4NX0A

Crystal structure of abp-wt, a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
430
structure length
430
Chain Sequence
SMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVDDIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 151
structure length 430
sequence length 430
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nx0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx0A01
1G67A 5AHIA 1ME8A 1N55A 2Z0IA 4QM1A 3BAXA 3BG5A 1FBAA 1X1ZA 3WFAA 1AG1O 3MYOA 4I9AA 3IIPA 4JTFA 3PB2A 5D30A 4GI8A 4MY1A 1CPUA 4MFDA 5U7SA 3WNMA 2FLIA 4NI3A 2QF7A 3OG3A 5I3FA 2I9EA 3ZWTA 2EEXA 3QYQA 2VEKA 4O16A 2ZRZA 2WCGA 1JQVA 3HB9A 1KTBA 3VNDA 5AYXA 3P8IA 1FY6A 4P2VA 4X9SA 3BMVA 1RR2A 3G0UA 4YWIA 2EAEA 3MI6A 3OLEA 5BNKA 2JGQA 2X1TA 1KWGA 5ABTA 1ZY9A 4UFHA 1ICQA 1RQBA 2QR6A 1UKTA 3WEOA 1OJXA 1W5QA 3BLEA 4DO6A 3BG9A 3ZR5A 3DENA 3G22A 1OX4B 1JRBA 4JTLA 1K8XA 3ZFHA 3FAWA 2R94A 4EOUA 3ZR4A 3ECQA 1G4EA 5I3HA 5HUOA 3DX3A 4NX0A 1O95A 2V81A 3BUBA 2JBMA 1X6UA 3P61A 1WX0A 1Q6RA 5C5YA 1TQJA 3NR0A 1KXHA 5EYWA 2GUYA 3M0ZA 4AH7A 3G3MA 3WK0A 4PSPA 1B0IA 1MO0A 1JR1A 1G6CA 3VE9A 1PHWA 1SO3A 3LGEA 2EACA 4MUZA 1Q3NA 4YCPA 4UQEA 1LLWA 3BVWA 1I2QA 4JTSA 4J3VA 3NPWA 3F4WA 2YFOA 4ADSA 1XCWA 3EJPA 1Z42A 1AVAA 1VIWA 3VSVA 2HTMA 3RNDA 3KHJA 4FMVA 4TMBA 1BF2A 3NM3A 1AQMA 1XM3A 1EHAA 2VFGA 4MY9A 3S1WA 3EXTA 4MKNA 3EXSA 2WNZA 2YR1A 4ZQOA 1E51A 1KLZA 1OF8A 4UR8A 1EP3A 1QO2A 3VM5A 1J0HA 1LROA 1S3HA 4AXKA 4H3DA 1OFQA 1CXIA 1KA9F 4DO4A 1KM3A 3L4WA 3CWOX 1TIMA 4N9CA 1VCVA 5AN7A 5K9XA 3WNKA 4H2CA 1SO6A 1X7FA 1XD0A 5EL1A 1OFEA 2QAFA 3W2UA 3WJYA 4H8UA 2AQWA 4Q33A 2DZXA 3N9SA 5L9FA 1VZWA 4GBUA 5GVJA 1QI3A 1LORA 1UUOA 1TRDA 1A50A 3GKFA 1TTIA 3MO7A 2PWGA 3BH4A 4B9ZA 3LTPA 5CZTA 4I7WA 2A5HA 2ZWYA 2NX3A 3B0VC 4CNPA 1D9EA 3II1A 4AMWA 4JXCA 2WSPA 1MW1A 4OIFA 2DZTA 3W2MA 3BLBA 5F2MA 3HZ3A 3O8AA 6TAAA 4O13A 5AC7A 3K8LA 4RXFA 2FQIA 1EA0A 1Q6OA 3SR7A 3UD6A 3N3MA 3ABSA 3UZ5A 3BUDA 1UA3A 3C3NA 3ZSSA 1RZMA 5F4XA 3G1DA 4AIEA 1H7NA 5LGXA 1BPLB 3L4YA 3P74A 2F1AA 3R12A 4R33A 2RDUA 2WVUA 4FNTA 1LTDA 3S5OA 1W9XA 5DBUA 1IXQA 3L4UA 4UOZA 1GVFA 1QHPA 4RV8A 4HP5A 1FCQA 4PEKA 1GZGA 2V0TA 4MIMA 3BLIA 3NVTA 4N4PA 1CXEA 4MZ8A 4I7VA 4NNCA 4TVUA 5K9CA 2X2IA 4BF9A 1S46A 3LTYA 5E0KA 1MVYA 2ZUTA 4HOWA 3EKLA 2JKEA 3G18A 3C2RA 3S1VA 4RZ4A 4HNUA 3GDTA 3QZEA 4M6VA 1UD8A 2FH6A 2ZTKA 3EX2A 3NZRA 5EKYA 2ZUSA 4M5PA 1GWJA 3NQ7A 2TRSA 5HJLA 4JCMA 3S6DA 1O5KA 3SZ8A 4LS2A 3DC0A 4A29A 2ZXBA 2Y85A 3ELFA 2PWDA 1CGUA 2YYUA 1UA7A 2BHYA 3D50A 1VPXA 3PG9A 3TC7A 3WJSA 2ZX8A 1VRDA 4UZSA 4TIMA 2EAWA 1Q45A 2I1OA 1WP6A 3LCFA 4ZMGA 2EQDA 3W74A 3EX6A 4PA8A 4K6AA 3HG2A 2D0GA 3BAYA 1L6WA 1OSEA 5CPMA 1AL8A 3LCGA 5AOUA 4H8VA 3KOFA 3O1NA 3TA6A 3TE9A 3LPOA 3SFKA 3DKJA 3F4NA 1MWOA 1GVSA 4IPJA 4PODA 3KE0A 1YPFA 5AFDA 5E1QA 1G4SA 1UCWA 1L6YA 3Q58A 1YADA 5G1TA 4AWUA 1JCXA 4BI6A 3FJLA 1JGIA 3WDIA 2QJIA 1GJPA 3M41A 4J3WA 1PAMA 2NV1A 1G4TA 3HJEA 3W1MA 2EABA 1TREA 5FF2A 2E6YA 4UNIA 4C1KA 3WK1A 2J9ZA 3T44A 4N6FA 1CW2A 2NZLA 1FCBA 3HG5A 4K7VA 1ALDA 4ADUA 1P6WA 3PSWA 5CLWA 1DBTA 2AGKA 1ZALA 1RPXA 1IV8A 4TR9A 1U5JA 4D2JA 3C56A 1BLIA 2JK2A 1H3GA 3UWZA 3BSHA 4K7YA 2BSLA 4FNUA 1QPQA 1ICSA 1R30A 2NX9A 3OLDA 3O6DA 1WQ5A 1X1OA 4Q32A 3QPYA 3LB0A 2GVLA 4NXKA 3W6YA 3BUQA 5A2AA 1PE1A 4K38A 4KMQA 1PVNA 2C13A 4IX2A 3BARA 2FHCA 2ZX5A 3L2IA 1H61A 5DLCA 3QQ1A 3LRLA 1W5NA 3KRZA 2NUWA 4M56A 1B4EA 1H50A 2CLKA 2CZDA 2YZRA 4Z1BA 3M6YA 1WOAA 1PHQA 3DDGA 2NXHA 1CXHA 1VH7A 1KV8A 4JYEA 1V3LA 1QPRA 1TPC1 2V5LA 4CQ8A 3QMRA 1ZJBA 1OFOA 4GJ1A 3LTSA 1JUBA 3LHUA 4LS1A 3UZJA 3G24A 4PTNA 2ZA3A 3CU2A 2Z1BA 2OW6A 3VX1A 1N8FA 1XH2A 2VEMA 4AB4A 2V9DA 5G2IA 3ATZA 1MW2A 3VFLA 4O17A 3NA8A 1EH9A 3KLLA 3W22A 1M53A 1WV2A 2E5CA 3UXDA 4JIPA 1XD1A 3B06A 2OSYA 3HG4A 1PS3A 3EDJA 2GPTA 4WXYA 2PWFA 3VGGA 2NUXA 3PBVA 4UMBA 5T26A 1CGXA 3G0SA 3GYEA 3TJLA 1IIGA 3KAOA 3PC0A 5HWNA 3D4YA 5H91A 2V3DA 2WKLA 1AMKA 4IXXA 4M19A 3CB8A 3TROA 2B7PA 1TTQA 2RKXA 3L9CA 3TSDA 3OLGA 2CLEA 3TX9A 3EX4A 2Q8LA 4CQ9A 3P60A 4AYGA 5CPLA 4CNOA 3LERA 1QPNA 1O7DC 4FIQA 4UTTC 3BVXA 4NJIA 4Y90A 3H54A 1JDAA 4PH6A 1YTDA 5AHFA 1QWNA 5TIMA 4IMDA 1UBSA 3MHUA 2CLMA 4S2BA 1Z44A 5CSSA 2X2HA 1JF5A 3GXIA 1KM6A 3NPUA 2OT1A 4JTEA 1JAEA 1HT6A 3BGGA 3W72A 4RCXA 4LUJA 1W54A 3MI3A 2QUUA 6TIMA 2BHZA 1MFVA 4AIOA 3W7PA 1KXVA 3KLKA 8CGTA 3VKJA 2E4TA 1TB3A 3EJRA 5E6ZA 2NWRA 4UC5A 3LHWA 4RZ5A 1C8VA 1OK6A 3LHVA 3TC6A 4IOTA 2VEIA 1JRCA 2NWSA 3BVUA 3NDOA 1UD2A 2VOMA 4JS3A 5D05A 1WZMA 2A1YA 2NV2A 4JTGA 3W7CA 5I23A 1GVIA 2A2IA 1TMQA 3UG5A 5DCBA 4HSNA 2NXIA 5DXXA 2C19A 2E6FA 2QEZA 5EY5A 1F7BA 4U33A 3RLVA 3CEUA 2Y7EA 2WSKA 4O1BA 2EKCA 2ISVA 2QCEA 2D0HA 3ZOAA 3IJ9A 3KVMA 2VFDA 4LUIA 1KCLA 2TSYA 4FIRA 6CGTA 3UXAA 1CXLA 3GDRA 1F6PA 3M07A 1AW1A 3JRKA 3DX1A 4CLMA 4JGDA 1E3ZA 1XBVA 5HQEA 3FS2A 3EWYA 4O12A 2DIJA 1GYNA 3R5EA 1LLZA 4LVAA 3M5ZA 2V2DA 2F7QA 2GUUA 3G8RA 1S5WA 2VELA 3D4ZA 4O4WA 5E6YA 4XBKA 4UNKA 3RIKA 2VFEA 4EF8A 3P8JA 5HDRA 2XN0A 3TMQA 3O6YX 3UYCA 5LHFA 2QCHA 3W76A 2I14A 1MEIA 2A7PA 1VGAA 1XBXA 1E40A 1WBHA 4JNMA 1OFAA 4Y96A 2ZZ7A 1K8YA 