4NX0A

Crystal structure of abp-wt, a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
430
structure length
430
Chain Sequence
SMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVDDIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
total genus 151
structure length 430
sequence length 430
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nx0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx0A01
4OV9A 1SMDA 2ABBA 2ZZ1A 3LI1A 3KEHA 1IGSA 4RXFA 2OW7A 2ZA1A 5I0DA 3GXDA 1JF5A 5H91A 5DO8A 2FGZA 3QPYA 3EDFA 4U33A 5CGMA 3MYPA 4MFEA 1GYLA 4X2RA 2ZTKA 3LHYA 2VEKA 1EEPA 2EF9A 3CZLA 2GVYA 1J0IA 1B57A 4WJEA 2BWGA 4WD0A 1SU5A 1HL2A 2IQTA 4LVGA 3IGUA 1ZY9A 1SPQA 1J5TA 1OK6A 4KFPA 2R8WA 4FLSA 1MWOA 3M16A 4X9YA 5HJLA 2QCLA 5LZLA 3ZO9A 5CPNA 3FKRA 2OT1A 4E2BA 4CNNA 5G4WA 3P8JA 1L6SA 3W70A 1O60A 3A23A 3R13A 2VEIA 1RPKA 2WQPA 3CWOX 3IVUA 3VI2A 2O7SA 1D3GA 1KM1A 3UWZA 2E6AA 5HQEA 1OHLA 3CZGA 3NGJA 1ZAIA 1Z41A 3LCIA 2WCSA 3N9RA 3VNZA 1AVAA 1WX0A 1KTNA 4BFAA 1PVNA 5LSMA 3OLGA 4NNAA 2J9ZA 3NQ6A 4O53A 3N73A 2B7NA 4DO5A 4AYSA 4JTSA 1QMLA 2D73A 3BAKA 3DGRA 3HB9A 2CLKA 3G0SA 4TIMA 5D2TA 5C55A 3S8HA 4GKLA 3HG4A 3FS2A 4UTLA 2P10A 3P5ZA 3O8AA 4K7YA 3N14A 1HL9A 4JS3A 2F7RA 5D32A 4Z1DA 2V2CA 4AWSA 1TTJA 1CGXA 1X8FA 3S42A 4DPQA 1SZEA 4NI3A 3TSMA 1A53A 3BLBA 1ZJIA 1BPLB 3STFA 1PZ2A 2XWEA 3N2XA 3NG3A 7CGTA 3ZR4A 1Q6QA 1VR6A 2RDUA 4O0ZA 2ISVA 2GOUA 2NX1A 3TJLA 4IGHA 2XFWA 4CKQA 5D05A 3MJYA 4J3SA 3UYCA 4ADSA 2FH8A 1MO0A 3O63A 3MBDA 4UTMA 3EDEA 1J0JA 3QC3A 3KVLA 4HNTA 3VSTA 1OB0A 1BWLA 1GVSA 3E49A 2RFGA 4MIMA 2QF7A 1OFQA 2ZUUA 4AYGA 3EJTA 4IPIA 1W56A 2AGKA 4GO9A 3Q94A 4GUHA 4AB4A 1IXNA 1QHOA 4MY1A 4PODA 5AOUA 2FHCA 1B2YA 4NXSA 5U4NA 4A29A 2B7PA 1U5JA 3GIYA 4KMQA 2Y62A 2QCHA 5CZSA 5I3GA 3HGOA 3K1DA 4GE8A 4AEFA 1UA3A 3W38A 2C1HA 3AO0A 5E6ZA 1SUXA 2OJPA 1WYIA 4O19A 1QPRA 4HT3A 3FFSA 2G3NA 3HF3A 4AHOA 1RP9A 3CLWA 1XH0A 1K02A 4WQ6A 5LNWA 2V82A 3FEMA 3NQEA 1O95A 3NXFA 5DLCA 5I3IA 1QHPA 1OJXA 4JTTA 1G1YA 1W5QA 3R8RA 1XD0A 3W7RA 5D37A 1CIUA 4MKNA 3CHVA 3SY5A 1JR1A 4DELA 1VYPX 4OWGA 4IXHA 3L67A 3NDOA 3UY7A 3D50A 3NM1A 1RVGA 3GXPA 1EB3A 3G3DA 1QW9A 3OG3A 1LBMA 4JTIA 2YIHA 4FNRA 1VIWA 3MP3A 3C61A 2X16A 3K8MA 1HG3A 3BCFA 2XIIA 1KXQA 4PH6A 3A9IA 1MW2A 2PRLA 3ATYA 2WO5A 3PWAA 2YXGA 3EJRA 1OGSA 4PSRA 1XBXA 2XN1A 4H8UA 2YPIA 3O6DA 4EOUA 3W87A 5FF7A 3F1QA 4C1KA 1P1XA 3PC0A 3UWWA 1VC4A 1JCMP 3TKFA 1YPIA 1EP1A 4I7VA 1PAMA 2PE4A 3C2OA 3UWVA 4BF9A 1OYBA 5AC8A 3HMJG 1OFPA 1OFRA 4ML9A 5A2BA 3T40A 3WNMA 3TFXA 3W7JA 1TRIA 2GVJA 3DFTA 4LNYA 1KCKA 3W1MA 3GR8A 2B4GA 3BC9A 2Q3RA 1R30A 1KLYA 5KZMA 3D0CA 4O57A 2ZUWA 3VFLA 2DZPA 2G96A 5G4EA 4U2ZA 3W7PA 4WSKA 4AMWA 1AW1A 3N19B 1G5AA 1DJNA 1QI3A 2Z1KA 4Z1AA 4UR7A 3EX3A 5FF2A 5D02A 2XVKA 1IV8A 4KWUA 3HOJA 1ZAJA 3NQ8A 3OLIA 3G18A 1VCVA 3LBCA 2ZRUA 1V5XA 3S1WA 3ZWSA 1OX5A 3LCXA 2ZUTA 1WBJA 4TMBA 1G4PA 1YDOA 2Y7GA 3DX2A 3QSTA 5FF3A 3P62A 5I23A 3UG5A 2OYKA 5EA9A 3TIMA 1QPKA 3ZT5A 1TTPA 3KOFA 1A5AA 3LX9A 1TIMA 1XD1A 4RZ5A 1MVYA 1CXFA 3V1PA 3ZSTA 2QCDB 2VFFA 3GXFA 2OZ0A 3FAXA 3W7DA 4LTSA 5CXPA 3UEQA 4NJIA 1OG0A 3W2KA 4O10A 4AMXA 4GI9A 3TXVA 1JXKA 4G1KA 2V30A 4FXSA 1AMYA 2AMGA 1LOSA 4R33A 3DDFA 4JXCA 1TPFA 2ZX5A 1CPUA 2QPSA 5KEZA 1DV7A 3IK2A 1KM0A 1JL8A 3W88A 1OFOA 1TMQA 3T7VA 3DX4A 1GTHA 5DBTA 3S0CA 3BH4A 1TREA 3PUEA 5J5DA 1NF0A 3QZEA 3TC6A 2HSAA 4ZMGA 4AHQA 3C4UA 1W5OA 3PR2A 3WDJA 1KW1A 1VGAA 2HS6A 3KXQA 4YXGA 3DHPA 1MSSA 3NPWA 3QQ0A 4PC8A 1GVQA 4NZJA 1O94A 2CLHA 2NXIA 2ZE0A 1R75A 1EUNA 3VCRA 3TW6A 1XUZA 3M5ZA 4CNPA 1LZOA 3NL5A 4LS2A 4LVAA 1PIGA 3AMLA 4LRSA 1EH9A 2WJZA 3LLDA 1IXOA 2V3EA 4H6KA 1PCWA 5A6LA 5HULA 3LOTA 1MW1A 5KMYA 2G95A 1WOAA 2A7NA 3ABQA 4TO8A 2F7PA 4BZYA 2BXYA 5AHEA 4U2YA 2NT0A 3S1UA 4AEEA 1XI3A 2WVSA 3AXIA 2O7QA 1VHCA 4B9YA 2BSLA 1JI1A 2JBMA 2ZRXA 1QWNA 3QM3A 1MZHA 3W1PA 2BY2A 4FIQA 4IX0A 2CU0A 3WJSA 2C14A 1CW2A 4FF7A 4UR8A 2ZA2A 1O7DC 3CQ0A 4XKYA 3TMQA 3L5AA 4AWUA 1YLVA 1KXVA 4IXXA 3HGSA 2VFHA 4ZZ9A 5EYWA 3BVUA 1VQTA 5F7UA 3W07A 4MZ1A 3UWQA 3EX4A 3W76A 2E9BA 4ZQRA 4J28A 1JG9A 2NWRA 1TPVA 2QJHA 4JTGA 2WVVA 2OX1A 3QEZA 8CGTA 5G1TA 1ME7A 2TRSA 1QOQA 1F7BA 2FH6A 3D52A 4X0NA 3KL3A 2PWFA 2ZQ0A 4FNSA 4N6FA 5D30A 1K7XA 2CW6A 1PS3A 1ZJBA 3DXIA 2AQWA 3W84A 4PFMA 4CVWA 1Z44A 5L9FA 3NQCA 4H3DA 3IGSA 3P74A 1YDNA 3E12A 1K03A 2DIEA 3TOPA 5E0FA 3WK0A 4A3UA 5KSWA 4X3ZA 1FBAA 1GYNA 3NQ2A 1DOSA 3NZ1A 4LV9A 3EXTA 3UXAA 3D4YA 3UERA 1UH4A 2YSWA 2EKCA 3TTSA 3DHFA 3W86A 4DF1A 5D38A 4GI6A 3W23A 3BW4A 1SQ7A 2QKFA 5D03A 2CZ5A 1GVOA 1PIIA 3P7YA 1TRDA 4UFIA 4NZFA 1JUBA 3BG3A 4NVTA 2E68A 3GBDA 4XTIA 3JS3A 3IRDA 5LNRA 4UTTC 5I3HA 1KXHA 3L4WA 3HPXA 3Q58A 1CXIA 2WKJA 4MJMA 2NX3A 5HWJA 3STCA 4K8EA 4E38A 3W1LA 3S5NA 1FDZA 4CNOA 1W31A 3GZ3A 2V81A 5D2XA 3W7QA 1R46A 1AK5A 3NOEA 4UNKA 1SO4A 4R34A 2E6YA 1JCLA 2ISWA 3MMTA 1FWSA 1TPB1 3WJYA 2GJPA 5A2AA 2CLMA 3PBVA 1EP2A 1V3LA 3BLEA 1UKSA 1FDYA 1FWWA 2ZBTA 4JYEA 3OIXA 1VJSA 2WPGA 1WPCA 1BAGA 4GIAA 1YPFA 3K8KA 1OX6A 5A2CA 3EKLA 1Q4NX 4ICNA 2ZZ5A 3KHJA 4Q4KA 3RNDA 3TW7A 5K2ZA 1OFBA 2FDSA 5FEWA 3C3NA 3TTYA 3WNPA 