5CSUA

Disproportionating enzyme 1 from arabidopsis - acarviostatin soak
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
518
structure length
518
Chain Sequence
ISVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
total genus 179
structure length 518
sequence length 518
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csuA01
3AYRA 3VGFA 2ZIDA 3MV01 5A6BD 1UH3A 3NDYA 1WZLA 3WF1A 1XV8A 1W1PA 3GXMA 4R5EA 5M3WA 4B3LA 4AZ5A 5I0DA 2W61A 4P8VA 2VX6A 2ZE0A 3WQ6A 4J7RA 4QLKA 4U2ZA 1QVBA 2JIEA 2FHCA 1QI5A 3FAWA 4AZ7A 4AMCA 5DT5A 1IZKA 4Z2KA 4UZSA 3IJ8A 1HVQA 3LPFA 4JFSA 4PUEA 1SYTA 1W9BM 4OZOA 3D5HA 4PMYA 4H41A 2Y4SA 1JAEA 4HPHA 3ARTA 4Z2GA 4W8AA 1UHVA 2YJQA 4AZ6A 1UKTA 3BLPX 1W9PA 4UQBA 1QBAA 1V6VA 3EMCA 3WNLA 3WH9A 1E6QM 2EPOA 1WB0A 1V3JA 1J01A 4ZEPA 4KGLA 2GJRA 3GTNA 3N17A 4TX8A 1CDGA 2E9MA 4GKLA 1LLOA 2XVKA 1BVZA 4YHEA 1JG9A 3W6MA 4GINA 3WN6A 4M56A 1C3FA 4ACZA 1PPIA 2WKLA 2WWDA 3CUIA 4U3AA 3K8KA 2XPKA 5A1AA 3EYPA 3AMDA 1CYGA 4EKJA 4PUDA 5GNZA 2X1IA 3TP4A 3WMSA 4KRUA 3WEMA 1E9LA 1KWGA 4M81A 3VGHA 4BF7A 3VUPA 3THCA 2VX5A 1XH0A 3MUY1 1E4NA 4TTGA 4U3CA 1U33A 1CGWA 4Q22A 3CLWA 3VDCA 5CJ5A 1JZ6A 5C70A 1JZ5A 3GNRA 4S3JA 3VIJA 2WHJA 1DP0A 1QI3A 4PMVA 1J11A 1KGUA 9CGTA 2YLLA 4M24A 4ATLA 5CPTA 2JE8A 1KQYA 1LL4A 1UKSA 4HZ6A 4UFHA 5GPRA 5D4YA 3VDAA 2W92A 4AD1A 4JL2A 3VNZA 1LWHA 2UY4A 5BROA 2FH8A 3BAWA 2G4FA 3RIKA 2FHFA 2PI6A 3FW6A 1OGBA 3AHZA 3MO4A 1CGVA 4BCEA 2VZSA 2PF0A 5BWFA 3K8MA 1C8QA 3W38A 1UG6A 4JFUA 4GI9A 1NARA 3PHAA 3LPGA 1NOFA 2WZEA 1WNOA 1JI1A 2ZUWA 3CZEA 4H8UA 5C71A 1EOKA 3UR7A 4Z2LA 3VD9A 3D3AA 5E0FA 5IFPA 2VZOA 3EMZA 3EBVA 1TVNA 2WM0A 3OZOA 1U30A 3B9AA 3ARXA 1KR1A 4H2CA 1CXFA 1NOWA 1V0NA 3BSHA 1MW1A 3W37A 1WDRA 3RO8A 1GW1A 2UY2A 2BY3A 3CHEA 2VVSA 4ZENA 3VINA 3M6DA 4D6EA 3B9EA 1QNPA 1JF5A 3CMGA 4AXNA 4C7DA 2XGIA 1HIZA 5DT7A 5HNNA 3HU7A 3N12A 5ABHA 5HPOA 3WQ4A 4DWSC 2PB1A 4MJ4A 5A6AA 1Y7VA 2ZX5A 3WMBA 3ZJKA 2J7HA 4X0VA 3OGSA 5FCZA 5BRPA 1R8LA 2VCCA 4ATWA 4NSBA 3WF2A 3VX1A 2YDQA 4TOQA 3GXIA 1Q6DA 1SMAA 4UZUA 2YBUA 2J77A 4GIAA 1B0IA 4HZ7A 5AYBA 1TA3A 1GQLA 3CZKA 3QR3A 1EH9A 2E0PA 3AIQA 4QFUA 1JAKA 2YIHA 2D0GA 2O9PA 2WMIB 3AS1A 3AZSA 4PEEA 4CCEA 4NRSA 1W32A 7A3HA 2WMHA 2EPNA 2O9TA 4U5IA 1M03A 4CD6A 2VZTA 4QDMA 5E6YA 4XV0A 2XHYA 4PYSA 4ACZB 2J47A 2F61A 3ZJ8A 2ZUNA 1H49A 3K1DA 4W7WA 1JFXA 1GNXA 1HKKA 2ZWZA 2EPLX 5A3HA 2WHLA 4JZ5A 3VGEA 2DH2A 2D24A 3AIWA 2JFEX 5GNYA 3VGBA 4TVCA 4PTWA 3MMWA 3KL0A 3WFZA 4W7VA 5A95A 5FL1A 2CHNA 3WUEA 1K9TA 3VILA 5EBAA 1HKMA 4XZBA 3BMWA 1RP8A 3BSGA 4QP0A 1UWTA 4PTXA 2VQTA 3APGA 3UEQA 3VD3A 2WC3A 1E0VA 1ZBWA 1B2YA 4LYRA 4CCDA 4MAVA 1E3XA 1TR1A 3ARYA 5ABEA 4QLLA 4BA0A 2BVDA 3L4YA 5EMYA 2W66A 1HL9A 4CGTA 1E15A 2J4GA 3L4WA 2XSAA 3N15A 2ZX9A 4UQCA 3OG2A 1NP0A 2V5DA 6A3HA 4PMQA 4MNMA 5A6JA 2D22A 2G3IA 5LYRA 3RDKA 3EDJA 4W88A 4UNIA 1J12A 2WBGA 1V02E 2A3HA 4JIEA 5KZ6A 2F8QA 2E9LA 2J7CA 3PZQA 4XZWA 2GDUA 2DEPA 2QPSA 3OLDA 3VO0A 3WY1A 3VDBA 1MVYA 1E56A 3OZPA 1Q6GA 4L4PA 3CHCA 3W27A 5LA2A 2WC4A 1FOBA 4PTMA 3TTSA 3AOFA 4W87A 3W6LA 4D6GA 2ZXBA 2J75A 3OIHA 4ML4A 2PWEA 1JIBA 1AVAA 2CPUA 2XFFA 2J25A 3RPMA 4F79A 3CUHA 3UCQA 1WCGA 1W1VA 3AIUA 4PN2A 3AIVA 1H0IA 5E70A 2Y8KA 3GH5A 1VB9A 4KGJA 3OGVA 2J7DA 1UWUA 4HA4A 4OKDA 5JUVA 1PX4A 5BCAA 1ZU8A 1VFOA 3M7SA 1GVYA 1I1WA 1MWOA 3RJYA 1UOKA 3FHAA 4TXEA 1HT6A 1BQCA 1OSEA 1BG4A 4JCLA 3HMCA 4D6JA 2VNCA 3CZLA 4N42A 2ZX7A 3DHUA 2J74A 3AMKA 5BRQA 1F4AA 4IUGA 1XSIA 1JFHA 5E0CA 1HJVA 3T2PA 2ZX8A 4MADA 2Y2WA 4LGXA 1WZKA 1W2VA 1OCQA 1XCXA 1H09A 3BAYA 3U7VA 4IISA 2V3GA 5A69A 3MV11 3PZ9A 4S3KA 2O9OA 3VVGA 4HMEA 4UFIA 3ZT6A 4W85A 1E71M 1JZ8A 1CXEA 1SMDA 2FHBA 1ITXA 4J3SA 3VX0A 2WVTA 1QI4A 3W53A 1B1YA 2XVLA 4A3YA 2ZUTA 5A94A 4AD2A 3VNYA 3DC0A 4B9YA 3WFLA 2WVUA 1DTUA 3L4TA 3A4AA 3LMYA 1UWQA 5A8PA 4J3VA 2CKRA 2G3NA 1E3ZA 3VOCA 4JFVA 5M17A 3ECQA 1UD2A 1M04A 1V08A 4GI6A 1GQKA 2BHUA 1N82A 1NQ6A 1KGWA 1RP9A 2VURA 1E4LA 4XB3A 1TA3B 1C90A 3F4VA 3VIFA 2D1ZA 2OSYA 3L4UA 1QI2A 2IXVA 4MTVA 4AD3A 1GJUA 3VIOA 4AZCA 8CGTA 1UYQA 1V3HA 4QCEA 4FLOA 3KL5A 3ARVA 1GCYA 1XSJA 1V0MA 4V28A 1CBGA 2ZWYA 3CHFA 2VR5A 2VVNA 4MB4A 3OB8A 4WKHA 2ZX6A 2MANA 3GBEA 2J78A 5IHSA 1GQIA 3CO4A 3PTMA 3WD4A 1JD7A 1H4PA 4MB5A 2JF7A 4Z2JA 1IZJA 2NT0A 2VX4A 1KCKA 5FOOA 4NZCA 3CMJA 1ESWA 5IXEA 1MXDA 4F8XA 1X6NA 1PAMA 2J7FA 3WEOA 2C8NA 3UESA 3J7HA 3NCOA 3BAIA 4F9JA 1K9EA 2VTFA 1NP2A 2ZXAA 1VFMA 4GZEA 2V3EA 3B8SA 5A6SA 1DWAM 4NF7A 1EXPA 5HXMA 3PN8A 4MNJA 4R27A 2AMGA 2QMKA 4FF5A 4AWEA 3VIIA 1UD3A 4CU8A 1UWIA 4U5KA 1QNOA 4YPJA 4HP5A 4WKFA 1DWIM 5LA0A 2GJXB 3POHA 3KEHA 1QW9A 1D3CA 1HJXA 4CD8A 2YDSA 3CPUA 2VRJA 3O6AA 1UKOA 2D0HA 5A6KA 1HNYA 4D6IA 4FMVA 1OWQA 5FKYA 4CD4A 1XYZA 1E0WA 4FLSA 1FHLA 1SFSA 1GZJA 5EB8A 1TUXA 3VD7A 5CXPA 5BXRA 2BVTA 3AICA 2YA0A 1VENA 2VL4A 1CZ1A 1QHZA 1NWSA 3VD4A 5TD4A 5HOSA 2X2YA 2FGZA 1GJWA 1UD4A 4W84A 2E8YA 4UFKA 3ZJ6A 1EDTA 2NT1A 4OIFA 4MDPA 1UZ4A 4JFWA 4B16A 2VZVA 3T0BA 2G3MA 4AISA 4GXPA 3FHQA 5CSYA 4KH2A 2VI0A 3ARRA 5CGTA 4UTFA 1I1XA 2VUYA 1QW8A 4PSPA 4HU0A 3RILA 4Z2HA 1G01A 