4NX0A

Crystal structure of abp-wt, a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
430
structure length
430
Chain Sequence
b'SMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVDDIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 151
structure length 430
sequence length 430
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nx0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx0A01
4IMFA 3W72A 1TMQA 4L4LA 5U4NA 4TU1A 4GNJA 2G3NA 4MLRA 5E1QA 1DBTA 1FXQA 2YSWA 5FEZA 1DJQA 1YTDA 5CKSA 2V3EA 3KL3A 3RILA 4MY8A 3NPWA 4BK9A 2ZDRA 1QR7A 3W7PA 1SSGA 1PCKA 3LHTA 3NGJA 3W7MA 2C1HA 2Y70A 3CZSA 3L4WA 4Z0JA 3W7JA 1FWWA 1OX4B 1QO5A 2YOCA 4GXMA 1SW7A 1UUMA 3QZEA 4JDBA 4O18A 1FWNA 4GQQA 1RVGA 4CGTA 4J7RA 3N14A 4GINA 3P61A 3NG3A 5D32A 2ZWYA 5I3GA 1GQNA 3OIXA 1KLZA 5CPLA 3E0IA 1W0MA 4GI8A 3GXDA 3KL0A 4K37A 3W3OA 5CSSA 3BMWA 1B9BA 4UTLA 3PY2A 5DCEA 1Q6OA 3WY3A 3DHUA 2VOMA 5KZDA 1F2JA 3P7YA 3RU6A 3EEGA 3EX1A 3LRMA 1T0OA 2WVTA 2NX3A 1VJIA 3S6DA 1XCFA 1TPWA 1S3HA 5BRBA 1KGWA 1CGTA 3WJSA 4FHAA 1K8ZA 2VRKA 2ZWZA 2QR6A 1SO5A 5A6MA 1E3ZA 3FYPA 4MYXA 1R2TA 5KINA 2C7FA 2JGQA 1V7YA 2TMDA 1HFBA 3EJTA 1XSJA 3EXTA 4FF7A 1HUVA 1W8SA 3NZRA 1MZHA 1TO3A 2FPTA 3UY7A 1J0JA 5CGMA 2WNWA 2XN2A 3NL6A 5IBXC 2NT0A 4GUIA 2E8ZA 1CGXA 2FB2A 2OCZA 5F1VA 3D4ZA 4JDYA 2VFHA 2CLHA 3W7EA 1K3UA 4JX5A 3BCDA 3ZSSA 3L5AA 2NV2A 3MUXA 3BAXA 3CIXA 3UG5A 1XSIA 3E02A 2QJHA 1DJNA 5E0KA 3M41A 1BLIA 3PC0A 1G1YA 2ZUSA 1JCLA 1LBLA 5F2IA 1SU5A 5D2WA 4DQWA 1Q45A 1Z32X 3CLMA 1A50A 1PS9A 2ZRUA 4AMWA 4AF0A 3L2MA 5L9FA 1HX0A 4R34A 1G67A 4MFDA 4ORIA 1FBAA 1PEZA 2BHZA 5KZMA 3TSBA 2Y7DA 3AJXA 3ZR6A 1BKSA 3I68A 5DBUA 4YLWA 1A47A 1SMDA 3O1NA 2PWDA 4O15A 3GDKA 3TX9A 2A6NA 3IIVA 1R2RA 1OFEA 4Z1CA 5G1YA 3W7GA 1AMYA 1MFUA 2E5CA 3R5EA 4JTEA 4NNAA 2V0TA 5TD4A 4X0NA 1WX0A 1L0PA 5EY5A 4UQBA 2G95A 3G8RA 1MW3A 3BAWA 2JK2A 4UNKA 1UA7A 2I1OA 3PG9A 4O0ZA 1P1XA 3JS3A 3W2KA 2PWHA 3WEMA 2DZUA 4FLOA 3IGXA 1MXSA 5AHIA 2OJPA 4K7YA 1EX5A 5G4WA 3UWUA 3S8HA 1D3GA 3HGJA 4JD4A 2FE0A 4IWWA 4UQDA 1LM1A 5CZJA 2PWFA 2ZZ5A 4WQ6A 3GDTA 4CKQA 1VJSA 4ADUA 4H8HA 5FF0A 3G3DA 4GFSA 3UYCA 1KM0A 3C0JA 3B4UA 1CGYA 1PIIA 1TPB1 3STCA 3GXIA 3S1UA 3TR2A 5K7JA 3W38A 3PS7A 1OGSA 4JYEA 3LHZA 3HJZA 1BEUA 3NQFA 3WNPA 3C2VA 3VNZA 1NM9A 3BUPA 2LLEA 2Y61A 1OT1A 4WY0A 2E4TA 4UNLA 2ZRWA 3ZQ9A 3LCGA 1WV2A 4E0CA 1JD7A 1QWUA 4GI9A 3LB0A 2OMAA 3W7QA 1Q6RA 3U6WA 3L9CA 3CLWA 4O1BA 1X8FA 1KFEA 3W2MA 1R2SA 3P62A 3FJ6A 3F4NA 3N73A 1KBKA 3CHVA 4UCGA 3G1YA 1X1OA 3NQVA 5F4WA 3FS2A 4NU7A 5TQLA 1LDCA 1JCMP 1J0HA 3QQ1A 4AB4A 3PB2A 4BI7A 3IV3A 1FY6A 2NUXA 2VELA 4IXHA 4Z0SA 3GZ3A 4HPHA 3VSUA 4H2CA 1FDZA 4MZYA 3W1AA 2BXZA 3CZKA 3II1A 2D0FA 3GKFA 5I3HA 4H3DA 3CU2A 5I3KA 1NF7A 2V2HA 2J6XA 2CHNA 3F03K 3TE9A 1IIHA 3NVTA 3LTSA 3NL5A 4E2OA 2DZVA 1MVYA 2EAEA 4HNTA 5K2ZA 1TQJA 1BTMA 4JTLA 2PC4A 5F7UA 3QEZA 4BFAA 3VNDA 3AXHA 5LNUA 3HZ3A 3THAA 3FEMA 2C0AA 3GXFA 4GRSA 3TUUA 3GK0A 3MMTA 4GE8A 2EQDA 1YTKA 5AB3A 3B0UX 1LOQA 4AXKA 5E70A 4OT7A 1I2PA 1UBSA 2V2DA 3Q58A 1HT6A 2A0NA 3LCFA 3EWUA 3BAKA 2WVVB 3HQ1A 4WSKA 1QOPA 5AHLA 3L4TA 4IMGA 1OFDA 2PWGA 4X9YA 5FEPA 4EF9A 1QHPA 1UH3A 3M5VA 2D0GA 5FEWA 2BLEA 2ZZ3A 3FKKA 2A2IA 5KMYA 4NQ1A 2VFIA 1FCVA 2EKCA 3S9YA 1B4EA 4BWLC 5D38A 3TV8A 3EKZA 4MJMA 2OW7A 2ZX6A 1DVJA 3C61A 4QIUA 4B9ZA 2BY2A 4JFSA 3WFZA 1JUKA 3E96A 1PPIA 1THFD 3CZEA 5FESA 1GZGA 2DIJA 3NL3A 4ZQOA 2EAWA 1KM2A 3TC7A 2EJ1A 1OB0A 1GYNA 4CQ9A 1MW1A 3VMOA 4Y6GA 5IBXA 7TAAA 3WNLA 2BWGA 3DKLA 4WSJA 4JIPA 1UD2A 3SI9A 2J9YA 2PURA 3NM1A 1O5XA 2ZUWA 3VX0A 3PSVA 2ISWA 3IK2A 5DCBA 3SR7A 1GOXA 1UD5A 3BLKA 4LS2A 3C56A 5E6ZA 4HIBA 3HO8A 3DENA 1XFBA 1VR6A 1HTIA 1EO5A 4AEEA 3L67A 2A7PA 1UA3A 1ZAJA 2FQIA 1GG0A 3EWYA 4JFWA 4M7TA 4HOWA 2V8ZA 4FNRA 3SY5A 4P2VA 2CU0A 4IJBA 1TTJA 1RPXA 1R47A 2AQWA 2RFGA 5EMUA 3BG3A 4TO8A 3NL2A 1AQMA 1CXHA 2F84A 2PCQA 3W2NA 2HMCA 1H62A 4H4IA 4FNUA 3W2LA 1GVRA 2OSYA 2E5DA 3W23A 2YX0A 6TAAA 4FLQA 1VYPX 2FHCA 1V3KA 4UR7A 3S5NA 1Q6LA 5LKYA 1B3OA 2QCGA 1VIWA 4JR5A 3KRSA 4IPIA 3BUBA 3BW4A 1LRTA 4QSHA 5I5RA 2WCGA 4UCFA 5G2IA 1TPDA 1M6JA 3UWYA 1XD1A 5AC8A 3LI0A 2DJLA 8TIMA 1JCJA 5F2MA 4H8VA 1VYRA 1P4CA 2PRLA 3BSHA 1XUZA 5EYWA 3EDDA 2NUWA 3VM5A 1JXJA 3ZOAA 4RXFA 3MBFA 5EPDA 3K8LA 1FWSA 4E2BA 4ZQPA 4O57A 3WEOA 4B9YA 4FXRA 1WAUA 3W22A 3W6YA 3LPOA 1LOSA 1HWWA 5MHBA 3RK8A 4RK8A 3WJYA 5F4XA 3GDRA 2O7SA 3BCFA 4WF7A 5CLTA 3IIZA 3I7RA 1OVDA 2VT0A 2ZRZA 2J25A 1KM4A 2W6RA 3ECQA 2GQ8A 1JRBA 2JKPA 3P82A 1FWTA 4O14A 2CLKA 3HBLA 4FX6M 3A22A 3UG4A 2RDUA 2FTPA 1FXPA 4UFMA 1GJUA 3DBPA 1A5SA 1N8FA 1RQBA 3UPBA 3OEXA 2GVYA 3RLUA 3ZO9A 1IXOA 1XKYA 2GQAA 3B04A 2QCEA 2VENA 3W1TA 3PF3A 4R53A 4M56A 2FDSA 3VSVA 2ZTJA 3OBKA 4UFJA 3HG4A 2FHBA 4OE7A 2FLIA 1GCYA 3BUQA 2WPBA 3WJZA 4AEOA 4X2RA 5A2AA 4HPJA 1YPFA 3IGSA 4U33A 1AW1A 2QCHA 4DBDA 1QWGA 5D09A 1LLWA 1H50A 3Q2DA 1TJRA 3UWZA 3NQDA 2W79A 5L6UA 1KM3A 3EDKA 4EOUA 2BHUA 1IIGA 4QITA 5H91A 2OSWA 4Q33A 2QDHA 3AJ7A 3NAVA 5CSRA 2V30A 1KFLA 2XFWA 2ZXBA 3O06A 3EXSA 3WDHA 5DO8A 4N6FA 2E9BA 3QSTA 2ZXAA 3USBA 1OABA 1VZWA 3OLDA 1TQSA 4EWND 2FPYA 