4PCTA 5G2WA 1LRTA 3W22A 2OMAA 3VO0A 4UFLA 3KVJA 1U83A 2TMDA 3CU2A 5FF4A 2G3MA 1SO3A 3M0ZA 1EUAA 1R2RA 3G1HA 3LHUA 4NUWA 3E9AA 2J9YA 1SZFA 2CPUA 4IQLA 2WKLA 3ZT7A 2V3FA 3WNKA 4O54A 4GUIA 3WK2A 1X6UA 4NX5A 3BMWA 2DZWA 2E5CA 1LLZA 5GVJA 4O16A 1AQHA 2RHGA 1BF2A 1K7EA 1UBSA 1OK4A 4MAZA 1CI1A 4YL2A 2QR6A 2QUTA 3S1XA 4O1AA 3NZRA 2R14A 4J3VA 2YJQA 3EX1A 3O07A 1XSKA 2A1YA 3JRKA 4XBSA 1JCJA 1G4SA 5IBXA 3RLVA 2B0MA 4M7SA 3SECA 1Q6RA 4PTNA 3QPZA 2PWEA 2NZLA 1KM2A 5CPLA 4GO8A 1S5VA 2WNNA 2EEXA 1WZKA 5D2YA 3VM7A 3QRHA 4JX5A 1RPXA 3G8EA 1NM9A 1GT8A 2DJLA 3BVTA 4CLMA 1DVJA 3W7HA 1G67A 4BA0A 3BO9A 1GTEA 1SW0A 3HBLA 3LM7A 2D0HA 3WY1A 4MJZA 1FWRA 3IVSA 2VUYA 3L2LA 2YX0A 4MFDA 4IMEA 1U2YA 2YYTA 1BLIA 3I7SA 3MHGA 5CGQA 1AW5A 1H3GA 1YDVA 2NT1A 2BY1A 4EVZA 3VX0A 3EEGA 1VPXA 4XBKA 4QJ1A 1ZHAA 3NO5A 3TSBA 3W73A 3Q2DA 4GRSA 3GB6A 3KLKA 1BSIA 3CTTA 2ATMA 1HT6A 1G7UA 5CKSA 1CLVA 5E6YA 3S5OA 2QCGA 1KBJA 1KFBA 5U7SA 2ZYFA 1DHPA 1AL8A 3WY2A 1P0KA 3PM6A 3QH2A 4UIOA 2XIBA 3VMNA 3T78A 2WNZA 2DZTA 1E51A 3JR2A 2PRHA 3QMRA 3B8DA 3TONA 3C2VA 5A8GA 3W83A 5IBXC 1EHAA 3EJSA 1VFUA 4XUGA 1WDWA 1TPDA 3TUUA 3TSDA 2H6RA 2EHHA 4MY8A 2J27A 4YWIA 4U3CA 5TIMA 3B05A 1CGUA 2J6XA 1QO5A 4FLOA 1RV8A 1GVRA 1JDAA 4WY0B 3SGUA 4J3UA 2A6LA 3PG9A 4N4QA 3ZFHA 1B4EA 4A2RA 3P60A 4OBTA 4DBDA 1VCFA 1IZJA 2VFDA 3ATZA 1H7OA 2E8YA 4FX8A 4J3XA 4Z1BA 4QNEA 3L0KA 5AC6A 3DFOA 2ATSA 3WDHA 3GNDA 3PAJA 4JX6A 3W2UA 4FHAA 1PHQA 3HJZA 3AXHA 1TQSA 1RQEA 3R5EA 5EL1A 1L6YA 1IF2A 3BUBA 3EWUA 4O8RA 2GJLA 5T26A 1WBHA 4UZSA 3HQ1A 2YCEA 4HOXA 3MWAA 1MEWA 1SW3A 2ZZ2A 3VGDA 3BUDA 3W7LA 4UQCA 2FFCA 1KV8A 3BG5A 3PULA 3PUOA 1UJPA 4NX0A 4XQ6A 4FO4A 1CGYA 4NT0A 1OT1A 1PIFA 4UXDA 1D9EA 2NX9A 4MZ8A 5CGTA 1PHWA 3W71A 3O1NA 3L4ZA 1T8XA 1XSIA 1H1YA 1KFLA 1I75A 1M7OA 2ZX6A 2F2HA 3KRSA 3OVRA 2CFFA 2J88A 3DBPA 1CXEA 2BHZA 1NVMA 4OKDA 4QAWA 1OT2A 4U28A 5DY2A 1TPC1 3W85A 1LM1A 2BZNA 4ALDA 2A7RA 1TTQA 5C5YA 5AHLA 3IJ8A 3L66A 3G1XA 2CLFA 2FIQA 3WJWA 4BI7A 1A5BA 6TIMA 2TPSA 4IMGA 4AVFA 1UD8A 1EA9C 4ZQOA 3M5VA 4N2YA 1E3ZA 3BG9A 3P81A 3OVPA 3GDRA 4CQ9A 1GJWA 3IEBA 3NPVA 1ALDA 3NQMA 4UOQA 1D3HA 2A5HA 2W0UA 1OFDA 3O15A 5KZDA 1KFEA 4LC8A 2Y70A 4NNCA 2ABAA 1FCQA 5I24A 3UZJA 4PCFA 2ZRWA 2Q8ZA 1LLWA 3D51A 1ZJAA 2Q3OA 4JICA 5AYYA 3NL3A 4M5PA 1A47A 1M53A 4OQVA 1JUEA 2ZXBA 5AYXA 1SFLA 3W1NA 2XN0A 3TDFA 3IIXA 3NVTA 3DHUA 4JL2A 4TU1A 1TTIA 1MXDA 1C8QA 1BEUA 1WAUA 4JTHA 1WO2A 2FLIA 5HMSA 4UFKA 4KKXA 4OIFA 5BRPA 3UWUA 3NEVA 1LROA 1B0IA 4XB3A 4FXRA 4UQDA 2OYMA 1WA3A 1TQUA 1VFOA 2FHFA 1HWWA 3UZ5A 3VNYA 1FXPA 5FEPA 3WNLA 2IGTA 1KTBA 3PBUA 1TPWA 2V2HA 1TQXA 3L5LA 2BY0A 5A5WA 3BAYA 4K37A 4X9SA 4AWTA 5AHFA 3TC7A 3NL2A 1UD6A 1GWJA 2I1OA 1F05A 4UTUA 1V3MA 3CIXA 3STGA 1TJPA 2RDWA 1KV5A 3RU6A 1IIHA 1QO2A 1XC4A 2WSPA 1TO3A 1QWGA 5CG7A 5MHBA 4W93A 4I7UA 2WNWA 1Y7VA 3BVVA 2JKAA 3FIGA 2VELA 3S5YA 3W1XA 5AB3A 1Q45A 3L9CA 1K8YA 2EAWA 4K38A 3C8FA 2XWDA 4LWWA 2WVTA 1ZS2A 1PEZA 2ZZ6A 4ZQCA 1KBIA 3LTPA 3P67A 3TCEA 1SSDA 5BNKA 1JVNA 4JYFA 1MXSA 1WP6A 3OVQA 4L4MA 3HPZA 1JF6A 2V9DA 1UH3A 2JKPA 3ZS4A 1ICSA 4GQQA 4FX7A 1G69A 1EP3A 3VGFA 1P6WA 1YXDA 1BVNP 2QDGA 3ZWTA 2VEMA 4WY0F 3EDKA 3K8LA 3CM4A 2DJXA 3OLEA 3PY2A 3BVXA 1KWKA 3W2LA 1H7RA 3KL5A 1IXPA 1R34A 2V2DA 3WENA 2BHYA 2AAAA 3EWYA 1KLZA 2B7OA 1FDJA 4Z08A 3L2IA 3DFSA 1JUKA 4JN6A 2NSXA 1ADOA 1W3IA 3IIVA 4DPPA 3FLUA 2EPHA 1HO1A 1BTMA 3NQ7A 2GVGA 4LXFA 3IIPA 2CLEA 4O1CA 3QW3A 3VMOA 4FNQA 2ZXDA 4WOQA 1ZCOA 4JX4A 3W7MA 2GQ9A 5HNRA 3ZT6A 1JI2A 3GX9A 1GJPA 1O5KA 3F03K 3LTSA 1EA0A 2RH9A 2Y2WA 3UQNA 1VCGA 3OHIA 1G7VA 3SSJA 3KL0A 3ELFA 2EQDA 3RFAA 4FEZA 4UMCA 2I9EA 3BVJA 3SFKA 4JFTA 3O16A 1KA9F 2WSKA 4O1BA 3L68A 2QAFA 4MY9A 4PEEA 1NFBA 2ZA3A 2LLEA 3F4NA 1OF6A 4UQEA 2DIJA 4JYDA 3TE9A 2F7OA 5EKYA 1TQWA 3P8IA 1GPWA 1UD3A 2WNQA 4GUGA 2PC4A 3E0IA 1UKTA 2FPYA 3LPPA 3W7GA 4RK8A 3EWWA 2GJRA 4UFMA 3YPIA 1VB9A 3OA3A 1I2RA 1W54A 3NYZA 4MOZA 1SO6A 3FJLA 3INPA 3CV5A 3ZOAA 1KM3A 2A6NA 4ATWA 3LERA 4OE7A 1UCWA 1S3HA 3BLIA 1Q6OA 3WJZA 2CLOA 4FB7A 1XSJA 1JDDA 1JDCA 4JIPA 3AJXA 4PSPA 3N9SA 3FKKA 3MI2A 4HPHA 1OX4A 4IMCA 1TJRA 2VXNA 3B0PA 3IVTA 4AAJA 3HG3A 2QEZA 2D3LA 1Z32X 1PL9A 4Z1CA 1LOQA 3G1DA 4OV4A 3HPSA 5KITA 2ISSA 2Z1BA 1DKWA 1K3UA 2F84A 2H90A 5DFAA 5HUPA 3NQVA 3L4UA 4FNPA 3LI0A 4QSHA 1FQ0A 3KFTA 4DF2A 3BAJA 2WPBA 3W7NA 4UMBA 4TR9A 3QSRA 1MEIA 4QISA 4M7TA 3BLPX 1FUYA 3W6YA 2V0TA 3LCHA 2EABA 3EWBX 3PVFA 3AJ7A 4H8HA 5CLWA 1GQNA 1GG1A 1ME8A 3EJPA 4MVAA 1J2WA 3C52A 3S6DA 3W2MA 1HNYA 5F1UA 2YA2A 4OU1A 4QQ3A 2B7QA 2YFNA 4NU7A 4LW7A 1ICPA 2VRKA 2R94A 4JFUA 2D2OA 3M9YA 3H54A 1TYGA 4L4LA 4ZVJA 2E0PA 2YOCA 3UG4A 4FLRA 2A7PA 1H7PA 5G1YA 3KAOA 3U8GA 1W37A 3EDDA 3NNTA 4YLWA 2ZXQA 5FESA 1JXJA 4OGZA 3LBMA 1VRDA 4LQ1A 6ALDA 2D3NA 3FA5A 3P5YA 4J9JA 2Y7EA 3L0GA 2Y61A 1AMKA 2RKXA 3UCQA 5HR6A 4GXMA 3DENA 4MYAA 4AH7A 2EJ1A 5D2VA 4BWLC 4R53A 2G5WA 4WUIA 1P0NA 4UZUA 2D0FA 2PWDA 1JJKA 1WOBA 3TU9A 1G6CA 4UNLA 5G5IA 7TIMA 3TXZA 1NOFA 2R91A 3W75A 2DZUA 4QITA 3B0VC 2E6DA 1HTYA 1WZMA 3SGZA 5E93A 4IJBA 2E8ZA 2V8ZA 4Z0JA 4ADTA 2ZRVA 1QCWA 3P82A 3O06A 4UUIA 1BG9A 4AF0A 