5CSUA

Disproportionating enzyme 1 from arabidopsis - acarviostatin soak
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
518
structure length
518
Chain Sequence
b'ISVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
molecule tags Transferase
source organism Arabidopsis thaliana
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
total genus 179
structure length 518
sequence length 518
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csuA01
3CPUA 3VGFA 1TFVA 4UCFA 3ARTA 3FW6A 1MW3A 4H2CA 4FLSA 2IXVA 2MANA 4XZBA 7TAAA 5CJ5A 4MAVA 5I78A 2VRQA 1US2A 1QBAA 3WH7A 3MUY1 5F7UA 1JZ4A 3SCRA 5M03A 1VFMA 2E8YA 1V6VA 1OM0A 3AHTA 4P7LA 3W0KA 4AZBA 4GI8A 4CN1A 2VCAA 2WM0A 4N42A 3A4AA 3CMJA 3FHQA 4M82A 4PTMA 2VZOA 3SCUA 1QW8A 2XIBA 3TONA 4D1IA 2WAGA 3KEHA 2DQXA 5AY7A 4CCCA 1JNDA 1JIBA 2PC8A 1YHTA 5I5RA 1TMQA 2GJRA 1W1YA 4LGXA 2DPEA 3SURA 5IHRA 1E15A 2XWDA 2OLHA 4MB3A 1GOQA 3KZSA 4X0VA 2GUYA 4ZXLA 3SUTA 1C3FA 1UKSA 2ZUMA 1DWJM 4ATLA 4PSRA 4DUWA 1PIFA 3TTOA 4UQCA 4F8XA 3ZJ6A 4YPJA 1PZ3A 2YDRA 2VZVA 2OSYA 1LLOA 1XV8A 1QVBA 3T08A 1QPKA 3ZT6A 1GQLA 4GKLA 3AMCA 5DEZA 3RJXA 1VJZA 3D3AA 3VKKA 3KWXA 4GI9A 4FLRA 3DYMA 1LF1A 1KR1A 4UFLA 1JXKA 1BYDA 1D2KA 5GQBA 3BGAA 4ZXOA 3IJ8A 4PMNA 2XPKA 2XVKA 3M6DA 5EFDA 1ZS2A 2DT3A 1E6PA 1F4AA 1B90A 5A6JA 2BXZA 1W3LA 1FOBA 3AZSA 2D23A 3VNYA 4W5UA 5A8OA 2O9RA 3CZEA 4N0RA 2CIPA 3AHVA 3POHA 4PMUA 3DECA 1B3WA 4Z2IA 2XVLA 3MSGA 2XUCA 1HJUA 4BCEA 3ARRA 4CD6A 3ZIZA 3OB8A 3RIKA 2YLLA 3EMQA 1R87A 1JZ6A 2WANA 3WDPP 1J0YA 1QHPA 1C93A 1BSIA 4UQBA 3VIIA 3VMNA 3N17A 3SCQA 3ARPA 2NT0A 1W9BM 3RM4A 4JCMA 1FH9A 1UH3A 4CN4A 7CGTA 1JYWA 4YN5A 1W3HA 1KQZA 1PEZA 2GDUA 4D71A 4HU8A 5HDRA 4HA3A 1KBBA 2BHYA 2VZUA 5ABFB 3W38A 1IZKA 4D6FA 3QOKA 3PTQA 4J27A 3F5JA 4IUGA 5C70A 4WJXA 1UD3A 3F5LA 3GBDA 4L4PA 5JIWA 1JZ8A 3WUBA 2ZX5A 1QI3A 1HVQA 1ZL1A 3WD0A 1E55A 1UWTA 4UQEA 1DHKA 1QNOA 5A6MA 1KXVA 4Z2JA 1XRVA 2ZUNA 3AXHA 1RPKA 4CN6A 3AZRA 3M46A 4PMYA 3WH6A 4J3TA 1KGWA 1QNRA 3ALGA 2BHZA 2XTKA 1LG1A 4ACZB 1XD1A 1V3IA 2J4GA 3AS2A 4PMDA 3BLPX 1TVNA 2WHJA 4NSBA 3W37A 2W62A 4JFVA 5A2BA 2DSWA 4QFUA 4A4AA 4CUCA 5I23A 2PWEA 5E0CA 4MJ4A 3MMUA 5KZ6A 4P7NA 4FF5A 3PZMA 1DEDA 3WF0A 5EFFA 4MNLA 1V0KA 1K9FA 3D5HA 3ZMRA 1KGUA 2PI6A 1EQCA 4P7RA 1WDPA 3K8KA 2X1IA 5D9OA 4JL1A 1BYAA 2OYKA 3AHXA 4HP5A 1W9DM 2YKKA 1LWHA 1NOWA 4P7OA 2UY3A 2WSPA 4WKFA 2VO5A 1K9TA 1Q6EA 3WDRA 4AD4A 1E4MM 1OWQA 4CVUA 1GJUA 1PX4A 4EANA 1NH6A 2EQDA 3VIHA 1RP9A 1XH2A 1VEPA 3N12A 3MUIA 1FHLA 5GNXA 1B3ZA 4U5IA 1VEMA 5BXSA 1SYTA 2A3BA 2OYLA 3VINA 2J62A 2GFTA 3W82A 2X0HA 2W4XA 5DT5A 1W1PA 4U2ZA 1CXHA 3AROA 1CXLA 4W7VA 4XX6A 5D9MA 6TAAA 2WZHA 3GM8A 3CBWA 2PWHA 2DT2A 3AOFA 3WF2A 2XVNA 4AYSA 1C92A 1HJVA 1OSEA 1Q6GA 4Z2KA 1JF5A 2CKRA 2YL9A 1NWRA 4DWSD 3UG5A 3VDHA 5ABEA 3U7BA 1EDQA 3OGVA 3VDBA 3VMOA 4CVWA 1XC6A 3ZSSA 3TTQA 1PIGA 4YHGA 4F79A 3WMCA 2O9OA 4U33A 1FP8A 5BXTA 1ZBWA 1E4IA 1QI4A 1CGWA 4UR9A 5AC5A 1GQIA 5EBAA 1OT1A 2BXYA 3TA9A 1WCGA 1HT6A 1ISZA 1UQZA 5A3HA 2D1ZA 1LQ0A 1QHOA 7A3HA 1CXFA 5HNNA 3WQVA 1Y7VA 5CSYA 1H0GA 1HP4A 1KWKA 1H49A 3AS0A 2YJQA 1W9UA 1ZJBA 4J3UA 1IV8A 4JAWA 3SCTA 1JFXA 3N11A 4W7UA 1DP0A 1HJWA 1V0LA 4BQ3A 5A6BA 2F2HA 4Q22A 1KB3A 2YL6A 2E8ZA 1M53A 4AXNA 2DSKA 5IHSA 4D6EA 1B30A 3SCOA 1QI5A 5LA0A 2VR5A 4M29A 2ZWYA 2WW5A 5BRQA 1WNOA 2WNWA 1BFNA 4S3KA 3BMWA 2VOTA 3ARVA 1OBAA 5CPTA 4WSJA 4QAWA 2G3JA 3VIMA 5JIPA 4C7DA 1LL4A 1W9XA 1W3KA 3WUFA 3N15A 1OD0A 1UKQA 2YL5A 3APGA 2WKGA 1EOMA 5IDIA 5D9PA 1J0HA 1GOOA 2BY1A 3MO4A 3VNZA 4PMXA 3NSMA 1W1TA 5JBEA 3E1F1 3KL5A 3VGDA 1BG4A 4KRUA 3SCPA 2CESA 2W66A 1MW0A 2WCSA 4OKDA 5CLWA 3K4AA 4PMRA 1UG6A 3QHOA 1JZ3A 2XFRA 1C7SA 2CHNA 2G3IA 3K4DA 2DIJA 4DM1A 4CU6A 3ZJ7A 1WZAA 2QHAA 3WKZA 4C7GA 3AISA 2G4FA 3W28A 4W87A 2IXUA 1UUQA 4W5ZA 1NOUA 2OSWA 1BYBA 1E71M 1NWUA 2VC9A 2AMGA 3NSXA 3VVGA 5A8QA 4OUEA 3THCA 3NYDA 4H04A 2D3NA 1CDGA 3CH9A 1K9DA 2ZE0A 3UESA 2WLZA 3SUUA 2XFYA 4TVUA 4W84A 3VIPA 4H7VA 2Y8KA 4D6JA 1D7FA 1UD2A 3AMKA 4C7FA 1E0VA 4QLLA 4AZCA 3A6OA 2WVUA 2WLYA 2XGBA 3NSNA 3VILA 5D4YA 3AYSA 3T2PA 2A3CA 4GPNA 1GVYA 3K1DA 3B8SA 4GO9A 2QV4A 3W6LA 5C8BB 3EYPA 2VCCA 4D6DA 2EO7A 3MV11 1BG9A 1G94A 1HF6A 5ECUA 9CGTA 6A3HA 1V3JA 1UWIA 1NM9A 4TXEA 1NQ6A 1X6NA 2WKLA 4TUFA 5CPQA 4QLKA 4D6IA 4PMVA 1UOKA 2FHCA 2AAAA 1ZB5A 3PZTA 1O6IA 3VM7A 3WFLA 1AQHA 4FLOA 2BV9A 4AW7A 4D6GA 1GVIA 3UERA 3UR7A 1HKMA 3T09A 2JIWA 2DDXA 1VRXA 2VZTA 2NT1A 1GZJA 4EE9A 3CZKA 1R85A 2JF6A 5AC4A 4X9YA 2YIHA 1EHNA 1TUXA 5FOOA 4W8BA 1TA3A 3DHUA 1CYGA 2E4TA 3WIJA 2QPSA 3W6MA 3MKKA 3I3EA 4L4OA 2YA2A 5BYWA 1FH8A 2GK1B 5TD4A 1UD6A 3SUWA 2Y4SA 1UA3A 3RO8A 1XHGA 2A3AA 5AYBA 2JFEX 3CUIA 1Q6DA 1AQ0A 1N82A 2Y5EA 1US3A 1UKTA 3B9EA 1HL8A 1R7OA 1B1YA 1GCYA 1UH4A 4IM4A 1J11A 3EDJA 2XM2A 2JALA 1C8XA 3GDBA 3F4VA 3II1A 1UQYA 1BLIA 4EAMA 2E9LA 2YLAA 1UWSA 5E6ZA 3GTNA 1M7XA 4AD1A 3MMDA 4PBGA 2WMFA 2CBUA 1E3ZA 1H09A 1M03A 2BY2A 4J3XA 4Y7EA 5A1AA 2DGAA 2QLYA 1CENA 3CUGA 1JNEA 4LYPA 3TTSA 3FAWA 4DWSA 3FXYA 1HJSA 3BC9A 2J7GA 4MB5A 1XSJA 5HXMA 3SUSA 3WF3A 5CSUA 4TVCA 3BAYA 2YDSA 1M01A 1WAWA 