4M7SA 2Z6JA 1P0NA 3HPSA 5CKSA 1YDNA 1LP6A 5K3VA 4DXVA 4AMXA 1ZJIA 1LOLA 2V3EA 4JFSA 4NVTA 3SGZA 1I2RA 2WPBA 1EO7A 2YA0A 5AC8A 1G9HA 2CU0A 4LNYA 3DDFA 3CM4A 1SZNA 2OSXA 1ME9A 2BY1A 1OT2A 2A7RA 3CPUA 2VR5A 3S5ZA 3LOTA 3TH6A 1AK5A 2BZNA 4N9DA 3BVVA 1DQWA 1WZLA 3L5LA 2X1UA 3VNYA 4JTKA 1M7PA 2ZZ3A 4P61A 4QIUA 1KFEA 5KSWA 3TK7A 1KM2A 4UTTA 4OQVA 1B9BA 3N2MA 1VHNA 3QFEA 5AHEA 4KFOA 3Q37A 1QO5A 3TXZA 1SPQA 3GXPA 2V5BA 2YW3A 4PSRA 5CZJA 3W86A 3UCQA 1DVJA 3TR2A 4GNJA 1JVNA 1P5BA 4FB7A 2OYMA 4QITA 4UNLA 4N6EA 3LM7A 2J25A 2CZ5A 2GVGA 3AJXA 4NNBA 4JDBA 2GJNA 2Z1KA 1XCXA 1V7YA 3HIJA 3SY5A 3VMOA 3DH7A 2C6QA 4DPQA 3NQCA 1QI5A 3WNNA 1H7PA 3RK8A 1NOFA 2D2OA 3NL3A 3WN6A 5D2YA 4LY8A 1VLWA 2X16A 1LWHA 4QJ1A 1Z41A 1G5AA 3OLIA 3CWNA 3VE7A 3FFSA 2FIQA 1KBBA 2ZZ2A 4UFKA 2ZRXA 4JTIA 3T4CA 3USBA 3W07A 1HUVA 4AEFA 3JR2A 1SW7A 3BC9A 3GDKA 3UWYA 4JFUA 1WZAA 4LRSA 4LTSA 3CZKA 3CTLA 3EEGA 3PB0A 1XL9A 3P5YA 3Q94A 3W7HA 2FPVA 2QV4A 3EWBX 3LV6A 3UWUA 1K3UA 3UNDA 3LBMA 1OFPA 1HX0A 2X1RA 4IXHA 3W38A 4AMAA 4GC4A 1JXJA 1DHPA 3P84A 2F2HA 2F7OA 2XWDA 4Z1CA 4HT3A 3W87A 2WSQA 4O18A 3DHUA 3TMLA 3I6RA 1CDGA 1MXGA 3BW3A 3VSUA 1GTEA 4DBDA 2IGTA 3PULA 3NPVA 3BW4A 3BUPA 4GUGA 2DZWA 1DHKA 3TQ0A 4JDYA 3H55A 2J9YA 1K7EA 3N9RA 2ALDA 3GK0A 3W9ZA 2WVVB 4ORMA 4CCEA 5K2ZA 1WXJA 3MI2A 3VGBA 1SUXA 1PIGA 5HWJA 3GVGA 3CT7A 3S42A 4NJHA 3RFAA 4OT7A 2QLYA 1BSIA 3LRKA 3LX9A 2P10A 3STEA 4O1AA 2PRLA 3IGSA 5K9DA 4CNNA 4O11A 3DI0A 1GYLA 1KFJA 3FJ6A 3HGJA 4CN1A 3DAQA 2QAPA 2QCDB 2ZXQA 1CI1A 4AWTA 4BI5A 5FESA 1GJWA 2J27A 1VCFA 1XV8A 4PC8A 1TCMA 2A21A 1DJQA 3M5YA 3IIOA 2EADA 2YYTA 1LBMA 1OX4A 3EJQA 2CZFA 5MHBA 3UWQA 2ZX6A 3P80A 1P1XA 1PS9A 1YDVA 5AC6A 2PRMA 3KEHA 3LCXA 2Y70A 3YPIA 2VFIA 3P7YA 1MFUA 3NM1A 3M44A 5KZDA 2Y4SA 2ZFAA 1TV8A 3QC3A 1SW3A 3BVJA 2CLLA 1J2WA 1HO4A 3BV4A 4FX8A 3VX0A 4X3ZA 4WX2A 4FF7A 4OJYA 3LLDA 1PZ3A 2QKFA 1T96A 3M43A 4XTDA 5AHNA 1RQHA 1OX6A 1EX5A 3OA3A 1D3GA 1W5OA 3CLMA 3QSTA 2XVKA 3U6WA 4OBTA 2YKKA 2B7NA 3QRHA 4E38A 1H60A 3PBWA 1Q6LA 3LV5A 3W7GA 4JL2A 1R2SA 2H8XA 3QW3A 3W7DA 2V82A 1OABA 3DU0A 4FLSA 1KTNA 1N7KA 4A3UA 4POCA 2F61A 3TW6A 3C0JA 3H53A 4J27A 4XWUA 3TQKA 3MHFA 1OYCA 1YXYA 1MW3A 3DBPA 2VENA 2H90A 3D0CA 1RP9A 3ABOA 4OWGA 2WC7A 1GTHA 2D3LA 4O19A 3A6OA 3E49A 5G5IA 1TPH1 3O06A 2BTMA 3STFA 2RH9A 2HSAA 4RLIA 4WJEA 4FEZA 4EIVA 4ZZ9A 4NJGA 2FHFA 3DZ1A 4CCDA 3OHIA 1DV7A 2FPYA 3VCRA 3BCDA 3CIXA 1NAL1 2AAMA 2HS6A 1TPEA 4GFSA 3CHVA 3QEZA 4FXSA 4O52A 4DF2A 1FDZA 1QX1A 4N9BA 3L2MA 2W0UA 2WQPA 3BVTA 3OEXA 4JFVA 4GUFA 2YFNA 3NGJA 3T78A 5KZMA 3EDKA 3DX4A 3PUOA 1CXFA 2X1SA 3TJXA 1VFOA 4ZQMA 5K7JA 3MYPA 1LZOA 4MJZA 2P1FA 2A7NA 1EP2A 2ZZ5A 3GR8A 2BY2A 1F6KA 2F7RA 2WOQA 3W7NA 5IBXC 3WJXA 3LRMA 4O4VA 4ZQNA 3UERA 4UQBA 3NAVA 2ZRYA 4FX6M 4UMAA 4XKYB 4BFAA 2DP3A 3LCHA 5LNRA 1VYSX 3EWXA 4O53A 3WNOA 3BW2A 3JS3A 2WV8A 1KTCA 4JN6A 3P81A 3I65A 4IQLA 1PV8A 5A2CA 2CLIA 3GTNA 4N4QA 1IXOA 3PAJA 1JIBA 2Q3OA 1YYAA 2C1HA 3SW6A 3TKFA 3LI1A 2YJQA 4X2RA 4YCOA 4RXGA 5F7UA 1KWKA 4JTUA 3TTYA 2VRQA 1UKQA 1THFD 2OT0A 5G1YA 3N73A 1ZHAA 2V30A 1L9WA 2ZRUA 1JUEA 4WD0A 1J0KA 2WNWA 3QSRA 3NQFA 1H5YA 1PPIA 3VO0A 1SU5A 1WYIA 2FPTA 5FEXA 5HWMA 7CGTA 3V1PA 2Z6IA 2B7QA 3BLPX 5I24A 5G2HA 3LLFA 1LBFA 3DFSA 2YW4A 1PJ9A 2ZQ0A 4HSOA 1AW5A 3MBDA 2E09A 2WJZA 1LCOA 4RK8A 1TTPA 1YDOA 3EDFA 1GVQA 4LT9A 3U8GA 1V5XA 2QCNA 2C18A 4K36A 1BTMA 4Y8FA 3GKAA 2OSWA 4QNEA 1PZ2A 3VM7A 4LXFA 3T40A 1U83A 5CGMA 1LDCA 3A47A 2V3FA 3TFXA 3QMTA 1D3HA 3S0CA 3L65A 4MLJA 1DEDA 3R8RA 2Y24A 4GINA 3L4VA 1WAUA 4EWND 1I75A 3VGFA 2ZX7A 1F05A 1J0IA 1OK4A 1ADOA 2F18A 1XBZA 3TIMA 4O54A 3CZLA 3EX1A 1LOSA 3TXVA 3FOKA 1PEZA 3I7SA 4J9JA 3ZT6A 3NPXA 3HG3A 3UG3A 1VCGA 4LVBA 2NLIA 2OZ0A 3L2LA 1LWJA 3W7KA 3GBDA 3PG8A 4ORIA 3CEPA 1D7FA 1GCYA 5D02A 3FAXA 3BMWA 2GVJA 2XN2A 4DPPA 2BXZA 1MXSA 4FO4A 3RU6A 4AWSA 2DJXA 3C6CA 5A8GA 2CXGA 4K37A 4QISA 2DZVA 1YPIA 3IVTA 3SSJA 3VSTA 1A5CA 3S1UA 1XDMA 4JEQA 2H8ZA 5CGTA 5TD4A 3M9YA 3E96A 1TPWA 1IXPA 3IEBA 2V2HA 3O07A 3RF9A 4NXSA 3GDLA 4WOQA 1HTIA 2ALWA 1TPB1 1B57A 3FKRA 4UTUA 1VC4A 3LCWA 4IUOA 3TW7A 1Q6QA 1KBIA 2D0FA 4C1LA 2Y88A 2H3DA 4BA0A 1OFBA 3LCIA 2C3ZA 1R2TA 3IJ8A 2A6NA 1CGWA 4HN4A 3W7LA 1UD4A 1NM9A 3VU2A 2OYKA 4PCFA 1W31A 3QPZA 1HFBA 1U30A 1JI2A 1FCUA 2X2GA 3CQ0A 3NZ1A 4JR5A 3UWWA 2BY3A 1LRQA 3QJAA 4HNNA 1T99A 4WQ6A 4KWUA 4MZYA 3KX6A 3L66A 2XWEA 1KCKA 3LPPA 3WK2A 4MB1A 3A5FA 4JYFA 3PS7A 4XTIA 4E2OA 3MP3A 1I45A 1JDCA 3NQ8A 5BOOA 2J9XA 3KVLA 3UWVA 1TQVA 1E3XA 3WDJA 1H62A 4IMEA 4IWWA 2WKGA 2E0PA 2CLHA 1VQTA 1RD5A 4GRSA 3TCEA 2TMDA 2KZHA 4XUGA 3VMPA 1XSIA 2J88A 2D3NA 3R2GA 3L5AA 2BXYA 1FCVA 2IQTA 3ABQA 3W71A 3BAKA 4U28A 1YLVA 1OHLA 3A22A 2P0OA 2E8YA 1MZHA 1QDSA 3MP5A 2E5DA 4NX5A 4HOZA 4B5NA 1TYGA 3WFZA 1HNYA 3L21A 4UTIA 2EF9A 5CPNA 2QJHA 2Z2UA 1TSIA 3M16A 1G7UA 3WDHA 4OGZA 3F03K 4IMCA 1B3OA 4AAJA 3G0XA 3W23A 2YX0A 3HOJA 2VT0A 5FF3A 4WUIA 3W1LA 3W37A 2ZUVA 3HO8A 3L4TA 1G94A 3GXTA 3EJTA 1VS1A 3GAYA 1EWEA 4CKQA 4O0KA 2WSRA 1TTJA 2O7QA 3E02A 1JUKA 5DXYA 4MY8A 1Q4NX 1LBLA 4PL1A 3QF0A 4X9YA 2Y61A 2WCSA 2BWGA 4XBSA 3W1RA 5CXPA 5F2LA 