4NX0A

Crystal structure of abp-wt, a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
430
structure length
430
Chain Sequence
SMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVDDIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 151
structure length 430
sequence length 430
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nx0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx0A01
3S5ZA 4UTTA 3R12A 1KV8A 1LOQA 3P61A 4GQRA 4N9CA 5EBUA 1EA9C 4O17A 3QF0A 4CN4A 4EOUA 1YPFA 2A7RA 2J9YA 3NPVA 3UWYA 4HOXA 4CNOA 1GVSA 2G95A 1IXQA 1G9HA 1R2TA 1ICPA 1TTQA 1EH9A 3W37A 3NA8A 1B0IA 4QISA 1OX4A 3N9SA 1ZY9A 3INPA 1PS3A 1QI4A 4FF7A 1YADA 5BRQA 1QMLA 2R91A 4KFOA 2YFOA 1WOAA 4DXVA 3CV5A 1H1YA 1G4EA 4Q4KA 2X1UA 4O1CA 4J3UA 1VYRA 2WVUA 2A21A 2I14A 3EWYA 2QCMA 3W2UA 3HJZA 3PM6A 5FEPA 4PFMA 1ZCOA 3USBA 1JRCA 1FBAA 3PF3A 4FHAA 3W84A 4O11A 2H3BA 3B0UX 3W1LA 1GYNA 2V82A 1KBIA 1CXFA 2GVYA 5HXMA 1S46A 1C9DA 2W6RA 5L9FA 3CPUA 3LV6A 1W31A 3R89A 1SFJA 1W5MA 2D2OA 4O10A 4NJKA 4ORIA 3VM5A 1VJIA 3W1MA 2Z1BA 4EVZA 3O8AA 2EADA 3C6CA 4GUIA 1GVOA 3IIZA 3IJ8A 1ZALA 3WFAA 3VNZA 5H91A 4J27A 3SZ8A 3SSJA 3P7YA 2ZZ5A 5AHIA 2A1YA 3NZRA 3RF9A 1DEDA 1MO0A 2EGZA 3FJLA 2Y70A 2WANA 3UEQA 2QDGA 3UZ5A 3GXNA 1V5XA 3HGRA 1PIFA 1Z42A 2NLIA 3KWXA 3PUOA 3FIGA 3O63A 3KE0A 3KHJA 2NT1A 4AWSA 1K7FA 2J88A 1GG0A 2Y62A 1TB3A 4M7TA 1UD6A 2NZLA 1R47A 1JDAA 3O6CA 5D30A 1E40A 1BF2A 3N34A 2ZZ7A 1U30A 3VGGA 2TYSA 3N2XA 1FDZA 5E9AA 2GQ9A 3EWWA 3B06A 1V3KA 4A21A 1H3GA 3PVFA 4JYFA 2J6XA 2CLIA 5D32A 1I75A 1YTDA 4LNYA 1OFOA 2F7FA 4O1DA 1KBBA 4RKAA 4A2SA 4C1LA 1JDCA 2YFNA 1DORA 3HO8A 1KLYA 4GIAA 3PSWA 5DCDA 2WSKA 2JGYA 1UOKA 1LTDA 3DFTA 5HWMA 1UH2A 1O7DC 3L5LA 2BY0A 1JD7A 2EHHA 2KZHA 3GXPA 1VCFA 5F1VA 3D50A 4O13A 3BLPX 1AW2A 3GB6A 2V2DA 2BXVA 5I3HA 5HUOA 1TMHA 1ZHAA 1YTEA 5I3KA 4C1KA 1V7YA 4OIFA 2FIQA 2QAPA 5EA9A 1MFUA 1LORA 1KBJA 3C56A 4KFPA 2XIIA 3LGEA 2TAAA 3VFLA 2CPUA 3NNTA 3L67A 1ZAHA 4FNUA 1XI3A 5F2MA 3S9YA 3B04A 1GCYA 3D4YA 3BGJA 2XVKA 4HPHA 4HSOA 2CLEA 3C3NA 2WNNA 1XCFA 4UQEA 3NQ6A 1KFEA 1R34A 4GJ1A 5LHEA 2C8NA 5FEXA 2ZX7A 1TQUA 2DORA 3OBKA 3EJTA 3LDVA 1PAMA 5FF0A 5E1QA 4WY0F 1UH3A 2ZZ2A 1M7PA 2X1TA 1M7OA 2HMCA 4XKYB 3W87A 2V8ZA 1TCDA 5I3JA 2TPSA 2ZTKA 3M5YA 2A5HA 4UTWA 3TSDA 1CPUA 2VFDA 2TRSA 3I6RA 3BW4A 3LV5A 3W1QA 1L6SA 4K6AA 3EX1A 4NJIA 1MXDA 3T4CA 5F2LA 2QJGA 5AYXA 3TAOA 2EACA 1EHAA 1OYCA 1H1ZA 3RLUA 1HL8A 3MYPA 5EL1A 3ABSA 3DX1A 4E2BA 4O0KA 4JFWA 3M47A 2JKAA 1YDVA 3LCIA 4M8UA 4YL2A 1IIHA 3S1VA 2FB3A 2TMDA 3KFTA 3PBUA 1I2PA 3W9ZA 1W3IA 4O53A 5H2ZA 3P62A 4DO6A 1B57A 2VEKA 3NL3A 2OYKA 1XFBA 3QJAA 4FEZA 4MKNA 3KVKA 1CGVA 1CGTA 2J9ZA 3UCQA 3QMSA 1VYSX 4JTHA 4RR4A 2QJHA 4XB3A 3TJLA 1KXHA 1KB3A 3BVVA 2CW6A 3O05A 2J27A 4WXZA 2EEXA 4DPQA 1UH4A 3UWUA 4H2CA 1EO5A 2WKLA 4O57A 2ZUUA 3LHUA 4JICA 2RKXA 1OFDA 3R5EA 3FOKA 2B7NA 