5CSUA

Disproportionating enzyme 1 from arabidopsis - acarviostatin soak
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
518
structure length
518
Chain Sequence
ISVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 179
structure length 518
sequence length 518
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csuA01
2WNWA 1UH3A 5EB8A 5CG0A 1GQIA 5I77A 4ML4A 3QHNA 1NWUA 5M3WA 2XWEA 5HXMA 1C7TA 5HPCA 4XZBA 2YDSA 1EOKA 3L4UA 4P8UA 4FLOA 1ZBCA 5CLWA 2BFGA 1KXHA 4J3VA 1VB9A 2GVYA 1C3FA 2VX5A 2XIIA 4AZCA 2W67A 3QOKA 3VO0A 1UR8A 1R86A 1PZ2A 4UCFA 3UCQA 1ZS2A 3GBDA 4AZ7A 3GNOA 2XFYA 2WW5A 3WNNA 5E0FA 4FK9A 3DC0A 4DWSD 2OWWA 4B9YA 4WF7A 1WPCA 1HKJA 1CXHA 1QHPA 2NW0A 2WCGA 3BMVA 4MB1A 5A6AA 3SCQA 2YLAA 5I2UA 4UNIA 2JE8A 4UFJA 4C7DA 1LL4A 3BC9A 3K4DA 3BCDA 1FOBA 1M7XA 1B3ZA 3SCTA 2V3DA 3KEHA 1Q4NX 2DDXA 4CD8A 3VD3A 4F8XA 5A6JA 2IXUA 2EPKX 4U2YA 1ZL1A 2CBVA 3AIBA 1JZ3A 1CENA 3WQ5A 4AZCB 4GZEA 1RP8A 4JHOA 2ZUWA 3KE0A 1H49A 1HXJA 3OZPA 1MQQA 3RDKA 4HP5A 1UA7A 1HJVA 4CU6A 4QLJA 3U7VA 1LG2A 2WM0A 5FL1A 1C8XA 1EDQA 1AQHA 2EPLX 2WYSA 1R7OA 1HVXA 3VIOA 2DSWA 4OJYA 3AIVA 4CN1A 1J10A 3N9KA 2XG9A 2FHFA 5GNZA 2ZWZA 3S2CA 4LPCA 5D9MA 4MNKA 1CXIA 5E09A 2JF7A 3W37A 3WELA 1VEPA 3F4VA 2E8YA 1J0YA 1K9FA 1QHOA 1B31A 1BF2A 2FHCA 4F79A 2VUYA 2B31A 1G1YA 2YL5A 4CU7A 5DO8A 5C70A 1UR9A 3ZM8A 1DWFM 4WK9A 3GNPA 3BLKA 1D3CA 3FAXA 3VDAA 1HKMA 3CUIA 4UOQA 4E8CA 1UWIA 2WVSA 1O7AA 5HNNA 2QLYA 3OLDA 3ZJ6A 3B9EA 1D2KA 5CGMA 4GZIA 1XHGA 4IUGA 5I78A 3OZOA 2G4FA 2YJQA 2A3AA 3NIYA 2J7BA 4IM4A 4S3KA 5GNYA 3DYOA 3WSUA 1ODUA 1LWHA 2WMHA 1IT0A 4TX8A 1V6XA 2VRQA 1WZAA 3D5HA 1MVYA 1JDAA 2ZIDA 5ABHA 1J0IA 4UQEA 4CGTA 1WZKA 3IANA 1ISZA 2CNCA 1AQ0A 1JAEA 1B30A 3WF1A 1CLVA 3CZKA 2PWDA 1BVNP 3GXIA 3W26A 4J28A 2WMGA 1W9DM 4GQRA 3VGBA 2EQDA 2VVNA 1JDDA 3IJ9A 2W66A 2GK1B 4NF7A 3VGGA 3WQ4A 4W7UA 2WMKA 1NWRA 3I3DA 3CPUA 5GPRA 4AZGA 4W7VA 4L4OA 2XJ7A 3MU7A 3U5YA 2WBKA 5I5RA 3TTSA 4D6HA 1B0IA 3WDHA 1WKYA 3VIKA 5CPTA 1MW1A 2WZEA 1N82A 3FXYA 3W6LA 4PN2A 4YPJA 4W86A 9CGTA 2WSKA 4KRUA 4RL3A 3VU2A 1OWQA 4FLQA 2WMIA 1E3XA 2VX7A 1X1NA 1OGBA 1E43A 4XB3A 1HX0A 2BVYA 1XCXA 2VJXA 4BS0A 5A3HA 4J3SA 1QI0A 2BXYA 3FAWA 1EHNA 1E6ZA 4MNLA 3SCWA 1MQPA 2XYLA 4JIEA 1UKTA 1V0NA 2V38A 1VJZA 3VGEA 2CXGA 4JAWA 1TFVA 1PJ9A 2D24A 3AYSA 1UD8A 3WH5A 5I6SA 3GH7A 2WVVB 1US3A 3MV01 2J77A 4IISA 4FLSA 5D4YA 1O6IA 1TE1A 4BQ5A 1VEMA 1SFSA 2F8QA 1W3LA 4HMDA 3WENA 3K8KA 1BLIA 1W3KA 2ESCA 1MYRA 2CITA 3BCFA 4MPKA 2XM1A 1JD9A 1BAGA 4KMQA 3RJXA 1CIUA 4XX6A 3SEPA 2PWGA 3GZAA 3PZTA 3UERA 2G3NA 2YL8A 2XSAA 4XZWA 3WF3A 2WAGA 4HOXA 4ZE4A 4PMUA 4JHZA 5BCAA 1W9XA 1TCMA 1JI1A 2C0HA 2OWXA 3M7SA 3CUGA 4GPNA 3AFBA 4P7NA 4LYPA 1QNRA 4UQ9A 4AEFA 1OT1A 1UR4A 3EMCA 4LXFA 3L4XA 5LA0A 3WMBA 4U5KA 1UD6A 3FNDA 1E9LA 1VRXA 1DWAM 1E71M 4CCEA 1DP0A 1UZ1A 3OIHA 2DH2A 2XTKA 4JKMA 1B9ZA 1EO7A 1QNSA 2WXDM 4U3CA 2GDUA 1UR0A 3WDIA 4HOWA 3WBAA 1EQCA 1U2YA 4L4PA 5AC4A 2XGBA 3O9NA 7A3HA 5BXPA 1K9DA 2Z1SA 1QBBA 1MW2A 4MAVA 3VINA 1JYNA 1W9VA 3CHDA 1KR0A 2XM2A 1NOWA 4GIAA 1MXGA 1W91A 2X8RA 2WMFA 2UY2A 4PMQA 4MNMA 1JZ6A 4WSJA 5I0DA 2BY0A 3N04A 2ZX5A 3O2LA 4W88A 4UZSA 2J4GA 2YIHA 3T2PA 3WQVA 4H8UA 4D6IA 4FLRA 2D0FA 3CLWA 4A3YA 1JFHA 3CUJA 2Y8KA 1TA3A 1US2A 1W2PA 4GQQA 3SCSA 1QNPA 4UTFA 1QI3A 1XCWA 4Z2HA 2YLLA 1KQZA 4JCLA 3K4AA 3OA5A 4JFUA 1HNYA 3PZGA 3BH4A 4CN4A 4DUWA 3EDKA 1OM0A 4LQ1A 4B16A 1KGUA 4AD2A 3T0AA 1HF6A 3VIPA 3E1F1 1WCGA 3ZMRA 2ZWYA 2VL4A 4M29A 2VR5A 3W82A 2D3NA 1E5JA 4QP0A 4PMRA 4GXPA 1EQPA 2DIJA 4UFHA 3PN8A 3VNYA 1V3MA 3SCOA 4JL2A 2X2YA 4M8UA 2XUCA 4B3LA 1NARA 2VQTA 2ZX8A 3S6TA 5A1AA 6A3HA 3M6DA 4U2ZA 1OIFA 5FCZA 5A6SA 1TA3B 4YN5A 4HA4A 4AZHA 1M03A 2DGAA 3AROA 2YA1A 3WNMA 1CXLA 3MUAA 1UKSA 2VZVA 4X0VA 4BQ4A 3DHUA 4MJ2A 1ODZA 1W32A 5IXEA 1K6AA 1W3JA 1CGXA 5ABEA 3SURA 1E6SM 3WKZA 3L2LA 4H2CA 4AEEA 1UUQA 4EE9A 3AZTA 1ECEA 1UWTA 2D0HA 1E5NA 2D3LA 2GJPA 3VIHA 2DH3A 1UKPA 1I1WA 4Z2GA 2VZOA 4DUXA 1DWJM 2DT1A 1Q6GA 1B90A 4MNJA 1CZ1A 3ZIZA 1C92A 1CDGA 3SCNA 1PX3A 4FF5A 4P8VA 3AISA 1BYDA 1B3XA 2WC3A 1CGVA 2WHMA 1K9EA 2E8ZA 3GXMA 4U31A 1YQ2A 4NRRA 3ARXA 5BRQA 4DM2A 5A8NA 1LL7A 3OBAA 2BHZA 1V02A 1JF6A 1UQZA 4JFSA 1CECA 3ARVA 3F5LA 2FGZA 3CHEA 2Y24A 3A3HA 2EPNA 1R7AA 3N13A 2CKSA 3WUGA 3AHYA 1A3HA 1GCYA 2VNCA 4UQAA 2CHNA 3EDFA 4AXNA 5HDRA 4HMEA 1BGGA 2DSZA 2BV9A 1VFFA 4M80A 1LWJA 4B15A 1E70M 2VRJA 4PMDA 3QHOA 5A69A 1KXTA 3MS8A 3VDBA 1QBAA 3WQ6A 1H5VA 4IPLA 4EANA 4HA3A 3RM8A 2E3ZA 1VJSA 1KGXA 1KXVA 4D6GA 3CUFA 1G01A 1JXJA 1KFWA 2ZICA 1J18A 4HPGA 3VMOA 1H3GA 4KH2A 3UG4A 2ZXDA 3PZMA 1UYQA 1GORA 2WHLA 1E6NA 3ZR6A 1WDSA 2VTFA 4AZBA 4H7VA 2ZXBA 3CZLA 5A95A 4ACYA 2YBTA 4GKLA 4R27A 2V5DA 4J3XA 5D9NA 5JIPA 1QW9A 7TAAA 1B1YA 3PBGA 1XYZA 1KQYA 2CBIA 4PEEA 2E9BA 3AZSA 5D9PA 3VIFA 2WVTA 4UR9A 4OOUA 2BY3A 4AIUA 2PWFA 4NSBA 3AIWA 1DTUA 1HJWA 3TA9A 5LA2A 1QVBA 3B9DA 4U33A 4J3WA 1OD8A 4W8AA 3VKKA 3WUFA 4CD6A 4TVCA 5FKYA 3N18A 3VMPA 2VC9A 4UQDA 2EXOA 3VNZA 2CPUA 2PC8A 1PIGA 2PWEA 4HA1A 1FH9A 2ZXQA 3AMGA 5A2BA 4XUYA 3VIJA 4LGXA 1YHTA 2WC7A 1E56A 