1XCXA 3G1YA 4A22A 1AL7A 1OFAA 3L4TA 4CGTA 1PV8A 1ODUA 1JQVA 1EPXA 4K7VA 4HOWA 2DH3A 1T96A 2VT0A 4QM1A 1R2SA 4UC5A 2QCCA 3TMLA 5CSRA 2A85A 3UY8A 3KLLA 3N2MA 2VFGA 4H4IA 2WSQA 4ZQPA 4RR4A 3ZSSA 1JIBA 4I9AA 3QF0A 2GQ8A 2Y88A 4AIEA 5F2MA 1BVZA 1L9WA 5DXYA 2QJGA 4UQ9A 1D3CA 3LHTA 2PWGA 2YZRA 3RIKA 1LTDA 2QUUA 2E5BA 1JGIA 1VZWA 2BY3A 1DHKA 3W7EA 1LYXA 5J5RA 3UPBA 3DZ1A 2X2HA 2I14A 3SJ3A 5D04C 4JIQA 4JTLA 4P2VA 4JTJA 5IM51 3BUIA 4JY8A 4WZHA 4UCFA 1GOXA 2VNCA 4WF7A 3E96A 4UTHA 1UA7A 2QUVA 1QDSA 1TPEA 5AN7A 3VE9A 3IJ7A 2QLYA 1WXJA 3BUQA 4N9CA 4GJ1A 4TMCA 3QYQA 4IPJA 5CSSA 1GEQA 3FYOA 3HGRA 3W3OA 3DI0A 3MHUA 4IMDA 3GXMA 3TAOA 4GUFA 2Z2UA 3ABSA 2BHUA 3S5ZA 3S2CA 1BWKA 2YW4A 3U2OA 5HWMA 1LWJA 4RLIA 3LCGA 4XWUA 3LRKA 2VENA 2QDHA 3BGGA 4LUJA 1EX5A 3KRZA 3Q37A 3FJ6A 5C6MA 3BAIA 4Y96A 3W7OA 2CHNA 1C8VA 5K3VA 3LDVA 2EACA 4BWLA 2BXVA 1N8FA 3I7RA 2PRMA 4X22A 4JTKA 3A4AA 2BLEA 5LNVA 1ZAHA 5TQLA 3M07A 1QW8A 2FB3A 2YYUA 4RCXA 1W5NA 4AXKA 4U31A 1UB3A 1KWGA 3BW3A 5F2GA 2YGYA 3VMPA 1DORA 1PS9A 3G8RA 3NM3A 3IIZA 2NUYA 3TK7A 2F7FA 2Z6IA 5EY5A 4AEOA 4O18A 2FE0A 3GR7A 3CPUA 4WX2A 2NWSA 4PL2A 3VM5A 3R12A 4M6VA 1T99A 4UTIA 4JY9A 3VU2A 2YFOA 4GINA 1RR2A 4XZ9A 1YTDA 3QMSA 5DCDA 1D7FA 3L2MA 3P80A 4FIRA 1H50A 3W1UA 1UD2A 4FNUA 3B06A 3WEOA 3OEXA 4NQ1A 1F2JA 1UH2A 3GDLA 3WK3A 2ZIDA 3W7CA 3HO8A 1TB3A 3EWXA 1HL8A 1VFMA 1P5BA 2ZZ4A 5LKYA 3MHFA 2H8XA 2F7QA 1G4EA 1TMHA 2CLLA 1JRBA 4TX9A 5G2IA 3TAKA 1H1ZA 4DQWA 2BX7A 3II1A 2QPUA 1QI5A 4HHPA 4ORIA 3KRUA 2JGYA 3BAXA 3ABRA 2VEPA 4LVBA 1QFEA 3NA8A 5G2HA 2CZFA 3M47A 5C2XA 3L4VA 1UASA 1FXQA 1NAL1 4AW7A 4HNVA 1EWEA 1K7FA 1JCXA 4O0KA 2PWHA 3L5MA 4MB1A 1ICQA 4W9TA 1B3OA 1K8XA 5HPOA 3FYPA 3T55A 1TCDA 1FCUA 2X30A 3PB2A 4K39A 3FW6A 1JQXA 1TSIA 3NPXA 5FEZA 1UUMA 3M5YA 2FJKA 2FQIA 3L0NA 3OLDA 4HSOA 1FX6A 3PF3A 3STEA 4M6PA 1RD5A 3WK1A 1YXYA 4M19A 3R89A 3GYEA 4C1LA 1MFUA 2C0AA 4JCLA 5I3FA 3CZEA 3BW2A 2A21A 3TROA 3D4ZA 3L65A 5DN1A 2ZZ3A 2ZUSA 4PCSA 3CIWA 3CLMA 3G1AA 2GVLA 4DO4A 3LRMA 4POCA 5BW6A 3UNDA 2HTMA 4KWVA 4O13A 5F4XA 3U6WA 5E70A 2X2IA 3GDTA 1EIXA 3V75A 3VNDA 4CCCA 3IV3A 1PJ9A 1PCKA 2ZRYA 2XVLA 2XVGA 1ZENA 3PG8A 3PSVA 3EX6A 3TX9A 4S2CA 2Y89A 2YA1A 4BI6A 1AG1O 1I45A 2CZEA 1IZKA 1H63A 3NQFA 3GBEA 2Y4SA 2QCEA 3HG2A 1N7KA 1WZLA 1CYGA 3A22A 1GZGA 4UMAA 2H3DA 1LBLA 3EXRA 3G1SA 2OSXA 3IIOA 2WV8A 1QPQA 1L2UA 3I65A 1U30A 1W9XA 1XXXA 2VKZG 2AAMA 1S5TA 2ZICA 4HA1A 4ZQNA 4WXYA 2Z6JA 5LHEA 5LGZA 1H7XA 4GUJA 4B5NA 3BAWA 1Z48A 1SFJA 1JFHA 9CGTA 3BUPA 3GAYA 3LHWA 4EIVA 3RF9A 3GK0A 2WC7A 1LCOA 1O5XA 2DH2A 3LTYA 1XUUA 1XDMA 3BSGA 2YW3A 4O50A 2F18A 1KM4A 1DJQA 3DH7A 4UTWC 3EB2A 3C0JA 2QAPA 3BK0A 2QMJA 1PPIA 1HO4A 4QAIA 2FPTA 3LXCA 4WOZA 2G97A 1H7WA 3QJAA 2CWNA 2WOQA 5BRQA 2F61A 3EX2A 4O52A 2DORA 1T0OA 2EGZA 3CPRA 3OBKA 1MW0A 2EADA 3H55A 1SMAA 4FMVA 1ZALA 2VFEA 4RZ6A 3PUDA 1YTEA 3PB0A 2GJNA 1JD7A 6CGTA 2HS8A 4HPXA 3RILA 1VS1A 4EWND 4O11A 1OF8A 5LHFA 2OT0A 2Z0IA 4WY0A 4AIOA 5I3KA 3BLKA 1A50A 2QV4A 3NR0A 3HJEA 4WLCA 3DDGA 5EMUA 1GVFA 1QI4A 2QCFA 1WE5A 4HP5A 3GAKA 4FX6M 4LOCA 4NJKA 3W7IA 3A47A 2OSWA 1LWHA 1RP8A 1W3NA 3W9ZA 5CPMA 3WNOA 3KVMA 4RX0A 1J0KA 1LRQA 1N55A 4O17A 3WFAA 4LV4A 1QX1A 4Q32A 5DXXA 3W2JA 2P0OA 1TV5A 1GJUA 3HZ3A 6TAAA 1DL3A 1VJIA 3MO7A 1TPUA 4DO6A 5DY3A 2UV8G 3UXDA 3M43A 3WY3A 3FOKA 4WXZA 4GI8A 4UQBA 2DU2A 1F6PA 3B04A 4H8VA 1CGWA 1HXKA 1XGZA 3LCWA 3KWXA 3M6YA 4UNIA 4UFJA 5LGXA 2WVUA 1R47A 4JR5A 4DF0A 2H8ZA 3BCDA 4GNJA 3WFZA 2F1BA 1ZNNA 2QJIA 3GXIA 2NXHA 5EMYA 1MEHA 1VYSX 3BSHA 3BLFA 5AFDA 3KVKA 1MW3A 1KGXA 5A6MA 3LV5A 3HG5A 5HR7A 3BPWA 1FWTA 3A21A 1J4EA 1WQ5A 4HPJA 3TJXA 1QNVA 2EO7A 3GTNA 1NEYA 4XKYB 1KFKA 1HVXA 2JGQA 3BARA 3USBA 2GUYA 2E6FA 1LOLA 3MW7A 5AHNA 3W1RA 5K4ZA 1QOPA 2WKGA 3CTLA 1I2PA 3ZR5A 1LP6A 3M41A 3WJXA 3O6YX 5E9AA 1XH1A 4JNMA 3W2NA 2TSYA 1WZAA 1W1ZA 3GDKA 4NXKA 3CB8A 2QCDA 3EKZA 1S46A 4S1FA 4KFNA 2NLIA 5F4SA 2BTMA 3TV8A 4HOZA 4LS1A 3S9YA 5K4XA 3LXBA 1LBFA 4NNBA 4O1DA 3BVWA 2ZTJA 3MBFA 4I7WA 2VC6A 2QMKA 4O14A 4UTKA 1M7PA 2TYSA 2C19A 4HKPA 4CN4A 1GVIA 4JFSA 3CEPA 2Y85A 5DCEA 3M1ZA 1F5ZA 1OABA 1W5MA 3C2EA 3QW4B 3T44A 1X1ZA 5AYZA 4JEQA 1DQXA 4OHQA 3AMKA 4YMZA 2OSYA 3LB0A 5EPDA 4N6EA 3THQA 4Z0SA 2Y7FA 1AW2A 1OVDA 1LDCA 3DFPA 2D0GA 4K8HA 3DHDA 4J3TA 1G9HA 3EXSA 4LVDA 2X2GA 4KFOA 4E2OA 3VGEA 3BMVA 7TAAA 1XFBA 4MUZA 3VGBA 5KZEA 1LORA 1BKSA 4CCEA 5TD4A 1QPNA 1TQTA 2BXZA 3LXAA 3DKJA 1SZNA 1SZGA 3LHVA 3NQAA 4LT9A 1ONRA 4TVUA 3THAA 3LV6A 1GG0A 1H62A 3C6CA 2WVVB 4CN1A 1G4TA 3O05A 4JDYA 1I2QA 4J27A 1TV7A 4HIBA 1X7FA 1TPH1 1DTUA 3WELA 4IMFA 4Q33A 1CGTA 4O28A 4Y8FA 4ZL1A 4LPCA 1I4NA 4D2JA 3M5XA 1XKYA 1XH2A 4JCMA 1L0PA 1CXHA 1XDLA 2ZFAA 3W1AA 3G0UA 5CZ0A 1NF7A 4GFSA 1THFD 4E0CA 4U4MA 3QGVA 2ZXAA 2FPVA 1XV8A 1F6KA 2C7FA 3LCFA 3B4UA 3SZ8A 5HUOA 3DX0A 1XCFA 5D2WA 1TCMA 1KFCA 3MI6A 1IXQA 3A5FA 4IWWA 1B4KA 3WEMA 2ZCGA 3VX1A 5E1QA 2WANA 1HTIA 1NSJA 3C56A 2NUXA 2JK2A 4MLJA 3ABOA 1QPOA 1E3XA 1CX9A 5CZJA 2X1RA 1CXKA 4O15A 1KTCA 5C54A 1KB3A 1H7NA 2J9XA 3QQ1A 3B0UX 2X1UA 4IUOA 1GCYA 4XTDA 1ME9A 2E4TA 4N9EA 3G0XA 2C13A 4HSNA 1FCBA 2NUWA 