4NX0A

Crystal structure of abp-wt, a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
430
structure length
430
Chain Sequence
SMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVDDIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
total genus 151
structure length 430
sequence length 430
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nx0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx0A01
3SY5A 3L0GA 1QDSA 2BX7A 3MJYA 3M47A 1SUXA 4BA0A 5I5RA 1GOXA 1Q6LA 3UZ5A 3P81A 4NJIA 2B4GA 5CPMA 4GO8A 1Z32X 4NXKA 3M7WA 3P7YA 1J2WA 1JIBA 2EGZA 2ZXAA 4IMEA 4BR1A 1E3XA 1HL9A 1B3OA 4WJEA 1VLWA 2YGYA 3I65A 5EKYA 5J5RA 1AK5A 1QO2A 2ABAA 3E49A 2GJRA 4CKQA 3NL3A 2F84A 1TYGA 2FE0A 1MW1A 1XCXA 1OYAA 3MYPA 5D37A 5AYYA 3O1NA 3C2VA 3UZJA 5FI8A 1E3ZA 1WPCA 2D0FA 2ZICA 1TPC1 3LCIA 3GTNA 1NEYA 1V3LA 2BWGA 1QOPA 2QV4A 4LRSA 1JCLA 3W71A 1Q6QA 3IJ7A 3L9CA 1DHKA 1JD9A 4O4WA 2ZRXA 1YDNA 2H3BA 4XUGA 3HGSA 4Z1AA 1CXHA 4OIFA 1A53A 1FWRA 2C18A 2UV8G 1XBYA 3L4XA 5U4NA 2BY3A 3G22A 1WZKA 4K6AA 1FQ0A 1OGSA 3BMWA 3CPRA 4UTWA 1ML1A 1JQVA 4JCMA 4GUFA 1TV5A 2Y2WA 2E6AA 3LRKA 3DC0A 3MWAA 3CZEA 5DXXA 4O57A 2F1AA 3RK8A 3IIVA 4AIEA 2P0OA 4ORIA 4AH7A 3M5XA 1XC4A 4GKLA 3CB8A 3LPPA 3SI9A 4UTMA 5A2BA 4XZ9A 2CZDA 4DXVA 5I23A 1Q6RA 3EWWA 1FCUA 1OFRA 5AHLA 3JS3A 1QI4A 3FA5A 3B4UA 3WDJA 4A29A 3BG3A 3W2UA 1KFKA 4UFMA 4DO4A 3BAIA 1E51A 1BSIA 1TTJA 2H90A 2JK2A 3NQCA 1KTBA 4HKPA 4M7SA 5HWMA 1XD0A 1N7KA 3E0IA 1G5AA 2F7FA 3GDKA 4YLWA 1AMKA 4UUIA 3ZWTA 3D4YA 1MO0A 1KGUA 4GI9A 4LVFA 1F05A 2EEXA 4GI6A 2PRHA 5EY5A 1SW3A 3W1PA 3WJWA 1F2JA 2FIQA 3GKAA 1ZJBA 2VFGA 3S1WA 4HN4A 1CIUA 4EF9A 2JGQA 1M7XA 3GYEA 3MI2A 3P84A 2WPGA 1SW7A 4O16A 1EA0A 1WXJA 2VENA 3LCFA 1A5CA 1ALDA 1G4SA 3VMOA 3MP3A 4HPXA 1ZAHA 3S5NA 4UXDA 4MOZA 3II1A 4RZ5A 2OMAA 4N2YA 1PCKA 1PIGA 4TVUA 4UTIA 2PRMA 1KBJA 3W1QA 3QGVA 3HOJA 5LHFA 2ZX7A 2V5BA 1EP1A 1HL2A 1YDVA 1DHPA 3PM6A 5HULA 3LHWA 3NQGA 3CIWA 1UD5A 3HG3A 5L6UA 1LWJA 3DHFA 3W72A 1O4UA 4TR9A 4UFHA 3W7IA 5I3FA 3NM3A 2WCGA 2ZUTA 5A8GA 3QRHA 3L65A 2VT0A 1X1OA 4AWTA 3TW7A 1L6WA 3W7JA 5DCEA 5MHBA 3UG5A 3NO5A 1JUBA 1H1ZA 1HUVA 3SECA 4XKYA 3WENA 1W37A 1FUYA 4RR4A 1CXIA 1IXQA 3W7RA 2EO7A 3W85A 2V5LA 2E9BA 2ZWYA 3LXBA 3DFOA 1JCXA 3O8AA 4CN1A 2VXNA 3LCWA 1F74A 1C29A 4O50A 2GVJA 3VFLA 3LI0A 3WFZA 3G24A 2BXVA 3L4ZA 4GI8A 2WKJA 2VUYA 4LS2A 3C0JA 3NXFA 1W0MA 4IXXA 4NUWA 1NFBA 2ZRVA 1W3TA 4E0CA 2YFNA 3W7QA 3LCGA 3S42A 4LVGA 3VNZA 3STEA 3WDHA 3VSTA 1R2SA 1KCLA 4BI6A 1JRCA 4BI7A 1UA7A 1OFEA 3EWZA 3RLUA 3C6CA 4HOZA 3SGUA 4JTJA 4N4QA 3ZQ9A 1QOQA 2X16A 3WK0A 2OYMA 1Y0EA 5CPNA 3OBKA 4R53A 3AXIA 3KE0A 3OHIA 2NX3A 4TO8A 4CQ8A 3S8HA 1BWKA 4K7VA 3M6YA 4QISA 1ODUA 3TAKA 4WLCA 3BG9A 4UTTA 1EH9A 3GXIA 4OJYA 4CQ9A 3CZSA 1KM3A 2CLKA 4GXMA 2J6XA 4JTHA 3TUUA 3TE9A 2YXGA 4QIUA 3DX3A 2CU0A 1MEIA 1ZJAA 1ZAJA 4OWGA 1K3UA 2QPSA 2Q3RA 1EUAA 4HNNA 1HTIA 2Z1BA 3ABRA 4LVBA 3NQMA 1LM1A 4PCSA 1K7EA 1U83A 3RF9A 3ZSTA 3UCQA 1H7XA 4GNJA 3BPWA 1TPDA 4OE7A 4N9EA 3M1ZA 3STFA 4NXSA 2QDGA 1FDYA 2G97A 4UTHA 2BHUA 1QPQA 3HQ1A 1JCJA 1KFLA 1JXJA 2J9YA 2WVTA 1LOQA 2CLLA 3OLEA 2XVGA 1TIMA 2XVLA 1QI3A 4AMXA 4CCCA 3KRSA 3PSVA 4YCPA 3HG5A 4O10A 2BTMA 4CNOA 3ZOAA 4Z08A 3NPWA 2ZA1A 2R14A 3PG9A 2C1HA 4UFJA 4U33A 3WNNA 5G4WA 4PEEA 4UTJA 2YCEA 5BMWA 1EWEA 4MPQA 3W88A 3BW3A 3S0CA 4LS0A 1JUKA 5E93A 1JI1A 1VAHA 2NV2A 3ABOA 1QWGA 1H63A 1ADOA 1KBIA 4J7RA 2RDTA 4PEKA 2QCEA 2X1TA 4RCXA 3GNNA 4FLQA 3L0NA 3HGRA 4N02A 1LBLA 1KM1A 3IIOA 4M6VA 4WSKA 3CTTA 2LLEA 4FLSA 1W5QA 1DVJA 1XBZA 2FB2A 1C8VA 2NXIA 3BSHA 1KM2A 1XBVA 3L2MA 2EKCA 2ZUWA 3WEMA 4CCDA 3BO9A 1CYGA 4JFTA 2E6DA 5CKSA 3VGEA 1DL3A 2VEIA 2FB3A 1WO2A 3LHZA 2DZXA 1WX0A 3KWXA 4H4IA 1W3IA 2CZEA 1T8XA 5LSMA 4AMWA 2NWRA 3BLBA 4OU1A 1CDGA 3PB2A 4HPJA 1JCMP 1P6WA 3WK3A 9CGTA 1O7DC 3DENA 3JRKA 2JBMA 3RIKA 2P1FA 2BLEA 1SO5A 4YMZA 3G1HA 2YJQA 4O4VA 3RILA 5G1TA 2TMDA 1D7FA 3TMLA 1P1XA 4GUIA 4GC4A 2XVKA 1OVDA 3MI3A 4JR5A 3LCLA 4P2VA 3E96A 1QHPA 2FH8A 2QMKA 3M5ZA 2Q8LA 3KX6A 1O94A 2ISVA 1VRDA 3U2OA 1ICPA 4IX2A 4HP5A 3QSRA 1G4PA 2ZYFA 3ATYA 5K2ZA 4YXGA 3G0XA 3TQVA 1U2YA 1RD5A 1K8YA 1RQEA 1FXQA 2ZUSA 3W7HA 1IV8A 1YYAA 2B7QA 1OABA 2ZIDA 3LB0A 4Q4KA 1MW2A 4ADSA 4Z1CA 4IPJA 3WMSA 3TIMA 3DX0A 1GEQA 3P80A 1KXHA 4JYDA 3VGGA 3FS2A 3EDEA 3KVJA 3K8LA 4JDBA 4IPIA 2A7RA 2J9XA 5EPDA 2BXYA 4B9ZA 3WNOA 3W7GA 2YPIA 4LOCA 1ME7A 2V82A 4JS3A 4J3XA 1KXVA 5HNRA 3CT7A 1LCOA 4PODA 1KBKA 4M56A 3EKZA 4UNLA 5K9CA 3VNYA 1H7WA 3TC6A 3KL3A 4LV4A 4OBTA 1DJNA 3BAKA 5AC6A 3OEXA 1WE5A 1ME8A 5HXMA 3O15A 1WQ5A 1TQVA 2J27A 1KFBA 4ZVJA 1JI2A 2XN0A 1XUUA 1ZHAA 1ME9A 3QJAA 4MZ8A 5G2HA 2ZZ7A 3O63A 2PRLA 3GKFA 3NNTA 3ABQA 2YA1A 1OT2A 3VGBA 5CLTA 3UXAA 3P62A 1XI3A 1QW9A 2EABA 3LHTA 2Z2UA 3H53A 4KFNA 2EADA 2ZE0A 2PWDA 3NQ7A 4JFWA 3LV5A 1WZMA 2Y6ZA 1NF7A 1BVNP 3AO0A 3T78A 1WA3A 3C4UA 3EX3A 3EXRA 2XWDA 3DX4A 4A2SA 2D73A 2EAEA 2JKAA 2Q8ZA 3T40A 5F1VA 2ZDRA 1TJRA 5F7UA 3BAXA 1DEDA 3FJLA 1U33A 2ISWA 3DH7A 3HPXA 3QEZA 3SZ8A 3BCFA 5C5YA 3MHUA 1H60A 2GVLA 3H54A 1GQNA 2F61A 5HWJA 1V3KA 3DFNA 2WSPA 3D51A 3IIXA 1ONRA 3NVTA 3GZ3A 3M5YA 