3L4ZA 3B8SA 1E4IA 3DYPA 2TAAA 3K8MA 1ZBWA 2V3FA 3L4VA 2ZX7A 3GBEA 2QMJA 5I23A 1V6YA 4OUEA 3VD4A 1PEZA 2DSKA 1E1FA 3VIIA 1K9TA 3VVGA 1F4HA 1B3YA 2PF0A 3WD3A 1HJXA 8CGTA 3GXDA 3ZSSA 3IJ8A 2WSPA 6CGTA 4LYQA 4PMNA 3AXHA 3MO4A 2ZXAA 4QDMA 3AMKA 2OSXA 4UFLA 1ISWA 3TOPA 4AMCA 4MB5A 3ZJ8A 3VMNA 4PBGA 1VBRA 1GHRA 1UOKA 1FP9A 1GZJA 1SR0A 2WLZA 2D1ZA 5M5DA 4NI3A 3UR8A 1PZ3A 2XPKA 3RM9A 4HU0A 5DT5A 3TP4A 2ZX6A 1F4AA 4XV0A 3VM5A 1OT2A 1OGGA 3CZJA 1E55A 3DHPA 4TX6A 2J78A 3A47A 1ZJBA 3BMWA 4N0RA 4U5IA 3PZUA 1V3LA 4MTVA 4Q7NA 3W38A 1HP5A 3TTYA 3AXXA 3NCOA 4PMZA 5IDIA 1FP8A 4QLKA 3NYDA 4BQ3A 1LL6A 1UWQA 3FHAA 1CXEA 2GK1A 4CU8A 3L4WA 3OGVA 1M04A 4GI6A 4TUFA 5HBFA 2X0YA 5IFPA 2J8GA 4HZ8A 2ZUSA 4W85A 4AD1A 3WF0A 2ZUTA 4CKQA 1WNOA 5TD4A 2OYLA 8A3HA 4DWSB 3ARYA 2G3IA 1X6LA 3WNKA 2WANA 3VGDA 1MW3A 1EDGA 3GH5A 2BHUA 4KGLA 4TTUA 1UD4A 1HVQA 1KXQA 1WZMA 1UWUA 3WD4A 1RD6A 1JD7A 2HVMA 1TG7A 1HKKA 1H09A 1G9HA 2DEPA 1J11A 2F2HA 3MMDA 1KWGA 1FHLA 2YL6A 2VRKA 4NZCA 1LLOA 1Q6EA 1HIZA 4W5ZA 1GOMA 1VFUA 2A3CA 3AIRA 2WVVA 1OSEA 4M24A 1VAHA 3MMUA 5DMYA 3W4RA 1WB0A 2C7FA 2QF8A 3EDEA 4AISA 3BXWA 3WN6A 3EMQA 1DWHM 5BXSA 4PTXA 1CGYA 3AIQA 2PB1A 4LX4A 1UA3A 3THDA 1JAKA 1CWYA 1CTNA 1FHDA 1UZ4A 5JBDA 1CNVA 4M56A 1CXFA 4BF7A 3WBEA 5BYWA 2UY5A 5JIWA 1OIMA 3AHZA 2J47A 1PPIA 1EXPA 3B9AA 1W9BM 3ZJ7A 5KEZA 1V6VA 3F5JA 3T0DA 4YHEA 1SMDA 4AIOA 1IV8A 3W24A 1BPLB 3WH9A 4H8HA 2VURA 4AY1A 4PMXA 5A6BD 1S46A 4ZXOA 2WC4A 4J7RA 4MDPA 1B3VA 1P6WA 2J7DA 2CESA 3OLEA 1KCKA 2D0GA 4ATLA 3WH7A 2RGMA 3ARWA 1XRVA 2OSWA 4OOZA 3OGRA 4AYSA 1W9PA 2NT0A 2BVDA 1CEOA 3PTKA 3II1A 3KWXA 2Y5EA 1NOFA 3WDQA 4P7OA 3WEOA 3APGA 4ZENA 2DT0A 2EEXA 3NJ3A 3VX0A 3GM8A 5E6ZA 4ZE5A 1XH2A 2W92A 4OZOA 4V2XA 1H2JA 4AC1X 4TOQA 1HL8A 3GH4A 3PHAA 1QI5A 3M07A 4UZUA 3NDZA 3AS1A 1SYTA 1CGUA 4JCMA 1ISYA 3NSXA 1XSKA 3WD0A 4EKJA 1TVPA 4PRWA 5F7UA 2WMJA 1LQ0A 2E4TA 2J7CA 2YA2A 4WJXA 5IFTA 1JL8A 1WAWA 3HJEA 1J01A 4MJ4A 2VCCA 2DSUA 2J7HA 2FH6A 2EBNA 3AJ7A 3PZQA 3CHCA 1BTCA 3WQWA 4B3KA 4AD3A 3W6MA 3GDBA 3VD5A 5CLTA 2UY4A 2YDRA 3M46A 4PCTA 1ITCA 2DT3A 2WWCA 1OCQA 1MFUA 5AYBA 5E70A 5EMYA 3EDJA 3WUEA 4UQBA 1GW1A 3T08A 1V3JA 1JYVA 3MV11 4CD5A 1JGIA 2A3EA 3AXIA 4GO8A 1G5AA 1HT6A 1UD3A 4HOZA 3KL0A 4BA0A 2VX4A 2XVPA 4M81A 3OG2A 1Y7VA 2G8ZA 1V6WA 4DM1A 4UFKA 4F9JA 2X1IA 3L4TA 3OLGA 3WNOA 3HU7A 1XH1A 1KBBA 3FN9A 4UOZA 4PSPA 3AMLA 3WL0A 2Y2WA 3MANA 3HMCA 2CKRA 2D23A 2XGIA 1J0HA 1JZ2A 5CPQA 2A3BA 5BWFA 2GFTA 1X6NA 1R87A 4DWSC 3WNLA 1HP4A 1GOQA 3LPOA 2QPSA 3VDCA 1GUVA 2JIEA 1UKOA 4WKHA 1J12A 2O9PA 4CVWA 5DFAA 1ISVA 2VVSA 1GOKA 3BLPX 1KGWA 3IAQA 4MDOA 1XC6A 3T2OA 4X0NA 4D1JA 3POHA 1PIFA 1V6UA 4J3UA 4H41A 4CD4A 4GI9A 1VF8A 3VIGA 1KBKA 4F9DA 2PWHA 2YL9A 4JL1A 2UWFA 3ALFA 1W1VA 5HOSA 5EBAA 4W89A 3POCA 3K8LA 1LG1A 1WE5A 5AYIA 2YKKA 3W81A 5AC5A 4KGJA 4V28A 2VZTA 3AHVA 5FIPA 3THCA 4Q22A 3I3BA 1FFRA 3UESA 1CPUA 2CYGA 4V27A 4K68A 3GYCA 2WVUA 1CGWA 2CETA 1KB3A 4RE2A 2OYMA 2D2OA 2WCAA 1UD5A 1MQRA 4WKFA 3K46A 1XD1A 5FD0A 4AWEA 2GJXB 2VR4A 2VCBA 4D71A 3G6LA 4GZJA 2XVNA 1E6PA 4TVUA 1UQYA 1HJQA 1E1EA 1KR1A 1E6RA 3WQ8A 2G41A 1UG6A 4AW7A 4URIA 4HTYA 4FMVA 5KZ6A 2WKGA 3WIJA 2VO5A 1EH9A 1XV8A 3W28A 3BSGA 4OBRA 3CO4A 2GSJA 2E0PA 1E0VA 1B3WA 1EOMA 4P8WA 3IJ7A 3AIUA 3RJYA 2AMGA 5LA1A 1GJUA 2Y4SA 4TTGA 5D9OA 1RP9A 3WFZA 1H11A 2VI0A 4P7QA 4NRSA 4Z2LA 3JUGA 4ZEPA 2WZIA 3IAPA 3DYMA 4JKKA 1V3HA 1V03A 4D6FA 3RO8A 3AYRA 3EYPA 6TAAA 2WB5A 2V3GA 3CMJA 3GXFA 4M82A 3RCNA 4AIEA 4OIFA 1H0IA 4PTWA 1GONA 4E8DA 4D6JA 4WKAA 3AIEA 1W2VA 7CGTA 3VPLA 1JYWA 4UFMA 3WNPA 2J79A 5ABFB 3DECA 2CHOA 3EBVA 4E2OA 5I79A 4P7LA 1ZB5A 4X9YA 2VX6A 3WDPP 3AOFA 2Q8XA 1JDCA 5I3DA 1L0PA 4Y7EA 4MADA 2W4XA 1NP0A 3VILA 2JF6A 2VCAA 1CXKA 2XFFA 1R8LA 2W61A 3BAKA 5I24A 1C8QA 4D6CA 1GHSA 2VMFA 4GI8A 3AS2A 5A2CA 5CSUA 1E0XA 3SCPA 4Z2IA 5LYRA 1ZBKA 4MAZA 4J3TA 3PZVA 3CBWA 3RPMA 1AMYA 4W87A 1FH8A 4PMVA 3LPGA 3AHXA 3TTOA 4ATDA 1BG4A 4IPNB 1ISXA 3ALGA 4QFUA 2CBUA 1GPFA 2FGLA 1MW0A 2J7GA 3WF4A 4PTVA 2GDVA 4PMOA 3AHTA 1H1NA 1MXDA 2PI6A 1A47A 2EJ1A 1TR1A 4RE3A 1NM9A 2E9MA 5DT7A 3AMCA 1NOUA 2WWDA 4HZ7A 4CCCA 1M53A 3AZRA 2JALA 3N17A 1C91A 5E0CA 5M17A 3RMEA 2WCSA 1DWIM 3U57A 1Q6FA 1E73M 2ZUMA 3NDYA 3CGTA 3ZSTA 1JYXA 4AD5A 4DWSA 4TXEA 1V0LA 2ZUNA 1E40A 5BROA 3U7BA 2Y8VA 4F66A 5IHRA 4KRTA 1JZ8A 4QCEA 3ARUA 5A94A 1Q6CA 1V0MA 1GOIA 4BZYA 3MMWA 5M03A 1HJUA 3EDDA 1HKIA 4R5EA 3UETA 4Z2KA 5FL0A 4GINA 1QHZA 1G0CA 1DHKA 3LPFA 2X05A 3CTTA 1XH0A 1TUXA 3WH6A 1QI2A 3SCVA 2V5CA 2CCRA 2BHYA 1UWRA 4JFWA 3WD1A 1JNEA 2VT0A 2EPMX 3PZIA 1QOXA 5A6LA 1KWKA 1XGZA 2DT2A 1VFMA 4W7WA 1UH2A 2CBJA 1EO5A 2XSBA 3N15A 4AZ5A 5D8WA 4W93A 1BQCA 1J0KA 1PAMA 1QNOA 1E4LA 1JFXA 2ZUVA 5CSYA 2O92A 1E15A 3OLIA 1FFQA 1V3KA 4KWUA 1V08A 3D3AA 4AD0A 3A4XA 2FHBA 1QW8A 4HMCA 3ARRA 3SUTA 2ZUUA 3NUKA 4J27A 4TVDA 3LPPA 1UHVA 3FW6A 1NWSA 4QCFA 2V3EA 2JEQA 3AMDA 2J7FA 4WIWA 1H0GA 3SCUA 1DEDA 2CIPA 1EA9C 3NSMA 2X09A 4PMYA 3ZOAA 4JFVA 2OWCA 1GQLA 5CXPA 4BCEA 4D6EA 3KL3A 4N42A 1EGZA 2EPOA 3W27A 2E40A 5C71A 4JKLA 3BSHA 1BSIA 3A4WA 1EIBA 4B9ZA 1NWTA 