1KWGA 1MEIA 3LV6A 1Z48A 2CXGA 2YFNA 3O63A 3LM7A 5D03A 3K30A 1TMHA 3N9RA 1PL9A 2ZXDA 1WO2A 4ADSA 3BAIA 1TPFA 1BPLB 4JXCA 1QOQA 1KGUA 4CN6A 8CGTA 1IF2A 2DZXA 4MYAA 3T7VA 1BSIA 2ZUTA 2ZX9A 3SJ3A 2IGTA 4UTUA 4LV4A 2OX1A 3C52A 1UD8A 1ZY9A 1JD9A 5LSMA 4O1CA 1H61A 4O53A 2H3DA 7TIMA 1J0IA 1TRIA 4DPPA 3G22A 2ZZ1A 5I3FA 5F4SA 1YXCA 2V81A 4Z1AA 1G4PA 1KV8A 1H7XA 1M5WA 1TQXA 1UKSA 2DU2A 1JAEA 4X9SA 2YW3A 1WBHA 2Y85A 4WXZA 2Y62A 3FAXA 3BGJA 5E9AA 3TA6A 3ABQA 2QCCA 4ZVJA 1VCGA 4UQAA 3CQ0A 1H63A 4CCEA 1AL8A 3W7IA 5F2GA 1OG0A 2H8ZA 3D51A 3LBCA 4G1KA 3GNNA 3L5MA 4LRSA 3TXVA 4WX2A 3R8RA 2BY0A 2ABBA 1JQXA 2G96A 3TXZA 3VU2A 2CLMA 1WDWA 3BW3A 1QPOA 2TRSA 1LBMA 4WOQA 1ONRA 3N2XA 3PUOA 3E49A 5CPOA 3SSJA 2OYMA 3TOPA 5HR7A 1PCWA 1H5YA 3HIJA 5EA9A 4JS3A 3BLFA 1OFBA 1I2NA 1TV5A 1ZALA 4JYFA 2ATMA 3NM3A 5TBOA 4FMVA 3EJRA 3CPRA 3EWWA 3QC3A 4AYSA 3G1DA 4EVZA 3EXRA 5G2HA 2QCDB 2Z1BA 5FF7A 1SZFA 3BAYA 4N9BA 4NXKA 1UCWA 2RHGA 1W37A 1MFVA 2AGKA 3VKJA 3QW3A 2FYVA 1OF8A 2V5BA 2YA2A 2C18A 3DHDA 4C1LA 1OFOA 4UFKA 3GXNA 1OX5A 1OFRA 1R34A 1WZKA 2YFOA 1X7FA 5K9DA 5D37A 5D2VA 3SGZA 1JF6A 3M5XA 1RZMA 2I14A 2QCNA 2CLOA 1WP6A 6ALDA 5G1TA 3DFPA 1E3XA 4IPJA 2BXVA 3NA8A 4WD0A 3LLDA 4U31A 5A6LA 1XDMA 4UTWC 4MJZA 4FX8A 4K38A 1QAPA 4LS0A 5AN7A 2E1DA 4KFOA 4HP5A 2ZUUA 3QRHA 3VX1A 1O95A 4AEFA 4NZJA 2ZRXA 4LY8A 1T8XA 1VFMA 3TMLA 2V9DA 3LCXA 1UKTA 3INPA 3BSGA 1GEQA 2HS6A 1TPEA 4CCCA 5I23A 4XZ9A 1R30A 3RF9A 2BHYA 1XDLA 3VFLA 2P10A 1XBZA 3QM3A 4U3CA 5CZTA 4O8RA 3W7NA 1VS1A 3TAKA 2Y63A 2FHFA 4DO6A 2WSKA 2ZXQA 3VE9A 2GVGA 4XTIA 1E51A 2E09A 4UQCA 1C29A 1SO3A 4HN4A 1K7FA 1D3HA 3W85A 1JULA 3OLIA 4GQRA 3WJXA 1D9EA 3KVJA 3W2JA 3TIMA 4OHQA 1CXFA 1FCQA 3FYOA 2I9EA 3DI0A 2WKJA 4ALDA 1O94A 2NLIA 1JUEA 1DHPA 2WNNA 2X2IA 3VGFA 1MO0A 2WJZA 3NQ7A 1EWDA 1UH4A 3KX6A 1DHKA 3MHFA 2R91A 1R75A 4MY9A 3AXIA 4ZQRA 4JCMA 1KLYA 4QJ1A 1VHNA 3LDVA 1FCUA 3HPZA 1KXVA 3EJUA 2J24A 3W87A 4AIEA 3S42A 3N3MA 3ZSTA 3GIYA 3MP3A 3BC9A 1LRQA 1G5AA 2H8XA 3UY8A 2GJPA 2KZHA 1KM5A 3NEVA 3W07A 4POCA 2WOQA 1LWHA 3VMNA 3N19B 2YIHA 4TVUA 4QQ3A 2ATSA 4GC4A 1KTBA 1S5TA 1ODUA 4AMXA 1CXLA 3WK2A 4OV9A 5I3IA 4MOZA 1TRDA 4R7JA 4WXYA 3FOKA 1C8QA 2FH8A 1JDDA 3O16A 5DELA 2WC7A 3N2MA 1PHQA 3B0VC 1B2YA 1H7PA 1V5XA 5I0DA 4NUWA 1VFUA 5TIMA 1XGZA 3DDFA 1OK4A 5AHNA 2C19A 3HGSA 2FFCA 3ZT5A 2YPIA 3VGHA 1X1ZA 1JGIA 3GBDA 1TV7A 3VO0A 2CLFA 4XTDA 4M6PA 5DXXA 1ZCOA 2BXYA 2Y4SA 2DH3A 3GAKA 3M43A 4FIRA 2GOUA 4DELA 2EO7A 4NX0A 4FLRA 2ZICA 1ZENA 5C54A 3NQMA 3PB0A 2DJXA 1JDCA 2H6RA 4XBKA 3MHUA 2GJLA 3HGRA 3WELA 5K4ZA 1W31A 5D33A 3GTNA 4ZL1A 1ICQA 4O4VA 1KM6A 1TTQA 1JI1A 2X30A 3UWWA 3MHGA 4NVTA 3SIZA 3P8IA 1M7PA 1YDNA 4JTJA 3HG3A 3KFTA 3OVPA 3Q94A 4O19A 2PRHA 1AW2A 4GUGA 4E2DA 1J4EA 2Z6IA 3MYOA 1GJWA 3G1HA 4DO4A 4LT9A 1Z44A 5KITA 2J88A 1CX9A 3PUDA 1JFHA 4MIMA 4UTMA 4O54A 5CXPA 5HWMA 3TQKA 3LOTA 5AYZA 1AMKA 2BZNA 1GYLA 1E43A 2W0UA 3NPXA 3TQ0A 4DPQA 4ONVA 1ZJIA 3K8KA 1EA0A 2DIEA 1WZAA 3C2EA 3L0KA 3S5ZA 3G3MA 4AH7A 2BSLA 2CFFA 2ZA1A 3FIGA 4FIQA 3H53A 1OJXA 3WENA 2WCSA 1EP1A 1I8JA 4O11A 3SFKA 4TMCA 5HMSA 1O4UA 4XKYA 1CGUA 4X3ZA 2YYTA 3DX2A 1EO7A 1EUNA 1S46A 2VEIA 2EPHA 5AFDA 3DU0A 5J5RA 2WSQA 3EJSA 3G0SA 4N9EA 4OU1A 2PWEA 2DZPA 3H55A 1GT8A 4J3SA 3TJXA 2ZE0A 3TW7A 4DO5A 1YADA 5K4XA 3LHVA 3L66A 1H7NA 3MJYA 2GQ9A 1UD4A 1VCVA 3BAJA 3DDGA 1VYSX 1KA9F 5HWNA 2P0OA 5A2CA 1XCWA 4ML9A 2NWRA 4UTWA 4Z08A 1W9XA 3NQ2A 1O60A 3NPUA 3TTYA 1OX6A 3UWQA 5ABTA 6TIMA 3TC6A 4M19A 2GUUA 3SZ8A 2QF7A 2Y6ZA 2F18A 2WVUA 1GTHA 1QPKA 1BVZA 3PUEA 3GBEA 2NXHA 3L4UA 1DORA 1OX4A 3L5LA 1NOFA 1PJ9A 4DF0A 3ANYA 4KFPA 4MPQA 3VI2A 2ZFAA 2YZRA 3GR8A 1F76A 1SW0A 1GVIA 2JKAA 3EX6A 4LW7A 4YCOA 4I7VA 1PV8A 2V2CA 1JR1A 3W71A 4GWEA 4OIFA 1Q4NX 4K8EA 1EP2A 2B7PA 1HXKA 1QHOA 1DEDA 1UD3A 3W9ZA 1J5TA 1WZMA 2VFDA 1HNYA 1VHCA 3GVGA 1F5ZA 1VRDA 1PIGA 1LROA 1KGXA 1W5MA 4UZSA 1HTYA 2UV8G 3SW6A 3P80A 1N7KA 3LXAA 4UMBA 1YPIA 1ME8A 5LHEA 4GI6A 2ALWA 4IQLA 1KCKA 2Z1KA 1EB3A 2B7NA 3F4WA 2F7FA 1I4NA 2OZ0A 2ZBTA 4A21A 3UPWA 4O17A 1MEHA 3L4VA 5HJLA 5CG7A 2E6YA 1JQVA 3BLPX 3DX4A 1RV8A 2BY1A 5LNSA 1KB3A 1TPH1 5FF2A 3TONA 3LHUA 3LCWA 1LOLA 1YXYA 3DZ1A 4UIOA 3DKJA 3EX3A 5CPMA 4UXDA 1P0KA 5K9CA 1FDJA 3C2RA 4K36A 1TQTA 1AK5A 1F74A 3UNDA 1KFBA 1FX6A 3GLCA 4QNWA 1D7FA 1X6UA 2ZRVA 1G7UA 3N34A 3FKRA 2NWSA 3G0UA 3MP4A 3OA3A 3L4YA 4PTNA 1GVFA 2QEZA 4B5NA 1OFAA 1SSDA 5DXYA 3VE7A 3PWAA 5D05A 2J27A 3CZGA 3EX4A 3PVFA 2ZZ7A 2YXGA 2NXIA 4S2BA 2GJRA 1TREA 2QCFA 3RMJA 3TTSA 3KAOA 4AWUA 2XN0A 1JCXA 1QNVA 2C15A 4UUIA 1VQTA 2NZLA 3DFSA 1JJKA 2WVSA 4UFIA 5FEXA 3W86A 1UUOA 5HINA 3QFEA 1PZ3A 1IGSA 3CZNA 1K02A 3KXQA 4RV8A 3CEUA 4JTIA 3E9AA 5LZLA 1AVAA 4O16A 5EBUA 4QAWA 4S2CA 4GUFA 1ME9A 5HDRA 1OYCA 2C3ZA 1WQ5A 1Y0EA 4XUGA 3D50A 1MEWA 5F1UA 5AHFA 9CGTA 3TFXA 1KBIA 3BV4A 2V3DA 4FNQA 2YDAA 2G97A 4U2ZA 4NZFA 1JRCA 4JFTA 2CLEA 3BLEA 5HR6A 1QW8A 1ADOA 1AW5A 1W54A 2X1UA 3KOFA 2RH9A 3NOEA 4PH6A 3V75A 4FXSA 4H8UA 3M6YA 1MWOA 1KFKA 2R14A 3BK0A 1TQWA 1DV7A 1SZNA 5CZSA 3BVVA 3Q37A 2R94A 1F6KA 2E5BA 1ICPA 4M6VA 2ZUVA 1B0IA 4EIVA 4BF9A 3NDOA 1FCBA 3UQNA 3M7WA 