3W2NA 1LROA 3PAJA 4JL1A 3L2LA 3CIXA 2QCFA 1SZNA 4DELA 3WK2A 4KWWA 1S5WA 3G1FA 4K38A 5G2IA 2GQAA 5HQEA 2X2GA 5H2ZA 4PL1A 3ZR5A 1GJWA 2OJPA 1Q3NA 3WNPA 4IX0A 1H7NA 1KB3A 2F1BA 3TSBA 3K1DA 3L0KA 1UCWA 2QJHA 1KM4A 4HPHA 2XFWA 3BVTA 5C54A 3P82A 1WOBA 2WVVA 4FIQA 3LDVA 3FYOA 2E6YA 4O15A 1XBXA 4LQ1A 1SFJA 4U31A 2OYKA 1PPIA 2VFHA 2OCZA 3W6YA 3CV5A 4LS1A 3WJYA 1F5ZA 1IIGA 1TCDA 4E2OA 5LKYA 3S5OA 3VNDA 1YADA 1VPXA 3KXQA 2EQDA 3CGTA 3HGOA 3W7MA 2ZZ6A 1TMQA 3L5AA 3QPZA 3IK2A 1X6UA 3Q58A 1CGUA 3NL2A 1AL8A 4BK9A 2QKFA 5AHFA 3EDDA 1NOFA 4DBDA 3UYCA 3W1NA 1KTNA 1OFAA 1WAUA 3G1DA 4N9DA 4FX6M 1W5OA 5A6LA 4PC8A 3W23A 2ZXQA 1N55A 1WDWA 1WOAA 1CGYA 3TMQA 1Y7VA 4MVAA 2Y88A 3GNDA 1PE1A 2E5DA 3BARA 3DX2A 3PG8A 4HA1A 2V2DA 4PCTA 4UQ9A 1MEWA 1H7PA 3WY4A 3BLIA 3OIXA 2WANA 1IXNA 5TIMA 3G0UA 4FHAA 4JL2A 4MY9A 1RP8A 2Y24A 5E1QA 4XTIA 3THAA 1JCYA 3EX1A 2ZUUA 2PWFA 3G3DA 4XTDA 1R2TA 4K8HA 1AQMA 2D3LA 2VFIA 4Z0JA 2D0GA 2YYTA 2C15A 4K37A 4LT9A 2TSYA 4UR8A 3GBDA 1EP3A 3QQ1A 4HNUA 3TONA 1IF2A 1QPOA 3I7QA 3W76A 2ZRZA 3WY2A 3LLDA 2E77A 3GXTA 3MHFA 4UFIA 2EHHA 2E4TA 4OV4A 3DAQA 2ZWZA 4ML9A 4RK8A 1O95A 5FEPA 1DOSA 4QQ3A 3G0SA 1DORA 3W22A 2WJZA 1NF0A 2EJ1A 3IJ9A 1GTEA 1P0KA 5E6YA 1AQHA 1OB0A 1I2OA 1U5JA 3QM3A 1LDCA 4JNMA 2WNQA 4QJ1A 4RLIA 2FPVA 1RZMA 4W93A 1MW0A 2IQTA 4H8UA 1CGTA 4AIOA 3EX2A 4AHQA 3TJXA 4UNKA 4J9JA 1JL8A 1SSDA 4UTUA 4O52A 1ZALA 3R13A 1S3HA 7TAAA 2F7RA 3NZ1A 3L5MA 1TREA 1QO5A 1LORA 3VMNA 2CZFA 4QAWA 3C2OA 5AB3A 3B05A 4JCLA 4UZSA 3WN6A 1JCNA 4PCFA 5E0KA 2NUXA 1GYLA 1GTHA 1SZFA 2CLHA 4X9YA 3A23A 1KA9F 1PVNA 2FLIA 2WSQA 3KFTA 5I3JA 3I68A 3B03A 5LNVA 3NZRA 2Y5EA 4AEEA 5C55A 1SO4A 3ATZA 1JF5A 3VSUA 1HVXA 1V5XA 4UQDA 3QQ0A 2RKXA 2GQ8A 2QUVA 5G1YA 2RH9A 1VFMA 1TQUA 3NOEA 3MYOA 2QJIA 1UJPA 3HPZA 1GVIA 1DBTA 1OFQA 8CGTA 1B4KA 3LTSA 4FMVA 1TPWA 3TROA 3W7NA 3P8JA 1X8FA 4MKNA 2ZXDA 1UH3A 3LLFA 3G1YA 3W3OA 4NJJA 3D4ZA 3G1AA 1UKTA 1QHOA 2WO5A 4U28A 2BSLA 1K7FA 3EX6A 4Y96A 2WV8A 1PEZA 1B9BA 2E0PA 3E12A 4CNNA 3MUXA 2W6RA 3C3NA 1YTEA 4TMBA 1WBHA 5E6ZA 1CX9A 4PSRA 7TIMA 3QW3A 2Y62A 3D50A 1VJIA 3IGSA 3QMTA 4XBKA 4YL2A 5LNUA 4A21A 4OGZA 5FF0A 2QMJA 3CZLA 1Q6OA 1XDLA 2V0TA 2Y7EA 4UFKA 3W84A 3KRZA 1BVZA 1FWWA 2DZUA 1TV7A 8TIMA 2V3FA 2E5BA 4MLRA 2A4AA 3BV4A 1MSSA 4RXGA 4RZ4A 2A21A 3A9IA 2ZRWA 2H3DA 1EX5A 2OYLA 3UPWA 4DQWA 2G3NA 1UUOA 3EWYA 4JEQA 3CHVA 1PZ2A 1VZWA 2D3NA 5AYZA 2OZ0A 4JIQA 3P60A 3GIYA 3OLGA 5FF2A 3TFCA 1W56A 2P10A 1SMAA 4WXZA 1G6CA 1MVYA 1YDOA 3TOPA 1AW1A 5AN7A 1W54A 1X1ZA 2Y7DA 3VKJA 1X7FA 1KFJA 2X2HA 4N6EA 4O54A 4FF7A 4C1KA 4GWEA 1AW2A 5HINA 1J5TA 1JF6A 4DBEA 4LU0A 2TAAA 2QUTA 5K4XA 1MFUA 1SO3A 2QCNA 3PULA 3QYQA 3TNOA 2ZRYA 5EBUA 3ZR4A 3VM5A 4MJMA 3UQNA 3UNDA 2TRSA 3ZWSA 1J0IA 1A5AA 1VCFA 1WP6A 1JR1A 5F2MA 5BRBA 4MAZA 3LBMA 1L2UA 4JTEA 1LOLA 4AEFA 4J28A 3BLEA 4JXCA 2CZ5A 1TB3A 1E40A 3MMTA 2NUWA 3W86A 3S6DA 3M07A 2JKEA 3GX9A 4WZHA 3UEQA 1Z48A 4MFEA 3DFSA 1ZENA 1CGXA 4KFOA 2F7QA 3TH6A 3RFAA 4IMDA 1KBBA 4BZYA 4JD4A 4IMCA 3WNLA 2ALDA 2TYSA 6TAAA 5BNKA 3VGHA 4UCGA 2C13A 4GINA 3UG3A 3SIZA 3HG2A 1CW2A 1W8SA 1CPUA 4AYSA 1H50A 2V8ZA 3HPSA 1SZGA 3HBLA 1TV8A 2X1UA 2ZTKA 4GO9A 1KXQA 5F2LA 1CXFA 4DF2A 4H7VA 2QCMA 5HDRA 1DKWA 1KWGA 2X2JA 4M6PA 5U7SA 2YOCA 1EP2A 3LHYA 4AAJA 6ALDA 5K4ZA 4HHPA 4Q32A 2OT0A 4RKAA 3W1MA 4UQEA 3VM7A 1VHNA 3CWOX 3ELFA 2R91A 3FYPA 5G4EA 4D2JA 3L5LA 3LXCA 1D3GA 1XKYA 3HMJG 2ZX9A 2QCDB 2XIIA 3KAOA 5AOUA 3L4YA 4MYAA 1QI5A 3VX0A 3EJQA 3DI0A 1I45A 2ZZ3A 3IVSA 4FO4A 3FOKA 3L4UA 3ANYA 3GVGA 4M8UA 5D2XA 3Q2DA 4LVAA 3RMJA 1TTPA 2B0MA 1A47A 1VYPX 4AXKA 4O19A 4Y9AA 2OW7A 5E9AA 1OFOA 5AC8A 3VSVA 4LRTA 4GUGA 4EIVA 1TQWA 1BG9A 1QX1A 4K8EA 1VGAA 1KM0A 3NM1A 3NQ8A 3KVKA 3FAXA 4X0NA 3ZT7A 1KM6A 2YSWA 3VX1A 1F73A 1LOSA 5D2YA 3GAYA 1DQWA 4ZQCA 2JKPA 5LZLA 4ZQRA 3O6YX 3NQEA 2RFGA 1F7BA 1H62A 3KOFA 3W2LA 1CXKA 1ZY9A 3CTLA 3W7KA 1UASA 1FCVA 3MO7A 3N9RA 5D05A 2V2CA 3W1TA 5HWNA 3PWAA 4X9SA 3DXIA 1G7VA 2C8NA 3GR8A 4PTNA 3FKRA 2G95A 3L4TA 1QPRA 4FNSA 2V3EA 5CSSA 4H8HA 2ATMA 4E2BA 1JXKA 4H8VA 4AMAA 2YX0A 1QPKA 3ZT5A 1G7UA 2C16A 3F1QA 1VIWA 2FJKA 3G8RA 4NJHA 4JYEA 5D02A 5AHIA 1J0KA 5DXYA 5AFDA 3GXPA 1EB3A 1V3JA 1LRTA 4NJGA 3W1LA 3BUDA 1GJUA 3LOTA 4TIMA 4WQ6A 4FXRA 3BW2A 1LLWA 3BLKA 3W1XA 1H1YA 2GUYA 4UOZA 1DTUA 1EUNA 5I3KA 1TPEA 2G3MA 3GDMA 1J4EA 1WV2A 1AVAA 1MXGA 2DU2A 1W3NA 4BI5A 5K9XA 2IGTA 3IGUA 4PH6A 3FW6A 2CLFA 5LHEA 3BGGA 1V3MA 3WNMA 2A7NA 2WKLA 3BLFA 3DU0A 4LXFA 2WVVB 3P5YA 4MUZA 3EWBX 5H91A 3DI1A 3QPYA 2E5CA 4ALDA 1YPIA 4NX5A 2WNZA 4MZYA 3LM7A 1H5YA 1FXPA 1Z42A 1B0IA 1LRQA 1JDDA 4LV9A 1KV5A 2FTPA 2PC4A 3NPXA 2HS6A 2KZHA 2AQWA 2FYVA 4DPQA 3O07A 5FEWA 5LNSA 5CGTA 3C2FA 3W2KA 1OFPA 3I6RA 5DLCA 1TPVA 2EPHA 4XWUA 3W7EA 4Z0SA 4U4MA 3NQAA 2F2HA 1WZAA 2DORA 2RDWA 2VEKA 1UD2A 2ZXBA 3OG3A 2DZWA 1B2YA 2B7NA 3LCHA 3G3MA 4FB7A 2DZVA 5D30A 1D3CA 1XCFA 4M7TA 3BAJA 3HJZA 1L9WA 2Y89A 4WOZA 4ZQNA 5TQLA 3DFQA 2PWGA 3G1SA 3DX1A 1L0PA 2D2OA 4RJEA 3E9AA 1CI1A 3TAOA 2HMCA 2E1DA 5D03A 3H55A 3BK0A 1OK6A 3W9ZA 5CGQA 4AEOA 3UWWA 1FCQA 3BUQA 1W31A 4KKXA 3F03K 2QR6A 2Y7FA 2E09A 3W1RA 2VFEA 