3WD2A 4DUVA 1U33A 2J7EA 3SCRA 3PTQA 1JZ5A 3VIMA 3N11A 5BRPA 5C8BB 1WO2A 1TZ7A 2IUZA 1UR2A 1U30A 2BY2A 1JZ7A 3HN3A 5DF0A 2J62A 2WHJA 2NT1A 4WSKA 4HU8A 2BY1A 3GTNA 4A4AA 5ABGA 2JEPA 3UEQA 3ZJKA 3BAYA 2XIBA 1GNXA 3TTQA 2D22A 2YDQA 3TONA 1CGTA 3RM4A 4AZIA 3SUUA 4W8BA 3MUZ1 2MANA 1KCLA 3RIKA 2AOSA 2J74A 5JBFA 2WBGA 2WKLA 3MUY1 4P7RA 2BNJA 2DQXA 3L4YA 4H8VA 1ESWA 1I1XA 4LYRA 2BS9A 2E9LA 4MB3A 2W62A 2XVGA 4D6DA 2ZE0A 3CMGA 3T0BA 3GNRA 2W63A 1BGAA 3A4AA 1WDPA 2XVKA 3T09A 2W91A 4EAMA 3AQUA 2O9RA 1GVIA 1H41A 3SUVA 4WLCA 1W9UA 4PUDA 1BYAA 1FA2A 2WMIB 3MSDA 3A6OA 1J9YA 5JBEA 3RILA 3MKKA 1QI4A 4RE4A 2BXZA 2X0HA 5E6YA 1QNQA 1W1YA 3UG3A 1MWOA 1GOOA 4M1RA 3WMSA 5ECUA 3SIMA 3VGFA 1BHGA 1H4PA 2WK2A 1WZLA 3CH9A 1J0ZA 5A6BA 4CN6A 1ZJAA 1Q6DA 1Z32X 1PX8A 4C7GA 3ARZA 1C7SA 3AICA 3AS3A 2O9TA 3KL5A 3OB8A 1W1TA 3CZGA 1HN1A 2JIWA 3WDRA 2JFEX 4AD4A 1DWGM 2HISA 1JIBA 1WP6A 3WY1A 2FDMA 5A2AA 3SUSA 1M01A 5CPSA 3BGAA 3G6MA 3UG5A 2A3HA 2W5FA 4BQ2A 1JI2A 1UD2A 4UFIA 4W8LA 1VFOA 2NSXA 3N12A 5A8QA 2WHKA 3BAIA 2D20A 2G3MA 1GVYA 1BFNA 1TVNA 2J75A 1FH7A 5A8PA 3ARPA 1WDRA 3VGHA 3KZSA 2RGLA 3CZEA 5GNXA 4QLLA 3SUWA 3ZT7A 1D7FA 1V02E 1MFVA 5IHSA 1E4MM 1XSJA 1W1PA 1LF1A 3WMCA 2WPGA 5AY7A 1C90A 1XD0A 3U5UA 1NQ6A 2DPEA 1GOWA 5A8OA 3ZT6A 1UR1A 4ZXLA 2GUYA 4Z2JA 1CYGA 3CUHA 3F5KA 4PYSA 5GQBA 1JZ4A 1XSIA 3PTMA 3WH8A 5A8MA 3VD7A 1JG9A 1ITXA 4CVUA 2QV4A 4UQCA 1E72M 5E9AA 1E6XM 3CIVA 1OB0A 1OINA 2O9OA 5JUVA 4E4PA 4CD7A 2WLYA 4D72A 4CUCA 1ZU8A 3CHFA 1G94A 1TMQA 4U3AA 1C8YA 1JNDA 3VDHA 3ARQA 1UWSA 4S3JA 1V0KA 1BG9A 2IXVA 1GQJA 1E0WA 4H04A 2DIEA 3QOMA 3ZT5A 3AI0A 3IK2A 1RPKA 2QPUA 1AQMA 1RH9A 2ZOXA 3QR3A 5CJ5A 2FH8A 1B2YA 1BYCA 1SMAA 4GO9A 3W0KA 3T2QA 1E6QM 2VZSA 3MUIA 2GJXA 3VX1A 2XWDA 3ZO9A 1E3ZA 1WDQA 4PCSA 1PX4A 1NH6A 1IZKA 1BYBA 1QPKA 2OSYA 3WEMA 3NSNA 2C8NA 1EDTA 3AS0A 2CERA 3ZQ9A 3VUPA 1OD0A 2QMKA 3VOCA 1CLXA 3N1AA 2YOCA 1IZJA 4A3HA 3WUBA 2F61A 1BVZA 2XHYA 1LJYA 3ARTA 3WF2A 4HPHA 2Z1KA 3I3EA 1OBAA 3ARSA 2OLHA 1V3IA 3W25A 3VM7A 3BAXA 5DEZA 4MB4A 2OYKA 2J8FA 3VTRA 1VBUA 4C7FA 3CZ8A 1UKQA 1VEOA 2EO7A 2VOTA 3WFLA 5BXRA 3FHQA 3QHMA 4OBSA 4ACZA 5D8ZA 1E4NA 4AZ6A 1GQKA 3BAJA 3W53A 3WDJA 1JXKA 3W29A 1I75A 4HZ6A 2YBUA 1HJSA 5ABFA 1AVAA 3PZOA 3ECQA 5CZKA 3K1DA 3J7HA 1R85A 4OKDA 3O6AA 2UY3A 1XYFA 3UR7A 4QAWA 4W5UA 3EMZA 5HPOA 5BXTA 1CBGA 2VZUA 2PBGA 3WL1A 3WEZA 4D1IA 4UOJA 1ZBVA 5CQ1A 2GJRA 2WZHA 1L8NA 1NP2A 4P8XA 3MSGA 1UH4A 4YHGA 4JFTA 4EK7A 3PZNA 1VIWA 3OGSA 1HL9A 4ACZB 2CEQA 2ZX9A 4PSRA 2XVLA 1J0JA 1GJWA 5FOOA 3LMYA 3ZR5A 2PBOA 5A6KA 4ATWA 1PBGA 3FY1A 4W84A 4PTMA 5EFDA 4ZFMA 3PZ9A 3VD9A 4JZ5A 2XFRA 2QHAA 2BVTA 2J25A 3BAWA 2DSVA 2G3JA 1W3HA 1C93A 1JF5A 5EFFA 4PUEA 1EHAA 1VENA 1OGSA 3QGVA 2YA0A 2VQUA 3L2MA 5A6MA 4CCDA 5CGTA 2AAAA
chains in the Genus database with same CATH superfamily
1P6CA 5CG0A 2QCNA 1G4PA 4PR4A 1RY8A 1I6NA 4ML4A 3T78A 3TR9A 4UTTC 3W1RA 5HXMA 2YDSA 5JH1A 1M7PA 4FLOA 3UP8A 3IARA 2BFGA 5GVJA 4OHQA 2NQHA 3VO0A 4PL2A 2KZHA 1FWAC 3ZYZA 4ZMGA 3UCQA 1FDJA 1FWHC 4RXFA 2VFFA 3KW3A 4KFNA 2WW5A 2R1NA 4HB7A 4HHPA 1XM3A 4MG4A 1VD6A 2CFFA 4WF7A 1GK8A 4NJGA 5LSMA 2QZRA 1CXHA 1QHPA 2XFWA 4OUIA 2PF8A 5T9BG 3UWWA 2WCGA 4MB1A 3GUWA 3TNOA 4RNHA 5I2UA 4JTUA 4JQAA 4MY8A 4X63A 3IGUA 3IUHA 5HNUA 1LL4A 1VLWA 2D73A 3KVLA 3VE9A 4P2VA 5I7GA 3H2MA 5BOOA 2V3DA 3E02A 3GYEA 5A6JA 2EPKX 2CBVA 1S3TC 4AZCB 1ZAJA 4C65A 5HMFA 4GZEA 3R13A 1FWSA 1UR3M 1M6JA 1H49A 3TXZA 1MQQA 3UYCA 4HP5A 1HJVA 4QLJA 4FP1A 3KTSA 2EPLX 1R7OA 4L4LA 2CU0A 3F2CA 3AIVA 3BG5A 2FZNA 1ZSXA 1T5AA 2FHFA 2PRHA 2W27A 5I3HA 4GY1A 3TYAA 4LPCA 1DJZA 5D9MA 1FXPA 2JF7A 3P8JA 3N4FA 2WNZA 2E7FA 2YXGA 3TIMA 4L64A 2XGZA 4EIVA 1B31A 2WJZA 4F79A 3LCLA 2VUYA 2B31A 1G1YA 2YL5A 1UR9A 3ZM8A 4WK9A 1U1UA 4XBSA 3GNPA 3VDAA 4E8CA 3W1XA 3TZNA 3BOXA 2NV2A 3PULA 3OLDA 4S3AA 3ZJ6A 3IJDA 1XHGA 1RVKA 1UZDA 2AQVA 3B40A 3WSUA 2E28A 1LWHA 3GX9A 3GKFA 2ZTJA 4QNWA 2WMHA 4HHHA 4XVEA 1DXEA 1OYAA 2Z27A 4UQEA 1RK5A 4O0KA 2CNCA 3KRBA 2OMAA 2FKPA 1FBAA 1Q6LA 4LB4A 6TIMA 3B8WA 1W9DM 4GQRA 2EQDA 2W66A 2GK1B 1W1B1 3F4DA 2RKXA 3WQ4A 1KW1A 4Z08A 5GPRA 4L4OA 3MU7A 3LU2A 3U5YA 4LUSB 4D6HA 4P5UA 3VIKA 4D8AA 1MW1A 3FXYA 3R7MA 1PXGA 3S1GA 3TKFA 3PUGA 1WV2A 3H22A 1OWQA 3H2FA 2WMIA 3WQEA 2A0NA 1E3XA 2HXTA 1J6OA 4MFEA 4XB3A 1XCXA 1LTDA 4BS0A 5A3HA 3VUSA 3CPGA 5HJLA 3HO8A 4ZGYA 3BG9A 1XDJA 1OVDA 3OHIA 1E6ZA 3S5ZA 1MQPA 4Z1CA 2A3LA 1WKEA 4MZYA 2V38A 3R6IA 3B0UX 1DYSA 3W2JA 4FOKA 3QY7A 3WH5A 3QC0A 1OYBA 5I6SA 3GH7A 3RGTA 4JTEA 3ITVA 4YTUA 3E5PA 3MV01 1V7AA 3BWWA 2Z4GA 4IXXA 4QEEA 3EEGA 1SFSA 2F8QA 3KBNA 1W3LA 3LCGA 4O11A 5K2ZA 1T6MA 3WENA 5AZ1A 3NGFA 3G1XA 4NX5A 2DUZA 3KXQA 2XM1A 3R11A 3QLDA 5FJUA 1BAGA 4JBRA 3GZAA 5TQLA 1G7UA 3E38A 3UERA 4HCHA 2O56A 2A21A 3KUMA 1EP1A 3WF3A 4BI6A 1LYXA 3PBYA 4ZE4A 4O14A 2EHHA 3VNMA 4W4QA 3LXAA 4PMUA 3ID7A 4B4HA 1TCMA 4LBRA 1PUDA 3V5CA 4G7EB 3AFBA 4H4IA 2XN0A 4NQ1A 3ONBA 1DJQA 2PCEA 1OT1A 4IG2B 3EMCA 4LXFA 3GK0A 3FNDA 3E49A 3V5OA 1A0CA 3W1QA 1VRXA 1DWAM 4IFKA 4CCEA 2DH2A 1U22A 2XTKA 2WJFA 3WFAA 4U3CA 1UR0A 4YNGA 1XIFA 4L9YA 