3P60A 3HPXA 1HO4A 3SECA 2XN1A 3BO9A 2GVJA 3A5FA 4JTHA 4OQVA 3M47A 3P74A 3VSTA 3TQVA 1BF2A 1H7OA 1OSEA 3QF0A 3T44A 2D0HA 4PC8A 2NSXA 2B0MA 3VNYA 1YDVA 2CZ5A 3ABSA 3O6YX 4UMAA 4O4WA 4U28A 2WSPA 1BAGA 4AYGA 4TMBA 3L21A 5CZ0A 1H7RA 5DFAA 1VAHA 1VLWA 3G1XA 1B57A 3NQAA 1IZKA 3RNDA 3DAQA 1C8VA 3NXFA 4MZ1A 3TSMA 4YXGA 4LVGA 1J0KA 3M1ZA 4GUHA 1GTEA 1AL7A 3GXPA 2VEMA 3QSRA 4IOTA 4UNIA 1SO6A 3CGTA 3AMLA 4FEZA 1I2RA 3ATYA 4MKNA 2F1AA 3QW4B 2QAPA 1YLVA 3MW7A 3FJLA 1ME7A 1K7EA 4CQ8A 2XVKA 4NJKA 3MI2A 5EMYA 2WNQA 2FIQA 4N9DA 3CC1A 3QMTA 2Y7EA 3CB8A 5E93A 3BH4A 1KBBA 3W83A 1JDAA 3W37A 1QI4A 3OVQA 3EWBX 2ZCGA 5BMXA 4OWGA 1LLZA 3M07A 1O7DC 3O6DA 1CGWA 3EDJA 3THQA 3UWVA 2VC6A 3NO5A 4W9TA 3CWOX 4O28A 4FNSA 2WVVA 2AMGA 4HOXA 3QPZA 4AHQA 2EACA 1A5BA 3VM7A 1RP8A 1ZAIA 4UQEA 4LUJA 4Q32A 4MAZA 4DBEA 1ZS2A 4NX5A 1EPXA 1S5VA 4YL2A 2GJNA 4KFNA 5F2LA 2JBMA 1QO2A 4LOCA 3P5ZA 3DI1A 1QI5A 4I7UA 2ZX5A 1FDYA 2QUUA 3A9IA 3AO0A 2QV4A 3VGGA 3LCHA 3M16A 4DF1A 2Y88A 4WUIA 4I9AA 2FPVA 1M53A 1BWKA 1IZJA 2ZA2A 2IQTA 3LHYA 3BLBA 2OSXA 2ISSA 2OYLA 2Y5EA 4PSPA 3B8DA 3PG8A 3W76A 4JYDA 2QMKA 3KL5A 2X16A 1KXHA 5I24A 4LU0A 3CZLA 4LS1A 1J2WA 3STFA 1KFCA 3OHIA 4RR4A 5LNWA 2V82A 2NXGA 4ICNA 5AOUA 4AF0B 4JIQA 1L6SA 2CLLA 1S5WA 1XSKA 1K7XA 5FF3A 5D02A 3DFNA 5KTLA 3W7DA 2F7OA 2Y2WA 1CYGA 3W1LA 1LBFA 1C9DA 3QPYA 2C6QA 4K39A 3BVUA 2A1YA 5DBTA 1RQEA 1VH7A 1KXTA 4CNOA 2QKFA 3ZFHA 5E6YA 2WQPA 1KW1A 4RKAA 1PHWA 3P67A 3W1NA 4IMDA 3VGBA 3ZWSA 4A2RA 5D04C 4U2YA 3EDEA 2F7QA 1I2QA 3LLFA 3WMSA 1QPNA 1Z42A 4NNCA 4PEKA 3VGEA 2AAAA 3EX2A 3IVTA 3FLUA 4IMEA 2A7RA 1RPKA 2Y7FA 3PSWA 1V3JA 2ABAA 4JY8A 3C2FA 4YMZA 3LXCA 1RQHA 2H90A 2E68A 4GBUA 3T55A 4N4QA 3I65A 3JRKA 3G18A 2BTMA 5LGXA 4IXXA 4JTFA 3STGA 2J9ZA 5D2TA 3ZT7A 1QI3A 2ZZ4A 1N55A 3T4CA 4PCTA 4UOZA 1XXXA 4J3XA 5HPOA 2WO5A 4AWTA 4TX9A 2F1BA 4A22A 4Y96A 3GDLA 4LUIA 1SZGA 3O6CA 2DP3A 1ZFJA 2QCMA 5C5YA 3L4XA 2D3NA 4WY0B 3ZS4A 1PS3A 2F61A 4XBSA 1EEPA 1ZJBA 3GDMA 4RX0A 4NJJA 1I75A 4LRTA 1RP9A 4WLCA 3WDIA 1SZEA 4HPXA 5LNVA 3VMPA 4MZ8A 1XI3A 3C6CA 5HXMA 1TSIA 1XBYA 3IIPA 4HNUA 3HG2A 3DX0A 1KV5A 2GPTA 2G5WA 5BNKA 4ZQMA 1XC4A 3A47A 3BVJA 1CI1A 3KEHA 1G9HA 2DH2A 1NAL1 1XUUA 3EB2A 3S5OA 4RZ4A 3A6OA 2Q8ZA 5E0FA 4CN1A 3TK7A 4HHPA 5LNRA 2XWEA 1VCFA 1ICSA 2CZFA 4FNPA 4W93A 2Y89A 3W1PA 4AAJA 1M7OA 2YA1A 3D4YA 5CLWA 1LP6A 4JN6A 2C8NA 4UTIA 2QPUA 4FNTA 3UZ5A 3OLEA 5HUPA 1CGVA 4M7SA 4UTKA 1CXKA 1XV8A 4WZHA 1OT2A 1SR9A 1T99A 1U30A 4JTTA 3EJQA 4HOZA 1QDSA 3QH2A 4JTUA 1XBXA 3HOJA 1TQUA 3CV5A 4RLIA 1ZJAA 1HL8A 4K8HA 4LNYA 2FH6A 4O1DA 3UCQA 1W1ZA 3G1SA 1QX1A 2F7RA 4NJHA 4RXGA 3BPWA 1G7VA 3DHFA 2AAMA 3QQ0A 1P5BA 5H2ZA 2VEPA 2EEXA 4X22A 1W56A 3W7LA 1UB3A 2EGZA 5SWUA 4PL1A 4CN4A 2YKKA 4IGHA 1TIMA 4LQ1A 3P81A 5GVJA 2GUYA 4GO8A 4PCSA 4RCXA 3WNKA 3CWNA 4J3VA 1WPCA 2VRQA 2CW6A 2YR1A 3ABRA 1OYAA 3HJEA 1H1YA 4JNMA 2WSYA 4YWIA 5AYYA 4IMCA 1B4KA 1WYIA 1DTUA 3QMSA 1PVNA 4H7VA 3DFQA 3ELFA 3I6RA 2VEKA 3NQGA 5AHMA 3S2CA 4GKLA 1KWKA 2A85A 4BI5A 4LPCA 3F1QA 4M5PA 4JEQA 3W1MA 3YPIA 4HSNA 2RDTA 5AC7A 3LX9A 3KLLA 4EF8A 3M5YA 2FJKA 4NJGA 3QGVA 3B03A 3M5ZA 1JXKA 2CLIA 4UTTA 2XVLA 4J9JA 4UZUA 3LTPA 1OYBA 3WJWA 3NQ8A 4LTSA 1UH2A 1TCDA 1ZNNA 3ZT6A 3CIWA 4Y8FA 3IGUA 3BARA 4H6KA 3STEA 1WE5A 2VNCA 3S1VA 1UOKA 4GJ1A 4HKPA 3U2OA 4IUOA 3OG3A 5LHFA 2FGZA 1F7BA 5KEZA 1QCWA 1R33A 3CT7A 4DF2A 3HPSA 4PL2A 4AWSA 4Z1DA 3PAJA 5EKYA 4M8UA 3W84A 1GVQA 3I7QA 1PZ2A 3D0CA 3AMKA 5DY3A 1VC4A 1PAMA 1WXJA 2WANA 4AW7A 2HTMA 1VFOA 5AC6A 2VFGA 1EWEA 1H3GA 3O8AA 5J5DA 3LRLA 2DZWA 1TPUA 3O07A 3IVUA 4CVWA 3LRKA 1XM3A 4M6QA 1DQWA 1JF5A 4I7WA 3EWZA 3G8EA 3W7HA 1IV8A 2E6AA 4AMAA 1M7XA 3KWXA 3WY4A 2NT1A 3RIKA 3NZ1A 3K8MA 4J3WA 3ABOA 3PBWA 5DY2A 3R89A 1WA3A 3CPUA 1BG9A 2VKZG 1MW2A 1H51A 1U5JA 1SO4A 2ZYFA 3BLIA 1L9WA 2YW4A 5C55A 1F6PA 1EA9C 1PIFA 1W3NA 1I45A 2D3LA 4PCFA 3LGEA 1G4EA 2RDWA 3EJPA 4MFEA 4FLSA 2QCDA 1R46A 2HS8A 1OHLA 3PM6A 4GIAA 4UFHA 3IJ7A 3P84A 2F7PA 4JFVA 1MSSA 5FI8A 3UXDA 1OK6A 3S0CA 3LV5A 1I2OA 2ZQ0A 2YYUA 3PR2A 4GO9A 2Z2UA 4JL2A 1QW9A 4OKDA 3R12A 1GJPA 1YYAA 3DFTA 1W3IA 4JTGA 4A2SA 1L6WA 1U33A 1TB3A 5C2XA 1ML1A 1IXPA 2ZA3A 2EF9A 3BW2A 4OV4A 2X2HA 1HO1A 4KWUA 4O52A 1RD5A 1Q3NA 4WJEA 2JGYA 1RR2A 1Y7VA 2VFFA 3I7SA 3WNOA 3C4UA 3W88A 1W5NA 3WK1A 4UOQA 1D3CA 4BZYA 1GVOA 4RZ5A 2QCLA 2ALDA 1F73A 3BG5A 4FX7A 3UXAA 5KZEA 3G0XA 2R8WA 1TCMA 4O13A 1EP3A 2NV1A 3WY2A 4N4PA 3G24A 3DGRA 2DZTA 1KTNA 1SW3A 1OFQA 2ZTKA 4AHPA 3UEQA 3TDFA 3WN6A 1NFBA 4LVBA 4AVFA 3G1FA 4XWUA 1EH9A 3SGUA 1A5CA 3U8GA 3W1XA 1CDGA 5BMWA 5EL1A 4A29A 1OFPA 2VXNA 4OBTA 2PRMA 1TTIA 5A2BA 4O0KA 4KMQA 1KBJA 2CZDA 4LC8A 3RLVA 6CGTA 3D52A 3PBYA 4JICA 4UR8A 4ZQCA 1SUXA 3LHWA 1T96A 3L68A 1O5KA 2C13A 3W70A 3IEBA 4XQ6A 1TJPA 4WOZA 1UKQA 3DX1A 2XIIA 1QPRA 2OT1A 4PFMA 2ZIDA 4PODA 4CNPA 4LWWA 2OYKA 3TSDA 3HF3A 4ADTA 1EIXA 1VLIA 3DC0A 3GAYA 1KTCA 3KRUA 4Q4KA 5KSWA 1JUBA 1YXDA 1E40A 4OJYA 2EHHA 4CCDA 1MXDA 2ZZ2A 3HG5A 1DOSA 3MP5A 2DORA 4FO4A 2WKLA 1IXQA 3KVMA 1QFEA 3GKAA 3M44A 4NT0A 3EDFA 3WDJA 3W7CA 2E6DA 4JTKA 3NQ6A 1TQVA 3R2GA 5HNRA 3RFAA 5I3JA 3PBUA 3TH6A 2A7NA 