4NX0A

Crystal structure of abp-wt, a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
430
structure length
430
Chain Sequence
SMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVDDIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 151
structure length 430
sequence length 430
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nx0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx0A01
1XBVA 3N34A 2QCNA 3HJEA 1KFLA 4O0KA 1H7RA 3K8KA 1TTPA 4NNBA 2V2CA 2YKKA 4BFAA 2PWHA 2OSWA 5FEZA 2QCMA 2FHCA 1X1OA 3NZRA 3L5LA 1ICSA 1A5BA 1G4SA 3NYZA 5AC6A 4XZ9A 4UIOA 1SO3A 2VEMA 5BMWA 3W7QA 4MY9A 4X9SA 4LS2A 3KL3A 1L9WA 4MLRA 3ECQA 1KXQA 1WZLA 1Q3NA 4DPPA 3VX0A 1H1ZA 4Q32A 1B57A 1YXYA 2OZ0A 1R47A 5G4EA 2ZIDA 3E96A 3M5XA 3CZEA 2ZZ2A 4PA8A 4JTJA 3C4UA 3EXRA 2Z1KA 4J3SA 2TMDA 3V1PA 3TFCA 5G1TA 4JY9A 1BVNP 2J25A 3BSHA 2Z6IA 4P61A 2E8ZA 1S5TA 3EKLA 1EWEA 3W1TA 3FYOA 1TMHA 2WCSA 2TAAA 3RLVA 1KFKA 2JGQA 2WANA 1E43A 5DCDA 4UXDA 3P80A 3NQMA 3R5EA 5LGXA 5CPOA 3W74A 1F73A 2WC7A 2FPYA 2Z6JA 1JGIA 1KWGA 4O50A 3ABSA 3M0ZA 2EABA 5I3GA 4JY8A 4Z08A 4UTMA 1EO7A 1F74A 3BUBA 4NX0A 3N2MA 1DVJA 5AC8A 3MI6A 1PIGA 1HG3A 1FXPA 3ZSSA 1TCDA 2ZUWA 8CGTA 1NSJA 1TV5A 2ATMA 3LX9A 2JGYA 5DLCA 3W86A 3HZ3A 4N4PA 4R33A 2V3FA 3M47A 4Q33A 5TQLA 4U28A 3W2UA 2QMKA 1SZFA 3RFAA 4UQCA 1EHAA 4I7WA 2EEXA 1IGSA 5AHNA 3H55A 4KFPA 4R7JA 4CQ8A 3DHUA 4CCCA 3B0VC 1H51A 3HG2A 3I7RA 2G3MA 1O7DC 3P60A 4PC8A 4GE8A 2YCEA 5KINA 2ZZ7A 4H8UA 4N02A 1JCMP 1QOQA 4HT3A 3WJZA 2J88A 5AHLA 3ZFHA 3PG8A 4AVFA 3HGJA 5I3HA 2EAEA 1THFD 3WNKA 2H6RA 1V3LA 4UNIA 4AEFA 2GVGA 2WSRA 3DHFA 3PWAA 1TRDA 4O12A 2VFHA 1MXGA 1H50A 1XC4A 1W3TA 3GBEA 3W7MA 1JUEA 4FO4A 2E6YA 1JRBA 3W7JA 1ZY9A 3BH4A 2D2OA 2Z1BA 4MY8A 1CGXA 2XFWA 3AXHA 3L2IA 3NPXA 1KTBA 2CXGA 3DFSA 4M7SA 4AXKA 4PCTA 3LCIA 3LRMA 1ZNNA 3HO8A 3UPWA 1UOKA 4TR9A 3HBLA 1PPIA 3W22A 1NFBA 3LV6A 2X1UA 1S5WA 2VR5A 4M19A 4CN1A 4UNLA 4NUWA 3UZJA 2ZX5A 2QCDB 4MVAA 5E0KA 1RVGA 5I0DA 2O7SA 3VGEA 5L9FA 1MFUA 3OG3A 3BLKA 1ME7A 4XB3A 2ZZ6A 4J9JA 1UASA 3W1MA 2A7PA 3IVUA 4KWVA 1YYAA 1XXXA 1SO5A 1PHWA 4LV4A 4WY0F 2OT1A 1GQNA 3RILA 3MHGA 5DXXA 2XVKA 3P81A 4O13A 1K7EA 4GUGA 4Y8FA 2ZRXA 4HOWA 4AYGA 4WOQA 2F7QA 2R94A 1H7XA 3FOKA 1OFBA 2EHHA 2B0MA 4NXKA 1JFHA 2XIIA 1UD6A 3BAXA 4O10A 3NQVA 2ZRVA 3C2VA 2NV1A 2O7QA 3C52A 3PG9A 4JN6A 3BMWA 3M43A 1KW1A 1HUVA 3BARA 3L0KA 4AEEA 1TYGA 5J5RA 2D3NA 3W7LA 1KCKA 3IJ7A 4JTHA 2TRSA 4Z1DA 2DZXA 2UV8G 3TOPA 4ATWA 1FDYA 3HIJA 3EJUA 1KWKA 3G1HA 3W2NA 1KM1A 3BG3A 4ADUA 6TAAA 4GINA 2C15A 5KZMA 1SMDA 1QWNA 2DH2A 1BWKA 5SWUA 2C7FA 4PH6A 1BEUA 4JL1A 2NZLA 1D7FA 2ABBA 3STFA 1ZAJA 3TMLA 4DBDA 1CI1A 1H7WA 1LBLA 3I7SA 4FNRA 3N9SA 1ALDA 3GKAA 4A22A 4BA0A 4FXRA 5CZJA 3DFOA 3IGUA 1AG1O 3VE7A 1TJRA 3DX2A 4DBEA 1AMYA 3EXTA 2ZA2A 3P67A 3CPRA 1P4CA 3UWUA 4DF0A 1Q4NX 2XIBA 3USBA 2Y24A 2W6RA 1GTEA 4WY0B 5KZEA 2C0AA 1HNYA 4JS3A 2QJIA 4QAWA 2HMCA 4KFNA 4Y90A 2OJPA 2JK2A 5HWNA 4HP5A 4LV9A 3HMJG 1W5MA 3DAQA 3R13A 1H62A 3LPPA 2FGZA 3P5YA 4Y6GA 1FUYA 4MKNA 1SO4A 3K8LA 1UA7A 5E6YA 3QMRA 2IGTA 2Q3OA 2ZICA 3P74A 1TTIA 3NNTA 1EP1A 4UQBA 4Z1AA 3IK2A 1BLIA 4A3UA 3IJ9A 2QJHA 5D09A 2WKLA 3WDIA 2YFOA 4J3XA 1P0KA 3M5ZA 1K02A 2F2HA 1OFAA 3DI0A 4E2BA 5AHFA 3QM3A 2C6QA 2BY1A 3M16A 1LTDA 3QC3A 1S46A 2E4TA 2X16A 1L2UA 1PVNA 2ZRZA 3GIYA 1JAEA 3MBDA 1TQWA 1H7NA 2XN1A 1SFLA 5DY2A 1AK5A 1UCWA 1A5AA 3BGGA 4OV9A 1G4PA 2NX3A 2Y2WA 1UH3A 2QAPA 3QH2A 3BLPX 3G1XA 1CDGA 1AW5A 2NXIA 3C2FA 3ABRA 1R34A 5LSMA 3NPWA 3QZEA 3PBYA 3WENA 3EX1A 4TMBA 3P82A 2QLYA 1W3IA 1JULA 4MUZA 2VNCA 1OT1A 4LS1A 3N9RA 1WZMA 2FPTA 1C8QA 2A0NA 1GJWA 3VNDA 3OVPA 2NXGA 4JTTA 1QWGA 2EO7A 3UD6A 1JVNA 3ANYA 1PIFA 2NUYA 3G18A 3G0UA 3UYCA 2C18A 2WO5A 4S2CA 3W2JA 1KV5A 3EDFA 1V3JA 1NEYA 1W5OA 2ZDRA 4S2BA 3W72A 1FWSA 3BV4A 3EJPA 3GBDA 1QPOA 4B9YA 1TQXA 1GTHA 3ZT6A 3N2XA 1XCWA 1W54A 4OHQA 1LDCA 5I5RA 4GC4A 4OE7A 4TVUA 4FF7A 4UCGA 4LNYA 4Z1CA 4GRSA 1KV8A 1WXJA 3M07A 1OX6A 1JXJA 4G1KA 1B4KA 2W79A 4AF0B 2VEIA 4RXGA 1GVRA 4CCDA 1JXKA 1WZKA 1LOQA 3EJSA 5DXYA 1D3GA 1RV8A 2RDTA 5ABTA 5G4WA 4DPQA 1DEDA 1MXDA 1OFOA 4H8HA 2D0HA 3TUUA 3EDJA 4UQ9A 5CPMA 2VKZG 1BSIA 3KOFA 2GVJA 5C55A 2E6FA 1VPXA 3L5AA 1I2QA 4O11A 1O94A 3KFTA 4LU0A 2GJLA 3UG5A 4LVDA 2ZBTA 2P0OA 3PB2A 3TCEA 3NQCA 1PS3A 2YW4A 3VFLA 1UD4A 3GNDA 3O6DA 4O4WA 2V8ZA 3PF3A 4WUIA 4M56A 2X1SA 3CPUA 1OFDA 3PAJA 4JX5A 1OSEA 1I75A 5AYZA 3H54A 1JL8A 3EX3A 3HGOA 1G67A 1YTDA 2C3ZA 4POCA 3W7DA 1JDDA 2FHFA 2NSXA 1XH1A 3R2GA 3N19B 4OWGA 4UFIA 4JR5A 3NA8A 5DCEA 3BSGA 1KM0A 5I23A 1XDLA 3G1YA 4AIEA 3U6WA 1X6UA 1HXKA 3VM7A 1XBXA 4ML9A 3W1XA 1UJPA 4ZQRA 4AEOA 4QM1A 1UH2A 3W07A 1J5TA 3UPBA 4HNVA 2C19A 1KM2A 1NF7A 3BLEA 4UTUA 4GQQA 1WAUA 1KFJA 1XM3A 3A24A 2A5HA 4J3TA 1TPB1 4QAIA 1DJQA 3TTYA 5F2MA 2DZTA 3AO0A 3FS2A 1QR7A 2H3BA 3KHJA 2ISSA 3TC6A 4LY8A 2Y85A 4UZSA 1M7XA 1EB3A 1VCVA 1Z42A 4X9YA 2OMAA 3DX1A 2DP3A 4IXHA 4K39A 1W5PA 3GDRA 3ZR5A 1F76A 3MP3A 4QJ1A 4K7VA 2RHGA 1JUBA 3KRUA 3M44A 3HGSA 2G96A 9CGTA 5H91A 3EJQA 2GUUA 4FX6M 3CEUA 1JQXA 3LM7A 3EWXA 4FLQA 1TPVA 3CIXA 3W2MA 1ONRA 3KLLA 3L4YA 