3K8KA 2GOUA 3SY5A 4RJEA 4HPXA 5CGTA 3L2LA 4CKQA 1OJXA 2JBMA 4NJHA 1WZLA 3LTYA 1Q6LA 1D3GA 3OVPA 2DU2A 4MZYA 1UD8A 3BCDA 2QCDB 4IOTA 1A5SA 1BPLB 4CN1A 2BX7A 2ZZ3A 1JAEA 2WKJA 4D2JA 1TIMA 5KZMA 2AAAA 2C6QA 4JTUA 3ATZA 2Z0IA 4N9EA 2OSYA 4X2RA 1CXHA 3JRKA 3ZSSA 3NGJA 3OLIA 3N2MA 4Z1DA 4FLOA 1RV8A 1XH1A 3NEVA 4PCFA 5C54A 2ZRXA 3NL6A 4DF2A 4DO4A 1XV8A 1JUKA 3MO7A 3TSMA 5F4WA 3DX0A 5CKSA 3GBEA 1W37A 2ZX9A 1VLIA 3M43A 3BMWA 1XH0A 4AHPA 1TPB1 1AK5A 3G3DA 3W88A 3B4UA 1UASA 3BGGA 3CU2A 2AGKA 5A6MA 4JFUA 1V3JA 2PCQA 3K8LA 5KSWA 1DVJA 5EPDA 4U31A 1F05A 2E09A 4AWTA 3OA3A 2FPVA 3GAKA 3AMKA 1FWWA 1BVZA 2X2JA 2GJLA 2OT1A 2J25A 4Q33A 3SECA 2NX3A 4U2ZA 4DF1A 3OLGA 2Q8LA 4AF0A 3TMLA 2ZDRA 3NPUA 1SO4A 4MY8A 3DC0A 5KZDA 4YLWA 1E51A 2O7QA 5CGQA 4WD0A 1H7PA 1OFAA 1XKYA 2PRLA 2DH2A 2BXZA 2ZCGA 3GAYA 3H53A 1GOXA 3TNOA 4GNJA 3U8GA 4LC6A 1PIGA 2NUWA 8CGTA 3GDKA 4CNNA 3BVTA 1RPKA 5LZLA 4CGTA 3W71A 4JFTA 1IXNA 3EJUA 5BW6A 1J0HA 4JIPA 2ZUVA 1RQEA 4P2VA 1UUMA 3DFPA 4LS1A 3TCEA 3LLFA 2I1OA 4LY8A 1AVAA 2Y63A 3WNKA 3GIYA 1IGSA 4UMCA 3TE9A 1VS1A 5D33A 4L4LA 4IMCA 3EDEA 5LNSA 2F18A 5EMYA 6TIMA 4TMBA 1KXTA 3LLDA 5K9DA 3WELA 4M19A 1BVNP 1WZAA 3LX9A 4CNPA 4UNLA 3SI9A 1PHWA 5BOOA 2ZZ6A 4O4WA 1AMKA 5I24A 3NQ2A 4H7VA 3UWQA 5G4WA 1KFJA 2DZSA 5HDRA 3ANYA 4GUGA 2ALWA 2G97A 3ZT5A 2X1SA 3A21A 4R33A 4J3VA 3DENA 5D38A 3ZOAA 1LM1A 3LXBA 4O52A 1C8VA 1TPDA 1MXGA 4MLRA 3BVUA 1SPQA 3CIWA 3QMTA 1G7UA 1VHNA 3UY8A 4BWLC 5HWNA 2QDHA 4ORMA 4RCXA 4CQ8A 3CZSA 3EWZA 5LGXA 2GUUA 3PG8A 3TUUA 3CZEA 5HULA 3VX0A 1EPXA 2E1DA 2WNWA 1PZ3A 3G18A 2VKZG 4LVAA 3CT7A 2A0NA 3G1YA 2Y89A 4UTTC 3S1XA 3HG2A 1R46A 4BI6A 5SWUA 1F73A 4ONVA 4XQ6A 3TQ0A 3MP3A 3WENA 1VRDA 3C2RA 3P80A 4GRSA 2QEZA 1TJRA 1DTUA 3ABQA 1XCXA 3DFNA 4PA8A 3LCFA 1ALDA 2WSPA 1HX0A 4E2OA 1KM6A 1MEHA 1YDNA 4RZ6A 3E0IA 4FIRA 3W7JA 1QW8A 3EKZA 4H3DA 5AHFA 2E0PA 1JCYA 1XUZA 1G4TA 3THQA 4LS2A 3IRDA 1LBLA 3W74A 3LOTA 2Y61A 4Z1BA 1KTBA 4OU1A 4OHQA 3T55A 1ZJAA 2V2HA 2PRMA 3LTSA 3MUXA 6ALDA 1XD1A 3TQVA 1FDYA 3BH4A 5LNVA 1UBSA 1CI1A 2QCGA 1E3ZA 3BG9A 1PHQA 3EB2A 3ZWSA 5DCEA 4DELA 3KLLA 3WNMA 2FHBA 4UTUA 3GKAA 1B3OA 1TPEA 5FEZA 3L68A 4GUHA 1J0JA 5IM51 5LNUA 1HT6A 2CFFA 2G3NA 3O16A 5D09A 2VENA 5A8GA 1UKTA 4BFAA 4GUFA 4ADSA 3A5FA 3HG5A 2VXNA 3CZNA 2CZ5A 1OHLA 3KRZA 3AJXA 4TR9A 5D2TA 3BUBA 3ABOA 3W1NA 4JCMA 1NM9A 3OVRA 4LV4A 5DXXA 3I7QA 3CZGA 3TTYA 4ZZ9A 4IMEA 2VFFA 2DZVA 4CCCA 4UTLA 3FYPA 2ZWYA 4MYAA 1VJSA 4JL1A 4POCA 4Y6GA 2P10A 4Z0JA 1SQ7A 4LRTA 1FUYA 4IX0A 5HUPA 1LROA 3TKFA 3W23A 4R34A 1SR9A 2YIHA 1TCMA 5G2IA 1CIUA 1A47A 3WEMA 4IJBA 1TRIA 4LWWA 5LGZA 1JDDA 1WE5A 3VSVA 2A85A 3WNPA 3DI0A 5DBUA 2ZX6A 5KEZA 3CTTA 3G1SA 1KGUA 2AAMA 4CCEA 1XL9A 3ZSTA 1J2WA 2WVSA 2RDUA 3LCWA 5FF2A 5C5YA 3L0GA 5AOUA 1F6PA 4O0ZA 4UR8A 5CPOA 3BSHA 4JYDA 1WX0A 1GWJA 2CU0A 3BV4A 3HF3A 4GWEA 4L4MA 5CZSA 2EF9A 1W5PA 3B0VC 3OLDA 