4YCPA 3WN6A 1S5WA 4UCGA 1Z42A 1PZ3A 3ANYA 4O12A 3NQDA 3CEUA 5CZTA 5FI8A 3DI1A 3M44A 1YTKA 4JTEA 5L6UA 2NV2A 2X1SA 1E43A 1KXTA 3QFEA 3DC0A 4N9DA 4Y90A 3CZSA 4RKAA 2Y5EA 3GXTA 3KX6A 4JL1A 1KFJA 2EAEA 3W74A 1R33A 3RMJA 1QWUA 4BK9A 3T4CA 3DX1A 2V5BA 4PL1A 5LNSA 3SW6A 2VRQA 1LRNA 1TQVA 4LS0A 1QAPA 2W6RA 4CN6A 3UPWA 4DEFA 2E77A 1G94A 1EWDA 1W0MA 4J3WA 4JTFA 3DKLA 4ONVA 2A4AA 3LHZA 3N3MA 4JTUA 3G1FA 4P61A 1JAEA 1KBBA 2V5LA 2Y7DA 5EBUA 3L4YA 2Y6ZA 2GQAA 3ZR6A 4FNTA 4HN4A 1RQHA 5K7JA 3C2FA 3IGXA 3L4XA 3C2RA 1CXLA 4GQRA 1JCNA 1EO7A 3GNNA 1U33A 4A2SA 1KGUA 1F73A 1CGVA 5AHMA 3PSWA 3LGEA 4A21A 2J24A 2VOMA 1FWNA 3TQKA 3W7KA 2YDAA 4IX2A 1JD9A 4AMAA 1SO5A 3GKAA 2GPTA 5F4WA 3PBYA 2W79A 2P1FA 4MYXA 3FAWA 3IJ9A 4RXGA 5ABTA 4RZ4A 3A24A 3MP5A 3GVGA 2CXGA 1I2NA 3EJUA 2HMCA 4LRTA 1FY6A 1AQMA 4UFHA 2FYVA 2C16A 1OSEA 3TA6A 1MFVA 5AC7A 4WSJA 1CDGA 1EO5A 4H7VA 1B9BA 1SSGA 3RLUA 5CLTA 3SR7A 2NV1A 2CZDA 4J7RA 3LLFA 3NL6A 4PA8A 3WNNA 2YA0A 3LPOA 1VLIA 2RDTA 1HFBA 5F1VA 4EF9A 3TH6A 1RZMA 1UKQA 3VGHA 1O4UA 2Y24A 2ZX9A 5KTLA 5F2IA 4CCDA 3VSUA 1W8SA 1W3TA 1YXCA 2YR1A 3GDMA 4JFVA 5D33A 2C6QA 3MI3A 5BOOA 4JD4A 2FB2A 4UTWA 1FCVA 3EJQA 1A5CA 1SR9A 3MUXA 4FLQA 4EF8A 3TQVA 3W37A 5FF0A 2GUUA 3N34A 2ZZ7A 1P4CA 1OFEA 3G22A 2Q8LA 4RJEA 3GKFA 2X2JA 1HX0A 4CQAA 5HWNA 3I7QA 3DAQA 4KWWA 2WCGA 1UD5A 3KE0A 3QMTA 2F1AA 2OCZA 4AF0B 1C29A 4JDBA 1M7XA 2DZVA 2FHBA 1J0HA 5SWUA 2E09A 3UG3A 1VH7A 4RV8A 4UTTA 3CZNA 2ZX7A 4N02A 1H51A 1SW7A 2C18A 3LRLA 4O4VA 1I2OA 1V3KA 1YADA 1M6JA 3EWZA 2C15A 3I6RA 4M6QA 2VR5A 3PBWA 3PS7A 4LUIA 1VAHA 5KINA 1H60A 1VLWA 3CWNA 5DBUA 1QR7A 3G1VA 5TBOA 3VKJA 3VE7A 3VSVA 2KZHA 1XM3A 1JCYA 3DU0A 5FEXA 1X1OA 2A2IA 1ZFJA 4QIUA 4H2CA 4MZYA 3WDIA 3P61A 2A0NA 4GC4A 3TNOA 3UD6A 3GXNA 1PE1A 4UOZA 1KM6A 3LCLA 3CGTA 4NJGA 3CC1A 1JULA 3WY4A 3M7WA 3G24A 1KCLA 1K8ZA 4LC6A 5CPOA 3P84A 3BV4A 3NQGA 1F76A 3L21A 4MPQA 1DEDA 1UUOA 2PCQA 2Y63A 3GLCA 4ADUA 3UWYA 3TR2A 3A6OA 4LY8A 4ZQMA 2ZRZA 4M8UA 4PEKA 1V3JA 4BI5A 5LNUA 3MYOA 2OYLA 4UTJA 5F2LA 5K9DA 2ZDRA 4OT7A 3DX3A 5K9XA 3CT7A 1Q6LA 2XN2A 2C8NA 3CZKA 1Q3NA 1UOKA 1V7YA 2DP3A 1KBKA 2VFIA 4K6AA 4N9BA 5K9CA 4YCOA 8TIMA 3O6CA 4MLRA 2QCNA 2QCMA 1Y0EA 4JGDA 1L6WA 2WSRA 2E5DA 4OJYA 4IOTA 4S2BA 4GBUA 4Y9AA 4M56A 3TFCA 3W1QA 4NJHA 3SI9A 3SIZA 5I5RA 2DZXA 3I68A 5D09A 3NAVA 1F74A 2JKEA 3R2GA 1OX4B 4N4PA 1WV2A 1MXGA 4UQAA 3B03A 2E1DA 3G3MA 4GWEA 3E02A 4BR1A 1XBVA 5HDRA 1C9DA 2OW6A 1TV8A 4ORMA 5HXMA 1R2TA 2TAAA 1M5WA 3H53A 3EDJA 4HNNA 2ZX8A 4LVFA 2J25A 3S1VA 2V3DA 4DXVA 3WMSA 3A5VA 2YKKA 1XBZA 2NXGA 4Y6GA 3W1TA 5E0KA 1IIGA 4CQ8A 1OYAA 4R7JA 4E2DA 5H2ZA 2ZWYA 4LU0A 1VHNA 4B9ZA 1DQWA 4HNUA 3W72A 1H61A 3NPUA 1XCWA 1OYCA 1VYRA 2ALDA 3HIJA 1JRCA 4DBEA 3MP4A 2H3BA 3BGJA 5DELA 4O4WA 5BRBA 5I3JA 1TQJA 1YYAA 4NJJA 3ECQA 3TQ0A 3DFQA 1H5YA 3VGGA 3K30A 1ML1A 2C3ZA 2ALWA 1I8JA 5AHIA 2FTPA 3DFNA 1E40A 2PURA 4QNWA 2DZSA 2WSYA 4JFWA 1KM5A 5BMXA 1DBTA 3ZQ9A 1UD4A 4K36A 3F4WA 2ZWZA 2CLIA 1XBYA 1W5PA 1A5SA 5HINA 3RK8A 1XL9A 5DCBA 1KGWA 5BMWA 1HUVA 4AHPA 2X1TA 1RQBA 3HGJA 2ZUVA
chains in the Genus database with same CATH superfamily
2XC8A 2R1YB 4OV9A 2ADJA 2VXVL 4AT6A 4HCRH 1V7MH 1DCEA 2XTSA 4JN2B 5BRZA 3LI1A 3M88A 5TDOB 4XCYB 4XWOC 3KEHA 2WLJA 4RXFA 2OLDA 3TPKA 4B97A 3ZLHA 1E0WA 3GXDA 2VC2B 3UTQB 4BSVB 5LBVA 2FGZA 2WBJB 1GKOA 1TYJA 2CJUH 4FERA 3FK4A 2BDQA 4JHBA 1AIFB 4YHPA 3EDFA 2QSCL 4NCC1 2IDQA 2ZT9C 4QR7A 4MSSA 4JZJB 4PJ5E 1RAMA 4R4FL 3MYPA 3KJ4B 4AGNA 3UGRA 4HZ8A 3S3BB 1MCQA 3M1BA 1YY8A 2D3VA 2ZTKA 2ZNWA 1A6WL 5DLML 5AVTB 1EEPA 3TN6A 1KFGA 3T6ZA 4A3QA 2EF9A 4X98A 1TIWA 3CZLA 4PPTA 3DROA 1XIMA 4WJEA 1QSFE 1FWAC 4FQXA 2DWEB 2D03L 4ONHB 1SU5A 1UHVA 2IPFA 2IQTA 5TE6L 2OWWA 5E56A 4EP8C 4Z2LA 2Y7NA 2J8HA 4X99B 1SYVA 3GHRA 2FO4B 5JHLL 5TK2A 4I85A 2V5JA 4F80A 1JNHA 1SHMA 3QJRB 3RKPA 2I9TB 5ICXA 3WFBH 2OT1A 3H2OA 5J13B 1KYOJ 4KXZH 3REVB 2DWYA 2PFHA 3ENLA 2VR3A 5G4WA 3P8JA 5FO7B 1BZOA 4QHNA 4IU2A 3WUGA 3N40P 3QJVB 1KXQE 1I3GL 2B5IB 4P5SA 3A23A 3TO4B 4F7CA 1O60A 2BMBA 1I1CA 2G75B 4ORGB 2RFXA 4XVTL 3RBSA 3WMPA 1B0WA 4X6DB 1I1RA 1FFPA 1LK3H 1MLCB 4IU3B 2E6AA 2G4EA 3A4DA 3JWNG 1AXSA 5EU3A 2BBFA 2PDNA 4JFZH 1J11A 3NGJA 2IQ9L 5DMGC 1AY1H 4GW5A 1O12A 2YL9A 5HDBE 1DQLL 5FV2A 4M5ZH 5IESL 3VNZA 2O55A 1QNPA 3MRDA 2P3EA 2DKSA 4C8XA 4W7UA 2XIJA 2DTML 4KTGA 3QA3B 3FSVA 2D8KA 3M0HA 2L7QA 5FDWB 1OP5K 3OLGA 4YL4A 5L9DL 4NNAA 1K5NB 4LHQB 3NQ6A 1L9RA 1XF5B 5D1ZA 1PDYA 1WDQA 3V6ZA 1F4AA 1RK0B 3JV0A 4JRXE 4K94L 4WSGA 1QBAA 5HDBB 3FS2A 2YLLA 3P5ZA 2BP8A 1CU4L 2EG8A 3V95A 4DM1A 1D7BA 4ZUWB 2QQ6A 4ODHH 2IFGA 3BW9B 4ZOEA 3NN8B 1KCXA 3DPBB 4A2HA 5D32A 4X9BA 5CC3A 4WJ5A 1WJ3A 4L3EA 3C2AL 3EJCA 4WU5B 4IP4A 4JTCA 1A25A 1A53A 1W32A 4LP5A 3BLBA 2F58L 3D7PA 4KKAD 4U3SA 3X11B 5DWUL 1BPLB 2F74B 3WUEA 2R15A 5JA8B 3BZFB 2YC1B 3WQEA 3U4BL 1Q6QA 2QGEA 3FK3A 3DPDA 1OOWA 4RGOL 3KDOA 3QFJD 3QUGA 3RX9A 1CB2A 4RLDA 3W2DL 2A74C 4UI2A 4JFDE 5D7IB 4WV1C 4J3SA 3U1QA 1IYXA 1EYWA 1OEPA 4O2EB 4XNMB 4ZTXA 5GGRB 5SWSA 4QRRA 2UY3A 4NAEA 4RDYA 5DZPA 4C55A 4WU7B 3IBOA 3LPFA 4GFTB 5FUZL 3SDAB 3ARUA 1QSFB 1E28A 4LLQA 