4P7LA 2PWGA 2PBOA 3ZOAA 1CXHA 1JYNA 1V6XA 2XVGA 3RJXA 4OJYA 4A4AA 1ZB5A 3VIMA 2VMFA 1LL7A 5I78A 4YN5A 2EQDA 2EXOA 2GUYA 2VCBA 2X05A 2V38A 1JZ7A 2Y8VA 2GSJA 2PWHA 4L4OA 2BVYA 3WH7A 2ZXDA 1J0YA 1ECEA 4E8CA 1RPKA 1E43A 1K6AA 1JI2A 1CGXA 3PZOA 1O6IA 3L4VA 3BCFA 1B90A 2YA2A 2X0HA 2XGBA 3AS0A 4CUCA 1BHGA 1XH2A 2J79A 2BY1A 4ZE5A 4HPGA 5CZKA 3GYCA 1HL8A 3VM5A 3AJ7A 2W67A 3FXYA 1UR2A 2DH3A 3T08A 2V3FA 2DDXA 2YOCA 2A3AA 1VEPA 2V5CA 1ODZA 3U5UA 5I6SA 1OD0A 1G94A 3MSDA 1PJ9A 1ITCA 1C91A 3NUKA 2XSBA 1VJSA 5JIPA 1MW2A 2RGLA 3EDKA 5D8ZA 4C7FA 4ZXLA 1JXJA 4NI3A 1ISZA 4ZXOA 4D1IA 2AAAA 3PZGA 1Q6CA 3ZT7A 3N04A 5A8OA 1EIBA 1VRXA 2G41A 3SCRA 2E9BA 3WH6A 3AMCA 2GK1A 1EDGA 1DWJM 2BNJA 1IT0A 1OBAA 4GQRA 1NWRA 1NH6A 2O92A 3SCSA 3CUJA 1E6ZA 4CD5A 1AQMA 3VGGA 3WNMA 4TX6A 1Q6EA 1R85A 4RE3A 3IJ9A 3BMVA 4W8LA 4PTVA 3TTQA 1Z32X 4AC1X 2IUZA 3G6MA 3POCA 1E40A 4HZ8A 4ACYA 1QNSA 1YHTA 4KWUA 3GBDA 4AD0A 1H5VA 1GQJA 2BHZA 3PTKA 1UR1A 1EDQA 3N18A 3CUGA 4DM1A 2B31A 5I5RA 2OSWA 2UY5A 4W86A 3O2LA 1EQPA 2CESA 4W8BA 1VIWA 4HMCA 2Z1KA 3NSNA 2FGLA 3SCNA 1C93A 1V3MA 5ECUA 3T2OA 2YLAA 1PBGA 4OOUA 3M07A 1HKJA 1EQCA 5KEZA 2WYSA 1M01A 1OT2A 3I3DA 4HA1A 1XGZA 1UQZA 3UG3A 4AIOA 2X8RA 4AW7A 2OLHA 2OSXA 1DWFM 2WBKA 2XUCA 3RM4A 3L2MA 2Y24A 4KRTA 5AC5A 3WD2A 1BAGA 1V03A 1H0GA 1ZBVA 4HOXA 1H41A 1UQYA 1W9VA 3WQWA 1JNEA 2ZUMA 3NSXA 1US2A 3AYSA 4C7GA 1W1TA 2VOTA 2ZOXA 3SUTA 2D3NA 1CPUA 1QOXA 3F5KA 4U33A 1JYVA 3AIRA 2WVVB 4GQQA 1FHDA 1B30A 3ZT5A 3VD5A 2WSPA 3WIJA 3L2LA 5FD0A 4JAWA 2DQXA 4WSJA 3A47A 1E4IA 3BLKA 4JKKA 1CIUA 3CTTA 3PBGA 2D2OA 2YKKA 2ZUUA 4D71A 1MW0A 3RM8A 4PCSA 3L4XA 2QV4A 1CWYA 3WEZA 4D72A 1MQPA 1ZBKA 2YL5A 1J10A 4RE2A 2VCAA 2WZIA 1XSKA 2DT1A 1WP6A 1V02A 4NRRA 4V2XA 3ZJ7A 5AY7A 1HJSA 4UOJA 4ZE4A 5A2CA 1W91A 3WBAA 3AZRA 1MFUA 4ZFMA 1Q6FA 4UFJA 5I3DA 3EDDA 1XRVA 2DSKA 4PMZA 2RGMA 4D6FA 1AQ0A 4AY1A 3AXIA 2EEXA 5A8QA 2BXZA 4AZIA 2OYKA 3SCTA 1E70M 1XCWA 4UOQA 1US3A 5FIPA 1CECA 3SUUA 1E6PA 4DWSB 2CITA 3QHNA 4P8WA 1FFRA 3MKKA 4P7NA 4Y7EA 1M53A 2JALA 5C8BB 2DIJA 2VQUA 5A8NA 1BFNA 2VX7A 3RMEA 1AQHA 3B9DA 1J18A 3UERA 4HOWA 1BYBA 1BYCA 1VFUA 4AEEA 2XM1A 2ZICA 1CXIA 4CVUA 2CBIA 1BF2A 3ZM8A 3DHPA 1XHGA 1KCLA 1PIFA 1PZ2A 4HMDA 2BY2A 2BV9A 3MMDA 4Z2IA 1EO5A 1E6RA 1CGUA 2C7FA 3A4XA 3I3EA 2CBJA 4KMQA 1ISYA 2Q8XA 2CETA 4M80A 3AFBA 4UOZA 5I23A 2IXUA 1MXGA 3TTYA 1V3KA 5A8MA 1HP4A 1PEZA 2X0YA 1CENA 1OINA 1UKPA 7TAAA 3AROA 3PZTA 2VRQA 3GH7A 4W5ZA 1PX8A 2OYLA 4H8HA 3WF3A 2DSVA 3ALFA 6CGTA 1UR4A 1HJWA 2YL8A 2JEPA 1V3LA 4RE4A 5HBFA 1EO7A 3WL0A 3KWXA 4BZYA 3K4AA 1F4HA 4GZJA 4BQ5A 4QCFA 4XX6A 3L4ZA 4JHOA 3ZO9A 2E40A 1W9XA 1QNRA 4OUEA 1QI0A 3NJ3A 4TTUA 2CIPA 3CZJA 1UD6A 1TE1A 4LPCA 1LL6A 1KXTA 4GO8A 4H7VA 1MFVA 1GONA 3WNKA 1NWUA 1D7FA 1BSIA 1TG7A 3VIHA 1M7XA 1HJUA 3IJ7A 1JD9A 3I3BA 2VR4A 3BXWA 3AHYA 2CCRA 1VBRA 2GJPA 4CU7A 1KXQA 4TUFA 3WQ5A 1KR0A 1ISVA 2UY3A 3W82A 1R7OA 3SCWA 2OYMA 1WDPA 4IM4A 1OM0A 2J7GA 4RL3A 2NW0A 4AIUA 1TFVA 5BXPA 1ZJBA 4BS0A 1KBBA 1LQ0A 1OB0A 2YL6A 3U5YA 2JIWA 1KXHA 2Y5EA 3FY1A 2WC7A 7CGTA 1KBKA 1J0KA 2EPMX 1E5JA 1GVIA 4J3XA 1W3JA 3N1AA 1ZS2A 2W63A 3WDHA 5E09A 1FP9A 1MQQA 3OLGA 3WD3A 2PWFA 1NOUA 3FAXA 3K46A 1JZ3A 3NSMA 3AMGA 4LQ1A 2WSKA 4WKAA 2WLZA 1CXKA 3FNDA 1CEOA 5DF0A 3ZQ9A 4CU6A 2EBNA 1B31A 3WKZA 1BVNP 2JF6A 1JGIA 2V3DA 1W9UA 2W4XA 4H04A 4U2YA 1OT1A 3WDQA 5IHRA 3GH4A 1GHRA 4DWSA 3BCDA 4AD5A 1DHKA 3A4WA 1W3HA 4TVUA 1C8XA 4HU8A 5A6LA 1WDSA 1A47A 3JUGA 3RM9A 1CNVA 3O9NA 2CKSA 4AEFA 1XC6A 4J27A 4QAWA 3ZMRA 2WCGA 1B3ZA 2YL9A 3TONA 3WENA 1G5AA 3ZSSA 2DGAA 2HVMA 4CN4A 4UR9A 1FFQA 2XFYA 1CLVA 5BXTA 4B9ZA 3WDRA 4GPNA 3S6TA 2W91A 1ZBCA 1YQ2A 3WUGA 1FH9A 1KB3A 2YBTA 3AHTA 3WUFA 5A2AA 2HISA 3OLIA 2W5FA 1UR8A 1UZ1A 3VMNA 1MW3A 3SCOA 1JYXA 2FDMA 3IANA 4JHZA 4LXFA 3SCUA 1WO2A 2BFGA 3CGTA 5CPSA 4B15A 4DWSD 4MDOA 4W89A 3SEPA 3VDHA 4OOZA 1EHAA 1HKIA 4UQEA 1V0LA 1DEDA 2QMJA 2WK2A 1E1FA 3OBAA 1PX3A 2WAGA 2XFRA 4EK7A 5D9OA 4E2OA 1G0CA 4HOZA 1JL8A 3W28A 4B3KA 5CG0A 3WQVA 3TOPA 3W81A 3GZAA 1E6SM 3W4RA 4UQAA 2WKGA 1V6YA 3N9KA 4EE9A 1GHSA 1B3VA 1TVPA 1OGSA 3EMQA 4PMDA 2WXDM 1LF1A 1QHPA 4E4PA 1AMYA 5A6MA 1CXLA 4CCCA 2WCAA 3VM7A 4AD4A 3WQ8A 3VIKA 1OIFA 1DWGM 5CLWA 2J8FA 1ZL1A 2PBGA 5ABFA 5BYWA 4GI8A 4GO9A 1VFFA 1TCMA 2VZUA 4UFLA 4V27A 1MYRA 4J3TA 3DYMA 4YHGA 2O9RA 1GORA 3UR8A 1OD8A 1C92A 2DSUA 2QHAA 4JKMA 1UUQA 1GOOA 1H3GA 1I75A 2GK1B 2BHYA 2XVNA 4X9YA 4MNLA 2XIBA 3BH4A 3WD0A 4MAZA 2WMKA 1X6LA 2A3CA 2GDVA 3CZ8A 3ZR6A 1K9FA 2OWCA 1GOWA 1E55A 2TAAA 3WH5A 1UR0A 3IK2A 3PTQA 1GOKA 1RD6A 1VEMA 5DO8A 1PZ3A 1LG1A 3KL3A 1LG2A 3VMPA 4A3HA 3ZR5A 1QPKA 1VEOA 4CVWA 3ARPA 1UKQA 1C7SA 1U2YA 1XH1A 4QLJA 1J0ZA 3UG5A 1BPLB 2F2HA 1GOMA 2GFTA 4EANA 1JF6A 3SIMA 3WF0A 2J7BA 3WELA 3BGAA 3WDIA 3EDFA 3DYPA 2DT2A 1LWJA 2WVVA 1KGXA 1BYAA 2XG9A 4AZGA 4HTYA 3WD1A 2WNWA 2XTKA 3WBEA 1B3WA 3WH8A 3PZNA 2G8ZA 2BXYA 2XWDA 5FL0A 2EPKX 5DMYA 2WMFA 1WDQA 1E0XA 4OBSA 2OWWA 1HXJA 3EDEA 2WCSA 1E4MM 2DIEA 3AXHA 2YA1A 2J8GA 3SCVA 5DFAA 4J28A 4PMOA 5JIWA 3CUFA 4TVDA 1VF8A 2XJ7A 2VO5A 5CQ1A 3E1F1 1EHNA 4PRWA 1MQRA 2WMIA 