3A24A 1SFLA 4KKXA 1QWNA 1WZLA 4JFUA 1A53A 4AIOA 5DLCA 5G2WA 5BRQA 2B7OA 2G3MA 4NJIA 3O15A 3LTYA 4JL1A 3EWXA 3NNTA 3C8FA 3GNDA 3UG3A 3G1AA 2OW6A 1KM1A 1DKWA 3P8JA 4J28A 7CGTA 4CLMA 3UERA 4KWWA 1G4TA 2CPUA 2Q3OA 3QYQA 3TFCA 2ZX8A 2V5LA 2YA0A 3UZJA 4MUZA 5BRPA 4OGZA 3L2IA 3LERA 2CZEA 2Z0IA 1HG3A 2C14A 4K6AA 1XH2A 1LTDA 2OT0A 4LC6A 4NXSA 2TYSA 4AHOA 3W1RA 5LGZA 4D2JA 1GG1A 3DFOA 4ZQNA 4CQAA 4S1FA 2BY3A 2YJQA 3L65A 5D2XA 3H54A 3W1UA 1W3TA 1P0NA 1CLVA 1W5OA 3BUIA 2D73A 5C6MA 2B7QA 3A5VA 1NEYA 2BX7A 1LORA 4MLJA 1CW2A 3MYPA 3W1QA 2GVLA 2VFEA 3B06A 2F2HA 3T78A 2NUYA 5K3VA 1K03A 3L4ZA 1P6WA 4QNEA 3A21A 4UQ9A 1HVXA 4E38A 4RZ6A 5IM51 3N9SA 1A5AA 2QDGA 3PBVA 2ZX7A 3CTLA 3WNNA 5U7SA 3O05A 4JCLA 3GR7A 3HMJG 3NR0A 1W5PA 1TTPA 2JKEA 4HNNA 3ZWTA 5BW6A 3CEPA 4TIMA 2B4GA 2X1SA 5G5IA 1VPXA 4LVFA 1H60A 1H7WA 1U83A 3B05A 3KHJA 1QMLA 3LBMA 5AYXA 3ZR5A 4BI6A 4DXVA 4JTSA 2A4AA 4HT3A 4PA8A 1LCOA 1XBVA 2XWDA 3BGGA 1JVNA 4C1KA 2YGYA 4UTJA 2WKGA 5AHEA 3BUDA 4CNNA 2RKXA 1KCLA 3DH7A 4TR9A 1WBJA 2Q3RA 3FAWA 3OVRA 4KWVA 1CIUA 3GB6A 4FB7A 3NPVA 1VGAA 4DEFA 1K8YA 1BWLA 3TNOA 4ATWA 2YCEA 2Z6JA 3QJAA 2FB3A 1AQHA 1L2UA 3TAOA 4JY9A 5G4EA 4O10A 4JX4A 4Y9AA 1NF0A 1ZAHA 1UJPA 1MW0A 1G4SA 4LV9A 3W74A 1Q6QA 3E12A 3G1VA 5CPNA 4PSRA 4RJEA 5BOOA 3W7KA 1AG1O 3S1XA 4J3TA 3PULA 3OLGA 4K7VA 4J3UA 3L0NA 1LWJA 2X1TA 3M0ZA 1LZOA 2E77A 2ZRYA 1Z41A 3DHPA 1YDOA 1MXGA 4ZMGA 2VUYA 3FW6A 3GYEA 3WY1A 4IX0A 2ZZ6A 4UTHA 5CGTA 3WFAA 3TU9A 1JL8A 3C3NA 3T40A 3KRZA 3M9YA 1L6YA 1SQ7A 3MO7A 3V1PA 1HL2A 2NX9A 3IVSA 1XH0A 4MVAA 1XL9A 2QMJA 3GXMA 2WPGA 2Q8LA 3DX3A 5CGQA 1TV8A 2WSRA 2TAAA 5HUOA 1BVNP 3BG9A 2D2OA 3B0PA 3W73A 1YTEA 3NQEA 1VB9A 2C16A 2X1RA 5FF4A 2E6FA 3S1WA 4WY0F 5T26A 3HB9A 2QPSA 4L4MA 5HULA 4O1AA 3ZR4A 3KLKA 1K8XA 4XB3A 3UD6A 3W75A 3L0GA 4BR1A 3TROA 3CTTA 4A3UA 2CWNA 4UTTC 1GPWA 5K9XA 3A23A 4MY1A 5DN1A 1OF6A 2J9XA 4UC5A 2A5HA 3GXTA 2E8YA 3VCRA 1NSJA 1WOAA 1EUAA 3A4AA 2A21A 1ALDA 1CPUA 3GX9A 3K1DA 4PEEA 5A8GA 3IIXA 1UD6A 3VGDA 4LVAA 1V3MA 5D2YA 1U2YA 2QLYA 4P61A 1NVMA 2QUTA 3QMRA 1F05A 4BA0A 4JGDA 5HWJA 5HQEA 3MI6A 3S5YA 4BWLA 2X2GA 2XIBA 1SFJA 2QJGA 3KE0A 2QJIA 4N2YA 1LRNA 3TJLA 2NX1A 1EHAA 1G69A 2VR5A 3W2UA 4HNVA 1H1ZA 2HSAA 4N02A 4NNBA 3LPPA 3DXIA 3KVKA 1JG9A 1LYXA 2TPSA 2QAFA 1FWRA 2PE4A 3BVXA 3KVLA 2Y7GA 3LCIA 3TMQA 2QUVA 4QAIA 3LI1A 4O50A 3WK0A 4Y90A 2XVGA 2O7QA 5DCDA 1ZHAA 1KXQA 3LXBA 3NQCA 3JR2A 2H3BA 1KFJA 2EADA 3L2LA 3MWAA 3W7RA 2Y24A 3P5YA 1TPVA 1CXEA 1FQ0A 4QISA 1JCNA 1CXIA 1WOBA 3MI3A 4JX6A 3IRDA 1XD0A 1W5QA 1SMAA 2ISVA 1GWJA 3IIOA 2X2JA 2EABA 2V3FA 4NI3A 1TYGA 3EKLA 4LVDA 4N9CA 4IX2A 3CM4A 3HGOA 3ATZA 3BVWA 1JCYA 1UASA 2TSYA 1QPQA 1DQXA 1GVSA 1IXNA 4U4MA 3TCEA 2WNZA 3IJ8A 3W7OA 2WV8A 1PE1A 3TKFA 1V3LA 1TPC1 3R13A 4HA1A 4UMCA 3TW6A 4LXFA 3MBDA 2P1FA 4HSOA 3FFSA 5A5WA 1G94A 4N6EA 4ZZ9A 4MB1A 1G6CA 4QM1A 4ORMA 3FA5A 4YCPA 2A6LA 4XKYB 1SPQA 3BVTA 2DZSA 4R33A 3IJ9A 3WK3A 1FUYA 1XCXA 4J27A 4O12A 4GUJA 1XH1A 1JI2A 3BMVA 1JIBA 1DL3A 5D30A 2E0PA 3C2OA 3LCLA 4Z1BA 1HL9A 3NYZA 4UFLA 3WNMA
chains in the Genus database with same CATH superfamily
4Z76B 5C7VA 4HCLA 2YGQA 1KCXA 3BCJA 2GC7C 3RILA 1IAIH 4EBQH 4XZUA 1NEPA 3CZSA 2GTZB 2IFFH 1H15B 1U6AL 3OIHA 1WFJA 2YOCA 1JXDA 2YBUA 2VDMB 3WSUA 3SJVD 3PJLA 4GINA 3V0VB 3P61A 3KP0A 1GQNA 4HKXB 4XMLH 2W9DL 3CYVA 3QUZB 3F7YA 3AIQA 1Q6OA 2Z7ZA 3C60C 1UJ3A 3EX1A 3MUHL 4R97C 4AZUA 3EIFA 3B34A 1FN4A 3VXOA 2YJLA 3C5ZB 1V7YA 4Q6XA 2R9HC 3NZRA 1B4JH 5ERWB 2E8ZA 3WQOA 4JDYA 1A22B 4X99B 3JU2A 3P02A 1ZRQA 4KJYB 4Y9CA 1EJ6A 4WFFE 3SDDA 2NV2A 4JG5A 1PS9A 4AMWA 4LGRB 3E0VA 2E7LA 5FPIA 2Y5TA 1BKSA 4NC2B 2YZ1A 1BREA 5D71L 3WLPA 1AMYA 5TQ0L 5HGBB 3PL6D 2XINA 4QTIL 4UNKA 1W8GA 3UBXB 1SEQL 2P28B 3MRCB 1MXSA 4KWSA 3KCLA 2L7UA 4IWWA 3PAUA 2G9HB 2W81C 1BM7A 4FXFA 2J56A 4BYHA 2OFQA 1QASA 1P48A 2F53B 2J3SA 3NQFA 4OLZH 4P5TC 1JPSH 3VNZA 1QXLA 4UWQB 1ZE3H 2E4TA 3CUGA 1QWUA 2P1YA 3CXOA 5FYLD 5EORH 5E2WL 4Z3TA 2ENYA 4J2QA 4TUJA 2VLJA 4Z7UE 2Y25A 3E6FB 1U1HA 1MREH 5I79A 2OL3A 4IXHA 1H3WM 3ARBB 5I16A 3VVWA 1Y65A 1F4XH 1W3KA 4HPYL 1U8LA 2OO6A 2WLKA 2V5SA 4GE8A 5AB3A 1NBVL 4QKXB 3G5VA 4TVPE 3FHQA 2IADA 5JOPE 3SCMD 1Q90A 4EF9A 5FACA 1PYMA 4BWLC 3VXNA 1DQQB 5L2KA 3DPDA 2PA6A 2BPBA 4YSSA 1N6QL 4OZGF 3MSRA 4GLRI 2BP0A 2HNEA 4Y6GA 4AZ5A 3RM4A 3SDXF 5FYLL 3HZMB 1QFHA 5JXAL 2CK0L 2HK1A 1XMWA 3TX4A 4BFKA 3CHPA 3T8XA 3BLKA 1XFBA 1BSLA 4GOSA 3ARFC 2AQ3A 1MNZA 2I85A 3UC2A 3UC0H 3S35L 4ZQKA 3MOAL 3V7AG 2J12B 1RU9H 4P3DB 3MMUA 3QB7C 4XCFL 4YFDB 3IJYA 4WHBA 2V9QA 4G1MA 4G9FE 2FTYA 1YNQA 5LKYA 4EN3A 2X0WA 3UTTE 3NWRA 5ICUA 4NENB 5KANI 1X5JA 1BQHG 4H8VA 1JXJA 2WLYA 3MJ9A 1JNNH 2H3NA 4PFHA 3QJTB 1U6AH 4RK8A 4QDWA 1FL3B 1T66D 1Q7QA 4DP2X 4GKOA 3IIZA 4XCNA 4APQB 5GSVB 2IH3A 1F45A 4F2MA 5PCYA 2P88A 3G6JB 3EBAA 3T4YA 5FM5M 4L8SC 2WAGA 5I17B 1OW0C 1YJDC 3J8F7 2PPEA 4JHWH 1FNGB 1OAZH 2WXHA 1E4LA 3MBXL 4OE7A 3BUQA 4YXHL 3DIVA 4NN5C 4CEXC 2ICWI 1V4YA 4X4XB 3KPPA 1L2QA 1ZWIB 1IC7L 4EDWH 1J9YA 3V6OE 5BOEA 2E9BA 4Z78B 4QXGL 3DG7A 1XF1A 4XMVA 5F1IB 2E46A 2DL9A 4W1TA 2DQIH 1M1XB 3N9RA 2DMKA 1TZ9A 