1CXEA 3VGFA 2A0NA 3IV3A 4YCOA 5CZ0A 4R34A 3WFAA 4PA8A 5DBUA 2EACA 4JTIA 3WJZA 1GVRA 1H7RA 1ZJIA 1IXOA 2BY2A 5D38A 5IBXA 5I0DA 2E68A 3STGA 3A5VA 3N2XA 2CW6A 3W87A 3EXSA 3LHUA 3V75A 2FH6A 1XL9A 2GJNA 1OYCA 4BWLA 3PUEA 3TFXA 3QMRA 1ZAIA 5E70A 1K03A 4IMFA 1U30A 2WOQA 1UKSA 1TQTA 4MJZA 2V30A 4NNAA 2OW6A 3THQA 1XDMA 2FFCA 4HOWA 1CLVA 1GT8A 3T7VA 5KMYA 1DQXA 4QNWA 4LUJA 1QMLA 5SWUA 3K8KA 4NT0A 3EWUA 3S2CA 4JTKA 1BPLB 1OF6A 5HR7A 4UMAA 3A47A 3NQ6A 1BLIA 2XWEA 4U2ZA 3FLUA 2V81A 2WNNA 4A22A 1I2PA 2R8WA 2VOMA 4H6KA 4L4MA 1XD1A 4MZ1A 2WSKA 1I75A 5FF3A 3PS7A 3UWVA 3C2EA 1VH7A 4DEFA 3DFTA 4GQQA 4MB1A 1JD7A 2ZZ1A 1GVOA 3U6WA 2ZX8A 2YW3A 1KGXA 3FIGA 1P5BA 4ADUA 3B0VC 2VFFA 3B8DA 2D0HA 2VRQA 5A5WA 5TBOA 4GRSA 3K8MA 4ATWA 3G8EA 1A5SA 1QFEA 4I7WA 1GVSA 1RP9A 1GYNA 3S1VA 5AC7A 1GJPA 2ZX6A 3EJTA 2NX1A 2E8YA 1F6PA 1RV8A 1RPKA 3GXFA 4BFAA 1WZLA 1SU5A 1Z41A 3N3MA 1IGSA 4J3TA 3S1XA 3SFKA 2ZA2A 1TQXA 3L68A 3ZO9A 3GDRA 1JUEA 1BWLA 1VYRA 3WJSA 1HO1A 1OG0A 2DZTA 3CLMA 4LY8A 1B57A 1XSIA 2NV1A 3R12A 1NSJA 5HUOA 4DPPA 2QJGA 1ZCOA 1FY6A 3FJ6A 4KFPA 2J9ZA 1I4NA 1VQTA 3A4AA 5A6MA 1T0OA 1ZS2A 2YR1A 5TD4A 2EF9A 4FNQA 2XN2A 3W70A 3GB6A 3N14A 1JAEA 2WPBA 3LTYA 5EA9A 1RQHA 3PBUA 4IJBA 4Y8FA 2VR5A 2QCLA 3NQDA 3SSJA 4JY9A 2AGKA 3CQ0A 3EDJA 4JTTA 2RHGA 3P5ZA 3NYZA 4ZQMA 1VJSA 2PURA 4WF7A 1HXKA 2YKKA 3TJLA 4FNUA 2NUYA 1SPQA 1MWOA 1TQSA 5KZEA 1SW0A 5D2TA 1CGWA 3C56A 3ZSSA 4DF1A 1K7XA 1G9HA 2V9DA 3VO0A 2A2IA 2VKZG 5K3VA 2ZUVA 2BHZA 3W07A 3ECQA 1ZFJA 3ZT6A 1JQXA 2CWNA 2OX1A 2QCDA 3OLDA 4GUHA 3ZS4A 4FIRA 5KINA 4GIAA 5DY2A 3PB0A 4WD0A 4HIBA 4TX9A 4X3ZA 3TV8A 3NL6A 2NSXA 5IBXC 3O06A 1UD3A 4WX2A 1XGZA 4UCFA 4LC8A 1W1ZA 1H51A 2GOUA 1VFOA 3BVXA 3G18A 1OFDA 2GVGA 4AHOA 1FWNA 4HT3A 2X1SA 1EA9C 4Z1DA 1W5NA 5HMSA 3WJXA 3NAVA 3DHPA 4S2CA 1QWNA 1TPH1 2GJLA 4EOUA 3HG4A 1IXPA 1YTDA 3W1UA 2EAWA 4LUIA 2QLYA 3AJXA 4UQCA 1FWTA 4IXHA 3GXMA 3INPA 4AWUA 1OK4A 5KZMA 4J3VA 1MW3A 1KW1A 2J88A 2YFOA 4L4LA 5FESA 4Z1BA 2WSYA 4GJ1A 3S5YA 4JTUA 4R33A 5AHEA 3IVTA 4LW7A 4LWWA 4J3WA 5FEZA 2H6RA 1VFUA 5KTLA 1A5BA 3PUOA 3T44A 4OKDA 2CLMA 2H8XA 2ZQ0A 3VE9A 1QNVA 2A6NA 1PJ9A 4MIMA 1EO7A 1SZEA 2VELA 4TU1A 1KFCA 1RVGA 3TW6A 1CXLA 4A2RA 5EL1A 2ALWA 3MBDA 3C52A 4J3UA 5D09A 3VMPA 3CEPA 2NXHA 2NT0A 4O0KA 1UUMA 5L9FA 1FWSA 1SFLA 3W83A 2CFFA 1QWUA 1UD4A 1SQ7A 3N34A 1KWKA 3L4WA 3C8FA 1W5PA 2AAMA 3QFEA 3EEGA 4JX4A 1G1YA 3O6DA 3QZEA 3CZNA 2VEMA 1M7OA 3FKKA 3NA8A 1P4CA 2BY1A 3M5VA 1JGIA 5F4WA 3W73A 2NWSA 3BMVA 3LTPA 1HTYA 2QCGA 3LI1A 3UY7A 3TQ0A 1E43A 3WELA 4UQAA 4FEZA 2X30A 2NXGA 3MBFA 1G67A 4I7VA 4JGDA 4MFDA 1JG9A 3F4WA 4U3CA 3NGJA 1R75A 2QDHA 4I9AA 2GQ9A 3L21A 1TO3A 1JVNA 3R89A 5HJLA 1JFHA 3O16A 2VRKA 1EWDA 1OJXA 1SMDA 3QMSA 4UMCA 3S9YA 5A2CA 1J0HA 1HFBA 4X2RA 2BXZA 3WY1A 1S5TA 4JTSA 4EWND 2TPSA 3A24A 1VC4A 1UB3A 3R5EA 3CC1A 2OSWA 3N9SA 4UTTC 3TQKA 3VE7A 1PL9A 4NNCA 4KWVA 1UD8A 1I2RA 1M6JA 1Z44A 3M44A 4JX5A 4O53A 3MI6A 4NU7A 3VI2A 4I7UA 1PV8A 4B5NA 3T55A 1G94A 2OSXA 2WQPA 3B04A 5F4XA 3TK7A 1PAMA 1BF2A 5KEZA 4HSOA 1WBJA 1Q45A 3TXVA 3N73A 1GG1A 1XXXA 2A6LA 3TSDA 4K36A 4AYGA 2WVUA 1FDJA 1SO6A 1XSJA 1PCWA 2DZSA 1THFD 4EVZA 3IIPA 3LCXA 1VB9A 2C14A 4TMCA 5CPLA 2O7SA 4CN4A 3EXTA 1VCVA 2ZZ4A 3GXNA 4O12A 4XQ6A 4JTLA 3EJSA 1AL7A 2J24A 4FX8A 1KTCA 3DDFA 3GBEA 2Y85A 4R7JA 1GCYA 3IGXA 2AAAA 4NI3A 4NZFA 1R34A 1UD6A 3LPOA 1LYXA 4OQVA 3QF0A 5I3IA 1EPXA 5C2XA 1D3HA 4QITA 1I8JA 3VCRA 2XIBA 4JTGA 3TX9A 1JDCA 4O8RA 4ORMA 1PIFA 3UWQA 1IZKA 1RQBA 2GPTA 4UR7A 2DH3A 2F7OA 2ZTJA 1BAGA 1MXSA 3NDOA 3MHGA 2YW4A 3B0PA 5DCBA 4UIOA 2C3ZA 1TTIA 3MP5A 3P8IA 3W7CA 3KEHA 5GVJA 2DP3A 5CZSA 2C19A 3TKFA 3YPIA 3PY2A 1UH4A 2BHYA 2NZLA 3UY8A 4JFVA 3WK1A 1QCWA 1HL8A 1KLZA 1UOKA 5FF4A 4GQRA 4RX0A 3IEBA 4QAIA 3TA6A 5BRPA 1R47A 3FEMA 5DCDA 1RPXA 4NZJA 4IWWA 4W9TA 1B4EA 1GVFA 3A5FA 3HIJA 1M53A 2PCQA 1G4TA 2F7PA 1XUZA 1JDAA 4E38A 3W1AA 3I7SA 5I3HA 3LBCA 4DF0A 4HSNA 2WSRA 2FPTA 3GDLA 4XKYB 1SR9A 3W7DA 1QAPA 1S5VA 2FPYA 5DELA 3OA3A 1VHCA 3O05A 2WKGA 1SSGA 3A21A 1MXDA 2G96A 4U2YA 2WVSA 3KHJA 1KFEA 3AMLA 4XB3A 4FNRA 1UA3A 3B0UX 1FDZA 2C6QA 3W75A 1VYSX 3L67A 4CNPA 5G2WA 5F1UA 1LRNA 2G5WA 1VLIA 4HOXA 1QR7A 2GJPA 3UXDA 1MFVA 5DFAA 3GLCA 5CLWA 4H2CA 1CGVA 4UNIA 2NLIA 1L6SA 3W38A 1JULA 1R46A 4LTSA 3ZFHA 1HG3A 3QC3A 3T4CA 3SGZA 7CGTA 2B7PA 2VNCA 3NQVA 3EJRA 5CPOA 4EF8A 3S5ZA 4MY1A 3TR2A 2O7QA 3BVUA 2NT1A 4NVTA 1QW8A 3LX9A 1N8FA 5LNWA 4O28A 1YXYA 3MW7A 3NQ2A 4O18A 3EKLA 2F18A 2QEZA 2WCSA 3GXDA 1YPFA 4JFUA 4K7YA 4GUJA 4QM1A 4CCEA 3WDIA 2CHNA 3TSMA 3QSTA 1TQJA 1YTKA 5D2WA 1EEPA 4OT7A 3S1UA 3UWYA 4IQLA 3FAWA 2Y70A 4Y6GA 2RDUA 5FF7A 3BUBA 4PSPA 1KXTA 1UBSA 3EX4A 1MZHA 3AMKA 1WYIA 4JX6A 1OT1A 3SW6A 3WEOA 4FLRA 2HS8A 3W37A 2I9EA 3KLKA 2DJLA 4LPCA 3SJ3A 3PBVA 4H3DA 3CZGA 3TTSA 3A6OA 3NPUA 4C1LA 3DHUA 4WY0A 2VEPA 1LLZA 2GVYA 1G69A 3KLLA 3KVLA 1J0JA 3BVWA 2Y4SA 3IIZA 3BW4A 1OSEA 4GFSA 2YA2A 2E8ZA 2Q3OA 1JJKA 3GDTA 4WXYA 4FXSA 3LHVA 3C2RA 5CGMA 3UWUA 1IIHA 1TRIA 1R2RA 3M41A 4JICA 3C61A 3PVFA 3QH2A 2PE4A 4NQ1A 5DBTA 4JFSA 2DJXA 5LGZA 3TU9A 3LXAA 1T99A 5D33A 4JN6A 4FX7A 3Q37A 