1VLIA 4ZMGA 2AQWA 2KZHA 1UD5A 1BTMA 3W37A 5KITA 1LWHA 1L6YA 2DZPA 3EWYA 2PRHA 3FIGA 5DELA 4J3WA 3KX6A 5CLWA 4CN6A 1PCWA 2A1YA 1ME8A 3NR0A 5E0FA 4H4IA 4MJMA 2C14A 4LRTA 4O15A 3S5OA 1XSKA 3QRHA 1OJXA 4ONVA 3W85A 2YA0A 2Q8LA 4PODA 2AAAA 2YGYA 2B7QA 4JFWA 4JTGA 3RU6A 3SGUA 2DZVA 4S1FA 3BVJA 3PSVA 1RQHA 2H8ZA 4JD4A 5DFAA 2Y7EA 3BC9A 3LCLA 2CHNA 3O06A 1YPFA 3STGA 1UA3A 3FW6A 1X8FA 1VR6A 2CZFA 4AYSA 2HSAA 1J0JA 3BUDA 2YZRA 3A9IA 1B9BA 2F7PA 1DV7A 3NDOA 1XUUA 4B5NA 3LHYA 2VRQA 4GJ1A 2VXNA 3P5ZA 4A2SA 4QNWA 3W7IA 3A21A 2GQ8A 2X30A 1HTYA 3IGSA 2F7FA 1SR9A 3UG4A 4Z0SA 1VQTA 1D9EA 1OVDA 2QCEA 4XKYA 1G94A 1QHOA 1PIIA 4AF0A 3DKJA 3DFQA 1SZEA 3KVKA 3GDMA 1OX5A 1RR2A 1M6JA 3UZ5A 2NV2A 1YXDA 3LI0A 2NX9A 5KEZA 2IQTA 2QCGA 1YDNA 3DZ1A 3PVFA 5D2VA 1PJ9A 3WJSA 3G1DA 5D2TA 5HUOA 3CTLA 4K36A 2C1HA 3TQVA 2QCCA 4LQ1A 5CLTA 5FF4A 2ZRWA 4B9ZA 3IGXA 1ZFJA 1ME9A 3O1NA 4GO9A 1L6SA 3GR8A 1KLZA 2I14A 5DY3A 3LXAA 2OYMA 3NZ1A 4WZHA 3OBKA 3PR2A 5EL1A 5EY5A 3UY7A 4AAJA 2YFNA 4ZVJA 2QCHA 3OEXA 3CQ0A 4JIQA 1MSSA 4K37A 1MO0A 4JX4A 1YTKA 3GZ3A 4HA1A 2DH3A 2EACA 4I9AA 1TQSA 3CB8A 4NVTA 4OU1A 4QSHA 1KTNA 1MEWA 1WDWA 2ZA1A 2ZQ0A 5D30A 3OLDA 1IXQA 3YPIA 1CIUA 5HPOA 1YTEA 2WKGA 1WOAA 4XQ6A 1AVAA 2WNZA 4JYDA 1G69A 1N55A 2A2IA 4O1DA 3OLEA 2EQDA 5IBXA 4O28A 2CPUA 4JDBA 3W1PA 4CQAA 3WY4A 3WEMA 3VMPA 3EX2A 2ZUUA 4IPJA 1LWJA 1AQHA 1W37A 1FY6A 5GVJA 3C3NA 4JGDA 3S5NA 1OFRA 1X1ZA 3TFXA 1MXSA 3OLIA 1W8SA 1TREA 3S1WA 2PRMA 3D0CA 4HKPA 2QV4A 1FBAA 1FCBA 5H2ZA 2DU2A 3TSDA 3UY8A 5CZSA 3GKFA 1BF2A 4BK9A 4U4MA 2FE0A 3G3MA 1PZ2A 3LLDA 4KFOA 1A5SA 2WVVA 3KWXA 1SUXA 3KL5A 3E9AA 4YCPA 1RP8A 1Q6QA 2Y5EA 2ABAA 2ZXDA 1OFEA 3LLFA 1UD3A 2WOQA 1I2PA 3VSVA 3L68A 1LOLA 3BVVA 2W0UA 3C2EA 1RQBA 5F2GA 3Q58A 1DKWA 1FXQA 3OVRA 5DO8A 4A2RA 3DI1A 1F2JA 1QMLA 3WMSA 4NI3A 1W31A 3PBUA 1J0IA 3C0JA 1G4TA 1PS9A 3BUPA 1R33A 2ZFAA 3S8HA 3GXTA 3L66A 3P62A 3PULA 2BZNA 1WBJA 5EYWA 1I8JA 4EVZA 3CTTA 4WSKA 5FI8A 1Z41A 1TRIA 3W7CA 3HG4A 1EUNA 3W1NA 1F05A 5HUPA 4U2YA 1EEPA 1TQJA 5CGTA 3SR7A 2EGZA 1FDZA 3KVLA 3WK1A 3F4WA 1IXPA 2VT0A 1GT8A 2Y62A 3NQEA 4PEEA 3W7EA 1G6CA 3A5VA 1FDJA 3WDJA 4DXVA 4DF1A 2A85A 4MAZA 5BOOA 3UWVA 2R14A 3TQKA 1W3NA 1X7FA 3G1FA 1I2OA 8TIMA 1WE5A 2VFFA 4L4LA 1HT6A 2YSWA 3KXQA 3SW6A 1AMKA 5A6LA 1JJKA 4X22A 1HO4A 4JFSA 4FIQA 4R34A 3LOTA 3LDVA 2ZCGA 1U2YA 1Y0EA 5HR6A 3SY5A 2ZRUA 4W9TA 4ZQMA 4FLRA 3W87A 2FB3A 3WJWA 3G22A 2J6XA 2FTPA 5BNKA 2GJPA 2B7NA 1CGUA 1EO5A 4UMBA 1TTJA 2BXYA 3QW3A 3C56A 4IPIA 4GI6A 3BW3A 4UNKA 1G4EA 1HWWA 1YDOA 1GYLA 3BLIA 1G7VA 1GG1A 2VFIA 1Q6LA 3DBPA 1Q6OA 5LHEA 1F5ZA 2FLIA 1W5QA 1I2NA 5U4NA 4UTTC 2ZUSA 2E6DA 2WJZA 1KBBA 4FMVA 4IMGA 3QGVA 5A2CA 1TPWA 1PE1A 3W6YA 3TMQA 5A2BA 2FIQA 2GOUA 1KGWA 1WA3A 1TCMA 2WNWA 1H61A 4NU7A 4HPHA 5F4SA 5AN7A 4FLOA 2HTMA 1EPXA 1KXHA 3O05A 1F6PA 4E2DA 4OJYA 1OFPA 5HINA 5HMSA 4IX0A 4PL2A 5K9DA 2LLEA 4KWUA 3MHUA 3F4NA 3HB9A 2VEPA 3RLUA 3T40A 1TIMA 2QUVA 1LBMA 4FNQA 3JR2A 1O95A 1HTIA 4UTKA 3FA5A 3T44A 1G5AA 2XWDA 3TH6A 4PL1A 1SFJA 2D0FA 3BAYA 2DZSA 1KXTA 3CEPA 1M7OA 4OBTA 4HN4A 1EIXA 1NF0A 5LNRA 3U2OA 1J2WA 2E6AA 4LS0A 4XWUA 4ADSA 3B8DA 3A47A 2BHZA 1RPKA 4J3UA 4AMAA 3M7WA 5C54A 1D3HA 1EUAA 3DX3A 1KFCA 1EP2A 1VH7A 1VLWA 1ZJAA 5D2YA 2DJLA 2QPSA 3BVXA 4ORIA 3TAOA 3W73A 3THAA 5LNUA 1WQ5A 1OHLA 3L2LA 3VGBA 1DQXA 3L5MA 4JL2A 3A23A 1WBHA 5EMUA 4X0NA 2YA2A 4JDYA 4XTDA 1OF6A 4MPQA 4UTWC 1ICQA 1SW7A 4HSNA 4UTWA 1U83A 3IIVA 3IVSA 3MI3A 3Q2DA 2V0TA 3VSTA 3W7NA 4UTLA 5I3IA 3RIKA 3GXPA 3W71A 1ODUA 4OKDA 4IMDA 1TPH1 1XSIA 3M41A 2CLOA 1GZGA 3FFSA 3TA6A 1V3KA 2YOCA 5HR7A 3FEMA 1AL8A 1Z32X 2R91A 2RDWA 4O8RA 1XBZA 4NJIA 4O53A 5F4XA 1J0KA 1IXNA 4NJHA 3ZT7A 3TR2A 3EDKA 2PWFA 3HPZA 3O6CA 4N9BA 4TIMA 3WY3A 4MYAA 3EWBX 3W7GA 2VOMA 2AGKA 1W5NA 3L65A 3S9YA 3S5YA 3QF0A 1VFMA 5KSWA 2G97A 3ZWTA 2J24A 5MHBA 1SZGA 4O1AA 1LYXA 4O1CA 6TIMA 1KM5A 4J3VA 3I7QA 1SSGA 1L6WA 4CNPA 4WJEA 3NGJA 2V5LA 3O8AA 4K8HA 2Y88A 4FIRA 3W1UA 1IXOA 1A5CA 3HG3A 1MEHA 3TU9A 3NEVA 1U33A 2ZX6A 2YYTA 5FF2A 1T0OA 3BG9A 5HWMA 4N6EA 3TSBA 4N2YA 3BLBA 3II1A 3AJXA 3TV8A 3NQ8A 3DENA 5DN1A 2CLKA 4IX2A 1Q6RA 3D52A 3QW4B 1GJPA 1EP3A 1OX4B 1XDMA 2E09A 2QJGA 4IOTA 2G95A 4NNCA 3S1VA 1QI3A 2PRLA 2GJNA 1DHKA 3KL0A 5E9AA 3M5YA 3SECA 3STEA 1XL9A 3VU2A 3C2RA 2QCLA 1CGYA 1B0IA 4E38A 4RJEA 2EPHA 5DCBA 4JTUA 4IGHA 4HHPA 2P1FA 1LRQA 4W93A 1KBJA 4CVWA 1OFQA 4UOQA 3GXFA 3ZSTA 1KGUA 1L0PA 3P84A 1KXVA 3W23A 5E93A 3DGRA 2QEZA 1E40A 3NQDA 3EWZA 1P6WA 3TXVA 2VRKA 4UC5A 2ALDA 3VSUA 3UNDA 3UWWA 3GXIA 1E3ZA 1VJSA 1QO5A 1ICPA 1KFEA 2E0PA 3QPYA 2Y4SA 4N4QA 4LTSA 3W70A 3TSMA 1ML1A 1GVSA 1GVOA 4JIPA 3VKJA 3I65A 3M1ZA 3RF9A 1QPQA 1UUOA 4JTSA 2XWEA 1VCFA 1OT2A 4CNNA 1UUMA 2OX1A 2BY2A 3W7RA 3WK3A 2X2GA 1VYPX 4XKYB 2Q8ZA 1VC4A 5G2WA 2XVLA 1H7PA 1YADA 4FB7A 1OG0A 1DL3A 1ZHAA 2VENA 4UOZA 3BAKA 1LOSA 1JR1A 2ALWA 4RZ5A 2WV8A 2G5WA 1G1YA 2WCGA 1YDVA 5U7SA 4GXMA 4LC8A 1W1ZA 3C2OA 1YPIA 1ZENA 2C13A 4YLWA 4XBSA 1C9DA 4AIOA 3DKLA 4ZZ9A 2QF7A 2EADA 5A6MA 1RZMA 1H63A 4LVGA 1LCOA 4ORMA 1TPC1 2QPUA 3N14A 2B7PA 2CLLA 3D50A 2RKXA 2TPSA 3RNDA 1ZJIA 5AFDA 2YPIA 