3NYDA 5F7UA 1J0HA 1ISXA 3PZVA 2VC9A 3OGRA 3W0KA 2YDRA 1ODUA 2CBUA 4BQ2A 4P8XA 1E73M 1VJZA 3MUZ1 2CNCA 4FLRA 3SUWA 2UWFA 4UQ9A 1EGZA 3AS3A 3ARZA 3BAXA 5CLTA 3OA5A 5I77A 3DECA 4FK9A 3WNOA 3N11A 4OBRA 1OGGA 3ALGA 3G6LA 2BS9A 3ZSTA 3K8LA 1W2PA 2W62A 1CGTA 4J3WA 1OIMA 3TTOA 3VGDA 5BXSA 6TAAA 2VT0A 1CGYA 3MU7A 1TZ7A 4CN1A 4UCFA 3AHXA 4W5UA 1E1EA 1HVXA 1J0IA 4M8UA 4M1RA 3IAQA 4WLCA 5D9MA 5DEZA 2WMGA 3VMOA 3LPPA 1HP5A 4D6HA 1H11A 3WUBA 5CSUA 2QLYA 1WPCA 2Z1SA 3ZIZA 3WL1A 2DSZA 2WHKA 3GXFA 4JCMA 3U7BA 1UWSA 2C0HA 3CHDA 4M82A 1VAHA 1P6WA 3CH9A 3AIBA 1H2JA 2DPEA 1UD5A 2WW5A 2BY0A 1WAWA 3ARSA 4P8UA 1XD1A 3NIYA 1SR0A 1JXKA 2FH6A 5GNXA 3UG4A 4CKQA 4MJ2A 4D1JA 1XD0A 2XVPA 1XYFA 1UD8A 1W3LA 2D3LA 3T2QA 5I79A 4FLQA 4URIA 2WB5A 2OWXA 2WMJA 5ABFB 2CYGA 5A6BA 2D0FA 5IFTA 1HF6A 5A2BA 1JNDA 3II1A 3M46A 1EOMA 3MMUA 4P7RA 2J62A 3SURA 3MUIA 2CBVA 5I24A 1Q4NX 1S46A 2A3EA 3SUVA 3PZIA 1EA9C 1UWRA 3WNPA 5E6ZA 5JBEA 1FH7A 3SCQA 1QHOA 1WE5A 2VRKA 5M03A 2WZHA 3WSUA 3VTRA 4JKLA 3GXDA 1FP8A 4JL1A 4W7UA 1B3XA 1BGAA 3VKKA 1J9YA 3T0DA 3A6OA 5HPCA 1VBUA 2XM2A 4XUYA 3AI0A 3PZUA 4WF7A 2XIIA 1FH8A 3MANA 3WDJA 3T09A 3T0AA 1KQZA 2ZUSA 1V3IA 3GNPA 4UQDA 2ESCA 5JBFA 2E4TA 2QF8A 1G9HA 1GUVA 2ZXQA 1RH9A 1B9ZA 2DT3A 1D2KA 4WJXA 3THDA 1V6UA 4WSKA 2PWDA 1GOIA 3QGVA 2G3JA 4U31A 3W29A 5IDIA 1JZ2A 1CTNA 2GJXA 3IAPA 4MPKA 3VPLA 4AZBA 3MS8A 3QOMA 5M5DA 3WMCA 1QNQA 1E6NA 4W93A 1PIGA 5E9AA 2PC8A 1ISWA 3U57A 1G1YA 3KZSA 1BG9A 1FA2A 3MUAA 3N13A 4PMNA 1GOQA 3AHVA 2NSXA 2X09A 3AS2A 2XWEA 1JYWA 4PBGA 2CERA 4MNKA 3NDZA 4JFTA 4M29A 1BLIA 4PSRA 4K68A 4X0NA 3CZGA 1W3KA 2DSWA 1KXVA 3VIPA 3GDBA 5D9PA 2WPGA 4PCTA 1H1NA 3KE0A 1TMQA 1UA7A 3BC9A 3WDPP 3QOKA 1B3YA 1L8NA 4CN6A 1R7AA 3TA9A 3ARUA 3W25A 4CD7A 5HDRA 4D6CA 3VIGA 4AZCB 3GNOA 1UR9A 1JZ4A 8A3HA 3SUSA 1E6XM 4P7QA 3PZMA 5EFFA 3CIVA 1V0KA 3UETA 1UH2A 3HJEA 1W9DM 3F5JA 2WVSA 4DM2A 3CBWA 1A3HA 3AXXA 3WF4A 1BGGA 4LYPA 2GVYA 1QBBA 5CGMA 1JDAA 3SCPA 3BAJA 1WZAA 3W26A 2WANA 2XYLA 2D23A 3MSGA 4H8VA 4AYSA 3RCNA 1WZMA 2WLYA 4DUXA 5D9NA 1KFWA 2DT0A 4DUWA 1J0JA 1JDCA 4UFMA 4DUVA 3GM8A 3FN9A 5GQBA 4MB1A 3ARQA 4EAMA 3AZTA 4E8DA 2D20A 4LX4A 2EJ1A 1KWKA 1C8YA 1WKYA 1NM9A 4AIEA 3W24A 1BTCA 2CEQA 4LYQA 1LJYA 1K9DA 2CHOA 1DWHM 1BYDA 2AOSA 4IPNB 1NWTA 1HJQA 5AYIA 1UH4A 2JEQA 4MB3A 1HN1A 1O7AA 3VU2A 3OLEA 5ABGA 4PMXA 4F9DA 1ZJAA 4PMRA 2J7EA 5EFDA 1IV8A 3BAKA 4BQ4A 4HA3A 4F66A 1R87A 2WHMA 1L0PA 1CLXA 1HX0A 5D8WA 5LA1A 3WNNA 1UA3A 1V6WA 4PMUA 1R86A 2E3ZA 3F5LA 1JDDA 3A3HA 3K4DA 1E72M 3HN3A 4P7OA 4WK9A 5I2UA 5CPQA 1C7TA 4D6DA 4Q7NA 2VJXA 4IPLA 2A3BA 2QPUA 4ATDA 2ZUVA 1GPFA 1X1NA 3ARWA 3AMLA 3AIEA 1E5NA 4AZHA 2E8ZA 3AQUA 4BQ3A 3AISA 3DYOA 5JBDA 4WIWA 3QHOA 4J3UA 3S2CA 2EO7A 3QHMA 4N0RA 3LPOA 1W1YA 2WWCA 2CXGA 4GZIA 5AC4A
chains in the Genus database with same CATH superfamily
2G97A 1QPNA 5A6BD 3M0XA 3S5NA 1NFBA 3E38A 3TYDA 1W1PA 1R3QA 4XAFA 3ITCA 3A3XA 3GD6A 4I3GA 2V8ZA 4QLKA 4JXCA 4ZTXA 3R4IA 2JIEA 4E3VA 5U4NA 4DZAA 1IZKA 3DBPA 4Z2KA 4UTUA 4UZSA 1SYTA 3N6HA 1W9BM 3N3TA 3QC0A 4JDBA 4H41A 3TKFA 4Z2GA 4DX3A 3L66A 1UKTA 2CZVA 3EMCA 1UPMB 1DIEA 3M4HA 1E6QM 3SGZA 1V3JA 1XBXA 3MUCA 3KBWA 4ZEPA 3GTNA 1P0DA 3PPCA 2OLAA 1CDGA 2E9MA 4GKLA 1BVZA 2X2GA 4UTJA 5CSRA 3W02A 4Q4KA 3SY1A 4ZSUA 4MJZA 3AXKA 3ATYA 3WJSA 4PBEA 3UBPC 1O1HA 3OVRA 5D32A 3L23A 3S5YA 2ACSA 1TO3A 3KX6A 5G4HC 2EPHA 2XSXA 1TRIA 1HZYA 3QV8A 4JTSA 3WEMA 4QX4A 3CU2A 1K8XA 1TWZA 4BF7A 2VX5A 1XH0A 4DJED 1XYAA 3CLWA 5CJ5A 1JZ5A 3GC2A 3VIJA 7REQA 4JDYA 3QF0A 3N2CA 9CGTA 3AO0A 5CPTA 2TODA 1IWPA 2IS7A 3TYCA 5C9UA 4HZ6A 4FNTA 4UFHA 3VDAA 2W92A 1LWHA 1A5LC 3T44A 2Z7KA 3UJSA 2PF0A 4L6HA 3W38A 3IGXA 4JFUA 4GY1A 1DXEA 1JI1A 2VEFA 3OQ8A 4H8UA 1S2WA 1EOKA 3HPAA 5MKGA 1LZOA 4C90A 1KCXA 1A5AA 4PTNA 4Y90A 1ML1A 4H2CA 3MKVA 1CXFA 3GTHA 2QCLA 2JKEA 2ISVA 4X63A 3PSVA 3NPUA 3RO8A 1GW1A 3PWGA 1DJHA 4MZYA 1MEHA 1Q7ZA 1QNPA 3CMGA 4C7DA 3BZGA 4GVGA 1FWHC 1S3HA 1HIZA 5HNNA 4BK9A 3N12A 3S2NA 5ABHA 2GGHA 1HKWA 1Y7VA 1C8VA 2NVCA 4X0VA 3OGSA 5FCZA 3TQ0A 2NV2A 1AFSA 3W74A 1YE6A 2VCCA 2Z1VA 4LS0A 5IRPA 2C15A 4ROPA 1RBOB 4HNLA 4WJ8A 3TFXA 4TOQA 3I6TA 1KKOA 5KITA 3L9CA 2E0PA 4MWAC 5EMJA 2DZAA 1DQWA 3WLQA 1YNPA 1MRQA 3AS1A 2QVHA 7A3HA 2E6YA 2C14A 2O9TA 2VZTA 2OU4A 4RUBA 2E1WA 1F6PA 4ACZB 5HQEA 3UF9A 3EXSA 3B9OA 4QHRA 4W7WA 3DFQA 1RA5A 1TE6A 2P3EA 4LUIA 3QGAC 3E0FA 3V3WA 1XLBA 2R8WA 1DJQA 2P50A 4G1KA 2YCKX 2WHLA 2DH2A 2DZWA 2D24A 3DAQA 2PTDA 1ZAJA 1BTMA 4PTWA 1FBAA 4ROQA 2NQLA 3N29A 2BOFX 1K9TA 1HKMA 4DJFC 1DKWA 3BSGA 4QP0A 5AVNA 1ZTVA 4RXFA 4XISA 1D9EA 3K30A 4LYRA 4ZO7A 1J2BA 1E3XA 3ZLGA 4QLLA 4BA0A 1KV8A 3L4YA 5AZ0A 4D8ZA 3A22A 1PZ0A 1OFQA 2WOQA 2ZX9A 4M6QA 4JICA 1O12A 3W7QA 4PMQA 5A6JA 5LYRA 4JY9A 3EDJA 3BLOA 4UNIA 1E0UA 5BWAA 4NZ3A 1V02E 1O95A 2VXNA 4XUGA 2F8QA 2C91A 1AUSL 4XZWA 4RE0A 1H7OA 4AB4A 2DEPA 2D2HA 2Y7FA 4Z1DA 1POKA 3PPHA 3CHCA 1KLZA 1FOBA 4PTMA 4G5DA 1W56A 4ML4A 2J75A 2EKCA 5AFDA 1JIBA 4IL0A 2XFFA 3O3RA 4F79A 4AXKA 1W1VA 3AIUA 3AIVA 2Y8KA 1P43A 2GQ8A 1X1OA 1VR6A 1ZU8A 4OWGA 2PDGA 3HG2A 1NDYA 3C3NA 2E6FA 3WO8A 