2YDAA 4CLMA 4P61A 3OVRA 3L66A 4LVDA 3BLPX 3PBYA 2FGZA 4M5PA 4O11A 4ZMGA 2FDSA 2XN1A 5F4SA 3BC9A 1R33A 1TRDA 5BMXA 4ZQOA 2QAPA 3NEVA 3F4NA 1W9XA 5HUPA 5K9DA 2Z6IA 1LBFA 3HB9A 3LGEA 3HZ3A 1YXCA 3N2MA 4GBUA 1EO5A 4RZ6A 4ICNA 2FHFA 3A22A 1GVQA 2ISSA 2Y63A 4Y90A 3DKLA 4ONVA 4O14A 4CVWA 1KCKA 1W5MA 3IJ8A 3VU2A 3G1XA 3OVPA 5K7JA 2CLIA 1FCBA 1P0NA 5DY3A 3UWZA 4RV8A 2ZZ5A 2YZRA 3D0CA 3KL0A 4UQBA 4K39A 1RR2A 1LP6A 2A1YA 1ZNNA 2DIEA 3CWNA 3DHDA 2A5HA 1PHWA 2NX9A 4ZZ9A 3R2GA 4UTWC 3KL5A 2CXGA 1O5XA 5LNRA 1QPNA 3PSWA 3ZR6A 5HR6A 3NG3A 1H3GA 2CLEA 3ABSA 4WSJA 3CPUA 2FQIA 4ZQPA 1JRBA 1VS1A 3BVVA 3TTYA 2ZBTA 2H8ZA 4O1BA 3W7OA 3L2IA 2C7FA 2V2HA 5AHNA 1GZGA 1K8ZA 3P74A 4WOQA 2A7PA 4NJKA 3UPBA 2HTMA 3W7PA 4BF9A 1OX4B 2OT1A 4OHQA 4GE8A 2QCHA 4O17A 5D04C 4M6QA 3RLVA 1XM3A 4J3SA 1M5WA 2ZFAA 3P67A 4O13A 3GR7A 5LGXA 2CLOA 3NL5A 1GWJA 1UKQA 2E6FA 4LNYA 1PS3A 4E2DA 4UFLA 1XH1A 2QF7A 4S1FA 1TJPA 4KWUA 1A50A 1TMHA 5CG7A 1KLYA 4FNTA 1D9EA 3FFSA 3V1PA 1BEUA 3KVMA 1XCWA 3OVQA 4BWLC 5I3GA 2Z1KA 4IUOA 5CXPA 5IM51 1PZ3A 1GG0A 4NNBA 3DZ1A 4OV9A 4Q33A 1BKSA 2J25A 3M43A 2C0AA 4QNEA 3EJPA 4HNVA 2QPUA 2FHCA 3I7RA 3PC0A 4JTFA 3VGDA 1OF8A 1PS9A 3WY3A 3USBA 3GK0A 3L4VA 1I2QA 1YXDA 5KSWA 4N6FA 5G5IA 3BCDA 3AXHA 2B7OA 2BY0A 1ICSA 3P61A 4N9CA 3LV6A 3U8GA 2DIJA 2YA0A 3KRUA 4XBSA 4NX0A 3R8RA 1G4EA 5BW6A 5AHMA 4MYXA 1HO4A 1ICQA 2R94A 4DO6A 2ABBA 3G1VA 4PL2A 1LWHA 4A3UA 4JIPA 1OYBA 5F2GA 4S2BA 3AJ7A 3B06A 5F2IA 4AVFA 2JGYA 3LRMA 2A85A 1F6KA 3UD6A 2WNWA 3CEUA 4UC5A 4CQAA 5C6MA 3W2JA 3BVJA 1XH0A 3CU2A 3W7LA 4AF0A 4UMBA 3TC7A 3RU6A 2DZPA 4ZL1A 3TDFA 2PWHA 1IZJA 2ATSA 3DKJA 2GUUA 1V7YA 2ZRUA 1C8QA 2DH2A 3DBPA 1HNYA 2ZZ2A 3DDGA 2V3DA 1Q4NX 6TIMA 5BOOA 3BG5A 2W79A 2WC7A 4O1CA 1TPFA 4AHPA 3IVUA 5CZTA 1HT6A 3W2MA 4PFMA 3PF3A 3Q94A 4O0ZA 1O60A 5CZJA 3BAYA 6CGTA 2I14A 1TCMA 1NAL1 3K30A 4ADTA 1H61A 3EDFA 2I1OA 3HF3A 4LC6A 3HGJA 2W0UA 2Y7GA 3E02A 1HX0A 4KMQA 3RNDA 4CGTA 1KGWA 4DO5A 1XH2A 1F76A 3EWXA 4UOQA 3WNKA 4JYFA 3TCEA 4IMGA 1TTQA 2OSYA 4UZUA 1C9DA 2Y61A 3STCA 4AF0B 4CN6A 4WY0F 3LERA 2YYUA 1VR6A 4AB4A 2VC6A 1TPUA 3BH4A 1FBAA 3BUPA 1I2NA 3M9YA 4HNTA 3UERA 3PBWA 1AG1O 4O1AA 2AMGA 4RXFA 2QAFA 3TXZA 1EHAA 1DV7A 1MEHA 1M7PA 3IRDA 3M0ZA 5T26A 1T96A 1R30A 3EDKA 1KV8A 3SR7A 3EJUA 3QW4B 5DO8A 5KZDA 2QUUA 2HSAA 1OX6A 1VCGA 4WUIA 1NM9A 3HJEA 5HPOA 1K02A 1XV8A 4UTKA 4AW7A 1PIIA 4M19A 4MLJA 3BGJA 5ABTA 3PR2A 5KITA 1KM5A 3CZKA 4G1KA 3BSGA 2ZA3A 3D52A 1L6YA 4X22A 3CLWA 2X2IA 5DN1A 4YWIA 4FNPA 1TSIA 5AYXA 2BZNA 1OHLA 2YIHA 4N4PA 5J5DA 3OLIA 1PHQA 5EMUA 3PUDA 4B9YA 4IGHA 2ZX5A 1AW5A 2FHBA 3NPVA 4AWSA 4POCA 5BRQA 1YLVA 3NR0A 1LTDA 4FLOA 1LZOA 1XFBA 2Z0IA 1XSKA 1AMYA 1S46A 4UTLA 4MY8A 3BUIA 4JDYA 2Z6JA 3NQFA 1OFBA 3UG4A 4QSHA 1TPB1 4J27A 1NVMA 1K8XA 2ZCGA 4O1DA 1BTMA 5D2VA 5CSRA 3DGRA 3MP4A 1DJQA 3BAWA 5FEXA 5E0FA 1FX6A 4WY0B 1HWWA 2PWEA 1EIXA 3HO8A 5EYWA 3JR2A 2CPUA 1H7OA 3GAKA 5EMYA 3M16A 3EB2A 3O6CA 3N19B 3W74A 1UH2A 3LRLA 1LBMA 1OX4A 5I24A 5A2AA 2X1RA 4N9BA 1GPWA 3DFPA 4IOTA 5D32A 3CM4A 1O5KA 4JY8A 1OX5A 2QCCA 2VFDA
chains in the Genus database with same CATH superfamily
4WNQB 1W2VA 4KUZL 2XH0A 4MXQD 5LXXA 1W32A 3N1FC 1A6UL 3MJYA 4PJGE 4JRYB 2UWEA 2BIMA 2VLME 3MLTB 4JO4H 2EVFA 1NC4A 4ZFQA 1MHHB 2AERT 2NY3D 2E5EA 4DQOL 4GAGH 3FSTA 5H8PA 2XN9B 3ILPB 4NJIA 4MMXB 5CPMA 4NXKA 1WC7B 2JK5B 4A6YB 1PZ5A 3FT0A 3P7YA 1OQOA 5CBBA 1JIBA 5DUMH 2BOLA 1MDAA 3HS0A 3N6HA 4N0CC 2ZXAA 4BR1A 1N4XH 1NGQL 4HEMA 2BCKA 4WJEA 4X6DA 2F8OA 3TZVC 1QI2A 3KPSE 2YGYA 1FWAC 4ATTA 2J1ZA 4W85A 5J5RA 3R8HA 3WLLA 3C60C 3MFGB 2PYFA 1QO2A 3BWZA 2ABAA 4YHKL 4ZSOA 3EFDL 3F7VA 1SYVA 4DN3H 4PWEA 4S3KA 1JHTA 3NL3A 4M61A 3AITA 3FT9A 3N85L 4LRIC 3FEQA 3QR3A 1CQYA 3K46A 1XCXA 2DM4A 3MYPA 3ZDZF 2J8FA 3OSKA 3O1NA 3OA5A 3Q2CA 2K78A 2HMID 1ONQA 2GYIA 5FACA 3K74B 3HE7C 3QKEA 2OCFD 3PHSA 2LLNA 4XMUA 4BH7A 1NEYA 2QV4A 4BBWA 1ZAGA 2BWGA 2E9LA 1WISA 2JKRM 3RM9A 3WHXB 3O81A 1BYBA 3H3PL 1AQKH 3QPQC 2XINA 1AJ2A 3L9CA 4O4WA 5HHOB 3PWNA 4JLRA 1XR9B 2APFA 3WF4A 3CFQA 1FNSH 2VWEE 2CUIA 4FL4C 3S34L 2QHAA 1XB8A 3FNKA 3FN0L 5JOPD 4MTMA 1HW6A 3ANUA 3BO8B 4HH9B 3AM8A 1AD9B 2IADA 3ABKB 4JLRB 4MJ5B 4WUKH 2V2WA 2WO2B 4U1MA 3U46B 3WGUB 3O16A 1K4HA 1JQVA 3FTZA 4XCYB 3N2JA 4DZ8B 4XPHH 1HC1A 4C60A 4PYSA 4U6YB 5FKAB 3WIHA 4L9DA 3SE9L 1S7VB 2E6AA 3LRKA 3N2CA 4JKMA 3UIZA 1J10A 3V0FA 3MWAA 4ZB2A 5FCSH 3LEYH 4L0YA 4J8QA 2Q9OA 3DGCR 1J96A 4P2OD 4Y0GA 2R0KH 1XC4A 3CYVA 4IU2A 4PVLA 4QX4A 1PF3A 4GKLA 2VZSA 4AGOA 3ZYZA 4HJGB 2CMRL 3BPOC 3K6SB 1B9KA 1PG7L 4UTMA 4HIIB 4OD2B 4PJ7B 4F33B 1QRKA 2CZDA 5KOVC 5I23A 4XZ9A 4XBEL 2EE6A 1CDIA 5F1NA 2K9FB 1FV1A 2HTKD 5JHDE 3CQJA 2A77H 1W0WB 1ZT4A 2Y9RT 3WDJA 3UP1A 5TF0A 5I76B 3VFVB 1TKKA 3B4UA 1HHJB 1H5BC 1TJHH 5E9DE 4D7BA 2C3VA 2IANB 5CJMA 2XG4A 1UJTA 1KUMA 1XLGA 5DT7A 4NKDB 5AUMA 2VGFA 3CHPA 1TTJA 4M4RB 5DT1H 3BJLA 1DYSA 3JUGA 3RCYA 2DQTH 1S6NA 3DSNA 3F64A 5HWMA 3O3EB 4KOCA 3RA7L 1N7KA 4ISVB 4G9FA 1JUFB 4TULL 3K80A 5JW4R 1IT7A 4UT7H 1T5XA 3AIBA 4DT2A 4PJDA 5GNYA 1W8GA 3RY4A 1KFWA 3Q5OA 3WO8A 4Z7UF 4PS4H 2RTTA 3ZBMA 4ATLA 4NWUL 4GYPC 5EY5A 