1J4EA 1QPNA 1QPRA 2BXVA 3LHVA 5CG7A 4JFTA 1FX6A 1GWJA 5AHEA 3BUQA 3I6RA 3A6OA 3W84A 2BHYA 4DO5A 3HJZA 2Z0IA 1GVFA 4AWSA 3TTSA 1K7XA 1D3CA 3V75A 5CPNA 1BG9A 3CLMA 1GEQA 3SJ3A 1BAGA 2PWGA 1SQ7A 3LHZA 2A7NA 3CWOX 3CHVA 3W2KA 3W38A 3FAWA 1XBYA 1SO6A 3BCDA 3P7YA 4RCXA 4GUFA 2FFCA 2FPVA 1P5BA 2OW6A 4FHAA 2WVTA 3IJ8A 1NOFA 2NX1A 3NQGA 4O4VA 3ZT5A 3S1UA 3GLCA 2CWNA 3MBFA 3L4VA 2EKCA 2BY0A 2J9XA 5AHMA 3UWZA 5FESA 5KZDA 4M6QA 2E5CA 1RP9A 3M9YA 5C2XA 4AMXA 3TE9A 4WOZA 3KEHA 3L4WA 2E9BA 3HG5A 1CX9A 3QPZA 2NLIA 1QAPA 3EB2A 2BLEA 2WVVB 1K3UA 3DC0A 4HIBA 1CGVA 3QSRA 3F1QA 3WFZA 4I7UA 4ADTA 2WNNA 3IIXA 5D33A 1A53A 1DTUA 4PCFA 3LCHA 2DZWA 5CGQA 3BW4A 3MP4A 3SGZA 4BR1A 1XH2A 1TB3A 3B04A 5LHFA 3NPUA 3NXFA 3WNNA 3NQ6A 1TJPA 2NT0A 3NOEA 3B0PA 1EA0A 4J28A 1VCGA 3QQ1A 3NL3A 1OX4A 3FYPA 5E6ZA 3UXAA 3DFPA 2V2DA 4LT9A 5C6MA 5FF0A 4M8UA 1KFBA 2Y61A 4N9EA 5D05A 3ZR6A 3E02A 3BCFA 4ICNA 1C8VA 4AW7A 4LUIA 3A22A 2RDUA 5E1QA 5D03A 3P61A 3LCXA 4WX2A 2J27A 4GIAA 3GDTA 1WX0A 3VM5A 3PS7A 3W7HA 1QW8A 1T8XA 1XD0A 4WSJA 1VAHA 1VFOA 4OQVA 3W1QA 3G8RA 3IEBA 4C1KA 2HS8A 5L6UA 4MZ1A 1KM3A 3CGTA 3G3DA 2ZTKA 3DDFA 4KMQA 1FWNA 4GI8A 1O5XA 2YIHA 4QNEA 2ISVA 2R8WA 4FEZA 3THQA 4WLCA 1RD5A 4CLMA 1T99A 3QMTA 1QX1A 4U3CA 2ZZ4A 4P2VA 4LXFA 1EA9C 2ZUTA 3MJYA 2YXGA 4O1BA 4MZ8A 3BO9A 1BWLA 3CZGA 4UFJA 2BSLA 2OYKA 2E5BA 2VFGA 3Q94A 4DQWA 3P8JA 2F18A 3TROA 3MO7A 2ZWYA 1OF8A 4GUHA 4MY1A 3MYPA 4QIUA 5C5YA 2JKEA 1FWWA 4MYXA 4NQ1A 3QEZA 4KKXA 1GG0A 4WQ6A 3GK0A 3QQ0A 2FB2A 1MW3A 3IVTA 3WY1A 1C29A 1UBSA 4AWUA 3GXNA 2CLEA 3M6YA 1PHQA 4QQ3A 4XUGA 1QNVA 3G8EA 1QW9A 1AL7A 5I3KA 3L9CA 3DHPA 3EJTA 4GKLA 5EBUA 1XKYA 3TNOA 2DIEA 4UZUA 3B06A 3SZ8A 4E2OA 4UTJA 4UQDA 4NNAA 3MW7A 1HO1A 2Q3RA 2GPTA 4N9CA 3HGRA 2ZWZA 1E51A 2OT0A 1T96A 1TPUA 4TO8A 5F1UA 1SSDA 4N6FA 3E12A 5HJLA 3TAKA 1DJNA 1LLZA 2D0GA 3ZOAA 4RLIA 3AXIA 3P8IA 4UUIA 3WK2A 4HPXA 2CLHA 4UMCA 5F7UA 3GYEA 4NX5A 4BZYA 3B05A 1QO2A 5T26A 1TV8A 4GQRA 5CXPA 1ZJBA 1JIBA 1CXEA 2CFFA 4JICA 3W7KA 5K2ZA 2XN2A 3ZWSA 1DOSA 3R8RA 1F7BA 1O5KA 2GUYA 1LZOA 1VB9A 1VZWA 4OT7A 3EKZA 4UFKA 4U31A 4DO6A 2E8YA 4KWWA 4FNTA 1XH0A 3PM6A 3W76A 4H2CA 5BRPA 4HSOA 4BWLC 2J9ZA 4UTIA 4BWLA 2WSKA 5G5IA 1UKQA 1AW1A 4DF2A 2WQPA 2NUWA 2YW3A 3VGGA 1K7FA 2ZXQA 5K3VA 1QI5A 3L2MA 2Z2UA 1MVYA 3EX4A 2GJRA 4R53A 2ZX7A 7CGTA 3ZO9A 2ZZ1A 3G0SA 2WSYA 1CXHA 3UXDA 2V3EA 5HWJA 5I3JA 3MWAA 3M5VA 1CXIA 4HNUA 3WEOA 3TXZA 4O17A 4UQEA 3LTPA 2BHUA 3W83A 5DBUA 3DDGA 3PUDA 3VMOA 3NL6A 2C8NA 3NO5A 5FEXA 2E77A 2ZXBA 3LXBA 2JBMA 5CSSA 2X1RA 3MUXA 5CZTA 4WD0A 2OSYA 2V9DA 1WV2A 3FLUA 4DEFA 3DFNA 3NQ7A 5D2WA 4RZ6A 4WXZA 3NVTA 1PEZA 3SIZA 1S5VA 1M53A 3K8MA 2A6LA 4JX6A 1G7UA 2VEKA 1QHPA 1CGTA 4JTEA 1JCLA 2I1OA 4JTFA 3O07A 4LC6A 3AJ7A 2NUXA 2OW7A 3D4YA 3TDFA 3LPOA 4YL2A 4IJBA 1J0HA 3JS3A 4LPCA 1CLVA 2FHBA 1Y7VA 5BW6A 1O60A 4O54A 4UFMA 3TJLA 1PAMA 1EWDA 1CYGA 4J27A 2WVUA 2ZE0A 3S2CA 4QITA 2AAMA 4YCOA 5DBTA 4XTIA 5FF3A 2FH8A 1MFVA 1SU5A 3LB0A 2YX0A 5AYXA 1YXCA 2PURA 2VUYA 1UH4A 2ZRYA 3LBCA 3L0NA 4M6VA 2BTMA 3LTSA 3NAVA 3QJAA 5I24A 2EF9A 1LLWA 3VE9A 3ZR4A 1I45A 2DJXA 3JRKA 3C8FA 2A21A 2E68A 3D51A 1JDAA 4O52A 3L0GA 3BLFA 3PY2A 4UR8A 4UTTA 1XCFA 1FWRA 2E5DA 1JF6A 3W9ZA 1H5YA 3VMNA 2FQIA 1R2TA 1ZALA 3L21A 2BWGA 4CN4A 4H7VA 3TQ0A 2RH9A 1GOXA 3W75A 2OYLA 3VGFA 5TBOA 5BMXA 1B2YA 3S6DA 7TIMA 4Y96A 1LBFA 3BAWA 5D38A 2CZ5A 2VFDA 5A2AA 4DO4A 3IRDA 5I3FA 1WO2A 2Y7GA 4LVBA 2B7OA 3OVQA 3HF3A 3NQAA 3T55A 3EDEA 3T7VA 3MI2A 6ALDA 5A5WA 4Y9AA 5LGZA 3GXMA 4MLJA 3IIZA 3ZQ9A 4H3DA 5HNRA 1QI4A 4RZ4A 3EWUA 2DIJA 3LHWA 1JCNA 4RKAA 3SI9A 2H8XA 4YMZA 3GB6A 3LI1A 4MOZA 3LCWA 3UWYA 3ATZA 3KLKA 1K03A 4EF9A 5CSRA 3CZNA 1B3OA 5AC7A 5LNWA 3UQNA 5K9XA 3CV5A 4IMFA 2CZEA 3WJYA 1JF5A 1QOPA 1ZAHA 3W3OA 1A50A 3BUIA 1QPKA 2Y63A 3IIOA 1ZAIA 4IUOA 4FNPA 1UD8A 3WNLA 3TX9A 3CZLA 2F7OA 1RPXA 2F7RA 2FDSA 1SW3A 4RV8A 3EXSA 3NM3A 2E1DA 3O16A 2X2HA 1O4UA 4JFVA 3ATYA 3UCQA 3I68A 1OYAA 1TPEA 5EA9A 1KBKA 1VS1A 3TC7A 2GVYA 2FYVA 5HULA 3OLGA 4GO8A 1VHNA 4GWEA 1K8XA 5FF7A 3HQ1A 5K9CA 4JCMA 3O15A 5FEWA 3TW6A 2VELA 1PL9A 1MWOA 2GQ9A 3KAOA 2NXHA 4U33A 4NJKA 1FCVA 5HQEA 1UB3A 2CZDA 3CWNA 5BRQA 2VFEA 5D32A 2PWEA 4PSRA 3HOJA 1N7KA 2ZX9A 4H8VA 5CGMA 1HX0A 1VRDA 3PUEA 2OCZA 1AW2A 1OK6A 5LNVA 3CC1A 1ZCOA 3VGDA 3BVWA 2QCFA 2QDHA 1GJUA 5TIMA 1UKTA 3DFTA 4AHQA 1PZ3A 2TYSA 3L4ZA 4MIMA 3VGHA 3W2LA 1GCYA 2FH6A 4N9DA 1WP6A 4A29A 3W1LA 2GVLA 2QMJA 1MW0A 1ZS2A 4PSPA 1JCJA 3D4ZA 1KGXA 2JKAA 4JTIA 2YJQA 1LORA 4IWWA 5AYYA 1E3XA 3A5FA 3LERA 1Z48A 3C6CA 4MFEA 4HOXA 4HOZA 2BXZA 3H53A 3N3MA 1KB3A 4L4MA 2EJ1A 3VI2A 3VNYA 3CZSA 2F1AA 3TW7A 5J5DA 5CKSA 1G9HA 1VFUA 3L4UA 2YDAA 1EX5A 4MJZA 3GNNA 3W1RA 1UD2A 4OGZA 5AB3A 1SZNA 1DORA 3STCA 4LW7A 3FAXA 1R30A 5D02A 1KCLA 1TQUA 4EF8A 3O63A 3LCGA 4LVAA 2X1TA 1Z44A 3K30A 1JI1A 3CM4A 1QFEA 1OYCA 4H6KA 1A47A 5A8GA 4RK8A 1XV8A 1KBIA 4NT0A 2AMGA 3CU2A 3RK8A 5EKYA 1QWUA 1DHPA 3W88A 2Y89A 4U2ZA 1XGZA 2HS6A 1R75A 1VGAA 1WZAA 4NJJA 2WNQA 1IZKA 2XVGA 2DZUA 1M7PA 4BI5A 2V2HA 2V3DA 3CT7A 3WNPA 4K6AA 1IV8A 1CW2A 5CZ0A 3S1XA 4FNUA 3LBMA 1U5JA 1XFBA 3MYOA 3EWWA 