5CPNA 1SW0A 3WMSA 2B7QA 3BLKA 2QCHA 3CGTA 5D2WA 1GVQA 1XBVA 1SZEA 2ZUTA 3C2EA 2PWFA 1OFEA 3GR7A 3TA6A 2AMGA 1R2SA 2EO7A 1Q3NA 3IGUA 4WY0B 1CLVA 1TPWA 2Z2UA 3D4ZA 2JGQA 4NZJA 1AQHA 1D7FA 1GZGA 4HA1A 3EWBX 1TMQA 3PBWA 4UFIA 3MBFA 1OVDA 5HMSA 5KITA 3MI2A 3ZR6A 3DI1A 1XSKA 3LI1A 3CC1A 3GK0A 3BVWA 1G67A 3Q37A 3RIKA 4ML9A 1MXSA 3LCLA 3TC7A 4PEKA 2XWDA 1TO3A 4CQAA 3UPWA 1K8XA 3BG3A 3KOFA 4FX6M 4I9AA 4N4QA 3W7PA 1H63A 3BAXA 4FMVA 1DQWA 2ZRWA 3TU9A 1UD3A 3WFZA 3E9AA 4UFLA 3PBVA 3VMNA 1CGXA 1RD5A 1M7XA 3HPZA 4O54A 4NZFA 1J4EA 4PEEA 2ZRUA 3BUIA 4TU1A 3L2MA 2IQTA 5F2IA 1KM0A 3DGRA 1JUBA 4FXSA 3S8HA 1G94A 4UQCA 3DHUA 3DHDA 2CLKA 2YW3A 3CHVA 5KTLA 3VKJA 3W2LA 3EX6A 2YA1A 3UZJA 5K9CA 1OYBA 1Q6RA 3P84A 2Z1KA 3Q94A 1IZJA 1KCLA 3BVXA 2ZICA 1TSIA 4AYSA 5AYZA 3QMRA 2XIBA 1D9EA 1O94A 1P4CA 1PVNA 2ZRYA 3ZS4A 2NV2A 4AWUA 4LUIA 3G1XA 7TAAA 4JXCA 1OSEA 4Y9AA 2OSXA 5A2CA 2QPUA 3KAOA 2ZZ4A 2E68A 5A5WA 5L6UA 3BCFA 4QIUA 1WZKA 1YPIA 1WOBA 3QM3A 5E70A 1XBXA 1EIXA 4UMBA 3EJSA 1BEUA 1TTJA 2VRKA 4FNPA 2OMAA 1FQ0A 2QCCA 3HJEA 1JRBA 1LDCA 4ICNA 1CGYA 3AXIA 4JX5A 3W7HA 4IPJA 2E8YA 2E5DA 4M56A 3QPYA 2WV8A 1P5BA 4UTKA 1WV2A 4UR7A 3EX2A 1GT8A 3HGJA 1B9BA 3QQ1A 3WNNA 2C1HA 3NQGA 3CB8A 3IJ7A 5EY5A 7CGTA 1FWSA 1L6WA 5E6YA 1SUXA 3TOPA 4DF0A 1PZ2A 1G69A 1XC4A 2TSYA 2XWEA 5G5IA 4JFSA 4X0NA 4HNUA 5K4XA 4JS3A 1VCVA 4HPJA 1KCKA 1KWKA 1K3UA 3K30A 3W7NA 3VGDA 4K7VA 3WJYA 2PURA 2C14A 3FLUA 2VEPA 3Q2DA 4EF9A 2HS8A 2C16A 4FNSA 3GXIA 2ZFAA 1P6WA 4PCSA 3GXTA 3HMJG 2GQ8A 2ZIDA 3W07A 5AHMA 2DZUA 1JD9A 2CWNA 1TQXA 2H8XA 3BLFA 1WYIA 3TDFA 1WP6A 2FQIA 1SO6A 3F4WA 3TXZA 3FFSA 3L4ZA 4FXRA 3CIXA 2DIJA 1G6CA 1JI2A 4O4VA 3GYEA 1OFBA 1OT1A 3VSTA 4HKPA 2OCZA 5TBOA 1YXDA 1HO1A 2NUYA 5E0FA 1WO2A 1FXQA 3M7WA 3WDJA 4HN4A 1OK4A 4FIQA 2EAWA 2ZTJA 2H8ZA 1J0IA 1R75A 5E0KA 3KL3A 2C13A 4UZSA 3G1HA 3VNYA 5J5RA 1ZAJA 4KKXA 3L4XA 2V5BA 1Z48A 3KL0A 4UC5A 1G5AA 2WVTA 4UNIA 4UCFA 2FB2A 4IPIA 1RP8A 1EUAA 3PY2A 5G1TA 4FLQA 4DPPA 4KWVA 4YCOA 3A23A 2GVLA 1CX9A 3O6DA 4PSPA 1FWTA 2P1FA 1JGIA 3QPZA 2E6AA 4FLRA 1LWHA 2AQWA 1W3NA 3W7MA 3T44A 1XUUA 2XN0A 5DLCA 1QHPA 1ME7A 2CZDA 3TROA 1KTCA 2VT0A 2NWSA 1Y0EA 3P74A 5AC8A 1I4NA 1QO2A 3I7SA 3BMVA 1EO7A 2F2HA 2ISSA 3DBPA 3MWAA 5DFAA 4AXKA 1FDJA 1TV5A 1TPVA 4JTKA 4O8RA 2F84A 2GPTA 1FWRA 4N6EA 3GXDA 1W54A 1ME8A 2WSYA 1JUEA 3W7EA 2W79A 2FLIA 3OIXA 1CDGA 3O07A 5KMYA 5HWJA 4EWND 3FA5A 2WOQA 2YW4A 4GUJA 4MZ8A 3A24A 4LS0A 1OGSA 1F2JA 1W0MA 3QFEA 1FCQA 4RLIA 1MW0A 3FS2A 4JIQA 3W1TA 1QPKA 3L9CA 3GDMA 2R14A 4Q32A 4W93A 3DFOA 4NX5A 4JGDA 3W83A 4FB7A 4J3XA 3WNOA 4S2CA 3W76A 5CG7A 2YJQA 3BUQA 2Y7FA 4LVFA 3TK7A 4XKYA 4ZQOA 3C61A 3BO9A 4LVBA 3GR8A 1VGAA 3AMLA 2NX1A 2QLYA 4IGHA 3HG4A 2RH9A 1HWWA 1ZS2A 4J9JA 3PSVA 3WJZA 4ZQRA 1LOLA 2B7PA 4PTNA 4CLMA 1NOFA 1FWNA 4U2YA 3D0CA 1PIIA 3L4WA 3MHGA 1UKQA 3VCRA 1A5CA 2FJKA 3TQKA 3QRHA 2PE4A 1GG1A 