4LC6A 3KVKA 2G3MA 3UY7A 4JICA 3B03A 3CC1A 4K8HA 1GG0A 2CW6A 2DZPA 2NT1A 3I68A 2ZZ1A 4WY0B 1UD5A 3GXNA 2RFGA 4O14A 3N19B 2GJPA 3G1AA 1XUUA 4TU1A 4ICNA 4NJKA 5CZSA 3DKLA 3GBEA 4ZQCA 4Z08A 4LV4A 6ALDA 2G95A 3NEVA 1H63A 4S1FA 2UV8G 1Y0EA 3IIVA 3GZ3A 1QNVA 3NQGA 2CHNA 1KGWA 3IIZA 3U2OA 4B9YA 3TNOA 2ZA1A 1HTYA 3QH2A 1SO4A 2PWHA 3BAWA 2PRHA 2F1BA 2NUYA 3OVPA 1KFBA 3P82A 3AMKA 3O05A 2E8ZA 2GJRA 1KV5A 1PIIA 4W93A 2YXGA 1BEUA 3KRUA 1QI4A 3AXHA 2BXVA 3HMJG 2PWEA 5DO8A 3PF3A 3NO5A 4NJJA 3GXMA 5F2IA 1FDJA 3G1VA 4GQQA 1TMHA 3VNZA 1MEWA 5KITA 1KFCA 1QR7A 1I8JA 2VFFA 4UFLA 4UFMA 4DBEA 2ZE0A 4JY9A 2C0AA 1H7OA 3K30A 3MJYA 3ZSTA 4GQRA 4U2YA 1WA3A 5CGQA 4LV9A 4UFJA 4M6QA 4R7JA 1ZAJA 4JY8A 4LWWA 3BO9A 2FFCA 3INPA 1VJSA 2E77A 3T7VA 2VC6A 1HO1A 3LBCA 4RJEA 5LSMA 3TONA 2O7SA 3IRDA 1K03A 4A22A 1W0MA 1YXCA 2E6AA 1XSJA 3BPWA 2FB3A 3WNPA 3HPXA 5FF4A 2G5WA 2QUTA 2ZUWA 1PCWA 1I2NA 1JD7A 3FW6A 2Y7GA 5E93A 1SO5A 4A2SA 1SZEA 3MWAA 3EWZA 5HNRA 1SQ7A 4DO5A 3W1XA 1KM0A 5LHEA 4AHQA 2DZUA 1OG0A 3W1QA 1C8QA 3FYOA 1MEHA 2J24A 3W84A 3CZGA 1DORA 4JCLA 4FLOA 4UTKA 4R34A 3TV8A 3S2CA 3S8HA 2ZXDA 1QW8A 1GVOA 2EPHA 4LOCA 3DXIA 1TV5A 2G97A 4IGHA 4IJBA 3W75A 5J5DA 5LNWA 3BLFA 3TDFA 3DFQA 1MXDA 1JL8A 1P0KA 4AVFA 1XI3A 5HINA 3FEMA 1BWKA 4TX9A 2E68A 4LU0A 1OF6A 1TRIA 1GEQA 2A0NA 3GDMA 3AMLA 4DQWA 5SWUA 2TYSA 1KXTA 2VXNA 4MYXA 1W8SA 3KFTA 1PIFA 3NQMA 3WEMA 1YTKA 3R13A 1UD3A 4JYDA 1LRTA 2B0MA 2W79A 4MYAA 2ABBA 3A4AA 4PCSA 5LNVA 4UXDA 3PBUA 3UPBA 4WSKA 3DFPA 2E5BA 3I7QA 4JX5A 4LQ1A 4DELA 5FI8A 3NQ2A 4JL1A 2TAAA 3UPWA 1M7OA 3IVSA 1TV7A 1SZFA 4M8UA 2D73A 3S5NA 1W5MA 4GO8A 4EVZA 4CGTA 2E1DA 3L0KA 3K8KA 1OFDA 2QCLA 2WNNA 1XH0A 5DY2A 1R47A 3WNLA 3W2JA 3C2OA 3FIGA 3M7WA 1QAPA 4J28A 3ZWSA 2AMGA 3O16A 3GNNA 2R91A 1J4EA 9CGTA 2Q8ZA 4GXMA 4PEEA 2WVVA 4OE7A 2B7OA 4XQ6A 4HNVA 2ZZ6A 3ATYA 4RKAA 3V75A 2ZWZA 4JTHA 4J3XA 3W73A 4NNAA 4AHOA 3P62A 4UUIA 1LRNA 7TIMA 3EWUA 5C54A 4NQ1A 1QWUA 4I7UA 4IMGA 1SR9A 1F5ZA 4GKLA 2WVTA 4AF0B 2Q3RA 3GAKA 1FUYA 1D3CA 1SZGA 4J3UA 1KFLA 3CTTA 4LS0A 2QCDA 1QW9A 2ZCGA 4ONVA 1W3TA 4LPCA 1BVNP 4MAZA 5G2WA 1OT1A 1ZS2A 5HXMA 5F2GA 5FF7A 3W7QA 3OIXA 1VJIA 2E6DA 1K8ZA 4FLRA 2F7PA 3LHZA 3NOEA 5LZLA 4IMFA 1ZAIA 4OHQA 3LXAA 1LM1A 3EB2A 5C55A 4UQCA 5TQLA 1OGSA 1FWRA 4UQAA 2YA2A 3A23A 3TFCA 3B04A 2FDSA 4FNPA 1IZJA 3C2VA 4AEEA 2HMCA 4RR4A 3W1AA 4O10A 4AHPA 2FJKA 3GB6A 3ZS4A 5EA9A 5BMXA 1I2PA 1ICPA 3G1HA 3OBKA 1NF7A 1DOSA 2PC4A 4JD4A 3ZQ9A 4MJMA 1KM1A 4M6PA 4UCGA 4JFTA 1G4PA 3D51A 4GUIA 5I5RA 2XN1A 3G1YA 3HQ1A 5FEZA 3A9IA 4QQ3A 2TPSA 3M47A 3W3OA 3VMNA 4TMCA 5HMSA 1QWGA 4LC8A 2QDGA 3PY2A 4G1KA 3M5XA 4AW7A 3BUIA 1RP8A 1ODUA 3FKKA 2DORA 2H3BA 1TPDA 4X0NA 2NXGA 3FA5A 3S5YA 4OU1A 3UG4A 5D2XA 5LNUA 3BLKA 3PUDA 3NQEA 1L2UA 4JIQA 4QSHA 3DFNA 1PCKA 3W2NA 1KBJA 5CPOA 3W1PA 2YCEA 2FHBA 3PVFA 2C15A 3P67A 3C52A 1VHCA 1FXQA 3BSGA 1BKSA 3TOPA 1VAHA 2B4GA 1TPVA 4YL2A 4HKPA 2C7FA 1RQEA 4GUHA 4UTLA 4ZQRA 1EA9C 1ME7A 1OYBA 5FF0A 1XC4A 3THAA 4FLQA 1R46A 3WY3A 2PCQA 1EEPA 1UUMA 1A47A 3PBYA 1XDLA 1OFRA 3C61A 1OX5A 3EDDA 3WENA 2YIHA 2ZX9A 2ATMA 3QQ0A 1W56A 1L0PA 3W7JA 4FX7A 1KW1A 4QAWA 1GVRA 1UH3A 2EHHA 4Q4KA 4UR7A 4Z0SA 3W85A 2AAAA 3MHGA 5G4EA 4J3SA 3G3DA 4Z1DA 1M7XA 3STCA 1EPXA 3PM6A 5F4WA 1ZAHA 3PUEA 3W1NA 1JCJA 1W5PA 5BMWA 2FH8A 2OCZA 3L68A 3ZO9A 4QAIA 4UZUA 1A5AA 1YXDA 3NQAA 1VLIA 1GOXA 4CN6A 1EUAA 1WPCA 3TAOA 2R8WA 3CZSA 2V2CA 4GE8A 1X8FA 1JI1A 1FWNA 4CN4A 4UTHA 1FXPA 1O5XA 2EO7A 1A53A 1H51A 1TO3A 2VEPA 1XGZA 4WSJA 4W9TA 5HR6A 3TSMA 3DHFA 4XB3A 4J7RA 2OW7A 1WDWA 3HGRA 2HS8A 4XKYA 5E0FA 1W3IA 1KXQA 1MW0A 2GQAA 1QPKA 4WY0F 3MP4A 1O60A 3G1SA 3G1XA 3TQVA 3NQVA 1J0JA 4O1DA 2A6LA 1LOQA 3BK0A 2Y5EA 1HL2A 1RVGA 1FWWA 3KVJA 3HPZA 1QHOA 2ZRWA 3NL2A 3GLCA 3GXDA 3EJSA 1SSDA 4QNWA 3UQNA 1DL3A 1HG3A 5HPOA 2A85A 1U33A 5LGZA 1G1YA 3MUXA 2QMJA 3NXFA 4CCCA 1S5VA 4YLWA 3W2LA 3LI0A 1DKWA 1IF2A 3L4ZA 4LVGA 2JGYA 4UCFA 4BZYA 1SMDA 3W7RA 1TQUA 1LYXA 3RLUA 3PSVA 2BLEA 4UTJA 2DJLA 3IGUA 4JX6A 2RDWA 4N9EA 4GI6A 3WY4A 4BR1A 3W1TA 3WMSA 3NYZA 3W83A 3DX2A 5DFAA 5EBUA 4ZVJA 5G4WA 1HL9A 2WANA 1QOPA 1WE5A 5D2TA 5CG7A 1C9DA 1JXKA 2QCCA 3L67A 3MBFA 4HPJA 1IZKA 1U2YA 5I3JA 3EX3A 5LNSA 1BG9A 3ABRA 2W6RA 3GIYA 3STGA 3GNDA 2J6XA 2CFFA 2ISSA 3AO0A 2CPUA 1KBKA 1A5BA 1SFLA 3ZR6A 4HPXA 2NSXA 4U2ZA 2ZICA 3LHTA 5FEWA 2QUVA 2ISWA 2QCFA 1M6JA 1QCWA 3W88A 1VR6A 2QPSA 4UOQA 1WBJA 2X30A 4HIBA 3LXCA 3QM3A 1A5SA 4O15A 3SGUA 3CPRA 3T55A 1KGUA 5KMYA 2DH2A 1KGXA 1WOBA 4RX0A 1JJKA 4FNQA 1P4CA 2CWNA 1R2RA 2NX1A 5DELA 4KWWA 3CZNA 5AHLA 3TSBA 3SI9A 1SMAA 2ZZ4A 4UFIA 3KWXA 7TAAA 1VFUA 1M5WA 1CYGA 4ALDA 3WJZA 2OMAA 3NQ6A 3KL5A 3C4UA 2WSYA 5IBXA 3M5VA 3S9YA 3RILA 3QMSA 4IX0A 1QMLA 5DBTA 2F84A 3MMTA 2WO5A 3DHDA 3THQA 3WELA 1F74A 3G8EA 3N34A 3DI1A 1EIXA 5DN1A 1TQXA 3K1DA 5D2WA 2YSWA 1GT8A 1TQSA 2ZRVA 1UH4A 1OB0A 1HVXA 4GUJA 1XFBA 4BWLC 2FE0A 4NT0A 2QPUA 3SJ3A 3M1ZA 2RHGA 3N2XA 1MSSA 4O50A 1WO2A 4R53A 2YDAA 3LCLA 1KM4A 4FNSA 1JDDA 3TTSA 2DH3A 4HHPA 4UTWC 5A2BA 3A5VA 4H8HA 3KL0A 1NVMA 2XVLA 1JQXA 3EXRA 4WXZA 4O28A 4GO9A 2BHUA 3L4XA 4MFEA 5BRQA 3PWAA 2XVGA 