3DXIA 3DX0A 1BVZA 2G3NA 4C1LA 4I7VA 2A4AA 1LROA 2ZX8A 3L4XA 4FLSA 2Y70A 1HFBA 5LZLA 4RXFA 4Z0JA 1K8ZA 4JTLA 4K38A 1LRNA 1KLYA 1N8FA 2WSPA 1VYRA 2WPGA 1S3HA 1JCYA 3FJLA 4TX9A 3SFKA 3KRSA 2PWDA 2C16A 4HPJA 2V81A 1JRCA 2QCDA 3QMSA 4NXSA 3IV3A 2QR6A 3F03K 6CGTA 2NWRA 3FJ6A 1U30A 4UR7A 1TO3A 1MZHA 1HL9A 3NPVA 2P10A 1AQMA 3EJRA 3DX4A 3VCRA 4UCFA 1GVQA 1CGWA 5K4ZA 5BRBA 3CLWA 5E70A 4IXXA 1CXKA 1HL8A 1LRTA 3PB0A 3MP5A 1JUKA 2Y7DA 5AHIA 3DHDA 3KVMA 2X2JA 2ZA3A 4ZL1A 2I9EA 3KVJA 3R89A 2A6NA 1MEIA 3GAKA 3UWQA 1TMQA 4AHOA 1B4EA 4GI9A 2QUTA 1LP6A 3LGEA 1JD9A 4LUJA 1EH9A 3B4UA 3T4CA 3TIMA 1KA9F 3GR7A 3OHIA 4JYFA 4M6PA 4M5PA 3HPSA 4GUJA 3GTNA 3C61A 4ZQNA 1NAL1 2YR1A 2CW6A 3BPWA 2Y6ZA 3G1SA 4MB1A 2D3LA 3ABOA 2BX7A 1XD1A 3WNOA 4FX8A 4OIFA 4UFHA 3VNZA 1LM1A 4HNTA 1YLVA 1H60A 2VC6A 1R2RA 3B0UX 5F1VA 4BI6A 1IF2A 1W56A 4IQLA 1P0NA 2F61A 2CU0A 1FWTA 5K7JA 3TKFA 1DBTA 1MW1A 2Y7FA 2TSYA 3QSTA 4UQAA 2CLMA 3ABQA 5F2LA 3W7OA 7TAAA 1OGSA 3BK0A 4ZQPA 4WXYA 5F2IA 5IM51 1P1XA 1JG9A 5D2XA 3WFAA 4D2JA 3ELFA 5LKYA 3K1DA 4NZFA 3S5ZA 3O6YX 4GUIA 4Z1BA 2ZZ5A 2YA1A 4K7YA 2ATSA 3G1AA 3GDLA 3KE0A 1HL2A 2B4GA 4IMEA 4PFMA 1I2RA 1XUZA 3OA3A 3MMTA 1R46A 1H1YA 3BVUA 1FCUA 4RX0A 4E0CA 3EEGA 1BKSA 4WY0A 1SPQA 2ZZ3A 5CPLA 4JNMA 3DU0A 2DORA 4TU1A 2V82A 5G1YA 1VYSX 1WOBA 3INPA 3WELA 3LV5A 4BI7A 4JFUA 3NL5A 2RFGA 4ALDA 3E49A 3LRLA 4O19A 1XCXA 3NQ2A 4JYEA 1GYNA 4Q4KA 3TJXA 2F1BA 4M7TA 3MHFA 4GFSA 3IIPA 4O57A 4ZQOA 3FKKA 4YXGA 4NZJA 1I4NA 3LXCA 3G0XA 3WY2A 1Q45A 1V5XA 3FKRA 3G24A 3R12A 3SSJA 1OABA 3T78A 4CCEA 3BAJA 2OSXA 2NT1A 1JQVA 4QISA 3EX6A 4JXCA 3NM1A 4O14A 4YWIA 2ISWA 1HVXA 3LRKA 4O0ZA 3N73A 4PEKA 2JKPA 3A4AA 2EAWA 4ZQCA 4CNOA 4X2RA 3NL2A 1OB0A 1IIHA 3GVGA 4HNNA 3B03A 4EOUA 3NG3A 5HDRA 1IIGA 1JDCA 1IZJA 4X3ZA 4LRSA 4OV4A 2PC4A 4GNJA 1RQEA 1FCQA 4LOCA 3WJXA 3WNMA 3ZS4A 3GAYA 1KM4A 3QFEA 1KTCA 4MFDA 3BG5A 3BAIA 2QDGA 2WPBA 4JEQA 2D73A 3AMLA 1GPWA 3BW2A 1ADOA 4FNSA 2GQAA 1SMAA 4AMWA 4CQ9A 3GX9A 2H3DA 3S42A 3WN6A 1W0MA 3VO0A 1QDSA 1TPFA 1VJIA 3PBVA 3Q37A 3UG3A 3NQFA 2QUUA 1MW2A 5EMYA 3RMJA 5KMYA 4J7RA 5EPDA 2NWSA 3TONA 4UMAA 4FXSA 2WVSA 4PTNA 4LWWA 3PC0A 2WSQA 3CIWA 1WYIA 3AMKA 4JTKA 1SW0A 2A7RA 3W1AA 1H3GA 1W9XA 3EDDA 2PCQA 4K8EA 4CKQA 2F84A 4UFLA 1CXLA 2H90A 2PE4A 3CZKA 2CLFA 1KM6A 4BF9A 1TV7A 3L4TA 1NVMA 1TSIA 1CXFA 3BVTA 1WPCA 5LNSA 2XN0A 3DH7A 1V7YA 4MZYA 5D04C 1R2SA 1OK4A 3BGJA 3GXDA 1M5WA 4EWND 5TD4A 2ZXAA 4JCLA 3WDHA 1K8YA 3LTYA 3G1VA 5KTLA 1PV8A 1VIWA 3UERA 2J9YA 4IMCA 4DELA 4O18A 2ZYFA 3PUOA 2BY3A 2V5BA 5G2HA 5K4XA 2FJKA 4AB4A 2WKJA 3L67A 3LHUA 2X2IA 1PCKA 2ZTJA 3PBWA 3LHTA 4AWTA 4XBKA 5HXMA 3UEQA 3GDKA 2CLIA 3W7PA 3KRZA 4EIVA 5D37A 4RR4A 3OIXA 1QCWA 4WF7A 3E0IA 5F4WA 4GBUA 4A21A 1GVIA 3BMVA 1DQWA 1CPUA 1TPDA 1UKSA 4PCSA 4UTHA 1TTQA 1XSJA 1FQ0A 3TK7A 1XI3A 3S0CA 3WK0A 4AHPA 4CGTA 2YYUA 1V3MA 5FEPA 1TQTA 4TMCA 3PSWA 4AH7A 2ZUVA 1JI2A 1JCXA 1F6KA 1NM9A 4NJGA 1VHCA 3QYQA 1BPLB 2V30A 4FX7A 5AOUA 3HPXA 3U8GA 3LCFA 3VX1A 5G2IA 1TQVA 2QKFA 4O16A 1JD7A 1OYBA 5IBXC 4LVFA 2QAFA 1H7OA
chains in the Genus database with same CATH superfamily
3LY6A 2HVNA 4CQBA 1DLFH 3FFOA 2ANUA 2C3VB 3PPSA 5FEZA 1J93A 5A95A 4OQTA 4GGHA 2HISA 3KGRA 4XCEB 5AD0A 2WLIB 4ELKB 4LAQH 2UX7A 4H20L 3MO4A 3B2VL 4DPPA 1LD9A 1H5BB 2WLLB 3DX8B 5C7XH 3E0VA 5DJXA 1C5BH 4J3SA 4MTVA 5BMFL 1OM3L 1W2VA 5T3ZD 1GZPB 3FPYA 2TAAA 5LIUX 1XRSA 2YPVH 3ZTNL 5DUML 3ORWA 1ML0A 4GXUM 2EABA 4PUBL 3MPCA 4G72B 3OWRA 1KNOA 2HB0A 3FTGA 1Z5YD 2ATPB 4XNDA 4W7UA 3TTEA 3BI9X 3UJTH 4RZBA 3G6AB 4Q33A 3W2UA 5TQLA 1SZFA 3RGBA 2VKXA 3K6SB 2JJTC 4KFPA 3DHUA 2JJTA 4L6OA 2PR4L 2ZUYA 1H51A 2EDYA 4XPAL 3FHAA 4H8UA 1BWMA 1JZ4A 3C6LA 3HGJA 2G30A 4P5KB 3ULVD 1V3LA 5IVZB 2R1MA 4LOUD 5T3XL 3W7JA 1QR4A 5D6DA 3T8VA 5D4IA 3F84A 2NTFB 4KAQH 4OLVL 2FX8H 5FGBC 3ILPA 5FGBA 4IBWA 3LV6A 1M68A 1A6TB 3UZJA 1H0IA 1KENH 4GABA 1CDCA 4HUKB 5HD8C 1THCA 3ULSA 1S7RB 1GGTA 2WQXA 1INEH 3LSCA 2ICEC 4TM9A 5HJGA 2ICEA 2XVKA 4GRLA 4OCWH 4IRJB 2YD2A 4EXKA 4ISVA 3NIYA 4XMKH 3TBYB 5BUGA 1EC9A 3U1SH 3TYUA 3LIUA 2HE8A 3LGDA 4AJWA 1KWKA 2CD0A 4N5ED 4ADUA 3F64A 6TAAA 1YBQB 4XO9A 1GJIA 3QCUH 1JZGA 4JM2D 4JQIL 4Y7EA 1E6RA 4FCAA 1T3FB 3CIQA 1NDGA 1Q4NX 5KSBE 2QJIA 3Q8FA 1R17A 4Y90A 3C8HA 1HGYA 2XSBA 4FAAB 3R13A 3GGWA 2KLTA 4DUXA 3ZRSA 1JZDC 1R19A 4DZIA 5EOQL 1F4YH 3IJ9A 1QUMA 1DQLL 2XSXA 3M5ZA 4JE0A 3U6RA 4IPNB 2H8PA 1TVBB 4Z7NB 3GIYA 5HGBB 4PJHF 4YLBA 5HOSA 2CO2A 3QI9C 3BGGA 3QI9A 3ROOB 3PDOA 5FGRA 2DYSB 5G4MA 4DNHA 4I5BA 3KCLA 2J72A 4XBPA 5LSMA 4HSAC 4C56D 4NO2A 3IUDA 1ZMYA 5M5DA 32C2A 1P2CB 1OADA 2FPTA 4FZ8L 2J8OA 1OTSD 4I0KA 3QEQA 5EO0B 2CLVB 3K0YA 4HA4A 4XIMA 1TQXA 4XCFL 1J1PL 2LFGA 3V6ZA 2QPEB 1UMYA 4HU4A 4LLVA 4R7NB 5I5RA 3Q65A 4FF7A 4GRSA 3ARDD 1S2TA 3RVUC 3KR3L 4DEUA 1R85A 4K9EC 4PJHB 1I9CB 1W72A 4WJKB 1OFOA 4BGDA 4JMXA 4DBSA 1V6TA 1UZGA 1RLCL 4UQ9A 4LPTA 3L5AA 3MRKB 2VR4A 4HA3A 3LZFH 2GJLA 5HP5A 3F2LA 5BS0D 1TSRA 3TL5A 1M3JA 4B5SA 3B9KB 1SJMA 1F3JB 3ICJA 1MI5A 4POCA 1CG9A 1EYEA 4A1RA 4G7VL 1VFSA 3MRDA 3MTRA 5JQ6L 4EPBC 1J5TA 1KBLA 1SY6A 4DFIA 4K3EH 1CI5A 4DZAA 1IFRA 