4AZCB 2UY5A 2OWCA 1SR0A 4HOZA 3W26A 1EXPA 1P6WA 2WBKA 3MMWA 4AMCA 3SIMA 2E3ZA 3WH5A 5CGTA 1HNYA 1KXTA 1LL6A 3T2OA 1SMAA 4W7WA 3ZQ9A 4U31A 2V3GA 1RP8A 3AIEA 1E70M 1AMYA 1CGXA 1EO5A 3SCNA 2O92A 2CBJA 5BXRA 4MNMA 1JD9A 1C90A 3BXWA 1V0MA 2VUYA 1C7TA 3QGVA 3S6TA 1GHRA 4FK9A 5A8NA 1RH9A 4GXPA 2Y24A 3GZAA 2HVMA 1HIZA 5E6YA 1MYRA 1MXGA 2EPMX 1HL9A 5FKYA 3OZPA 1V6XA 3WQ4A 2VT0A 3POCA 1CGYA 2YBTA 2PBOA 3ALFA 3L2MA 3N9KA 2D22A 2WHKA 2WBGA 1BTCA 1U30A 3WL0A 1UWRA 4HA1A 4E8DA 3EDEA 4EKJA 1Q6FA 2VJXA 2GJXB 3CMGA 2GK1A 3T0BA 3MV01 1MFUA 2W92A 1C91A 3WMBA 3GXFA 3WH9A 2D0FA 1XYZA 1WB0A 2E0PA 3AIBA 1QW9A 3U5YA 2WYSA 5LA2A 1MW1A 1ZJAA 2PWDA 2ZXBA 1JF6A 1UZ4A 5A6LA 1IZJA 3J7HA 4MJ2A 1E9LA 3CZLA 3VD9A 1BGAA 1NP0A 4LX4A 4CU7A 2XYLA 2CETA 1QI2A 1H41A 3UCQA 1GW1A 1I1WA 1AVAA 1E4NA 1V3LA 1MQRA 1E72M 1LG2A 4J3WA 3OZOA 5ABGA 2OWWA 2X05A 3ARZA 3F5KA 4MDOA 2HISA 2JEPA 3NDZA 1JXJA 5C71A 4TX6A 4DWSB 1VEOA 4JL2A 3PZIA 5GPRA 1MQQA 2VX7A 1EQPA 1KQYA 2WWDA 1UZ1A 1UR9A 2PF0A 1HJXA 1J10A 3WEMA 4OOUA 2J8GA 5GNYA 4HMEA 4HU0A 1H1NA 2AOSA 1XGZA 2CHOA 3TOPA 4F66A 1TZ7A 4GIAA 1H0IA 1ITXA 5DF0A 3SUVA 3ZR6A 2PB1A 3WNPA 3FN9A 3RJYA 5FIPA 1W9VA 2J79A 4EK7A 4UOJA 2GVYA 1OD8A 2PBGA 3W24A 4M80A 4PSPA 1G0CA 5IXEA 2BY3A 3VIFA 4JFTA 4W93A 2WC7A 4W8AA 4JKMA 5BWFA 1GQKA 4TTUA 2WSKA 3HJEA 3AMDA 1JFHA 3L4UA 4UNIA 1JDAA 3W81A 1H2JA 3FNDA 1HKKA 1X6LA 1UR8A 4KGLA 5I2UA 1PX8A 4P8VA 3ZR5A 1E73M 2CITA 5A8PA 4JHOA 1E3XA 3VGGA 4TOQA 4Z2LA 3M07A 4UOQA 4XB3A 2D0GA 2WC4A 1UR0A 3AFBA 3ZM8A 4F9JA 4KMQA 4M24A 3WENA 3GYCA 3PZ9A 1J0IA 2VL4A 2VX5A 2ESCA 4NRSA 3IAPA 4M1RA 3JUGA 4V2XA 4WLCA 3WQ6A 1R7AA 4P8XA 4BZYA 4MTVA 1F4HA 1W2PA 4GZIA 1XD0A 4AD3A 3VUPA 1CLVA 1UKPA 4PTXA 3DYOA 1GORA 2J7FA 4U5KA 3IAQA 2J25A 3PZGA 3VO0A 4U2YA 3AICA 4AZ6A 1J9YA 1HKIA 2V3EA 2V38A 4GINA 5CXPA 3KE0A 3LPFA 2UY2A 1Q6CA 3WFZA 1XCXA 2E9BA 3AXXA 2DEPA 3A3HA 1QNSA 4HPGA 2XG9A 1JZ2A 1ISXA 3KL3A 4E4PA 4TTGA 1CXIA 1DWFM 2FGLA 3EDKA 4ZE5A 2XSAA 2Y8VA 4AD5A 2Z1SA 4CD5A 3CHEA 3CZ8A 3LMYA 1CEOA 3GNRA 3EBVA 1OGBA 3CUJA 4PCSA 1NWTA 5EB8A 3U5UA 3MUZ1 1XH0A 2WK2A 1EGZA 1K6AA 2VNCA 4E2OA 1E6NA 2W61A 2G3NA 3G6MA 4H8VA 1PZ2A 3IK2A 2CYGA 2VR4A 1PAMA 1JYNA 1CXEA 2WXDM 4B15A 3QHNA 3PN8A 1NWSA 3L2LA 2FH6A 1OIFA 4PMQA 3BAJA 2DT1A 2JEQA 4RL3A 5E9AA 3PBGA 4QCFA 4ZE4A 5AYIA 4P8WA 1UD8A 3WDHA 3HU7A 4AZ5A 1MXDA 1QBBA 1WDRA 1EIBA 2NW0A 2ZUUA 2J74A 3RCNA 1KGXA 1WP6A 2PWFA 3GH4A 4UFMA 4BQ2A 4YHEA 3AIWA 4UQ9A 4HMDA 2J75A 4LYRA 2BFGA 3N04A 1VF8A 1X1NA 2X09A 4MAZA 1E40A 4D6HA 1EO7A 2XWEA 2YA1A 4ACZA 1KXHA 2ZOXA 1B3YA 8A3HA 3WEOA 4CCEA 5BCAA 2J47A 3OLIA 4HZ6A 3PZUA 4R27A 4X0NA 3WD1A 1WDQA 3ZJ8A 3WD4A 4F9DA 3SCSA 4GQRA 1UR2A 3AJ7A 3VDCA 5FD0A 1TR1A 1S46A 1DWHM 1UA7A 2TAAA 1C8YA 4S3JA 3THDA 4UFHA 3SCWA 2DH3A 2VQTA 2F61A 3BAXA 4DM2A 4ML4A 3OG2A 4PUEA 3WMSA 2DH2A 2X2YA 3IANA 4A3HA 2WMIB 1UD4A 1I1XA 3ECQA 1CZ1A 4KWUA 1YQ2A 3O2LA 3TP4A 4AZGA 3G6LA 5LYRA 1C8QA 3ZJKA 4PMOA 3I3DA 5A6SA 3AMLA 3AYRA 4HA4A 3MU7A 4AY1A 3RM9A 3LPPA 4OJYA 1QNQA 3NCOA 1J18A 1QI0A 4WSKA 5HOSA 2VI0A 1OB0A 5DFAA 2W67A 1XCWA 1FFRA 4BQ4A 5DMYA 2B31A 3AZTA 5DT7A 1BPLB 3MUAA 1KWGA 3O9NA 3W53A 2WVVA 3GNOA 1HP5A 2XVPA 2VMFA 1B31A 3VOCA 5HBFA 2WHMA 1EDGA 4CD4A 5IFPA 2A3HA 1WZKA 1LWJA 4D6CA 3HMCA 4KGJA 2C7FA 3AHYA 3ZOAA 5EMYA 3BCDA 4ATDA 2CKSA 3RM8A 3GH7A 1SMDA 1V02A 2GJXA 5D8ZA 2XGIA 4GZEA 3CLWA 4HZ7A 3UG4A 3U7VA 2D24A 2UY4A 2WB5A 3W25A 1EA9C 1FFQA 1CECA 1LL7A 1A3HA 3IJ9A 5A69A 4M8UA 5CLTA 1HKJA 2WMJA 1W3JA 4DUXA 2A3EA 2ZX8A 1V6WA 3VGEA 3K8LA 2JIEA 1L8NA 4FLQA 3NIYA 2WZIA 3N13A 2ZXAA 1AQMA 4E8CA 3AMGA 1ECEA 3EDDA 1HJQA 1GOIA 4GI6A 3ZO9A 1JG9A 2QMKA 5CQ1A 1H3GA 4MNKA 3CIVA 3OLEA 2C0HA 1OT2A 3BAKA 3RILA 3WH8A 1JI2A 5IFTA 4P7QA 1E6RA 1MFVA 2E9MA 5FL0A 2G41A 3CHDA 4V27A 3IJ7A 5CGMA 3OIHA 3WUEA 2D2OA 3CTTA 3K46A 3ARWA 2XVGA 1E6SM 3GBEA 4B16A 4RE4A 2J7BA 3WD2A 5KEZA 1DWIM 3AIRA 4UFKA 1BHGA 2J77A 4HMCA 3T0AA 1CGVA 4JFSA 1KCKA 2J78A 4W8LA 4XUYA 4IPLA 2ZX7A 3RDKA 1WDSA 2ZUSA 2EPKX 2Y2WA 2WMIA 1UR1A 2D20A 3ARUA 3OLDA 4D1JA 4AIEA 1E0XA 1EDTA 3VX1A 1ZU8A 3L4TA 2YDQA 3LPOA 3WQ5A 3ARXA 3CHCA 2BHUA 3CZGA 2EPLX 1GJWA 1E43A 5D9NA 3VIOA 3BAIA 4HOXA 4KRTA 5ABFA 1JAEA 1L0PA 4NZCA 2OYMA 1CBGA 5JBDA 1VFUA 2BVDA 4A3YA 6CGTA 4GQQA 2WVVB 1CGUA 2IUZA 1G1YA 3S2CA 1CXKA 1DWGM 2CBVA 4JKKA 3B9AA 1NOFA 4TVDA 4R5EA 5I24A 2EPNA 1E6ZA 1OGSA 1Q4NX 1CWYA 2BY0A 5M17A 2QF8A 4HTYA 4XV0A 1G5AA 1FHDA 5I3DA 4H41A 1JZ7A 3PHAA 2VTFA 5A94A 3L4WA 5JUVA 2FH8A 3BSHA 4B9YA 1V3KA 3WNNA 5HPOA 3VIJA 1WKYA 4BA0A 1CPUA 4PEEA 2V5CA 4HPHA 1G01A 2VZSA 2VURA 2DSZA 1JDCA 3SCVA 4W86A 1WPCA 3FAXA 1VAHA 1J01A 4GZJA 1XSKA 3FY1A 3DYPA 2O9TA 4JIEA 4RE3A 3VGBA 3OBAA 4K68A 2WWCA 5E09A 4AZIA 1B9ZA 5BRPA 5A6KA 3WNOA 3VX0A 1UH2A 1E1EA 2J8FA 2VVNA 4DUVA 4DWSC 2YA0A 4PMZA 1OINA 3DHPA 5D8WA 3W4RA 5A2AA 4OBSA 2G3MA 3L4ZA 1BGGA 2FDMA 2YL8A 3AIQA 5GNZA 2X0YA 1FP9A 1HVXA 5I6SA 5I77A 1UYQA 2WZEA 1V0NA 4OZOA 2VRJA 1JZ5A 3BMVA 5E70A 2QMJA 3WNKA 4HZ8A 4NRRA 1W32A 1GHSA 1DTUA 1A47A 2CXGA 2ZX9A 2BVYA 3CO4A 4UZUA 3PZQA 4B3KA 3UG3A 3EMZA 4MB4A 3VMPA 2VX6A 5M5DA 1E5JA 1W91A 