4GI6A 1KM4A 2VEIA 4OJYA 3W1XA 1YYAA 3NYZA 3BC9A 3L4YA 3UERA 2OYMA 2GVGA 5F4SA 3UY7A 2FHFA 1Q4NX 2NWRA 3S6DA 4AEEA 1I45A 3LBCA 1YLVA 1SZGA 1O5KA 3G1FA 1H62A 1L9WA 4QNEA 2DJLA 1TPFA 3BAJA 1J0KA 1BWKA 1QFEA 5G2WA 4WLCA 5HJLA 5K2ZA 3LHWA 3VX1A 4DBDA 5CZJA 4CQ9A 5A2BA 1CW2A 3EXTA 5G1YA 3ZR5A 4UQAA 5J5DA 1QI3A 3RILA 2QMKA 4M6VA 1QNVA 1JCMP 1LP6A 4YCPA 3O15A 1VHCA 1WPCA 1C8QA 1KWGA 3S5NA 1GPWA 1S5WA 2QCDA 2QUVA 1QWUA 1H7OA 2NXIA 1NF7A 3RU6A 3TONA 1LLWA 4HNTA 2DZPA 3DKJA 3CEPA 4NU7A 3EWUA 5E93A 4U3CA 3DHFA 4M7SA 4Y90A 4AEOA 4JX6A 3BAWA 4JEQA 1HG3A 4A29A 4NNCA 1NSJA 3NQDA 3VGHA 3BUDA 3DX2A 2RDTA 4WSKA 2PWDA 4DQWA 1DJNA 5MHBA 3IJ9A 3GLCA 3RK8A 4RV8A 4HOWA 1H50A 1TTIA 3M44A 4A22A 1GJUA 4AYGA 4BK9A 3NQEA 3GDRA 1CXLA 1OG0A 3G3MA 2WVVB 1DQXA 4NNBA 3MI6A 2NV1A 3C8FA 3LERA 4MJZA 3DAQA 2YOCA 3IGSA 4YWIA 3LRKA 1KXVA 1S3HA 2QCLA 3MJYA 4AW7A 4J3WA 4ADUA 3N3MA 2WCSA 3E96A 5LNRA 2C19A 4HOZA 3A6OA 1O95A 4OWGA 2F61A 3H54A 3W7QA 3W1UA 4UZUA 3AO0A 2E6DA 3UPBA 3L5MA 4XUGA 2ZXQA 1VCGA 3BW3A 4MVAA 5IBXA 3A9IA 2BLEA 2ZX5A 3BAKA 3EKLA 4Z08A 1UUOA 4QJ1A 3EX3A 2CLMA 1M6JA 5I23A 4AMXA 3LXAA 3BLEA 1UKSA 2GJRA 2E77A 1I2QA 4MYXA 3TSBA 3TMQA 1VB9A 2F1BA 4JTJA 4NXSA 3BVJA 4QAWA 2GJPA 3IV3A 4MAZA 1KTNA 4NNAA 1VFOA 1F74A 5CXPA 3DDFA 1VFMA 1EA0A 3LB0A 1SZFA 2Y7DA 1DOSA 1R33A 2QAFA 1XH2A 1MWOA 1X6UA 2YSWA 1KW1A 4IMFA 2ZRVA 1D3HA 3VE9A 2WQPA 1K7EA 2B4GA 1H7XA 3C52A 4JDYA 4FO4A 1SW7A 1QPQA 4CCDA 5FEWA 4JY8A 4S1FA 3SJ3A 3BSGA 3CLWA 4B5NA 2VELA 1NFBA 3T78A 3CWNA 5CPLA 3KL5A 2XFWA 2FYVA 5KZEA 4IX2A 2VFEA 2EKCA 4KFNA 4HT3A 4AIEA 5F1UA 1X1OA 1ZENA 2Y85A 1OFRA 2OZ0A 3GX9A 3WY4A 3W1RA 1JQVA 3DH7A 4ALDA 4WJEA 3P60A 3IIXA 3W3OA 1KA9F 4HP5A 2DZTA 1H7WA 3FKKA 3FKRA 1J5TA 1MW2A 3KRUA 1E43A 3P5YA 1IZKA 4YMZA 5I3FA 3EWXA 1KLZA 4N4PA 4NQ1A 5BRBA 2ABBA 3LPPA 4LTSA 2EABA 3NL5A 1WXJA 1OK6A 3LHVA 4PC8A 4PODA 4H6KA 4MLJA 3UWWA 3AXHA 1VLWA 4O12A 1EUNA 2NX9A 5CLWA 2CHNA 2XN1A 1RPXA 1S5TA 1GVFA 3RFAA 3BAIA 1XBYA 1QW9A 1O5XA 2ZRZA 4OT7A 2EQDA 2A6NA 1AL7A 5F4XA 2O7SA 4MPQA 3G0UA 4JL2A 3UG4A 3I65A 1LBFA 3UD6A 2Y6ZA 1QWNA 1N7KA 3TW7A 1GVIA 2W0UA 4UCGA 2VR5A 1JULA 3LCGA 1GJPA 2JK2A 3PUDA 4E38A 2YCEA 2G96A 1QR7A 1XSJA 3KVLA 1IXPA 3G8EA 1DL3A 2PWGA 3ELFA 3G24A 1KBKA 3B03A 2F7PA 1LCOA 4MOZA 1L2UA 5BMXA 2F7QA 1JQXA 2ZA2A 4EF8A 3NR0A 5I5RA 4GC4A 2C7FA 4J28A 1FCBA 3G0XA 4UTIA 5I0DA 2A7PA 2QCFA 4JX4A 2ATMA 2F1AA 3DZ1A 3PWAA 4N6FA 3CTLA 5F2GA 3OVQA 2OW6A 4UQDA 3HB9A 2ZXDA 4QQ3A 3PAJA 4KMQA 3CZLA 3TIMA 2QR6A 2FH6A 4JR5A 4QNWA 2YZRA 5FF3A 1CGWA 4MZ1A 4OV9A 1XD0A 1E3XA 1W5NA 5K9XA 4K36A 3IVSA 3WK1A 3NG3A 3VU2A 1X7FA 1A5AA 5EYWA 4K38A 2ZXAA 2YA2A 2VRQA 1SMDA 1BTMA 1DV7A 2ATSA 1JIBA 1SMAA 1MSSA 3LTPA 5D37A 3N19B 4BZYA 4MIMA 4TO8A 3QW4B 1GQNA 2ZA1A 2DZWA 3CZKA 1KFBA 1GTHA 4JN6A 3S5OA 3M9YA 4E0CA 2FH8A 2RFGA 2VNCA 3HIJA 1KGXA 4O28A 3VMOA 5EKYA 3ZT7A 1K7XA 2WC7A 