4FJYA 1YKWA 1O6SB 5C0ND 3B6SA 3JW7A 1I9JL 2EXYC 3GT6A 5EZIL 3EJCA 3ETTA 4R0LA 2ZX9A 4N5UA 5HHQA 3B40A 4F24A 1TWDA 3CZJA 5FLUA 4KPHH 4QTIH 4PMYA 2ZZ1A 1SEQH 4UDTA 5GXBB 1EHLH 2C91A 1NBYB 5EMLA 3H2FA 5HGHA 4PRPE 5DRZB 4BQ5A 4CCEA 3W7IA 3UXIA 3NJLA 4G1KA 5FA3A 3QJFB 1TV3A 3HRZA 3TOPA 4MCMA 3VQ2C 2H1LM 3OB8A 4YX2L 5BROA 4GSDL 3U4EA 4JVPA 1OAUL 3EXRA 1TZ7A 3GTHA 1OAKL 1SZFA 5I8KL 3HEIB 5CAKA 1AA1B 3QW3A 1JCVA 5E2WH 5CJBA 1X7FA 3AGWA 3UAJD 3PUUA 5CJOH 4QI3A 3B8YA 4G80A 4M48L 1JZ3A 5LN8A 1S5MA 4PVNA 5BZDB 5G4MA 1YMMA 1XDMA 2IXQB 3DYOA 3KPLB 4K5MA 3B3DA 3S7GA 3QRHA 2XWBA 1KIQB 3I2CH 3L1EA 2NY3D 1YAZA 3LDBB 1T8XA 4YFLI 5H35B 1XMEB 2AJVL 1NBVH 2VW7A 5E94A 3AS2A 1FORL 1TPEA 3QIBC 1A7QH 2NY1D 2P10A 1XBZA 5KJRL 4NO5A 1M7IB 4HJFA 2QSVA 3TTOA 4GRWB 4I90A 3W85A 3LH2H 5D70L 3NSNA 2FLRT 1AFVH 1O5QA 5MEQB 3Q8BA 4IFKA 3P3TA 3AXIA 4QJ1A 3AISA 5JXAH 2CK0H 1KXVA 4EX4A 4PBFA 2IQDA 4L3AA 5B22A 2YIHA 4X8JB 2VM8A 3TVMA 4IRJB 1M56B 3GMNA 1G7QA 4KQ0A 3EH5B 5F2FA 3WXVL 3B0VC 3BPNC 3CAKA 3MOAH 1E6OL 3WFDH 5I9QC 4XCFH 4WI6A 4KRMB 4ZPTB 1S9VA 2G50A 3HUJF 1NTHA 3RDTD 1FPTL 4FOJA 4PJ5A 3EA2A 5RUBA 3LMJL 4BZ2H 1NIDA 2IAMC 1MDRA 1XBDA 3DX8B 4DM1A 3A4WA 1M9WA 1TTQA 4V2CB 1M7PA 4JTJA 1KNWA 3Q94A 2X89A 4L8CA 4KNUA 2UWEA 5KITA 4PJ9D 12E8L 3AU6A 2Z35A 3TQKA 2E27H 3VD2A 3LQLA 1GYLA 3H7BB 1J96A 4ZDHB 2Z92A 4DPQA 4EPBC 2X3BA 2X4UB 4X7SL 3VNMA 2PPDA 1VFTA 3NO3A 2OCFD 5EU6E 3PNUA 1U8NA 2WCSA 1M7DB 4ZW3A 4HMDA 2VEIA 4YXLL 5FYKD 3MBXH 4EE9A 3LZNA 3P54A 1CG9A 4YXHH 5D1ZD 1YNTB 1NARA 4QHKI 4ML9A 4NG3A 4Z08A 4ZFFB 3NDYE 2QNEA 5AVSB 1ISXA 4OZFG 2DW6A 2WVUA 5EO9A 4QXGH 2DZEA 2WQUA 4Z3HA 3VWJD 2QKIA 1BECA 4PGJA 3FT9A 3JTSA 4L05A 4XNMB 5JUVA 1DO6A 2ZYSA 4YDLB 2R6OA 1EP2A 1I9JH 3SGEI 1J5TA 4W88A 4K15A 2QADC 3RAJH 1XGYL 5LGJB 4L7ZA 3SW6A 1URZA 2DIBA 1KPRA 3NACL 3REWB 4QKTA 2NVDA 3O4OC 4DM2A 1NFDE 3JT0A 3SGJA 1TPH1 1CFSB 3GTXA 4DEWA 3CH1B 4PGDA 1B3IA 3UU0A 2XUWA 3OA3A 4PTNA 3QNXA 1OAUH 3VE7A 4G59C 1OAKH 3KLQA 3CPLA 2YXGA 1VEPA 3WO4B 4C6MA 3IJLA 4Q52A 1KGIA 3DFSA 5EBMB 3MO1A 1BGXH 4E0RA 3E38A 5IQ9B 3QUKB 1LEIB 2C3ZA 3OW1A 3BV4A 2WZHA 3A6CL 3EFOB 4AU0A 3LRSB 5IFTA 3BKYL 4ZFQA 4ELDA 3IUHA 3V5KB 2AJVH 4LCSA 4OOZA 4Z7QE 3NRFA 2FR4B 1QYGL 2ENJA 5KJRH 3WGVB 3ECWA 1NDZA 3VTTA 5AZUA 2GVJA 3E0GA 3W9EA 3VSTA 1JZ7A 3FMGL 5D70H 4Q8BA 1YDVA 4XOAA 3KGTA 4UT7H 4TMBA 1FA4A 2WTPA 1K6QL 2NXZD 4Z3IA 3RNDA 3A4FA 2OL3H 3FT3A 5JH2A 3FQTB 4CDGC 4MKNA 1D9KC 1SXCA 3OMIB 2EE2A 2Q8BL 4NZRH 3NJVA 1BQRA 1N8ZA 4U1GB 3ITVA 5BMXA 4KY1L 1BFNA 5JOFB 3FQYA 5KSAD 3QQ3A 3TBWA 5GNZA 2D7PA 1FPTH 3APNA 2DT3A 5DJZA 4YSCA 5C9JA 4PRBA 4K2SA 4LOCA 3DI1A 4I7UA 1SYVB 4M6NH 1B6UA 4PSPA 3PG8A 2R29L 1NELA 1AH0A 4W8BA 1J2WA 3KWSA 2W0KA 4JIQA 1PMYA 3HC4L 3GRWL 4JDZA 5I6MA 5FF3A 3DFNA 12E8H 2W80C 1CYGA 1ITQA 1EQCA 1IC5H 2JXMA 2ZZUT 4Z5RB 3O3DB 3QPYA 4WU5B 4BSVA 1YG9A 1S9WB 4CNOA 2A9BA 3O3BB 1EWHA 3ZYZA 1I4FA 3A4XA 3WMSA 2IPTH 2AAAA 3EX2A 5JYMA 3FU3A 4IMEA 3NVDA 2Y7FA 2ABAA 1U8OB 2KC0A 2MQ3A 2BNQD 4UAHA 3I65A 1HJQA 1QI3A 3HG1D 4HCRL 4APXA 3RWEA 1R3RA 3MJ9H 2FL5B 4AWTA 1ZFJA 1SMOA 2WXMA 1IT8A 3QFJD 4I18A 3KNBB 1QSZA 2CO6A 1TSIA 1KV5A 5JW4Q 1XC4A 2IAAC 2A4ZA 5L0QB 4GH7B 2WWKO 3QY7A 3ARQA 3TN0B 4M7SA 4RQQA 1KG0A 3AIUA 3V0UA 4JTUA 1XBXA 3HOJA 1QX1A 1PKQE 2CUAA 1ODAA 4FXKC 4QHNB 4WCYL 1W56A 3EH2A 4L6HA 3GNOA 1GK8A 4Y2DD 4FF5A 2DJMA 3QMSA 3RDKA 3UVIA 3NPSB 4BI5A 3F1QA 4M5PA 4JEQA 4P04A 4NJ9H 2E9WA 1MJ7L 4UTTA 3TH4T 5C9UA 1OYBA 3CUFA 3LRGA 4FQLH 1EXBA 5GRYA 3E2RA 3T0EB 4Z7NF 5LXGL 2CWXA 4NZTL 4DF2A 4AWSA 3PAJA 1PZ2A 2HMID 1YYCA 1NEZA 2HFFB 1QYGH 1WC7A 5GPRA 5CZKA 4NQSA 3SADA 4CNIB 1SXAA 2EG8A 5KZCD 2FKPA 3E74A 3UJ2A 3MV11 3CC5A 3WKNA 3FMGH 1W3NA 1Y5VA 2D3LA 1JGEA 1I0DA 5F7AA 1K6QH 3DYPA 3MRQA 3R12A 3T65A 2PABA 2ZA3A 4J3OC 2IIJA 5KOMC 3SDAC 5C07E 3FONA 2HPOA 3QXWA 4IYKA 5ABEA 4AD5A 1RK1B 1PWLA 4FD0A 2AERT 2NY6B 1DJSA 4XO4A 1BWWA 3T42A 1LO2L 1D5ZB 1SFSA 2AL2A 2VYOA 4O0KA 2YRLA 2DQDL 1JGVL 3UYPB 4AJ0A 3ETBJ 1YUKB 4Q4QA 3OAZH 5I1IL 4EAEA 3L68A 3LHWA 4YVUA 1OBAA 4QX4A 3PXLA 4ZTOL 1F3DJ 5LGYA 3RWIA 1UMLA 1BF8A 4FXJA 1V6WA 2H8PA 3KRUA 4LEOB 4OJYA 5DK2A 3RE0A 2R29H 3HE7D 2WZMA 3KVMA 3U6XS 4K0OA 4Y2NA 5A16A 3GRWH 1LE9A 3B2UC 3MLUH 2BV9A 5I3JA 3PQYD 3L7FA 3QORD 1WZLA 3P14A 1XT5A 3PWJA 5BRQA 5JIWA 2Z7WA 1ZLWK 2G3MA 4GUCA 4PUDA 3H4HA 3VTMA 5AKVA 5I0VA 2CZEA 3C8KB 5EC1A 1VF8A 3BT0A 3N29A 4S23A 3P4OA 1S2WA 1BEXA 2H5UA 4RX4D 1A6AA 5AW0B 2WIIA 2F74A 1UJQA 3P9WB 4JIRA 1WAAF 1LGVA 1GNXA 1BIIB 4XT1C 3QG6B 4L9LA 3MYPA 1Y07A 2VFEA 5DK3A 3DG3A 1ASQA 1FNEB 3IWVA 1YDPA 4UQ9A 4L9YA 5KSBF 3F7LA 2B5IB 4LSPH 3TGXA 4CU6A 1IARB 2JKEA 4LAJH 5F21B 2DWEB 4UTAL 2POZA 4X6CA 2EXSA 4XMPH 3U7YL 4PA8A 3UT0A 2MNJB 3QIUB 3RPIB 4XPGH 3JBG7 5F96H 3PWUB 1TEYA 2EG7A 3FUIA 1VGAA 1SEBA 2QVTA 4LDEB 3MV9B 2R0LH 1NKRA 3WL0A 3RHWF 3WU1A 4WCYH 3B4NA 4L8DA 1HJVA 3BH9B 4R5VA 5D5ME 4HXBH 4GGBA 2FBRA 2ONEA 1Q9LA 2PBOA 4WW2A 1LWJA 1NGYA 2PTTB 1YDOA 5D9NA 3BSZA 3DTDA 1BZ9B 3KRZA 2RD0A 3C09B 3MGOB 4R4FL 1XL9A 4IGBC 5JHAA 1HKMA 2NR6C 4QHUB 2A77L 5D8ZA 5JLZA 3MRBA 1MJ7H 2W9EL 3W0WE 2DD8L 3T3PB 2QQQA 