3EFDL 4WEEA 1ZANH 2QTVA 1YE4A 4FFYH 2V0AA 1EBPA 1P6BA 2WLIA 3BHBA 3E49A 2PMQA 2RFGA 1MI5D 2AJZB 3N1AA 2ANUA 4WCYL 2O61B 1MJUH 5GHWL 5IVZA 3VB9A 3GSOA 3WS3B 1PD6A 5GZOD 1OHZA 1W56A 3IUHA 2D24A 4AB4A 1QHOA 3UACA 5AOUA 2HT2D 1E5UI 3QFDA 1ZLUK 1B2YA 4DZ8B 1XQKA 2B7PA 1E0UA 5EU4A 3GIYA 2AQSA 4MHHG 4XO5A 1MJJA 4IIHA 3UNTA 3D9AL 2DWDA 1X5AA 2KZ1B 2SODB 1SM3L 1UA3A 3DRTA 1EJUC 1XZ0A 2WZIA 2NY4C 4XD6A 1UZ6E 2WXHA 1SNRA 3DOHA 2A3BA 1K4DA 1GC1H 3TO4D 1GW6A 1QNZL 1WYIA 2OJPA 4G6CA 3G04A 4JFEA 4OF6A 2MQCA 5D72H 3PNRB 2P5WB 1CD1A 4OLWH 2C9AA 3BP4A 3TCSA 2FT8A 2HRWA 3CLWA 1XH0A 3XINA 3P0YH 3ITVA 2APTA 4F2FA 3P11L 1E9ZB 5FHBL 2OMNA 5LNWA 2R39A 4QHKI 1XIFA 2JB6B 3W0WE 2H9AA 3NXFA 4V1XA 4PUUA 4ERSH 4NERA 1S7SB 1J01A 3VIHA 4FFZH 2WYHA 4FXLA 3S4SG 1KCRL 3EH1A 1W5QA 1XD0A 2YWYA 1OG6A 3R8RA 1DN2A 1CIUA 2WLIB 3WCYA 4RA3A 2PLJA 4IU3A 1I3UA 1DQTA 3EBVA 1H6UA 3QR1A 1PTAA 3FQ1A 5LIUX 4PS8A 2FZ3A 4R4NC 5FYJU 3L67A 3UY7A 3D50A 5JH2A 3NM1A 3CFCH 1YUHA 4A4AA 3GXPA 1L9MA 4A67A 4ZEPA 5C0JB 3J07A 2DI8A 2HLFC 3RWDA 1B3VA 1REQB 4JTIA 1NDGA 4PMFA 2F54E 4RGOH 3MP3A 5INCA 1NM4A 2OL3B 4KI5F 3SCUA 4A3HA 1A5FH 5E2UH 1ZEAH 2E74C 3D25A 3V0AC 3A9IA 1QZNA 1KG0A 2HLAB 2W9LA 4U1KB 3O8XC 4O2CB 5F8RC 4Q7BA 4NPYB 1X97A 2WO5A 3FULA 5EZJA 5HGAB 2YXGA 3EJRA 3ARDB 2NZ9D 1WKFA 1V5JA 2WQUA 5L0QB 4GUQA 4L6DA 2V7HA 2G41A 1ES0B 3L3KB 2X0HA 3TH3T 3O6DA 1A0QH 1ZGLM 5FF7A 2DQCH 5HJXA 1V7NL 4AJVA 1ZANL 4C1KA 1KRAC 2GSGB 2V17L 3HR5B 1J0YA 2W0KA 3SB3A 1NOAA 2H45A 3BPCB 3MS8A 1EP1A 1E9YB 4I7VA 1ACYH 3AS0A 3C2OA 4KUZH 2EDJA 2VQTA 1BWVA 2N59A 2HZGA 3QUZC 4PUNA 1OFPA 3SCOA 3UWVA 4Y1AA 3KYMB 5AC8A 5HHPB 4CVXA 3T40A 5B7YA 2Z34A 1XF5A 2OM5A 4MRCA 5D70L 4RDWA 5DD6B 1OVZA 4KK5D 2Y72A 3UH8A 3BC9A 3G6JA 2JCCE 2Q5BA 4PIRF 5BS0A 5KZMA 3VB8A 2ICWA 3I50L 2Z25A 1YUHB 4I0PC 3WTUA 2FECI 2ZUWA 3CQQA 5A40E 2DZPA 3VFLA 3MCLL 2G2RB 3EYOB 2BVOA 2YPKA 5HBBA 5LKNA 5IT2H 1J6OA 4UWMA 3CHDA 3QEHA 4U2ZA 5J6GA 3DKHA 4JNZA 5JW4Q 3W7PA 4XP6H 4AMWA 5D7JD 1FNEA 2CBUA 1BXXA 1G5AA 3LZFL 4NZ4A 3U5YA 1UIPA 2H32H 3Q2CA 2HLAA 3L3JB 1BAWA 3Q0HA 1Q2RA 5C9XA 4UUJB 4N2FA 3P11H 3LIZH 2TRHA 4PVNA 1FNSL 1OCRB 1XB3A 3OLIA 4ETQB 1VCVA 1ZAJA 3QZAA 1H6TA 2BO0A 1JWUB 1NSNH 2VABA 2IV9A 4JDVB 4GY4A 3SBWC 2IOMA 3OAUH 1ZLWH 5J6HB 3GG1A 1YEJL 1JBJA 4XAFA 4JDZA 1LUCA 2EPKX 3QEQB 1H0DA 4I9JA 2Q87A 3KG5A 3DX2A 4P2CG 4YK4C 1IMHC 4NKOA 2W27A 3UG5A 4LLQB 3AWEA 4U6XB 5EA9A 1GGBL 2TSBA 1TTPA 2WHJA 4QTGA 2CKNA 4JO5A 1FGNL 1NPUA 3Q8BA 4PTUA 5I71B 1A5AA 4KKZA 1EC7A 4QRPD 3GSXA 4N20A 2WBKA 1T7XA 4OLZL 3G6JB 4QEEA 1FH7A 4ODUA 4B5VA 1I9IH 3BAEH 1NLDL 1IAOA 4M48L 4MVBD 5C0AE 3V0JA 2Z31D 4O8AA 3PP7A 2CD0A 3FAXA 5IMMA 2EVJA 4Y2WA 2JCCF 1WGVA 1RZJL 2Y7MA 4V2BA 3QC6X 3OHXA 5KJ7E 1NP0A 5FA4A 5DJ6A 2ZVIA 4GJTB 1FNEB 3KCJA 3W2KA 2PTWA 4G1KA 3IPBA 2J4WL 3MFFA 1OGBA 2O4MA 1AMYA 1W72H 1AAJA 4MBOA 5DJZA 4OV5A 3N6JA 4GVHA 1ROCA 1WC7B 4JHZA 2WGNB 3VGAB 2FZ3B 4PGLA 2UZPA 5JIWA 1LEKB 1PKNA 3CBKB 1WDAA 4BXSV 5I0VA 4D0BB 5HD8C 4JJHA 4CMMB 3WUFA 4F8XA 1OFOA 2G9HA 2R23A 2HVBA 3VZZA 2NDGA 3LKQB 3FONA 1AIZA 3BO8B 3DX4A 3L3OB 1GTHA 4BV1A 3KBJA 5FSEC 2YBVA 3WIFB 3S0CA 3BH4A 3EHBD 4DW2H 5I5MA 3CVIL 1XVSA 1TSHA 2DJUA 3FTWA 4U1NB 1IO4C 2G60L 4M00A 3LKNA 4LY4A 4ZMGA 1Z9SA 1MRAA 4Y1SA 2ATPB 2FL5A 32C2A 4F7PA 4AHQA 1NEZG 3PV6B 1IGJB 4P2RD 1JOIA 5E6IB 4F27A 4V1YA 2P5EB 2ZCLL 3DHPA 3HZVB 5KN5A 1L7IH 1MSSA 1LJYA 2AI0H 2OTUB 4JN1H 2A77L 4ZUUB 3IJYA 4HJSA 2QADD 4YFDB 3RWDB 1VBHA 3TYBA 3S6OA 4PB9L 2OV0A 3ELQA 3HLAB 1OD9A 3CMOL 5F7FA 5AZUA 4AD1A 4L8CA 1O94A 1W1B1 5T9CE 3U79A 1AH4A 3H8NA 4YE4L 2FO1A 1EUNA 4PJBB 2DMCA 1XUZA 1MCDA 2XIQA 4WIQA 2VLLB 3HE6A 4CNPA 3L3DA 3IXTB 4AIZB 1AHWA 4NBZB 5ABEA 1KYDA 3SBPA 3AMLA 1NGQH 5DD0L 5INDB 5IROD 2WJZA 1EGJH 4HWUA 4JREC 2V3EA 3ISRA 2YSSB 4ODVL 3QXDA 1U5VA 2P1YA 3C5XA 4WI2A 1HCZA 2G95A 1A22B 1M71A 4Q0XH 4TO8A 9XIMA 1H3TA 3DG6A 2NT0A 3MGOA 2DWDB 4M6ML 4XPAL 3KMDA 3L3JA 2WVSA 4CC1A 3TS8A 4KDTC 4WI0B 1BZ8A 1CL7L 3GI8H 3IDYC 1ITXA 4JFDD 2JBMA 1QWKA 1QWNA 2CXEA 3FF8A 3QQ3A 1MZHA 1W15A 4NO0B 5SV3A 1EXHA 1QOXA 5CUSH 2FJFB 3UCDA 3GKWL 3WQDA 2C14A 3CN3A 2J4WH 1SEBB 4PJDA 5E5MB 1CW2A 1EJRC 3SUVA 4QHLB 4XKYA 1BZDA 1A9VA 1KPVA 1YLVA 2GAZA 5DEZA 3VIMA 4WCYH 4GY0A 2VFHA 3O6FB 2EVHA 3AIQA 3ZMRA 3LAFA 3ILDA 4PW9A 4GCXA 4B91A 5HGBB 2V69A 4FABL 3MJ7A 5BZWB 4A2GA 2BGNE 1EQPA 5FCSH 3EX4A 3W76A 2AQQA 2GFTA 1DIDA 3EYFA 1ECZA 4D9RE 4B0MM 3H4WA 1CMOA 2BVQA 4NKIL 1VERA 2EICA 2FWSA 1PBYA 4NT6B 1CN4A 3GC3A 3O4LD 5AVUB 3HF3A 4JTGA 1ME7A 1EEZB 2AQRA 5F1OB 1XKJA 5IMMB 3H70A 2PWFA 3L2NA 3RIFK 1DL7H 4ZR8A 5INCB 2HWZH 1EMTL 2CNCA 2A4ZA 4YGAB 5L6YL 4BS0A 2KUTA 2EE0A 3D0LA 3ZKXB 4RZBA 1KG0B 2IFFH 4NZ1A 4KKBD 1Z44A 1JF1B 5EG6C 3NQCA 4HUMB 5DJZB 5EEZA 1K3IA 4OV5B 1XEUA 1Y07A 4KK6D 4H3DA 3BZGA 1NDZA 3WIAA 2OP4H 4ZXOA 3RXZA 1G9ML 2DIEA 3TOPA 4GKSA 4P04A 3OF6D 4KVCL 3HN5A 5K9JL 3ULVC 3RI5K 1J5HA 4P9HC 2EDLA 4X3ZA 4O02H 2GIYA 3I9PA 4MS8D 4H6RA 3NSNA 4PB0L 1XWYA 4C4UA 5D8WA 4AEIL 1FVCB 3MA9H 4OSUH 3TTSA 5JHDE 1DN0B 2UWFA 4OGQC 4PUEA 4S3AA 3NVQA 4JEGB 2IAND 1BLNB 4XBEH 5D38A 5CILH 3RUGA 4D8PB 1MCOL 