4IXXA 3UQNA 3G1AA 1X8FA 3PB0A 4UFKA 3I68A 5FF7A 1BSIA 3VO0A 1F76A 1TPH1 4Y8FA 2JKPA 2D0HA 3F4NA 3G8RA 4NJJA 3GXFA 2C18A 3S0CA 3F1QA 2ZZ1A 1Q6QA 4GKLA 2ZXBA 3P8IA 3W7OA 1TQVA 3UG5A 3W70A 3A22A 3L5AA 2GVJA 5LSMA 4NT0A 2YKKA 1GJWA 4U28A 3NQMA 4UXDA 2V3FA 3FEMA 1QWGA 3WN6A 1VR6A 5TD4A 2GJNA 1HNYA 2WNZA 3M0ZA 3NL2A 3O6YX 2NUXA 4LU0A 3LRLA 1WA3A 4DEFA 2Q3OA 1XSIA 4PCTA 3WEOA 2HS6A 1QOQA 4GBUA 4JTEA 1WZMA 1VH7A 2PWEA 2X2IA 3CPRA 3OEXA 1YDOA 4UQ9A 3DU0A 5AYYA 5CLTA 4IWWA 5GVJA 3WY3A 2FGZA 4WY0A 2CLHA 1CGUA 2BHUA 3L21A 3FYOA 4IUOA 1ICQA 3W2KA 4JYEA 5HQEA 2Y7GA 3LCXA 4MFDA 1V3MA 3NPWA 1QI5A 3P81A 4GINA 3GTNA 2J24A 1QPRA 1ZJIA 4XZ9A 3W1PA 1AQMA 2ISWA 3EXRA 1XCWA 2V3EA 3EDFA 3VI2A 3W2NA 3W7KA 2DH3A 2Q3RA 3EDDA 3SIZA 1TREA 4LXFA 1PCKA 4AMAA 1SFLA 4WF7A 1TQTA 3PBYA 1QX1A 1K8YA 4N9BA 1TPC1 4N02A 1ADOA 5CSRA 3WDHA 1W9XA 4UOZA 4GFSA 3A5VA 5K3VA 6TAAA 4O1BA 1LYXA 4AHQA 1RQHA 3HPXA 3ZR4A 4OKDA 2V5LA 3HG3A 1AW1A 3N9RA 2BY3A 1VFUA 2PWHA 1OX4B 2E6YA 2UV8G 3IIPA 2OT0A 3NOEA 3DHPA 3W2JA 4HHPA 1O60A 4NJGA 1LRTA 4AAJA 3WY1A 1N55A 1W5OA 2VC6A 5FI8A 4BI5A 3QSTA 2J9XA 2P0OA 2Z6IA 1OX5A 3AJ7A 2GQAA 2NT0A 3QEZA 3GNDA 1JG9A 1OABA 2YYUA 1G1YA 2WKGA 3D51A 1CXIA 2ZUWA 1OF8A 4H8UA 2YDAA 3MHFA 1KFCA 3LRMA 4OQVA 1SSDA 4O50A 1EP3A 3O06A 4MUZA 5CSSA 1GVRA 3C2OA 1LRNA 4RXGA 5D2YA 3IVTA 1ML1A 3U6WA 5G4EA 2XVLA 4H8HA 1NAL1 2H6RA 3CM4A 1V3LA 3EXSA 3NZ1A 4OV4A 5HPOA 1THFD 3NQVA 4BI7A 1HFBA 1CXKA 4Z1CA 4XBKA 5DCBA 1PS9A 3BLBA 3PUEA 2WCGA 1WQ5A 4R53A 3C2FA 3G1VA 1UCWA 1WAUA 4KWUA 4GI9A 2QF7A 3M07A 4RX0A 1H60A 3R8RA 3U2OA 3ZFHA 5C2XA 3CQ0A 4NX0A 4OE7A 4K7YA 2WPBA 4H4IA 1YXCA 3PG9A 3TW6A 4ZQCA 4ZQNA 3DFQA 3NQ8A 2BHZA 5CZTA 2E5CA 1SO3A 5BNKA 5DN1A 2H3DA 3UYCA 3HQ1A 3EJRA 3VGFA 3DKLA 3WK2A 4UQBA 1KGWA 4LOCA 4O19A 3NQ7A 3BLIA 4JDBA 3FAXA 1ZAIA 4I7WA 3THAA 1PJ9A 2R8WA 4LV9A 1KM1A 1B2YA 2BTMA 4FX7A 3IGXA 4BF9A 1HO4A 4LVDA 1T0OA 1MW3A 4PL1A 3W86A 1YXYA 2FTPA 3N73A 2CLLA 4U33A 3B05A 3KRSA 4QSHA 2YPIA 5ABTA 1QPOA 3NQCA 3TFCA 4M6PA 1MZHA 4BA0A 2JKEA 4XWUA 2OX1A 3B8DA 3KVJA 1MVYA 3DX4A 3NVTA 5AHNA 2BHYA 1UJPA 4JTLA 2E4TA 3V75A 3JS3A 3KXQA 3A4AA 3QW3A 4WZHA 1F6KA 2ZQ0A 2RDWA 2IGTA 1FXPA 2DZXA 3MW7A 4UFJA 3L0KA 4FLSA 5IBXC 2RHGA 2X1RA 3PB2A 5DY3A 4U4MA 3NPXA 1U83A 4AEFA 1MEWA 3TAKA 1OB0A 1HVXA 4N9DA 1JJKA 2A2IA 1EWEA 1PE1A 1FX6A 1W56A 3ZO9A 5HNRA 4NI3A 2FPYA 3KX6A 1OT2A 3BW2A 1RP9A 1LZOA 1GYLA 1VC4A 1XXXA 1L6YA 3LM7A 4XBSA 2VEMA 2QUTA 5I3IA 1M53A 3QZEA 5FESA 3T7VA 3VE7A 4J3SA 1JCLA 4HSNA 1GTEA 1A53A 1TQWA 4AVFA 2WJZA 4IXHA 3EDJA 4LRSA 1JF6A 3SGUA 1K8ZA 2XVGA 1TPUA 3UNDA 3OHIA 1QCWA 4J7RA 3WNLA 1DKWA 3NQFA 3RNDA 3HZ3A 2QUUA 2FDSA 3W7RA 4UOQA 3G0SA 1Z32X 4RZ5A 1AG1O 1RQBA 3B0PA 1KXQA 1ICSA 1DBTA 1JCNA 1I2OA 1R2RA 3QYQA 1JCXA 3MMTA 1JCJA 3BUPA 1EP2A 2B0MA 1VYPX 3UWVA 3FAWA 1L0PA 4JTGA 4M6QA 1X1ZA 3K8MA 2EAEA 2BZNA 3NDOA 5E6ZA 2D0FA 2CLOA 