3C4UA 4C65A 3H21A 4EXAA 2BDQA 2Z6JA 4N42A 3VNMA 2XDFA 1F4AA 3F2BA 5HMFA 2Y89A 1GGOA 1HJVA 2ZX8A 3LHZA 2Y2WA 3NQMA 1WZKA 2V2DA 3C0QA 3O1NA 4FXSA 4B5SA 3R6IA 3KHDA 3OOQA 1RBLA 3MT1A 2PDHA 4IISA 5A69A 3E96A 3MV11 3THQA 3STEA 3A4JA 4HMEA 1XPGA 1U5HA 2FHBA 1TJRA 3VX0A 2WVTA 4IMDA 3H55A 3EWDA 4LCRA 3BK0A 3W53A 4CQ8A 2JQXA 3TSMA 2XVLA 4A3YA 1XRFA 3D0CA 2WVUA 2X1RA 3KM8A 1G7VA 1X8CA 3C0SA 4O1DA 4PH6A 3H7VA 3O0FA 1V4YA 1M7PA 4GI6A 2PLCA 1GQKA 2X40A 2BHUA 4Y9NA 3F4VA 2GVEA 3TUUA 5BU6A 4JTGA 4IFKB 4Q3MA 5F2GA 1ZFJA 2OZ8A 1GJUA 4AZCA 3PUGA 3R7MA 1RLCL 1GCYA 4G56A 1H7XA 3DI1A 3KLKA 3ZS4A 1S2AA 4WKHA 2MANA 3GBEA 2J78A 1CX9A 3M0YA 3LQGA 3LZ5A 3CO4A 3PTMA 3MWAA 1XBVA 2JF7A 1HL2A 1IZJA 2VX4A 3E0VA 1KCKA 1XYMA 4H9TA 4NZCA 1ESWA 2B0MA 5IXEA 4Y8FA 3AAMA 3UCCA 2J7FA 4KRZA 2Z1BA 3BAIA 2VTFA 2E5DA 5A6SA 4E2DA 1DWAM 4NF7A 5HXMA 1WXYA 1JDEA 1R3YA 3PN8A 4R27A 4AWEA 3FSUA 3VIIA 1E1CB 3GNDA 4IWWA 3LCWA 2GJXB 3HGRA 1HJXA 4BFAA 4JR5A 3TAOA 3GU9A 3FA4A 3SN1A 1HNYA 1SW3A 5C5YA 4FMVA 3E2VA 5FKYA 5K3VA 3IJLA 4GHRA 3RX2A 1NY1A 5BXRA 4P5UA 1IEVA 1OX5A 5J8LA 5EA9A 1QHZA 3CM4A 2D2GA 3B0UX 4UFKA 4RW5A 3H54A 4MDPA 1UZ4A 3B4UA 4B16A 2VZVA 3GUWA 4AISA 3WLHA 1TYGA 3UVIA 3BGJA 3URNA 2VUYA 3VFLA 4HU0A 3RAOA 3CPRA 4F0RA 4HPXA 4XO6A 4OJYA 1ZB5A 3E74A 1HG3A 3I7SA 3B0XA 4YN5A 2VEPA 2TMDA 4IX0A 2X05A 4C6BA 1JZ7A 4RV3A 1YTEA 2GSJA 1F61A 2BVYA 3NR0A 3WH7A 1JRBA 2ZXDA 4C6OA 4JQ4A 1Q2SA 5HMSA 3I68A 1E43A 1K6AA 4DPQA 3SO7A 1O6IA 4JOMA 5K9DA 2OGYA 3H2CA 3UGRA 4F2TA 3BCFA 1F05A 3RLVA 1WAUA 4DNHA 3GNNA 3N73A 4CUCA 4L9ZA 2BY1A 5CZKA 3GYCA 3VM5A 4V33A 3AJ7A 3VI2A 2FFCA 3FXYA 1UB3A 1VKFA 2DH3A 3T08A 3Q2DA 6REQA 1IXPA 3PC0A 1NF7A 1OD0A 1S5WA 4X2RA 1QW7A 1LLZA 3MSDA 2GJLA 1VJSA 4R7JA 1MW2A 2NXIA 1JXJA 1ISZA 3S8HA 1WA3A 3LEPA 4L64A 1JVNA 2HCVA 1X39A 3WCZA 2G41A 2E9BA 3WH6A 4DO5A 4GFSA 3AC0A 1OBAA 1NWRA 2J8TA 4Q8QA 4C6KA 1EEXA 4CD5A 3WNMA 4TX6A 1Q6EA 2W9MA 1XLIA 3BMVA 4KCWA 2IUZA 4L1XA 3E0IA 5CPMA 1QNSA 4AD0A 3TA6A 1EDQA 4DM1A 1SGJA 3BICA 1H61A 5I5RA 4W86A 2FDSA 4AHQA 4QM1A 1PXGA 3H23A 3NSNA 2FGLA 1XS2A 4WEVX 4R85A 4RCXA 3O6CA 1AA1B 4Y9MA 3M43A 3I7QA 5ECUA 2ZDRA 3T2OA 3MQTA 2FPTA 1VP5A 1UQZA 4IFKA 4DO6A 2X8RA 3HA1A 3DFPA 3UZZA 2OSXA 1DWFM 2XUCA 2Y0FA 3RM4A 4NJGA 3GU2A 2VEIA 4H19A 1RA0A 1BAGA 3MDWA 3PB2A 5TAOA 3KW3A 3IVTA 1AD1A 1W9VA 3WQWA 1JPDX 1XJBA 3E0LA 1W1TA 2GDQA 2VOTA 2ZOXA 4HJWA 1P6BA 2D3NA 2VFDA 3S1XA 1QOXA 1M65A 4A2SA 1JYVA 1K03A 4XKYA 4NASA 2NUWA 2OKTA 2BXVA 2QNEA 2CZFA 5LIYX 4S38A 1FHDA 1B30A 2A0NA 3B3DA 4IT1A 3U3HA 3VD5A 3WIJA 2DQXA 3A47A 1CIUA 1MZRA 3CTTA 3PBGA 5F2IA 4DRSA 1RHCA 4Q6JA 1MW0A 1EPXA 5MKGB 2GJNA 3E5BA 4D72A 4ES4A 2NQJA 3O6DA 1Q7MA 2NX1A 1TPWA 2WZIA 1GYLA 4DJDC 2V67A 3R13A 1R9XA 4ZOEA 3B4YA 3MJMA 1W91A 3WBAA 2PLMA 3ITXA 3KOZA 4ZFMA 3QTGA 3WG6A 1ONRA 1XRVA 2DSKA 4F3HA 1AQ0A 5A8QA 4MSSA 3M0ZA 4NYYA 1BXBA 1G4TA 3LUTA 4AZIA 3SCTA 4C6CA 3R12A 1US3A 3UP8A 4A29A 1VH7A 3KDOA 4WDXA 4BF9A 1GVFA 4QDWA 3GS6A 2B81A 4DWSB 1UP3A 3DG6A 3IVUA 3AALA 4YVPA 1A5UA 2HBVA 4OFCA 1A0DA 1I0DA 4Y7EA 1M53A 4XSMA 3WLMA 1XR2A 4ICNA 3Q37A 2VX7A 3RMEA 5J5DA 3B9DA 3V16A 4O1EA 3AU6A 1J18A 4IMGA 4AEEA 2ZICA 2DZPA 1BF2A 4LF1A 3DHPA 1XHGA 3SRDA 3NQDA 4HHMA 3FFSA 4UTIA 3MMDA 4LBRA 3QY7A 2TYSA 1GG0A 3M44A 3T42A 1QWGA 3DFHA 1QNVA 1Q85A 4KMQA 4CNTA 4FXRA 3M0VA 2VELA 4WRHA 4JYEA 1PKMA 2PRHA 5I23A 4CQDA 4C6NA 1XFBA 2INEA 3G1FA 2Y63A 2IXUA 3TTYA 2I5GA 8RUCA 4UTHA 3PSWA 1UKPA 2RDTA 3NQ8A 1F3WA 1C9DA 3OVGA 3WF3A 5H2ZA 2E6AA 3ALFA 6CGTA 1FX6A 1HJWA 1XDJA 2ZYFA 1LYXA 5FAJA 4UR8A 4H8NA 3W1LA 1SPQA 3KRUA 3PBVA 3EOUA 4ZVJA 5AC7A 5D05A 1FWAC 3W7PA 2E6DA 1K02A 4X61A 4H00A 3KCOA 4OUEA 2I9EA 3S1UA 1QOQA 3NJ3A 4TTUA 2CIPA 2VC7A 1UD6A 4LPCA 3U9IA 2TRSA 1EGMA 3T9PA 4GO8A 3TC6A 3WNKA 5CCZA 3S9YA 3U6WA 4Q7BA 5I09A 1IE7C 4GUHA 1QATA 3LHUA 4AH7A 4UTWC 2WNQA 2OYMA 3L7RA 2J7GA 1K1DA 5BXPA 1ZJBA 2VFEA 4BS0A 4WVXA 2C16A 2Y61A 4HT3A 3V0TA 3U5YA 3U0HA 4E8GA 2WC7A 4DLMA 4GACA 2EPMX 2DQWA 1GVIA 4ZB0A 4H7CA 4HKPA 2PD9A 2DJXA 3WDHA 1UW9A 3WD3A 4YYFA 1NOUA 3FAXA 3QPEA 4Z1AA 4HSNA 5BMXA 2WLZA 1CXKA 3DFNA 3EEGA 4B2DD 2QUUA 3ZQ9A 4GY0A 3QJAA 1YE4A 1B31A 3MSYA 2HDJA 2A7NA 2Y85A 1WUFA 2JF6A 1JGIA 2V3DA 4HN8A 2W4XA 5DCBA 5C2CA 1GHRA 5LIKX 4GRSA 4J35A 4RNFA 1ITUA 3HPZA 1OYBA 3A4WA 1T8XA 1C8XA 4HU8A 1DIKA 4AEFA 3QW4B 1XC6A 4US5A 3A5FA 3HPXA 3NZQA 2YL9A 4MZ8A 2DGAA 2HVMA 4UR9A 1FFQA 3SI9A 1R38A 4DAIA 1MNSA 1YQ2A 4FSAA 3WUGA 1FH9A 3VKCA 1FHUA 5A2AA 3OLIA 2PU0A 2PGEA 3UZYA 5KZDA 1HQTA 3BJFA 4QAIA 3VMNA 1MW3A 4JHZA 4LXFA 1WO2A 3N4FA 4MDOA 2OTDA 5T9BG 3SEPA 1DJNA 5FI8A 2QGHA 1EHAA 2HRWA 1W1ZA 5FACA 4KKXA 1E1FA 3URAA 1QRQA 3VABA 1PX3A 1FHVA 4F0MA 4EK7A 3M41A 4E2OA 1G0CA 4FF7A 4HOZA 3ENLA 3G2GA 2Z0IA 3W28A 4B3KA 3CAVA 2Y6ZA 2E09A 3GZAA 4M0XA 1EP1A 3BOLA 3N9KA 2OFJA 2X42A 4W9TA 1PE1A 4A3QA 1WOAA 2CWNA 1LF1A 4DI8A 1EJ7L 4XSLA 5CZSA 3B8WA 1AMYA 1CW2A 1RJQA 3STPA 3WQ8A 1TB3A 3W76A 1DWGM 3ANYA 5CLWA 1KLYA 4UFLA 1NJJA 3VC5A 3OVPA 1ZP4A 3LCLA 1FUYA 1XG3A 2Q8LA 3I6RA 2VGBA 4BI7A 4JKMA 2QUNA 4H6QA 1GOOA 4OQVA 3F4NA 3JR2A 3QH2A 4MNLA 