4WNSA 2Q6WA 1VRXA 2WAQA 1OQOA 4X6DE 2ROYA 3IJSB 2NQHA 5D03A 4FQLH 4TF4A 4N9OB 3U0PA 3QUXB 4QR6A 2PXYA 2J47A 3P7YA 4AKPA 5AECA 1TRDA 3QK0A 2LHAA 2Z28A 2GJ6E 2WWMC 1V0LA 2XFGB 2BVOB 2RR3A 3MLWH 3BG3A 2BRQA 2WUBH 4PRWA 4L05A 4X5QA 3RPKA 2GK1A 5ENWA 4EKXA 2XN9D 1FYTE 1L4IA 1IB5A 4JB9H 3LS4H 2LFEA 3VJ6B 4PJ8B 1RZGB 2QKIC 2PTDA 3Q58A 4BQ5A 1YEDA 2WKJA 4S1RH 4DZAA 3GI9H 1A9BA 3DCPA 2R9RA 3STCA 4KX9A 4K8EA 5DRXB 2ATPA 2K4AA 32C2B 3GH4A 4P8WA 4MQ7A 3FOMB 3SKMA 2PLCA 4CNOA 3MRIA 4JE0A 3UXKA 3WQOA 5D2XA 1MQKL 2GDUA 3CUIA 3RRQA 5IBTL 4JQIH 4TQPA 4QJ5B 5L88L 4PJ7F 2DD8L 2ZYRA 5C8BB 1BZ9B 5EC1B 2EYSA 2CHRA 2ISWA 5IJKA 1TPB1 1GK8A 1A7OH 4NAMA 1NGPH 3CH9A 3PBMA 2IBZY 2ZCZA 1E5ZA 1UZ8B 3ECBB 1FGVL 1MCFA 4H8WH 2CLMA 4U6VL 3MU3A 3PBVA 3U4AA 1UKSA 2HJLA 1WZ1H 5A8NA 1Z5LB 2LVEA 3R79A 4E4PA 2I9LB 3FQRB 3KAAA 2NTFA 4MNQB 2JI2A 4KITB 4APQA 2I07A 1WAEA 1YNKH 4Y5XA 1VJSA 5C7VA 2VERN 3MDUA 1I7RA 2R0KH 1YPFA 4NHVA 1GKPA 4QOKB 1RZ8A 3K8KA 2GAZB 4OLVL 1CBVH 4C6MA 4HS8L 5EC2A 5KVFE 4WRHA 1S6NA 3BPOC 1Y0LB 5BZWA 3WBYA 4ZGYA 5K2ZA 1UXWA 4O02L 3TW7A 1AI1L 2ERJB 3VJ6A 4DK5A 3D33A 4UMSA 1NCWL 2D3JA 3WNPA 5G2WA 3W22A 2OMAA 3MXWL 5EBLA 3VO0A 2VAAB 1AYRA 4DJFA 3CU2A 5FF4A 2G3MA 4WWKA 1Q6GA 3LDBC 4TUOA 5FYLE 5T8IA 5E2VH 1IC4H 3GB7B 3SPHA 1P7KA 4IKJA 2J9YA 1LO0L 3VVVA 4IOIB 3QB7C 5KW9L 5C0JA 5D8JL 3MA7B 2V3FA 4ML4A 3WK2A 3ARYA 4FXJA 3FTYA 1I4FA 4JCWA 5EU7C 3QNZA 4PJXB 4D9LH 4EN3B 5KJRH 4ZAKA 1TR1A 3UABA 2DZWA 3NJFA 1YEGL 3MUJA 1LLZA 4XMWA 3F5JA 4Y88A 1J9SA 3ZQWA 4KEMA 1MWAH 2ZDSA 4O16A 3CFEA 5ILTL 1JUFA 4M4RB 3U9PH 1AQHA 2C71A 3VXTB 3R11A 4DI8A 5ALCH 1KJVA 4K5LA 1BF2A 4TLUA 3Q9QA 4KNQA 1C8YA 1T1XA 4P8VA 1NMBL 1FHGA 1UXLA 2X1XR 4L29A 1UBSA 1WK0A 4GNKB 5JW4N 4BZ1A 4DZ8A 1RJRA 1E6SM 1R0MA 5B22A 1RA0A 2XSBA 4GYPC 3R58A 2RQ8A 1A4MA 1E4KC 2R9HC 2ZYSA 3NEOA 2R14A 3RUGB 5AW9B 1KNWA 1W9UA 1ADSA 1V05A 1Q38A 3OZ9H 4Y9EA 5JHLA 1A49A 3BXWA 1XSKA 1UR4A 2DYRB 3FUMA 4J2PA 2WXRA 5IK3B 5IBXA 1EV2E 3RLVA 4M7SA 5GQBA 1A2YA 1E7VA 4IGBD 3IM1A 3DG7A 2IH1A 3QZWB 4PI2A 4N0FA 4PMYA 4O58L 2WNNA 3PZNA 3SDCA 3W9EA 3MRHA 5D2YA 3W4RA 1XYZA 3QRHA 4QD2E 4BF7A 5JMRA 2VSMB 1NEUA 4ZDHB 5DHDA 1GT8A 4F20A 3WGVB 3SYQA 1XF4A 4IRSA 1VBJA 2G3XA 1NMAH 4XX1G 1A80A 3GSNB 1HSBB 4OJDH 1SW0A 4L9LC 4AD2A 3MRIB 5H1WA 2Z65C 3QIUB 4H88H 3FCTB 5E94A 1NPNA 3VD4A 5T9BG 4JZJA 4QOKE 3GZQA 1ZLVK 1NC2D 4JM2D 4Q8TA 1SPDA 2VUYA 3L2LA 2YX0A 4MFDA 4NP4H 4L65A 4X2PA 2BIOA 3BW9A 1BLIA 3EUDA 2XQYG 1Q94B 2XU9A 3P4OA 3I7SA 5D96C 1YY8B 1RXLA 2R1YA 1QNOA 2Y6SC 2YXFA 2Z1WA 3C0SA 4X6BB 2DM3A 3GMLA 1IBBA 3COTA 4LGSB 1EF3A 4RBPH 1T22A 3BN9D 3CYVA 5EZOH 3CVHA 5J1AA 4AKOA 2BOCA 1HH9B 3VX0A 3BZFA 3UL4A 4YHYC 1I9CB 5KSAC 3NO5A 3BIBX 5L0QC 3CJPA 5CZSA 3B8SA 1W9DM 3W73A 1VZGA 3SDDA 3GB6A 2FEEI 3O6AA 3KLKA 1A4CA 4ZXBB 1GGTA 4TUJA 5HA7A 3AZUA 5BYWA 1HT6A 1DJGA 5FJPA 4HUVA 5E9DB 3QEQD 4P2QB 3BWUC 5K9KB 3E1F1 2A0LD 3SDCB 1KLUA 5E6YA 4FG0A 4BRVA 4CC4A 1A9EA 4WK9A 2NY1D 4FQXD 3V2AR 2QCGA 2ITFA 2MH4A 3VYLA 4JHOA 2Q7YB 5B3NA 3H0TB 5ECGA 4A38A 1ONQA 2V2TA 1P0KA 4MNGE 5D1ZD 2C34A 1R3IL 5H37H 3S3CB 2W38A 2XIBA 3JTSB 4GSQA 5DK2A 3IMSA 4LCQA 2EKJA 1AXSB 4KI5C 5EU3B 5CBEB 1VFHA 3JR2A 5J1SC 3C2VA 1PU0A 1OLLA 3AACA 3F85A 5IBXC 2AQPA 5I17B 3EJSA 2ESVA 3OZ9L 4IISA 4AY7A 3ZHKA 4XUGA 4M1CC 1D8WA 4J35A 1TPDA 4OFVA 2PPEA 4RISL 3U7YH 5L2KB 4K2UL 4HDIB 4ELDA 2J27A 5BVPH 4ESKA 5EZLB 5E51A 4U3CA 3QP3A 3UP1A 1TTFA 2BS9A 1CGUA 4XP4L 5K9QG 1FBIH 1SVCP 4OZ4A 1QVBA 1QO5A 4APXB 5MEOB 3MRRA 1RV8A 2PTTB 1JZHA 3K2MC 4WY0B 4KOBA 3SGUA 3ILPA 4JQ3A 1HDMB 5JIKA 4FXGB 2A6LA 3ZFHA 4A2RA 4EI6A 3B4NA 3CH0A 3RWHB 4OBTA 4DBDA 1D9KC 2VFDA 2HP4A 4N8VB 4Y5YA 4KU1A 4F0SA 1FIGH 1NELA 4YK4B 1R5WB 1UP3A 1WAAF 1X6NA 4U05A 1UZHA 4QNEA 4U5KA 2ATSA 3VE0A 3WDHA 3HFTA 2Z4TA 2G8ZA 4B90A 2APWA 2D7TL 2VKXA 3FFDB 3P4LA 3OYXA 3C60C 3KXFA 4UOW1 3SY8A 3GD1C 3H3PH 3RGVA 1QABA 2C7UA 4CQCA 3AXHA 3T5WA 5KSAA 3BT2H 2E7LA 3R5EA 4LEQA 5EL1A 4G80A 3EZJB 5EZOL 3IE4A 3J7HA 2IH1B 4K23L 1FE8L 1IZCA 2HXTA 1DQDL 2EYSB 1BVKA 2BFVL 4FQLL 4K94C 4WJ5B 1WBHA 3UGEA 5JUVA 5AKQA 3NSDA 4NPKA 5IW6A 2VEFA 4UTBH 3EMCA 2Q01A 3MWAA 1Z3GL 4H2HA 1SW3A 4DJDD 3VGDA 3VFCA 5LCVL 4XBJA 3BKYH 3MV7B 2YAFA 2ICWJ 3U2CA 4PY8J 1W6WA 3PWPA 4GMEA 4WI0A 4MNQA 4OB5H 4P9MH 3PULA 3DI2B 3PUOA 5BOPA 4XQ6A 3NFPA 4GH1A 5GSRA 4Y4KC 1CGYA 2WBJC 2CKRA 4NT0A 4UXDA 3WQVA 2Q1EA 2UVFA 3O45B 3V0WH 3CMGA 2OX5B 3GI9L 3FB5B 4KQ4H 3FVDA 5E1GA 3MSDA 2F68X 1G6RB 2GITA 4H9VA 3QUZD 3W0WD 1Z0MA 5I8KH 3FT2B 1F8IA 3W71A 1OADA 4ZMYA 4NF7A 3L4ZA 4AISA 3FN9A 4CLMA 1XSIA 2CCRA 4XO4A 3CC5A 3MMWA 4K3ZA 3SKNB 4JQIL 4LARL 1YYML 4K7PL 4QXGL 1ASQA 1I75A 4UNTA 1M7OA 3VAVA 2YKLH 4Q9QL 1IR2A 3L9RA 2BHZA 4GAJL 4OKDA 4W9KC 2CDGA 3AT0A 3QFJE 5E6IA 4QXIA 2IUZA 3N5AA 2QELA 2JF7A 4P9HH 1LE9B 3DSFH 1FIEA 4PG9B 5A2LH 4WKFA 3MO1A 3IFLL 3IJ8A 4TQIA 3G1XA 5LNDA 4BI7A 4H2AA 2A9CA 4BDVB 4OIIH 3OQEA 4G56A 4IMGA 6TIMA 3CVDA 3U30B 1MSPA 3FNKA 3S4SA 4G5AA 2GUBA 4MHHI 3RZCC 1JZ7A 3DESA 3GSWA 4R4ND 1JGDA 5IEHA 4HKJB 2ZWSA 4JFYB 5D5MF 1BHGA 1MCHA 3P0WA 3BFOA 5GSRB 3BG9A 2HLFD 3OVPA 1E6ZA 1PLCA 2EJAA 3BVNA 