4WUUA 1KTDB 1EX0A 1XM3A 1GAFH 1TPB1 2FZ3B 2DDQL 3OB0K 2ISSA 5CSZB 3QXVA 4HWBH 3GDRA 3MJ7B 4K7VA 3OW1A 2AGTA 2NY1C 1H3PH 2H41A 4HS6B 3CIXA 1IHIA 3RY5A 2VLRD 4TNGA 4YHML 2IAAC 4BH8A 4CQCA 1QLRA 3NAAH 3UG8A 2NW2A 2KMWA 3QA3A 4XUYA 2JFCA 1S7WA 1XSKA 5J89A 4Z2HA 3R06B 2AAAA 4Y9CA 4B9GA 1KRAC 3SGUA 2V63A 5FYKH 3PSVA 3DHMA 2P8PA 1ZIAA 1LHZA 1NFDA 1QHQA 4WDIA 2NY4B 4MNQD 2CHNA 4K5PA 5T1DL 2FZBA 4P2QB 1DV7A 4XVTL 3SKNB 2GQ8A 2CIPA 4OGYL 2C3GA 3LQMA 1D9EA 2Z7YA 4XKYA 3ZGIA 3UZ5A 2NUPA 1FNLA 3UAJD 2DWXA 3DZ1A 1OC5A 2VXSH 3QJOA 1M7DA 4WSGA 1OD0A 4FHBD 2N1KA 4FFYH 1ZFJA 1M3IA 1AH0A 2I14A 4BKSC 2OYMA 1EZLA 3PR2A 2QCHA 5B1BB 4X5LA 1DBAL 1VENA 6REQA 4RMRA 1CJYA 2RACA 2RUSA 5HPOA 1QRNE 1YTEA 4J3OF 3WU1A 3Q5TA 4GBXD 4TF4A 4OM1H 4JAWA 4Z5RB 1YEKL 4JDBA 2BWQA 4GA8A 1UWGH 4WEEA 4IPJA 3MJ6A 2OKTA 5KZCD 3O45B 3ULVF 2PYEE 3TVAA 1XR9B 4GXPA 4AQOA 2QV4A 5JDSA 3WQWA 2QT3A 1AKPA 3GKFA 5BOJA 2FX7L 3KWXA 4ZX6A 4U1NA 2ZXDA 1UD3A 3IFNL 1PYWB 3MX0B 5HHNB 3BGAA 3Q58A 2REQA 5I06A 1BP3B 4GLEA 3BWUC 5JXAL 1N70A 4XMWA 1WBJA 2AANA 4EVZA 4HMDA 4JKWA 3N42F 3QLDA 1ZRUA 4JAMB 1IE7C 1QP1A 4F20A 1PKQB 5CGTA 1VF8A 1UM4H 3QUMA 3CXDH 3WK1A 2M83A 2DLTA 4IIEA 4LCRA 4DFHA 3II3A 4HJJL 5EHFA 3CX5J 5CSYA 2VFFA 4XHJD 3FB6B 2UXTA 1J6PA 4LUYA 3UO8B 5GRYA 3HIZA 2FB3A 4YVPA 4OVUA 4JM2F 4RE3A 1EO5A 3QW3A 2ZOWA 4GI6A 4UNKA 2BB0A 4X9HA 2O4MA 5JHDA 3BLIA 4U1SA 4PGBB 2J8UF 3ZY7A 1QFWL 3SQBB 5IHZB 3BWSA 5A2CA 3SUSA 4PRNB 4BZ1L 4PHXA 1EJRC 5DRNA 1H61A 2XINA 1EFQA 4W9DC 2WN3A 1SLVA 3O3UN 1PBGA 4ZODA 5HINA 3P0VL 3SODB 3N41B 4X9GA 4GUPA 4EI5B 3GG1A 1HTIA 2QFPA 4MXQD 2XETA 2B77A 1F11A 4JM2B 1M9WA 5ADPH 1J2WA 4GAAA 4W8AA 3VG9C 3CDCA 1T83C 3M7WA 1T83A 1D3HA 2LLGA 2DT1A 3BVXA 4KHTH 4EBQH 4LQFL 3FJ4A 3BW9B 3QV7A 2DQGL 4PJDA 1QFUH 2XZAH 1TCRB 5DWUH 3JXAA 1V3KA 3AQXA 4W8BA 1VPQA 2X7LB 5C92A 1F42A 1IXNA 3PREA 2AMXA 3BVNA 5GXBB 1YUHA 4Q6IA 1IR2A 2ZKXA 3VOHA 4HOMA 2C9VA 3NGJA 4XN5A 4XNZC 4PJ7F 2IH3B 4DOHE 1FYTA 5ITBL 4I48A 3NQ8A 1ACYH 3I3BA 1GJPA 4FQPA 1TQCC 1HJUA 1QNZL 2GJNA 3NJVA 4L5ZA 3ARDB 1XL9A 2B3IA 3HUJE 1YN7B 4A7VA 2QCLA 3ZVIA 1S7UA 1QWHA 1G7HB 4NQEB 4B0MB 3P84A 1X5AA 1D6EB 4PRRA 3SPIA 3V4VA 1MZZA 2YKLH 2AJSH 3LYEA 5BS0B 4N6QA 3EOTH 3EG9B 4C6NA 3RF9A 3KPOA 4PJ7B 2OX1A 3BH8A 2GZXA 1CFSA 2Q8ZA 3F62A 2NCMA 1EEZA 1H7PA 5F3BB 1SXAA 4F27A 1JR1A 1F4XH 1Q6GA 4N42A 2PTZA 4BSWA 1J9SA 5CD3B 3VDBA 2Z6FA 1TWIA 4ORMA 4FADA 1YAZA 3D50A 2PS2A 2K3TA 1KB5H 2R29H 1I8MB 2XWJB 2VDNB 4KWSA 4ODTL 4ATLA 4CNUA 4L3FA 3GR4A 1I1FA 3BUQA 2E28A 1P4UA 4HU8A 3LPFA 1K7XA 3CLMA 1GEQA 2LLLA 4YO0A 2JNZA 3LHZA 3WLNA 3FT2B 3K1GA 2FK9A 4FHAA 2V5DA 5EZPA 2UYLA 3O9NA 3UDWA 2YBRA 4HBCL 3VKBA 3RURA 4XD5A 4O00A 3O3DB 4N90E 5DVKA 4TSCH 3MRNA 2Z7UA 3CNYA 3EBAA 1ZXQA 4ZXBB 4HIBA 1QSVA 1X4ZA 2ZD0A 2YPKA 3BE7A 2BZCA 4U1LB 1YPZF 1KLGB 4S2SB 2XY2A 4U6XA 3W26A 2ZADA 5B80A 3GDBA 1C7SA 3VI3E 4HD5A 4WX2A 4OLUH 4XI5D 4ERAA 5TF0A 1U8IB 2WM0A 3P73B 2D2JA 4LCUB 4GX9A 5DMJB 4AL8C 3MSPA 3AREA 2FEDD 2ZZ4A 1EA9C 2OJEB 4KEVA 1S9VB 3K6NA 2BBFA 3BISA 3ETSA 5IKCA 4R8WL 1NAML 4NHCL 3IBOA 4A3RA 2J6EA 1CFNB 3OKKB 1KNWA 1BFVL 2PO6C 4JHAL 4Z7VB 1A1NB 1Y65A 2BNQA 4UTJA 5KZCB 2ALAA 1JGEB 4EI6B 2QZ5A 3CH9A 4N6FA 4WU5B 5A3ID 4EAEA 1LMIA 5T26A 1E27B 3MBEB 3T3ME 2R51A 2A9AA 3GU1A 4NKQB 5DR5H 5K2ZA 3BJ91 3C5JB 4ES9A 1LP9E 4HIHB 4IMKC 4IMKA 2W0KA 2YCIX 5T1KD 1E5BA 4D3CL 1IEHA 3UXIA 2DI9A 2YQGA 4LARL 4MAYA 4PJBF 1AW1A 3OKOA 1QI5A 1A5MC 1Q94A 5CEZD 4H7CA 5DZVA 3JTBA 3KHQA 4GMSL 1DXFA 5BXSA 3M5VA 3FRUB 4HHAB 3LTPA 3SCQA 4F37K 4PJEA 1LE5B 4ZMXA 3BSMA 5BXPA 5D6CA 2C8NA 4URTB 1S1PA 1VPOH 4BQ2A 2HEJA 5D70H 2UXFA 1UWXK 3T09A 2I27N 1JNNH 2R0ZH 1AGEA 4JJ5B 5L4FA 4JX6A 2R2EB 3F4DA 4OM0H 4JTEA 5I30L 1A6VL 4H2AA 4X8CA 2XVNA 3ARTA 1NGZB 3WMBA 1Y7VA 5E1GA 1GOKA 1EWDA 3PZTA 3I6GA 2AAMA 3MTWA 4Y19A 1HXJA 4M6VA 2BTMA 3MKGA 3E0GA 3NZQA 1E3FA 1D7KA 4MTMA 3QHMA 2EF9A 1MAMH 3I10A 2XUCA 3VIJA 2NY7H 5HAOA 4NYLA 4Z3GA 2ESVD 1ZALA 2YWYA 1NCCL 5D8ZA 2CZ5A 2QQQA 3IRDA 2QR0A 3WE6A 3EDEA 2CBUA 5A5WA 2P8CA 4XH2A 4XVDA 1QI4A 3HI1A 3RWCB 1QW7A 3ZTJH 3CZNA 5AC7A 3PWNB 1IO4C 3ZHLA 3UQNA 5DVOA 4PRIE 3WXWH 5I1IL 2NNRA 2HWZL 4Q8NA 1AD0A 4HJSA 3F01A 5EC1A 2WO4A 4FTVE 3NM3A 1Z0MA 1OYAA 4JPKL 3V6OC 1C12B 3OAZK 3V6OA 5AC4A 1K8XA 3HQ1A 3A13A 2KDGA 1PL9A 1MWOA 3SOBL 2XPYA 2QGBA 3T6VA 1FYHB 4ZG1A 3HOJA 5HHMB 4G7EB 3U7YH 3PGFH 3VIKA 2Y0FA 2R2BA 3QK0A 4H5SB 2GWNA 2H6UA 2BO0A 2FTYA 4JTIA 1LORA 1E3XA 4X6DA 4HOXA 2V6HA 2Z1PA 4YE4H 2DY3A 4OF8A 4L4MA 2R69L 2DQUL 5CKSA 4HPYH 4B60A 2CM6A 1UD2A 3SGGA 2CBTA 4Y16C 1TQUA 4GQGA 5ADOL 4ENED 3QPQC 5DT5A 2XWTB 4ZE5A 4H6KA 1Q65A 2CH8A 1KBIA 5IGXL 2Z92B 2GGJA 4B5TA 4R97C 1RY0A 5EOTA 1VGAA 4DGVH 2WV3A 1Q7MA 2WNQA 1IZKA 2MTPA 3U4EA 4G8GA 3BLLA 4KKAC 4OI9A 4AU0A 2XDHA 5E8DH 5GZOC 4UT6H 4NJAL 4HJTA 2W8CA 1E1CB 4X4XA 4JTLA 2X4PB 3SN6N 4LSBA 5HHPB 2P5PA 1ISWA 5F93C 1NLDL 6CGTA 1KG0A 3UNTA 1TO3A 4HUCA 3MA7B 2C9UA 2BLFA 3DHDA 4P23B 1ND0A 3TIDB 4Q8BA 3R89A 4ILDA 1LP6A 2WB7A 3B4UA 2UX6A 4M5PA 2Y07H 4GUJA 5AL0A 2Y6ZA 3IJHB 4RDQG 1MG3C 1ZXKA 4PUWA 5CU5A 5TDNB 5BW7C 4HIXH 1W56A 1OCBA 3NFSH 3QSTA 