4LOCA 3BLDA 1ZZMA 3CZ8A 4WOZA 2QUMA 4HK6A 3NAVA 4PB5A 1W3NA 3SBFA 3IK2A 3F4WA 1RD6A 3NEHA 3JZUA 1LG1A 1LG2A 3KCJA 4FOKA 4LJ3A 4CVWA 4LU0A 1UKQA 2CLIA 4H9VA 1U2YA 1XH1A 1XGEA 4X60A 1BF6A 1ME8A 1KTNA 2F2HA 1GOMA 3VE7A 2ACRA 1JF6A 1E1CA 3G5EA 3OW1A 1H63A 1MDRA 3LERA 5C2XA 4XZ9A 1LWJA 2WVVA 5IBXC 4AZGA 5K9XA 3N6QA 4LRTA 1XFCA 3PZNA 4FOJA 3AUOA 1KC7A 3A5VA 1BKHA 2WCSA 2DIEA 2Z7GA 2YA1A 3UXAA 3P74A 3BSMA 2PLKA 1KTCA 5JIWA 4TVDA 1VF8A 3CQKA 3TC7A 1BXCA 1D8CA 4LC6A 4PRWA 2QUVA 2WMIA 5F7UA 2R6OA 1ISXA 3PZVA 1S1PA 1W6TA 2YXXA 3OGRA 1SZNA 4IICA 1ODUA 2RAGA 3S5SA 1ICSA 2W27A 2AAMA 2CBUA 5HMDA 4C91A 2AQWA 2CNCA 4FLRA 3SUWA 2WSQA 1K4HA 3SSJA 1ZAIA 1YBQA 3V4BA 1RSCA 1VYPX 3BAXA 1PL9A 4HN4A 1GVRA 4FK9A 3QC3A 4OBRA 2VKZG 3JVAA 1Q5MA 3ALGA 3R0DA 4Q8OA 3G6LA 5CG7A 1TX0A 1W2PA 1ME9A 2ZZ7A 4PMJA 3N14A 1PZ1A 1SJBA 1CGTA 1X98A 1OIMA 1DL3A 4M3PA 3LM3A 3TTOA 4YWIA 1N8IA 1VIZA 1OY0A 4JD4A 3GIQA 4LUJA 3MU7A 1X7IA 4FI4A 4CN1A 3V18A 4G8TA 3W1XA 5D9MA 2WMGA 4O10A 3WUBA 3FLUA 2QLYA 2QR6A 1L2UA 1WPCA 2Y88A 1O60A 4O1FA 3UYCA 1UWSA 1P6WA 1H2JA 3R10A 4G9PA 1ONWA 1JXKA 5C9WA 5GNXA 1XX1A 4MJ2A 2J24A 1UD8A 2D3LA 4G7EA 5F4SA 2D69A 3F2DA 4FLQA 1FKWA 3S4TA 1BQGA 2BOEX 3KFTA 1DQUA 3NL3A 2CYGA 5C0QA 2D0FA 5IFTA 5A2BA 2J62A 3MUIA 1TWDA 2GQ9A 2CBVA 4GISA 1Q4NX 3USZA 2V5LA 5CH9A 1I6NA 3E3HA 5H91A 1UC5A 1B3XA 1KM4A 1F2JA 1VBUA 2XM2A 4FHAA 2RKXA 5KZEA 3CWOX 3TH6A 1XPYA 1LRQA 4INFA 3MZ2A 4Q4OA 2ZUSA 3TR2A 1KBLA 3BPWA 1BRLA 1HKVA 2HS8A 5HULA 4AYGA 3B8TA 3OBEA 2WPBA 4QE4A 4GKTA 1Q3NA 2J9YA 1XINA 1JQXA 2E4TA 2FZ8A 4KW2A 2FPVA 5FJPA 3MSRA 2DT3A 4WJXA 4C6JA 4WSKA 5T8GA 2PWDA 4U31A 1UZDA 3D6NA 1QPOA 5IDIA 5G4WA 4KS0A 2HQAA 3OG3A 2Q6ZA 2BODX 2XIMA 4W93A 4CNSA 2UBPC 2PC8A 3WJZA 3DESA 2DIKA 5I7GA 1P0EA 2FIQA 4XWUA 1ICQA 1G1YA 5D2WA 3UNTA 3PNUA 1TREA 1BG9A 1R47A 1OCBA 6PTDA 2FKPA 3N13A 1DE5A 2GPTA 2QIIA 4UUIA 3QYSA 3H4XA 2PD5A 1LBLA 4L6OA 2OX4A 4R9XA 2DSWA 3VIPA 4GFIA 4AEOA 4N7QA 4JN7A 3KE0A 3RX4A 1TMQA 1ZP3A 3TW9A 1UA7A 5FSDC 1K8YA 3G1DA 2P3ZA 5FA5A 1CLKA 4D6CA 3RPTA 3GNOA 1RJRA 1Q6OA 1E6XM 5D09A 3NZRA 4E2BA 3CIVA 4LUTB 5HINA 4ZBCA 1BKSA 4C6FA 2A85A 3AXXA 2A6NA 1BGGA 1ZENA 2GVYA 3SCPA 4MIMA 3NFUA 4H9MA 2VC6A 2KZHA 3QMRA 4AYSA 4HQVA 2QQ6A 2NQ9A 5D9NA 1KFWA 5C54A 4S3CA 2YZ5A 1Q66A 3ANUA 3P82A 1FXQA 3AZTA 2OZ0A 1F7BA 1KWKA 1WKYA 4JTTA 3M1ZA 1A50A 1K9DA 2FTYA 2AOSA 5AECA 4IPNB 3NM1A 4HNUA 4F9DA 2IKIA 2OCZA 3FDKA 2R1KA 1S39A 3R25A 3A64A 5CJMA 5EFDA 3DIPA 3W85A 4F66A 3W07A 4JEJA 3I65A 2XN0A 2GQ3A 1I8JA 5HNRA 3QFWA 4EWJA 3UD6A 3NPWA 4FPSA 1JDDA 2P10A 3DKLA 3LLFA 4N9DA 3UPBA 1XLLA 1E72M 3DCPA 4P7OA 4GXMA 2VJXA 3BV7A 1DHPA 1SJAA 4A8RA 2HSAA 3C2VA 2QPUA 1MEWA 4I5XA 3AMLA 3C2YA 4J40A 1W31A 3AIEA 3RPDA 3AQUA 1XM3A 3NQVA 2Z4GA 3QHMA 4DN1A 4NJHA 4G7FA 2CXGA 1EEPA 4K37A 3AYRA 4DI9A 2ZIDA 3MV01 1CB7B 1UH3A 1WZLA 3WF1A 1Q6LA 2GQAA 2W61A 4HCDA 4B91A 3OYXA 2VX6A 4OTKA 2I9UA 4GYKA 3T8LA 4JIQA 4U2ZA 4TMCA 3SRFA 5SWUA 3TFCA 1QVBA 2JKAA 3C2RA 3FAWA 5HWJA 4QISA 5E93A 5HAOA 2OR2A 4FX7A 1XI3A 4YLWA 5GJMA 1HVQA 4PUEA 1KCZA 5D2YA 3KS5A 2RDUA 2DVTA 3IV3A 3OBKA 2DW6A 3E0WA 2Y4SA 4MJMA 4AIBA 1JAEA 4HPHA 3BE7A 3FGCA 2PGFA 4ZO6A 4KBXA 2YJQA 2ZE3A 3BO9A 4UQBA 1W9PA 1QBAA 3KTCA 3WH9A 4F0LA 2EPOA 4TIMA 5JH1A 3W87A 1A3XA 4RJEA 3SM0A 1J01A 4IJRA 1KM3A 3HO8A 1XDMA 4TX8A 5F4WA 4NZFA 3UZWA 3IV8A 2IQ0A 1REQA 4UC5A 3U48A 4YHEA 3EB2A 1UCWA 3RLGA 3IUIA 2O0TA 3W1AA 5FJUA 2HNEA 3EOOA 1NTHA 4YMZA 2GGIA 7ODCA 4AHPA 1FVPA 4Q8MA 1TWSA 3AMDA 3FEQA 2QZRA 3OHIA 1YDNA 3TP4A 5EMUA 3FSTA 1KWGA 3VGHA 3THCA 5DELA 2F6KA 3W7OA 2C1HA 1U33A 4BI5A 4EF9A 3T81A 5C70A 3P8IA 2IMRA 3GNRA 4FXJA 4S3JA 4IIDA 2WHJA 1GWJA 2HZGA 4M24A 4ATLA 2B4GA 2JE8A 2CWXA 3VOHA 3EOEA 2PP0A 3TSBA 1P0BA 4W4QA 4UTWA 1A3WA 3CJPA 5BROA 2NXHA 4RZ5A 3VNKA 2R94A 3ABRA 2FHFA 3AHZA 3MO4A 1CGVA 1KBJA 4JS3A 1FWIC 1ONEA 1W5OA 4A6GA 5HR7A 3UWZA 4WD0A 3OQEA 3TEVA 3IIZA 4MWAB 3FKRA 3UR7A 1O5RA 3WLIA 1VRDA 2VZOA 3FV9A 3EX6A 2VFFA 3TZNA 1OABA 3OZOA 3QQ1A 4HK5A 2HE5A 2YGYA 3ARXA 1KR1A 4DF2A 1XG4A 1ME7A 3VINA 4RZBA 4GX8A 3B9EA 1JF5A 4AXNA 1IWAA 1LORA 5DT7A 1WUEA 3HU7A 4IXXA 5HPOA 1VLIA 5A6AA 3L2IA 3WMBA 2J7HA 4GJ1A 3C86A 3KOYA 3SR7A 5CZTA 1LOSA 4DBUA 3FIGA 4F2UA 4E5TA 4ATWA 1TIMA 4NSBA 2PDWA 4OE7A 3CO8A 1MDLA 2YDQA 3GXIA 1X1ZA 1Q6DA 3MMTA 4S3EA 2J77A 3C61A 3GLCA 1B0IA 2OO0A 2OQHA 1GQLA 3QR3A 1BSLA 1EH9A 4QFUA 1EC8A 2D0GA 3P3BA 3M5ZA 2WMIB 3GYEA 3AZSA 4PEEA 1YTDA 4NRSA 4NG3A 4O1CA 1XBZA 1X97A 2ISSA 3VDGA 1PO9A 2ABBA 3SJ3A 2J47A 1KM2A 3UWYA 3ZJ8A 2ZUNA 1CI1A 1KRCC 1Z9AA 4JN8A 2R1PA 3DDMA 1NFGA 1W8GA 3TN5A 2WSRA 3W1RA 1HKKA 3MJYA 2WQDA 4PCNA 4BJHA 3HM7A 2OOGA 3VGEA 1OJXA 1WV2A 1ZGDA 4JTQA 4K6AA 4S2BA 3TDFA 1XRSA 3QZAA 4Q8WA 4B5NA 4PUJA 1YTKA 3VGBA 3S6OA 1T96A 5HK4A 2HNHA 3DG7A 3NQGA 3WFZA 1DOSA 5A95A 5FL1A 3VNDA 3CAQA 4XZLX 3DH7A 3LTSA 5C6MA 4EX4A 1RP8A 1GK8A 1LLWA 2VQTA 1LROA 3ELFA 3VZXA 1JPKA 4WHBA 5E5CA 3G8EA 3VD3A 1EJXC 1E0VA 2QYGA 1XIIA 1ZBWA 5D37A 1B2YA 4A05A 1MNZA 2PDLA 1DIOA 1TR1A 3ARYA 2PAJA 3CV2A 4RLIA 5ABEA 4UXDA 3BVJA 2BVDA 1IT7A 2PRLA 2W66A 1E15A 3L4WA 