1E4LA 2D0HA 4JCLA 1MVYA 1GOKA 1V6YA 3VD5A 2WMHA 5LA1A 4HOWA 3VIKA 3DC0A 3LPGA 1UR4A 1XYFA 1HN1A 1KBKA 3PZOA 1SFSA 1PJ9A 2F8QA 3OLGA 3ARYA 1E5NA 1TG7A 4Z2GA 4CKQA 4ATWA 4H8HA 2VRKA 4GO8A 3A4WA 3WBAA 3ZT7A 1VENA 4UQAA 1EOKA 1H5VA 4P8UA 1XH1A 3VIGA 4J7RA 4CCDA 1BVNP 1E6XM 2DIEA 4AC1X 1UWUA 5CPSA 1GOMA 1HX0A 1VJSA 1WZMA 1XSIA 4CD7A 8CGTA 4NI3A 1V3HA 2ZICA 1GUVA 1WE5A 3I3BA 3WNMA 2BNJA 4AIUA 2CNCA 4Z2HA 3BSGA 5A6AA 3N18A 2VVSA 3NDYA 3OGRA 2CBIA 3WBEA 4J3SA 1HXJA 4CU8A 4AEEA 2VX4A 4UQDA 2ZX6A 1GONA 4V28A 3BLKA 1CIUA 4WK9A 1FH7A 4AD0A 4OIFA 5M3WA 3WD3A 4MDPA 2BVTA 3WQWA 1E56A 5JBFA 3WQ8A 4M56A 4ZEPA 5FL1A 2CPUA 3PTKA 4UFIA 1CLXA 2ZUWA 4NF7A 3U57A 1ISYA 3EDFA 4ZENA 3ZSTA 1W2VA 1ODUA 3ARQA 4UZSA 2QPUA 3MS8A 3CUFA 3WL1A 4J3VA 3WELA 2ZXDA 1V03A 2W5FA 2JF7A 3KL0A 3BAWA 1ISVA 2C8NA 3BCFA 1IT0A 2VCBA 1JYXA 1JAKA 1V02E 3CHFA 3BH4A 4IPNB 1WO2A 1TE1A 1H4PA 2WVSA 2YOCA 2RGMA 5E0FA 4TX8A 3AI0A 1B0IA 1J0ZA 2CERA 3VU2A 3ARSA 1OIMA 3AS1A 2EPOA 5CG0A 1VFOA 3AQUA 4QCEA 1MWOA 1QOXA 3GXMA 4AZHA 4H8UA 1EHAA 1PBGA 4J28A 3GXDA 4W88A 1J0JA 4UFJA 1B3XA 1O7AA 2FHBA 4U3CA 2YBUA 1K9EA 4CD8A 3N1AA 4MADA 3WEZA 2EJ1A 2G8ZA 5A2CA 2FGZA 1DWAM 1JGIA 4BF7A 1KR0A 2VQUA 4JZ5A 2E40A 3T0DA 4LXFA 4CGTA 3OGSA 4JFUA 3K8MA 1KCLA 3PZNA 4WKAA 1R86A 3L4YA 1GPFA 3M7SA 1KFWA 1QNPA 1H11A 1U2YA 4AWEA 2FHFA 4IISA 2EXOA 1ZBCA 1B3VA 3ZT5A 2XM1A 1UHVA 4JHZA 3WF1A 2WCAA 1TA3B 2GDVA 2WMGA 3WDJA 2WMKA 5BROA 1TVPA 4W85A 4PYSA 1JDDA 4PTVA 1MW2A 5DO8A 1CNVA 3VD3A 4BQ5A 1JYVA 3W27A 1E1FA 3WN6A 4Q7NA 4QP0A 2OWXA 4UTFA 4LPCA 3CUHA 3WY1A 3AXIA 1GQJA 1FA2A 2WCGA 2GSJA 1BQCA 1PPIA 2DSVA 3VM5A 2V3DA 1V08A 2J7DA 4AD2A 2XHYA 2Q8XA 3UEQA 1JL8A 1KXQA 5BXPA 2EEXA 2NSXA 2RGLA 1TCMA 3QOMA 5FCZA 5A95A 1CGTA 4AISA 1Z32X 1EH9A 1R8LA 1JD7A 1MQPA 3AHZA 3QR3A 3HN3A 1ODZA 2XIIA 4PTWA 4AIOA 1BVZA 2D3LA 5CZKA 1W9PA 2J7HA 3RPMA 2X8RA 2ZUVA 3VTRA 3PZVA 4QLJA 4WIWA 3OA5A 1I75A 2OSXA 3A47A 4W89A 4B3LA 3NUKA 4PN2A 1CTNA 2ZXQA 2GJPA 2XFFA 3WUGA 4MPKA 1OCQA 3GXIA 3VD7A 4MNJA 3UR8A 3UETA 1E6QM 1VB9A 4KH2A 3TTYA 2Z1KA 2V3FA 5HPCA 5A6BD 2W91A 1VIWA 1ZBVA 2WVTA 3B9DA 1M04A 4WF7A 1NP2A 2W63A 1BF2A 4URIA 1BAGA 3FHAA 2JE8A 3W29A 1RD6A 3WNLA 1ZBKA 1NARA 1QHZA 2O9PA 4JFWA 2CCRA 2ZWZA 4QDMA 4OOZA 1GNXA 3NJ3A 5I0DA 1UD5A 3EMCA 4OBRA 4PRWA 2BS9A 3T2QA 3QHMA 4LQ1A 1B2YA 2EBNA 1J0KA 4UOZA 3AIVA 1OGGA 4D72A 3O6AA 3L4XA 4AZ7A 4BS0A 1E0WA 3WF4A 2XJ7A 1WZLA 1PX3A 1V6UA 3VGHA 1V3MA 2J7CA 2WC3A 4M81A 4LYQA 2ZUTA 1VBRA 2PWGA 2V5DA 4JKLA 1UKOA 4B9ZA 1U33A 4U3AA 4PCTA 3VPLA 1VBUA 1JI1A 1D3CA 3PTMA 1J12A 3CZJA 4ZFMA 3L4VA 1ESWA 2UWFA 4MB1A 2ZIDA 1VFFA 3RMEA 2XSBA 3SEPA 5I79A 3MANA 1BYCA 3WDQA 2CEQA 1LJYA 4XZWA 3A4XA 4WKHA 4PUDA 3VDAA 2WHLA 4FMVA 1GOWA 3WSUA 3VD4A 2DT0A 1ITCA 1W1VA 2DSUA 3MSDA 3AS3A 4RE2A 1UWQA 5ABHA 3GH5A 3CGTA 1ISWA 4ACYA 2WPGA 5A8MA 1G9HA 4AEFA 2J7EA 3WDIA 3AIUA 3GNPA
chains in the Genus database with same CATH superfamily
4UTUA 4JX6A 3NXFA 4Y9MA 1R47A 2IXVA 4HNTA 1VLIA 4GH3A 4MAVA 2VRQA 3BQ5A 2FQIA 3E0LA 3SW6A 9XIMA 2G0WA 1V6VA 1OM0A 1GGOA 2VCAA 2WM0A 1RBLA 1H7OA 2GQ8A 4K36A 3CLMA 3DERA 3KEHA 1JNDA 4GIEA 3CEPA 1TMQA 3W74A 2PDIA 3QMTA 2PRMA 3GC4A 4LUIA 4S2BA 5IHRA 2R8WA 5LIYX 1GOQA 2FVKA 2GUYA 3SUTA 1C3FA 4LVGA 3B4UA 4JTQA 4ATLA 4QAIA 4GD0A 1MRQA 1PIFA 1B54A 2FVMA 2V2HA 2VD8A 4F0RA 1PZ3A 2VZVA 2DZUA 1JR1A 3NL2A 1GQLA 3R94A 2HPIA 4JQ3A 1AH0A 3EPNA 4GA8A 4GI9A 3TQ0A 1KR1A 4QX4A 1EYEA 3GXPA 3NQMA 4F0MA 2XPKA 4Q4RA 3FYOA 5K7JA 2BXZA 4XIAA 1H61A 3FYYA 4IMDA 1FOBA 2Z25A 4W5UA 2CLFA 1TWDA 3KTXA 2DZVA 2CIPA 4Z2IA 2XVLA 4JICA 2XUCA 2UBPC 1GPWA 4CD6A 3QXBA 3ZIZA 3RIKA 3MBDA 4NJKA 3WDPP 3NNTA 4MLRA 1R3RA 2EF9A 1BSIA 3VMNA 3IGXA 4ZTYA 3LBMA 4A8LA 4HPXA 4ERGA 1VPXA 3KRUA 4Q8NA 4QQUA 1ZFJA 4DPPA 4I5RA 4LB4A 2OZ0A 4D71A 3OO2A 3H2OA 3T1GA 4HA3A 1KBBA 2VZUA 3B40A 4H9MA 1CX9A 4HN4A 4I5UA 4D6FA 3QOKA 2V67A 1W1A1 3N2TA 3F5JA 2IKGA 4MKSA 4RPPA 1S38A 2QCMA 1TV2A 5JIWA 3WUBA 4TV5A 3LXBA 3GDRA 5D2VA 1ZL1A 3APYA 4JTGA 3NURA 3BG3A 4HKPA 1L2QA 1QNOA 2OLAA 3DG6A 5E1QA 4Z42C 5DLCA 4Y6GA 1AW5A 2ZTKA 3RGTA 4CN6A 5CEWA 3M0XA 3M46A 2XINA 1TQJA 1KGWA 1LG1A 5T9BG 4N7QA 1V3IA 3SY8A 3AS2A 1P4CA 3BLPX 2IKJA 2WHJA 4JFVA 5A2BA 4CUCA 4BI6A 4MJ4A 5KZ6A 1A0CA 4P7NA 1EC7A 3ZXWA 2WOQA 2PP0A 3WF0A 2CLLA 3CASA 1OEPA 5FJRA 1LYXA 3RF9A 2PODA 2YW3A 4LAOA 1G67A 4ZB0A 3GE7A 5HJLA 1YTDA 1A5OC 3BLEA 3K8KA 2X1IA 4H01A 1V77A 4LVAA 1SFJA 3NEVA 3C6CA 1LWHA 2BGSA 2WSPA 4WKFA 1EBHA 1BVWA 3WDRA 1E4MM 3WK2A 1Q7QA 4JYEA 1XH2A 1VEPA 3TZNA 4O17A 3ZR4A 3CWOX 4U5IA 3GG8A 5HJXA 1H7WA 3EEGA 1SYTA 1FWFC 3C2YA 1NFGA 2W4XA 1W1PA 1CXHA 4GNVA 5C5YA 3KDNA 6TAAA 3NG3A 2WZHA 3GM8A 1K77A 3CBWA 5AHFA 2PWHA 3AOFA 3TN3A 4AFYA 2CZDA 2XVNA 4AYSA 2QGYA 3G1DA 2Q02A 2OR2A 1Q6GA 1TPC1 2Y61A 4DWSD 3VDHA 1PWLA 3MZ2A 3N14A 2BGNE 2OXNA 3W2KA 1XC6A 2PURA 4FIRA 4MM1A 3TTQA 3ZVHA 1YPFA 5JMUA 1KFJA 4QBXA 1BEUA 4L9XA 4FX6M 4AB4A 3PVFA 5BXTA 3C2EA 4AQLA 3UA3A 3BGGA 1GQIA 1OT1A 2BXYA 1SM9A 1WCGA 3LM3A 4MWAB 3USZA 1OC7A 1TCDA 3UFYA 2BP1A 3NPUA 7A3HA 1V5XA 3H8AA 1HP4A 3QC0A 4QDWA 1JUKA 3OIXA 3QFEA 3MHFA 4JAWA 