4O02L 3KLHD 4LRNH 3E2SA 4TVSa 4F7TB 1P1XA 3ARGC 1ETJA 5EUOA 3MV01 3TZNA 3A6CL 3HR5A 1EQWA 2BCMA 2ZZ3A 3WELA 2BP0B 1B4TA 4UTBA 1DUYB 4GFSA 4AYDC 2D22A 4GOSA 2ZCKH 3SYAA 1RBAA 3R12A 1S7VA 3OGOE 2NT1A 4Z77A 3KS0H 3IDGA 4F7EB 4JXCA 4LKXB 5C0NC 4TTUA 4PEKA 3A4AA 2OELA 2VISB 2BSTB 4H8NA 4N2HA 4LLMA 1BGGA 4I9MA 1SFHA 4DQOH 3TESA 3BP4A 3BWAA 4HJWA 3AMLA 4P5RA 4I2XB 3LNIA 3WYRA 1ZBVA 4NZ3A 4ZE4A 2H7WA 1HQRA 2PC8A 4JTKA 4XNBA 3WAKA 1H3GA 3KNBB 5EUKB 3EKGA 3CZKA 4YXKL 1CR9L 3VU1A 1HINH 4WJXA 3OKEB 4LPVA 3ARSA 4UAHA 4LL1A 1XLMA 2OQJB 1V8EA 4JCLA 2AJZA 3CK5A 3TH3T 2A74A 2WYTA 3PUOA 4DNMA 5EA0H 1JVKA 3IU3A 2ZTJA 4ZTPL 2IFFH 3EH5B 4RNFA 3UIYA 4KVPA 1TPDA 4JY4A 1OTUC 4GH1A 2ITCB 4KRLB 3HPXA 3LCFA 3SBRA 1KFLA 3NH7L 1XYCA 3N91A 4JLRB 1WWCA 5CGBA 3GI8H 2O5XH 4AZ8A 4NZCA 1XL4A 5CUSH 1L9WA 2AEQL 4PJFE 3MJ8B 4XPBL 1VFTA 3VX0A 2EXYD 1YXYA 2XRAL 1A6ZB 1SNRA 1QFHA 1W72H 4K9EH 3M17A 4RFEA 1WC7A 1A02N 4OLWL 2UY6B 3VFPA 3R5EA 3PXLA 3J7HA 2FPYA 2XH4A 2Z6JA 1KWGA 4O50A 4FEMA 3NVQA 2ESVB 4H25A 3WG7B 1A0EA 2J8FA 4WRLA 1A0CA 4UINL 4XP9L 3C2SA 1TA3A 1S9XA 1MHCB 2B3RA 3C2AH 4LCSA 3QUXC 2POZA 3ZSSA 1KBPA 3QUXA 4N2OA 4JHUA 1C8PA 3LS5H 3GPSA 2YJLA 1IE4A 5AB9A 4LHJB 3ZRCC 2Z0BA 4EUPG 2QMKA 4P0DA 2MUCA 4JNZA 4AM0A 1DZBA 2NNXA 4NFCA 4S1RH 1SY6H 2QT6A 5JHLA 4A8IA 5TJWK 4X5WA 4DK3A 1X6NA 4KRMB 5ICYA 3U2SA 4IOIB 2Y5TA 1P1ZB 3GBEA 1N8ZB 5TAOA 3BH4A 1G6VK 4OZGA 4YHLH 5C09E 1KTBA 4ALAC 2EDJA 1RZPA 4F9PC 2CDGA 2EXSA 5DLML 4NQXA 2P1YA 2EH7H 2NX5A 3Q5OA 1S7TA 3V0VB 3CQIA 4IT1A 3BLKA 3MR9B 4I85A 4REQB 3LN5B 4MVBC 4PIBA 2HRWA 4G7FA 1BGAA 4CD7A 2IDQA 4FQ1L 1YC7A 2WMPB 1YE6A 2MTAA 3HE6B 4XNMB 4Y8FA 3TXAA 3VH8G 3UETA 3I84A 4E41A 5D2LA 5H2BA 1IGIL 3WQGA 2ATKB 3T04D 3UBPC 4MJ2A 3BARA 4PBVC 4O51B 3MYJB 1BF6A 4EXBA 4XBGB 2C15A 4AEIH 2PDJA 2YR3A 4EX4A 5ENWA 2ABBA 4ERGA 4N1HB 2B7DT 3NEXA 4FXRA 3IMUA 4X80L 8XIMA 1T0MA 3VE7A 4AIZA 4DBEA 1AMYA 3KVDD 3CUXA 3USBA 1ETZA 3O4LB 1ECZA 1WRFA 1GTEA 3BDYL 5A69A 4LSSH 1P7HL 1VFHA 5AZUA 2FO8A 1QTYT 3DAQA 3P5YA 9RUBA 2ZSVA 2ZUXA 2WZPA 1US2A 3AG3B 3GSUB 2QVIA 1DQQB 3UYPA 1FLRH 2F9RA 1MQRA 1B2WH 4LCCB 4GJTB 2X16A 4AQAB 2EUWA 4U0RC 1PVNA 4F0HA 1UCWA 1AHWC 4JZ5A 1RZ8B 1YY9D 1AHWA 5BZDA 3Q2NA 3TP4A 2QAPA 4HZ6A 3UA4A 1YEJH 3SSGA 3WEXB 1DDTA 1SM3L 2FL5B 2Z4QA 3VNDA 3BICA 3Q5YA 3GNPA 2ZDRA 4B9YA 4P2RD 4ZA0A 2X9YA 5EEUA 4TVUA 2WBKA 4YSRA 2X4RB 5AW6B 3QUMH 1D3GA 2RDTA 1A66A 3ZX1A 4DPQA 5AKQA 3VNKA 3MJWA 5CPMA 4QHKJ 1A9EB 2GVJA 1VPXA 1I2QA 1O6VA 4DN1A 3KFTA 5SWZD 1PS3A 5ECUA 4ROQA 1A6UH 3G6DL 3PF3A 4HSHA 1TFVA 1HXMA 1JZ8A 1A7NL 5AYZA 2DBLL 3ROLA 2FHFA 3IWPA 2HFGL 4TX8A 3N44F 1MCWW 1Y6KR 2RALA 1XDLA 3G1YA 4AIEA 4YTSA 3XINA 4ZQRA 2DN7A 3FH5A 2C19A 1SYVB 5CCHE 1KGCD 2ENJA 2Z8RA 1G9NL 4DB7A 4ELDA 1O68A 4ZUVA 1TTGA 5I82A 4MYPA 3KHJA 2HJFA 4KT2A 4X63A 3ZVHA 4DP5X 3AMCA 1JUBA 3T4AC 2I9TB 1MRAA 1RZQA 3T4AA 3AIUA 1W16A 1PCSA 1LM8V 1ZK5A 2IKHA 3LM7A 3STBA 4C6JA 3W2MA 3DOHA 4WKHA 1TTUA 3TBCA 1U1HA 1BCIA 5LGKA 5IW6A 2PSNA 3N44B 5D7HA 5TE7L 3OHXB 3MBWA 3BIBX 2WY3B 1OARL 1J0ZA 3KBVA 5ICXB 4YFDB 3RU6A 3G5YB 2YD4A 1UP2A 1U91A 1MJUL 4RVBA 5T3XE 2UZXA 3BUDA 4B0MM 3CV6A 3A9IA 25C8L 2F7PA 4GJ1A 2NXYB 2R1YB 3NDYE 2K3HA 4Z7WE 4G8IB 2NSOA 1I8KB 2PUQT 1NBZB 1U8NB 5GRWA 2HFEA 3GD1C 5HDQL 1J5SA 1YXDA 3WDQA 5KEZA 1YDNA 1XICA 3EHBC 4LMQE 4DJFA 3TQVA 3QEHB 4EVNA 5AECA 1ZPUA 3MLPA 1WS7A 3MRHA 1MNZA 3B9VA 3O1NA 3GR8A 2AQVA 1LK2B 1J9YA 4ZVJA 5E94B 1MSSA 4BRVA 2RB8A 3W5MA 4IG2B 1MEWA 2GJ6D 1IXQA 4JFPA 1MCSA 1JF1A 3JT2A 1WOAA 4F8LA 2PCEA 4JFYB 4MXWH 5IB4B 1E42A 3Q3GA 1YRKA 5A8OA 1B4LA 1HXYA 3C3NA 1X1ZA 3TFXA 1WF5A 1BXVA 2PRMA 2FYYB 2JELH 3B7SA 3FB5A 3TSDA 1XLAA 1MFMA 2CESA 2D03H 2G4FA 2PPCA 3WFEL 3V4VH 3UTSA 1K4CB 3LK6A 4PJ8C 1I6NA 1T7XA 4XO3A 5DO8A 1RPUA 2X6MA 1P84J 3DTDA 2J7DA 4NUGH 3BUPA 4HIIA 1R33A 4GYJA 2JQAA 5CJQH 3D05A 4QRSA 1TRIA 2NMSA 1ONQA 3DGGB 4D0BA 1ZEAH 3VXUE 5BZWB 3WOVA 3NQEA 2R7EA 1F02I 5EBMB 2EKSA 4KRUA 1ZGDA 1IBGH 3VB8A 5AY7A 1HT6A 4OIBA 3GVVA 4TULL 3LOTA 1BMWA 2ZCGA 1A0QH 2A79A 1IJNA 1W8NA 3W56A 4PLKC 3WJWA 3ARFC 2B7NA 3QNXA 3ZJ6A 2JI1A 1RZ7L 4JQXC 4JQXA 3TTQA 2XA8H 4HZ7A 2OKOA 3V5KB 1JPFA 1Q6OA 1T1WB 5CC6A 4DP2X 1CK0L 2WJZA 1FFOA 4QOKE 1IC4L 4IMGA 4BGLA 1PE1A 3IWUA 1EPXA 1J5OH 3ESMA 1CNVA 2G0KA 1NWOA 4ZSOE 5C07A 1ZGLM 3V5HB 3URNA 1XYZA 3OC8A 2OP4L 3GLDA 3OAZH 5EBLB 2JFEX 4AL8H 3P30L 3NQBA 5D2YA 1BPVA 4UMSA 5FO9B 1K2DB 4MD5B 4P4RB 2GSMB 2YXXA 5FX3A 5IF0A 4C6DA 1MCWM 1WBHA 1WAAF 1HI6B 3T9WA 2XV6B 1DBKH 4BA8A 2X38A 3RIKA 3GXPA 5FR3A 1NCHA 2J6EH 3NTYA 2RDWA 1T41A 1IBBA 1XVSA 4XMTA 3WUWB 2IDCA 3TBWB 2ODIA 4IUGA 2HDJA 3NJ3A 4HMCA 1TR1A 1LYXA 5KBNC 4UT9A 4CNPA 3APMA 3UIZA 4L4OA 2OZ4A 2FQDA 1A5CA 2R1WB 3V8CA 2EDDA 1VP5A 4ELMA 4MYWB 3GBNL 5H37G 4NUJB 2J57A 1ET7A 2VL5A 3STEA 5A6SA 4G6ML 3CDFA 1M6OA 3WIIH 4OKVA 3MLXH 4KH9A 1EZ2A 3EWZA 4DEPC 4A6YL 5IIEB 1BBJB 3T2QA 3GXIA 3FZUC 5SWZB 3L5JA 3P4OA 3GQYA 2YD6A 4YDNA 3QUYB 3MMDA 2MMXA 3H21A 2X2YA 4FSAA 4TNEA 4BIKA 3SYCA 4F1SA 5IESH 5E9DD 3MVTA 2P5WA 2WV8A 2IWGA 1YPIA 4Z6AT 2DEPA 4JDEA 5C7VA 1S7SA 5ITFB 2GW5A 2B7PA 5DJ2B 5FA3A 4OR1A 