2PETA 5E1AA 4DWHA 1LQ0A 3FCSA 4OLEA 2BW4A 3ORWA 4DVBA 4K2UL 5KTEH 4DH2A 3TC9A 2POTA 2FL5A 1CIUA 2HXTA 1FZKB 2NXZB 1EA0A 4W4OA 4FFWD 2N01B 4RGMC 4JZOA 5FGCE 1ALDA 4MRBA 1LO3H 1IAIM 5EU7E 1PLBA 2XVPA 2DLFH 3SUWA 1NCOA 3QISA 5FIEA 2AJYL 1IQWL 1HXJA 2VXVH 3VNIA 1UM4H 3EO1A 2VC2H 1E6ZA 1A2YA 4OLVH 1TQCC 1JRHL 2WXPA 5HYJE 2PRMA 5FYKL 3QGVA 4PRDB 4G8AC 4KHTL 2ZX7A 5AD0A 3BRGC 2BK8A 5DZ9A 4PBXA 1L8NA 3VABA 4P2OA 1T1YB 1HL2A 4N8PA 1YDVA 4MWAE 1DHPA 6PTDA 3PM6A 5HULA 4BV1A 1WBYB 5JOFA 1VF8A 3SDAB 3VFTA 1ADQH 2WZAA 3QO0A 1FH2A 1XLBA 2MCG1 1JZ3A 3DHFA 2AJXL 5L6UA 1CYWA 1RH8A 2NX5E 3HG0A 1UM4L 2DQJH 2NZIA 4TR9A 3VAVA 2W38A 1SHWA 4JTSA 4AD1A 3RYMA 5A8GA 4D9RE 3F2DA 2OZ4H 2VT0A 1ANUA 3QXUA 2Q8XA 3ZGHA 5DCEA 5MHBA 2EDMA 3QJVB 4YX2H 3NO5A 4Q4QA 3SECA 1JXGA 4JKLA 4XKYA 4V2BA 1Q13A 2VELA 3K1GA 4RR4A 3WLJA 3W7RA 3QCUL 3FUHA 2EO7A 2UYLB 4KC3B 4XNZB 1IARB 4YXHL 3DBXA 3LXBA 3BQUC 1JCXA 4MASA 3EF4A 5C08B 2XH4A 1IM3A 1EFXB 4TVCA 1MDTA 2J7BA 2VXNA 4F40A 2NYZA 5BS0D 3RWGB 2EYTB 2VDKL 2ZSWB 2GTWB 5M7QA 5HDBB 3B3DA 1IE5A 1AACA 2P8BA 3WH9A 1JWUA 3WLWC 5A43C 3WFZA 3LI0A 4NRXB 3UBXI 3V5HB 4PJAB 4DKTA 3QVAA 4EVNA 1JWMB 2BXVA 3FU7A 1EJXC 5DVMA 4XZNX 4ZENA 3MBWB 2B0SH 2FRGP 4HAKA 3U7VA 3CNYA 2VXSL 2VISA 2NY4B 3LZFL 1TIWA 3SEPA 3OB8A 4LOUC 4IXXA 2PLCA 4NUWA 3E8UH 4Y5YB 7REQB 2V67A 5CPSA 4POZD 2OXHB 3TA4D 3LCGA 2DT3A 2K4AA 5ENLA 1RLWA 1POJA 4AY1A 4HKZB 1GYWA 4PV1C 4G8FA 1F3DJ 2A77L 2DJMA 2WKOA 3TJIA 2QSQA 2NTFB 3VSTA 3S37X 2Y72A 1YRKA 1VFAB 4N2CA 1M2OA 2F8VA 1OCZB 3R8BB 5IHUL 5IJVA 2CLZA 2VLLB 4HU2A 4HOZA 3DYMA 3UPCA 5A40E 3C6CA 2K45A 4L2YA 2Q7YB 4AT6B 3U83A 3SAZA 1T6BX 3IRPX 4MJIB 3WUWG 3SKJL 1SXNA 4P5TA 1WG3A 3SYQA 2X16A 1Z5YD 4WV1C 4HVXA 2YCJA 2OYMA 1IQDA 2FJUB 2QFRA 2BERA 3AQZA 1DJWA 2EYRA 3KE0A 3LEYL 2CBPA 2HXAA 2NNAB 1Z5HA 4YLCA 1BWKA 3LYRA 4NQDB 1W1PA 4K7VA 2EC9T 4W7VA 4PJEF 1HQRB 1RXOB 3QIWD 4UUJA 5BW7C 4BKLA 3Q2NA 1YW1A 3AWNA 3JUZA 4PJXB 4W9DC 3C8KB 1SJXA 3G6JE 5I19H 3P14A 4OJDH 3PWUB 5BZDA 2MQCA 4GRWE 4N0FB 1NY1A 1U6AH 3GXIA 3BKJH 1CFMA 3P0YH 3HHMA 3EFOB 1HCVA 5AKVA 4ZS6D 4H7ZA 4ZFOA 4QRTB 3BD4A 4K4KA 4KETA 4M7ZB 4MAUH 4AQEA 4RWHA 3BDKA 4HPNA 1K3UA 2QPSA 4DKFH 2Q3RA 4WY7H 5XIAA 4Y16C 2PTDA 3K6FA 2Z1BA 3ABRA 4JANA 2APWA 3WUWB 5CJXA 4R2GB 3RGVB 2AXGA 1AQKL 1QABA 2FNBA 3BDBA 1K7EA 4JOMA 2E9JA 3BSMA 3OVGA 1UP0A 1YNYA 1NCAL 2J7LA 2OV0A 1ED3B 3ZSTA 5D7IB 2VGBA 3BPWA 4HK0B 4N9EA 5GRXG 1MFDL 3STFA 4HS6B 5AYIA 2G97A 1A3WA 4UTHA 4YFLI 4ZK8A 4BQ8A 1T66D 4UV7L 5JPMB 3BW9A 3GUTA 3VA6A 1EEQA 1OF0A 3O8XA 4AX7A 1YSOA 2ICCA 4DN3L 2EIJB 1LOQA 5MEQB 4X60A 2XVGA 3IPFA 3GD1C 4KPHL 1E5YA 1F18A 4NQCD 5DJ6B 1FIGL 3MGOA 2HKFH 5DC9B 2C0HA 4ZGYA 3QPXH 2ARJQ 2PLKA 3KRSA 1SMOA 4LCCA 4NO0B 2QKIA 4WFHE 3HG5A 4R83A 5DJCA 2F54E 5A6AA 5I19L 3GDBA 1LL7A 4W9IC 2CU9A 2XKSA 4NO5B 3ZOAA 4AI7A 4Z08A 1E9LA 1MWAB 2EUVA 3H9SE 1BV8A 3KBNA 4UFJA 2FDMA 3E3QE 4ZE5A 3RWEB 3I9IA 5DUJA 4JY4B 1OQFA 5G4WA 1BFVL 3V0SA 3WLKX 4IQEA 3ZZSA 1UWQA 4AIXA 5A2KH 5BMWA 3W88A 4HSAC 3BW3A 5B80A 2MKWA 1BFNA 1JUKA 1JI1A 1VAHA 5HTSA 5A16B 5K9QG 3S35L 1R87A 3CWGA 5AY7A 4PEKA 2KMWA 4JPKL 4FLQA 2EXTA 2C9UA 4OCNC 1CLOL 2VGGA 2XH2A 4LBEB 3HGRA 2R9RA 1XWYA 1LP9B 3UGXA 4NKMA 1LE5B 2APVA 2F58L 3CTTA 3LZLA 4QF1B 4WSKA 1PJWA 4M4PA 1JSYA 1THAA 2BSCA 2NY0D 2P42B 4NT6B 3CWHA 1MF2H 1P1VA 2J44A 2NSOA 1FC1A 3PP3H 3HU7A 4FLSA 5C0BA 4F27A 2FB2A 3D46A 5DMGC 3OODA 2YWYA 4S1RL 3HE7B 5D1QE 2VDGA 3QPEA 3BXWA 3TH4T 2OR9L 3V2AR 1GCFA 4Y8DC 2P5WA 1I85C 3ARTA 4M5YH 2EKCA 4L48A 3TN4A 3BO9A 1MH5B 4JFTA 4YZFF 2KBGA 3LZFH 2WWDA 1KULA 4KKCC 3CHCA 4DF9A 1BPVA 5D2NA 5DANA 2N0KA 4X9HA 4S1QH 5GS1A 2CXEA 2FECL 3ENLA 2KZ1B 1NCNA 4DCQB 2DZXA 2YEZA 1H11A 2NY6B 1LYQA 2Z35A 4GUCA 4H4IA 1ZEAL 3NAAL 4DW2H 1W3IA 4DJDD 1N0LB 1T8XA 3TEXA 2IKHA 2ZG3A 3QPQD 3WFDH 2CLVB 1M56B 4KCUA 3A9BA 1KJVB 3MSYA 1OCBA 3MOBH 1U8CA 2BFVL 3N1PC 3C2YA 3SE4A 2GDUA 4NL1A 1GOGA 1NBQA 2KC0A 3CNKA 1CDGA 3OZLA 3C6LB 4P0DA 3WTSA 2GZXA 4GYJA 1L8PA 2EE2A 1G4RA 2QSCH 3QNZA 2WK2A 1JCMP 1G0CA 3I6KB 3V7MA 1I8AA 4RVBA 2IPWA 5BQ7A 1CFNB 1EAOA 1O7DC 1UT2A 3O6LH 5I1DB 4M4RA 4V1DD 3WUBA 1MWAA 4G9FD 5F6HI 5T1KB 3WXWH 4NO5A 2W4XA 4Q8UA 4TXEA 1O1ZA 3IKCB 1IBBA 4YHOL 3T0EE 5JIWA 5I30H 4DZ5A 3RIKA 3VDAA 4WEBL 5CCZA 2BLEA 3K2KA 3OB0H 3G1HA 1X5YA 2BZCA 1DQIA 5JIHA 3MUCA 4U1GB 1YYML 2W60B 3LZ3A 4PGEA 3BVNB 3F65A 4L4VB 5F71A 5G1TA 4P8XA 4JM2C 3BGMA 2DIBA 1P2CB 4ETQB 2QQLL 3B8YA 4YPGB 3LQZB 4AQOA 1S9WA 2YPKA 4UZGA 4URKA 3LCLA 4L9ZA 1D5BA 1NMAH 5HD8D 2FH8A 2QMKA 1PZDA 3RX8A 3S5LG 3KLHC 4AE0A 3KX6A 2J6EA 3MJ8B 4GBXB 4UQ3B 2G37A 1A7OH 1O94A 1TZGL 1WAAF 4X6FA 2ISVA 4PVMA 4LCIL 5AAMC 1QNOA 1FWEC 4HP5A 4IX2A 4L64A 1I7UA 2EDQA 1G4PA 5EOQH 4ORGB 4AVIA 2Z64C 1J93A 1U8JB 3ZZ1A 2YPVH 3MC0A 4P3CH 4KKCD 1HKVA 5FKAA 5B1BB 3G0XA 1HHKA 1U2YA 3TQVA 3TYCA 3WEXB 2R1PA 4XCYA 1Z9AA 2VDPL 4L37B 1J5OL 1K72A 4MA1B 3KW8A 3ZKXB 4B95C 1AH4A 1TFPA 2H32A 2P4AB 2WBXA 3KXFB 3ML8A 1YYAA 2DKMA 2YO3A 4N68A 5KSVB 5BXSA 4XCFH 3MJ9A 1LL4A 3RJDA 2G9HB 4V1XA 5BWFA 2BP8B 1QHZA 3V4VA 1JHLH 3WMSA 3C0QA 3UJJH 2LU3A 1IGYA 3L6FA 1INDL 2JFCA 4NWTL 2YSSB 