4I9MA 3HPXA 2HE5A 3RCMA 2E6DA 5FACA 3N9SA 4JQ4A 2HZGA 4LT9A 3GNNA 3BV7A 1JPDX 2ZC8A 3VYLA 4D6EA 1QI5A 3TNOA 1T7LA 2VR5A 2ZWYA 5BRQA 4E2BA 1WNOA 2ANUA 3XINA 2OJPA 3LMZA 3BMWA 3VOJA 1QFEA 4R85A 1UC5A 3RX3A 4UMCA 3VKBA 3FV9A 5FF4A 4QAWA 4DHGA 5JIPA 4C7DA 1LL4A 1W9XA 1W3KA 5AHMA 4DYEA 3VUSA 1OD0A 2YL5A 3H70A 3HQPA 3GFXA 4C6EA 3GTIA 2BY1A 3EAUA 3NSMA 2GGGA 4ZVJA 1J93A 1JCXA 1UIOA 4XZ9A 4PUMA 2Q8ZA 3DZ1A 1MW0A 4TQTA 1OFAA 1EB3A 4JEQA 4OKDA 3FKRA 5CLWA 3K4AA 5TF0A 4PMRA 2OZ3A 3KTSA 3TYAA 1EBGA 4IF2A 3PFMA 5I03A 2JQXA 2I9UA 1TTJA 1KO0A 1S3TC 1W37A 1FWDC 2OMAA 2X1SA 1S2AA 2C14A 1UUQA 1QOPA 1NVMA 2FPTA 2PDMA 2OSWA 1BXNA 4MY9A 4O52A 2AMGA 3NSXA 4OUEA 1LTDA 4ROPA 4X3ZA 1K9DA 2J13A 4O13A 3LG3A 1VS1A 2WLZA 3SUUA 4LUYA 3KX6A 4FEZA 3TX9A 2QCDB 1Z89A 2VDGA 4NHVA 3VIPA 2A1YA 3VNDA 3Q67A 4Y8FA 4NU7A 1E0VA 2Z00A 4QLLA 1F6YA 2WVUA 4GBUA 4B5UA 1Q6QA 2BSLA 3VILA 4TX9A 4FIQA 5D4YA 1NFPA 4B5WA 1T8XA 4Y9OA 3AYSA 4GPNA 3LXCA 3GKFA 1GVYA 3NM1A 3MDWA 3M44A 3UWZA 4IP7A 3WLHA 5C8BB 2QDGA 2EO7A 2DZXA 3WCZA 1HGYA 4JQAA 3BJFA 9CGTA 1P0KA 1V3JA 5K2ZA 1TTPA 1UWIA 3PTDA 1NM9A 1NQ6A 2WKLA 1GZGA 3KVKA 1UOKA 4A29A 2AAAA 3PZTA 1XQKA 1AQHA 1YDYA 4O18A 3E5BA 3UR7A 1HKMA 2QIIA 5REQA 4JTRA 1WOAA 2BZNA 1AA1B 4AU0A 3CZKA 2JF6A 3JZEA 3G24A 1OFBA 1KRBC 2YIHA 1TUXA 1TPB1 3C8NA 1M7PA 3SQSA 3THUA 1F8IA 3IWPA 3RG6A 2F6UA 3L5MA 3W6MA 3MKVA 2YA2A 3MHUA 1AJ2A 3MTWA 2GK1B 4ZA0A 1VFLA 4EACA 3TR9A 1VCVA 1UA3A 3RO8A 3PPGA 3XIMA 5LZLA 2BOGX 1AG1O 4Q4QA 1FHVA 3U4FA 1US3A 1AZ2A 5D2YA 1YBQB 1N2VA 3TAOA 1UH4A 1QPNA 2V9DA 2XM2A 2JALA 3RMJA 3PPHA 1C8XA 1FWBC 3F4DA 4HCLA 1M9HA 3II1A 4AH7A 2OG9A 4WRHA 1BLIA 4EAMA 1WA3A 3EWYA 2WQDA 2OT1A 1M7XA 2VDHA 3G3DA 2INEA 3TEVA 1H09A 3MDUA 4J3XA 4GJ1A 5D04C 2DGAA 5A1AA 3ZVHB 1L9WA 1PKNA 1JNEA 1LWIA 4BR1A 3W7PA 3HG4A 4GLEA 1SZFA 5T91A 1W8SA 1HJSA 1VYRA 1XSJA 3SUSA 3LCGA 5HULA 1M01A 3GTXA 2OWCA 2WO5A 1M65A 3H7RA 2WBKA 3SIMA 4M0XA 3FGCB 3WH5A 3HTWA 1S2TA 2XIQA 1HNYA 3T2OA 3JS3A 4W7WA 1U5JA 2CLEA 4BWLA 3QY8A 4U31A 2VGBA 2V3GA 4RDWA 5KINA 3AIEA 4WHBA 4S3DA 9RUBA 5TNVA 1AMYA 3O05A 4C6IA 3L9CA 4ALDA 2QDHA 5A8NA 2DW7A 4IMGA 1SZGA 4N02A 3GZAA 2HVMA 4QJ5B 1MI3A 4AWTA 1MYRA 4O14A 1SJDA 1HL9A 3R11A 3W1UA 1XLLA 1SO3A 2PLKA 3MB9A 3ALFA 3PJTA 2WBGA 1BTCA 1Q6OA 1DJQA 2GJXB 3U8GA 3T0BA 3MV01 3W1PA 5J04A 3BANA 3S2JA 2BX7A 2D0FA 3UJFA 3XISA 2DUAA 2PWDA 2ZXBA 1F3TA 4DQWA 4KRZA 4MJ2A 4PBEA 2OELA 3EA3A 2VC6A 4CU7A 3RRAA 1QI2A 3G77A 4HD5A 1XDMA 3H26A 4DBDA 1M68A 3NOYA 4HU4A 1E4NA 2Z29A 3GAYA 4KQNA 1E72M 3H12A 1LG2A 2HVNA 4XAGA 3CYJA 3VE7A 3C0SA 4ZOBA 4MDOA 4GUFA 5C71A 4TX6A 4DWSB 1XQLA 2OO6A 2PDLA 5GPRA 1N55A 3GFZA 4LNYA 1U5HA 4PBFA 1K4HA 2A7NA 3WLLA 5EL1A 5FF7A 4M1BA 1IZCA 2C71A 2EPHA 1J10A 4OOUA 1H1NA 1R2TA 3MUXA 2CHOA 1TZ7A 1GVOA 3W00A 2P76A 3SUVA 2PB1A 3HM7A 3FN9A 4CQDA 1R9ZA 4UR7A 4DJEC 2QIWA 4EK7A 1J6OA 4CCZA 1VC4A 3W24A 5EU9A 4M80A 3HB9A 4PSPA 2BXVA 1TIMA 4W93A 2WZMA 4HK5A 1QT1A 3KOZA 4DJEA 2E1DA 1SQ7A 2QEZA 2VELA 1GQKA 3LSCA 4HK6A 2PDGA 3EPOA 2I9EA 1R3YA 3HJEA 3N4EA 1ZP4A 3E2RA 3E9AA 4TR9A 3ZR5A 4RX0A 1E73M 2P10A 5A8PA 4L80A 3G2GA 3VGGA 4Z2LA 6TIMA 1UR0A 2PTXA 5AB3A 1D8WA 2CLOA 3WENA 4KEMA 1WXYA 2VEGA 5HR7A 4AMAA 2VX5A 4NRSA 3W7MA 3FA4A 2QVNA 3GR4A 3BLLA 4GXMA 4V2XA 1FVPA 3T40A 4Z1YA 2A7RA 1XD0A 3URAA 4RXFA 1UKPA 1D8CA 4E4UA 2HRWA 3WLQA 4AX7A 1X1OA 3PZGA 1J9YA 2V38A 2NLYA 3IJQA 4GINA 1BWKA 5CXPA 4V1XA 1XCXA 2PGFA 4DF1A 3A3HA 4GVFA 3KP1A 1QNSA 2POTA 4QE4A 3HV9A 1RVKA 1JZ2A 1ISXA 3KL3A 5FEZA 2NQ5A 3K30A 1H62A 3B0YA 4JR5A 5HWMA 3SRDA 5BW6A 3RHGA 2Y8VA 4CD5A 3CHEA 2FTWA 5CZ0A 3IGHX 2Q71A 3H4WA 4UIOA 3SR7A 1NWTA 4WX2A 5EB8A 3R89A 1EGZA 1K6AA 2XIMA 3NTYA 1ZAIA 4KWOA 1ADOA 4J5NA 3G6MA 4ERIA 1PZ2A 1PL9A 4YTSA 1UB3A 4C6OA 1JYNA 6ENLA 3OHIA 3NL6A 3N3MA 7REQA 1DE5A 4EAYA 1TPVA 4HB7A 2A21A 1OIFA 4H4IA 3O0FA 4Z08A 4HSHA 2JEQA 4RL3A 1Q63A 3GS6A 1V51A 3PBGA 4QCFA 3RUBL 3P81A 4AZ5A 5K9XA 1WDRA 3WJWA 2NW0A 4RR4A 1DJWA 2J74A 4A8RA 2PWFA 3PPFA 4YHEA 2CZFA 3AIWA 4FS9A 5AC8A 2J75A 4XG1A 4M6VA 1AJ0A 1VF8A 4IMAA 4O4VA 1MDLA 3CAWA 2QCCA 4MAZA 4FA3A 1EO7A 3B05A 4PA8A 1C9WA 2OKTA 4NAEB 3WFAA 1B3YA 8A3HA 1ZY9A 4XAYA 4UMAA 1GK8A 4S3CA 2QUUA 4D2JA 4GQRA 4I6KA 3NZGA 3JVAA 3AJ7A 1ELSA 5I3KA 1FUYA 1DWHM 5DRIA 2TAAA 2PTYA 5LGZA 1EUNA 3IIZA 3DFHA 3BAXA 2CLMA 4KIEA 4PUEA 3WMSA 4A3HA 3U2ZA 4KWUA 1XYAA 3S2NA 3LXAA 1OCJA 3SQLA 2OEMA 3UXDA 4CNPA 3N6QA 5B7YA 4PMOA 3I3DA 2YB1A 3AYRA 3MU7A 4AY1A 1ADSA 4FSAA 3LPPA 4OJYA 2FFIA 3NCOA 1U1UA 3BJTA 1W54A 5FF2A 1QI0A 3ATZA 3DFOA 3M41A 5DFAA 2NV1A 5DMYA 1JPMA 1EFZA 1RV8A 3PUOA 4ZO8A 3BPWA 2PP1A 3OU8A 2C19A 3O9NA 5C9UA 3HJZA 1HP5A 3CL7A 1A3XA 1RJRA 1B31A 2QDDA 1UASA 1WUEA 4MG4A 1KNWA 1E9ZB 2Z7GA 4UTTA 1WZKA 1F7BA 4HN8A 2QV5A 3ZOAA 5EMYA 4GYJA 4ATDA 1DXEA 3AO0A 3RM8A 4DXKA 2Y1HA 2VXNA 2GJXA 3CLWA 3FJLA 4JEJA 3LU2A 2FMOA 3HGSA 3DX5A 2GPTA 2YDAA 5DMMA 4Z0SA 4DIAA 3KWSA 1R5YA 2ZX8A 1V6WA 5E9XA 2JIEA 2WZIA 2ZXAA 4K39A 3P6LA 4OE7A 4ZGYA 3EDDA 4H9VA 1EJXC 1PHWA 1RHCA 1GOIA 3KBSA 2PDKA 2B0MA 3CIVA 5JQ9A 5K3VA 3WH8A 3TIMA 1JI2A 4CLMA 3S8HA 4I6VA 3I6RA 1V7AA 4DO6A 4V27A 