1XR8A 1HKFA 1GWJA 5EO1A 3M0KA 1RU9H 3QCVH 4RGND 4H1LA 3THUA 3QFDA 4FQ2L 2YCLA 2DEWX 5E23A 2RHEA 1Y8BA 3MVSA 2FFCA 3NJIA 4WQOA 1FA2A 4X5XB 2W07B 2EKCA 2YB4A 5EEXA 3AQZA 4AMXA 4F7CB 1FORH 4W6YB 1I8IA 4DRSA 4ML4A 2WVVB 3ABZA 1IGYB 3NSXA 1VCAA 3MO1A 5AVSB 5GIRB 4I7UA 5C0AA 4B5WA 2OMBA 4F2MB 4PWFA 5CGQA 4E9QA 1A0DA 1DTNA 4G71B 4OJAA 3DXAB 1IT8A 2GC7C 4JKLA 1J1XH 4XP1H 3W39A 1EOKA 4Z7UF 1QBLL 2WLMA 3A22A 3O6MH 1A1OA 2J21A 3W7HA 1T8XA 3AOFA 4ODUB 1VFOA 3ZQXA 4M9OA 4HCRL 5JIWA 4Y9NA 1V6VA 2CHOA 2A73B 2CDFA 3QAZB 2ISVA 1QX1A 2ZKWA 4QRBA 4NO5A 1N64H 2YXMA 3BFWA 3RUGA 2I9UA 4DQWA 3IMWA 1U8MB 2R2HA 3TA3C 3I9IA 3TA3A 1U3HD 4J2QA 1L9RA 4KKXA 3HPAA 1UBSA 4ZDHA 2EDBA 4Z7UB 3MRBA 3KJ6L 1I1AC 1K8DA 2BASA 2P76A 3CV7A 4MWAE 2K6YA 3NRFA 4FQIH 4HLEA 2R0LH 4N9CA 2NY5L 4TO8A 1BD2D 5F1NA 3TO2A 3LHPL 3F8UB 1PD1A 4TQTA 4RLIA 4X7DC 2ADIB 2EE3A 4D1IA 4E9TA 3L3KB 1PZSA 5JIPA 4BFRA 2Q3AA 3EXJA 2CIKA 2CMRL 1CU4H 3EKZA 4DO6A 1EYWA 4PJAA 3U57A 2VQTA 2WXOA 1K7FA 1MCCA 3PJWA 3HB3D 1HHIB 7CGTA 2ZZ1A 3OZ9L 5GRJH 4N9GA 1BEXA 5B3JF 4B3LA 3AROA 4IW4C 1KLUB 3VMOA 3QZNA 4WEMB 3FUEA 1CECA 1I1XA 5AW4B 2DF3A 3F7LA 3B4NA 2J43A 3JUYA 3L1OH 1R0AH 3KDOA 1JCLA 2FVLA 2G5BB 3U1PA 3H4FA 1TEYA 4MSWA 3R58A 5KVEE 4P57A 2E6QA 1WWAX 4ZFMA 5I07A 1A25A 4A7GA 3D39E 4J27A 1SXCA 1SU5A 5L4IA 4K7FA 2G50A 2PURA 4AC4A 4JDTL 5JDJA 4KJPD 3RWIB 3GI9L 4LY4A 4O52A 3C6LC 5GGVH 4LESA 5DD1H 4W9GC 1BM3H 4WK0B 3VMNA 3TQ0A 4DUWA 4UTBH 4X7TB 2O0TA 3S2JA 3RRQA 3NCJL 5BMXA 2HLFC 3BAWA 5D6DC 5L2JA 5GRVL 1ITXA 4KW2A 4CD4A 5J6GB 1TJGL 3B2XA 3WEZA 1L3WA 3ZQ9A 1WUNT 1URIA 1Q9LA 4K3JH 5F1KC 5CJOL 3NUKA 3LCWA 1FFNB 3DOIA 3ISRA 2EIEA 5D4JA 5T5FA 3K3QA 5B7FA 1JF5A 2DSUA 1A50A 2Y63A 3BGMB 2EPKX 4P9ML 3STPA 1A14L 4LEOA 2Y7MA 1F3EA 2XN9A 1JCVA 4ABVA 3KTCA 1W80A 4GRLC 4R2GD 3O16A 2D9CA 1AR1C 3GSXB 3IMSA 3V16A 4FQCH 2Y3AA 3TW6A 3KAOA 4MJID 4Q6YA 2NXHA 2IANA 1TR7A 2XXGA 5D32A 4PBXA 1MHEA 2YAMA 4W9IC 5GGTL 3LCYA 4Z7NF 3FT0A 3DROA 4N0FA 4G9FB 1AO7D 1GPOH 3HA0A 1GCYA 3FXGA 4A29A 2D3VA 4QCFA 3MCOA 4LUTB 2JKAA 3NJXA 2YJQA 4FZEH 1MFAH 3QE5A 5AYYA 2CZNA 3OO2A 4KERA 4L1LA 4QRAA 3ZXAC 5AYIA 4YLQT 5LDUA 2OXNA 4IFKB 4LSDA 3B6SA 5ABAA 1VFUA 3L4UA 1QBML 1E65A 4JUTA 2VITA 4RZKA 1VIZA 4P5TD 5E99L 2BVYA 5K59F 4ZENA 4F3FA 2DQXA 2GUOB 2IPTL 3F05A 4ICWA 1TMCB 3GYRA 4LCVA 4NQUA 3SDYL 2EIZA 4TLUA 2IBZX 2VX7A 1DVUA 2UZYA 4FFTA 2ZOLA 2P24A 2W92A 5FS5A 3WNPA 1CW2A 4US6A 5F0LB 4IRSD 5EIIG 4FLSA 3SBWC 1DN0B 3SBWA 2WSPA 1S3HA 4TSBH 2J13A 2WKOF 4W5ZA 5ANMA 3IV3A 2QR6A 1YYML 1P5UB 3KG5A 3F2DA 1U30A 5CNHA 4WHCA 2Y2YA 1JWMA 1SJEA 3W9EA 5K4ZA 1IBZA 3CLWA 3TEZA 4R7VA 4R7OA 3CMOL 3R8BB 1AIFB 3C5XA 1Q5MA 1B31A 2FFIA 5E08H 3AYRA 1RJPA 2AL1A 1Z7JA 2YDQA 4Y4KD 4PBFA 2EIMB 4MB1A 4HFWB 3JYCA 3CFDA 4EXPX 1WGVA 1ES0A 4Z76B 4ZFOA 4P8UA 5JHLH 4L4VD 2CLMA 2J12B 1YSOA 2EYRA 3W7OA 1G6RL 1JG9A 5I71C 3SDAD 5KVFE 2KPNA 3KE0A 4IMEA 3FQNA 4ERSH 3IDMA 3MANA 2PW1A 5H6HA 4ALAH 7FABL 2BS71 3GT6A 3OMZA 4BHUI 1A7OH 3FOLB 1V6UA 3TJXA 5EN2B 4KJQD 3MHZA 4EN3C 4M7TA 4EN3A 2W1NA 3LKOA 1UC6A 4F2FA 4NZJA 4TL5A 2C26A 5CWSB 1PFOA 4Z23A 4Y1AA 5C0FA 2QJJA 2CCRA 4J3ZA 1EANA 5JOFA 1YX1A 3ZJKA 1ONXA 3OPSA 1OC6A 4ZQCA 4LCWE 4XN4A 1U8PA 4JQ1A 4EOUA 5F0MB 4BQ4A 2OXHA 1IIGA 1JDCA 3VB9A 1XKJA 2KS0A 3MJ9A 5C2BH 2IOOA 1ZT1A 3WNMA 2MOGA 1CCWB 1UR3M 4YHKH 2E47A 3MKVA 3WUWG 4JFFB 5I8EA 4AMWA 1X38A 1Y5XA 1BD2B 3GSNA 4M4RA 4K15A 3RMJA 3CXFA 4NBYB 1E28A 5AZEL 1T1XA 4FXSA 4PTNA 4QGTA 2F84A 4HPOH 4U3HA 2CKBL 4BF9A 2PODA 2OGYA 3IJEA 1V7YA 2V6AA 5E2VL 4GKNA 4XBEH 4KO5A 3LTYA 3WDHA 1VERA 2J9YA 2FECI 3UZVB 1W0VB 5IFJA 1BQ5A 5G2HA 4OZFG 5JMUA 1P7TB 2MQ0A 2GYIA 5IWLA 1GKQA 1S5HB 1XSOA 1QCWA 3HB3B 4HJFA 3BMVA 4XZWA 2O92A 2OLDA 1TTQA 4UBDD 4Y5YB 2HJLB 4R6UA 1AQ0A 3B9AA 3PSWA 3CHPA 1I7ZB 1U9KA 3MUGA 4GZJA 2J5LC 1JD7A 4Y2OA 4JR9H 1I3UA 3BT0A 1KDIA 4BEUA 1T5WA 5DK0B 2JMRA 3FB7A 4D7BA 1X1OA 3NYZA 4XZ9A 4A4AA 1JZHA 1FAKT 4A8LA 3EBVA 4I5UA 3W7QA 3KOZA 3OVUB 2IBZY 4YH6A 2ZG1A 3OAUL 1WZLA 3KPPB 3M64A 4YUEH 4F4RA 3WDPP 4X6BA 3QW9A 1GYAA 3GC5A 1IEVA 4TRPL 3ZDZE 1CEOA 1LQSR 4FQXD 2G2NA 1KFKA 4ICMA 3SCVA 4UXDA 2XHYA 1XYMA 1SDDA 4RDQF 4WI3A 1BFOB 2F15A 3SDDD 1KT2B 1PIGA 4HNOA 3NZPA 1EV2E 4OUEA 4U7MA 2BW5A 3EEZA 2HMID 5CZXC 1UXSA 3AHTA 3N41F 1F3TA 3KPNA 3QZWA 5T33H 3PPFA 2WXLA 4U1GC 3GLZA 3P60A 1DXEA 2DLEA 2SEBB 1Z2KA 2EKGA 2CZVA 4HC1A 3ZIMA 3SGEH 2PXYC 1UYWH 2PXYA 3A3WA 3NN8B 4H26A 3PWAA 1TJ0A 5JO5A 1CLYL 2BC4B 4C91A 2WZ6A 4JFDA 5A94A 3L2IA 4PMVA 4HPNA 3LZLA 4R2GB 4U1MB 5J12B 1WNOA 4LBEB 3UCRA 4MAUH 1PPIA 1N9PA 2Y7QA 5FUZH 2GSGA 1D5BA 1MJ7H 3A4JA 4XV0A 2JSFA 3DRQA 4ZMOA 1ZSDA 4KPHH 3V5OA 4O13A 1AKJA 2PUZA 1RURL 4LNRA 4BH7A 1XINA 1AO7B 5I1KH 4O2CB 1G4RA 3PV7A 4I1PA 4UIKL 4JFQB 3M43A 1HUVA 1TYGA 3IJ7A 3HAEA 1A2YA 2TRSA 2YD7A 4OCMC 2QGDA 4B4HA 4B15A 2VLJA 4ODWB 4P5TB 1GSKA 2FGBA 2RAMA 4DY1A 4OD3H 2GHWB 3PZ9A 3FT4B 4G5ZL 4A22A 1J18A 2P80A 3DX2A 3EXTA 4ODSL 3OTRA 2W6RA 2LGNA 1F4HA 3L7RA 4AY1A 4QAWA 5D5ME 3CVIL 2HMCA 3I85A 5CGYD 3IFOB 4GFTB 3HHRB 4L9DA 2ID5A 4Q6IC 5DO2D 3UGVA 1EK3A 4IRSB 1OTTC 3BP5B 3OPZH 4HKBB 4C56B 3CUGA 5FJPA 