4HZ1A 2QPSA 3VXMA 4MX7B 4NQDE 1K2DA 5LXGH 4NZTH 5TH2A 2GTQA 3BLOA 2W60A 2V5TA 3GC5A 2GKIA 1ODZA 4U7MA 1QFOA 1XHHA 3GSNL 4IG2A 5HQEA 3RB7A 1ZP4A 2NZ1A 3RBSA 1E28A 4MWAD 3QC5X 4PB5A 3ZIZA 3CFEB 4RZCB 5AYUL 1HZYA 1JG9A 1LYXA 4RZBA 1SDYA 1OD8A 4U4IA 3VKBA 4MJ4A 3LSCA 4C6JA 5CD3A 3DEQA 2XVGA 1OG6A 4U6YB 4JKLA 1G9NL 5DVKA 4B0MM 2IBZY 4AVOA 3MWAA 1C12B 3IGAA 3PWVB 3MI3A 1CXIA 3FFDB 5E9NA 2QUNA 1BX2A 3QSKB 4FYRA 1JCYA 1UASA 2G8ZA 3W7OA 1NCOA 2GBVA 2CLZB 3S8WA 4FADA 5KYYB 2VXUL 4US6A 1RJYA 4YHNA 2X6VA 1G6CA 1SQMA 1Q6CA 1FUYA 2DQDH 3BMVA 2B9BA 5CEZE 1ETA1 4HD5A 5A2FA 3E2HC 3T2NL 4IMFA 3QWRD 3W72A 3ZK0A 1MCQA 1GC1L 1UMYA 5E1QA 4P2QD 3TCSA 4ZTOH 1WIUA 5E9DD 1KEGL 2WNKA 4PV9A 2VDPB 2O1AA 3W7JA 2VCBA 4DF9A 4GZEA 1ORSB 1KRBC 3FO1A 2QPXA 1D5BA 2NX5D 4CVUA 1UUNA 4X5LA 1DQUA 1BD2A 2QGCA 3O6FB 3EGXA 1KC7A 3CCHA 2OMVA 5C0RL 4XP5H 4M02A 2RQ8A 4G9PA 3T0XA 3SE3C 3AALA 2HPMA 3E6EA 4JTAA 4HC1A 1CGTA 4H9VA 3WQCA 3SM0A 4MYXA 3RGBA 1XC6A 3IDNB 3D3VE 5J57B 2HKFH 1A1NB 2Z64C 3L48A 1CE1L 1M71A 5IIEB 1JGLL 5C0CB 4DN3L 4Z7WF 2B2XH 1BXBA 1EZUA 4AGQA 3FN3A 2J74A 3VXSE 3H42H 3E3QC 3QZBA 2ZUSA 2H2PC 3OZOA 2NYKA 2DWYA 4XNZB 1HX0A 1QR1B 3Q2CA 5KZMA 4OIAA 2A6NA 4LFYA 1S2TA 2BP8B 4QEEA 5G1YA 4UV7H 4YH6A 4JTEA 3R5EA 1DVZA 4PV8A 4PBWD 2E9IA 4Q2ZA 2OJPA 5G4WA 2WYZA 4PREA 4GY0A 3UYCA 1KM0A 1V77A 3E0LA 4ISVB 1PIIA 5CM1A 4Z2GA 1A8JH 3SGKA 2BOCB 4EI5D 2X4TA 4LCCC 9XIMA 3OYZA 2CRZA 3GD6A 3LHZA 1T80A 4YVNA 1BEUA 2REQB 4KROC 2O6DA 4MNGE 2MKWA 1FH7A 2A77H 2HB0A 1NDVA 7ODCA 2W9EH 1IT9L 4WWKA 3BPCB 5KYXB 4W6WB 3G1YA 5CD5C 3FT4A 2IXVA 3KPOB 3CIQA 3LGGA 3W01A 4D9PA 1TQJA 4GX8A 1P6AB 3D08A 3L3KA 3GSNH 1F1AA 2RMNA 1UBSA 3I50H 4ZNEE 4H20H 4QRQB 4DLMA 1TWSA 2D0GA 1WS7A 1X5KA 5AYUH 3GE7A 4G7YH 2WY3B 3K13A 3UZZA 2VZOA 4QIUA 1AP2B 1MQQA 5E23A 3NIFE 1A6UH 1PPIA 3A67H 1TZGL 5B80A 4QHLA 2VM3A 4XI5C 1UD2A 4DRSA 2I5GA 4WWOA 2PYEE 5EOTB 5EF3A 2ICSA 3JVAA 2AL1A 2VXUH 2HLAA 1ETZB 3FO2B 2JK5A 4FA6A 2RALA 2IGLA 1W72A 1SF3A 3OKOA 1U8MB 4TO8A 3KPRD 1RH9A 3VOCA 1XGUA 5HJXA 4B6ZA 4HD9A 4FOKA 4LHJB 3S1GA 2WBJD 2GIYA 1V8EA 4ZX3A 4OM0L 4GT7A 5C0FB 1KEGH 5EYWA 4KTEL 1T0NB 4HWBA 5DRNA 1DFXA 2X7VA 3D39E 4OKVA 3IFOA 4V2BA 1KCRH 3GS6A 1US3A 1NGZA 4LSVL 4QLRA 4YE0A 2OO0A 4WSGA 1C9SA 3ECQA 2X6AA 3LAFA 3P82A 3FFCB 5DFTA 5C0RH 1MVUA 2FTPA 1GJUA 4ORGA 3FZUC 4DJFC 3UPBA 4E8CA 1VZHA 1W1PA 3MCNA 4PJDB 1KFAL 3CUZA 4F8TA 1ORQA 5CC6A 3CN0A 4ANVA 3HG4A 2AJSH 3MKGA 3WJZA 3AWEA 1E9LA 4PY7A 3IGSA 1JGLH 2H1PL 1M2VA 1QRNE 1I8AA 3B5TA 5H91A 3UEZA 1MG3C 1H9VA 4OCSH 5HDBF 1ENUA 1EAQA 1QJWA 5AL0A 3FU8A 3TNNB 4ILDA 2G4EA 2FTAA 2VDOB 2VE6B 2FGLA 2B3RA 5DHVH 1LMKA 3NJXA 3DI3B 3BAIA 5EOQH 3S3PA 3EWDA 2ZUTA 3F2LA 3VDCA 2VAAA 2OV0A 1XB3A 3GNXA 2F54D 3IANA 4Z1AA 3UP8A 4I1RA 1YC8A 5FM5O 1JAEA 3N9GL 2QQLH 2QCCA 5F2GA 2OI9B 3PV6B 2NNCA 2CLMA 3EFDL 3L13A 1WDWA 4Y2OB 3HR6A 5L2JB 1UR8A 3BLFA 4UTCA 4XMKH 5HTSA 2INZA 2DVUA 4JYFA 5EA0L 2V9UA 3G6AA 2ZCZA 3EJRA 5IHZB 3QC3A 4LPUA 4JTCA 2XWCA 2QCDB 1RHHA 3B2DC 4HUWB 2AGKA 2DY3A 1CI3M 3G5ZB 1UUSA 2C5DC 5EEXA 3HR5B 1HXYA 2WYSA 1U8KB 4S2SB 1A1OB 3VINA 4KXDA 2Y36L 4GSXA 2CBIA 2VAJA 1DDHB 5IOPB 4KKBC 4U31A 5ICXA 1Q0XH 4K38A 4PJFE 5L8LB 1KIUA 3QDGE 2G4FA 1O7VA 2XA8L 2DQFB 4MS8C 4P99A 2O92A 4UINH 1DQLL 1PZCA 4HK3J 4MS6A 4QR7A 5A2LH 4V11A 2IMNA 3QUXD 4UTBL 3SUWA 4F1SA 2PGEA 1T5XB 3E0WA 2A83B 3KVJA 3G5YB 5IMMB 1MFBL 2I9EA 1MCWM 1TWZA 4XAWL 1GIGL 2P80D 1OADA 2OMTB 2WNNA 4HZ7A 3MHFA 5J12C 1QKZL 1UWTA 3FTGB 4XWGH 3HC3L 1SHMA 4K7FA 1G5AA 3BPOC 1TE1A 1JTTA 4OV9A 3N50A 3VD5A 2O4EA 3M46A 3PGDB 3EPOA 4W5ZA 3E3QE 4M93B 4JCWA 1XGZA 4Y9BA 4REQA 1CBVH 3O3EA 4I1NB 3FY1A 4Z7OE 4XTDA 2WGNB 3GAKA 2Z25A 2J5LB 3VXUB 1UR3M 5HK4A 1YYMH 4OQ1A 1CQKA 3CVHB 3I6GB 1ICQA 3BX7C 3GSXB 3UBXG 2BSTA 4XVDA 4YNGA 1TT6A 1E2WA 1IWBA 1R3IL 4NQED 4IIHA 1PYFA 4GG6A 1NGQL 4Y16C 4LSVH 3II3A 2KLSA 3VRLF 1CX9A 2Q8XA 1JFHA 3F7QA 1TZAA 4B97A 5MERA 1ZBWA 3LOTA 5ABDE 1DUYA 1E43A 1N26A 1QFUH 5C09B 2VZSA 3MROB 1L9PA 5CSZA 1KFAH 1EP1A 4P2AA 5KYNA 2WMFA 1MRFH 1EUNA 1S46A 4RAHA 4N9EA 3RGVC 3MV7E 4DAGH 1FP8A 3FN0H 1U8QB 2CO7A 4JVWA 3I6KA 3FGCA 3MUGB 1LO4L 3IDYB 1TETL 5DD3H 2CXEA 4OD3L 1RZPA 5JOPD 3QLLA 2ZCKL 4MPQA 3N2JA 3VI2A 5JXQA 4G8FA 4HPOH 1U0QA 4PJCB 4J1UB 1Q4NX 5DMNA 1VACB 4HV8A 5IM7B 3W9ZA 1FG9C 2PDWA 2ADGA 2OX5B 1KGXA 3U9UA 1YPIA 1ME8A 1S7VB 2EE3A 4HC1H 3JVFC 4GI6A 2VXTH 3UXKA 3IJSB 4ODTH 3N9GH 4D8LA 5DRCA 4BKLA 1LK2A 3TO2B 4J2PA 3HE6D 2DICA 3SN4A 2FATL 3ESUF 1XF2B 1EKOA 3VI4A 2FMOA 3SJVA 2XUCA 3ZDZE 4ZSOB 4UXDA 3ARGC 1UB6A 1F74A 5FJIA 2EYTB 3SKMB 1BM3L 5FOBA 3HC2A 2ZRVA 2CESA 3WLTA 1SSDA 3W00A 2J27A 3NRQA 2J1XA 3HVNA 3UTTD 3U2SA 4GQPH 5KVDE 4JFPB 2J4GA 1GH7A 1RLBA 3FCBA 2FBOJ 3QAZC 3E9AA 2Y36H 3QZAA 4XNUH 3D50A 1MEWA 3VXTB 3PK7A 3CK5A 5C0QA 4IBTA 5EFDA 3D09A 1ZLSL 4JRXA 5GGRY 2O61A 3NOEA 1N6VA 4FXSA 1MY7A 2F6KA 1HGWA 5I6LA 4CQCA 1XO8A 4KTDH 4UM9A 1F6KA 3ATFA 2HG0A 2YPLD 4PMQA 5MP6L 2W92A 2JVUA 1EFXD 1MFBH 4KXBA 3EYFA 3PL6A 2WSPA 3H70A 4XAWH 4P23B 5JZ7D 1GIGH 4KC3B 3K5XA 4TLUA 1CBGA 2QT6A 3L5IA 3T81A 3DAQA 2EDEA 1GYWA 4BCYA 2Z65C 1A3XA 4YHYB 