4TLKA 3LNFA 2XTJC 3VGGA 4AKOA 4W86A 4XWGH 2VE6A 3P73B 4D8ZA 2KS0A 4UT7L 3ASOB 1UA6L 1ZWIA 2QJDA 1KZYA 5E9DD 4B9ZA 3SZKC 4HJIA 4LOCA 2V82A 5IHHA 4FHKA 1V08A 1KXVA 3NYDA 3ET9F 1FDLH 2YC1A 3QGKC 1AGBB 3JWOC 1MRCL 2Q2LA 3UC0L 4C56B 1N8WA 4ETYA 3V7AG 3BLDA 3EKZA 3FOMB 4YHGA 2R1YB 5ICZA 2WHLA 3TC6A 2OKOA 4KJPD 4P07A 3FBQA 1QSFD 1RUQL 3IPEA 1F6LL 4NIKB 3U1SL 1VEMA 5MHSD 1AD1A 4AMKH 1M71B 3K6NA 2AJZB 3D48R 3HA0A 1L0QA 5IF0A 1LUCB 3OEXA 2AMXA 2Y7LA 1FN4B 1WE5A 4PWKA 5AB1A 3CSGA 5EMMA 3L17A 5HXMA 1SFTA 3O15A 2MQ3A 2CBUA 4IPNB 1IC4H 1KFBA 4GQBA 3G6DH 2OXHA 4TQHA 5IFHL 4ZVJA 2VQUA 2XN0A 5SWQA 3QJAA 4OD1L 3O63A 1NM4A 3CFUA 3L1OL 2O4QA 1ICTA 3O3BA 1A4AA 5BPPA 4BS0A 4M6UA 1QSEE 1PZAA 1E2WA 2IH1A 2YN5A 1IGTA 1WC7A 3MGAA 3HNTH 3HN3A 3UXFA 4A6YA 1AO7B 2NNRA 2R56H 3QIBB 4NN6C 2N0MA 3ZTCC 4HN8A 1RV6X 2FX7L 2OI9C 3BEVB 4QGYA 3SE9H 2KLTA 3TVMD 1KSRA 1BQGA 3UXAA 1RZPA 1PKYA 3TN0A 1RZJH 4MXWH 2Z2UA 2UWEB 3MLTA 5KVEH 4KFNA 1PB0A 2WBJA 3WD1A 1B5TA 1FWIC 3AIEA 2G0LA 1ZE3H 3HQOA 4WK4B 3MQIA 1D7BA 1LILA 2DJSA 3MUZ1 5LIUX 3NDYE 2CGZA 1EZWA 2B81A 1NF7A 3RX2A 3S34H 2LVEA 1MJ7L 1SFDA 1WA3A 3TWCH 1AXSB 2D7TH 2GY5A 3CZFA 2XWDA 4LLAA 4XZUB 2IQDA 3L3DB 4RMSA 3EXRA 3FHAA 5HJ3B 5EOCJ 3TBSA 3GEFA 3NSFA 1IAOA 1UT1A 2ZPKH 4X98A 5D4YA 3OQEA 1XG4A 2Q8ZA 1J48A 4ZFOL 4L4TE 5F7UA 5I66A 3Q8FA 1CDYA 1DEDA 3SY0A 5CCJA 3S3CB 2IPTH 4G7YL 3U7AA 1S2WA 2SFPA 4AGNA 3QEZA 4LUSA 1V4YA 3JZ7A 5C5YA 4PMXA 3X11A 1OTTD 2ZDSA 4FG2A 4HYVA 2ETWA 3H54A 4POYA 5HWJA 4GKZB 3D51A 3IN0A 1I7TA 4FFWC 4P2CG 1XLDA 3NZQA 4OVVA 3SQOL 1QSED 3M5YA 2O9TA 3MJ6A 3K6DA 4QHPA 1ZV9A 4F2TA 3P93A 3R0KA 3VOCA 3EFDH 1GY1A 3S48A 4L3AA 3BANA 2CUHA 4NUGL 4HCGA 5CC5A 3WK2A 2A6KB 4NQEA 4X4ME 1S5WA 5ACZB 4K38A 1Q63A 2X2GA 4H0HB 4OLZH 1PDKA 3T2NL 3ZR5A 2DQHL 5AW9B 1RUPL 1R3JB 5TDOA 4DP6X 1IR2A 1Q3NA 5TPWL 5E1IA 1Y5XA 5EIIB 4JJOA 5F3BB 3F4CA 3WNPA 1N4XL 1NGQH 3QXDB 4WGKA 1KB3A 2CM5A 2ZAHA 4JN1H 3MCYA 4BFGA 4LQFH 4ROQA 2QJHA 1KM4A 2DSWA 3GHTA 6ENLA 4ODHL 4YNYA 2BOCB 5IW3A 3WO4B 3IWUA 1WOBA 2G41A 2WVVA 4DTGH 5LGJB 3LDVA 4H8WL 2O30A 4O02H 5DMJB 5CZXD 3S4SB 2IDUA 4TV5A 3LNDA 3L3DA 2Z93A 4LQ1A 1J8KA 1EZUA 2P46B 2UZXA 4L1SA 4OVUA 3WEAA 3LG3A 3OKOB 4X4KA 3LMYA 3QCTH 1PPIA 1YJDL 3G6JA 2VFHA 2YZ8A 3EUDA 5ISZA 2PF0A 3W6YA 2IKGA 4QHKI 4F0LA 5HGBA 4ZTOL 4Q6YA 2XV6B 3KPNB 4XAWH 2VW7A 4JDZB 1OK8A 2R7EB 3B7UX 4GG9A 2VO8A 4IRJC 3HZMA 4TSBH 4WUUA 5GGSB 3ZXAC 3V0WH 5EGRA 3S5OA 4I0PC 1G9MC 2FLBT 4QXIA 4Q8WA 2EILB 2NSQA 4OZGA 4QRSA 1KTDA 2GJ6A 4FCHA 2XJ7A 2H7WA 2GSIA 3EJZC 3W9EB 2J2ZA 1G0XA 3AREC 5EIIG 3KMDA 1J9YA 2WW5A 4AZ6A 4QE5A 2W9DH 3L5JA 5FJRA 3L5AA 2MPAL 3APYA 1VKXB 2XWRA 3Q58A 4A05A 3FSAA 4ZW8A 3GS6A 2QKFA 3EDDA 3TN3A 4KI1A 4AMCA 1ZGLB 3F5KA 4KAQH 1ZVSA 3PZOA 3UYCA 1YEHH 3G1DA 1U93A 1PO9A 5CBEA 1FVCB 4XP6H 1W5OA 4AD2A 1YPZA 1YBQB 3V7PA 1W3JA 1E50A 3TJHC 2NY6C 3W24A 1WDWA 4B9PA 4AIZA 5KUKA 2AK4A 4V2CB 1Y7VA 3QUYB 1H9DA 1BMWA 5C0BD 1M3UA 4DN4H 2ICWB 4C7FA 1TMLA 3V5DB 3BARA 3LNMA 5EBAA 3X1NA 1ECQA 4HA1A 4XTRD 1UR1A 3O2VH 3Q67A 3QDGE 3DMMA 4NM8H 2ZCLL 4RMTA 5FGBC 3NJLA 4DZ8A 3KP1A 4NG3A 5I8KL 3NFSL 3GW3A 5DFTA 2WANA 5E5CA 5CN1A 2PZNA 4I5XA 3S5LA 4RRPM 5LDSA 4MY9A 1RP8A 1KCRH 5E1QA 2I9LA 3NFPA 4HPYH 4D9LH 4DK3A 5BWAA 3UTSE 3M0LA 2AQQA 2BP0B 2HYMA 2ZUUA 3HTLX 3F7KA 4XTDA 4EI5D 1AP2B 1AQMA 2H26B 3EYFA 1MFBL 4N2GA 4ZSOE 4EIGB 5C70A 5ECUA 2VFIA 1DQQB 4NUMA 3UJ2A 4UR8A 1O9VA 4WJ5B 3MLYH 4Z0XB 2TSYA 2R2EA 4ZBJA 3QQ1A 1SXZA 3TONA 1UWSA 3GO2A 3GQYA 4V28A 2AL2A 3LLDA 2ZYIA 2MPVA 3QFGA 3BH9B 5KBMA 2CKBA 3CDGB 4FXKC 2E4TA 2AFNA 3SHSA 1VRSA 3WQ5A 2VZTA 2EDBA 4GLRH 5EZPA 5FWQA 3Q3GB 3X3FL 4D0BB 2NY0C 4RK8A 5GGVY 1NL0H 2JXMB 5C7VA 1VLXA 3GHEH 3KWUA 1DORA 1HXYB 2P49B 4QHLA 2UUDH 5J57B 5B38A 5DK3A 2EJ1A 3W22A 5C8JB 1XFPA 3EJYC 3ZDZB 1AQHA 2C26A 5JORA 2W61A 1SLVA 4JIEA 1I2OA 3K91A 4WGXA 3W28A 5T5NG 2DVTA 4JNMA 4Q7DA 4P23B 2FPVA 1FRGH 4PG2A 4PJIB 4W93A 4H9MA 1GKQA 3V0HA 4KRUA 4YJ5A 2MNUA 2YJLA 4Z23A 5DC4B 3FT2A 4U49A 2SODB 3AROA 4H0LC 3EX2A 5H37H 1AHWA 2F8QA 2X53A 2R2BB 2Q09A 1EZSA 4O52A 1FSKC 3DO7A 5JXEA 1JK8A 2CEQA 1ID5I 5LWYL 4U1SB 5HYSG 4L2LA 3DVNA 4B3ZA 4R7OA 5GGVL 4AM0B 1MFAL 4BSWB 5FO8B 1Z7JA 3QUXC 5BQDA 3VMNA 4GIRA 1ZHBB 4LDLB 2IAMA 3HBQA 1A6ZA 1AZBA 3USZA 5JA8B 3MRCB 4JRYA 3L3IA 4GH1A 5AB3A 1FL3B 4JCLA 4OQ1A 2D7QA 3GS7A 4QRPA 4UZSA 4XC3L 3Q5TA 3RQ3A 3U0TA 4RA3A 4GB9A 1U8CB 3WN6A 2NUXA 2V3GA 1GYLA 1G7HB 1FCCA 2YAHA 3LN9A 1GTHA 1TG8A 3A23A 3UZQA 1PVNA 1R24B 4Y4KA 4A39A 3HZVB 1DFXA 1FA4A 5HOSA 4JQXC 5I3JA 3VG0L 2W92A 2J74A 4NUJB 1BFOA 5LNVA 1R5VA 3QIWC 4GW1A 5E2WH 5HHMD 4AEEA 2E40A 1SO4A 2FZMA 2YCKX 2K9UA 1XVSA 2WSDA 1HVXA 3RE0A 2CG9X 3UJTH 3GBNL 4L8DA 3VSUA 4KKZA 4A55A 3CFMA 2WZEA 5J0BA 2A1WL 3RWDA 1TQUA 3SSGA 2BVOA 4IGBA 3NURA 5GPRA 1R5WB 3HPZA 3C5SB 5I16A 4KKLC 4M5SA 1B4KA 3LB6C 3LTSA 4S0TD 1M1XB 3OKDB 3WQGA 4MKNA 4H00A 1DSFL 1KG0B 2MRYA 3LEVL 4PJAF 4X80L 3GNDA 2F2KA 1A9BB 3D4ZA 2YEVB 2VXUH 3ML9A 1QHOA 1JPGA 1VZIA 3RDJA 4IJ3C 4ZTPH 3VDHA 4F57L 1FNGB 1N82A 1IBGH 3KWVA 5ICUA 3EX6A 3AAMA 4Y96A 2A3EA 3LKSA 1B3IA 5I15L 2E0PA 4M5ZH 2ASHA 4CNNA 4HHHA 