3WDIA 3CK5A 5TBOA 3WBAA 4F0MA 3U8GA 4MKNA 1BRLB 1K9DA 2DU2A 1QBBA 1MW2A 4MAVA 2Q8LA 3WLPA 3VINA 4CQCA 1VBJA 1Q2RA 4IMEA 2Z1BA 1KR0A 4UR8A 2PSNA 1I45A 1W91A 2WMFA 2UY2A 4PMQA 1KCXA 1KBLA 2QVNA 6REQA 2ZX5A 5I3IA 3S9IA 2J4GA 3P7YA 3QKZA 1G4EA 3T2PA 3WQVA 2X1UA 2PMQA 3CAVA 4FLRA 3CLWA 1RCQA 3CUJA 4I5UA 1TA3A 1US2A 1KM2A 3RMJA 2FJKA 1QNPA 7ODCA 3D6NA 1XCWA 4K8EA 3W7PA 1XLLA 1Z89A 3H54A 3PZGA 1W5OA 3BH4A 4DUWA 4KEUA 4LAKA 5F2GA 4UTWA 3QTPA 5C2CA 3VIPA 2GJNA 4H8NA 1SFLA 2Z1VA 4DI8A 2VL4A 1T41A 2YFOA 2A1YA 3R0KA 4CQBA 1NAL1 3RX4A 3W7HA 3ITCA 3FGCA 3N4EA 1L6FA 2PRLA 1EQPA 4DZIA 3LHZA 1JRCA 3PN8A 1NDZA 1FWWA 2DJXA 3G0UA 4O10A 4DQWA 2ASHA 4DBWA 4U2ZA 2PE4A 2VC7A 5FCZA 4HA4A 4JTTA 4B2DD 1M03A 3AROA 2YA1A 3M0JA 2VZVA 3DHUA 3LSCA 4MJ2A 1K6AA 1CGXA 4FZIA 3N2OA 2HE5A 3CT2A 1VQTA 3SR7A 4I7UA 4INFA 3UPWA 5IDZA 2D3LA 1UKPA 2VZOA 3L0NA 9XIAA 1KFBA 3P60A 1Q6GA 2A85A 1B90A 3L5MA 1C92A 2HDJA 3LK6A 3SCNA 2GZXA 5CSSA 3DESA 4LV4A 3AISA 2WC3A 2VXNA 1CGVA 2WHMA 2E8ZA 2IKJA 3ARXA 2JK2A 4DM2A 1A5NC 1V02A 3RUBL 1JF6A 2OLAA 3Q37A 1KA9F 2ALDA 4HYVA 2FGZA 1PWMA 2Y24A 5EBUA 5CEWA 2CKSA 4U4MA 3PTDA 4OQVA 4B5VA 3AHYA 1MI3A 2VNCA 3EDFA 1MDLA 1OJXA 2BV9A 2AKMA 1A5SA 1LWJA 1Y5XA 4TMCA 1E70M 1PYFA 4PMDA 4LS1A 5A69A 1H5VA 3CQ0A 3PAOA 1A5BA 3RM8A 4KCVA 3W74A 1KXVA 1JXJA 1PDYA 4GOAA 4JY9A 1J18A 4CCZA 1H3GA 4C5ZA 4KH2A 2V5KA 1VPYA 2WHLA 3I7SA 2VTFA 4AZBA 4R33A 4JIIX 4H7VA 2ZXBA 1WAUA 3UW6A 4C90A 3CC1A 2OOFA 2P3EA 2YCEA 5JIPA 1HZYA 5I3JA 1JCNA 4EXBA 2E9BA 3AZSA 5D9PA 4BFAA 4H9UA 4NYUA 2W9MA 3AIWA 3I68A 3TC6A 1QVBA 3NQCA 4J3WA 3ZXWA 2I9UA 3N29A 5D2WA 2EG6A 5FSDC 1S5NA 4IPJA 2VC9A 2X42A 1ZHAA 4UQDA 3U2ZA 1S5TA 3QSRA 4RR4A 3VOHA 1DQXA 4NHVA 2PC8A 4IIGA 1XLMA 1OX4B 4GE8A 2WC7A 3EOOA 3QEZA 3DYPA 3W1UA 1ZBWA 2PURA 3I4KA 3L4VA 2ACRA 5MKGB 2ZX7A 3DN5A 2QMJA 2FQIA 1V6YA 3IVSA 2OFJA 2LLEA 3VVGA 2DP3A 3LERA 3U48A 1TWZA 2PF0A 2ZRYA 3GXDA 2WSPA 4Z1YA 4QDMA 4C6KA 3AMKA 2QCFA 2E6DA 3GNNA 3V3WA 4MB5A 5EKYA 3VMNA 1XLEA 2ZC1A 1XIGA 1SR0A 2QJMA 3MB9A 2D1ZA 5M5DA 4NI3A 4GQBA 3TC7A 1MNZA 2XPKA 2Y63A 3VM5A 1PYMA 1OT2A 3TOYA 3V0TA 3TROA 4TX6A 1GZ1A 3A47A 3CV6A 1SO5A 1SZEA 2ZRXA 5HWJA 3CJPA 3HQPA 1V3LA 3KDNA 2HPMA 4Q7NA 1HP5A 5IDIA 4Y9MA 4QLKA 5CCZA 4GUHA 4BQ3A 1Z42A 3NPWA 8TIMA 5FF3A 4H9XA 5EMLA 2QCMA 4C60A 3BJFA 2C91A 4DO5A 5HBFA 4QNEA 3C0JA 3NAVA 4HZ8A 2ZUSA 1MEHA 2ACSA 3WF0A 4CKQA 1VFTA 3GKAA 1TR9A 4JD4A 1PTDA 2HVNA 2OYLA 8A3HA 1A5MC 2G3IA 3ARYA 1K02A 4LOCA 4GYFA 4Q8QA 4X60A 4J2PA 1KTCA 3TWBA 2WANA 3RXZA 4E3VA 3GH5A 2A2IA 3DEQA 3S47A 1TWSA 1KXQA 2PTDA 1UWUA 3QV7A 2YYUA 3D46A 2HVMA 4M6PA 3QBUA 3Q2DA 3ANUA 1KWGA 4M7SA 4IX0A 1LLOA 3E0VA 4RV8A 3BW2A 1HIZA 2ZVIA 2PODA 3AIRA 3MMUA 3NA8A 2BWGA 3KP0A 2C7FA 3EMQA 5BXSA 5CKSA 5CPLA 4GYPC 4PTXA 1CGYA 3AIQA 3K5XA 2ZZ6A 3THDA 1CWYA 5LGXA 1AH3A 4QRNA 4XAFA 3R8GA 2PDFA 5G2IA 5LNUA 2PDQA 5LNWA 2EG7A 4M56A 1CXFA 1OABA 4BF7A 4AXKA 1IXNA 3MCOA 2J47A 3BPWA 3DHFA 3FS2A 3KTXA 3EX6A 3B9AA 4DY1A 3TQ0A 1V6VA 1UOZA 3T0DA 4GIEA 1XBZA 1EGVA 5EPDA 2PDUA 1BPLB 4QSHA 2IPFA 2HNHA 4J7RA 5DRIA 4EOUA 3URAA 5IBXA 3NQ2A 3LI1A 1B3VA 3DBNA 1KCKA 1ZQ5A 2D0GA 4ATLA 3UZXA 1XRVA 2PDGA 3RITA 4PODA 3RX3A 1RCOB 3VZYA 1W9PA 3QMTA 1Q8AA 3AUOA 3PG8A 1GOXA 1KD0A 4JIRA 3II1A 5F4WA 1A5CA 2QF7A 1UMYA 4C5YA 3WDQA 4LCRA 1M65A 3DU0A 3WEOA 2Q3RA 3R79A 4W9TA 5LIKX 4C6OA 1W37A 3NWRA 1JQVA 1OADA 1P4CA 3SI9A 2NSOA 3NZQA 4K6AA 4OZOA 4AC1X 4TOQA 4HSNA 1KRMA 1QI5A 3EWYA 3AS1A 1HFBA 3C2VA 3WK2A 1V8EA 3FYYA 1XSKA 2J13A 4G56A 2PP3A 2CLKA 1W5MA 3H7RA 3ZZ1A 2FZDA 2V68A 5IFTA 3V18A 3HJEA 2FH6A 2EBNA 3AJ7A 3CHCA 3M44A 4E8GA 3CXOA 3GNXA 1TKKA 4R9XA 1ITCA 2DT3A 1O95A 4WY0B 2HS6A 3B8UA 1RBLA 4TIMA 3W1PA 1MFUA 4NZ1A 3G8RA 2NV1A 5EYWA 4MJZA 1Z8AA 3NEVA 3T81A 4QJ5B 4UQBA 1GW1A 3CB3A 5XIMA 5AHEA 3C56A 3MDUA 4WD0A 1MRQA 3BK0A 2A3EA 5IRPA 2X0SA 3AXIA 3R10A 4BA0A 3GVVA 1YLVA 1NFBA 3GFZA 3N14A 3SY1A 4KEMA 4UFKA 3MI2A 1BTMA 4O17A 3L4TA 1Q6OA 3WNOA 4XKYA 1KBBA 1QK0A 4AHPA 4IWWA 2Y2WA 1TZZA 4XAPA 4GFSA 3W7QA 1ZALA 4XSLA 1BF6A 1W6TA 1BKSA 1HO4A 3RLVA 2DZBA 3ANVA 3WNLA 3C0QA 1Q2SA 3PSVA 3VDCA 4L1WA 1TMHA 4WKHA 3EXTA 4WDUA 1ISVA 2VVSA 1BVWA 5CZSA 1XUUA 3IAQA 1W0MA 4MIMA 3T2OA 1Q66A 4D1JA 1WQ5A 2R1KA 2CLEA 1PIFA 3RLGA 4WY0F 3N6QA 4S39A 3L23A 2YL9A 4GLEA 4Q8NA 4FALA 4QR6A 5HOSA 5EBAA 4C6CA 4O1DA 3NM3A 1WE5A 3W81A 1PHWA 4KGJA 5CPNA 5CJNA 5BU6A 3RFAA 3KRUA 3AHVA 2PU0A 2X40A 1EPXA 4Q22A 2POZA 3I3BA 4GACA 4M7TA 4X3ZA 4V27A 1JCXA 4K68A 1CGWA 1KB3A 4X9SA 1K77A 4R7WA 2OYMA 2NQZA 1HQTA 3C61A 1IEWA 4AWUA 2Z29A 4WKFA 2RUSA 2OR2A 2AL2A 1XLIA 2GJXB 3OQ8A 1E6PA 1W1ZA 3W7RA 2OLSA 2XIJA 3W72A 4AW7A 3L12A 1XLKA 4URIA 5KZ6A 5DMLA 2WKGA 5DCDA 3G1RA 1YTDA 1VS1A 2OZ3A 3B8IA 4H2HA 4YCOA 1EXBA 3BGJA 3RU8X 1XLJA 4XZLX 3MSYA 5D9OA 3WFZA 3P8IA 1H11A 4LAMA 4NRSA 3JUGA 3GNDA 2H3BA 3DYMA 4JKKA 1V03A 1EUNA 1VFSA 1RSCA 2V63A 3AYRA 4K36A 8XIMA 2VWSA 3RR1A 1S2TA 4FR6A 2PLCA 4JTJA 3NQ8A 3GIYA 4OIFA 1Y65A 3DFOA 4PTWA 3G1AA 1EGMA 4WKAA 4IHCA 3UPBA 4DPPA 7CGTA 4JTLA 2IPJA 2AQWA 3CPRA 5ABFB 3UJEA 2CHOA 4I3GA 5EMJA 3EBVA 2EAWA 4E2OA 3HG2A 