1V3JA 3P5ZA 5EPDA 5AB3A 1Z48A 2G96A 2YA1A 2Y62A 2DZSA 4LW7A 4LRTA 1JCMP 3BCFA 1KLYA 3IVUA 1OVDA 3O15A 3OVQA 4MZ1A 1ZJAA 5A6MA 3WY1A 4HOXA 4JFWA 2FTPA 3UEQA 3KRSA 1R33A 3AJ7A 4GIAA 3OVRA 4CQAA 2ATSA 1KM5A 1K7XA 4WZHA 5D33A 5HULA 1XH1A 4O57A 1SW0A 1AMYA 2A4AA 5D38A 3NL5A 3LXBA 1T8XA 3TU9A 2CLFA 5KINA 3C8FA 4A21A 1H7RA 1L6SA 3DX0A 4DEFA 5C2XA 1I2OA 5E70A 1VFMA 2G3NA 2PURA 4YXGA 1XKYA 1C29A 5KEZA 3IIXA 3TUUA 4ADTA 1GPWA 1O4UA 3HJZA 1B4KA 1JCYA 3W7MA 2XIIA 4KKXA 1JF6A 4KFNA 4Y9AA 1QOQA 1W37A 3FYPA 5I3IA 3VI2A 4E2DA 3N14A 1ZNNA 1T0OA 2ZXAA 4YMZA 3IGXA 3EJUA 4HPHA 1OYAA 3GX9A 4N2YA 1EP1A 2DIEA 5J5RA 1CGVA 2Y89A 3EWWA 1CX9A 3IJ7A 4NZFA 5E9AA 4UMCA 1NF0A 5KTLA 1F76A 5I3KA 2QJGA 1VB9A 2E9BA 2ZTJA 2QDHA 4BWLA 3BG3A 1S5TA 3BAJA 2NT0A 3CLWA 2ZDRA 1BWLA 4HA1A 2GOUA 2QCGA 5KZEA 1FQ0A 1VYRA 4U3CA 2Y6ZA 3UY8A 4S2CA 2H6RA 4U4MA 3BAIA 3B8DA 3B4UA 3BGJA 4UTWA 1GJUA 4AYSA 3GR7A 4WY0A 4UIOA 3SIZA 1I4NA 1K02A 3CIWA 2YOCA 2VNCA 4H4IA 2JKPA 2PE4A 1SSGA 3B0UX 1YTEA 2QCMA 1QFEA 3B0PA 1UKSA 1KB3A 1BVZA 2ZUUA 4XZ9A 3D52A 1QPOA 1TJPA 1JD9A 3K8MA 4ZQPA 1H1ZA 3LHYA 4X22A 5CZ0A 1NEYA 1DTUA 5DY3A 5C6MA 1TJRA 4HNTA 2WVSA 3WJWA 1ZFJA 5F1UA 4ZL1A 3CGTA 4MPQA 2Y2WA 3IK2A 1SFJA 1IXNA 1PL9A 2Y7DA 3EKZA 2VKZG 1CGTA 1R34A 1UD6A 1IGSA 2FGZA 4WLCA 3I7RA 2WPGA 2Y63A 4OV4A 2GVYA 4JTJA 2DU2A 3LDVA 1DQXA 3VGDA 2C14A 5CSRA 1VYPX 2WNQA 4AEOA 5BW6A 1XCFA 1ONRA 1JULA 5DCDA 5F1VA 2ZIDA 1HXKA 1TPFA 4NZJA 3EDEA 4TO8A 1CIUA 1WZKA 3L0NA 1UASA 1EO5A 4U31A 1TCDA 2QMKA 1ZCOA 1IIHA 1E43A 8TIMA 1FWTA 1UB3A 3O63A 3E9AA 3F1QA 5I3GA 1AQHA 1HL8A 1UJPA 5EMYA 1AL7A 4KFPA 2EGZA 2Y7FA 4J3TA 3A24A 2F7FA 1TQWA 3W7OA 2ABAA 3KL3A 4UTMA 4CVWA 1R75A 2EJ1A 3ANYA 3WY2A 3SECA 3GXFA 2R14A 3O6CA 2XIBA 2GQ9A 4H7VA 4JX4A 3R89A 1F73A 4BI7A 3C2EA 4RZ6A 1XSKA 1DJNA 1FDYA 1GQNA 1XBYA 2V8ZA 3DFTA 3TAKA 5HR7A 5BRPA 1GG1A 2VRKA 4MOZA 4O8RA 1XXXA 3HBLA 5I0DA 3DFOA 4ATWA 1H7WA 2CZEA 3HGSA 5AHMA 4ML9A 1HWWA 5K4XA 4PL2A 3WK3A 4N02A 1XUZA 3S1XA 4Z0JA 1H1YA 3ZT5A 1H7XA 4LVDA 2XFWA 2ZBTA 1BAGA 4OKDA 1J5TA 4GWEA 1V3KA 1K7FA 5A5WA 2BX7A 1KFKA 3NNTA 4H6KA 4O1CA 3W2KA 4IPIA 1F2JA 1Z32X 2GJLA 3DGRA 4LVFA 5D32A 5D03A 2LLEA 5EMUA 3A21A 5AYYA 3W70A 3NQDA 1UOKA 5DCEA 2X2JA 4Y6GA 3VGHA 5AYZA 4O0ZA 4E0CA 2VUYA 3FLUA 4WF7A 2VFHA 3W7EA 1FWSA 1G69A 1CLVA 3IV3A 1UH2A 1B2YA 4FXRA 5K4ZA 3CZEA 1V3MA 3KXQA 3RMJA 5FEPA 2OX1A 1EB3A 4MLRA 3HF3A 4DF0A 4L4MA 2ZA2A 1NSJA 1EWDA 4PFMA 3MW7A 4L4LA 3B05A 3QGVA 4UQDA 4OV9A 4KWVA 4M7TA 4UQ9A 5IM51 2YPIA 4K8EA 5LKYA 4NUWA 1TPUA 5HUPA 5D2VA 3E12A 4K39A 1ML1A 3CV5A 4DF1A 3W7IA 1RPKA 2C8NA 1FX6A 1W3NA 3HGOA 2FYVA 2RDTA 4E2BA 1AW2A 4NU7A 4AF0A 4A2RA 3ZT7A 1JCLA 1EUNA 2GQ8A 3DHPA 3G1FA 2CLOA 3VGEA 5D09A 3AXIA 4FNRA 4PCTA 2JKAA 1CXKA 5H2ZA 3C2FA 4FHAA 1JFHA 5BRBA 4GI9A 1NFBA 5U4NA 2BY0A 3E0IA 4EF9A 1O94A 1G7VA 3NG3A 3Q2DA 1JG9A 4BK9A 5TBOA 5CLTA 5D04C 2ZYFA 4WOZA 3L0GA 1CGYA 1TQTA 1W1ZA 3NL6A 3PR2A 3QW4B 1ZENA 1Y7VA 4Z1AA 3W1UA 5A6LA 2C16A 1RV8A 4JTTA 5L6UA 2YGYA 3L5MA 5D37A 1JCNA 2OYLA 2FB2A 2OJPA 4MVAA 2WKJA 5F4SA
chains in the Genus database with same CATH superfamily
3QWOB 4FL4B 1H3WM 1IM3B 5ABDE 2I57A 4GI8A 1TJIH 1T20B 3VXGA 3WD5H 1ZV5A 2VC7A 3EH1A 3KM8A 3SE9L 4OIIL 3SJNA 3NZHL 3RVXD 5LHDA 4ZS6C 2JE8A 4HWEH 3SRDA 3MI6A 3KPSA 3NIFB 1VPOH 2N0KA 1IBHA 1FNHA 1KWGA 1TETL 4N0UA 4P23B 5I1DA 4DO6A 1AG0A 3LG3A 1LO4H 1UA6L 3HAEG 1GORA 4GABA 3PWJB 4I2XE 4TSBL 3HVNA 1B9ZA 3FRUA 5LG1A 5C5YA 3GIPA 1XKJA 4X6CA 1G9NL 2ISFA 4I4WB 4IGBC 2CDFA 3RGBA 1G6CA 2J6VA 4DQAA 2FMOA 2OXGA 3F4WA 1BQCA 4HYTB 3CASA 2HTMA 2Z8SA 5CUSH 4M1RA 4AITA 1J0HA 4KWSA 1IGCL 2PO6A 4RA0C 2VIRB 2EDKA 2R1XB 3DXAE 4GGHA 2OMWB 1SO6A 2G0LA 5F1IB 4Q33A 1MPAH 2QPXA 3TN0B 1OTSD 5JHDE 4XN2A 1PZBA 2YAFA 1NAML 5FIPA 1OGAB 2FD6L 3RIAK 1V7ML 1BEXA 4I13B 3PGCB 4HIIB 4BFJA 3BLBA 4H1LB 5DMJB 4AYFB 3RM8A 3Q8EA 3RU8H 3SR7A 4NGHH 3CSPA 2CIPA 4G3YL 3R7QA 1TPXB 4FPSA 1H7NA 3FH7A 1TZGH 5DJAA 2Z8WC 4KXCA 1BZEA 2UY2A 5MF5A 3KBVA 1SFTA 1FCQA 1BXNA 2V0TA 1E6PA 1X5GA 4CEUC 5HYFA 3ARZA 3VFPB 3IS1X 4QDMA 4HNUA 4M5PA 4Q9QL 3VINA 3JXAA 3FH5A 3P73A 1E65A 3OAUL 1AS7A 2DEPA 5CSGA 4WHBA 1P0DA 4HZ6A 4S1RH 2P47B 3W74A 2X6MA 4PA8A 4XMTA 15C8L 3KYNA 1L6WA 1TJGH 3FT3A 3WFBL 1U3HC 2AXFB 1ISVA 2UX6A 1YADA 4BQ4A 2Y6TE 4F4RA 4U7SA 3U5YA 1PKQE 2R0KL 4J1OA 4Y2OA 2HPMA 3DECA 3VRLF 2B81A 4PFHA 1ICTA 2J9ZA 1T7WA 4Y9FA 4JG9A 4ONGL 4X60A 4UBDD 4Y9BA 3MLTB 3FHQA 1H15B 4QWWD 4QP0A 3CVBA 3RWGB 1MAKA 3H42H 4LY4A 3MAWA 1NCHA 2DJ4A 3QA3B 4YUEL 1SJBA 1E6JH 4I9WD 3CHFA 1TPC1 4CQ8A 1DSWA 4IHOA 1OFOA 1KCRH 4KRPD 3PJLA 2ZA3A 2F7IA 2C1OB 4NB7A 4D7PA 3I2CH 1O1HA 2CLVA 1ND0B 1KB5L 3WHXA 2VR8A 4R7XA 5FYJD 4XD3A 5C7XH 4WEBL 5I8OL 3IFPB 2FUQA 4ZMAT 1LL6A 1RD6A 1EERB 3CDGA 5I28A 1ID5I 4XE0A 3DX5A 1FAIL 2KERA 4L5ZA 1O7DC 3BVXA 2J12B 4NJIA 4PJ8B 3EB3A 3O3EA 1P7HL 4PJDE 3MHUA 1Z44A 1GYUA 4Y4FA 3SE8H 1X7QA 5HHOA 3TA9A 3W7PA 3FONB 4ZOEA 8CGTA 1K8DA 3CH1A 5TF1L 3LHVA 3AS0A 3BVUA 4ZNEA 5AKVA 4RGOL 2Q6WA 2VISB 5E2TH 1IBBA 2DQTL 3KVMA 3ZOAA 2V8MA 4JUTA 3LZOA 1PZ5B 3I3DA 2W07A 3P3RA 3AMCA 4K5NA 3TLRA 1DIKA 3DURA 4HJJH 