1GG0A 1V6TA 2QCLA 5CGMA 4RUBA 1F61A 1QUMA 4G5DA 2C3ZA 3K46A 1DQWA 3I7RA 1Z44A 2XVGA 2DY3A 2Y7FA 4RE4A 2GDQA 4ERAA 1G4SA 1LT8A 3LI1A 3FVDA 4XTDA 3UT0A 5EPDA 4IPLA 3RDKA 4IGHA 2ZUSA 1OZQA 2EPKX 2Y2WA 2WMIA 5A5WA 3ARUA 5CAKA 5GVJA 2YDQA 3WQ5A 5DMNA 2BHUA 3DU0A 4G7EA 1E43A 3LGGA 5C2CA 3BQ6A 4HSOA 1AZ1A 1PYMA 4NZCA 1R3TA 3KFTA 2OYMA 5JBDA 2W9MA 3S2CA 3L5AA 4FNQA 3HPZA 4Q4SA 3F1QA 3NQ8A 1K7EA 1MXSA 2GL5A 3C0JA 3FVMA 2XIJA 1E6ZA 1OGSA 3IIVA 1Q4NX 1REQB 1CWYA 2BY0A 3KOWA 1SFTA 1VFHA 2OKOA 2ZZ7A 1Y65A 5TQLA 2PUZA 1ICPA 1V3KA 2PLJA 1DHPA 3DH7A 3VOFA 1EGMA 4O8RA 4BA0A 1CPUA 4PEEA 4Q4OA 2V5CA 3HPFA 1WPCA 3NVTA 1VAHA 3BLDA 4YS1A 1XSKA 3FY1A 3CS2A 2Z6JA 4RE3A 1HKVA 3QZ6A 2QVHA 3OBAA 4DVOA 3VZXA 3HPSA 5FF0A 5H8PA 2YFOA 3W7RA 3WNOA 5JXQA 1OYAA 3MWCA 4PMZA 4Q6JA 1OINA 3CXOA 2IQDA 1OX4A 1QASA 2O0TA 4C6KA 1FP9A 2DORA 1P43A 4Q7BA 1LT7A 4LY4A 3UPMA 3M0IA 4NYYA 3L67A 3BMVA 3AU6A 2ZVIA 2QMJA 3ANYA 1F5ZA 2I57A 2Y7EA 4QJ3B 1UUMA 3PUGA 1W32A 7REQB 1DTUA 1QO5A 1NELA 2BOFX 2BVYA 3RK8A 3ATYA 1YNQA 2QCDA 1OCBA 1I6NA 1E5JA 1W91A 1E4LA 3H6OA 2OZ8A 3LGEA 4Q8UA 4LAKA 3VD5A 2WMHA 4B4FA 1VFSA 4LBSA 3VIKA 4HOWA 3DENA 1TJRA 1X7FA 3LPGA 3PB0A 2TMDA 1XYFA 1HN1A 1KBKA 3OLGA 3E12A 1TG7A 6REQA 4PODA 1FXPA 2O7SA 5H8UA 3ITGA 2P0IA 5J8LA 2VM8A 8XIAA 3GVVA 3NA8A 3ISIX 4TO8A 3WBAA 1ZJIA 3QSRA 3ZT7A 2J8TA 1VENA 4XZHA 1TKKA 4C91A 1GG1A 1QATA 3FLUA 2E09A 5BU6A 4CNTA 1TWIA 3S4TA 3NPVA 1JDEA 3DXIA 3B8UA 5C9ZA 4DJED 4A05A 4AC1X 1FDZA 2XISA 3SFWA 3QGKC 1GOMA 1HX0A 3TYZA 3NL5A 3TSBA 4CD7A 2ZICA 1GUVA 3I3BA 3O0KA 1JUEA 4PTNA 5AKQA 1DTNA 3CL6A 3GFYA 3E2SA 3NDYA 2QCFA 4HCDA 4J3SA 1HXJA 4AEEA 3LNMA 4MF4A 2FZBA 2ZX6A 3GHSA 1OC6A 5AZ1A 1EIXA 3E2VA 2CHRA 3BLOA 1L6SA 2GGIA 1QAPA 3GX9A 3IEBA 3KBWA 4ZEPA 3PTKA 1CLXA 2ZUWA 5G4EA 3EDFA 4GXWA 2V5JA 4RJEA 4UZSA 2QPUA 3O3RA 4DAFA 4AWUA 4JTTA 3B4YA 1V03A 5G2IA 4AY7A 3S6OA 3ITLA 3BCFA 2C8NA 3OYZA 4TMBA 4QRNA 2VCBA 4EF8A 4CQ9A 1V02E 3CHFA 2A2IA 2BB0A 3W7DA 1TE1A 2ABAA 1R38A 1J0ZA 4DWDA 4GE8A 3VU2A 3ARSA 1DIKA 3SM0A 1GW9A 3QV6A 3ORWA 4DZHA 5EA9A 4L9YA 4J28A 3GXDA 4XZIA 3IARA 5EY5A 4L1WA 2FHBA 1EL3A 3UXIA 4TIMA 4JY9A 3W75A 1HUVA 2EJ1A 3EWCA 5A2CA 4AC7C 3KOFA 4BF7A 1Z7AA 1GVEA 4RZBA 3OGSA 2CLHA 3K8MA 3PZNA 4OV9A 4WKAA 5HQLA 3M7SA 3D0CA 4H9XA 4GYPC 4AWEA 2XH2A 1A5SA 4JHZA 1JCMP 3WF1A 1TA3B 4M5PA 1FCVA 1ZAJA 2WMKA 4DJDD 5BROA 4W85A 4PYSA 1JDDA 3SRHA 5HWNA 1TX2A 1JYVA 3W27A 4MGGA 4QS5A 4UTFA 3S1GA 3W88A 1IE7C 2OCZA 1IR1A 4QNWA 3AXIA 1GVRA 1GQJA 4LAUA 2JKAA 4XKYB 1V08A 3AAMA 4AD2A 1TV5A 3RN6A 3B0XA 1FWSA 4XD6A 2XZ9A 4A2RA 3M43A 3R0UA 3QOMA 4PCNA 1Z32X 1R8LA 3KBVA 2V2CA 1SUXA 4WY0B 1ODZA 2XIIA 1BVZA 3BOXA 1AD1A 2J7HA 2X8RA 1HO1A 4UNLA 3VI2A 2ZZ2A 3VTRA 3KAOA 5HMFA 4QGCA 1UUOA 4FNUA 3CWNA 1KCZA 2OSXA 4LH8A 1CTNA 2ZXQA 3IUIA 3M0JA 3O16A 1OCQA 3GXIA 4G7FA 4MUPA 3OEXA 3T6CA 1E6QM 3TFXA 3CB3A 3QSTA 2Z1KA 1L2UA 2P0OA 3TYCA 1IGWA 4E8GA 5JH2A 1ZBVA 3S1UA 1NP2A 5CC5A 4MZYA 1BAGA 2JE8A 4LB3A 1ZBKA 1NARA 4B2DA 3E0WA 3OVRA 2O9PA 2CCRA 4G1KA 1UD5A 5C9RA 2OQHA 3WQFA 2PF8A 3DKJA 3AIVA 1KV5A 4Y9NA 3IV8A 1K7XA 4BS0A 1E0WA 4CEUC 5AECA 1O1ZA 1V6UA 3BURA 1V3MA 3VKCA 5BWAA 1UPPA 4FR6A 4ZQNA 5AVNA 2PWGA 4K38A 1HTIA 1TPWA 4PCTA 3VPLA 1VBUA 2ABBA 1J12A 1ALDA 1WBJA 3QKEA 3W83A 2RDTA 4I90A 1G4EA 4WGHA 2KZHA 2XSBA 1EKOA 1MRAA 3SEPA 5FESA 4GCAA 1UIPA 1LJYA 5CKSA 2RJGA 1XLGA 5AHNA 4PUDA 3VDAA 2WHLA 1GOWA 1RQBA 4O0QA 2F2KA 1VBJA 4DI9A 4AIBA 3EKZA 2DZSA 3MSDA 4GABA 3GH5A 4ACYA 5T8GA 2FVLA 1FDJA 4ZO6A 4PMJA 4AEFA 1AK5A 3RR1A 1FXQA 3CQKA 4RNIA 1ZJHA 3H4GA 3VGFA 1TFVA 3ARTA 3FW6A 4ES4A 2EHHA 3ZLFA 1A5NC 1QBAA 1DOSA 3WH7A 5AOUA 1JZ4A 3SCRA 4Z0JA 4GYFA 1X97A 1VFMA 2E8YA 4ORIA 2FZ8A 3AHTA 4P7LA 1QK2A 2QR6A 3W0KA 4AZBA 3IVTA 3QMRA 5A8GA 2VZOA 2YXXA 3SCUA 4NXSA 3QV9A 2DQXA 2PC8A 5AZ0A 1FCUA 4UTIA 3F7JA 1YBQA 3E74A 1KW1A 2HS6A 3GDMA 1KFCA 3SURA 2OU4A 4NZ5A 3RCYA 1E15A 2BWGA 3KZSA 2QCGA 1RA5A 1UKSA 3NQVA 3DI0A 1DWJM 1XYCA 2FJKA 4H9UA 4DUWA 1EJRC 1PYFA 3C5QA 4HPNA 4YPJA 3UJSA 2HMCA 3DG3A 4V15A 1BRLA 4E3VA 1TWZA 3NZQA 2OSYA 1CI1A 5EMMA 3OTRA 1QPKA 2WM1A 4WGXA 1IEWA 4UBPC 1V79A 3AMCA 3RJXA 3D3AA 4A3RA 3QPYA 3TJXA 2HS8A 3C8FA 5K4ZA 4MHBA 1LF1A 1JXKA 1DJYA 2P88A 1OQFA 3B0UX 1WV2A 3VE9A 3M6DA 3EXTA 5EFDA 4IFRA 1ZS2A 4HZMA 1H51A 2DT3A 3Q2DA 4KIRA 1PCKA 3KOYA 4F2UA 3N73A 3VCCA 4UC5A 4DZ5A 3HBLA 5CBIA 1AD4A 3PWAA 4PCPA 1HJUA 4BCEA 3HFYA 3SB0A 4LSBA 2YLLA 3EX6A 2WANA 3MYPA 1DJZA 1FWAC 1LBLA 3MQTA 3NQDA 4UMBA 3ITCA 4IIBA 1KTBA 4HHMA 2IMRA 3NWRA 4L4LA 1W9BM 3RM4A 1UH3A 4XVEA 7CGTA 3EWUA 4YN5A 1W3HA 1PEZA 1N8FA 2WSQA 3S1VA 5IDZA 5HDRA 4NQ1A 3ANUA 3CQ0A 3IIOA 4QXIA 6PTDA 3JR2A 1IZKA 3FDGA 4POCA 3SBFA 4H6EA 4ZO9A 2PWUA 4WJXA 4HPJA 1GTHA 5DCBA 1SJCA 3F5LA 4L4PA 1XXXA 5CSSA 1JZ8A 2ZX5A 2UV8G 2ZRZA 4LS0A 4WDWA 2V0TA 3N2CA 2J9ZA 4R34A 4LWWA 2OVLA 5A6MA 5AHIA 1KXVA 2WSRA 4GC4A 3UY8A 1S5WA 2IQTA 3BWWA 1PV8A 3IPWA 1H50A 3A12A 3DFSA 2FZMA 2R1MA 4J3TA 1F6PA 3OHMB 4LBUA 3BG5A 2BHZA 2XTKA 4NT0A 3KZPA 4XQ6A 4CQAA 3DFQA 4QROA 2INFA 4ACZB 2J4GA 4PMDA 1F2JA 2PWEA 3QYSA 1VPQA 4FF5A 1EJUC 1KFKA 3PZMA 4HGXA 1Q4WA 1L6YA 