1NBZA 3P3SA 4P5SA 2I5YL 4NDMB 5G55A 2EKJA 5GRUH 1HH6A 4PI2A 1HIMH 4LLMB 4IIQB 4I3SH 5D7KD 4MCYB 2JTYA 3R0NA 4GBXC 3O6DA 3CVCA 2JI1A 3UWVA 1XIWB 3BXNA 5BUPA 4JZ5A 3D0LA 2VC6A 1NDGB 1IBGH 4HJ1A 2Z1SA 5KVFL 4Z2LA 5JMRA 2ARWA 4KFZC 3U7AA 2JH2A 4ZFGL 4OV5B 4RNHA 1A7RL 4PRPD 3MY9A 3ZTJG 3LSOB 2Z24A 5F2LA 2IVFC 2UY4A 4DF1A 1Y5WA 4EUPB 1JNJA 4JFQA 4GYPA 1IZJA 1C5BL 1RCOB 3NZ8B 1R3IH 1UVQB 2X0YA 2WLNA 4LYRA 1NSNH 5GGUA 1XIJA 2CLLA 4FQPA 1AKJB 4E9QA 2Y2WA 3Q5OA 1GA2A 3LYEA 3KYKH 3M1OA 1W72H 4BZ2A 3JWDL 4Y5YB 2QKFA 3H7VA 5E6YA 2NY4B 5CKAA 2G60H 3LS9A 1E27B 1I7TB 1SM9A 1B31A 4OZOA 3KWWA 3KYOA 3R43A 1KELH 1QUMA 1H3PL 3MRGB 3H3BC 5F9JA 1EUTA 1INEL 5CSGA 1U91A 5E6IC 2CIKB 1JV5B 1WCBB 1TETH 4OD3H 4FNLL 1TKKA 5B8CC 4ZOAA 2CC0A 2C3XA 1DDTA 4I48A 4HPXA 3C60D 3MX0A 1UCBL 5DYFA 1FE8L 4QRPE 4OFQA 3APGA 1WK0A 3BVJA 3ERPA 1MI5E 1L6XA 2R9HD 4FNTA 1CGVA 1Z0MA 2ZVIA 1AZ2A 1TNNA 4HISA 3L17A 2QDWA 1FG2B 1MQKL 2X0HA 3RR4A 1ZJAA 3POCA 5HJ3A 3UCQA 2O55A 3QDME 3DHFA 3V5DB 4RETB 3GJEB 3CV7A 2R0WL 2WWOA 4RA0C 4E5XA 1BM3H 5AAPA 1RA5A 2YKLH 2GUYA 4RCXA 2HT2C 1CFTA 3RX9A 3RITA 4MYWB 4LU5H 1PVNA 1ZS8A 3IYLW 3S2CA 5FJRA 2CDEB 3ARVA 4K23H 3WJLA 1DEEA 1W32A 4FHJA 4PJ8C 3L5JA 1E9QA 3RUGA 1M3UA 4U1HB 2ESVB 3BOVA 2ZDSA 3FYIB 1AACA 4KMLB 4JRYB 3V4PL 1GVQA 4BQ6A 4N24A 4YQXL 4UTFA 4H41A 4LVEA 1GPOL 4YZFF 3UZYA 2WANA 3W39A 1FZKA 3DSFL 3VA6A 1UZ4A 1ZHLA 4P5TD 5EU6D 3OBAA 3R89A 4GQBA 2VGIA 4N26A 5MP6H 5T1JA 1MOEA 3MGTB 2CGRH 5C55A 3FHAA 1F00I 5B7YA 4NZUL 2NQJA 3X3GL 1I2OA 5B39B 1QW9A 1YYAA 4KV5E 4GSUA 5K5YA 3D0VB 2H6OA 5D2LA 4KWUA 1RZ7H 4PBGA 5E8NB 1SJCA 2WMPA 3AUVA 1PEWA 1F3WA 4G8GA 1AZCA 1EP3A 3GFXA 3GM8A 1QPXA 4AHPA 4Y4KA 3GUTA 1PQZB 5EL1A 3K6SB 3UA3A 5E24E 3FRPB 3X1FA 3U30B 1QNOA 2NUTB 2ZXCA 4HXAL 1KTJA 3NJHA 3PWNA 3NMEA 4I5RA 1OCNA 3DMMC 2N3JA 2P26A 4TS6A 3UAJA 4KCUA 1IGJA 3V9FA 2OT1A 1VLIA 5KVEL 4FERA 2MCAA 1YEHL 1BMGA 3WI9A 1W0VA 1QFEA 5AW7B 1CDUA 4NQCE 2OWCA 1J9TA 1TQVA 3ARFD 5JXEA 3FSAA 3LB6C 2SEBB 4M7ZB 4LVHB 1A53A 4ZPVA 3IGKA 4Y5VB 1UXSA 3JWDH 4HH8A 1H6EA 3UTSB 1UIOA 5BRPA 1CUOA 3ZE0B 5CINH 3PPEA 2VMDA 3BH8A 3CN1A 3KOWA 4R7DA 1XWVA 4CVZA 5G4NA 2I07B 1U9KA 4HS8L 5EB9A 4LLQB 3MUCA 3TU6A 1XLIA 1H3PH 3TNMA 4YHZH 2JJVA 3C6SA 3A5VA 1INEH 4HEPA 3BLLA 3DGGB 4QOKE 4ZFOL 3BQ5A 1EV2E 2WNXA 5EEZA 4K1GA 4CU7A 1EDYA 5GSRA 4N90E 2ENSA 3G5EA 1H3TA 4C7GA 5DMLA 4HSQA 4ZRGA 3KZSA 3RRXA 4QRRB 2O4QA 3V79C 1FE8H 1E4IA 3QKEA 3MMDA 3B05A 1T6BX 1C5CL 2ZOLA 1QA9A 3MV8B 5AB0A 3O45B 1XCTA 4OF3A 3BUDA 2IDFA 1I9EA 2Q3RA 4KWVA 1MQKH 2YQBA 1WJ3A 1I6NA 4LESA 2W9DH 2F19L 2DV6A 3ABLB 3CHOA 4JY9A 1P53A 1NF0A 2R0WH 2FIRT 6XIAA 3BP6A 3P77A 4F7MA 4D6EA 3ISRA 2DPKA 4FQHB 3NFSL 2E77A 4HLZG 3LZPA 5LBGA 3FW6A 2YSSB 4HPGA 4EP8C 2ZZ6A 2BIMA 3GXUB 3HUJA 2GJ6A 4XP9L 3TU9A 2EXYD 1J05A 5SWQB 1XH0A 4EXAA 4MQ7B 3GU2A 4LUYA 3W73A 1BVNP 1CDIA 1N4XL 3BG9A 2IC2A 4KKAC 3LPGA 1K4HA 2X1RA 1XF5B 2V63A 5G4HC 1PY0A 3OKMB 1DP0A 1A4AA 1E30A 4NN7B 2F8VA 4GCAA 1XYCA 4POZC 4OLVL 4PJXB 3GX9A 43CAB 1UD6A 4AY1A 1CD9B 1V3MA 3QE5A 1R5VA 1TTUA 1F2QA 5D71H 3VWJA 3ITOA 1VA9A 1MPAL 5TQ0H 4MDIB 1RHFA 1AO7A 4F3HA 3ZE1E 4GCXA 2TPSA 3VFMB 4NZUH 1BZ8A 4HA0A 4D1JA 2P50A 5H4ZA 3ARXA 4J39A 4MJIA 3F01A 1FP5A 2OYPA 2ZSWB 3QXDB 3W7RA 2Y7QA 5E4EB 1TPVA 3ARYA 4IX2A 4YDIL 4IJCA 3BZFB 1FWCC 1NLDL 2WV8A 3IS1X 2YDQA 1ZGDA 4JPKL 3FB5A 3QIBD 4UMCA 2ZXEB 2P1FA 4HSOA 4XMUA 1XR2A 5F0LB 3QEQE 5T1DL 4YCPA 4PVMA 4OAWB 4PS8A 1SPQA 3IJQA 4J27A 4GAYB 2ZYRA 2DW5A 4HXAH 2NYZA 4Z1BA 1VJZA 2J88L 3ALFA 1TMQA 5TK2A 3WJMA 3C08L 1R3WA 2HROA 3GFUA 3JV6A 4HPYH 4Z2IA 5HYSA 5KVEH 2GK0A 1TR1A 2MHAB 3CHDA 4L1XA 5I1GL 3NG3A 1A7NL 3E0IA 1YRRA 3CNKA 5AVZB 1W6TA 1T0MB 1UIPA 3M8OL 3R4IA 1FLTX 1N6QH 4ACTA 1IEWA 2NX3A 3FPYA 1KGWA 2H32B 2R29A 5BU6A 5FYLH 2IAMD 5C2CA 2XFGB 4JDTL 3EXTA 3GRWA 2GGIA 1CQYA 4AE1A 4AIZA 1BWMA 1TQCC 3BT2L 3NFNB 1MFAL 4I13B 1NIAA 1BRLA 4AVNA 4LCUB 2LHAA 3R06B 1E15A 1K4CB 3S35H 5EFIA 1Z32X 3CLMA 4V27A 3K0YA 3GBML 4F2BA 4KHXL 4M7LL 2RR3A 3QQDB 2NLJB 3L2MA 1JHTB 3NZSA 5KSAA 5FECB 1RH8A 4ZD3L 4HCRA 2HKAA 4RAUA 2E5CA 4DEPC 1XGPB 5LG6A 4JGNA 2G2PA 1HH9B 4WTZG 2N0MA 5DUBA 3S35X 4O0ZA 4CNTA 4P5UA 2VLLA 5DRIA 2PW2B 3IGXA 1EX5A 3UWUA 4Y4FC 5CZJA 4ALAC 4CC1A 4RUBA 3CFIC 4XAPA 4HHMA 2WLLB 4IJ3B 1Y1UA 3V0IA 2G0LA 3BUPA 4XP9H 2WXNA 2NNAB 2QADD 5EU4A 3U0HA 3FJ6A 4WJXA 2CA3A 3V0AC 2X0SA 1IC7H 3S2MA 1JCMP 2JEPA 2BNQA 1M1BA 3ROLB 4LHQB 1CGSL 3WBWA 2VQ1A 1TR7A 4GD0A 3V5HA 3ETBF 1XLCA 5ENWA 1O6IA 4RE0A 2FSEB 1NF7A 3KLDA 3SD2A 5K2ZA 3QEZA 5DHEA 2ADJA 5EZIH 3QFJA 2CGZA 1HKFA 2DQCL 2ZKXA 5FEPA 1GYAA 4AK1A 3DURA 1UR9A 4NQ1A 1OAQL 2VFIA 2OW7A 3NUKA 3WOVA 2BSRB 4JFSA 2EVJA 3KOXA 1XYFA 4BH7B 5FYKL 1LO5B 4GS7C 2ITCB 1BD0A 3BQUB 4M6OL 1ZGLP 4FOMA 4LOFA 4PWHA 2DJSA 5CHNB 3CG8A 4OUIA 4MA1C 3NJGA 3PJXA 1FNSL 4YDIH 4YX2H 4GSDH 1VKXA 3FU0A 1NLDH 4L1WA 4DGIL 4F57L 4YHLL 4WU7A 5I8KH 1GG0A 4JFWA 3MANA 1IBFA 4AISA 4JLRB 5GGSA 4NF7A 4Y2DA 3AFLA 4X6DF 4RGNB 3ULUE 4ZFZB 4L64A 3TBVB 4M48H 3DPBA 3FOLB 2J88H 1GOQA 1Q6LA 1ISVA 2ZWNA 4FXGA 4Q8MA 3S3BB 2WQAA 1P4CA 4MAVA 3EDDA 4ODBD 3MBFA 4RIRB 1FORH 1D9KD 