4R2GD 2QCHA 1MEIA 4BK5C 4JNMA 4ZAKB 5HDOA 1A2YA 4B92A 4LNYA 5H4ZA 3ARPA 1ADWA 1Q9WA 1FJ1A 3GW3A 3N6JA 4AMCA 2L7UA 1AS6A 5I1AB 3B2XA 3CHSA 3GXPA 2YW3A 3EUDA 9XIAA 4G8EA 3NGBB 2O0TA 4Y5VC 1MEXL 5C2BH 2YCIX 5HJYA 4Y2DA 4ZEPA 1KIQA 4PB9H 4PJFE 1BGXL 1Q63A 4QY8A 4V1DD 4G5DA 3QXUA 3WFCL 3NL3A 1DJGA 2GWGA 4OUOA 4ZJ9A 35C8L 1FE8H 5TH2A 3NH7H 4DWSB 3PNRB 3O8XB 3BLLA 2N59A 3VAVA 2J1YA 3ZVHA 3ASWA 3W07A 3ZZ1A 3BC9A 1QW7A 1LLAA 4L4VA 2AVFA 4RL3A 1ZANL 3QS2A 1XIGA 5DRXB 3L9RB 3TBBA 3EH4B 3OGCB 1HX0A 4HH8A 4YSPA 4HT3A 4FQQA 1UURA 5IVOA 3N9RA 2IDCA 3ERXA 3GK0A 2TRHA 1NIBA 4ZPVB 5FIEA 3N42F 5DMIL 1IGJB 4XK2A 4G1MA 3ITCA 3M1BB 5IXEA 5GS1A 3DSFH 3A12A 1XB3A 4J3OC 3Q7JA 4LPWA 5IQLA 3M5YA 2E7LA 4QXIA 3ETBF 1USQA 3C5XA 1H3VA 2FSEB 2BM3A 3ILQC 1HINH 3O0RL 4Y2NA 5FSDC 1BLNA 2VC5A 3DBXB 2NXZD 3K2GA 4OBTA 1KG0A 3TBCA 1H60A 5T5NG 4O02L 4PQXA 3DO3A 5ILTL 1IIKA 5JO5B 3TW6A 5FDWB 4Q22A 4JG0L 1ULVA 2H90A 1VADB 3VIOA 5GRVK 2MSPA 3HZKB 4R90L 4OCYH 4GVHA 2HK1A 3VCRA 2CALA 1XT5A 4MLSA 4O52A 5FO2A 2EPMX 3OEXA 3U4EA 4KEMA 3I74A 4LE8A 4L5FL 3MYPA 3EOOA 2ZZ5A 2F7RA 1NFIB 4BM7A 4JTQA 4LDLB 5JDSB 3EWXA 2NY0D 3BDYL 3QG7L 4JN6A 3M7OA 1AJZA 1HE7A 4N4QA 4BFIB 3E2HC 4XMPH 3PWLA 4DOHB 5K93A 1JPGA 5DZAA 3QSRA 2INFA 2FPTA 2YPLE 3JWNC 2Z6IA 4WIQA 3KH3A 2YW4A 4N6QA 1AGCA 5DJ2B 5IB1B 3GMRB 1A5MC 2Z31A 1XR8A 1LDCA 2P76A 1AOZA 4QJ3B 4DAFA 1DEDA 4AKOA 1IX2A 2H32B 1WAUA 4IHCA 2F2KA 5CKGA 2F18A 4JQVA 4UTBA 4G8FA 4JDTH 4Y16C 3RI5F 1HYSD 2VUOA 3DXAD 2F54E 4H6RA 3WN5A 1PDKB 5EBLB 4DPPA 3GE7A 3N2TA 5JHDD 3VFGL 1YPIA 4FHJA 3HE6C 4H41A 3CV1A 3QDHA 4Q8OA 4KKQA 3AU6A 3O07A 4Q9BA 3QCUL 4N2GA 1Q6QA 4LPXA 4YDVB 3MA9H 3CFCL 4U6VL 3W24A 5C71A 3TPKA 4GJJA 2CITA 1QSEB 1A3WA 2CR3A 5EF1A 2V38A 4GA8A 1L4IA 4PJ7B 3IDYC 3H70A 4PB4A 4XRCB 3UG8A 3CSYA 4A3RA 4S3CA 4KFMA 4WEEA 3L5AA 1FCVA 2IQTA 4TTDC 3PHOB 2W0LA 2E8YA 4NJ9L 1PXGA 5MERA 4PJBB 4NX5A 4AVKA 1V79A 1ZIAA 4YQXL 3M16A 4IRSB 2XWBA 1DJXA 4C6JA 4NOFA 4LAJH 3E5PA 3FQRB 5T5NF 1T0PB 3V0HA 1X5AA 4HKZA 4PV8A 3GSWB 1IQWH 1XW8A 3S3GA 2RFGA 3CVIL 4HS3A 4S1FA 3ZL4L 5HI4C 3IDXL 4LF3A 4D7BA 3IIZA 4GIOA 4E9QA 4J1UA 4CVXB 1V6XA 4PRHB 5FHBL 2FT6A 5J56B 2YXGA 3AXHA 3RCYA 2NQZA 4GKOA 4G71B 1N68A 4IOSD 3W0KA 2AF2A 4JRYA 4N0YL 3LQZA 2G5BB 4YWGL 2MQ0A 4M6QA 4R7JA 1XCTB 1SXAA 1OCWL 1BAFH 1XGPA 1A3LL 1W0MA 1F18A 1EZVX 4ABWA 2YBGA 2CKRA 1NCUA 5C0BB 3EKCA 3CO8A 4MKVA 4APQA 1QG3A 1EVTC 4N86A 5IB5B 1FN4B 3QGKC 4FLOA 4R26L 4AUYA 4U1IB 4QTFA 3B0YA 3NP3A 3S8HA 2EPHA 4YH6A 1MNUL 2YJLA 5GGVY 3SDXE 5BJTA 4B50A 4UIKH 2O93L 3QNYB 4MYXA 4ASTA 3UO1L 2H2SC 1YTKA 1OF2A 5ANHA 1JPSH 2F58L 3UPBA 5KJ7E 4M5SA 2EE0A 2ENYA 1SZFA 5MEOB 3P0VL 4WVXA 4DJED 3B37A 2VR9A 4FI4A 1R47A 4QKTA 1J4EA 4GXMA 5CIPB 1BP3B 3IPEA 2YWZA 2O6DA 4XQ6A 4HNVA 3ASNB 4G5ZL 5C54A 4JNXA 4EPEC 2CMRH 1XYZA 3QXDA 3LKPB 4AM0B 3LGGA 4IU3B 3GMMB 3Q3GA 3IPBA 4LSRL 3OAYK 2VITB 4KKBD 5T1JA 4XCCH 2XBZA 2CU9A 1E0UA 3C2VA 4P7QA 3W6MA 4HSAC 5ABFA 2AK4A 2A6DA 5BMXA 1WFNA 1NGZB 3GKWL 3HNSH 5AW3B 3SY1A 5FGRA 4AW7A 2ZWLT 3KYKL 3VFSA 2DYRB 3ZE2E 2WMKA 1RZ7L 2C15A 4PJHE 5BUGA 3C52A 3SIKA 1FXQA 3TOPA 3MGOA 3K1KC 4YL2A 4CVZA 3UMNA 1MAJA 3NZ8A 5IEHA 3KPSB 1UUMA 1OZQA 4PGEA 1OX5A 4PB0H 5K9KB 3EDDA 4N0UB 5I66A 5I1DB 1EDTA 3LNHA 2Y8UA 5D5MF 2PDIA 1V0KA 5EZIL 3WL0A 4AC1X 3AIBA 5E2WL 4GP5B 1OCOB 3ULUL 5A3ID 2OCZA 3L68A 3VIFA 4X6CB 4JVPA 4M5TA 2J57A 1RUQL 2XPZA 3I6TA 3POHA 2CDFB 1IGFH 4Q0XH 3QJUB 3U7VA 2WYIA 1VCBC 3NJ3A 2DYPA 1UP0A 4W86A 3BUTA 1WHOA 1R5VB 1HZKA 1CC3A 3VQ2C 3HI5L 2ZOXA 3TA3A 1KGCE 4R7LA 1ECEA 4Q4OA 2NY6D 3W2LA 1XDTT 1NIAA 4LASH 1KBLA 1C12A 1UFUA 1MCJA 4F3FA 3LS5L 3VKDA 2QKSA 4DKEL 2KZ1B 3D3FA 4JPKH 1OAZH 4P49A 3WMSA 3NYZA 3NCWA 3LZRA 2WANA 4BZ1L 4YBLC 4TVPH 2QCCA 2K45A 4E5XG 4U1MA 1I3UA 4FZ8L 3W27A 3K81A 1A6PA 2C34A 2ETWA 4OFYA 3EOBA 1J18A 2Z65C 3JWOH 4DYEA 2C9VA 3SGUA 4MMWA 5DJAB 3NJIA 4OTKA 1CBVH 3OU8A 3TSBA 2CZNA 4GJIA 1VFUA 4QEHA 2HRWA 4KPHH 4F40A 1JWMA 4JO4H 4GS7C 4TX8A 5DBTA 4ZT1A 2FQDA 3O6KH 4B90A 4Q4EA 3P73B 2VABA 1XFBA 5ETUA 1SN0A 1J0ZA 2QPUA 3KYNB 3FT3B 3PUGA 4O50A 3V0VA 5KSVA 3GD1C 4O9HH 4FRWA 2IKHA 3UT0A 1HKFA 2X1OA 3L4XA 3PWAA 2IFFL 1GQJA 1V3JA 4Y2OB 2OLSA 4L29B 1X5XA 3REQA 4MXWH 2Q71A 5HVWA 2DM7A 3FSZA 2YPLD 3LBOA 2JCWA 4K3HA 1KDIA 5GZND 4HCFA 4GCAA 2EH7L 1E0VA 1OD8A 1GNXA 1FO0L 1KYDA 2V9QA 4DUOA 1FFOB 2BK8A 3GX9A 4HPOL 1A4AA 3SUWA 4IHOB 5BOJA 4L4OA 2F54D 2MMXA 1NMAH 4M1BA 5GGRA 4HFWA 5KZEA 1YECH 1NBYA 2CLVB 4UDTA 4B5TA 3WHXB 4U10A 1YW1A 4FF9A 4UIOA 1I4NA 4C56E 1MUCA 4XZ9A 2Y9RT 1GZQA 3UJTH 2Y36H 3CDGB 2BIMA 3GNRA 3U6RA 3ULAB 3R06A 1PWLA 4E8GA 1DEEA 1H5VA 1D7DA 3O3EB 4G6AC 3SM0A 3EADA 4OV4A 1A6VL 4Q8MA 3D4GA 4OT1L 1BX2B 4Y4FB 3QORA 5CSRA 4O2FA 4OZHA 3WLWC 3UBXI 1X7QB 5HHOB 3QY8A 5D7IE 1K8DB 1CIUA 3CH1B 4YSAA 5DJXA 1M68A 1BXBA 2Q6WB 3CZ8A 1X7TA 1HQTA 1J48A 4E9TA 1IR2A 3ANYA 3PTQA 4XVUD 4OQTL 4N0CD 4FQXD 4MDJA 2W07B 5D4QA 2CZEA 3ETTA 1PG7W 3DURB 2WNKA 2R4RL 3WEZA 1CMOA 1A2YB 1ISWA 2OLDA 2ZBTA 1WDDA 1NLDL 3GRWH 1V3KA 3CUJA 3DFYA 1P4IH 1ZP4A 2P5WA 3QRBA 1NEZA 1Q9WB 1FJ1B 4PJIA 2WMHA 2DB8A 2DLFH 1PF3A 1MCOH 1K8IA 4QRPA 