5CPLA 3PSVA 1SO6A 1V0KA 1XIGA 1V4YA 3KOXA 5JH1A 3ZMRA 3VKDA 3W76A 2OOFA 2PI6A 1EQCA 1WDPA 5FI8A 4Z1CA 3G5EA 2YBVA 3LERA 1BYAA 2PEVA 3AHXA 1XDJA 2YKKA 2VO5A 1K9TA 1WUFA 3P84A 4ZTXA 3TK7A 4CVUA 3CUZA 1GJUA 1PX4A 4EANA 3UD6A 4QJ4B 2FTYA 2NUWA 4WD0A 3UJEA 4FI4A 3CM4A 2A3BA 2HCVA 4CQ8A 3MPGA 3REQA 3VINA 3W1LA 3W82A 1GEHA 2X0HA 1UMLA 1Z69A 4U2ZA 5HMEA 1CXLA 4W7VA 4JN7A 2O55A 2PGRA 3WF2A 1HJVA 3EOSA 4TMCA 4HNUA 1JF5A 1IEIA 1IWAA 4GZ7A 2YL9A 1TPUA 4H7CA 3UG5A 3U7BA 3OGVA 1DQXA 3RX4A 4GX8A 2DZWA 3ZSSA 1I2PA 1XKJA 3G22A 1H7RA 2VFEA 1HZYA 5FSEC 1KV8A 3AWOA 1FP8A 1YPXA 4GNJA 4C60A 5HINA 5AC5A 5EBAA 1HT6A 3BW4A 1ISZA 1UQZA 2D1ZA 1UZHA 3WJYA 1K8XA 1QHOA 2CLPA 2ZRXA 1H0GA 1SR9A 3USBA 4E2DA 3AS0A 2YJQA 1TTQA 1W9UA 1IV8A 4L64A 3HMJG 3P74A 2OQLA 1F9CA 2P50A 5A6BA 1QNVA 3H22A 4Z1BA 1XGDA 4GOAA 2NSOA 1NSJA 2DSKA 5IHSA 1W56A 5LA0A 3PR2A 4M29A 3COTA 1XI3A 1OBAA 3GG1A 4KFPA 3BO9A 1PDZA 2JKEA 1VBHA 1UKQA 1VLWA 3NZ1A 3APGA 1NJJA 3PAOA 1SJBA 4DI8A 2WKGA 3KS5A 1EOMA 1J0HA 1M41A 4LVFA 1YKWA 3VNZA 2X7WA 4JYDA 3E1F1 3VGDA 2W66A 1UBSA 4B5NA 2P53A 3B9OA 5ABTA 5BMXA 1W5NA 3QHOA 3UY7A 1C7SA 1TIWA 2CHNA 2DIJA 2D73A 3ZJ7A 1BXCA 2R1NA 1WZAA 4C7GA 4C5ZA 3PAJA 1A5KC 2G4FA 2P3ZA 3QV7A 2GSHA 4DO7A 3TSDA 2VC9A 4FNPA 3EX1A 3THCA 4A22A 3QQWA 5CZTA 1CDGA 2ZE0A 1BWVA 1TREA 1Q8JA 2XFYA 3M16A 4TVUA 4W84A 2VHLA 1D7FA 4GUJA 3QN3A 2GVJA 2HWGA 3FX4A 4LUTB 4C7FA 1Q2RA 5XIAA 1WYIA 4KBXA 1MZHA 3QH2A 4UTMA 2CLIA 3S5SA 4YJ5A 5CJMA 3A22A 5DQPA 4GO9A 1DJIA 4G56A 2PDFA 3B04A 3DN5A 3MV11 1YIXA 5ECUA 4YTRA 1WXZA 2JKPA 4TXEA 1X6NA 4TUFA 4LJ3A 4QLKA 1P7TB 4X61A 2V5BA 1QPQA 1FCBA 3S6DA 3NQ6A 3T09A 4F0HA 2JIWA 4KETA 1VRXA 4K2SA 4AAJA 1GZJA 1Z6KA 3R79A 1KRCC 4X9YA 1ONRA 5FOOA 4LCRA 3UPWA 5F4XA 1Q3NA 2R82A 4JTLA 1TA3A 1CYGA 2G97A 3DHUA 3LLFA 2E4TA 5AN7A 1K1DA 3WIJA 2HPMA 3B8WA 4L4OA 2AKMA 3V75A 3LYEA 2JFEX 1Q6DA 1N82A 5CC7A 5G2WA 3B9EA 3WQEA 1HL8A 1SO4A 3LZ3A 1B1YA 5BZAA 3R43A 5L9FA 4JNZA 5G4HC 2ZZ3A 2DZBA 1W1ZA 2E9LA 5HUOA 4K8EA 4NJGA 3G18A 3GTNA 2QUTA 4AD1A 4PBGA 2WMFA 1VGAA 1XLEA 1E3ZA 3R1ZA 3NDOA 4RNJA 1CENA 2X0SA 3TTSA 1HKWA 1QW7A 3E5PA 1GQNA 4JIQA 2DZAA 3BC9A 3PULA 1H1ZA 1LQAA 5CPNA 3WK0A 4IPJA 4KCVA 4AZCB 1MEHA 2UY5A 4LEFA 1B3OA 4GGBA 4EF9A 2AL1A 4KERA 3ABXA 2OQYA 4OVXA 1AL7A 3M0KA 5DRCA 3V36A 3W86A 3MMWA 4AMCA 2E3ZA 3F4WA 4OHQA 4J2MA 1TSIA 3ITYA 5F1UA 1SMAA 3NQBA 2NX1A 1E70M 3UGVA 4GHRA 3UCCA 1CGXA 3GDTA 4MNMA 5CBBA 3I65A 3BZGA 1JD9A 2QCEA 3GIPA 3KVMA 4K37A 3QGVA 5E93A 2GGHA 3C0QA 4GXPA 5HATA 3STCA 4O1AA 2Y24A 3MVIA 3TSMA 2BTMA 3ZLGA 4G8TA 5E6YA 1MXGA 5FKYA 3PWGA 1TMHA 5C54A 1F73A 3N2XA 4LC8A 3WJXA 4C1LA 4XD3A 4PR4A 3N9KA 5KETA 2D22A 2WHKA 1G4TA 2VEMA 4C6CA 1O4UA 1QTWA 1UWRA 4E8DA 3EDEA 3K13A 4O15A 2VJXA 1P6BA 1IWBA 3RNDA 2R9RA 2GQAA 4ZOEA 3GXFA 4RDYA 3R12A 4KWVA 1XYZA 2E0PA 1QW9A 3W1MA 4MOZA 4LVBA 5A6LA 1IZJA 4H6RA 3CZLA 1NP0A 3F2BA 2DZTA 2XH7A 1FWNA 3UCQA 1SU5A 3G1RA 2V30A 1AVAA 1XDLA 2FDSA 1MQRA 1IWPA 2ZA2A 4HNVA 2E28A 2H3DA 4IL0A 2PZ0A 2E6YA 3T07A 3ARZA 3M0MA 3NQEA 2HISA 4K6AA 3C52A 3N25A 2ZKMX 3U9IA 1W1IE 3LCXA 4JL2A 3PZIA 1MQQA 4XZNX 1EQPA 2YPIA 1PDYA 2WWDA 1E9IA 4I7WA 1YDNA 4IGMA 2AOSA 4ZB2A 3LV5A 2VC7A 1H0IA 4CEXC 3WNPA 4D8ZA 4LCQA 4RLIA 2W27A 3LB0A 3FEMA 4YYCA 5FIPA 1W9VA 2J79A 1LDCA 3AYVA 4UOJA 1AQFA 1OD8A 1R2RA 1DBTA 5CBJA 1PTDA 1G0CA 1Z41A 5IXEA 2A85A 4JFTA 2WC7A 2VWSA 4JKMA 4F4RA 3B0PA 5C9XA 3ZVIA 2P3EA 1GYMA 2HEJA 1ME8A 1JFHA 3L4UA 4UNIA 3ELFA 1JDAA 1GT8A 2GUUA 3FNDA 4DBEA 1F6KA 1X6LA 4P8VA 4O0KA 1W17A 1XLCA 4RKAA 4N9BA 1IYXA 2DUXA 3DKLA 2ISFA 4TOQA 3M07A 1J6PA 3P7YA 4UOQA 1TELA 1WQ5A 5K9CA 4OECA 3M5XA 3ZM8A 1Q7MA 3TOYA 3ZFHA 5M2FX 3KM8A 1GVSA 3TJ4A 4BY3A 2VL4A 2ESCA 4PUWA 3IAPA 1M1BA 1AW2A 3LCIA 1KCXA 4WLCA 4BZYA 1W2PA 3OVQA 4GZIA 3GZ3A 2V82A 1FTXA 4AD3A 4PTXA 2A7PA 2J7FA 2J25A 4U2YA 4LS2A 1HKIA 4IQEA 5C6MA 3KE0A 1RY0A 2ZRVA 3WFZA 2WZTA 2E9BA 3AXXA 3VCRA 2PD5A 3GYEA 4HPGA 2XG9A 3C86A 1PSCA 1KFLA 4TTGA 1LORA 2FGLA 1O94A 4O11A 1RQEA 3PM6A 3LMYA 3WLTA 4L65A 3CUJA 4PCSA 1P1MA 4JIPA 3MUZ1 4V33A 5LXXA 4H8VA 3T4CA 4LRTA 5G2HA 2WXDM 4B15A 3QHNA 3A9IA 1NWSA 1VJIA 3L2LA 4XZLX 3E96A 1EXBA 3BUVA 2DT1A 2QUMA 1LUCA 4P8WA 3HU7A 4XAZA 1QBBA 1RSCA 1NU5A 3R7MA 3APTA 3H53A 5MF5A 4RDZA 1OYBA 1XLAA 4RNFA 2VGIA 1KBLA 2X42A 4LALA 4AVOA 2X30A 2X09A 3T42A 3RPTA 1W5QA 3UNDA 4RZ6A 1E40A 2XWEA 4ACZA 3V1PA 5LSMA 2PDXA 2Z2AA 4J40A 1XYMA 2XGZA 1ICQA 3W2JA 1S5VA 3WD1A 1WDQA 1VPYA 3ZJ8A 3SCSA 5F2LA 4JXCA 1EPVA 2I56A 3BV4A 3VDCA 3ABRA 2B7PA 1RCXB 3P2VA 1C8YA 1W1B1 3SCWA 2VQTA 4OT7A 4IP5A 3W85A 3PBUA 5C9WA 3M5ZA 4ML4A 3IANA 3ENLA 4KCUA 4DX3A 4YWSA 1XIHA 4ASTA 4IT1A 3W71A 3BGJA 3UXLA 2V2DA 3TYUA 4IJCA 1NDZA 3GHTA 2GZXA 3AMLA 3HGRA 3NAVA 3CV2A 3RM9A 4ICNA 4LOCA 4PUKA 2WKJA 1PUDA 4XAPA 3OW1A 1OB0A 3IGSA 2W67A 1XCWA 5F2GA 1FFRA 4DN1A 2PDNA 1KWGA 3W53A 4DBWA 2WVVA 1ZGDA 4BHYA 2XVPA 4O50A 1ZALA 3VOCA 3CK5A 4EWJA 2VGFA 2OOGA 1EDGA 5IFPA 5F4SA 4KGJA 3BCDA 3W7HA 3NPWA 4FOKA 1SMDA 1XIBA 2NVCA 2UY4A 1W6TA 3W25A 1R3WA 2F7FA 1LL7A 1RR2A 1F3WA 1GVQA 5A69A 1A5LC 3BZJA 4M8UA 1GYNA 1RXOB 2FB3A 5FJJA 2WMJA 