4UQCA 3OG2A 4AY7A 3FYYA 2V5DA 6A3HA 5I3FA 1L9WA 1S5MA 2H8ZA 3NQFA 2A3HA 5KZ6A 2E9LA 4JIRA 4NL1A 5K2ZA 2J7CA 3PZQA 1TELA 3CQIA 3TE9A 4BEQA 3SRKA 3WZ0E 3OLDA 1MVYA 3N2OA 3OZPA 5FSEC 1Q6GA 2DFAA 3CL6A 1GKRA 3W27A 4MLRA 2WC4A 3TTSA 4W87A 1JQVA 2PWEA 2CPUA 4Q4PA 1FCVA 3TJ4A 4PN2A 1VB9A 1YEYA 2ZZ5A 1IF2A 3NURA 3OGVA 2J7DA 3WK2A 5K4XA 1UWUA 1I9CB 3U2ZA 1PX4A 1GTHA 2PDNA 3PBUA 4DZHA 3FHAA 3TCEA 1OSEA 1BG4A 3EX1A 1SZRA 2EF9A 3DGBA 3ABSA 2VNCA 3GR8A 4Z1BA 1AG1O 4JX4A 2VDHA 3UA3A 4DO4A 2GL5A 3DHUA 4WDWA 1TRDA 3AMKA 1TV2A 3W00A 1KRBC 1JFHA 3MI3A 4QG9A 5E0CA 5H6HA 1YMYA 5TF0A 4LGXA 4KWSA 2A7PA 2EAWA 3PULA 4XBJA 4HHHA 3NZGA 1DXFA 1K70A 2C19A 3U7VA 2V3GA 3B05A 4S3KA 3N4EA 4NU7A 1FDZA 4DBSA 3DFYA 4UIOA 3NG3A 4TV5A 1SMDA 4IXHA 1KM1A 4V15A 2REQA 5KTLA 3IIVA 3STFA 5DLCA 2ZUTA 3TK7A 3CXOA 4AD2A 3VNYA 3APTA 4KWVA 1DTUA 3L4TA 4DELA 5A8PA 4GWEA 4JFVA 1NVMA 1UD2A 4M6VA 1GQNA 1NQ6A 1KGWA 5HJYA 2VURA 1E4LA 2BSLA 3W86A 1ZQ5A 2OSYA 3L4UA 1QI2A 3QR0A 1OVDA 4AD3A 3RRXA 1BWLA 3GWQA 1W8SA 3VIOA 8CGTA 1UYQA 1OQFA 3LLXA 2P88A 1V0MA 3BG9A 3ITLA 2Z2BA 2ZWYA 3RU6A 3A9IA 3G1RA 2VVNA 4MB4A 2ZX6A 4BY3A 1GQIA 3DX5A 3B8UA 3PUDA 1H4PA 1NELA 4UMBA 2NT0A 3CMJA 4QGCA 1MXDA 4PB3A 3LXAA 2AQVA 3GAKA 4F4RA 3J7HA 3BQ6A 3ZLHA 1K9EA 2XN2A 4N4PA 5DN1A 1XDLA 1VFMA 2Z1WA 4K36A 1FDYA 1EXPA 2PSNA 2AMGA 2QMKA 4IPJA 3VZYA 4C1LA 4H83A 5AOUA 3FEMA 1DWIM 5LA0A 3P62A 3POHA 2ZC8A 3FVMA 4MPQA 2XH0A 2D0HA 3U2EA 5A6KA 3GW3A 4DJEC 1A53A 1Q8AA 4CD4A 1JGMA 3IACA 2QDEA 1OCNA 4EOUA 3VD7A 5CXPA 3QY6A 2BVTA 3DXIA 3SY8A 3CMFA 1XW8A 2ON3A 3IJ6A 2CLEA 1OK4A 1NWSA 3VD4A 1DYSA 3Q58A 3KCLA 1W17A 4X2PA 4NXKA 1OFAA 2E8YA 3N34A 3ZJ6A 3PBMA 3PR2A 2NT1A 1ELSA 4XAGA 4LUTA 3T0BA 2VOMA 2X1TA 3CTLA 3FHQA 3P61A 4F2BA 1PDYA 1ZHAA 2F6UA 3P60A 1VPXA 1XUUA 4C5YA 3NQ2A 3LSCA 4PSPA 3MHFA 3RILA 4Z2HA 4P7LA 3CL7A 4IQJA 3ZOAA 1TWIA 4I9JA 3THAA 1CXHA 2F38A 2DZTA 4PE8A 2CLHA 4DYEA 4GUIA 3QR1A 3VIMA 2OO6A 2VMFA 3JZEA 1LL7A 5I78A 4MG4A 2BBFA 2Y70A 4QSFA 3CIWA 2V38A 4CCZA 5HQLA 1GVSA 3T0CA 4HU4A 3TW7A 5LIXX 2ZRYA 4E8CA 1RXOB 1OC7A 3S3GA 4NYUA 4ADSA 5ABTA 1B90A 1ITQA 1FWRA 1AD4A 1Q6QA 2KAUC 2XIQA 4O8AA 1FCBA 4PR4A 3ATZA 3EWUA 1WBJA 2V3FA 2A3AA 5FF0A 1VFLA 1G94A 2B7PA 3NUKA 1Y0EA 3OJGA 5LHEA 4WJEA 2FMOA 2RGLA 2V5BA 3EDKA 5D8ZA 4ZXLA 4HNVA 4NI3A 3HFTA 4A8IA 1M7OA 1LT7A 5DCEA 1EJVC 2D2JA 2YPIA 4ZXOA 2QCHA 5IBXA 3VNLA 4C6QA 4D1IA 4QBXA 2I14A 4O12A 3ZXWA 5A8OA 4GX9A 1YDVA 1U83A 3WLOA 2AGTA 2ZZ4A 3AMCA 1AH3A 2BNJA 4B5XA 4K7YA 1IT0A 4GQRA 4H01A 3GFYA 3CUJA 1AQMA 2XGZA 3Q94A 2EG8A 3SGGA 4S3GA 3ITTA 3UZ5A 1SR9A 4PUMA 3TTQA 4AC1X 3ANVA 4EPKA 1JCYA 2WJDA 4PUUA 1YHTA 3GG7A 3BTNA 1H5VA 4YTTA 3N18A 2PDCA 2A21A 2B31A 5RUBA 2OSWA 1XIMA 2ALDA 3V75A 1AJ0A 4HMCA 1IEQA 3H4WA 4IIEA 4JBRA 3BURA 3SCNA 1C93A 3UWVA 5D02A 1QUMA 1O5KA 3LYEA 2C3ZA 1PBGA 2CW6A 3H2MA 2WYSA 1I2OA 1OX4B 1JCTA 4HA1A 4IIGA 1TJPA 2OLHA 1EB3A 2WBKA 4KRTA 1AL7A 1THFD 3NWRA 1EWEA 1WXJA 3GXTA 4LBSA 1E9YB 1TTPA 3WD2A 1GJPA 4PUNA 1ZCCA 2HPMA 1V03A 5C7VA 2PDIA 5C9RA 1H41A 5CSSA 1O66A 3H7RA 2ZUMA 3NSXA 3AYSA 4C7GA 3FX4A 1EF2A 3SUTA 4U4MA 1CPUA 3ABXA 3DU0A 2IPGA 2QCFA 2WVVB 2REQB 4ZOAA 4PULA 3ZLFA 3B9NA 1VPQA 2WSPA 3CWHA 3QRHA 5AYXA 5HR6A 3L2LA 4LAZA 4OUIA 4JAWA 1YYAA 4WSJA 1E4IA 5ENLA 5HA7A 4D71A 3FA5A 4QG8A 3RM8A 1J2WA 3KUMA 4ICMA 5CEWA 2QCCA 3WEZA 4MHBA 1K8ZA 1MQPA 2HMCA 2YL5A 2O56A 2FPYA 2VCAA 3QM3A 2DT1A 1RBAA 3G18A 3DI0A 1WP6A 4NRRA 4V2XA 3SW6A 3WMLA 3ZJ7A 5AY7A 4ZE4A 4IMFA 3AZRA 3WK3A 1EJRC 3EDDA 5J04A 1EXBA 1FCQA 2ZZ6A 2Z25A 1LP6A 4D6FA 1E70M 1XCWA 4IF2A 1D3HA 1E6PA 1A5MC 3QHNA 1HFBA 1FFRA 3MKKA 4ZQNA 2WNNA 2JALA 1ICPA 5BU9A 2I17A 5A8NA 2P8CA 2O55A 2W79A 3U4AA 3EWXA 3RMJA 5LNWA 5EGRA 4QNEA 1NF0A 2PDJA 1P5BA 2CBIA 3KVMA 3ZM8A 3IK4A 9XIAA 1PIFA 1XLJA 1PZ2A 4HMDA 4IIHA 4JTHA 4Z2IA 1EO5A 1R6WA 1E6RA 1MMFA 2YCLB 5EBUA 3I3EA 4AAJA 5REQA 2CETA 5LIUX 1ZLPA 4GJIA 1GVEA 3GDTA 4M6UA 3TJIA 2QULA 1Q8JA 3GIYA 3SQSA 3LXBA 2X0YA 2Y5SA 1CENA 1QR7A 1OINA 5D2XA 2FLIA 7TAAA 1SFLA 2OYLA 4H8HA 4LVGA 2NX3A 5HJXA 1UR4A 1S38A 2JEPA 1V3LA 4RE4A 5FEWA 3WL0A 3KS6A 4CNUA 3V36A 4BZYA 4GZJA 1ECQA 4BQ5A 2QCDA 3L4ZA 1UBSA 3H24A 1JPMA 4R9OA 4O19A 2POTA 1OYAA 3QTPA 3CZJA 4ZODA 1HO1A 1TPEA 1EIXA 1TE1A 3M0IA 2FZBA 4YNGA 2AKZA 3PK7A 4B4FA 1RJPA 1BSIA 3VIHA 2A6LA 3R11A 3IJIA 1HJUA 1JD9A 3BXWA 2R91A 2V0TA 2GJPA 4TUFA 3JW7A 1ISVA 1IYXA 2HVNA 1R7OA 3PF3A 2WZMA 2CU0A 4OT7A 2NW0A 1OFBA 4AIUA 4XZIA 1KBBA 1DTNA 3WQFA 5HWMA 4HD5A 4KCTA 7CGTA 3INPA 6TIMA 1J0KA 1E5JA 1I60A 1N2VA 4NXSA 5E09A 1A4MA 4XD3A 1B3OA 5AYZA 4LTSA 2PLJA 3V1HA 3OEXA 2X16A 3AMGA 4PC8A 4LQ1A 3T07A 4KERA 1TPC1 2VDGA 4XD5A 3FNDA 3VAVA 1CEOA 2OG9A 5LHFA 4CU6A 1TV4A 1VD6A 1PTDA 1BVNP 3U4FA 1YX1A 3TTEA 1OT1A 1KRAC 4AD5A 3F2CA 3UJFA 4LUYA 5A6LA 3B8DA 4DBWA 1WDSA 1A47A 2FVKA 2CKSA 4J27A 3H2NA 2H3DA 4QAWA 3DKJA 3ZMRA 3V7PA 2JGQA 4NKCA 3W2JA 3TONA 4XD6A 3WENA 1G5AA 2QEZA 2XFYA 3RITA 1CLVA 4TO8A 3SIZA 3XIMA 3WDRA 3MI2A 2QJMA 4MYXA 3RLUA 1ZBCA 2PRMA 3G24A 3GXPA 3BV4A 3AHTA 4A22A 4ENLA 1H60A 2A5HA 1UR8A 3M64A 4O4VA 3SCOA 3UJRA 5AVHA 5TIMA 1DPMA 