1JPTL 2Z35A 3HF3A 2G3JA 1RCQA 5FGBC 1EWDA 1I3RA 4G8EB 4DY1A 1QNZL 3ORWA 1KIQB 1TPUA 5HYSA 3BWZA 1ML1A 2WY3B 4GHRA 5LBSH 1RPKA 1W3NA 3NOIA 1FX6A 4QY8B 2UVEA 2FWUA 5IUCA 3WD2A 4C57C 5DVKA 1UUQA 5TH2B 2ICWJ 4ETQA 4GI9A 2BY0A 5D1ZD 2WCAA 3D39E 3ZVHB 4RAHA 1EF2A 4OCRH 3F6JA 4JQIL 4Q4RA 4KHTH 1CGYA 4L4VB 4AYBA 1TR1A 4L2LA 2ERJB 4KZEL 3CSTA 4FFVC 2A74A 3AWGA 4LLMA 5I8CA 1G6RA 5B7ZA 1NIEA 1UGKA 4KDTC 4RSVA 4FQQB 4IJ3C 2DTMH 1D5BA 4JFOA 3PZOA 2FLIA 3WD3A 2WUBH 5CC3A 5CNHA 5D1XE 1TZAA 4Z7UA 4R3SA 3RFZA 3MU3A 1YPZE 4NZCA 1P1ZA 1RZGA 1E6NA 3O0KA 5GS1B 1H3PH 1BYOA 1ZY9A 1DPMA 4UFHA 5BQDA 1RQBA 1VFLA 1YJDL 1GC1H 1TYJA 3W5NA 1V6UA 4EIGB 3DEQA 4LEXH 3L12A 3QAZC 3IGAA 5EOTA 1Z69A 3FAWA 4MA3B 3QRLA 4DGVL 5AAWA 2V81A 1KXHA 3MPCA 3HZYA 5MP6L 3NSXA 1BLNB 2YD1A 1GPFA 4HHWA 2AMUA 5C08E 1PLAA 5BNXD 1L9TA 1HJUA 1KG0B 1B4JH 3CL8A 1P84J 3ARBA 3QIBA 1HE8A 3OP2A 4FJZA 4ABUA 1OP9A 3W5MA 1AQMA 1EHAA 4FXLA 1E51A 1K6AA 1A9EA 1CLKA 5IQOA 1WS8A 1OFQA 2DT1A 1CDYA 3BUYA 3AB0B 4H8PA 2GBUA 1NFDE 5EL1A 1OFEA 3S36L 2VZ1A 4Y0GA 2WXOA 2MTAA 3QN3A 4QG8A 3MO7A 4MAUL 4NRXA 3U4EB 2OYPA 2ICWI 3X1NA 3R7MA 5F0JB 2G5UA 2WSPA 3O6ML 3MRBA 4GYBA 1ZHNA 2ZAGA 4KY1H 1EA0A 4DN1A 1SOSA 3F58H 3SCMA 1N4XH 4K2SA 3LY0A 4XXWC 1W9XA 1U91A 3PWLB 2I5IA 4AZBA 4OLYL 2QADC 1XWYA 1S3TC 4KIEA 1NUNB 4W87A 1MVYA 4BFNA 2Y23A 3S1VA 4PAZA 4GEIA 1JERA 4N85A 3FTYA 2JK5A 4HJGA 3HAEH 1BXXA 1VPXA 3TC7A 3CQFA 5KVMC 5JORA 4ZMGA 2D0GA 3SN0A 2Z31B 1XR8B 3FQUA 3VFCA 5EWIL 3Q58A 5FUCC 5G1TA 1Z5LA 4AWUA 1KGCD 1FNAA 2P3ZA 8FABA 4N2KA 2J5LB 4RAVA 2E6YA 3U4AA 2YRZA 4G8FB 3V9CA 5JHLA 2NZLA 1MRCL 3GK8H 1ALDA 3KOWA 3PSWA 5DD3H 3WN5B 2NX9A 1I9JL 1ICSA 3PHQA 3AYRA 4Q32A 4TVPE 1PX8A 3BUQA 5DQDH 5J3HC 4PG2A 3VIHA 1CICD 3GQYA 5F7LB 1S9XB 3SGDH 3QQ1A 4PTUA 5TQ2L 1J86A 7FABH 4JO1H 4IRJC 4FKKA 3FU8A 4HHGA 1BGAA 3GTHA 5JOEA 4YU1A 1E6SM 3QOMA 2X1PA 4PJXE 2HYMA 4ZBJA 3UXIA 5LN4A 5EU4A 1PW3A 3RMEA 4YHYC 1I1RA 4XP4L 2GT9A 2OSYA 1PS3A 5FCUL 3GS4A 2Y3NA 3VGGA 2R0ZH 3GFUA 3FGCA 4BZ2A 4H8WH 1RJRA 3K2UH 4S3BA 1MWAA 1J2BA 3TX9A 4EPBC 3EX4A 4CNOA 2VXTH 3DX9A 4KUZL 5MI0B 5MERB 3ZHFA 4F8TA 2RALA 2AQRA 1DQUA 4LAKA 2VR4A 2QUUA 4KQ3L 4CILA 2E4TA 2CUIA 2XWBB 2ESCA 4JS3A 4AYDC 2ED7A 3EYSH 4HKZB 4PV8B 2ED9A 1ZB5A 2W3ZA 2DIKA 4OB5L 3HTLX 2C79A 4D0DA 1Q0XH 1CDCA 1LLZA 3MRCA 4HS3B 2V2DA 3VOIA 2VELA 4O4WA 4LF3B 4LHJB 2EG8A 4J1UB 4Z76A 4J4PD 2AXGA 4MCMA 2Z6JA 3N0AA 1LOLA 4JFSA 5D71L 1EO7A 4FL4C 4S38A 5T5FA 2OSXA 2A7RA 5EEZA 4JRYB 1VGEH 4ZUWA 3VA2C 4AZ6A 1PJWA 5LNEA 5AW8B 3Q43A 1KM2A 2J72A 3LKSA 5FDYA 4B3KA 1ACXA 1LQAA 2AGJH 2WZPD 1D5XA 1XGPB 4IIZA 1SPQA 2BVTA 2JWYA 4C56D 3OF6D 1DBJH 1QFUH 1YNTB 4P23C 4YHIA 2J25A 4APQB 5B39G 3DX7A 5I1HH 4MWAA 4GY0A 1QI5A 2OB3A 1NOFA 1VLWA 4B3EA 3FB5A 2XXFA 2F1EA 5AYBA 1W8OA 4UQIM 1K6WA 2REQB 5BJTB 3EYVA 4I9MA 5BW7C 4JM2F 2VJ0A 1OF2B 5ECUA 3BJLA 2AJVH 2IG2H 4PMFA 3QQXA 3QKZA 2XCMC 1RMFH 1XLMA 4ERAA 2EIDA 5C92A 4KRTA 3A3WA 3DHUA 1CDGA 1MXGA 3BYTA 5ADPH 4DBDA 3NQBA 1K7EA 1F8TL 1SFDA 4J8QA 1YC7A 1PIGA 3CFKA 4QPEA 3S42A 2QLYA 3LRKA 2B1OA 4UT7L 3ZW3A 3QXDB 4NQEA 3TN0C 2WOYA 4X4XA 1WUEA 4GBXD 2AOSA 4EI5A 3FTGA 2PP1A 3Q3GB 2LU3A 4MKSA 1LBMA 3UA4A 4NZTH 5FGCE 5H2BA 2DT3A 4XNYL 3UWQA 5LBGA 4LBEA 1P1XA 4A3YA 3KEHA 5AYIA 5ABFB 2AK4B 1JNNH 2A6DB 2KBGA 2AABL 1TPXC 1X96A 1G4MA 2C9QA 4XPBL 5AZ0A 3TTEA 5JLZA 3A3HA 4TMPA 1RH8A 2LABA 3VFSB 5F0PB 1E9LA 2MIZA 1NCBH 4X5WA 2Z1WA 3KW7A 4AIZA 4WI9A 3W7DA 2FDBP 3Q48A 3T2QA 3MGOB 3D39D 3I02A 4CVZB 4YSUA 3NZ8B 5IEHB 3ABOA 4PGEB 1ETA1 4JB9H 2QXWA 3UBXA 4YZFF 2DF3A 2FZNA 3STFA 4EIVA 4ZZ9A 5I66B 2PP0A 5EHFA 3I6KA 3GNMH 3LMZA 2F8OA 1TZHA 1TPEA 2WQPA 3EDKA 4URIA 4TUKH 5KSAA 5AOIA 4GXFA 4F0HA 1EL3A 1A1MB 4F7CA 4OLEA 3QWRA 1JZ3A 1F6KA 1B0RA 2FO8A 1TTCA 2DYPB 4DYKA 2DP3A 2V37A 4HQVA 3P81A 1YQVL 1PV8A 2NX5A 2QHRL 4NIRA 5J12B 2C1HA 3HC4L 2IOIA 1KWKA 4OR1A 4ODTH 1QSZA 3T42A 1J0KA 4MJIE 3NQFA 4F3FB 3POCA 4LFHD 3F7JA 3WQFA 5LXGH 1AW5A 4RK8A 2JKXA 1OINA 1GVQA 1V27A 2VMEA 4AZ5A 5C08D 3IKKA 4I9WE 4L65A 1N0XL 3VM7A 2OMBA 1DTNA 3RB7A 4U1MB 4MTMA 2FX8H 3VRLE 1BQLH 4TUJA 3EOBB 2GY5A 5H1WA 4PJGF 3P11H 3UG3A 1DL7H 3L2LA 2IIJA 5AQ0A 4PJ8C 3MRKA 2GK0A 3CEPA 1D7FA 2R9RA 4P48A 2YK1H 2GVJA 4Q89A 2ZOLA 3V7AG 2YXFA 2EIKB 1Z1WA 5JIMA 2J71A 4I1RA 1JWMB 2VLKA 5AVSB 1A5CA 4R83A 2WWKT 5EULV 3E9UA 3RF9A 1W9PA 4TQ8A 3GUTA 2VABB 4UTUA 2WK2A 4BJHA 1FH9A 2F15A 2P1YA 1OFBA 2HNEA 3H2CA 1JPEA 5A43C 1U8QA 5KSVB 4HN4A 3W7LA 4PCFA 1R0AH 4X6BA 4Z2GA 1IVTA 1HHJA 3REQB 2XWEA 4HF5L 4ZAKC 1IRAY 1DO6A 4OGXL 2J9XA 1FYTE 4UTAH 4ATTA 2WKGA 1UM6L 4GRSA 5T1LD 4XUGA 5JXED 4QDPA 4ZTOL 1YLVA 4ELMA 1QYGL 4KTEH 3VJ6A 3N55A 3IU4L 3AT9A 4L9YA 1RIHL 1M41A 5B38G 2EE9A 3WFZA 1MY7A 4XO7A 4MGXA 1MJUL 3NGBC 3T2PA 4PD4K 1DBKH 4IMCA 1P0SE 4AAJA 1DJZA 1JN6A 5FF3A 1PZCA 2ZUVA 1VS1A 3T8MA 3WTYA 4FHKA 2WSRA 3RAOA 1Q4NX 5GGRB 1LBLA 2FTYA 4HFWB 3MC5A 1NBYB 2P8LA 4UDTB 2WAHA 1CR9L 2NR6C 4DWSC 3O8XC 4IGSA 1UD5A 2GJPA 4TVPD 4OV5A 2IPTL 4V1DE 4ICNA 2J8UA 5TE7L 4JANA 6ALDA 2AXJA 4TM9A 1Y0EA 5F0MB 1QNVA 1GZQB 2ICWA 2VXSH 3SN6N 4JFFA 1KFBA 3U6RB 3R06B 4NM4H 3DUUA 1DEEB 