3WMLA 1PIIA 1QOQA 2A3EA 3VGEA 1L8NA 3EA1A 3NIYA 3R25A 4AVNA 3LM7A 1T0OA 1ZQ5A 1JPKA 4C1KA 1A0EA 5CQ1A 4DLMA 2GOKA 4HYRA 1XYLA 1OT2A 3BAKA 3RILA 5IFTA 4P7QA 2VDIA 1K8CA 2G41A 1H1YA 2CC0A 3KS6A 3IJ7A 4JDYA 3WUEA 2D2OA 2INZA 3N29A 3ARWA 4UB9A 1E6SM 1PKLA 4DF2A 2BLEA 3BOLA 3GBEA 4B16A 2ZCGA 3WD2A 2PPGA 2CZEA 3REQB 3VNLA 1BHGA 2J77A 4R3UA 4X9SA 4HMCA 3T0AA 1PWMA 1OFDA 2D2HA 4W8LA 2ZX7A 2D20A 3OLDA 3BARA 2W3ZA 3L12A 3LPOA 3ARXA 3GXTA 3GSMA 1LP6A 1GJWA 4B5TA 5KMYA 3WJSA 4HOXA 4LUSA 5J5RA 4ML9A 2REQB 1UW9A 4NL1A 3TWBA 5IBXA 2BODX 2BVDA 2G3FA 4A3YA 1CGUA 2IUZA 1G1YA 3NGJA 2DVUA 1X96A 4PC8A 3BCJA 1CXKA 2CBVA 1DIDA 4DO4A 1FCQA 1YLVA 4JKKA 4QHRA 4US5D 1NOFA 2Q8LA 2VFDA 5I24A 1I60A 3H4XA 5M17A 5LXEA 1XJBA 2QF8A 4QQ3A 4XV0A 3S5OA 1G5AA 1FHDA 4V1YA 5I3DA 3T55A 2ICSA 5A94A 2VTFA 3UBPC 3W7KA 1MEWA 5JUVA 2I17A 3B8VA 4PUUA 3WNNA 3VIJA 4BKNA 2GGEA 1KM6A 4LAMA 3TLQA 1X98A 2FZDA 4HPHA 1YDVA 4W86A 1TJPA 1OFQA 3EWWA 3EWZA 3DYPA 4ZSUA 3GC5A 1PZ0A 3VGBA 3W01A 4NX5A 4PTDA 3TNBA 4AZIA 3O6YX 1B9ZA 4NNAA 4HJWA 5A6KA 4IPIA 1UH2A 4DWSC 5CAHA 3W4RA 3AC0A 2CZVA 4DB7A 1HG3A 4MSSA 1KBJA 4Q4PA 3A21A 3L4ZA 4H19A 2GQ3A 3LN3A 4Y96A 1RVGA 1LBMA 3B8TA 1X39A 1AUSL 5GNZA 1PTAA 5I6SA 1J96A 4IL2A 1QU4A 2WZEA 2RHGA 1TMLA 5TBOA 2VRJA 2YCIX 1PKMA 3WNKA 1QWKA 2I7GA 1XLHA 4HIBA 3S46A 1EF3A 5H6HA 1XC4A 3W1RA 1H7NA 2YB4A 3VZYA 3PZQA 4Q8OA 4B90A 3UG3A 4PUNA 1VYPX 3EMZA 3CAVA 4KEZA 4NJJA 3PB2A 3VMPA 2VX6A 2PDJA 5M5DA 1X6UA 1MVYA 3CQHA 2F38A 1V6YA 1SJAA 4H00A 3GG0A 3SY5A 4I8YA 3OOQA 4R53A 2WPBA 1T96A 3DC0A 4HHLA 4NY2A 1UCWA 1UR4A 3T0CA 3PZOA 4NZFA 1IR2A 3DUGA 3ARYA 4JQ1A 3HQOA 4RNHA 3W7EA 1CW2A 4ILSA 4GO8A 3O15A 2WV8A 3A4WA 4IICA 3Q45A 1VZWA 1Q13A 3PJXA 3P14A 5HJYA 4XTIA 4AUBA 3PG8A 2G4JA 4J7RA 4YTUA 1P48A 3HA1A 5LHFA 1SW0A 3CPGA 1S2WA 3ITTA 5CPSA 1UOZA 1VJSA 1K70A 3MJYA 1WE5A 3BSGA 5LHEA 2VP8A 5A6AA 3N18A 4LF2A 1FWEC 4FX7A 1A5CA 3FKKA 2PDUA 3U3HA 4WZHA 1ITUA 4UQDA 1YPIA 4OV4A 4V28A 1Q8AA 3BLKA 3QBUA 3KHDA 1O5RA 4GY7A 3M64A 4YTTA 4QDPA 1XF0A 3KDOA 1Q6LA 2D2GA 2ZRUA 2P1FA 4RPQA 5DBTA 3CMFA 1TO3A 3WD3A 3LD5A 2BVTA 1OHLA 1E56A 5JBFA 4M56A 5FL1A 4IGNA 4AHOA 4Z1DA 1K7FA 1R30A 5F2MA 3CQIA 4L4MA 1W2VA 3ARQA 4ZODA 2OGJA 3MUCA 4IUOA 3T8LA 3CUFA 4FPSA 3WELA 2AQVA 4JY8A 1K6WA 1JYXA 4AWSA 1YW1A 2YYUA 4D8LA 5GJMA 1WO2A 5E0FA 2WVSA 1Y5VA 2RGMA 1XIFA 3N19B 1OG0A 1GZ1A 3OQ8A 4PB4A 5HR6A 2FGBA 1Q6RA 1OIMA 4MFDA 1XS2A 4QCEA 1MWOA 4HHPA 4XD4A 3V3WA 1PBGA 1IT7A 4C1NB 4GACA 4UFJA 4CD8A 1Q45A 1EX5A 2YXOA 3FOKA 2FKPA 4MADA 3WEZA 2TSYA 3M7WA 3NXLA 4Q33A 1ITQA 3GG7A 2E40A 1FBAA 2EGZA 2PDWA 5G1TA 1KC7A 3T0DA 3P0WA 3IIPA 3L23A 4JFUA 2C18A 1XUUA 1KCLA 3DG7A 3E49A 1S2CA 2V81A 3LX9A 4RE0A 3DEQA 3L4YA 2XN0A 1QNPA 2SFPA 3TWAA 4IISA 2EXOA 1ZBCA 4A3UA 2XM1A 5DANA 4HVXA 1OFEA 2QUVA 2XFWA 4ZB5A 3VFCA 2NQ9A 2G5WA 4PTVA 1MW2A 5DO8A 4KW2A 1CNVA 2R14A 3VD3A 1EA0A 1FKWA 4LPCA 2G96A 2R94A 2HXTA 3WY1A 2REQA 1FA2A 3VM5A 1PPIA 2DSVA 3QLLA 2C16A 2GJNA 1W5PA 2F6KA 2XHYA 3W22A 2Q8XA 3URNA 4IGSA 2QF7A 1ZTVA 3T05A 1TCMA 2J9XA 5U4NA 5A95A 1LRNA 1U83A 1H7PA 1JULA 2GOUA 4LY8A 3OYXA 4O1EA 2P5NA 3MCMA 3BDKA 5HAOA 4AIOA 4KFNA 3D46A 1NDVA 3RPMA 3UF9A 2ZUVA 4MWAD 3PZVA 3OA5A 1I75A 3NUKA 4IG2B 3ZZ1A 4PN2A 2ISSA 1PE1A 3MP5A 2FFCA 2XFFA 3WUGA 4MPKA 5C2XA 3U0HA 1I2NA 3UETA 3V16A 4MFEA 1VB9A 2PDQA 1UP2A 1PVNA 3IVUA 3FJ6A 3SO7A 3S5ZA 1XLMA 5HPCA 3ZWTA 3FA3A 2W63A 3W1AA 1BF2A 2NX3A 1ZRQA 5I3JA 3LCHA 3QLDA 1G7UA 4ZQRA 3TR2A 1S5TA 2R1KA 2ZWZA 4QDMA 3G1XA 3NJ3A 4XKMA 4C90A 1BQGA 1EP1A 3T2QA 4G6CA 3QHMA 2PDBA 1GKQA 3E6EA 3LHWA 1J0KA 5KSWA 1OGGA 1US0A 3UYCA 4EPBC 4D72A 4YCPA 4O10A 4H6KA 3WF4A 1WZLA 1VD6A 3DHFA 2A6NA 1PX3A 1XLJA 3VGHA 2GVLA 4M81A 1DE6A 4KFOA 1OX5A 2ZUTA 4DPQA 4R9XA 1YTKA 3G1SA 4H9YA 1UKOA 1XFBA 3WLSA 1NIUA 2YCLA 1U33A 1NEYA 1JI1A 3L4VA 3P8IA 3AU2A 4GC3A 5C55A 2PCQA 1L6FA 2Y70A 3LLXA 3R0DA 2NLIA 1H7XA 2I14A 1BYCA 1C9DA 3DAQA 4XZWA 2J6XA 3NEHA 4PL1A 4FMVA 4RK8A 3W1TA 2A0NA 2PGEA 4UTJA 4PFMA 1W1VA 2DSUA 4RE2A 4JOMA 4WOQA 3WO8A 3CGTA 1ISWA 4JN8A 1GJPA 1G9HA 2YSWA 7ODCA 3LQLA 3GNPA 3CQJA 1XLKA 4UCFA 5ENLA 1MW3A 4H2CA 4XZBA 3MJMA 2MANA 7TAAA 3MUY1 2Z2BA 1X1ZA 5M03A 4REQA 4PRRA 3P62A 2QJNA 4M6QA 3A4AA 3CMJA 3FHQA 4I3GA 3DCPA 5DXYA 3KHJA 2ACQA 4PFHA 4M82A 4PTMA 5TAOA 3PJUA 3TONA 4D1IA 4UTWA 1LBFA 4D9PA 2FPVA 3STGA 3T0TA 4F0LA 1YTEA 4EXBA 2GJRA 1V93A 4W4QA 2DPEA 3N2MA 3TV8A 4CNNA 1ICSA 5SWUA 2D69A 2ZVRA 1QDSA 4L6OA 2R91A 4MB3A 1HFBA 4ZXLA 2ZUMA 3KLLA 1WKFA 4PSRA 4IIEA 4GJIA 4UQCA 3TMLA 4F8XA 3ZJ6A 7TIMA 2E25A 1R0MA 5LIWX 3QVQA 2NX9A 1EUAA 3G1HA 1LLOA 3STFA 5CH9A 3B03A 3DBPA 4PGLA 3T08A 2F9RA 5AYXA 4OUIA 3ZT6A 5C7HA 5DEZA 1BTMA 5CC3A 5I07A 3VKKA 1QPOA 4B5XA 3NO3A 3KWXA 4KEUA 4FLRA 3DYMA 1BRLB 4GYKA 3I6TA 4XWUA 3OG3A 3BLIA 2ZQ0A 3A13A 1G6CA 4ZXOA 3IJ8A 4JPGA 4PMNA 3UU0A 5J5DA 1E6PA 1F4AA 1B90A 1LCOA 3R58A 1W3LA 5A6JA 3TC7A 3VNYA 5A8OA 3W72A 3CZEA 1U5VA 4C6QA 2Y63A 3VNJA 3AHVA 4LV4A 3GKAA 3DECA 5EYWA 2GWNA 1O1HA 3ARRA 3OB8A 4Q8WA 1IQ8A 1R87A 4JTFA 4JTKA 1BWLA 1L8PA 4BFAA 3G3MA 1QHPA 1KLZA 1C93A 4AX6A 3NO5A 4ADTA 4UQBA 3EOEA 4K1WA 3SGUA 