CBJA 3GSMA 4KFPA 1O94A 1J12A 1LLOA 1GQNA 4FLSA 1ZJIA 3OG2A 2ZX7A 4QNEA 3REQA 4L56A 2XIOA 1RBOB 4GZIA 4G8TA 4P7QA 2JQXA 1JCLA 3PTKA 4DJEA 2IUZA 2HISA 2YA0A 5LGZA 4H9MA 4XO6A 5F1VA 3V1HA 5FAGA 3QEZA 2R9RA 3MUAA 3PN8A 1NY1A 1HIZA 1UD3A 1C29A 2PDBA 2WJZA 4HSOA 1C7SA 2ZUUA 1ZB5A 3BGGA 4MB3A 2OPJA 3RR1A 3VKKA 3B40A 5M1TA 2BY1A 1L8NA 5KZ6A 1KGWA 1ODUA 1E70M 3JU2A 4D8ZA 1EP2A 1DJZA 2X0SA 4HP5A 4BS0A 3ARQA 4JTIA 1L2UA 4PEEA 3FYOA 3QYSA 1Q66A 4B3KA 2YZ5A 4P7LA 1GK8A 1A50A 3QR0A 3U2OA 3LRMA 2Z24A 4Q7NA 2FHCA 3W4RA 4PMZA 4NZ3A 5HJXA 2OJPA 3WLIA 2W91A 3CK5A 3FY1A 5FJPA 4HJWA 4C6NA 5C9UA 2FGZA 2VFIA 3SY1A 2OYKA 4K36A 1KFJA 2YFOA 4DXVA 1DJXA 2BSLA 1J2BA 1VHNA 4MKNA 2POZA 2WCSA 3VOFA 3B0UX 3GDLA 3NQ6A 3QHNA 3C2FA 4OU1A 4NJGA 1OWQA 3A3XA 1ZBWA 2Z1WA 3GLCA 2ZIDA 3K5XA 4H9VA 1U33A 1HVXA 1K4GA 3GVQA 1WPCA 4IXHA 4ZFCA 1FOBA 1LWJA 1SFSA 1YKWA 5BOOA 2WXDM 4CVWA 5FEWA 2BB0A 4XIMA 1R3RA 3MMWA 1OQFA 1HX0A 3SW6A 3QRHA 4F48A 3VKJA 4YHGA 1J01A 4YS1A 1E0VA 1XLJA 4ILSA 5FJRA 3DGRA 4AF0A 3B0YA 1QK0A 1BD0A 1LG1A 3DZ1A 1A5SA 3MSRA 1W9PA 1FCBA 1A0CA 2A1YA 1E72M 3STPA 3OGVA 4GOAA 2OGJA 1KM5A 1TV2A 4MJMA 5HMEA 4QJ1A 1AZ2A 5BXTA 3EDKA 2C0AA 2DZVA 2P88A 3WLTA 2FYMA 2YCIX 5TIMA 2VWSA 1PYFA 2A85A 4J3UA 2WZMA 4MLRA 2A3CA 2XJ7A 3AHYA 4FOUA 4KETA 5AZ0A 5EKYA 3WQCA 1RCXB 1H51A 4XD6A 1L8PA 3H54A 3PUOA 2NXHA 4MDOA 3SZ8A 2PUZA 3BVJA 1J18A 2WNQA 4LEQA 3R0KA 3OYXA 4Z2HA 1V51A 1R8LA 3RR4A 4JN7A 4Y8EA 4U3AA 3TTSA 1H5VA 3ZLHA 3OBEA 1F3WA 1H1ZA 2QPSA 3KWXA 4XAFA 3C56A 1EO7A 4NJIA 4LEFA 3URNA 3B9EA 2WC7A 2MANA 1F3EA 4HNTA 2OLSA 4Q8WA 3UR7A 2IPGA 1XLFA 1VBHA 4LGXA 4UOQA 4PB5A 3NZRA 1NU5A 1HKKA 1PSCA 2J7GA 5D9MA 3QPZA 1V7YA 2V2DA 3FAWA 4M3PA 1XRSA 3LHVA 4J4KA 2RDWA 1WZMA 1CZ1A 1SMAA 5K9CA 1SZGA 1DORA 3CMFA 2OWXA 5TNVA 1V3HA 4GNVA 3DFPA 3PZNA 1L6YA 3ALFA 4JR5A 5AHNA 2PC8A 2VZOA 3CTTA 2PC4A 4CQ9A 2WJFA 3CPRA 2P50A 3WL1A 2WNNA 4JTAA 4KCUA 3W01A 3AI0A 3GR4A 5E93A 1IT8A 3P67A 2MNRA 3AS0A 1DHPA 3FDGA 3PAJA 1EJSC 3I3BA 2CWXA 4DWSB 3STGA 4GX9A 2GVGA 3EKLA 4XZWA 3DYPA 4YVVA 1L6GA 4DPQA 4PUWA 5C71A 4WJ8A 2NVCA 2ZZ4A 3WQ8A 4EF8A 1SVDA 1EZ2A 2QCLA 2F8QA 3SQMA 3P62A 3SUSA 3HO8A 4YTUA 1IGWA 3WF3A 1TIWA 1T5AA 4GVGA 4IP7A 1ZP3A 5LHFA 1MI3A 2GL5A 1TJPA 4KEVA 3STFA 4HU0A 3FHAA 1N8FA 4K1WA 2YDSA 1LL4A 1KCXA 2I5QA 3QXBA 3LK6A 1XLKA 1DP0A 1XS2A 5BXSA 1XLDA 3WQEA 3C0LA 5D33A 3H2MA 2V3FA 4O0QA 3KOFA 2PWHA 4KQNA 3A4XA 3H7RA 4CGTA 2JKPA 4ZOCA 3R25A 3L7RA 3GVGA 2PD9A