5GJNA 1B90A 2PWEA 1MJ8L 2IADA 1R9YA 5KVFL 2PPFA 3U2CA 3UP8A 4G2AA 3QORB 3ME3A 4O2FB 4OZHB 1WA3A 4C8XA 4KRNA 2RFXA 2P50A 4ZFOL 4D1IA 5DJXB 2Y6SD 4BHUI 1JXFA 4OD1L 4XD5A 1H5BB 4JPWH 4H19A 4AZ7A 5E2UL 5K1VA 4X5XA 1KM0A 4QG9A 4QXWA 3QYSA 1UR9A 2G75B 2H0FA 1QTSA 3NIDE 1GVOA 2CM6A 2O5YH 4RISH 4IH3A 1BZ8A 3U4BH 4AVFA 5AWNH 1ET8A 1CVRA 4ENEC 3EPOA 3OJ2C 4U0RB 4MCNA 3AMLA 1ZTXH 3BSZL 2HRPL 2P5WB 4AL8C 1NEZB 3Q67A 3HUJF 3WZ0E 4KDVA 2ADFH 4UXDA 3GFZA 5FI8A 5A6BA 1K8IB 3LRHA 4MNHA 2D4DA 1XH0A 2Z35B 3E3HA 1ZVSB 4K2UH 2AMGA 4P9ML 3GNNA 3O16A 1I3RB 2ZZ6A 4J3XA 1BREA 1TG8A 3P62A 4LEBA 1TCRA 5HYSB 3EWUA 5C0AE 2WVTA 1QSFA 4N5ED 1TMCB 3QPEA 1SZGA 3PJSA 4ETQB 2CRZA 1J9SA 5T3XH 1XIMA 1J6PA 1E4XH 1OGSA 2B14A 1PDZA 1NQ6A 3B04A 3UAJA 4Z7QB 4KU1A 2A74B 5EA9A 1I2PA 3OBKA 1DJWA 2ADGA 1AP2A 4GZEA 3I50L 3V5HB 5CEWA 1G6RB 4QQ3A 4WCYH 1HKLH 1FWEC 1D5BB 2NXGA 4JFOB 4Z7NF 2XTJE 1KBWA 3VFNB 3HPAA 2HK0A 4Z7UB 1N18A 1OAUH 4XZMX 4R3SB 3RFZB 1Y6KR 4PI2A 5LLIC 2C9PA 1R46A 2BSBA 3IDJB 1P1ZB 1OC5A 1RZGB 5T1DH 1UUNA 1OFRA 4L05A 1UACH 2HVNA 2YIHA 1PU0A 1U9KA 2NNAA 2ATMA 3VD2A 3EBAA 2R8SH 3UTTE 3OHXA 2BOBA 3U2JA 3IGAB 5EOTB 4D8AA 5G4EA 5K9OA 2PR4H 3AY2A 1UROA 3G3DA 1DWFM 4NAFB 3V5KA 4YVVA 1ZAHA 3WQEA 1L6PA 2Z00A 5JZ7C 2YAQA 4M62L 1T1ZA 4NO3A 3NQAA 3HZYB 2G41A 3V4VL 1JI1A 4BS0A 4H9YA 2VDML 3G5EA 4KXDA 3IN2A 3B3IA 5KUMA 5AENA 3ARBB 3QIBB 4PD4J 3APYA 2YD9A 1R3YA 4R27A 4OZFH 1BYBA 4YHZH 2H45A 1A9EB 2ROYA 4H4NA 5HPOA 2A85A 1J93A 3H7BA 4RWHA 3GR4A 5IP4A 3EBIA 2OJ1A 2PMQA 3QP3A 3BUYB 3CZUB 4UTJA 1SBBA 4GI6A 3W1TA 4DW2H 5EBUA 4NRXB 1I9RH 4I0PD 3WUFA 3PDDA 1BG9A 5DANA 2XYBA 4XP6L 5C97A 3BPCA 3MRBB 4LCYA 1ZHNB 1A5BA 1WDQA 3I75A 5FEWA 2QUVA 4G43A 5IY5B 3NTYA 2ZOUA 3SCMB 2JJWA 1ITQA 3AT0A 4FG4A 4Y2WA 3OZLA 2HWZH 1JJKA 2CK2A 4Z7VF 1U91B 3TNMA 1Y1UA 1GH7A 7TAAA 3KWSA 2EPNA 1QNIA 1YEJH 5TFSL 1D9KA 5HYQB 4DP0X 4BQ8A 2JK5B 4IRSC 3IYLW 3CHPA 4HJGB 1T2QL 3VD4A 1Y5XA 3KRBA 1WWAX 3WFEL 1DQLL 3TZFA 4C6FA 2FVMA 3VAEA 3N2XA 4WU5B 3FQUB 2WBJA 4HNLA 1K8CA 1WAPA 1KM4A 5CCGE 5J5EA 4N6RA 2YKLL 1Z5LB 4WXZA 1U22A 2R1LA 3GS6A 2B0SH 8FABB 3OGSA 4RETB 4RAVB 1LWRA 4JMXA 1QKZH 4MJID 5JIKA 2X3CA 1V08A 4JFWA 4NENA 1XCQA 3LZ5A 5D38A 1OZTG 2WZMA 4J6IA 3TJPA 3S34L 1ZWIA 2FBJH 2TRYA 3PHQB 1EC7A 4AGMA 1EYWA 2AHIA 1RZJH 1JCYA 5CC5A 4Q14A 4PTUB 4RDBA 2XZZA 4YVUA 3DOPA 2XH2A 4PTDA 5E9AA 1XH3A 1U8LA 2X3AA 5LBVA 4Q6IA 1KTJA 4AQ8A 2HBXA 5EU4B 4E4FA 3V0SA 4GOAA 2GT9B 1MDLA 3UGUA 3WG6A 2FX7H 5TQ0L 1LD9A 2PE4A 4ZSOE 3RTQA 5H6HA 5J8LA 3FGCB 4QT5A 3Q1EA 4ZQPA 5TE4H 1VFHA 2XV3A 1B3JA 1MWAB 3M0KA 3MU7A 4QE1A 4M9PA 3CGTA 1E9OA 4WY7H 4ZMYA 4QRBA 5KBPA 3DX9B 4D0BA 5FYLH 3H3KA 3CD4A 3QV6A 2GVYA 2XUWA 5MENE 3ZHLA 2XKSA 2D03L 4CADA 5F1VA 2H47C 4I5RA 2C26A 1UASA 2QMKA 4IMLA 1HJQA 5EMYA 2AEPH 1AL7A 2Y7FA 4R4BA 1FYTD 4CVWA 4FQCH 4JX4A 4WKAA 2EE3A 1GQNA 4D0DB 2V8ZA 3BWWA 5CBIA 4O4YL 3ZJ6A 1DXIA 3K5RA 4QRQA 1I8KA 5C8JA 4OLZH 3MRCB 1QMUA 5F7EL 5E7FA 1SOQA 5K4XA 4CQCA 3WK3A 1RERA 4Z76B 3W56A 2AXGB 1ZS8A 3WLIA 1HEJC 3LQAC 3UYRL 2DQHH 3MBED 4PJEF 1IU1A 5BYWA 4LVOB 4ILSA 4Q3MA 3GO2A 2IMMA 4ZUWB 3HNTL 4PVLA 4WF7A 5SWZA 3LKSB 2VFHA 1D5XB 5D4YA 4NHCL 4PG9A 3F2BA 2G2NA 1XR2A 2HBVA 1E4LA 5AFAA 4P2RA 4YHIB 4ELKA 4WW2A 1OY0A 3DX7B 1P48A 1NWSA 4E2BA 3D25A 4MWAB 2FKPA 1JCLA 5IHRA 3O0FA 3FB5B 1CXKA 5D4IA 4LFYA 5U4NA 2IH9A 4MZ3A 1DWAM 3E6FA 3EYVB 4PP1D 2TODA 5D04C 2A3CA 4XVOA 3FN0H 4V15A 1ZENA 5M3WA 1E28A 3WKZA 2X4RB 1Q6GA 4Q8UA 3NJXA 5D8WA 5ALBL 2Z92A 4YDMA 5D93B 1JDEA 1UC6A 2A77H 3MTWA 1NCCH 1NQKA 3GPSA 2EEXA 3E2RA 3CFKB 3P8IA 4P3CL 3BMVA 3TYGH 2ZTBA 4NQEB 1GOQA 5D5ME 1BMGA 4X4XB 2R82A 4CD8A 1ZTXE 1URLA 1BJMA 4EI5B 4GAJH 3FTGB 4OD3H 1A4KA 2VXQA 3BG9A 3ZR5A 3QUML 4XT1C 1H3UA 1ZBWA 4LBEB 5HHQA 4NX0A 3SD2A 3ZJ8A 1UOVA 1Q6RA 3CH9A 2BW4A 4EE9A 4JY4B 5DO2C 1T22A 5LA2A 3KZ8A 4PSPA 1DSFH 4EJ1C 2DI8A 4Y4KD 1YYCA 5C0AD 1LLWA 3T8VA 5KG9A 3NPWA 2PD5A 4QE4A 4ADSA 3UZZA 4X5WB 1SJCA 1HGWA 4AIZB 1KBGH 5GNZA 1E8WA 4Z8FL 5T33H 3T2NL 3I02B 5T3XE 3PP4L 3H2WA 3SDDD 3FMGL 3CVCA 3ZYJA 1TE1A 2VX7A 4OF3A 3TU6A 2Z4GA 3SUUA 3I6KB 3CAFA 2YARA 4BHUA 3P30H 2I5YL 3HG1E 3FJTA 4YVXA 4JDEA 3NZGA 5KSAB 4N1EA 2XTJD 2WN3A 1CU4H 3WYRA 3B0VC 3LB6D 4AGLA 3WH9A 4GXVH 1B0RB 3NSNA 1TG7A 3BJTA 2Q8AH 1S2AA 3N3MA 1NJ9A 3RX2A 1YPXA 3IJHA 5DD1H 2W65B 1FQ9C 3L4UA 3H85A 4Q56A 1GVFA 2E9GA 4HP5A 1OM0A 3UTTD 1G9EA 1N19A 1AJ0A 2CRIA 5CCHE 3L3OA 1XIWA 3S6DA 1EC9A 3DC0A 1Z3RA 3C08L 5DA0B 5AB0A 1X5YA 4XAYA 2NV9A 9RUBA 3PTMA 2EQDA 2AAVA 5CPMA 5AOUA 2R0WL 4S11A 2X9ZA 3NIGE 1J9TA 2G30A 4JTDA 2BFVL 3BE7A 3B7UX 4POZD 1ZLUK 4EIUA 1GJPA 4TUJB 2NV1A 4G82A 4OFDA 2RAMA 5CC7A 4PJAF 6REQA 5CP7A 1ADQH 4JTCA 3ILDA 4IBTA 1OCZB 1GOFA 3MRKB 4GY1A 3D7PA 1OO2A 1RPXA 2GK0B 4JREB 1H3GA 2ZOLB 2Y72A 4Y4FC 4NO0D 2VLKB 1YEFH 3W6YA 1IAKA 3OM3B 2PDNA 4KO5A 3EXJA 1XLAA 3B9KA 5FHAL 2QGEA 3Q2VA 2X89A 3SQMA 4IM8A 3GUTB 1S2TA 2EDOA 3FNDA 2NUWA 4BUQA 3S35L 4K3GA 3DDGA 3WUWG 4MQ7A 3H24A 1M4KA 4QTGA 4HBCL 3SIMA 4FNLL 3FDKA 2YD5A 4JQXA 1U8QB 4AZCA 4BWWA 4XMKH 2PGWA 2Z1BA 5EA0H 1IC4L 3EO9H 3FOMA 5IW6B 2IBZX 3FK4A 3BOFA 2DJUA 4X6BB 3L54A 