1NF0A 4X9YA 3W70A 3WDPP 3LCFA 4F0RA 1DIOA 4DZAA 2Q8XA 3WBYA 2J6XA 5K9XA 1YMYA 2WJEA 2MNRA 2VCAA 3VDGA 3C4UA 2XFFA 4M1BA 2FZ8A 3KOXA 3AYVA 1A3XA 4GABA 1DL3A 4D6CA 3ZVIA 2R94A 3W6YA 2OXNA 4AWTA 1E0XA 2PDMA 1U5JA 3GG1A 4FA3A 3VKDA 1ZBKA 4K7VA 3T0TA 3RPMA 3EEZA 1IIGA 1TPDA 1BG4A 1ISXA 3TX9A 1FCQA 1HKVA 1NFGA 3MQTA 2D69A 1F3EA 3UQNA 4PMOA 4RDVA 1TRDA 3L9CA 2PI6A 1MXDA 3VYLA 2ABAA 2E9MA 5BNKA 4HZ7A 1M53A 3AZRA 2JALA 3GFXA 5E0CA 5M17A 3ZR4A 1N55A 4S3EA 1DWIM 3U57A 2ONEA 4DWSA 1V0LA 4QE4A 1XIDA 5BROA 4QCEA 1GOIA 1HKIA 3LRKA 4R5EA 4ZTXA 1D9EA 4B5SA 4XZ9A 3WJWA 5JH2A 1DHKA 1ICQA 3CH0A 3A23A 2X05A 3CTTA 4H01A 1TUXA 3BQ6A 1TV2A 1U5VA 3AU6A 3VFCA 3PZIA 5A6LA 5D2TA 1EJ7L 5CJMA 1TV5A 1R3WA 3LTPA 2GSHA 3TSDA 1PAMA 2ZUVA 1E15A 4AY8A 1FFQA 4NUWA 2NXIA 3O8AA 4KWUA 5FESA 1RLDA 2FLIA 3E9AA 4AD0A 5HR7A 5C9WA 4IGMA 4IGHA 3WG6A 4KWVA 1QW8A 3IGHX 1US0A 2QDEA 3OOQA 3NUKA 3FW6A 3DFTA 4QCFA 1R3TA 3TAOA 1RQHA 4ZBCA 4JIQA 4RKAA 3NR0A 4WIWA 3UXLA 3W2MA 1DEDA 2X09A 3ZOAA 3H2EA 4H6QA 2OB3A 2W3ZA 1KLYA 1O1ZA 3CLMA 1TPUA 1PWLA 1ALDA 1JDFA 3L21A 2E5BA 1UMLA 1OZQA 3DFHA 4DUVA 4IP4A 3AAMA 3KHDA 2RJHA 4Z1DA 3VE7A 1Q4WA 5LXEA 4IF2A 1XGDA 3QGKC 4E2VA 2IUZA 1QOQA 3VI2A 3S3GA 3SJ3A 2ZVRA 2OVLA 3IGSA 3GTNA 5AOUA 3SRDA 1S2WA 2JEPA 2I17A 3FJ6A 4O57A 1Q3NA 1K8ZA 1VZWA 3MP3A 3UEQA 1GVOA 5FACA 4DIAA 2XIBA 3BTNA 5A6TC 2XH2A 4GXWA 2IKGA 5D38A 4KEVA 4W8BA 2MANA 3WLRA 1SU5A 1KCLA 3P62A 1EC7A 5JBFA 4DI9A 2WBGA 4LH8A 1MMFA 4AH7A 5EA9A 2Z2BA 2J6VA 4RZ6A 3G24A 3CTLA 4MB3A 1JCLA 2GVLA 1Y0EA 2ZE0A 1BGAA 5EMMA 3P82A 3Q65A 1FXQA 2W91A 1BWVA 3TYEA 3K30A 2WQPA 1GVIA 3UD6A 5HINA 3M0HA 1BYAA 2WMIB 4IUOA 3MSDA 3SSZA 4EX4A 1EUAA 4KETA 3BJSA 4QG6A 4A6GA 1TSIA 3FA3A 3P74A 5F2MA 1S39A 3SAZA 3UG3A 1IZCA 4M1RA 4Q4RA 3NQ6A 3ITGA 5FF0A 1J0ZA 3E0LA 1AW1A 4FSAA 1PX8A 5D2YA 3RK8A 4YVXA 2NWSA 3A5FA 3AS3A 3GU9A 4YTTA 2ZZ7A 3UXAA 4RZBA 3EB2A 2JFEX 4AD4A 3GD6A 1WP6A 5HJXA 3SUSA 2QDGA 1A0DA 1FHUA 3M43A 3UG5A 4JEJA 4BQ2A 3LRMA 4Y8EA 1UD2A 2HEJA 3G18A 1YPIA 4W8LA 4FOUA 3CL6A 3DG3A 3E0WA 3CV2A 1SZNA 1BFNA 2VDHA 1FH7A 4NU7A 2DUXA 2TMDA 5A8PA 4O15A 1LUCA 1WDRA 4PUWA 3H70A 3VGHA 4L80A 2C3ZA 3KZSA 3TAKA 5C9RA 4QLLA 3LM3A 1D7FA 2FGBA 4IPIA 4HMNA 3EA3A 3W07A 5IHSA 3LXBA 4I7VA 3HMJG 2O7SA 3NNTA 4L56A 5AY7A 4FXFA 1D3GA 2BG5A 3M0IA 4HZMA 3LLXA 5A8OA 3P2VA 1UR1A 4PB5A 2GUYA 2C71A 3CUHA 4PYSA 2BVWA 2E09A 3F5KA 3G3DA 1JZ4A 1XSIA 4US5A 3PTMA 1IT8A 3VD7A 1JG9A 2QV4A 1XIMA 1S1RA 2WLYA 2VGBA 4D72A 3C3UA 1ZU8A 1UROA 4PBEA 3MJMA 4KWSA 2QCCA 2ON3A 1ML1A 2VEPA 4G2DA 4F0HA 4JX5A 3B0VC 8RUCA 6REQB 4QBXA 1GWJA 3ZS4A 3W0KA 3T2QA 3T4WA 3CUZA 3QH2A 1E3ZA 1XLGA 4PCSA 1EFZA 4ERIA 2C8NA 3TQPA 4PUJA 1EJTC 2CERA 2E1WA 3ZQ9A 4KT2A 2QMKA 3W73A 3EX2A 4WZHA 3N1AA 4DJDA 3RCYA 5AC8A 1GYMA 2P8BA 4R85A 2F61A 3H24A 4H6EA 3I3EA 3A13A 4H1ZA 3ARSA 3VNKA 4NZFA 2ZE3A 1LT8A 5LNRA 1X39A 4OT7A 2FPYA 1T40A 2EO7A 4L61A 3WFLA 4ONVA 5BXRA 3QHMA 4OBSA 3FGCB 4YCPA 3UCCA 3GW3A 1TIMA 4GUIA 1ADSA 1GQKA 5FI8A 1I2OA 3XISA 1GJPA 1JXKA 2NX1A 5H8UA 2P76A 4LUYA 5CPOA 3ECQA 5CZKA 4POCA 2J8TA 3J7HA 3K1GA 2VGIA 4N6FA 1R85A 3SW6A 4OKDA 4XISA 1EP2A 3CYVA 2ZA1A 1A4LA 4UBPC 4W5UA 1KBJA 3EMZA 5HQMA 1A53A 4H9YA 3G1DA 1D3HA 4WEVX 3WL1A 4AHQA 4Q4PA 1LOQA 4ZODA 1VBGA 1R9ZA 3PBMA 2QV5A 3W7NA 3EPMA 4ACZB 1GYNA 3OG3A 4PSRA 3REQA 1J0JA 2J9XA 3SY5A 2KX9A 4NJJA 3EB4A 4NIRA 3FA5A 1WUEA 1XWYA 5CBJA 4JZ5A 2BVTA 3W3OA 5DN1A 3V0UA 4JTFA 5EFFA 4V33A 2CXEA 5C0QA 1GGOA 4PUEA 2ZDRA 2OU4A 1OGSA 4LNYA 3QGVA 5A6MA 4CCDA 1ME7A 5CGTA 2P3ZA 3S2NA 1L9WA 2I5QA 3MSRA 1Y5VA 1PE1A 1SO3A 2WSQA 3L4UA 2HV5A 4LCSA 3UA4A 1KXHA 4J3VA 1R47A 1VB9A 2GVYA 1C3FA 2XIIA 4AZCA 4AVNA 3SQLA 1A5KC 2W67A 2VENA 1PZ2A 3GNOA 2XFYA 4L1GA 3WNNA 5E0FA 4FK9A 4DWSD 3AWNA 4B9YA 1V5XA 4DZ5A 3LHTA 1QJWA 2FZ9A 2QNEA 5A6AA 3UWYA 4M51A 4UFJA 1NTHA 4C7DA 4J35A 4KS0A 3K4DA 5LNSA 1I2RA 4CQ8A 1M7XA 2E68A 4IMAA 2QAFA 3KEHA 3SGUA 2EKCA 3M64A 4UC5A 2HMCA 1REQA 1XIEA 2VR2A 4JHOA 2ZUWA 3K4WA 3L68A 1KFEA 1FHVA 3D3FA 3AO0A 5DMNA 1CW2A 3U7VA 2WM0A 4FOJA 3FIGA 5CG7A 1C8XA 1AQHA 2NX9A 1HVXA 2NQJA 1IWBA 3VIOA 5DXXA 3V1PA 4XAYA 2UV8G 3B8VA 4X2RA 3TEVA 2XG9A 3UBPC 5GNZA 1XG3A 2ZWZA 1PIIA 4MNKA 1CXIA 1JUEA 5E09A 2ZRWA 4FNTA 5HJYA 1EF3A 3FLUA 1VEPA 2E8YA 3F4VA 3CUXA 1QHOA 2Q3OA 2OQLA 4CU7A 1S2CA 2PLMA 3CV7A 4XO6A 1TQJA 3BLKA 3WLQA 1KM4A 4DXXA 3FAXA 4WRHA 3OZYA 2ZA3A 5E93A 4BI5A 1B5TA 1HKMA 1UWIA 1O7AA 3GG7A 5HNNA 3SECA 3CEPA 4H6RA 1F73A 4C1NA 3OZOA 1A5OC 1UWAA 2YJQA 4NZ3A 2CZVA 2J7BA 2VKZG 1GVSA 3A24A 4S3KA 3N73A 5FJTA 4JQ3A 1V93A 3IACA 4UTWC 4FAMA 1IT0A 4WR3A 2POTA 3QPYA 2CLOA 3D5HA 1QPQA 3UZWA 3C2RA 3H23A 1DXFA 4CGTA 1FCUA 3IANA 3LA4A 1ISZA 3P84A 1VRDA 2RFGA 3WF1A 1XJBA 3CZKA 3TTEA 3O16A 4G6CA 1BVNP 5AYXA 3W26A 2WMGA 3B8DA 1X1OA 4N02A 2VVNA 4GUFA 1JDDA 3SFKA 4F40A 1QPRA 1AZ1A 3KBJA 1A5UA 2NXHA 4WOZA 2WMKA 3I3DA 4MF4A 4DO4A 1LRNA 1RQEA 1EIXA 3KVMA 1R5YA 2ZADA 1B0IA 4PFHA 2DV0A 4PCPA 1LP6A 4YPJA 4W86A 3H12A 4MGGA 4KRUA 1LQ2A 4RL3A 2PDYA 4ZSUA 3HM7A 2VX7A 3W7DA 2P88A 2C14A 4BJHA 1JPMA 1OFOA 5H2ZA 2P1FA 5M2FX 1FWBC 4JPGA 4GNVA 5MF5A 