4CQ9A 4BFNA 4CSZA 3R8HA 4YJZL 3TJXA 3NQMA 2W0UA 5DZJA 3MXVH 2XBDA 3VD3A 1KFEA 2JIWA 4LC8A 2OMYB 4Z2KA 3P3RA 4G7YL 6FABH 1FCQA 1E65A 3DVFA 4EUPA 2ZRWA 1LO0H 3TF7C 1LLWA 4LGXA 2D4FA 1ZJAA 3NP4A 1JHTA 1FE8H 2XV2A 4R90H 4X6EA 3NL3A 2WBJA 3H2NA 4OQVA 3SFWA 2QYGA 4WEBH 3CXDL 4AITA 2G0WA 1U3YA 4RMTA 4LF3A 1G7IA 5IUSA 4NM4H 1JUEA 2ENYA 3QJTB 4XXDA 5AYXA 4PMEA 3W1NA 1EOKA 3QQWA 1G9EA 2NY0C 1RJCA 4NNPH 5EWIL 4D8AA 2Q02A 4XR8C 4HAFA 2FQDA 3QGKC 4PRPE 4F93B 3GJEA 1KELH 2AJXL 2F53E 4TSCH 1J93A 1TZGL 1MFCH 2FLIA 4EE9A 3D25B 3MLXL 3L1OL 2NDFA 4IJTA 1F3RB 4MXQC 4UQDA 5D7JA 2P49B 2QJNA 2OYMA 4JLRB 2HJPA 3O4LE 3RGVC 3MRRB 1FRBA 2AFNA 1TQUA 1VFOA 3UZ5A 4Y4FB 1KRMA 2X7LB 5A8MA 5DWPA 2P80D 3COOA 3N04A 3WNLA 1E4XH 2X41A 4IDJL 3GFXA 3VOJA 4WV1B 1TPWA 5I28A 3EGXA 3MCNA 4B9IA 4Y19D 5EMLA 1PDZA 1TQXA 3FQ4A 1B54A 5IFHL 5A3HA 2BY0A 3HBGA 3GTVA 1TUXA 4X9SA 4AWTA 5H2BB 3EBHA 3ARFB 4AGPA 4KRPC 1GWJA 3DSFL 4XVJL 3JV6B 4YHLL 3ZMEA 3VFPA 5L8JB 3OP2A 1KC7A 2R6OA 1Z9SB 4PP1C 5C0BE 2VR9A 2QW5A 2RDWA 3STGA 2VABB 1K4GA 1A7NH 1QO2A 4H9ZA 3OXRB 1BEYH 4LCVA 4DGIH 1VACA 4H26B 4NN6B 5CG7A 4RGMC 1O68A 3FTGB 5MHBA 5CP7A 2F6XA 2IBBA 2WNWA 5IRPA 1DSYA 2WN2A 2DLHA 3QUYD 5CLXA 5LBSA 5J0BA 1G84A 3M0JA 5J06A 2B2XL 2EAWA 5FHAH 3C8FA 3C5SB 3W28A 5I1LB 2XWDA 4DBUA 2P53A 5FIPA 1MHPH 4A3YA 4NP4L 3SJVA 2J7BA 4EXBA 2QDVA 1JZIA 1C7SA 1MREL 4D8PA 2YZ5A 2ZZ6A 3N85H 1FHLA 1TZHB 1YO4A 1AXIB 5J57B 1JVNA 2ACQA 2EPOA 4PGCB 1XRFA 3WF0A 2TODA 4TULL 2L0DA 4XPBL 5IW3A 3UC0H 4JM4H 2JKPA 3BOVA 5FLUA 3ZS4A 1ICSA 1P4IH 4MNJA 2GT9A 4YLQT 4FX7A 3VIIA 1EP3A 4ZD3L 2PKDA 1KOAA 1JFXA 3ZWTA 1HI6B 3TYAA 4P99A 4A6GA 3UAAA 5BUAA 5FAGA 5K59E 3R0DA 5EZJB 4F4RA 3BVXA 1KWKA 3LBOA 3TN5A 4HHWA 1H7RA 4PTUB 1UACH 2YQ2A 4YDVA 4AJWA 1HAWA 1GA2A 4U49A 2BHYA 5JMOC 2CUAA 3EWYA 1H4PA 1UKPA 1R1CA 1KIPB 1NWRA 4N2MA 4OVVA 1JUKA 2A6JB 2LU3A 3MGAA 4I5BA 4K4KA 3V52H 5BMFH 4JN6A 5I6KA 3OC8A 5T33H 4YQXL 4WDTA 1HHGA 4DQOH 3IU3B 3EO9H 4QE4A 1IEWA 3SPCA 3B0YA 2G3IA 3RKDC 3E2VA 3GR4A 1L7TL 2Z9TA 3VXRE 3QQ4B 1USQA 4U6TA 4PB0H 2ICEA 4X6EB 5I1CL 3T2PA 3C2AH 4PN2A 3NSXA 1GOIA 3F7PC 1R9FA 3WJMB 2B20A 5IJDC 3AXLB 4NWUL 5HI3C 3IIPA 3OKOB 1AQKH 4O02A 4XIAA 1FAIL 4GW5B 3QW3A 3ES6A 3D0VA 4FJ6A 1XCTA 3O4OB 1I7RB 3OF6A 4FQ1L 4HJ0C 4JX4A 4P2QE 2AV7A 4JY6B 2GQ9A 2WJ5A 5BUPA 2R0LL 3QEHB 5HNRA 1Q63A 5CJBA 1NFDE 3M0KA 1FG2A 4HKZB 1GJPA 3I6GA 1BJ8A 3LTSA 5GJTH 1JPHA 2RH9A 3SJVD 1K5NA 4MTMA 4MDIB 1BYPA 4DGWC 2GGIA 2E7MA 4H0GA 3SSJA 1QPXA 1QXLA 1K4DB 1ORSB 4U6YA 3F5WB 3T77A 1X4XA 4QY8B 4ZPVA 4W9EC 3ZTEA 3REQB 1JPSH 3DOSA 3OR6B 4JFTA 4ZFFB 4H6EA 4H1LA 5I5IA 4J5NA 3CHXA 2WSKA 1KA9F 1DUYB 1X9UA 4GKOA 4YL9A 4IMKC 3S2JA 1ECEA 4PEEA 3HS9A 3OSVA 1HESA 5D5MA 4PRHA 1OF6A 3VUSA 2ITCA 5D2NA 1RPQA 3IGFA 4MMXC 3M0XA 2F7OA 4PJEF 1C08A 1TQWA 1S7SA 3C6SA 5B38A 3P8IA 1UD3A 4GYFA 4GUGA 1NGXA 2BRRL 1UKTA 2KS0A 1NWPA 2FPYA 4CILA 2GC7C 3LPPA 4UM8B 3UC0L 1UPPA 3W7GA 4RK8A 5CO1A 4ZAKB 2P47B 5KVDL 1KCVH 3HMXL 5EO1B 3OPZL 4K73A 3IF1B 4PRAB 2ZCHL 1V3HA 3YPIA 1HKFA 4FFZA 4M61A 3R7RA 4MOZA 4M4RA 4ZTEA 3X1FA 3LERA 3FA3A 3VACA 3H2EA 4MNQD 1XH3A 4WO4B 1UCWA 1S3HA 2FZ8A 1GC1L 2KKQA 1Q6OA 3M0MA 4FB7A 2VM4A 15C8L 4HFUL 1XSJA 4L3EE 2MNWA 2OJ1A 1K9DA 2HKFL 3R0UA 4PSPA 5K9KA 4N2OA 4E9WA 4AZ5A 2QQQA 1LQSR 5CN2A 43CAB 3WDPP 1HNGA 4JAMB 4TQHA 4G43B 4HPHA 3MI2A 4IMCA 4JN8A 4PMRA 3WD2A 2CLRB 3CPLA 3B7YA 3N40F 4XCYA 3HG3A 4OCLC 3C0LA 1G7LA 4HSHA 2IWKA 4GRWH 1FSKB 5I8KL 4I7ZC 2WLMA 1CBVL 3EJYD 5I07A 1Q0XH 2HTLC 4CL7A 1X7SA 1F3DH 3G1DA 4K1GA 2Z31B 1SXNA 3F7VB 4OV4A 3U1PA 5CZXC 2ISSA 2Z1BA 4WHYG 3UBXI 2H90A 5HHMB 4X8GA 2EPMX 1BX2A 2YD2A 3ULUE 4F2EA 5KOMC 2AZAA 2V5MA 4OFYA 5I15L 1AHWC 1U1HA 4M7TA 1NGZB 2BGQA 1XT5A 1FUYA 2J7DA 1EJFA 3FB8B 3QHFL 5SWQA 2V0TA 1N4XH 1NBVL 3EWBX 3AJ7A 5CLWA 1GQNA 3S35X 2OMWA 3WBEA 3GSNA 4IM8A 5FJOA 4M5SA 3SDDC 1NUDA 3BDYH 3QWRA 4OZ4B 5E03A 5I1IH 1DWAM 1ME8A 1XF0A 1J5DA 2XICA 1HNYA 3C52A 3AMCA 1BVWA 2DW6A 2NPLX 2AXWA 4NQXB 2FMNA 4MPKA 3PK7A 1IBHA 4ZSOA 5HANA 3IMRA 1RSYA 3HV9A 3SPVB 3I6TA 4O2FB 2QT6A 3HR6A 4DWDA 3JWOC 3M9YA 1HZLA 2OX4A 4AV5A 3DX7A 2CNYA 5G4NA 5C8JB 4FLRA 4PRID 2W0FA 2B9BA 3KBPA 3B2UD 3QUXA 3U83A 4L7ZA 4XZMX 1XCTB 1Q9OB 3QXDB 5ACLA 5FO9A 3SHSA 2WP3O 3LQLA 1MHHA 2ZXQA 3A4WA 1H0IA 5FS5A 1X5GA 2UBPC 1P1VA 1JXJA 4OGZA 2F5BL 3QEQE 1FG2B 4HKZA 3V0VA 2YDRA 2ODOA 1BBDH 4JTFA 3LVEA 4OLYL 1S78C 6ALDA 2IMNA 2OJEB 3HA1A 2D3NA 4WFHD 3MZGB 3P5YA 4J9JA 5AVSB 2Y7EA 3AG2B 3GSRA 5IBUB 1IWPA 3G1RA 2CK2A 1REIA 2Z7GA 3CL8A 3JV6A 4FG6D 1CR9H 3UCQA 2W67A 1EERB 3C8HA 4E41D 5JOPD 3EJZD 2QVNA 3PWPB 4MYAA 2EJ1A 3T07A 1AZCA 4S3DA 2YAHA 4BWLC 4ECLA 5FUOH 2EVIA 4LB4A 1LP9E 5IOPB 1EFXA 2H41A 2HN7A 4OQTH 1OY0A 2G5WA 4WUIA 5D2LB 2EC8A 2VI0A 2G9KA 1JCTA 4UZUA 3QZWG 3AHXA 3FCUB 2D0FA 4BD4A 1NFDA 1WOBA 3QLLA 4LAUA 4K9JA 4N28A 4YHNA 1AQDB 1VFBB 1GYMA 3MCMA 3SPVA 1I8MA 4JPGA 2XWJA 2PU0A 1G6CA 3JUYA 3MFFB 3H2AA 4Z3EA 1ZB5A 3KYOA 1NOFA 3N3EA 4XP5H 2VJXA 2R91A 1NIDA 3HCVA 2DQGH 4P4KB 5IHZA 1VKXB 1HTYA 1KMGA 3FQRA 1GS6X 1YE6A 4YBLC 3K72A 2NQZA 3AGWA 3NFSH 1XEDA 1CJYA 1EEZA 1ZK5A 2E8ZA 3K6DA 4G3YH 