1JR1A 1EEPA 3SW6A 3A47A 3MHUA 3W85A 1FCUA 2QKFA 4JFVA 1W8SA 3LHYA 4WUIA 5DBTA 2QPSA 3CWOX 1PEZA 4PSRA 2PC4A 4ZVJA 2A6LA 3W7IA 1U5JA 4LVGA 1T96A 1VQTA 3W7LA 2NXGA 1MW1A 4K37A 4AH7A 2G3MA 1BG9A 4RXFA 1TYGA 1UB3A 2CLFA 3HOJA 1B4EA 3VMPA 4UNKA 5D2VA 1S5VA 4RZ4A 1SSGA 2ZBTA 2H90A 4CVWA 3TR2A 3M5ZA 5TQLA 4ZQPA 1Z44A 3T40A 2Q8ZA 1IF2A 1H7RA 3MI3A 3CEUA 1K02A 5AN7A 2VOMA 4LC8A 3II1A 1UA7A 1G7VA 1R30A 2WNQA 4NXKA 1W1ZA 3STFA 5D04C 3K1DA 3EDKA 2V0TA 4AHOA 1JI1A 3EJQA 3VGEA 3W22A 4MY9A 1TV8A 3HPSA 4NVTA 1NEYA 1BWLA 1TJPA 2B7OA 5BMWA 3WK0A 3LCHA 1PL9A 3PR2A 1BKSA 1KFLA 4GQQA 3BAYA 4I7VA 3HGSA 1HUVA 4M5PA 1XDLA 3W7GA 3WJSA 1F7BA 2FHCA 2ZA3A 4FX8A 1GEQA 5HR6A 3MP5A 5AB3A 4UFMA 5K4ZA 5LKYA 4LQ1A 2YXGA 2FE0A 1HL2A 5C6MA 4WOZA 4JTSA 3LBMA 1A50A 5CGMA 4I7UA 3E49A 4MJMA 2G5WA 3LI0A 2X2HA 3STCA 2ISVA 1VZWA 2WPGA 2X30A 2A4AA 2A7NA 4IMGA 1KM5A 2E9BA 4HNNA 1A5BA 1H7NA 4X22A 1HXKA 4G1KA 1I8JA 1FY6A 4QAIA 1AMYA 3LHZA 3YPIA 5LNWA 2OW7A 1WDWA 3G22A 2QV4A 3ZQ9A 1HTIA 1W5QA 3NAVA 3L0NA 3TXVA 2NXHA 3PS7A 5T26A 4TIMA 3CLMA 4JNMA 4UFHA 4AF0B 2Y7EA 2DP3A 3W38A 2C0AA 3V1PA 4O15A 4XTDA 1UD2A 3LHTA 3S1UA 1SW3A 1EB3A 2Y5EA 1YTKA 2C3ZA 4E2DA 2QCEA 3TX9A 3QGVA 5BRPA 2BY1A 1WBJA 3HGOA 4HIBA 3GDTA 3R2GA 4GE8A 3VGBA 2D0GA 2QMJA 3W6YA 4FNQA 2CXGA 3P82A 3W73A 1PPIA 1UD4A 3ECQA 3QSRA 4TX9A 1SO5A 7TIMA 1CXEA 3L65A 4LUJA 3KLKA 3L66A 5CZ0A 2VFIA 2XN2A 3BPWA 2WVVA 1ODUA 2BXYA 1IV8A 3GKFA 3NO5A 3HBLA 3TTSA 1QAPA 3GVGA 4TMCA 1LRQA 4Z1AA 1ZFJA 4P61A 4JTFA 3DDGA 3H55A 5A6LA 5TIMA 4TVUA 1OFPA 1T99A 3FW6A 3GZ3A 3TJXA 4X3ZA 4B9YA 4J3TA 1M5WA 3BARA 3L2IA 2QJIA 3L4TA 4Z0SA 1DJQA 3MYOA 3M16A 3W1AA 3UXAA 4A2RA 1TRDA 1ONRA 1N8FA 5FF4A 4K8EA 4LT9A 2YGYA 3EEGA 3STEA 3LXCA 3ZWTA 1U2YA 1P0NA 3WJWA 5AC7A 3WJXA 2DIEA 2OSWA 1JVNA 3W7DA 2CZEA 3NXFA 4IMDA 1T8XA 4O14A 4K8HA 4WQ6A 1KM3A 4UTJA 4UTHA 4WX2A 4ZL1A 1QDSA 1SZNA 3E02A 2X16A 2FFCA 1IIGA 1NF0A 2R94A 3UWZA 3ZT6A 5DO8A 1ZJBA 1EWDA 3NM3A 5D05A 1I2RA 1P0KA 3WY2A 4UMAA 3W72A 3G1DA 1Y7VA 1EX5A 5AHLA 2EJ1A 4XTIA 3TH6A 1B4KA 3N14A 3P8JA 1OX6A 1QHOA 4GO9A 3R13A 3BG5A 5DELA 3SR7A 1SU5A 5LHFA 1K03A 3VNDA 4YXGA 2ZE0A 2F7RA 1TQSA 1AW5A 5I3GA 2Y88A 2WSRA 1H61A 2D73A 4MB1A 4IQLA 2ZWZA 4K39A 1ME9A 4X9SA 5F7UA 3TV8A 5CPMA 1MEIA 3MBDA 1RVGA 3I7RA 4ATWA 1TQJA 3SGZA 1JFHA 1VIWA 3UG3A 1G4SA 9CGTA 4UUIA 3EJPA 1LOSA 4KWWA 3IIVA 1QOPA 3RMJA 2HTMA 3S2CA 3BK0A 4UIOA 1QPNA 3L4UA 3JR2A 1KV5A 3STGA 4EIVA 2VFHA 2CZFA 2NSXA 2ZYFA 3IVUA 3DFSA 4W9TA 1O4UA 3M1ZA 4N2YA 5HR7A 4ZMGA 2D3NA 1XBZA 3L4VA 5D03A 5U7SA 5D2XA 3UXDA 3W2MA 2BSLA 1TV7A 1HL9A 4QM1A 2I9EA 1XM3A 4ADTA 2VFGA 4S2BA 3KEHA 1JXKA 3IIOA 2YR1A 3IEBA 1PCWA 4WOQA 2V30A 4A3UA 2E8ZA 4WSJA 2WSQA 5DXYA 3TFXA 3WK3A 1BAGA 1LWJA 6CGTA 3O1NA 3QQ0A 3RLVA 1TTPA 1RR2A 2PRHA 2X2GA 2WO5A 3DXIA 3DX3A 2YA0A 1OF6A 3OLEA 3OG3A 3IK2A 1AL8A 1FCVA 1XDMA 4FNRA 4B9ZA 4BR1A 4CN6A 3D52A 