4J1OA 1SW0A 1XPYA 3HPXA 4B5TA 2XYLA 3EAUA 4ZR8A 2FVLA 4RCXA 2CXGA 2QIWA 2D24A 3PR2A 3I65A 3STCA 1US3A 3C8FA 4LBSA 2FVMA 4XZIA 4MWAA 2QUUA 4IISA 3LB0A 5D4YA 1V79A 3HFYA 4AVOA 3PNUA 1BLIA 1MUCA 1W3KA 1CB7B 2CITA 3CAWA 1TV3A 3S2LA 3VNLA 2Z6IA 2PU1A 1XF0A 3RJXA 1CIUA 1EJUC 2NQ5A 2R91A 4Q8PA 3OHMB 2XSAA 2C19A 4XZWA 2ISWA 1GVEA 5EMKA 4GI4A 3PPGA 3BGGA 3SGZA 5BCAA 3A64A 1Q45A 2C0HA 4Z1AA 3ATYA 4QG8A 4GPNA 5IOBA 4P7NA 3R4IA 1GQNA 4UQ9A 1H7XA 1H51A 4HBKA 4NG3A 3PFMA 2JKAA 4U5KA 1XKYA 4O1AA 1RHCA 2V2DA 4GUGA 1UZ1A 4QROA 3OIHA 4JGDA 2UBPC 1QNSA 2WXDM 4K1GA 1FX6A 5CAHA 2GDUA 3OODA 3EKLA 4HOWA 1C29A 2GVJA 5REQA 1X98A 2ZYFA 1EQCA 1ENUA 2XGBA 4NASA 5CSRA 2VEMA 4HSHA 5B7ZA 5GJMA 2Z00A 5FEXA 3CT7A 2INFA 5D37A 1JEZA 5E0KA 4F2UA 2X8RA 1WKDA 3DENA 4FIQA 1JCJA 3GDMA 1R3SA 2BY0A 5DQPA 3HGOA 1QMLA 4JYFA 5IM51 2C0AA 1S2UA 1ZPTA 4A3YA 3IIXA 1XYLA 2G96A 1QR7A 4V1XA 3K13A 4UTJA 4Q7IA 1W2PA 3MBFA 3LNPA 3STPA 3GAYA 4UTFA 1QI3A 4XWUA 5AVNA 3ZWTA 4Z2HA 4ROPA 3K4AA 4HCDA 3E3HA 4CN4A 4OV4A 4DJDD 4LQ1A 4B16A 4YWIA 4QM1A 3T0AA 3IVTA 3LCHA 3FJNA 3PM6A 4LJ3A 4EWJA 3E1F1 3SN1A 4Y9NA 3ZMRA 4EP8C 2Y85A 4EXAA 3RPTA 3VCCA 3MA8A 4TMBA 1S5MA 2DIJA 1S2VA 3UXDA 1GPWA 1SFJA 3CQJA 1YXCA 3W2LA 3VNYA 4JL2A 5CH9A 4OE7A 2XUCA 4B3LA 2C1HA 2ZX8A 4YWSA 4CQAA 3WQFA 2Y0FA 3UZYA 1DQUA 5A6SA 5CC3A 4AZHA 3S1UA 2DGAA 4AG0A 3WQPA 2C6QA 1HUVA 3LQLA 4X0VA 1HTIA 4BQ4A 2F2KA 1PKLA 3HV8A 3PANA 1W32A 1W3JA 4ZB5A 3L2LA 4H2CA 4AEEA 3HBLA 1SZRA 4B4FA 5I3FA 1I1WA 4WJ8A 4DUXA 1RZMA 3M0YA 4G5DA 3TUUA 2RHGA 1ITQA 4NJHA 4PGLA 4L6DA 3U6WA 3B4UA 3TZFA 1XPGA 1PX3A 3VOFA 1B3XA 1TPWA 2A7NA 3U4AA 5BRQA 4Z1BA 1A80A 1LL7A 3OBAA 3F2BA 2PFHA 4RNFA 3SFWA 3BO9A 1SZFA 3F5LA 3RN6A 3CHEA 4ZO6A 3NQEA 1VIZA 1X96A 3AYTA 4NJIA 1EEXA 3BCJA 3N13A 4NJKA 3OVQA 4E38A 3WUGA 3SZ8A 1UBSA 5D32A 1GCYA 2CHNA 1K70A 1OF8A 5HDRA 5LIUX 5E5CA 2Z25A 4HKPA 3S2MA 1QW7A 3PUOA 1LWIA 3BV4A 3O0KA 4EANA 4HA3A 2E3ZA 1F6KA 4D6GA 3CUFA 3GXNA 3AXKA 4OV9A 1GORA 1E6NA 4KCTA 1DJXA 4AMAA 3HV9A 3TSBA 2QS8A 4ACYA 4R27A 2V5DA 4I8YA 1EC8A 3DOPA 2V0TA 1B1YA 1ADOA 1EL3A 3OVPA 1EZWA 2QYGA 4DVOA 3RR4A 3NOEA 2PWUA 4FNUA 2BY3A 4AIUA 2QUMA 7ENLA 4XAZA 4A3UA 3TA9A 5IBXC 4PC8A 4W8AA 4XK2A 1FWJC 3GG8A 2F9RA 2PGRA 3DUGA 2WV8A 2OO0A 3PAJA 3VNZA 4KERA 1FWGC 3W85A 3EWDA 3FJLA 1PIGA 4BHYA 4JN7A 1FH9A 2ZXQA 4LF1A 4XUYA 3PWGA 4HNCA 3DI0A 4S3GA 1YHTA 1XP3A 2GGGA 2CLPA 1J6PA 1E4IA 2YPIA 3B8SA 1M7JA 1LBLA 2BODX 3PWAA 2XIMA 1T96A 4F3HA 4A05A 4Q4OA 3T42A 3H8AA 1PEZA 4GXMA 5HR6A 4L5ZA 3GHRA 1XG4A 4ZO7A 1K9TA 3BLFA 1F4HA 1B3YA 4US6A 3IJ8A 1WXZA 3P80A 4PMNA 1XIHA 3MO4A 2ZXAA 3W2NA 2PDXA 2OSXA 4JTGA 1UW9A 1QO5A 1GHRA 4GY7A 1UOKA 3HQNA 2WLZA 4OWGA 4XAGA 3T8QA 1PZ3A 1FWEC 4HU0A 3TP4A 1F4AA 4DAIA 1NVMA 3MY9A 1WXJA 3CZJA 3DHPA 2J78A 4PBFA 1UJQA 4AEOA 1ZJBA 4N0RA 4U5IA 3PZUA 1JCTA 3BZJA 3KDOA 1EJVC 3TTYA 1SO4A 4RK8A 1FP8A 3DGRA 3GIPA 4YLWA 4A2RA 1IWAA 4KEZA 4NZ5A 4GI6A 4Q8WA 1KCZA 4BKNA 1NIUA 2H8ZA 2E6YA 2KAUC 4W85A 1OFQA 3A9BA 1WNOA 2UZ9A 3QR0A 5DY3A 3W76A 5HWMA 4DWSB 3M0XA 2Z0IA 3W2KA 3VGDA 1MW3A 3W2UA 1F6PA 2BHUA 4JHMA 4TTUA 1UD4A 5FJPA 1X6UA 1RJPA 3VCNA 1RD6A 3TMLA 1JD7A 1J11A 2PCQA 3COTA 4QJ4B 2F2HA 3MMDA 3QM3A 4I6VA 1H7PA 3BDKA 5LGZA 1FHLA 4Z0SA 1S5VA 3VABA 1F6YA 1Q6EA 2QJNA 4W5ZA 2WSRA 5LXXA 3N6HA 4O0ZA 4IICA 4GVGA 3UZZA 3THAA 4AISA 4HN8A 5EY5A 3OZMA 2E25A 4O28A 4QISA 4LAZA 4ZB2A 2OX1A 2ZZ5A 4TQTA 4O18A 2PB1A 1MRAA 1RLCL 4MWAD 3V7PA 2ISFA 2V2HA 4I9MA 2ADAA 5JBDA 1TV8A 4JDYA 5FEZA 1CNVA 1AA1B 3M0LA 3AC0A 1S3HA 3IUIA 2PDCA 4QDWA 4TV5A 3OBEA 4AIOA 1W1A1 4IP5A 3IPWA 1IV8A 1I9CB 1TRIA 2VURA 4AY1A 5A6BD 4ZXOA 2WC4A 3PNZA 4MDPA 4FNRA 3ABQA 3N4AA 2J7DA 3SRHA 3WH7A 6PTDA 1YX1A 3ARWA 1X1ZA 2J27A 4REQA 2OSWA 3STFA 1GKQA 3OGRA 4AYSA 4IGSA 3PBUA 4FNSA 1GTHA 3KWXA 1L6GA 1XR2A 2Y5EA 5D30A 4Z0JA 2QDDA 3TYCA 3O3RA 2XISA 1FWDC 1B4EA 2RDTA 4H00A 2E6AA 4DJED 3JZEA 3CL7A 3VX0A 4CNNA 2W92A 4V2XA 1VYRA 1AL8A 4NT0A 4GIRA 4HD5A 1N2VA 3B0PA 4XD5A 4F0SA 1UBPC 3WD0A 4EKJA 4PRWA 1W5NA 2WMJA 4O50A 1E1CA 2E4TA 4YTQA 4FR1A 2YA2A 1VKFA 4HNOA 4MLRA 1JL8A 3NXLA 4A8RA 1J01A 3KLLA 3DXIA 4QS6A 2VCCA 2NWRA 5XINA 3DIPA 1EX5A 1A3WA 1J2WA 4G9PA 4ZQMA 4IT1A 3VD5A 2YDRA 4PCTA 3M46A 1NDWA 1EEPA 4GFIA 3DDMA 3LTYA 2WWCA 5TNVA 5AYBA 4L9ZA 5E70A 3LYEA 4IJCA 1KM1A 3WUEA 1JPIA 2INEA 5RUBA 2VHLA 3IJIA 3T08A 4P61A 5C7HA 1JGIA 4RZ4A 4R53A 1G5AA 4HOZA 3KL0A 4G8TA 2VX4A 3WLLA 4M81A 3OG2A 3HPAA 1V6WA 1ITUA 2X1IA 2ZKMX 4AC7C 3O6YX 4PSPA 3AMLA 4LALA 4HA0A 3WL0A 2RH9A 3W88A 3L2IA 2D23A 2XGIA 3C0SA 2H9AA 2RAGA 1JZ2A 1LZOA 3Q58A 1WX0A 5CPQA 2VGGA 2A3BA 3GU1A 4JQ1A 5D2VA 5BWFA 4HPNA 2C79A 4NAEB 1MNSA 1R87A 4DWSC 4DPQA 1GOQA 3LPOA 2P10A 1LUCB 2QPSA 1MXSA 3LZ5A 3M41A 1J12A 4HK7A 4DF0A 2O9PA 4AF0A 4B92A 4DYEA 4JYEA 1KGWA 3NVDA 2GDQA 3CS2A 5PTDA 4EVZA 4H41A 3R12A 3N25A 4CD4A 3GY1A 1TYGA 1KBKA 3ZWSA 4ZO9A 1KFKA 2AGKA 4BY3A 2PWHA 5I06A 2QCHA 3ZLGA 3POCA 3K8LA 1W31A 3F4CA 2YKKA 3HFTA 3GVRA 2GUUA 2VZTA 4IGNA 4CNSA 5FIPA 2PP1A 3THCA 3DKJA 3UESA 1SSGA 1VR6A 3KFTA 3GDRA 1J79A 3FKKA 2ISVA 1W5QA 5L6UA 3B0XA 1MQRA 3K46A 1XD1A 