1NGYA 5BZAA 4CDHA 1BLIA 5D09A 4S3EA 2VDOB 1A5FL 4NP9A 2DQTL 3D7PA 2G9HA 3CXHJ 1JHKL 1N0LA 4NT6B 3ZDYE 4J4PC 1P4IL 4J4PA 1FNEB 4C54A 1R34A 5BOPA 2TSAA 4QRUB 3UFYA 4G8FB 2QHLA 1P0DA 5IG7B 4AYEC 2PD5A 2R4RH 1PLGH 1II4E 4M3PA 4FA3A 4MZ3A 1CFTA 3D69A 2C18A 1NEYA 4BFJA 4KQ4H 4NAFB 3EOAA 2ADJA 5KUMA 3UTZA 4Z1CA 1I1RA 4MNGE 2XFXA 4G1KA 5LDSA 3T2OA 4L4VB 4HK5A 2VEIA 5EU5A 2PA6A 1DEDA 3NWRA 3B8TA 2WO2B 1QTWA 4YXHL 2VKWA 4PRAA 2IH1B 2YW4A 1U21A 5I66B 4M56A 3QJFA 5E5LA 5I1JL 4NZDA 3EPOA 4WR3A 5I1HH 1H8NA 2DQHH 2QBWA 3DVIA 1L6GA 2PPGA 1N68A 5GJMA 4PS8A 3VFWB 3HNVL 3VM7A 4F7MB 3W1XA 4DZ8B 1Y07A 2X89A 1ZWIA 4TQEL 4EPSA 1BVLA 2VLRB 5D93C 3UDWC 1S9YA 4J1UB 3L7FA 3KPSA 4S1SL 2VRAA 2DZTA 3NSYA 4LDCA 3FS2A 2H3BA 1FAIL 3NCYP 1EFXD 4EUPB 4WI0B 2BZ7A 2PTWA 4GH7B 5E8PB 3LRGA 1Y6MR 3B4YA 4AYMC 2H3NA 2QTVA 4MNQB 1CF8H 1VACB 2CBVA 4ZMGA 3W9DB 3FQRB 4N0UE 3I6LE 4BUHA 2DZPA 3ELQA 5JW4Q 2NZIA 5CILH 5DELA 5F7NC 2W88A 4ILSA 3ZLQC 4Z7VF 3IT8D 2Q71A 4OJEH 2G8ZA 3BZGA 5DGRA 3X11B 4JFWA 1AYOA 4KZ0A 4L9ZA 2EVJA 1UC4A 1DQDL 1E6OL 4Z7OE 4Y9MA 3AREC 3O06A 2W38A 2YGVA 3MUHL 3RPIA 3HNSL 5JUVA 5FGCB 1JWSB 3DYPA 2I5YL 1SR9A 4RDZA 3UG4A 5HPCA 2RA1A 1PJWA 3ZHDA 2FD6L 1SZEA 3VH8B 3S88L 4Q8PA 1TZHA 4Y8EA 1A6WH 1X7QB 4OB5L 4GBXB 3V0DA 5SV4A 4LGXA 4C6OA 3IGXA 1C16B 1UUQA 3TJHC 2OZ4H 3DSFL 1K9FA 3TJIA 1UENA 3MJGX 1JPGA 1GGCH 2O9OA 1ZGLB 5HHOD 2PF0A 1WUEA 4YSAA 3LNHA 5I6LA 3GM8A 5LGJB 2XGBA 4OUIA 1OAXL 4ZFZA 4H8WC 4Z7QF 4HKPA 3B43A 4WTWA 5LGYA 1OPGL 1KCVL 1BX2B 4MAYC 4YCPA 2X12A 3EYPA 4TUJB 1E6JL 2W0UA 2OZTA 2Y25A 3L3JB 4XNUH 4APQD 4AT6A 1XRFA 3P62A 3S4SA 1ESWA 5FI8A 3RR4A 2DWYA 4QEHA 4XAGA 3W1NA 2QSTA 2WWMD 1EEPA 1AY1L 4S0SD 4R3SA 4Z7QB 2C7UB 3F5KA 3AUJA 1JDEA 5EN3A 2JIEA 1TT6A 4RE2A 1OAUL 1LO4L 4H1LH 5FYJD 3DJZA 3GVRA 4DP6X 2IGFH 4QCIA 3ZW3A 1IUZA 3V0JA 4XD4A 3QUZC 3QUZA 4JFSA 4QTIH 3QG7L 4EXAA 2Q87A 3AAZB 1FP5A 2EEAA 2B0SL 1CGUA 4W9JC 3AIRA 4RMTA 1HDMA 2BXYA 4L1BA 2OZ8A 3IUIA 5F88B 3ERPA 4QDPA 1PKNA 3GD6A 2EXWC 4M6ML 2R56H 4KI5C 4R5VA 4P3CH 1C91A 4C6EA 1RH8A 3W3BA 4B3KA 2YGOA 1PQZB 4ERIA 2WNWA 4AH2A 3EGXA 4JANA 1KPRB 3OGCA 5I1EH 1WDRA 3O05A 1I9RL 2DLGA 4RL3A 3ZYJA 3PWLB 2WXGA 4JHWL 2BRQA 5ACZB 2CIIB 3OJ2C 4I3SL 2PP0A 1TZGH 3CN0A 2VAAA 4AJ0A 4JG1L 1OAQL 5AOKA 1MAKA 4PV1C 4XWUA 1SMOA 5C3IA 5EMKA 3CUPA 4M80A 4WU7A 4NGHH 3CFBB 3IETA 2DJLA 3LZRA 2CBPA 1MFDL 3RTQD 5TQ0H 3WO3B 3TZVD 3THAA 3GMQA 3CU7A 3CSYB 4KJWD 5DMIH 4JDYA 2VDPL 2Q76B 2QGEA 3C09C 3T6ZA 1TPH1 5C08E 1BRLA 3CK0H 3ARQA 5LIXX 3O2VH 1IKOP 2IWKA 1T5AA 2IPKB 4Y89A 3DUHA 3L65A 2YK1H 1MFEL 4PRPA 1PG7W 1OY3B 3V10A 4WK9A 5IUCA 4GRWH 1FGVH 3R7RA 4GH3A 4Y5VC 3HS0C 4KZDH 4Y5VA 3HS0A 1IXOA 43CAA 4D2NA 4LB3A 2X0UA 1GYVA 2CLKA 4IX2A 4YDJB 1JZ3A 2W0FB 2XY1A 5LA0A 2G95A 1GW0A 5L0QB 5EU6A 5FHAH 1IBDA 3SPJA 5DCBA 3MMEA 3ZE1F 4DWSD 4M3JA 3BT2H 5BQDA 3TT1H 4OQTH 5C7XL 1LUCA 4X4MA 1P6WA 5DZPA 1C5BL 5B7MA 3VFCA 2JQMA 2DL2A 4LTSA 3UTQB 3VQLA 3N40F 4K1WA 1UPMB 1GVOA 1D9KD 3VKJA 4JRXD 2YPVL 3WKYA 1UUMA 4U1KA 4RGMB 2EEFA 3T71A 1EGMA 5DYOA 1GK8A 4V1XA 1XGPB 2IXQB 3U82B 1CT8A 5MKGB 2Q9OA 2CETA 3UJTL 5F6IC 1ISXA 5IRPA 4LVGA 4NO3A 4Z95H 4PN2A 3N14A 3FQYA 3ZE1B 1BZOA 1DN2A 1K8IB 2Z28A 4ZK8A 4DO5A 3TTSA 4N3UA 3CHVA 3HBPA 1XBYA 4HIEA 1QKZH 1N6VA 5IJVA 4JN2A 2OMXB 2J8HA 4KAQL 7PTDA 3IYLW 4DK5A 4QSFA 2FX8L 3EYSH 2NLIA 1MJJA 2GTWB 4QHUA 4XN7A 3GZAA 1KENL 3R94A 4UANA 1NIBA 2C34A 1DTUA 3LCHA 4GUQA 4HWZA 4F91B 2WWOA 3SPGA 5TGBA 3ZL1A 1OX4A 4OCWL 5T5FH 1KFBA 3E02A 1R1CA 1FL6B 4XMKL 1TFHA 4R4BB 3U1SL 2B5IB 3CL7A 3AS0A 4PB3A 4F58H 2WXRA 3TWAA 3RDTD 4I90A 4V1DE 1BZ8A 4EAYA 3ISWA 3DO7B 3WUFA 3QCUL 3MJYA 2XQYA 3IDIB 4A68A 2N59A 2OYKA 1C08A 1LT8A 1NUFA 2B9BA 1I1CA 2BGNE 2OX4A 4IM8A 3N12A 4MY1A 1KC5H 3GZOA 3D3VE 3IEAA 3QCTH 4LLQB 5HHOB 3WY1A 2R1XA 1DWFM 5KN5B 3QY6A 3NFPB 1MF2H 5GS2D 1XKYA 2BX5A 5I9QC 4N8PA 4DH2A 1F4YL 5T1KB 1U58B 2OT0A 2ZOKA 4KQ0A 2A74C 4UUIA 2XSKA 3V0FA 3GU9A 2X4SA 1P53A 2GT9A 1NEUA 1LK3H 5DZ9A 4WKXA 4ZI8A 4L65A 1NUGA 3MV11 4QHNA 3OZOA 3I50H 4G42B 3W7KA 1BZ7B 1MYRA 3LKRB 3ZWSA 5IHLB 1LZOA 4PP1D 5FA4B 2B2XH 3QDGA 4Q8VA 5BV7B 5JXED 2CPCA 1KCBA 4JHVA 1KIRA 2A9NH 4Z3IA 4JPQA 1O0VA 3JV6B 4R53A 3DOSA 5HNTA 1PF3A 2FWLB 3RG1C 3SDXF 3MWAA 1I4FA 2DLFH 4XGZA 3UJ2A 2DQIH 2QEJA 4DSYA 4CC0A 3GSWA 3NO5A 2QADD 1DCEA 5DUJA 3LZFL 5CZTA 2OSYA 4AQEA 4GKZA 4TXVB 4UM8B 1G7UA 1ZHKA 5F3HB 1E5YA 2VXVH 1EEYB 1D5ZB 3O07A 3GMOA 3CE1A 4E0RB 1QUNA 2XIDA 5LHDA 3VD9A 2JTDA 3FF8A 5BW6A 1O60A 1JJUA 1G87A 4K3EL 5FF3A 3SDXB 5J1AA 2YX0A 4OOZA 1GAFL 1RUKH 3FNKA 3QJAA 1CLZH 2XWRA 4HWBL 5DMLA 4NKOA 3PDGA 3PY2A 1BVKA 2FQIA 2WB5A 3R0KA 3FHQA 1F6AB 1H3PL 1AQKH 5TBOA 4HHWA 3WAJA 3RTQB 4D9RD 4OZHE 5IVXA 1W0WA 4Z2GA 4Y9AA 1ED3B 3IXTA 2C91A 3NAAL 3IIZA 5CEWA 3R7MA 1CD1A 4ZS6D 4ACZB 1QSFD 1JPST 2H8XA 2E9GA 1AQDA 4G6KH 3RJYA 5FYKL 4OJCA 4O2EB 1WISA 1N5YH 3DNKA 3MJ9H 4ZBCA 2P52A 4GSQA 4QF1A 4WI6A 2J7EA 4EWJA 4PV8B 4RRPG 1SW3A 3QXUA 1YDPB 2G2RB 3WTVA 5C7ZA 3UCQA 4X7EC 4WNQA 3N50A 2GVYA 3EYQD 3FSAA 2A1WH 4JCMA 2VC2B 4NJKA 1FCVA 3FH7A 2VXSL 2YC1A 4X6CF 2PWEA 3PG2A 1DEEA 4FFYL 2YLLA 1PZ3A 1H0DB