3QEHA 1P69B 3U2CA 4HGXA 1A14H 4ZMAT 1EHLL 3VVWA 2NXYB 5I1GH 1W8NA 3GMOA 5F0MB 1P7TB 4EUPA 3PAUA 5T8GA 1N2RB 2NRDA 2R2CA 4NKQB 2DW7A 3AXKA 2VQ1A 4N24A 3GHPA 3QMTA 3QW3A 4PB3A 3WD4A 4YL2A 5LNUA 5FF0A 1K9EA 2QMJA 4G43A 2QYGA 4B5XA 2P48B 5BU9A 2V5MA 4I3RL 2VX4A 4FYQA 4IJTA 3CQIA 3FH8A 4LDCA 1A7PL 4B9FA 3VIFA 3ARRA 3Q9QA 4MJ4A 4P9HL 1WZ1H 5K5YA 2BDNH 2Y22A 3GBMH 4KROD 1F4WH 2J62A 3PZTA 3RVTD 4JFEE 1DBJH 5IW6A 4ZEPA 3K2UL 3UPWA 4K94C 3P9MB 2G3NA 4Y7MA 3EWYA 1BXXA 3L54A 4BZ1A 2HFFA 3EOOA 5GGQL 1PZ2A 3L3JA 1UG6A 3GSQA 1PDYA 1DFBH 2OZ0A 5F7NC 4KMTL 1O5PA 4NQUA 2NW3B 3TFCA 3N17A 1IUZA 1FYTB 4C6JA 1SMAA 3OXSB 3THMH 2KPWA 3C2SA 4YTQA 1N5AB 4YS1A 1MJ8H 1S5MA 4XBGB 4JQ3A 4N20A 2PTTB 3IXAB 4WHYG 3TOPA 1I9RH 5AN7A 3WJLA 2K7PA 3HE6A 3GSXA 2PPGA 4BQ2A 3O3UN 3VKJA 2WC4A 1OGPA 5CCHE 3L12A 2Y7QA 3I84A 2YBRA 4OIAA 1WCQA 2JCCA 3HUJE 3QUMH 1Z66A 4W9KC 3VVVA 4B9IA 3ZUNC 3CX5K 3F7PC 1NGXA 3EOTH 4YS4A 4N25A 1WKDA 1FVPA 2VL5A 1XLMA 1UYWL 4B3LA 3SJNA 3AHVA 3UJIL 4YHIB 3UETA 3HI1B 3PULA 2IGLA 1LEGA 1AGDA 3VM5A 3MRRA 4HYRA 4HUVA 1ZT7A 4MJMA 5EBUA 5XINA 4XVSL 1SJEA 4HS8L 2TRSA 3UQNA 1SVDA 4XVTL 1NLDL 1CLZL 5BRBA 2OA9A 3SDOA 4FF9A 5C9KA 4LAQH 4C7DA 3M0XA 4J40A 1RURL 5KVGH 1ILUA 1LOLA 5DGQA 1ZVNA 4PMEA 5AVXB 1BOGA 3BLEA 4RUBA 1TVHA 3ZDXB 4CVXB 2D7OA 1WBHA 1OTUD 3C5JB 1E40A 3QZMA 2NUWA 2CR0A 4GKNA 2GABA 1UGNA 5PAZA 2JKEA 3RHGA 3BP6B 1ZA6B 4WZHA 4I5RA 2RR3A 4ERSL 4YIWA 5CJOL 3PFQA 3RU8L 3MBXH 4RBPH 4O1EA 4DI8A 4WUUD 2AJ3B 4M9PA 2WHMA 4IMDA 3SQSA 5A8OA 2FSEA 4K7PL 3I2CH 3RRXA 5JHLA 3PXJA 4JD4A 4Z7NB 4MWAD 4ODSH 4HWEL 2C9SA 3JT2A 5IM7B 1XW8A 2C71A 3ULUC 3VGHA 2D4FA 2OL3A 4UCGA 1YAIA 3BDYL 2J43A 3HG2A 1VP5A 4DPBX 2IAMC 3GSVA 2KKQA 4N5UA 3RM8A 1W8SA 1LP9F 1H50A 4EBQH 5F7FA 2WOBA 2GT9B 1SZGA 1M7JA 1TV8A 1CDUA 2X1UA 4HPGA 3BGAA 4GO9A 4XAKD 1Y6KR 4Q8TA 5FV1L 2JELH 4NENA 1NGYA 5FJPA 5HDRA 1DANT 4AEIH 3EJZD 2IOOA 2OCJA 4B0MB 2DQCL 4KJYB 4EPSA 3D4CA 1S7UB 3QQ3A 1EJOH 1NDMB 9PCYA 2P50A 6ALDA 1G7PA 3PP4H 2EIEA 3JBG7 4FA7B 1EKOA 1NDVA 2OT0A 1EOKA 4HHPA 4Q32A 1XGUB 4NO2B 1A6TB 2MNWA 2QHLA 4P5TC 1W8EA 3REVB 3FYPA 3QDHA 2R4SL 1D9KC 4JM4L 3LXCA 1LMIA 2OSLB 2WGNB 3AUJA 3GG7A 1HH9B 3HW7A 1F3XA 4NZUH 5A94A 3T4YB 4QJ3B 5EU7C 4JFXB 2HT3C 4TQEL 4IGNA 2QCDB 2R6OA 4AZ7A 1YJDC 4KXCA 3EJQA 3QO0B 4V15A 3VFTB 2Q7NA 4Y4HA 3XISA 1CK0L 3E1F1 3IVSA 4FO4A 4GQGA 3GH5A 3DROB 1KLFA 2AXHA 3L4UA 3GVGA 1Q9OA 4U4BA 1MJ8L 5JDJA 3RMJA 2B0MA 3D1MC 1B6UA 3NZ8A 3SGDI 5AD0B 3SDXA 3T8VA 3GMQA 2XVBA 5GIRB 3ZZQA 5B38B 1VBHA 1XJBA 2XG5B 3NP3A 3E2HB 3FULA 3T6QC 1I8LC 5JIIA 1OWRM 3PLYA 3VSVA 3BE1H 3STBA 5H94B 5BZWB 4GUGA 4EIVA 1DBJL 3AU1B 2YD6A 1BG9A 1BIIA 3UJEA 4F48A 1C7TA 1UWEL 3OWEA 3PL6B 3CH1A 1E71M 1Q4WA 1TUPA 1FP5A 4PJEA 3KVKA 3FUEA 4X0NA 4MQ7A 2H1PL 2P24A 2UXVA 4C54A 3DK2A 7PCYA 1E5NA 5D2YA 3FYEB 4W81A 1PQZA 4WJ5A 3GFZA 1L9RA 1DQWA 4I48A 4I3RH 2UBPC 3U0WL 2R69L 2NLJB 2YK1H 2DQUH 2RGSA 2AI0H 2DMBA 3KG5A 4OF6A 3C60D 5AVYB 4PGJA 1ZA3A 3RX9A 1K5NA 1CE1H 3NQEA 4A04A 5AW2B 1F7BA 1H62A 3KOFA 3R0UA 3HLAA 3W2LA 6XIMA 5DWPA 4YSAA 1U0QA 1XIWD 3PJSB 4KNSA 2FQEA 3WD5L 1EHLH 2TODA 4E4UA 1FCVA 3L5XL 4G83A 5HWNA 2V2CA 5G1MA 5K33A 4PRPA 4R90H 1K70A 4D6FA 3D0LA 4G9PA 3RJOA 1REQB 3FKRA 3DSNB 5EORL 1X8CA 4PRAB 4IOSD 4EE9A 1UG9A 1JNLH 3FTWA 4MSWB 3IGFA 4UTBL 5FYKD 3SFWA 4PPTA 4E2BA 3LEVH 4X80H 4H8VA 1MQRA 3OZOA 2CR3A 4YFEA 3I02A 2DUZA 4AMAA 1WBXB 2HFTA 3R18A 4K3JL 1ML0A 4WFGE 2YX0A 4XNAA 5IJKC 1TX2A 2PDIA 4WIWA 2C16A 3F1QA 4AXNA 3G8RA 5K1NA 3ESNA 3N9GL 2PBGA 4XP4L 1BX2B 1J0KA 2DIKA 4D6JA 3WFEH 4AW4A 1K9TA 5GS2H 2C34A 4EDXB 5I73C 43CAA 1V3JA 4KUCD 1EB3A 1LRTA 2N1TE 3UJTL 3QV7A 3W1LA 3LOTA 4TIMA 4IU2B 4U6HA 2I16A 1FHDA 1XKJA 3EH5B 4JDTL 2RQEA 5JOPE 2J2ZB 1A66A 3AQUA 4RNJA 1H3PL 3KPSB 3MX0A 6PAZA 1H1YA 3DYPA 3WNJA 1OHZA 3SGKC 3I50L 5I3KA 4I8YA 3VIOA 4RBPK 2OR7A 3CBKB 4AJWA 1WV2A 1SJHA 1FG2A 1TWDA 4ZRGA 3VXRE 4L4TD 2VN6A 4BI5A 4PS8A 3KM2A 4IKIA 3V55A 3LKQB 4JDVA 5CCGE 1OM3L 4AYEC 3FW6A 4IJCA 1VCBC 2A3LA 1ODAA 2ZP8A 4Y8EA 2QADD 3APDA 4JO3L 2WKLA 2IC2A 4KQ3H 1WH0A 2NLJA 4LXFA 5IIEB 2WVVB 1C3FA 4QNPF 2Y8UA 2RFXA 1FC2D 1NBVH 1WFOA 2E5CA 5I1KL 4XMKL 2OG9A 1VEPA 4QY8A 2VEFA 5IFAL 1ZSXA 2O9RA 1IBDA 3FT3A 2ZOOA 3SUSA 1C5CL 5G55A 4ECNA 1NFDA 1QLFB 2JKXA 3LM7A 3D05A 4X6DF 3PGCB 4R0LB 3BWUC 5FA4B 3NZGA 4LYRA 4RPPA 1B0IA 1LRQA 1JDDA 5DJZA 3VOFA 4DP9X 4D8OA 1AGFB 3MA9L 1TJXA 3OXRA 5BZAA 1EK3A 4NZDA 1QFWH 3SPJA 4HU8A 3T0DA 1OEPA 5GSVA 3MRQB 3QRBA 2PW2B 2H6UA 5LCVL 1OFPA 1UB5B 3KJ4B 3OKMB 3QFJE 2WWKO 1TPVA 3HB3C 4Z3IA 1TJ0A 4A7GF 1XLLA 4Z7WA 3WLWD 1RY8A 4GA8A 4BDVB 1AJ0A 1VZGA 5H8DA 2AEQH 1E7VA 3FRUA 1A9EB 2O6DA 3HPLB 3B2PA 3E0VA 4Z0SA 4TUJA 2F2HA 3AWFA 2CBMA 2FIKB 2XN9E 1I9IH 5LGKA 2RDWA 3ZIZA 4A8LA 4J4PA 5IHRA 5H35B 1E9QA 4YHZH 3SDCC 1I3RB 1S9VA 2J7CA 1QSFE 5KOMC 1PXGA 3T3ME 1Z9PA 4Z5RA 4IU3B 4GY1A 1B2YA 2LTQC 3G3MA 4TUFA 3FJTA 2OOFA 3UEZA 2OXGA 3T0AA 4LLVB 1EWHA 2GCYB 1NJ9A 3GZOA 4AIUA 1KCVH 1QPPA 2HAZA 3DFQA 5L4MA 3U4EB 4JIRA 4WOZA 2VOTA 3QHZL 1VACA 1EJTC 1T21A 2A0LD 1DQML 4MNQA 3PZGA 5ES4B 1CI1A 4H19A 4LAZA 5KJ4A 2WMPA 3T9PA 5J6GA 2WMPB 