4PUUA 1W17A 3EWWA 4IIFA 2B7PA 2VCBA 4GZJA 5U4NA 4TVUA 4DNMA 3G0XA 1YNQA 1FWCC 2FZMA 1XFBA 3VXGA 3WQ8A 1J2BA 2Z6JA 1RV8A 1F8IA 3CMFA 2Y1HA 4D2JA 1K7XA 4F2BA 2B7OA 4HTYA 1YNYA 1I2QA 4UTKA 4LB3A 3WIJA 1O12A 2TYSA 4JIHA 2A79A 4OBRA 1E0VA 1YIXA 1B3WA 3UXIA 3RJYA 2AMGA 1FCBA 3MT1A 3B03A 1EA0A 2VI0A 4P7QA 2GJLA 2WZIA 3TYUA 3CWOX 5H6HA 4S3CA 4HN4A 4D6FA 4JEQA 3W71A 2V3GA 3NM1A 3ZVHA 3HB9A 1PZ1A 2OZ8A 5B7YA 4M82A 2IS7A 3HF3A 4E8DA 1F7BA 1W2VA 3VPLA 3IIPA 1OQFA 3U3HA 4BR1A 4DYJA 2J79A 3DECA 5J5RA 4HIBA 4KFOA 5BOFA 4LU0A 2VX6A 1YDNA 3LLFA 1CT5A 3UNDA 1AW2A 1IHIA 4DXKA 4MADA 2W4XA 2PUZA 1BSLA 2QR6A 2BASA 3NPVA 4H3DA 4RPPA 3VILA 3EX1A 3LTSA 2C1IA 2W61A 1A50A 5I24A 1C8QA 1GHSA 3LGEA 2FTYA 4Q6XA 3EWUA 5A2CA 1RALA 5CSUA 3SCPA 5LYRA 2QGHA 3VC5A 1MEWA 1AMYA 3REQB 4W87A 4BF5A 1FH8A 2V81A 4HNTA 4ATDA 5DANA 1V6TA 2PDBA 2P53A 4QDPA 3G77A 1GPFA 5LZLA 1MW0A 2J7GA 1OFPA 1T8QA 3S9ZA 3AHTA 2QJHA 1EB3A 1TR1A 2A6NA 4HGXA 3M16A 2NQ9A 2EJAA 3IK4A 3AMCA 3A4JA 1FWFC 1L8PA 4HSOA 4MKSA 2VEGA 3R8HA 1R9YA 5KZMA 3T07A 4DF2A 4N6EA 1XLDA 1L6WA 3ELFA 3GHSA 6ENLA 3KWSA 4DNHA 1XLBA 3CGTA 3XIMA 4LUTA 3L0GA 1MZHA 3U7BA 2Y8VA 3UWVA 3UPMA 1R3VA 3WLTA 4KRTA 5IHRA 4I6KA 4NP7A 3ARUA 1Q6CA 1V0MA 2VC5A 4JTDA 1HJUA 3UJSA 1M9HA 4LV9A 1QT1A 3MP5A 3FDGA 4UMAA 4H9MA 3MKCA 3UETA 3FDKA 1H7OA 3ORWA 5T8GA 1QWGA 3ME3A 2VYOA 3C0LA 3LPFA 1XH0A 4Z42C 2V5CA 2EPMX 4AYGA 1KWKA 1XGZA 2DT2A 3W7JA 2R1LA 4O1EA 1UH2A 3OJGA 4DAFA 2XSBA 2QGYA 3HPZA 3AALA 3LG3A 4W93A 1J0KA 4Y96A 3OPSA 2Y7FA 1REQB 1JFXA 3BLEA 4OGZA 2ALRA 5CSYA 1JPDX 3GAKA 4C6QA 3G1FA 4QE1A 3BLDA 1V08A 4GYKA 3D3AA 4Q7BA 3S5OA 2FHBA 3D47A 2PGEA 4HMCA 4QTGA 3SUTA 3H2NA 4G1NA 1SO6A 4J27A 1NWSA 2V3EA 4DXVA 4BEQA 1S1PA 4PRRA 3AMDA 3FVMA 4GC3A 3TN4A 9RUBA 2J7FA 1PS9A 4NI8A 2CIPA 3NO5A 2OOGA 4PMYA 4IMFA 2OWCA 4FXRA 2GVGA 4HNNA 2DVXA 4QEHA 4R88A 4HNLA 5CXPA 5H8PA 4D6EA 2R14A 5FA5A 4H9VA 2EPOA 3W27A 2E40A 5C71A 4JKLA 2GGEA 1XC4A 4JTCA 1NWTA 1U33A 1QXLA 3HURA 2R6OA 3SCRA 1HL2A 4DJDC 3ICJA 4C1NB 5BRPA 5C8BB 5I02A 1TZ7A 5C55A 3OIXA 3UA3A 5C9UA 3GTIA 5HANA 4RX0A 2BGSA 1JZ7A 3VZZA 4HU8A 3GFYA 4A4AA 5ABGA 1Q63A 2ZTKA 5C2XA 1UASA 5CZ0A 3TYZA 2JBMA 3BAYA 5KMYA 1GNXA 4I5RA 5LIXX 2B7NA 4UTLA 3TONA 1TJRA 3SUUA 4YVVA 4KWOA 1XKJA 2ZRVA 1F61A 3RIKA 4JOMA 3W75A 2ZRUA 2AOSA 3LN3A 1H1YA 3NL3A 3L4YA 1QWKA 5FF2A 5FSEC 3R0UA 2BS9A 2E9LA 3LBOA 4DBEA 3IUDA 2W62A 5HWNA 2XVGA 3ABZA 4D6DA 3T0BA 4NAFB 3DFNA 1HG3A 3PP7A 3L65A 2XVKA 3HJZA 1DTNA 3H26A 3AQUA 4EAMA 2VFIA 1O66A 3LGDA 1ZY9A 1DJGA 1H41A 4WLCA 2HRWA 3N9RA 3PPHA 5F1VA 4PUDA 3FSTA 5G1TA 2I14A 5KZDA 4NZ4A 3A6OA 1YTEA 5JBEA 1BWLA 1FY6A 4RE4A 1GOOA 1TWIA 4QS5A 3LXCA 3SIMA 5AHIA 1N7KA 3HTWA 4C7GA 1YTKA 2BLEA 1P0EA 2O9TA 3GC2A 3KL5A 3QVQA 3OB8A 1DE5A 1TTPA 2IKHA 3WCZA 2YB1A 3APYA 3QV6A 3SQMA 4MWAB 1QAPA 3DZ1A 5A2AA 4K1WA 1M01A 5CPSA 4K3ZA 3G6MA 3I4EA 3W7IA 4BWLA 3SADA 3QV9A 3TC3A 3P0WA 2FMOA 3N12A 3IV8A 3TA6A 2OKTA 2YSWA 5DCBA 3QQWA 4O8RA 4UMBA 3OYXA 3S5YA 6XIAA 3F2DA 5HMDA 4MZ8A 3WK0A 2G0WA 3ARPA 2Y61A 3O06A 4HPXA 4I9JA 1ELSA 1KTNA 2V5BA 1V02E 1XSJA 1W1PA 1LF1A 1M41A 4Q32A 1XD0A 1PO9A 1NQ6A 3U5UA 1LRQA 1GOWA 3ZT6A 4YTRA 4S2CA 4B3ZA 3CASA 1ONWA 4Z2JA 3MHFA 1F3XA 3MBDA 3N34A 1OFDA 4C6IA 3HQ1A 5REQB 2CWXA 1E72M 2NUYA 4JTSA 1OB0A 1OINA 2VP8A 3W00A 2F6UA 2A7RA 4MFDA 4CD7A 2BXVA 4BI7A 1PSCA 4CUCA 1TMQA 1C8YA 4LFYA 3RX2A 1V0KA 1IT7A 1BG9A 2IXVA 3R8RA 5LIYX 5C5YA 4N9CA 4ERAA 1NEYA 3ZT5A 1RPKA 4H7CA 3WX7A 3QR3A 5CJ5A 2FH8A 1PCKA 1B2YA 1BYCA 4GO9A 2I1OA 2VZSA 3W1AA 4ROQA 1WDQA 1PX4A 1BYBA 3MYOA 3UWEA 3QYSA 4CNPA 3NSNA 4PZVA 1EDTA 2Y7GA 4Q6JA 3KOZA 4A3HA 4EWND 4J9JA 1BVZA 3CAQA 1LJYA 2NVDA 3ARTA 4GJJA 2F84A 2FFCA 3OBKA 1X7FA 2DUAA 3CU2A 1V3IA 3BE7A 3PJTA 4MB4A 4C7FA 3MI3A 5H8MA 1UKQA 2GLKA 3P81A 2V67A 1VEOA 4KIEA 1JULA 3MHUA 3FHQA 4ACZA 5D8ZA 1UPPA 3O6DA 2XZ9A 5CBIA 4FXJA 3BAJA 3N2TA 2Z2UA 3W53A 3WDJA 3W29A 3H55A 2YBUA 1N8WA 1HJSA 1AVAA 2CZDA 3PZOA 4Y9PA 2VOMA 2F7FA 4DRSA 1EJXC 1MZRA 1RUSA 4OFCA 2UY3A 1K7EA 3UR7A 1ECQA 3N6JA 4QAWA 4QSFA 2G5WA 2VZUA 4DUOA 3I7RA 4UOJA 2PP0A 5CQ1A 3W1MA 3STGA 4P8XA 4N4PA 3OQEA 4YHGA 3WLIA 4EK7A 1L6YA 2ZX9A 3BMXA 2XVLA 1U83A 2G3FA 4RDYA 3NFUA 1KKRA 1O68A 4O4WA 2PBOA 5A6KA 1AH4A 4ATWA 1PBGA 3FY1A 2HROA 5EFDA 3PZ9A 3K2GA 3NZPA 4E2BA 2G3JA 1C93A 5FF4A 3C5QA 3DFQA 4S2BA 4LSBA 3JZUA 4QQUA 3CO8A 2J9YA 3URQA 4LUIA 4H9TA 2WNWA 7XIMA 1GQIA 3RYSA 3QHNA 1M1BA 5M3WA 3PB0A 2XWEA 4KRZA 5HPCA 4Y8FA 1XQKA 4P8UA 2YCIX 5CLWA 1L2QA 1THFD 4MWAC 5DY2A 2VX5A 4JICA 3FVDA 3QOKA 1SZGA 2OT0A 3ES8A 3GBDA 1LBFA 3Q67A 4XD3A 3DC0A 3CWHA 5BOEA 2A6LA 3FOKA 3PF3A 3OYZA 4R34A 1KFCA 1OG0A 4DELA 3E0IA 2NW0A 3BMVA 3SCQA 2G4JA 3T8LA 4HU3A 4AX7A 5HNTA 3UXKA 2VEKA 1XYBA 3BCDA 4K8GA 5G2HA 4IH3A 4HPJA 1B3ZA 3R89A 4FXSA 3SCTA 4NVTA 1Q4NX 4CD8A 2GUBA 2OPJA 2DFAA 4XIAA 3VD3A 2IXUA 2PGWA 4ZVJA 3BLLA 3WQ5A 3KS5A 1RP8A 1HXJA 3LQGA 3RDKA 4E4FA 1HO1A 1UA7A 4CU6A 5D02A 3TCSA 4LAOA 2WPBA 4LUJA 2RDWA 1EDQA 2Q01A 2PDWA 3KS6A 3VKBA 1VCGA 4CN1A 1J10A 3BV7A 3TLLA 3N9KA 2RDUA 1QUMA 2R24A 2Z24A 2PS2A 1BD0A 1ZLPA 3O6CA 1ZFJA 5GJPA 