3CGTA 2I56A 2ALRA 3PJXA 4MFEA 1PDZA 3W7HA 4OOZA 4UQEA 1DJGA 1DEDA 2WK2A 2GWNA 3LX9A 1KFJA 1TIWA 3OBAA 1YDYA 1AZ2A 3FJ6A 1A0CA 1Q63A 1EUNA 3C2OA 3I10A 2Y1HA 3WQVA 1E6SM 2TPSA 1Q65A 4EIVA 1V6YA 3LTPA 1GHSA 1B3VA 1LOQA 4DAFA 1VGAA 3EMQA 1FCUA 4PMDA 2EG6A 1IGSA 1QHPA 5I3KA 4CCCA 2WCAA 3O7UA 3VIKA 3N9SA 1OIFA 3IGHX 2J8FA 4Y96A 1TCMA 1P7TB 1ZAHA 1P4CA 3L5MA 4LVBA 3BW4A 3DYMA 5FF3A 2UZ9A 1TZ9A 3TN4A 2BGQA 3GHUA 1XLFA 2DSUA 1PCKA 2QHAA 3CK5A 3FYPA 2CHRA 3NVTA 4GQGA 3TX9A 4O50A 5FEXA 1H3GA 2GK1B 2IQDA 1PWMA 1O94A 2XVNA 4FIRA 3W75A 2B7QA 7XIMA 3BH4A 4MAZA 4WDTA 1QXLA 2ODOA 1BD0A 2PTYA 3KTXA 2RJGA 1N55A 5C9XA 1TPDA 3DHFA 4REQA 3W88A 4EWND 5G5IA 3LM7A 4S3AA 4O14A 3NO3A 1J8VA 2NUYA 3T55A 2GWGA 1LRNA 3B97A 1V7YA 4FZIA 1H1ZA 3NXFA 1NDZA 3VMPA 3GTXA 4A3HA 1MUCA 1X38A 3ARPA 3SN0A 4GLEA 2XH2A 1C7SA 3QZ6A 4C6PA 4QLJA 1YPIA 4CEUC 4EANA 5FAGA 3APYA 5AKQA 1OHLA 1HTIA 5AHFA 3XINA 3WELA 3EDFA 3W7KA 2DT2A 3PWAA 1BYAA 2EG7A 2XG9A 1OFOA 3ITYA 4HTYA 2J13A 2OODA 4RNHA 3I4EA 4ORMA 1H7WA 5LZLA 5FL0A 1UPPA 4NZ1A 4HGXA 5LNVA 1IWBA 1E4MM 2WSYA 3AXHA 4LWWA 1DJIA 5DFAA 4AU0A 3HQPA 2QCMA 4PMOA 4DJFD 4AVOA 1V77A 2QAFA 3NGFA 1MQRA 4MY1A 2DW7A 2HXUA 3C56A 3TLQA 1W1IE 1Z44A 1J96A 3MCNA 3G1VA 4P8XA 3IPWA 2ZQ0A 1QOPA 4CLMA 3KP0A 3KBMA 5I3JA 1YDOA 3AS3A 2OZ3A 2XIOA 1LQAA 5CBIA 1R2RA 1IXOA 4QEHA 4LYKA 1NSJA 5I77A 4PCFA 1EZ2A 2P76A 2XZ7A 1RCXB 2V2HA 3N11A 2V68A 5TQLA 2BS9A 3K8LA 2PE4A 3C2FA 2R82A 5B7ZA 3PUOA 3VGDA 5BXSA 1NEYA 3MVIA 3W22A 6TAAA 4WXZA 4DIAA 4RNJA 3OZYA 8XIMA 2RJHA 4JTEA 4KIEA 3HG5A 4UCFA 5FEZA 4W5UA 4QE1A 4KIRA 1JJKA 4C60A 1J0IA 3GSMA 4M8UA 4M1RA 4WLCA 5DEZA 3TSDA 3P67A 3T78A 2C13A 3KLLA 1H11A 3GU1A 3TQVA 5CSUA 3ZIZA 2WHKA 1NDWA 2XN1A 3NPVA 3FJ4A 3ZZ1A 3U7BA 2C0HA 3GTFA 4M82A 1VAHA 3ID7A 3PG9A 3AIBA 4DJEA 2DPEA 4JTDA 2ZA2A 1WAWA 1EZWA 3ARSA 3NQCA 4US6A 1XD1A 4C1NB 5B7YA 1SR0A 2FH6A 3S42A 3UNDA 1XD0A 4NAFB 1LUCB 3T2QA 3KWSA 4NUWA 3K5XA 3RCYA 3R8RA 2OWXA 1V6TA 3SN4A 4IJBA 1O68A 4UNLA 3VK5A 5CZJA 3T8QA 3GK0A 4GGHA 3LGGA 3M46A 1EOMA 3MMUA 4P7RA 1R3VA 4IH3A 5I24A 3W84A 4RPPA 3LI1A 3PZIA 4GK8A 1EA9C 1UWRA 3A13A 5E6ZA 3BLFA 1DJZA 1ZPTA 4FNPA 1FH7A 1F74A 3GKFA 1QHOA 3UG8A 2VRKA 1J6PA 2WZHA 5AB3A 4JKLA 3LBMA 4JL1A 4DZIA 3PZUA 1S5TA 1XGDA 3MANA 3MP4A 1XC4A 2OELA 4QIUA 3NDOA 3GHSA 5JBFA 2QF8A 2OEKA 2ZXQA 1RH9A 1OZMA 2VP8A 4AF0B 3N2MA 3THDA 1V6UA 4IGHA 2FVLA 3LCHA 3CUZA 1B5TA 2DUXA 1OZQA 3RR4A 2EJAA 3IAPA 4YCPA 3AYVA 3W2KA 1T5AA 3W7MA 3TQPA 5G2HA 1QNQA 1E6NA 2R9RA 5C9ZA 3MKCA 1F3EA 3STGA 5E9AA 3G1XA 2AGKA 3WLKX 2NQ5A 1H51A 4TQTA 2H90A 1GG1A 5GJNA 1SW0A 9RUBA 4LFYA 1FA2A 4PTDA 4AWTA 4EVZA 3HBLA 1JULA 4PMNA 1ZSXA 1GOQA 1MSSA 2NSXA 3URBA 3MVTA 2X09A 3NL2A 2RHGA 2E25A 4FNUA 2J9ZA 2XWEA 2HBXA 3CUXA 4B5VA 4PBGA 3WK0A 4Q6XA 4MY8A 5L9FA 3VCRA 2H6RA 1SFJA 4PSRA 3G3DA 4K68A 2PUZA 3CZGA 1W3KA 3SGUA 4YTSA 3GDBA 4A21A 4PCTA 3BC9A 3LXCA 1B3YA 5H8PA 4CN6A 3TA9A 5PTDA 4CD7A 5HDRA 3VIGA 4AZCB 8A3HA 3EB4A 4XZMX 1GT8A 3T40A 3PZMA 3QV6A 1OEPA 4H3DA 4QRNA 2AL2B 3S9ZA 3HJEA 1TV3A 1ENUA 1GKPA 5L6UA 4DM2A 3CBWA 4CEXC 3WQPA 2DU2A 4O11A 4ADUA 4LYPA 3E2QA 4IG2A 2I7GA 3DC8A 5LGZA 1RVGA 3TWBA 2AL1A 1WZMA 2DT0A 2VENA 1TJ2A 1LRTA 4EPEC 3W7RA 3GM8A 5GQBA 3JU2A 1RALA 3VNJA 3TV8A 2NUXA 2D20A 3NYZA 2RUSA 4LBUA 1NM9A 4AIEA 4EACA 2CEQA 3CNYA 3H6OA 2CHOA 1YLVA 1BYDA 1NWTA 4JTFA 1HJQA 2DZBA 3KBJA 2JEQA 3DHDA 3OLEA 3OPSA 3GDKA 1UP2A 4O8RA 3G1YA 1NIUA 3BAKA 4QR6A 1XYCA 3UPMA 2YCLA 4KWWA 3RU8X 5AHLA 4ZQRA 3VYLA 3C52A 1H62A 3H4GA 2E3ZA 3F5LA 3A3HA 3K4DA 3CT7A 3R2GA 4JTJA 2BGSA 4Q8PA 1EL3A 4WK9A 5CPQA 4UMCA 4IPLA 4ATDA 2AQOA 1GPFA 1X1NA 4NNBA 5J5RA 1LUCA 4NAFA 4WIWA 4J3UA 4S39A 1QK2A 4N0RA 3LHYA 3Q4DA 2WWCA 4ZQMA 2ZCGA 4GZIA 4AVNA 1AL8A 5HMEA 3DFSA 3NDYA 2B7NA 3W23A 1SZFA 3OP2A 5M3WA 4B3LA 3MW7A 3TXVA 3ICJA 4MWAD 4AZ5A 5I0DA 2QDDA 4FA3A 4LRSA 3GFXA 2ZE0A 3NM3A 3WQ6A 4J7RA 2YB4A 1P0NA 4AQLA 1UZHA 1QI5A 2FHCA 3ZWSA 5DT5A 5G2WA 2INZA 1MUMA 4Y2WA 4Q4SA 1H50A 3NNTA 3GVRA 6REQB 3QW3A 4PMYA 2VEKA 3PPFA 1QPQA 4W8AA 1UHVA 2E77A 1VS1A 2XIJA 3BLPX 3BJTA 3WNLA 3I6EA 3L68A 3VE9A 2VHLA 3AUJA 1WB0A 4IPIA 9XIMA 3VOIA 4KGLA 2GJRA 2NXGA 1LLOA 3UY8A 2XVKA 4JTIA 3T6CA 2NLIA 3W6MA 4GINA 3IGUA 4M56A 2IKGA 4ACZA 3CLMA 4HIBA 3P8JA 3K8KA 4I9MA 2OX1A 2XPKA 1WKDA 4P61A 1RPXA 2FVMA 3R43A 4EKJA 1IQ8A 5GNZA 1WKEA 3VCCA 1FQ0A 5DX7A 5DY2A 1VHCA 3WMSA 4KRUA 1V79A 1E9LA 3QYQA 4I9AA 4IJCA 2NV1A 3TR9A 2YYUA 3ZFHA 4JIPA 1R3WA 1A5KC 3MUY1 4TTGA 3CPGA 2Y62A 3DFTA 4U3CA 5DMMA 2ZRVA 2VD9A 1JZ6A 3WJWA 1QI3A 1IIHA 2YXGA 3K4WA 2GGEA 5U7SA 5HANA 1KQYA 1TPB1 1LL4A 3W7GA 1UKSA 4GNJA 5GPRA 5DRIA 3VNZA 1EP3A 5BMWA 2FH8A 2G4FA 3QVQA 5BNKA 2PI6A 1IXQA 1OGBA 4B5UA 4BCEA 4DB7A 3VCNA 4JIIX 1A5CA 1CB2A 1C8QA 4WDUA 1UG6A 4GI9A 4ZO8A 1NARA 3LPGA 1NOFA 2ABAA 2WZEA 1WNOA 3CZEA 4U10A 1RZMA 3N25A 5F1VA 4N02A 3W2NA 3VD9A 3D3AA 5E0FA 3MWCA 3P0WA 5IFPA 1Z7AA 3DN5A 3EBVA 1L6FA 2QDGA 1OF6A 1PHQA 4R7WA 1U30A 5I06A 2ZFAA 3B9AA 2HROA 4JYFA 1V0NA 3B04A 1MW1A 3W37A 1FWNA 3PJUA 1D7KA 4ZENA 5FEPA 3VFCA 4D6EA 4HYWA 4TU1A 3WQ4A 4DWSC 2PB1A 1I2PA 1UBPC 1EJSC 2HWGA 