1A7NH 1BDYA 3FCGA 1SVBA 2FWOA 4WDWA 4TNVK 3KLHC 5EZLA 5JHDD 2CHDA 2KZKA 3M8OH 3UG4A 1JZDC 5I8EB 2HWZL 3RKDC 3CN4A 5CC3A 2CUIA 4DJEA 1P9MC 2GVYA 1YNYA 3IKKA 3W0WD 4YTUA 5F89B 3BIKB 4R53A 3VFRB 4NQDD 1XLJA 3QFGA 3VDAA 1L8PA 4HPJA 4LX4A 3SBWC 3FQNA 1YPFA 5JMOC 1S2UA 1I1AC 4LARL 2RA1A 3AB0B 1R3JA 2XPGA 2CJUL 3EADA 4FEMA 3WXVH 5EZOL 1E6OH 3GBMH 4KHXH 2VJ0A 4M7LH 3LM7A 3N4AA 2CJ3A 4LHUB 3LMJH 2VL4A 3NXLA 4ZD3H 2ITDA 2Q5BA 1JD9A 4OIBA 4ERSL 1H61A 3DWTA 4OLXL 2G0WA 4HZLB 4H44C 1I3RA 1BOGB 1EPFA 2VABB 1SYTA 3BVDB 4UTAA 1B3YA 2BY0A 3TJ4A 5JDJA 4JFZL 3N2BA 1E5ZA 1LBMA 4X7SH 3GI8L 2OYMA 4ERAA 3I9IA 1OFBA 4GP8B 4PG2A 2E7HA 4ES4A 3GWJA 5BV7C 1BQUA 3QORA 2YB1A 4FMVA 5CR1A 4YXLH 2EPMX 4EPEC 2VKXA 1FZJB 2FYVA 4M1RA 3AREC 4PJHE 4N8PA 2PP0A 4NUJB 5DZOA 3QNZB 4Y9GA 3TEYA 5D37A 1CGSH 3AADB 1E0XA 5G2NA 4KW2A 5JIQA 4JNXA 3REQB 3NA8A 4IU2B 3T4AA 5IFPA 1MFNA 3ZJ8A 5TQ2L 1YAIA 4LS0A 4TQTA 4DK6A 3TFKC 3WL9A 5GGQL 1FYTA 3O0KA 2BX5A 5IVZB 4AL8L 1XGYH 2BOFX 2DQCH 1D5RA 2WV3A 1KJMA 4FQQA 4M1BA 3NACH 4HB7A 3WLNA 3OAWA 1ZBKA 3STLA 3WQDA 4TUKL 3D2UB 4DGUA 3WQFA 5BW7A 3OLIA 4GQRA 1D9EA 3QOKA 2OZNA 2VSMB 4MJJA 1WAAA 1GYVA 2GCYB 2BP3A 5FYKH 3MMEA 2FVMA 2WJZA 3C87A 3GSNA 1R75A 3CWHA 1NPUA 1I1XA 4PS3A 4XP4L 3HPZA 4NQXB 5KSBA 3VXSD 1MELA 3T3MF 2BIOA 1VRSA 3ZKXB 4J3OF 4XMTA 4YHLH 4KRUA 5KBDA 4TVUA 1XGTA 2EKGA 2XVBA 1CVRA 1S5TA 1ODUA 3PWPA 4UUJB 3B8IA 3U0TB 2EXTA 3DC8A 2WLIA 4LP5A 4RH4A 4HT1L 4NAJA 3NFUA 3S5LA 1XR9B 2VL5A 1GS8A 1NIFA 4OD2B 3V0HA 1SYSB 3A9BA 4RNIA 2YQGA 3NJJA 1S39A 2P4AB 3TTEA 1VF5C 1G9MC 3A6CH 3NQMA 1E2VA 3BKYH 4J3OD 2QR0A 3ITGA 3SDAD 1CL7L 3D85B 2CERA 2H0FA 4FP8L 1JNHB 1QACA 4QY8B 4N3UA 3D46A 3P8IA 2K7PA 4GLEA 4HUVB 4FTVE 4PMOA 1PTAA 2OMNA 1F3DH 3VZXA 3NCEB 5LIWX 4N85A 4GKSB 4ONVA 4Z95L 4U7SA 1JVOA 3MNMA 2BSLA 2ZA1A 3Q44A 3OPUA 4TXEA 4ZMPA 3WF3A 2XTJB 2YYTA 3KLAA 4PTXA 1TA3B 1Z1WA 1X7IA 4XO5A 3E9UA 1POJA 4B5XA 3LEYL 2GQ9A 3FOMA 4E9XA 2ENQA 5EZJA 4LARH 2H9GB 1UJTA 2Q8BH 2NWRA 2XFYA 4IMAA 2CJUH 1UG6A 1QVOB 2QF7A 2X1XR 4KY1H 5T1KA 3B2UD 1GTHA 3LK6A 3L5LA 2OOFA 1NOFA 4PR4A 2YRBA 1SW0A 1TQBC 1JF1B 3W71A 2DYPB 7FABL 3SCRA 1V02E 2VFDA 4XNQB 3H3PL 2OMBA 4ERSH 3QWRA 1THCA 4P2QA 4YLQT 3O4LB 2B7NA 2DMHA 3B9DA 1N64L 1QATA 2BNRB 2PYED 2CDGB 3H2AA 3HC4H 5I7GA 4HIJA 4YNYA 1Y0LA 1T6MA 4JFZH 4YHKL 5DHVA 4ELKB 4ZCWA 1GZJA 3GRBA 1XGRB 3DZ1A 3GI8H 3I3BA 1KFBA 4H5SB 4RE2A 5E0QA 2NX5A 3VQ1C 3VFOB 2J1WA 2ZOXA 4HGWA 5HBBA 4QGTA 4DKDC 5DQDL 5F6HI 1AS8A 4EIBA 1A4BA 3EUDA 4DETA 2E1WA 1QNVA 2DLHA 4ZI8A 4HCRH 4BFFA 4FL4B 1S7RA 1AVAA 2CDFB 1XIHA 1KJVA 4GUFA 1CYXA 4HQQL 4U10A 3D39D 3TFXA 2OEMA 5EEYA 1BXUA 4U2ZA 4DOHE 3IFLL 3XIMA 4ZXBA 3L3DA 1TYRA 3RPMA 2WO2B 4AL8H 1RK6A 5HHOA 1B0IA 2AKZA 4LAKA 4HX1A 4Q58C 4IGBD 2AJUL 3TQVA 2NR6D 4D9RD 3MOBL 1BEYL 3QS3A 5HI4C 5CZ0A 4XZUB 1GKEA 1WXZA 4Z7WA 4Q22A 3WD1A 5E8EA 5JQHC 1B57A 1UBPC 5BRZD 1B2WL 2WMJA 2AW2A 2MIZA 3OXRA 3ATYA 4WVXA 3F7YB 2R1XB 4OGYL 4KNQA 3FCTA 1UJ3B 3U1QA 1ZT4A 4FFVC 1NOUA 3W5MA 4HT1H 1JSYA 5DMMA 2VSKB 1FN4B 3HLAA 3THQA 3VXOB 3WLSA 5EF2A 3WQ4A 4Y5XA 3ZXAC 2WVVA 3X1GA 1L9MA 4Q32A 2IUZA 2IH1A 1NP0A 1O68A 2AQSA 1A5MC 3SDDB 1CL7H 3M17A 4FP8H 3IU3A 1TZHA 4U6HA 4HBKA 1XXDC 1IEVA 2LV4A 4WFHE 4RR4A 2Y5TB 5AYQA 5IFJA 2F7OA 2QGHA 2XISA 4ZW6A 1ZLUK 2O9OA 4Z95H 3IDMA 2IPWA 4PMEA 2CE6A 4ANUA 1VH7A 2PP7A 1UR2A 2XBZA 2XWJA 4WGXA 3GTVA 2V33A 4U2YA 4XN7A 3IKCB 4PEKA 1YY9C 3MLSL 3IVTA 3FLUA 4PB4A 4A63A 5GS0C 2XIJA 1NDWA 5I6KA 3HPLA 2JJTA 5ESVA 3ZT7A 2QSTA 4OZ4A 4AYBA 5HPOA 1X39A 4A22A 3FCPA 4FPSA 1KCVL 1LO2H 5E09A 2J7EA 4W7VA 4TSAL 4JG1L 5IY5B 1JGVH 4RX0A 1K8IA 4NJJA 1I75A 4WLCA 4XD6A 5KUKA 1HXJA 1SZEA 2CHOA 4MZ8A 5IW6A 5I1IH 4HKJA 4BELD 1YX1A 3KPRA 4MF4A 4GYFA 4ZQMA 3H3PH 4TUJB 2VLJB 1XUUA 3EOLA 4MQSB 1V27A 5HJGA 5LNRA 2XWEA 2OL3B 4Z7OF 3CMFA 3CHRA 3N15A 5I16B 4JN6A 2C8NA 4KO6A 3T8LA 3EKCA 1N64H 3CDZA 2XTLA 1Q8MA 3A3YB 1U8LB 4RLIA 1FCGA 1W1ZA 4YHKH 4UYPA 2AAMA 4P7OA 4GVIA 2RBLA 3G5VB 2IADB 2CNZA 2YKKA 2H2PD 4MNKA 1BXNA 1PKOA 3FU7A 5H8UA 4NKDA 3VXNB 5BO1L 4YMPA 2L0DA 4ROQA 4MB4A 5L2KB 4RSVA 1G7JA 5AHMA 1E42A 3JUZA 1CB7B 2BP0B 2CHXA 1ZLVH 1MHHB 2IPUG 2Z28A 1A3ZA 3IGHX 4AC7C 1UH2A 3CIWA 1GYUA 3T8XB 4TSBL 1KFGA 4DYEA 2QJNA 4WK9A 4UTAH 3LCYA 4H4NA 4N68A 4ZQKB 3U7YH 4UANA 4N7QA 1MYRA 4KROD 4G8IA 2DQJL 2NT1A 3IJYB 4G1MB 3UPCA 4EN3B 5EN2B 4N2HA 2AJUH 2ZYFA 1S4IA 3BLIA 2YEQA 4YS1A 5FXCH 1BEYH 1ZTMA 4MFEA 3EOEA 3D87B 4AX6A 2H3NB 5CD5D 4M0XA 2ZE3A 4HEME 1UWAA 4XCNB 2OZTA 1Q3NA 5AZ0A 2IH3B 1KB9K 2VFFA 2JCCA 1BJ1J 4F2MB 4UTBA 3BDKA 3U4BL 3EH4B 1PX8A 1TCMA 3T4YB 4R4FH 3U8GA 1KKRA 3U5UA 2DD8H 4KMQA 1EGVA 2BWIA 3QXVA 1IT7A 4DXXA 1T5KA 1IGML 3D4CA 5ABHA 4JFEE 4ATTA 3HCVA 1O5KA 1W0WA 3KPPB 4AX7A 2B08A 4CNPA 4XI5D 5F71A 4C58B 3B7UX 1A9EA 1JPKA 4AXWA 1SXZA 2P5WD 4NZ3A 2QT3A 3IK4A 5KYWA 3B6SB 4YSDA 3RL2B 3SQBA 4R0LB 2P0IA 4JL1A 3NNTA 3G1AA 3QUXA 1KM1A 2PFHA 1G9NH 4UDTB 4QF1A 2YA0A 3LERA 3MLSH 4EANA 5I28A 5HGHB 5LGZA 4D2JA 4CQAA 4XZWA 2P80A 3H54A 5FA3B 4JHMA 4PUUA 4X7EC 5DRWA 3HRZB 2B7QA 3KW8A 1LORA 2HRPL 1KCVH 5D72L 4TSAH 3U4EB 2NXYB 4F79A 3PNZA 3NR0A 3T2NH