4IJBA 2CKBH 3WIIL 2R2EA 5HHVH 4BFFA 2ZRVA 1OZQA 4GQBA 3P82A 5F89B 4PQXA 3QXBA 1BG9A 4BK5C 4H5SA 1W72B 5KSVB 1H09A 3MC0A 3LCYA 1XLDA 3DRQA 4ZS6D 2B15A 1OFAA 1TR9A 4YZWA 2IV8A 1HQRB 2QGBA 4K7VA 4RNRB 5LXGL 2HPOA 3C60B 4UC5A 4MASA 4IRSB 3UYIA 1QUPA 2NY2D 2WKOF 5DX7A 3UY8A 5AYQA 3ESUF 1BGXH 3ZTJG 3KXFB 4AQEB 3K6SB 3N17A 1U8JA 2VFGA 5KG9A 4C83B 1EC9A 2OTDA 5IF0B 3ONCA 3PWNA 5J6HA 4RR4A 2JALA 5E4OA 1CT5A 5BQ7B 1BQLH 2VLKD 4ODWB 1FVEB 3D69A 1TJGH 4HCGA 3UXLA 4U0QB 1GCFA 2Y88A 2QUMA 3HPLA 5IHLB 4LVNC 4QBXA 4ZMNA 1E8ZA 1ZE3H 4XNYL 1LD9A 1D3CA 2VGBA 4L61A 2PWGA 4D94A 5G4HC 5FUCE 1I3RB 1JGIA 1P4IL 1CIDA 2QGDA 4JFFD 3ZKXC 5ITBL 1TJ2A 5CSZB 3T4AC 2KAUC 4HBCL 3KHDA 2BY3A 3FSAA 3FBKA 4EI5C 3OKOA 4O02B 1M9SA 1E5YA 5DGRA 3ULSA 1M7DA 3ZYZA 1V6XA 1JJUA 4LU5H 3WEXA 3FO2B 3QXVA 3KOXA 4JIQA 4JTLA 1DPMA 1CR9L 5IM51 4S3FA 4F79A 3AROA 2B1AL 2QL1A 3BE1H 3O11B 3GSQA 5E5RB 1FNHA 2VNCA 4POYA 4WF7A 1XRVA 3G6MA 3NZGA 3SUTA 4UTHA 1UA7A 2QF8A 1OD7A 4OCSH 3BRGC 3OJ2C 3VE9A 3MX0B 4JFXB 4DPRA 1MLBB 2QLYA 3A3YB 4KI5D 1WXJA 3ZN6A 3BWUF 4K3HA 4GJ1A 4KAQL 4P8QA 2PP0A 4TMCA 2XWCA 3KOYA 3QYQA 4IPJA 1XX1A 5SWZD 2L3BA 1GEQA 3HGRA 3W3OA 2DBLH 4HMDA 1ZBWA 5JLZB 3MHUA 4NJAL 4G8GD 2C3XA 4N2HA 1FAKT 1TLKA 1DBKL 3TAOA 4GUFA 4ES4A 4ZFZA 4ZQKA 1FVEA 3D69B 1V27A 2BVWA 5F2LA 2BHUA 4R2GC 1LL6A 3VFUA 2GBVA 1BWKA 2YW4A 2ZOUA 5DMMA 1NGQL 4ATTA 3H7RA 3MCKB 3GYCA 4H9XA 1YMMB 2F9BT 5C09A 4DT2A 1OCQA 2PDFA 5HHVL 1Z5HA 2FJGA 5GGTL 2YCIX 5ESQB 4B9KC 3GLAA 3KRZA 4NYUA 3FJ6A 3EMQA 1J8VA 3IF1A 5LUMA 2OLSA 4KROC 1AJ2A 3OGCA 1JXGA 1L9OA 1T1YB 4BWUA 5KN5B 4Y5XB 2OCCB 1T03H 1JPFB 1TV3A 3LDVA 2EACA 2QPEB 4BWLA 1WCBB 3IK4A 4D8OA 4EZLA 1N8FA 4RBPK 2DDQH 3E2SA 3OODA 5IB3A 5LNGA 1UZ1A 4GG6E 1EFZA 3LJ3A 1NWTA 3A4AA 3NK3A 3PRZA 4IQHA 4O2EA 4Q2ZA 5CP3A 4ZMQA 4FOJA 5TQLA 2IKIA 1S9XB 3ZUNC 4BZ1H 1QW8A 3A6BH 3HTLX 4URIA 3LH9A 2NUTB 3IDGA 5CCKL 3EMZA 4EUPB 5LWYL 2LW3A 1BQLL 3I02B 3RHGA 3B43A 3B9KB 1DUZB 3BSZL 4GRWE 1UWXH 2ZP0T 3EFFA 3BW3A 2PCPA 3ZJ8A 2VN7A 1QLRA 1PS9A 4QX4A 3IIZA 3TK7A 2X70B 3UAFA 3VFTB 2Z6IA 5EY5A 4AEOA 2W60A 2YARA 3D3VB 3IE9A 3OX8A 4FHBD 3F7KA 4LLVB 2P9RA 4YBQD 4I2XA 1HILA 4QXGH 4QRPE 4GGBA 2J71A 1TEYA 1IC5H 3V4VH 5IWLA 3OGSA 1U8IA 2DN7A 3CVBA 4PCNA 2NXYD 3L1FA 1BOYA 4WX2A 1W3KA 2VVSA 3TYZA 1OCJA 2Q3AA 1GZHA 1ZHKB 5I2IA 2HFGH 1T99A 2CBVA 1I4FB 2ZQKA 3HPFA 4N2LA 3RAJL 2Y6TE 3OW1A 5E8PA 2X4OA 1I31A 3AT8A 4XZ9A 3QMSA 1A3ZA 1FLRL 5CBEA 3LM3A 4AY1A 3L2MA 2MANA 3VD2A 2YLHA 3IMTA 1LMKA 1HIML 5DMKB 4NQXA 3MHZA 3B06A 4NQ1A 3O6FD 3IS0X 5EZIH 4Z7NE 3RRXA 1F45A 3HFFA 1F3WA 3EOLA 2F8OA 1KFAH 5C09D 2GUOA 1RCYA 2GI0A 4JO4H 5DEJA 2PP1A 1IM9B 3EWXA 1HL8A 2NW3A 3LZNA 2Y2TA 1VFMA 1DIEA 1DBKH 5E1AA 4R83A 2GIMA 4W8LA 2ZZ4A 3DX7B 1GVEA 3S2AA 1TMHA 2CLLA 1JEZA 4XBPA 1JRBA 3V8OA 1Z2KA 4IT1A 1MHCA 5TTRA 1A4BA 3MZTA 4PJDE 1HYSC 3FO2A 3GMOA 3I2CL 5CILL 4HHPA 3RO8A 3EOAA 1EEYA 4GLRH 1KNOB 5LLIC 2EG7A 2X42A 3BAXA 3KNBB 4I2XB 2H26A 2SEBA 1RCOB 1MQ8A 2DQDL 4NC2B 1J5OL 4LVBA 2Y9RT 1MNUL 2CAKA 3D47A 1W1IE 1L6ZA 2R0ZH 4JMNA 2OL3A 1UASA 1UZ8A 3BL3A 2CA3A 3CHPA 3CBJB 1J0ZA 1N2RB 1EXPA 2MKLC 1NAL1 1ACXA 3MLZH 4NAQA 3TH2T 4AW7A 1EWEA 1VD6A 2M1KA 4IEFB 3W6LA 1NBCA 4O0KA 5G4OA 2REQB 3PV7A 1EEUA 2XRAH 3FCTA 3AHYA 3IDXH 3DXAA 4I77L 3RVXC 3W39B 5H4ZA 5HPOA 1ZVHA 3WLOA 5BOEA 1J2BA 3FYPA 4LFYA 1HINH 3PB2A 4PTMA 4ZB2A 1HWGB 3WBDA 1L6PA 4LALA 5DJ8A 3NPXA 5FEZA 2VIRA 3A4XA 3OLDA 4HSOA 2QADC 2JEPA 2ATKA 4HYTB 4LHJB 4RCAA 3PF3A 3VTTA 5IFTA 5GGUA 2CZVA 5F7KC 1RD5A 5ES4B 2OXHB 1RAKA 1E9PB 4XAKD 1RHCA 3GYEA 1MFUA 2GSMB 5TQ2L 5I3FA 1BBDL 2IC2A 1S7RB 3CZEA 3PAUA 4XBGA 5J3HC 3H4GA 5DFVC 1BVNT 4ELMB 3L65A 2YSTA 1A3RH 1U8CB 5EU6E 1KJ2H 3ZDXB 2ZUSA 1DBBH 5IQ9B 1UWXK 2SFPA 5F89A 3GMOB 3UW6A 4XN5A 1AQFA 4EUPG 3PCYA 4ZFZB 5CHNB 1RURL 5I79A 1P5VB 1MI5B 1XH3B 1EDHA 4WO4A 4GSDL 2HTMA 3IJIA 2GQHA 2OJZL 3B56A 4KWVA 3N06B 4LOUD 3LGDA 3N42B 2ZAIA 5AB0A 4GEJA 4CCCA 2QVFB 3RNQB 2EUZA 3IV3A 1IQDB 5DZNA 1AKPA 1PJ9A 1F1GA 4KKLD 5JIPA 5F1NB 2Y5JA 4PV1C 3UZQB 5MP6H 2UY4A 2XVGA 3BWAA 3JWDL 4XN9A 1XLAA 4RESB 3PQYB 2VMEA 4J6IA 2AITA 2CLVB 3FN0L 3INOA 4RIRB 1EGZA 3CIVA 3VABA 2JXMB 4BI6A 1PLGL 2XBZA 1A1MB 1IZKA 3NQFA 4MX7A 4OCYL 2Z35A 3V3WA 3VRIA 3GBEA 4DNHA 4ZFCA 4GAYA 4NS0A 1TJXA 1WZLA 2PTXA 1ZLEA 2EH7H 1QSFD 3IXAA 1RLWA 4YO0A 3WQGA 4UMAA 4RFNC 3V5KA 5EUOF 5EO9B 1DJSA 3G1SA 2OSXA 3DETD 2XFXA 4DERA 1L2UA 3W56A 2VKZG 4GY7A 3PQYE 4PJCF 1S5TA 4NEHB 4K8RL 2ZICA 3EFFB 5C0BA 2XZCL 1KB5H 2Z6JA 3GVWA 1H7XA 2CDGB 2P5PA 4PLKC 3CFTA 4GUJA 1DQLH 2CM5A 2W0LA 4H20L 1YEFH 4QXWA 2X4SA 2EDRA 5TDPA 1SFJA 3QZMA 4JMXA 3G3LA 3RWFB 3GAYA 5EEUA 2WC7A 1LCOA 2NY3C 2P50A 1O5XA 2DTMH 1U8IB 2EEBA 3ABMB 3BPCA 5CNHA 4HGKC 1P7HL 2AJSL 3LTYA 2VZ3A 3PNUA 3FDWA 4XZHA 3MODL 5I30H 1XDMA 1TUPA 4D6JA 3I3DA 5JVLA 1Z3RA 3BI9X 2JELH 1TTGA 1VHPA 1IEXA 4QDMA 3H2MA 4FTDA 4UTWC 4XPTL 3BK0A 2ZOLB 1P4LB 4XVOA 2BVQB 5CCZA 3SBWA 1DZ0A 4AM0A 2FPTA 3V4PA 2PDPA 1MRDL 3GSOB 2GDQA 2ZJSL 2CWNA 1JNLL 2F61A 2H3XC 3EX2A 3WN5A 2AK4D 5TQ2H 3VTRA 3GO1H 2QHLA 4B95C 2EGZA 2VXTH 1MW0A 4L3ED 4MKTA 2HE5A 3E2QA 4R3UA 2NSOA 3H55A