1WBHA 2HSAA 4O1AA 2V9DA 4JD4A 1I2NA 2ALDA 1ZNNA 2V2CA 2Y24A 1XGZA 2OJPA 3MP4A 1H5YA 2BY2A 3F03K 3FJ6A 3KVMA 3PC0A 1LLZA 3E12A 4LW7A 1QO5A 3M5VA 4JY9A 4O16A 2F7OA 1DHKA 1VPXA 3P67A 1KFKA 4Y96A 2Y2WA 2Y4SA 4HNVA 4MFEA 3LPOA 4GXMA 1CYGA 4AMWA 4PH6A 5AC6A 2DJXA 1Q45A 3S5YA 4DBEA 1PV8A 2E5BA 4NUWA 2D3LA 4RK8A 4WXYA 1RZMA 1HTYA 4JTIA 3S42A 2EPHA 4GI8A 4OGZA 2E6FA 4R7JA 2ZUSA 4DO5A 3PULA 2YYTA 4QITA 1Q6OA 1BLIA 3TC6A 4O18A 3WDIA 2YX0A 1UD5A 2GUYA 1H51A 3M6YA 3M41A 3QH2A 2V3DA 4AB4A 5DY2A 1VAHA 1JXJA 1DHPA 2Z6JA 4PL2A 4FNTA 5AFDA 3S1WA 4LPCA 2LLEA 2BWGA 1OFQA 3P5ZA 1F5ZA 1EP1A 1LBMA 3W7CA 1C29A 5AHEA 3VM7A 3ABRA 1JF5A 2OYLA 5G2HA 4MY1A 4JCLA 5C55A 3C2VA 1U33A 2FPTA 5D02A 5K7JA 4JTTA 2ABAA 2V81A 4AIOA 5EMUA 1G4PA 3Q58A 4X9YA 3NQAA 3GDLA 3GBDA 4H8VA 3EX4A 1IXOA 4UTMA 5A2AA 1D3CA 3VSUA 4GO8A 3NM1A 4BWLA 1MFVA 2VUYA 1Z41A 2QCNA 3SFKA 3GXMA 3W75A 1W3TA 5U4NA 4UTWC 1P1XA 5KINA 8TIMA 3C0JA 4OBTA 4ZQMA 3C4UA 3ATYA 1JL8A 3M5XA 3GNNA 1OYAA 3QC3A 1UA3A 5HINA 1NVMA 1KM2A 2C15A 2ZX8A
chains in the Genus database with same CATH superfamily
3LK6A 1M1XA 1YZZA 1ZGLA 3BEWB 1OGAA 1EA9C 4G11A 3HIZA 2G95A 1FFPA 4PGDA 4ZXBC 3HS0B 2YCJA 2QGCA 3AQYA 3FO0H 3CV5A 2PDYA 2O56A 4MX7B 3FSOA 4NQXA 3HJZA 1I0DA 3PM6A 3CN2A 3AY4C 3KCWA 2CBIA 3VZYA 1TWZA 3SDDC 5JOEA 2OWWA 3R89A 2AJZB 2XQBL 5KS9B 1H8SA 4PBXA 4M3HA 4DI8A 5L88H 2HJFA 5DJ2A 4X5PA 6XIAA 2YWYA 4QKTA 2CCRA 2P46B 2W9DL 1VFFA 2HJKA 3UZ5A 1KBGH 3GY1A 1CUOA 3AOFA 4L2LA 4PTTA 3VW3L 5D1QE 3QG7H 5L2KA 3N29A 3SIMA 3NZPA 4KXCA 1XZ0B 3UYRL 1ZVSB 2YAOA 2M1KA 4CEXC 4OIIL 2P5EB 2HDJA 2XQYK 1UOKA 3L3JB 2EKSA 1U8MB 1SLUA 1X9RA 4JRYB 5ITBH 1ZP3A 5H6HA 1AW2A 3GB6A 2GABA 2R0LL 4CVZB 1A7QL 5C2UB 5FKYA 3DETC 4DKDC 3KZSA 1CCZA 2YPLB 4EOWH 3RBGA 4ES9A 2XVKA 4K2SA 3KPOB 2B0SH 1WXYA 4BFKA 5FEXA 1H41A 4Z7UF 2ZZ2A 1U4FA 1BYCA 3W87A 2F74A 3ITLA 3MY9A 3CL8A 2PABA 5G1MA 5JH1A 2OX5A 1NH6A 3T4CA 1NCGA 1XGQA 3DA0A 3IJEB 5EUOF 3WEAA 3F5KA 3MYPA 7XIMA 3DX1A 4Y1AB 1HKVA 5KVDL 3M47A 3V10A 1QNZL 5HHVL 3ZIMA 2TMDA 3KFTA 4OCYH 3EO1B 3D25A 1UEYA 5AKQA 1D7DA 4JJ5A 4DO6A 4TQ8A 1P0SE 2J9ZA 2E5EA 2QYGA 1BZDA 4NQTA 3N12A 4L9DA 1VZHA 4XBPA 1HKKA 1FWGC 1NWTA 4RBPK 3HE7B 3IDIB 2CGYA 2O9OA 3IJIA 1EFXD 3I2CH 3WKQA 1DYZA 3F2CA 4TMPA 1DBML 4Z1DA 3OL2A 1H3TA 4OF5A 3AREB 3VFUA 4Z7QE 5CFAA 1J18A 3IDNB 1RY8A 3UGVA 3MRRB 1S7RA 4LCWB 4LNRB 4E9QA 1KYUA 4DZ5A 3HBPA 2I85A 5EIIB 4JFUA 1EZUA 4X7TA 4HKBA 5D5MF 4AYFA 3CD4A 4U31A 3UR7A 4OOUA 3VXTA 3CJJA 2GJLA 4XAKD 2FVMA 1W9PA 5CHNB 2QV5A 4GCAA 1OFAA 3TNOA 4OCWH 3FJTA 3GDKA 4Y2DB 3EJUA 4AOFA 2WLHA 3O6FD 3GIYA 4GG6A 4LCSA 5JPMC 1FLRH 4OUEA 5DHDA 5C7VA 6TIMA 1P7TB 4WUKH 4IJ3B 4NO2B 2GK0B 1CLZH 1S1PA 2ZZ6A 2DMCA 4J6IA 3UGEA 4ENEC 1AR1D 4YO0A 3MRFB 1J9TA 4J3VA 1T5XB 1YNYA 1T7YA 2J6EA 3C5ZA 1SNRA 3BISA 3II3A 4X63A 3ALFA 5CJNA 4ORMA 1LJMA 2P8MA 4WW2F 3ZMEA 4E42A 2P5WD 1ZV2A 