2CLHA 2XIQA 1K9FA 1BF2A 2FHCA 5C70A 4KFPA 4PUNA 1DWFM 5FJOA 3E2QA 3CM4A 3ITLA 1FCVA 2YXXA 1IGWA 2R9RA 4EAYA 3CUIA 4UOQA 1Z44A 5ABTA 5HQEA 4FIRA 3B9EA 4GZIA 4IUGA 2NV9A 2QCLA 5I78A 1EYEA 3GWQA 3M5YA 4Q8UA 3IV3A 3NIYA 4Q4SA 4IM4A 4OVXA 1X7IA 4N9EA 4MUZA 4A8NA 2J88A 2PD5A 4TX8A 3BARA 4PUMA 2VRQA 1JDEA 5T26A 1JDAA 2ZIDA 5AC7A 5ABHA 1WZKA 3QFEA 1AQ0A 1XISA 1JAEA 2PWDA 1VYPX 3GXIA 3NPUA 1YBQA 3VGBA 1OK4A 2W79A 3VGGA 3B9NA 3CPUA 4ICCX 4AZGA 2DVUA 1MUWA 3GVGA 2WBKA 5I5RA 3TTSA 7REQB 4ZOAA 3NQ7A 4RNIA 1VFHA 7PTDA 1H61A 4KPLA 2WZEA 3P67A 2RDXA 1Q13A 3B0YA 3W84A 9CGTA 2CZEA 3PFRA 5HAOA 3DCPA 1NJJA 4LCQA 4MOZA 5EMUA 1X1NA 1TJ1A 1E43A 3NL2A 1HX0A 2OEMA 5AHLA 5DXYA 2GQ3A 4FX7A 4AU0A 8XIAA 3VFLA 3OA3A 4FI4A 4IQEA 1EHNA 4XSMA 4MNLA 4KCUA 3GG0A 3BW3A 1V0NA 1VJZA 2NLYA 3VGEA 4N9DA 3LX9A 1TFVA 4JAWA 1PJ9A 1UD8A 4UNLA 3V36A 4JTRA 3KCOA 1XFCA 4DF1A 2J77A 4GX8A 2ZQ0A 1E9IA 4FLSA 4PMJA 2WM1A 1A49A 4BQ5A 1NY1A 4JIPA 4HMDA 3K8KA 1LQAA 2ESCA 3ISIX 1MYRA 1O5XA 2BX7A 2G37A 2ZDSA 4JDBA 1JD9A 3RNDA 3UR2A 3TDFA 3UGVA 3SEPA 3QW4B 3PZTA 1F74A 2YL8A 5AKQA 2JKEA 2WAGA 4HOXA 1EP3A 2GWNA 3LHWA 4DB7A 2REQA 1SJCA 1C8VA 1JI1A 3SIZA 5D33A 1TWDA 4DHGA 3BL3A 2Z7GA 1QNRA 1VYSX 4AEFA 3A12A 1UR4A 2V69A 3L4XA 1A5AA 2V5LA 3IIZA 1P0KA 3QPEA 2ZCGA 1UD6A 1E9LA 2OZTA 5HA7A 4FNPA 1E71M 1L2UA 1XBXA 2DORA 1W3NA 4GZ7A 1B4KA 3SJNA 3UF9A 1EO7A 4O1BA 1H7NA 4M6VA 4REQB 3HA1A 4FS9A 3O07A 1R0MA 1A0EA 1H50A 7A3HA 3O9NA 2E77A 1CB2A 2XU2A 2AAMA 2Z1SA 3DH7A 3INPA 2PTWA 1G6CA 1JYNA 1W9VA 1JCYA 1D8WA 2XM2A 1YRRA 1NOWA 1MXGA 1JZ6A 4O54A 4WSJA 2CLLA 4RZ5A 3KOWA 3N04A 3GW0A 4O4VA 3S5NA 1O4UA 3O2LA 4W88A 4UZSA 3H53A 1F07A 2YIHA 1LDCA 4H8UA 4I7WA 2VFDA 3T05A 4D6IA 2DIKA 2D0FA 4C1KA 4ASTA 3E6EA 4GQQA 1Q85A 1E1CB 1JUBA 2GGJA 3WYZA 5CC7A 3JR2A 1HNYA 3EA1A 1H63A 4IFRA 1RA5A 2DZTA 2ISSA 1OM0A 1KGUA 1HF6A 1WCGA 1OHLA 4A35A 3GTXA 2ZWYA 1QOPA 2R82A 4M29A 1M7OA 4ADTA 3M5XA 2GQ9A 4QP0A 4GXPA 1TIWA 2TRSA 2X2YA 3QC3A 4CNUA 4M3PA 4M8UA 4UIOA 3WJYA 6A3HA 3BUVA 3VOJA 3WQGA 1OIFA 1XYCA 1IWPA 2DJLA 3P5YA 5F4XA 4YN5A 4NKCA 1L6SA 3OVGA 5TIMA 2BDQA 1ODZA 3KTCA 1X8FA 4ZQOA 4MYXA 3KX6A 3SURA 3NZGA 2WZMA 3WKZA 4H19A 4EE9A 3AZTA 2ODOA 1K4GA 2H9AB 4LVDA 2GJPA 3VIHA 2DH3A 1XLHA 4Z2GA 4XQ6A 2DT1A 3DX5A 1GG1A 5HATA 5E9XA 1CDGA 3WBXA 1NFPA 4RJEA 1XLCA 1VCFA 2HCVA 3B04A 3G22A 4P8VA 4AF0B 1BYDA 3GRIA 4UB9A 1YQ2A 3M0KA 1SJDA 2AMXA 2FVKA 4L9XA 4L1XA 4JFSA 3GUGA 2EG8A 1QDSA 2EPNA 4JTKA 1R7AA 1R30A 3WLMA 1KV5A 3MVTA 4UQAA 1XRFA 1KM3A 3WLKX 1H5YA 4LTSA 1BGGA 2DSZA 1VFFA 4ZQRA 1DE6A 1EJSC 3RLUA 2DW7A 4IXHA 1RD5A 4Q33A 1J8VA 2VDIA 4D8LA 2WSYA 1KXTA 3MS8A 4B91A 3VDBA 1QBAA 3WQ6A 4IMCA 2VFEA 4DYKA 1KGXA 1G01A 1KFWA 3UG4A 2ZXDA 3PZMA 3DBPA 3A21A 4UR7A 3QY6A 5JQ9A 1AH0A 3ZR6A 1U5HA 2DZWA 4JNMA 3GB6A 4GKLA 4LS2A 4JN6A 2PDKA 1YXDA 5D9NA 1QW9A 4A2SA 3TH6A 7TAAA 2CBIA 4LC8A 1P1XA 1FWRA 2H8XA 2I56A 4UR9A 4OOUA 2VGFA 4I5XA 2PWFA 4NSBA 1DTUA 1FKWA 2ATSA 1HJWA 5LA2A 3WUFA 4U33A 4CD6A 1OD8A 5AFDA 2YCKX 3ITTA 1P6BA 5FKYA 3VMPA 1FDYA 4TV6A 1SQ7A 3RHGA 4H7ZA 2CPUA 3TR2A 2BB0A 1KM6A 3AMGA 1RA0A 3CIXA 5A2BA 1FWNA 3VIJA 3ZVHB 2FYMA 1XXXA 3B8TA 4LGXA 4DO7A 3L4ZA 3W7MA 2TAAA 3K8MA 4LVBA 5I00A 1VJIA 3LHVA 2PWVA 2F6KA 1XYMA 3O1NA 4OUEA 1MDRA 4K38A 3VIIA 2GOUA 3NDOA 1HJXA 8CGTA 3ZSSA 6CGTA 4XVDA 3P5ZA 3AXHA 1UP0A 1AW5A 3FV9A 3KCJA 3IGXA 4UFLA 3BVJA 4AMCA 3MJYA 3ZJ8A 4PBGA 5AYYA 2PZ0A 3EPNA 1DJWA 2XSXA 3RM9A 5DT5A 1JQXA 5CZTA 4XV0A 4MJMA 2Q6ZA 4E6MA 3M9YA 4XD6A 1DIEA 4DEFA 3W38A 4Q8MA 3AXXA 3NCOA 4PMZA 4L4MA 1OY0A 3URBA 1UWQA 1TPEA 1Q7MA 4ECLA 4CU8A 3OGVA 1DJYA 1DXIA 3H4GA 4D8ZA 4J40A 3F4WA 2C18A 5TD4A 3U2OA 3U2CA 1IYXA 4LUTB 1QASA 1XIJA 3FSUA 4FF7A 3FA4A 1EDGA 2Y88A 3RRXA 3M6YA 1KRCC 3WD4A 4AHOA 1TG7A 4QITA 1HKKA 3E2SA 1G9HA 2DEPA 5CPMA 2Y5SA 2FFIA 1QK2A 4DJFA 5G4WA 1S5WA 3SGGA 3M0ZA 1K8XA 4LT9A 1AUSL 1JUKA 4XZMX 2FB3A 1VFUA 2WJDA 2WVVA 1OSEA 4M24A 1VAHA 3W4RA 1WBJA 3S4TA 2X1TA 1WB0A 2XN1A 2QF8A 3EDEA 3BXWA 3M1ZA 3CL8A 1P43A 1AD1A 3SO7A 4NL1A 3FFSA 4FX8A 3T0CA 1NELA 5SWUA 1UA3A 3TJ4A 3PVFA 1FHDA 3G1SA 2E1DA 1UZ4A 4LEFA 3DAQA 2D2GA 4IOTA 3WBEA 4Q3MA 2XN2A 5BYWA 3CQIA 2GGIA 1OIMA 3LSBA 3WLJA 5JIWA 1XGEA 1TVLA 1J5TA 4QXIA 4A3RA 1WUFA 1W9BM 5KEZA 4YHEA 5JMUA 1T0OA 2C13A 3I6TA 3W24A 5C7VA 3WH9A 2EF9A 2OZ0A 4H8HA 3C2EA 4PMXA 1S46A 5E1QA 3C8NA 3DGBA 2P0IA 1OCJA 2XH7A 3U0HA 4GISA 3MCNA 3S5SA 4JS3A 3UZJA 3MPGA 4OOZA 2H3DA 2PPGA 2QCDB 1CEOA 3PB2A 4A29A 1KM0A 4M0XA 3UFYA 3M5VA 4I9TA 4P7OA 3B05A 4ZENA 3GM8A 5E6ZA 2IMRA 1XH2A 3GSMA 4IX2A 4JNYA 1HL8A 1NSJA 2NVAA 3PHAA 2V5JA 3EX4A 3NDZA 4UZUA 5HULA 4C6NA 1YE4A 1HGWA 3NSXA 4WOQA 3CIWA 3R1ZA 3WBWA 1LQ0A 3A3XA 4WJXA 1G7VA 3KVJA 5CBBA 3IIOA 3GQYA 4GVHA 2YYTA 4WHBA 3PZQA 4B3KA 4AD3A 3W6MA 5CLTA 2UY4A 3V75A 1PL9A 4DLFA 4Q8TA 1UIOA 4NAEA 3GXTA 3FEMA 4N9BA 3G1YA 1P0DA 3EDJA 4I9AA 4NXKA 1XBYA 1GEHA 3SN0A 1KRBC 1V3JA 3GU2A 3MV11 2FZBA 1PKNA 1OFBA 1HT6A 1UD3A 5EGRA 2FJUB 1Q7QA 1IEVA 3SRFA 3E2RA 1Y7VA 5AECA 4DM1A 1SFTA 2HWGA 5G1MA 2I9EA 3QFWA 3HU7A 4S23A 3P14A 4ZQNA 3MANA 4ILSA 3PJWA 3HMCA 2CKRA 4GCXA 2OGJA <