2QGCA 3AUJA 1HHJB 3J7HA 3LHAA 4HCGA 2OR8A 4CSSA 3EA1A 4ECNA 1ZMYA 3QULA 5LIKX 1IIGA 4R5EA 3INOA 3PNUA 3AYTA 4X6FA 3IJQA 1FZJA 5D9SA 3QZOA 3C6LA 1GPOH 4ELMB 3GF8A 3VH8G 5I1KH 1KTDA 4U6YA 5GJTH 2C3HA 4U3SA 4I9TA 3UU0A 3G6DH 3FXGA 4GGBA 5XIAA 1ZTMA 5EN3A 1JN6B 3GI8L 4RZ5A 4ADIA 2VC2B 2FR4A 2I60L 1JRCA 3WXVL 2A1YA 5I23A 1E27A 5BCAA 2ZCKL 3BAEL 4OGAD 1TITA 2P8LB 1KCLA 4JZNA 1L9QA 1CLOL 1U8HA 1F6PA 4HDIA 1I7RA 1E3ZA 3ZLGA 5EUOE 4OV5B 3TJHD 2J8UB 5IJCC 3BQ5A 4JANB 2ERJC 3JVGA 5E6YA 4XBKA 1G7QA 3IWVA 2I85A 2ICWB 2VL4A 3X3GH 2A7PA 4LUTA 4M7SA 1VSCA 3TO4A 4AXNA 3DUUB 4L6OA 4OZOA 1HHGB 4YFLF 2IADB 1SZNA 3W11C 3C8HA 2BVUA 3SGEH 2BZNA 4UT9A 3AWEA 4JTKA 4BKTC 5KSWA 4UTTA 5KVEH 2RFXB 3TXZA 4DJDA 2LLLA 1LP9F 3LMYA 5GS1C 1JVNA 3K4AA 3RJQB 4X5XB 2DUZA 4D1JA 4YDNA 2E7LC 3M4HA 3VMOA 3NFNA 4DPQA 3PWPA 1H7PA 5D9PA 4A2MA 5EEYA 3ARUA 1QLFA 4GRLD 1V7AA 5FYLE 4HD9A 4JPSA 5MEND 4C7FA 4I3SL 1TLMA 3USBA 4FQ1L 4JFUA 4XCFL 4FOUA 1XL9A 3P5YA 1OM3L 3MV11 2PWUA 1KFGA 1ZE3H 4JN1H 4N2CA 3QXAA 5E8NA 2XX0A 1YEKH 3COOA 4MNHB 2EDFA 5FGSA 3VSUA 2XG4A 3NPVA 5I75B 1BQGA 3AG1B 5DMMA 5EF2A 4EOWL 3AB0C 4L56A 1UYQA 4GLRI 1QUPA 3VD7A 3E8UH 1EGJL 2WSDA 1QSFB 3IGSA 3RWFA 4L8DB 2E25A 3DAQA 3PJSB 1XRTA 2HTKD 5XIMA 4XP9H 1QVBA 4XX1G 4GUOA 2XZCH 2EADA 2DTSA 4KKAD 5B7MA 3T6VA 2WB1A 3U0TA 2AK1L 4P8QA 4FG6D 2HFTA 4FI6A 4F2BA 5FUZL 1TV8A 2ADGB 1AP2B 4A6YH 1SW3A 1EO8L 5E56A 3KD4A 2J6EL 2WHLA 3UP6A 1T96A 1GOMA 3ZN6A 3T9WA 4IF2A 3TF4A 3FUJA 3LEVH 2WNXA 3PBWA 1AQ0A 3LV5A 3N44B 4IDLA 4J27A 5EMMA 5LXEA 1MW3A 3X3FH 3VYPA 1E5JA 2WZHA 1T7LA 2Z31C 3VVVA 4CCDA 5CGBA 3FRUB 5BXSA 3OHXB 4FABH 1XLLA 1WWWX 5K9OB 3QUKA 3CLFL 2YFNA 3T6QC 3V5KB 2OXGB 3GEWB 4I88A 3CUXA 5L7XL 1FNGA 1T1ZB 2J5LC 1QFWI 4NO3B 1MLBA 3Q8AA 1HIML 3WN5C 3B3IB 5ICUA 2PO6B 4YXHL 5JIDA 2QQ6A 4G9PA 4DGIL 5KVGL 5HMFA 1K9FA 2EEAA 2NW3A 2PTVA 2QT6A 4ICXA 1TUPA 4JTUA 2VRQA 3H7BB 5SWSE 3VI4A 1UZ6F 3NCYP 4QHLA 4G42A 4XNUH 4GQZA 4G56A 4HIEA 4DF9A 4UIMA 3TFKC 2B1HL 5C86A 3AZSA 4JFED 1NC2D 1SFSA 1XQKA 3BPCB 4LCYB 4N9GA 3R8RA 4GINA 4EWND 3L7EA 3I75B 4PWKA 4N1CA 5T3XD 1T6VN 4G43B 4GRWF 4O54A 3CZLA 4A67A 1HXMA 3NPXA 3RHWK 2VVSA 3H2MA 4IIQA 3TNMB 5MI0C 3MMDA 4M6NH 4G8GA 3B9DA 4LBSA 3HG1D 3MA7A 3AG4B 5FOJA 1SY6H 1WDAA 2D2JA 3GTVA 4XP1H 4WOQA 2R51A 3S5LG 2GC4C 4LRNL 4NF7A 3GO1H 5I1JH 4JQ1A 2WBJB 4NC1C 3MLRL 1BXAA 5K69A 4QMEA 5C6WH 4N6RB 1SXBA 3AAZA 4QSFA 3VI3A 2R29A 3CQ0A 4OGQC 4XPTL 3OKKA 4TNEA 1CB2A 3FXYA 3IDIA 1FHGA 3KVLA 4NENB 1XMEB 4HFUL 1XCQB 3KOZA 3JQOB 3HQNA 3W01A 2KZHA 1M03A 4QHNA 1ZWIB 4KI1A 1P84K 3ANUA 1CCZA 1NL0L 1MUMA 3QV9A 1HNYA 3WG7B 1A3XA 1OPOA 4ZUVA 3F03K 1RUKH 5D7SH 3DX6A 4Q2ZA 4IT1A 4MXQC 3W1LA 2VDOB 4APQC 4NQDA 1TT6A 3GXTA 1XH3B 1U8LB 4A7GA 1TE6A 5DXYA 3APDA 2Y61A 1V8HA 4Q6IB 2YBUA 1BEYH 1XIFA 2F38A 4JICA 3MUY1 4I5XA 3GXNA 4HALA 2BB0A 1LD9B 3LQGA 3MRNA 3ARFD 2G95A 1H63A 4UQ2A 4QT5B 3M0VA 3RE0A 3ZMRA 4KVCL 4WEVX 1A49A 1E9OB 4GISA 2FAUA 3AMKA 1T5XA 4RVBA 3FX4A 3EO1A 1QI4A 1AO7A 4XODA 4D0BB 4XE5B 1XIDA 4KV5F 5F2IA 1TMHA 4DBEA 1P43A 4J6RL 5CGQA 4ONHA 4Z3EA 2X0HA 4CADB 1ZAJA 4OCSH 3PN8A 4R4BB 2PP9A 1NOUA 3ML9A 5HNRA 2GJ6A 3ALPA 1OG0A 1JTOA 3QFGA 4QRQB 3TV8A 1I8KB 2YZ5A 2ZXDA 1TWZA 5C8JB 3TDFA 1MXDA 3FJ4A 4OGYL 3K91A 1ZS8B 1SQMA 4HPGA 2D7OA 3V0WH 4AY0A 4PRAA 1UD3A 4OLUL 3LLXA 5E9DA 4NC2B 3FKUS 3GHEL 3S3PA 3NQ2A 5SWZB 5DZVA 4Y2DB 3D5HA 3C09B 3PJUA 3F00A 3SKOA 9CGTA 2WVVA 2QPDB 3GHTA 3F12A 4IK6A 2XU9A 4P2RB 5LIYX 4ELKB 4UUIA 2Y2TA 1E5NA 3D25B 4GW1A 3V6OE 4LK4A 1Y5VA 4DCQA 2ZCGA 4LPCA 4C90A 3E74A 3OIXA 5AEAA 2F5AH 1QSVA 3LHZA 4JE4B 1B0GA 4UQCA 3GBLA 4NZRL 2R2HA 4W5UA 3ULVF 5DVOA 4A68A 5KVEE 4AEEA 2UXTA 2X6BA 1VKXA 4DFIA 2XC8A 1KJ2H 1WT5C 2Z92B 4JFTA 4PBXA 1WFIA 4ORGA 5AYUL 3W3OA 5HMSA 3PFRA 5J12C 3IPWA 4K1WA 1FP9A 5GISH 1GQIA 3FA5A 3L3JA 1UWGL 5EFIA 2PD9A 1DBBH 3C2YA 4G1MB 2PUZA 1MHEA 3W2NA 3FULA 5FYLD 2V17L 1UZHA 1ZBVA 2YCEA 3UWEA 4EMZA 4RPPA 4GQBA 3BSGA 1BKSA 4YZFE 4UTLA 2J73A 4ODHL 1KGIA 4D9LL 4TQEL 1XDLA 5I77A 4P4KA 2FIRT 3QR2A 1LWIA 3R1ZA 1A4KB 3FT9A 4QAWA 3QKEA 4J12A 3ARGA 2CEQA 3B4YA 2IPFA 4EXAA 5HHQB 4RCAA 3STCA 5F4WA 2ZF9A 5BMWA 1S38A 2ESVA 4RZKA 1T22B 3TAOA 3NSJA 4GE8A 4UTHA 1FXPA 1F58H 3DHFA 5KG9B 3CFJA 1W3IA 5BV7H 4M48H 3BT2L 4N25A 4YTRA 1A0DA 4WWKD 1RBLA 5LCVA 3CLEL 4MBRA 4LANA 3WQDA 3GS0A 3LZ3A 5A6IA 1HL5A 1FRGH 1EANA 3LI0A 5JMOC 1A9VA 1SMDA 1NOLA 1VFFA 5L9DL 4BR1A 1MHCA 1Q1JH 3W83A 2WQSA 2MFNA 4JDEB 5BO1L 5CEXA 3EYUH 3T81A 3STGA 1WBZA 3ZR6A 1N70A 1FHLA 5GS2D 4PJGE 2VWTA 4KAQL 3F64A 4JM0A 2A5UA 3DGBA 1NJ9B 3A64A 5C6TL 4Y7OC 3IJHB 1P6FA 4O15A 1JPGB 3OGOE 4EEEA 2ZKXA 5AD0A 2ZZ4A 3SUTA 1CYGA 2E1WA 2XIJA 1HKJA 1AGCB 5AECA 1OSZA 4FQ2L 1DQML 3Q9PA 5IBXA 3S9YA 3L3OB 4IX0A 1XIWB 4QJ4B 1KGJA 5DHDA 2GEEA 1IO4C 1CGSL 1CQKA 6FABH 1NICA 4DZHA 4HWBA 3ITLA 4XZ4A 4OTXL 4BWTA 4NUMA 4LP5A 2APBA 2RHGA 4LQFH 1HI6A 1HKVA 1XF2A 1E5YA 1JQXA 4NNPH 2KMWA 5SWSD 1V0LA 4E36A 3DUSA 1R33A 2H9AA 4HMNA 3WGVB 1KNWA 5H8DA 1M3UA 3R94A 3QORC 2XA3A 1I2OA 3VNLA 1IAKB 3TUUA 3B9KB 1SR0A 4WK0B 5DD0L 1CL7H 5K39A 1H5BC 4TN9A 4MQ7B 3UGXA 4N2YA 4AQZA 1X5FA 5GRVL