2VITA 4OUUB 4LAOA 3CFKB 5D1XA 2JJTC 4G1MA 4X6CF 5CFAA 3TN0B 2V69A 3W9ZA 3RRAA 3X14B 3UWWA 1J8VA 5AYUH 4NM8L 3U4EA 4ADIA 2D3VA 3BUQA 3MLZL 3MRDB 5C2BH 3C08L 1B3ZA 3TNMB 4UF7C 3X12A 1NJ9B 1GW6A 1NC2B 4C56D 1Q6GA 2DL9A 3NCJH 3S36X 1UR8A 4BFBD 2BNQE 2DW5A 1V0NA 3KD4A 3SE3A 3VGFA 1WDPA 1CT8B 5IWLC 1CZ8H 1ECZA 3WFAA 3WJZA 1BWMA 2VYRE 4NN7B 1ZJIA 2FAUA 2IKIA 3VI4F 1CFSA 2BY2A 4HETA 5ADPL 3R1ZA 4NZ3A 5IBXA 5I0DA 4JS7A 4R5EA 1R5IA 3EXSA 3LHUA 4H41A 3MUIA 1XL9A 4WO4A 4C58B 4TRPH 4X83A 2GJNA 4WW2B 3PUEA 1AS8A 3IU3B 4OFCA 3GLAA 4UT9A 3AG2B 1AC0A 4JFDB 3SCMC 1A1NA 4XN7A 4IMFA 5H6HA 3BP6A 4QEEA 3REQA 1UB5A 3M1OA 1UKSA 4BFRA 2OPCA 2Q2EB 4LP5A 4P48A 1QQDA 1GT8A 5H37G 3T7VA 5IW1A 5I1CL 3NFNB 1DQXA 1LNUA 3CQQA 5FYJH 3V8OA 1QMLA 1IFHH 4IIQA 4UTAH 4QRPE 4NT0A 5FK9A 4BRVA 4TOYH 2VVSA 4K3GA 4L3ED 3EWUA 3G77A 4W7UA 3OF6A 2VR4A 2YRBA 1BPLB 3VFUB 2Z8WC 1JZGA 5DVLA 3DO4A 2CJUH 5KSAC 4U2ZA 1NP0A 4O0QA 1QASA 3NPZB 5FX3A 2JIXD 1RIHL 5TNVA 5DEGB 1AKJA 43C9A 2D03H 1MNUL 2O1AA 3CUPA 1A7BA 4H6KA 3D12B 4ENED 2VLRA 3DTXB 1PDZA 4L5FH 4P7NA 4IK6A 4PZVA 3UXLA 4E41B 4AQ8A 2N56A 4HKXA 4J3OF 1LO0H 4L1DA 1XR8B 4AZCA 4OCRH 2GSEA 2AQ3A 3WEXA 1RA0A 1JGUL 1GZPA 4RE3A 3WLSA 4QLJA 5ELIA 5HANA 5BJTA 3B0VC 2VFFA 3L3HB 3B8DA 5IT2H 3QEUB 5A5WA 2DQIH 4G5ZL 3ZVVA 5D1XD 1FUNA 1MFNA 4MA3A 4PTVA 2JI3A 3D3VB 3RPIB 3T2QA 4X6FB 2J7HA 3G8EA 4KO5A 4YIQB 2JB6A 2NQ5A 3ERXA 2YGQA 1PKMA 1EFQA 1GYNA 3P9MA 2PR4L 3ULSA 1TTGA 1GJPA 2ZX6A 4PREA 2PPAA 3WL9B 3EJTA 1FKXA 4YJZL 3QI9B 3RB5A 2C91A 2NX1A 3VOHA 2VQTA 5T9BG 5GGTH 1RPKA 3RUGF 3Q6FB 4E8CA 4YL4A 1Z41A 2Y07H 2AOSA 1RK1A 5I8EA 4IIGA 3HR5B 1W1IE 3SFKA 3CDCA 5FLVA 5HJXA 3V0TA 3WQEA 4W84A 1F1AA 2J5LB 4KJWD 1NPUA 3ZO9A 3FSWA 1T6WA 1JUEA 2DZTA 4MMZC 3QO1A 3MV7D 1B57A 1YNTA 2EDXA 4HJJL 2NV1A 2IQ9L 2VR2A 1RUML 5JZ7D 2AK4D 1WTGT 3T8XA 2P5NA 3N91A 2J9ZA 4MNMA 4G1NA 2ZXEB 5FO9A 1BFTA 4ZFGH 3MS8A 4WGHA 4YVVA 3JV6A 4K7FA 3VFNB 1AXIB 5C0AB 1B31A 5KVFE 3W83A 4FNQA 3ZDXF 4EANA 3QV6A 2VDRB 3AZRA 4DGUA 3W70A 2VIRA 3VW3L 2W5PA 1RI8A 1T66C 4AUUA 4HU0A 5PTDA 2DWEB 4GUQA 3NIGB 2BM3A 3BAEL 4FQHB 5I18L 3RRQA 1EDTA 1RQHA 3AC0A 5KYYB 1FNFA 1ZA3B 3QFDB 4MM1A 2VR5A 3ZHLA 3VFSB 5GS1B 4NHUB 1AKJD 2Z92A 3CN2A 3ZL4L 5D2NB 2AGKA 4MNGA 5CFHA 1CB7B 2R29H 4P23C 3QT2A 1LJMA 4YFLF 1GJIA 1UWTA 1OTUC 4JTTA 3F5LA 5JHDD 3ZX1A 1T22A 4ICWA 3NZHL 1GC1C 3NJIA 1UADC 4I1PA 4GMEA 5IFHH 4TN9A 3LHPL 5ETUB 5IDZA 3FN3A 1KLGA 3FU0A 3MRNB 3CXHK 1MWOA 4G56A 4AWSA 1UPMB 1DCLA 1NC4D 3D5HA 1SW0A 5EMJA 3U6RB 2XA3A 2VJ8A 3CXHJ 5D2TA 4HVBA 3UTQA 3CSYB 5M17A 1ZNNA 3ZSSA 4AMKL 2V9DA 2C5DC 3O0FA 4CBZA 1I1WA 3QCVL 3PTDA 4ANKA 3S37H 3Q8CA 4JKPH 2UY6B 4ZS7L 1OOAA 5K3VA 1F0LA 3BAEH 5A16A 2BHZA 5C07D 1RUKL 4LMQI 1F45A 1V7MH 4OR1A 2H6PA 5E8DH 3SDDA 3ZT6A 3O6AA 2PXYD 4LYPA 4F2UA 1GGBL 3OLDA 4GUHA 4QPEA 2F5BL 4AZ5A 5LLIC 3SCMB 3SD2A 3U1PA 4XO7A 4U5KA 3Q7JA 1S3KH 3PB0A 4XNUL 3IRSA 4WD0A 2DDQL 2AGJH 5DDHA 3U9UB 3NL6A 4D6EA 4WWOA 2YCLB 1JGLH 4GRLA 1RU9H 4N2OA 4HK3N 3S88H 1I53A 4ZUUA 3WIFA 5E99L 2XSXA 4H1LA 1A4BA 5CEYA 1HO1A 4HK6A 3F3HA 1W1ZA 2W0KA 1KNOB 2D31A 1WDDA 1IBZA 4XPAH 3G04A 5IHSA 4RNRA 1N5YH 1PWMA 2GVGA 2DPEA 5F9DC 1NGYB 1ZHKB 1FWNA 2Y8KA 1LLOA 1QFUL 3B7SA 4RMWA 2O9PA 3DIVA 1EA9C 1M05A 5I6KA 1NP2A 3L4CA 4Z1DA 2A9DA 5CP3A 5D7KD 1A5FL 3DUUA 2W59A 3SKOB 4DPAX 2H0EA 4H88H 3P4OB 4A38A 2I5GA 2C3GA 1FIEA 1HSAA 5GNXA 1JERA 2H1LM 5LN4A 3SYPA 4L4JA 4MNQE 5FLUA 2F8XC 1YMMB 4HZAA 2EAWA 5LBSH 2PGWA 3QEGH 3QZWG 4FQXB 2F74B 4PJ8C 2JB5H 1JZ7A 2J66A 1FWTA 3G6LA 4IXHA 3GXMA 2DQIL 3KYOB 5A6SA 2K8MA 4X6DE 3WAKA 5F96H 3INPA 4AWUA 5KZMA 4PTXA 2AL2B 3BKCH 3AHZA 2Z1PA 2J88A 4ZB5A 5KETA 3AHTA 4RDZA 2CA3A 5H2BB 1YNLL 2DMKA 4MMYA 1PZUB 1UP2A 3SN0A 4F7CB 3VJ6A 3WBAA 1T0MB 5IOKA 1AHWC 1AP2A 3EYFB 4XD4A 2AVGA 5FEZA 3IVTA 4LW7A 2H0FA 2V8MA 3SKNB 5IG7A 1E90A 4GKNB 3UXKA 3SRKA 1FL5A 5FHBL 1CBJA 2QUMA 4PJBB 3KGRA 1RIHH 4KX8A 4BZ1L 3VE9A 2AKRA 4N2FA 1WWCA 4UU9B 4FKHA 4WFHD 1HEJC 1KB5B 5E23A 3NQIA 5CO1A 4MIMA 3I9GL 2UX7A 2XX1A 1SZEA 3QI9D 4G11A 2P26A 2EEAA 2NNAA 3DRQA 3FT4B 3IBEA 4K7PY 5D6DC 4N9GA 1MUWA 2EYRB 4A2RA 3RDTD 4B53A 1IBFA 3QUZC 1N68A 3RWIA 3UJFA 3US9A 3VI3A 1D8CA 3C52A 4J3UA 2PD9A 2QS8A 4LIQE 2V37A 1H8NA 3D0VB 5EBLA 5D09A 4YHYB 1XSOA 5ISZE 2NXHA 3DIFB 4D7PA 3T8XB 4LBUA 2CDGA 2XKUA 4H4NA 3U2JA 2VURA 4FULA 4F8QA 2VHLA 1ZEAH 3CXFA 3NAAH 3ZDWA 4DW2L 3N34A 1KWKA 3L4WA 4R7LA 3WOVA 4HHMA 3WQOA 2NTFA 4D6HA 1SHMA 3NGBC 1C5BL 2DZEA 3HBLA 1PD1A 2BNUB 1HEZB 4WI7A 4HQVA 4MMWA 2XFXA 2CITA 3GLDA 1Q1PA 3O3DB 2YS4A 1P4CA 2C9AA 2HJFB 2AQVA 4YHLH 1SJDA 2NWSA 4GO6B 3N0AA 1HTYA 2QCGA 3PWGA 2DWXA 1N10A 3D85B 3NCBB 3FU7B 3P54A 1H41A 3U4AA 1PTGA 3TQ0A 5DS2A 3APNA 3FDWA 4YE4L 4APXA 5C0CA 5AZ0A 4QRQA 2V5TA 2AV1A 2NXGA 4DKEH 1EAPB 5BUPA 3Q94A 3DIPA 3HI6L 1WAEA 1YHTA 2GSJA 1JG9A 3AICA 1OVZA 5HGBB 4MCZA 2EDFA 3IJIA 3CSPA 1GMEA 2Y5TB 3NDZE 3PJUA 1DQMH 2EDJA 3TFKD 2GQ9A 4I9AA 4YDLC 1NIAA 5CCKH 4PGLA 1ACCA 1JEZA 3V5KB 1W8OA 3IFLH 5EIQA 4ZFMA 5IB4A 3PZUA 3QMSA 2ZOXA 3RTQB 4W7WA 2XZCL 3AT9A 3OF6D 4GMSL 1NCBH 4Q52A 4D6DA 1PNCA 1MAML 4N86A 4HFUH 3QW9A 5IGXL 3M64A