1SJDA 1S2TA 1R8LA 3M0HA 4FAMA 1U22A 1W5PA 1JUEA 4RK8A 1GOXA 4QS5A 1JUBA 2BGNE 4HZ7A 1GZGA 2PWUA 3M9YA 1TA3A 1XICA 5AYBA 3CL8A 2YIHA 5AN7A 3NVDA 1I4NA 1W32A 2EPNA 4U5IA 5EMLA 1M03A 5E6YA 3M7WA 4QQ3A 3RYSA 3DZ1A 4XV0A 3N2BA 1PSCA 2EHHA 1UWAA 3OA3A 1H49A 1PVNA 5I02A 3QBUA 3K1DA 4GYPC 5FESA 1R5YA 3OTRA 1KFCA 4KFOA 3UCDA 2EPLX 3F1QA 3RXZA 2BLEA 4FNRA 2GOKA 2ZTKA 3AIWA 2C71A 2JFEX 3GVWA 5K9CA 1SU5A 2P0IA 1VZWA 3AWNA 1TPFA 4TVCA 1M68A 1UR3M 3ABOA 3MMWA 1AW1A 3RX3A 4W7VA 2FMNA 3WUEA 2E67A 3HV9A 3VILA 5EBAA 1Q7QA 4XZBA 7PTDA 4NZ4A 1UWTA 4LV4A 3DOPA 1Z8AA 1VQTA 3UEQA 4JEQA 2WC3A 1G67A 1FWFC 3UZJA 1UJPA 3BGGA 5EMKA 4E6MA 1RLDA 4ZSTA 1TCDA 3I4KA 1UUMA 4REQB 2C1IA 3WQGA 2BP1A 4CGTA 5IDZA 2J4GA 2XSAA 3W73A 5JMUA 3SFWA 4MNMA 2BMBA 1R9ZA 1E51A 2G3IA 3RDKA 2DVUA 4Z1CA 1J12A 2WBGA 1EWDA 3B40A 4IFOA 1N8WA 4R3UA 4XZNX 3TMLA 1SO6A 3VO0A 3WY1A 3VZZA 1RCOB 2Q09A 8XIAA 1T7LA 3W83A 4BKNA 1XYBA 4D6GA 3GB6A 1PS9A 2QV5A 2J88A 4H2HA 4LY4A 1B9BA 3CUHA 1WCGA 4JY8A 4IFRA 5DRCA 5E70A 3GH5A 2NVAA 4KGJA 4ZO9A 1P0KA 2YR1A 4C1NA 2BB0A 3O06A 3BMXA 5F2LA 2ZA1A 5BCAA 3C2EA 1W5MA 1GVYA 3H53A 1I1WA 1MWOA 3H22A 5JQ9A 4O54A 2O4QA 4TXEA 1YPFA 1H7RA 3EA1A 1BQCA 3B06A 1JCMP 4H6RA 4P2VA 4D6JA 4NX5A 1EYWA 3CZLA 2NQZA 3S1WA 5AHMA 2J74A 5BRQA 2YW4A 5K4ZA 4K1GA 4EF8A 4O0ZA 3T2PA 4ERAA 4PUWA 3LCXA 4QEEA 3LG3A 2PZNA 1W54A 1OCQA 1V7AA 4MUPA 2Z00A 3EWBX 3NZ1A 1QWKA 4K39A 1VFTA 1OFEA 1Q13A 3UVAA 1IHIA 1FWDC 5BRBA 3H2EA 3SADA 3VVGA 4UFIA 3ZT6A 3CQHA 4W85A 1E71M 4XIMA 1CXEA 4B3ZA 4Z0JA 4JTLA 1ITXA 1PWLA 4J3SA 1WDWA 3RNDA 1M6JA 2OT0A 3P14A 2FTWA 1P1XA 5A94A 2FTPA 3DC0A 4B9YA 3WFLA 4US5D 3LMYA 4J3VA 2CKRA 2G3NA 2OMAA 4KETA 3VOFA 1E3ZA 1YNQA 4DWDA 4YXGA 5KETA 3ECQA 4GI4A 5HJLA 1M04A 4JTRA 1J6OA 1TA3B 1TX2A 3VIFA 4L6DA 4WY0F 2GVGA 2IXVA 4ZCWA 3UYIA 2LLEA 2V6AA 1JCLA 5MHBA 2O7QA 1V3HA 4QCEA 4FLOA 3KL5A 1XSJA 1ZALA 4I5RA 1EGVA 4V28A 1AJZA 1ONXA 3L67A 3F4DA 3OB8A 4GQ0A 4LUSA 1DJWA 3HB9A 3N6JA 3GVGA 4F8XA 1KFKA 3IWPA 1A49A 1PAMA 3T05A 3WEOA 4N4QA 5DMLA 4F9JA 1NP2A 2ZXAA 3QV9A 4GZEA 4UCGA 2V3EA 3LBOA 4KCVA 3BUVA 4MNJA 3NGJA 2MUCA 1J5TA 3P84A 4ZB2A 4FF5A 4NJKA 4I7WA 4DQWA 1UWIA 2J9XA 4U5KA 1QNOA 2ZADA 4HP5A 3FA3A 1IEWA 2TSYA 3KEHA 2CZ5A 3WLPA 4JX6A 4PL1A 3KVJA 5DY3A 2QXWA 3NQEA 2VRJA 4OV4A 3O6AA 2Z29A 2C6QA 2DZXA 3NOEA 4GVFA 1MRAA 1OWQA 1FWGC 1XYZA 4FR1A 3BWWA 5AC6A 3H12A 3M5VA 2DZSA 3EPMA 4E38A 4HPJA 1GZJA 4GBUA 5EB8A 1TUXA 3DUGA 3LQLA 3AICA 3R58A 4IIBA 1W37A 3MA8A 5HOSA 2X2YA 4PEKA 2FGZA 1GJWA 1KFEA 4W84A 1TV8A 3UR5A 1OG0A 1GEHA 2WJEA 1OYCA 4H6KA 1P1MA 4OIFA 3G3MA 1XLDA 4TMBA 4WY0B 4RDWA 2ZRWA 5CSYA 3BG3A 3K2GA 4KH2A 1Y5VA 4PFHA 4F0SA 5CGTA 3C3UA 2DV0A 1I1XA 3MYOA 1QW8A 3ES7A 2PWGA 2JBMA 4F0HA 3IS4A 4PFMA 3RJXA 3MBDA 2G5WA 2PGWA 2HVOA 3OO2A 5B80A 2QVNA 5CC3A 4LW7A 3IEBA 3O8AA 1SO3A 2GUYA 2Q3OA 4EXBA 4UTLA 4WUIA 2ZBTA 4F48A 3HTWA 3CH0A 3UU0A 2Y8VA 3CIXA 4HSOA 4L4OA 2Q02A 1KFBA 3DEQA 2A3LA 1ECEA 3LNPA 3WX7A 1RPKA 3EWYA 4RNIA 1QCWA 3V0SA 1RR2A 3WJXA 3NOYA 2IW0A 1CGXA 4O4WA 1I0BA 2A4AA 1BHGA 4Q32A 2J79A 3CHVA 3S5OA 4HPGA 2A7RA 3M0KA 1OG6A 1EJTC 1VEPA 2V5CA 3RHGA 1ODZA 2Y5JA 2X7WA 1PJ9A 5JIPA 5DANA 4GBDA 5KMYA 3W7IA 4AF0A 2AAAA 3FYOA 1SZEA 3HFYA 2DZUA 3SCRA 3VOJA 4PCPA 2GK1A 1EDGA 1DWJM 2GVLA 3ZVIA 1NH6A 3E2SA 4XK2A 3SCSA 5HATA 3LRKA 1XWYA 3EX2A 3IJ9A 3WLNA 4TX9A 3TZFA 4I6KA 1A5OC 3FOKA 4GYPA 1DBTA 3TYZA 3UWWA 2ZZ1A 3POCA 3G6MA 2HXTA 1XIJA 3GBDA 3HGSA 1G4SA 3PTKA 5FJIA 3P81A 5DBTA 2UY5A 1L6GA 1EQPA 1VIWA 1DJYA 5FF2A 3M0LA 1FY6A 4D8LA 3KTSA 1V3MA 4XKMA 4BWLC 4Z0SA 4DYJA 5GVJA 1HKJA 1EQCA 5KEZA 3H7UA 1M01A 3WQCA 1XGZA 4D8AA 3H2AA 4AW7A 3UA4A 2Y24A 3UT0A 1YXDA 4GZ7A 4YWSA 2D73A 3TNBA 1QFEA 4WR3A 4HOXA 2W6RA 1B4KA 2A2IA 4GYJA 4U33A 2FZNA 3Q65A 3FGCB 3ZT5A 4DZ5A 1K6WA 1Z41A 4ZFCA 1EPVA 5FD0A 4IGNA 1F8IA 2Y7GA 1TTIA 3BLKA 4RZ6A 2D2OA 2YKKA 4PCSA 3CV7A 3GHTA 3MDUA 1XLKA 1J4EA 3CEPA 1WOBA 1ZBKA 4RE2A 3ERPA 1XSKA 1TJ1A 1F8MA 3W70A 4O16A 4K8HA 4MYAA 5A2CA 5MF5A 3NPXA 1MFUA 4UFJA 5I3DA 3T4CA 4FXFA 4PMZA 4CNNA 5CJNA 3GO2A 3AXIA 4Z42C 2EEXA 2RH9A 2GGGA 4MMWA 2V5JA 4YTQA 3P5ZA 4UOQA 3W2MA 2G50A 4O0QA 4Y9OA 5EMMA 2GOUA 1CECA 2XU2A 3SUUA 3GVQA 3LZ3A 3KOXA 4IP7A 5C7HA 3W71A 5CPNA 3P80A 4P8WA 3W6YA 1DIDA 4ZOCA 4HYVA 3BG5A 3EKLA 3UERA 1ADOA 4HOWA 3EOLA 1C9WA 1BYBA 1BYCA 1VFUA 1DXIA 1M5WA 3R89A 2XM1A 1CXIA 2IQTA 4PRTA 4CVUA 2FZMA 2IKJA 2Z6IA 1KCLA 4DEFA 3P0XA 1FDJA 2BV9A 3RN6A 3DBNA 1VFSA 1BXNA 3D46A 1PTGA 4C6DA 3OODA 4UOZA 4X3ZA 4GMEA 3USBA 3QPYA 3MZNA 6XIMA 5I3IA 1HP4A 1PEZA 2VEGA 3EPOA 4O13A 1QMLA 2Z2UA 1RQHA 3PZTA 3R0KA 5EKYA 3GH7A 4W5ZA 4GCAA 3W1UA 1PX8A 1TWWA 4QG6A 3QEZA 3YPIA 3U8GA 3W7EA 4Q8VA 1EO7A 2RDWA 1F4HA 2XINA 3URQA 4ZL1A 2WJFA 4JHOA 6XIAA 4PBFA 1W9XA 4WXYA 1QI0A 4B2DA 1EBHA 2E7FA 4NZ5A 3HG3A 3IUDA 4NNAA 4PA8A 3M5XA 2ACQA 1XLCA 2V9DA 3A9BA 1GKQA 1MFVA 4ZMGA 3DG3A 1NWUA 1XIBA 3QSRA 5JXQA 1D7FA 3I7RA 1L8PA 4J5NA 2NZLA 4IMCA 1TV7A 3WQ5A 2X1UA 1Z42A 5M1TA 2BOGX 1WDPA 2ZC1A 2R1NA 3EEZA 3IIXA 4IM4A 2DUZA 4RL3A 2YCEA 1H7NA 4Q33A 4AMAA 1G7UA 1LQ0A 1OB0A 4QTGA 1E9ZB 2YL6A 3UFYA 2E1DA