4N9EA 3ARPA 3WBXA 5AHLA 4EP8C 3W2UA 4CN4A 2NV9A 4RW3A 1KQZA 2GDUA 4HU8A 1YX1A 1B57A 5K4XA 3VA8A 4R7WA 4FO4A 4O1DA 4IUGA 5C70A 4LW7A 4ADUA 1UD3A 2GYIA 3OZMA 1XRFA 3MI3A 3PNZA 2DQWA 1HVQA 3MP3A 4K7YA 3W02A 5E5CA 3WLNA 1E55A 5CPOA 1DHKA 4DZAA 4PE8A 2Z1XA 4S23A 3ABQA 2QYGA 4PULA 4Z2JA 3TTEA 3M0YA 4JTIA 4HYWA 1RPKA 3AZRA 1S2VA 3BL3A 3PY2A 5CPMA 1P1XA 1QNRA 1VRDA 4US6A 4LAZA 1XD1A 3A5FA 4DLFA 2W62A 1AH4A 5BOOA 4A4AA 5I23A 3HV8A 5E0CA 4IP4A 2GQ9A 1Y0EA 1PTGA 1DEDA 4OBTA 5EFFA 1T5AA 4MNLA 4JTSA 1KM5A 3WQPA 3QV8A 3VK5A 4LANA 1K9FA 3D5HA 2TODA 2GUBA 3WQOA 4GUHA 4WJEA 4S2CA 3L0KA 2QJHA 3MSRA 3QM3A 5D9OA 4KCWA 1OY0A 3V5FA 2YYTA 4ZZ9A 1NOWA 2X1UA 4P7OA 2UY3A 1KD0A 1Q6EA 3L7RA 1LLZA 1OWQA 3WLJA 1U1JA 1YNYA 3VIHA 1VHNA 5AYZA 3NM3A 3N12A 4KKXA 3AJXA 1B3ZA 5IBXC 3GVWA 1W8GA 5I3IA 3SY1A 5BXSA 3IJLA 2J62A 4F2BA 1GYLA 3B06A 3FXGA 2G95A 2JK2A 2ISDA 1CLKA 3T7VA 3AROA 5D9MA 4XX6A 2HQAA 1AFSA 1A5AA 1GWJA 3CT2A 2V68A 2CKRA 1NWRA 1OG6A 2RJHA 5ABEA 2NVAA 2EKCA 3H54A 1VYSX 4L1GA 4O1CA 3VDBA 3CNYA 4IXXA 3CO8A 1PIGA 1SO5A 4QG8A 2ONEA 4F79A 3NPXA 2O9OA 4YVVA 4U33A 2QZRA 3SJ3A 1ZBWA 1E4IA 1QI4A 4C6DA 4UR9A 1JCTA 4QEEA 4R7OA 4GMEA 3TROA 1CXFA 5HNNA 5CSYA 1KWKA 4JYFA 2QPXA 4J3UA 3MHGA 3L0NA 1JFXA 3N11A 4W7UA 1HGWA 4BQ3A 2F2HA 3N2OA 3BSMA 4Q22A 1KB3A 2YL6A 4EWND 3VNMA 2CLKA 4AXNA 4IFOA 3A23A 3IRSA 2FPYA 1B30A 3C4UA 2WW5A 1TWWA 3KCOA 5AHEA 4ZOCA 3EB2A 4FOUA 2VOTA 3PANA 4IMEA 3ARVA 2XH0A 2G3JA 3VIMA 4DO5A 3WUFA 2DP3A 3N15A 1LUCB 3P5ZA 1E0UA 2VR2A 3UZ5A 4CNUA 3PK7A 2EG6A 3KLKA 5D9PA 1TR9A 4O12A 1X8CA 2YW4A 1GOOA 1NDWA 4PMXA 3T8QA 4U10A 1X7IA 1W1TA 3TKFA 3KL5A 1JJKA 4KRUA 2CESA 3ANVA 1J5SA 3S3GA 2WCSA 2Z1VA 2C91A 2B7NA 3PUEA 3WBYA 2XFRA 2G3IA 3PFRA 4DM1A 2QHAA 3AISA 3C2FA 3D6NA 3W28A 4W87A 2IXUA 1H60A 3LTSA 4W5ZA 3WLKX 1NOUA 5DY2A 1NWUA 3LHYA 3VVGA 3TYBA 4RXGA 4H04A 2D3NA 3CH9A 5D30A 4GIYA 4NNBA 4JBRA 5H2ZA 1LZOA 2E5CA 5H1WA 2I1OA 4ZFCA 4JD4A 2Y8KA 2NV2A 1QCWA 4XZMX 2ZZ1A 3AMKA 2OEJA 5XINA 3EB4A 3GD6A 4CNSA 3A6OA 1TVLA 3YPIA 2XGBA 1I0DA 3M6YA 4O19A 2IPGA 1Z9AA 3OA3A 3GC2A 2A3CA 2PE4A 3K1DA 2NVDA 2QV4A 4Y9AA 3EYPA 2FB2A 1DJGA 1BG9A 1G94A 1HF6A 1R9XA 4ZSTA 3HG5A 4M7SA 3CB8A 1GEQA 4ZR8A 3TYEA 4NZ1A 1ZB5A 3LRKA 1O6IA 3VM7A 3WFLA 4FLOA 1O68A 4D6GA 1GVIA 3NO1A 4YIWA 3UERA 4YVXA 1TZZA 2OPJA 2DDXA 5MKGB 3H2MA 2FIQA 2VZTA 2NT1A 1RPXA 2AQOA 4H83A 3ITVA 1EHNA 4PB5A 1EX1A 3SI9A 4W8BA 3NQGA 3T78A 1AL8A 1EYWA 2PD9A 3M5YA 2ATSA 2OZTA 5DBUA 5C0QA 2O56A 4XBSA 3I3EA 2TRSA 3HO8A 4AHQA 2HNHA 2DW6A 3SUWA 2Y4SA 1XHGA 2A3AA 1OCNA 5AYBA 3CUIA 1TZ9A 2UZ9A 3A5VA 2Y5EA 1A3WA 3GUGA 3SQMA 2BASA 3KBJA 1GCYA 1HL2A 5CC6A 4XBKA 4MVAA 1P0EA 3VC5A 3H21A 2GVGA 2QCNA 3GDBA 3F4VA 1UQYA 1TX0A 5D02A 2YLAA 4AVFA 5E6ZA 2C1GA 2DZPA 1W5MA 4JTAA 1EC9A 2KAUC 4DJFD 3GVRA 1RBOB 2CBUA 2WQPA 4Y7EA 3UZWA 3QY6A 5LIKX 4QSHA 5HNRA 3CUGA 1EC8A 2Z0IA 3NGFA 3SADA 4DWSA 3FXYA 2YR1A 2J7GA 5JVLA 5CGQA 3W7JA 5CSUA 1I2RA 1X8FA 3BAYA 4TVCA 2YDSA 3GO2A 1WAWA 4G9PA 5I09A 5KZDA 4N4PA 3PG9A 3QY7A 3W26A 2H9AB 1EXPA 3TFCA 3H7UA 4QIUA 1XLIA 1KXTA 1LL6A 4GGHA 2Y0FA 2Q3OA 1XRSA 3H2EA 1EO5A 1U22A 4FXJA 2O92A 1NFBA 1ECQA 4ZO7A 3BXWA 1JCYA 3PBMA 3U6WA 4I7UA 3S6TA 1RH9A 5IOBA 1HIZA 3TLLA 4GFIA 5L6UA 4KEVA 3OZPA 1V6XA 2HK0A 1O5XA 3POCA 3NQCA 1TPEA 4FNRA 2ON3A 1YADA 3Q65A 4MYXA 3N2BA 1QXLA 3WZ0E 2Q01A 1OFOA 3WL0A 4HA1A 5EMJA 4BWLC 3NZRA 1Q6FA 4LTSA 4EKJA 2Z7KA 3NQAA 1OFRA 3CMGA 1Z8AA 2GK1A 1MFUA 2W92A 3UR2A 3W9ZA 3WMBA 3TQVA 1WB0A 3AIBA 3B8IA 3U5YA 1MW1A 1ZJAA 2E7FA 1UZ4A 1NY1A 3W1XA 2OO0A 1I2OA 1P5BA 3J7HA 1E9LA 2PAJA 3E02A 1BGAA 3CWHA 3OP2A 4LX4A 3P61A 2CETA 1I1WA 1JCJA 1D3GA 3MO7A 4M3PA 2VC5A 4PB3A 3OZOA 2OWWA 4JHMA 3K4WA 4XO7A 3NDZA 1JXJA 3ITOA 2ZADA 1Y8BA 1VEOA 3P60A 3S0CA 1KLYA 3O1NA 1UP0A 3K2GA 2RAGA 5IM51 1UZ1A 1UR9A 2PF0A 1T8QA 3SFKA 3WEMA 2J8GA 5GNYA 2X16A 4MWAC 1AH3A 4HU0A 1OX4B 3C3UA 1R2SA 1XGZA 1UPMB 3KRSA 1ME9A 4F66A 4DYKA 4L7ZA 1BD0A 1ITXA 1MEIA 3LHUA 3SSJA 1WAUA 3HPAA 3UG8A 3RJYA 4NAFB 3VABA 2GVYA 3ME3A 1VR6A 4YMZA 3I4KA 2PBGA 4UTLA 4S3EA 2BY3A 3VIFA 4DRSA 5FEPA 3HFTA 4W8AA 2ACUA 4JS3A 4NJHA 5BWFA 3I7SA 7ENLA 2VUNA 3UYIA 3MMTA 1DL3A 3WLMA 4NX0A 2YFNA 1O5QA 3NQ7A 5BU9A 3IUDA 3AMDA 3H24A 3HZ3A 3TW6A 1HKKA 3BG9A 1UR8A 4KGLA 3KRZA 3TYDA 2Y7DA 5DELA 1FWJC 2WC4A 4DBSA 3LSBA 2ACSA 3K1GA 2PSNA 4F40A 2BG5A 4KMQA 4M24A 3GYCA 3PZ9A 4MZ8A 3VAVA 3GUWA 4RV8A 4GI4A 4M1RA 3L66A 6REQB 5I3GA 4P8XA 3WK1A 4IQLA 2NUXA 1OABA 1UWAA 4MTVA 1F4HA 4ZQCA 3UZJA 5HNTA 3TZFA 3WBWA 1A4LA 1EEPA 3CAKA 1DIOA 3I7QA 2E6FA 3IAQA 2YZRA 3AICA 3GB6A 4AZ6A 2V3EA 3LPFA 3F03K 4KS0A 3TCEA 2IQ0A 4H9TA 1OC5A 5F1VA 4ORMA 4GYPA 1RCQA 1CXIA 1DWFM 3G0XA 3EDKA 5DMLA 1L6WA 2Q3RA 1E1CB 2DVXA 3CZ8A 1GOXA 3W7NA 3GNRA 3EBVA 4J35A 1OGBA 1SZRA 4J4KA 4XAFA 2WK2A 3S5YA 1I4NA 4HMNA 3I4EA 2PU0A 2VNCA 4Q8VA 1O12A 4IJRA 5B80A 4E2OA 4Q8TA 1I8JA 2J9YA 4Y90A 2G3NA 3N6HA 3IK2A 2CYGA 2VR4A 3D47A 2NXIA 4C6MA 2V69A 1DPMA 2WNZA 1VP5A 5I3HA 1N7KA 1TJ2A 5E9AA 2RUSA 4ZE4A 1ZLPA 3SDOA 1UD8A 3DFYA 4G2DA 1MXDA 2ZE3A 1G7VA 1XKYA 2ZUUA 1KGXA 1WP6A 3QTGA 4BQ2A 3EXRA 4HMDA 3KRBA 3DESA 1M6JA 4LYRA