1HOCB 1PQZB 1KIRB 4UANA 2W92A 2VKZG 3RWIB 5IQLA 3WBEA 5CH9A 1MJUH 1ZHLA 1XCXA 1EANA 1H8LA 1SJDA 4RZ6A 3LMJH 1JCYA 1XUZA 3PTQA 4ZFFB 3O8XC 4IF2A 4KI5E 5T1MA 3AIRA 2ANUA 4MASA 3KPMA 4D9LH 1XIIA 2F15A 4G7VH 3ZUNC 4RDVA 4PJ9A 4Q2ZB 2CR0A 2GITA 2YC1A 2G3NA 2OR9H 2VXUL 2X41A 1CECA 4BFAA 1QEWB 5CD3B 3UTPD 1MCBA 4NZ4A 4U1JA 3MLRH 3QDME 4KV5E 1RJCA 1G01A 4R7VA 4LV4A 2VFFA 3VD5A 4AZ7A 4S3AA 2GGJA 3UR5A 4HEME 2Z7GA 2EVGA 1LROA 4H8WH 3FQXB 1TCMA 2J6WA 4R7NA 4JY6B 3M0MA 3TJEL 1QP1A 2B1HH 3WNPA 2PP7A 2PDIA 2ZX6A 3QQ4B 5C5YA 3LCWA 3GSOB 3WKNA 3VSQA 5EZLA 5EEZA 4JMXA 4LJ3A 3T2QA 3KEDA 1E6SM 3QJXA 1UZHA 2Y1AA 4Z7UB 4PTWA 3CC5A 2CC0A 1OVDA 5IB1B 3R43A 3ZX1A 1QLFA 5E8OB 4OOZA 4E9YA 4FA7B 1T7VA 3NCFB 4I9AA 5EUOB 3BAXA 2BSEA 1DQWA 4IEFB 5IOBA 1VRSA 2ITFA 2ZRUA 4EWJA 3P0XA 2GG1A 5ANHA 4XX1E 1JRHL 3QFWA 3TO2B 2KLTA 1Q6RA 1AZZC 3TO4A 2NX5E 1P4CA 2BVPB 5BV7H 2H41A 5JXEA 4KHTH 5FCUH 1R5VB 5A5WA 4QIUA 3BEWA 4XNMB 4FK9A 1UOWA 3IARA 2QCCA 3F00A 3HS0A 3QPYA 1H09A 2XXCB 1J5HA 4MX7A 1RK6A 2A3BA 1QLRB 1J5SA 5EY5A 2XG4B 3CVIL 4U0QB 2TSYA 5D5MB 1MCCA 2AJZA 2NY1C 4NN5B 2F7IA 5C8JB 5KS9A 5REQB 2X0YA 3W7NA 2P48B 3C60B 4FX5A 1R6WA 4FNSA 4LSUL 2BRRH 3RDTC 4JAWA 4LE8A 4IMKC 4EZKA 1R0MA 4DHLA 3NGFA 4HJSA 4F7TB 4Z7WF 4Y4HB 3TDFA 2CKRA 3L4ZA 4O4VA 1UR8A 2DQTH 1JVLA 1YXDA 1HO1A 3J07A 3RUGE 4TRPL 1OZTG 2YWZA 3RLSA 2J6EH 2AEOA 1XZ0A 3SIKA 1ZVSA 3VIKA 4N24A 2P5EA 3L3JA 4JQXA 4RAHA 3GG0A 4DY1A 1U8MA 4XN7A 4FHBD 2CHXA 4JRYA 1C90A 5M1TA 2DT1A 4WW2B 4JHVA 3I7SA 4CVZA 1O5QA 1JYWA 2R29A 3VIGA 2APFA 2YPLA 4M80A 1V8EA 5C0QA 3E8UH 2LTQC 3KPOA 2OODA 5M2FX 4N0UE 2R14A 4W93A 1VJZA 4JGDA 1G9NC 5SWZB 4DTGL 3N4AA 5ADOL 4Z3TA 4P8XA 1KNWA 3K46A 1HKMA 4IJCA 4N9GB 4ZMNA 5I3DA 4L1SA 1VGAA 3L7EB 5G4MA 4IGHA 1P7BA 3IJEA 3QHTC 4CLMA 4Y1AA 4R9XA 3CFEA 3N3TA 3HFYA 2FX7H 3EO1A 1EJSC 1GG1A 1YYAA 3L4YA 3UY7A 1Q4NX 2V8LA 1TITA 3I4EA 4HIJB 4M4RB 1FI8C 4YX2L 5IBUB 3UP1A 4PMVA 4MJIB 1O5KA 1M4KA 4PZVA 5LN8A 3HE7A 2HVJB 3EXTA 3KPRB 4UOW0 3IDIA 5KSUB 2V5MA 1MQQA 1G7MB 3BOXA 1OM9A 4LVHC 2AVFA 3F7RA 1V7NL 2F6UA 1H7OA 2A6JB 2H45A 3S0PA 1Q0EA 2CJ3A 3CL6A 4JPWH 3DHFA 3WJJA 4JEQA 3AREA 2YLAA 4KF1A 3IDNA 1M01A 4K5NA 3S3DB 4ERAA 4A22A 3MRRA 4LCWA 4LNRA 1IWPA 3ARYA 5EIIA 2VDML 5FGCB 2DEPA 1B2WH 4YHOH 5D7KE 3KM8A 3N6QA 4UDUB 2W67A 3ZYIA 2OVLA 3A67L 4QG8A 3W1UA 2W0FB 3S8WA 5CHNA 5IBXA 5GGSY 2I5YH 3V5OA 5TF1L 3AICA 3FU9A 1U2HA 4Y2DA 4BXSV 3TSBA 2JKSA 3VD2A 5B80A 2V9RA 1KTNA 4BRVA 5EU7E 3CBWA 1UYQA 5I78A 1P7TA 3LKQB 1P1ZB 4NO2A 1UW9A 4GABA 2GK0A 1KW1A 1ZOXA 3MLZL 1PDZA 1BYDA 4OLUH 1LWRA 1IGMH 3CLWA 5ALBH 3ZVVA 4BWWA 1OALA 2X88A 1KCZA 5CPLA 4KFNA 1T5XA 3RDJA 5KVEL 4P5MB 5DD3H 3KWSA 4DH2A 3VC6A 4BE5A 4WJEA 3CT2A 1AFSA 4JFHE 1IZKA 1I1FB 3QGKC 5L88L 3V0DA 1HOCA 1LL1A 2ABBA 4KTYA 1PQZA 2BJMH 1WXJA 4N90D 3RWIA 1OK6A 5CBAB 2N01B 2QSCH 3AXHA 4L48A 1KBGL 1TMLA 3U0PB 2ZRZA 4PJ8B 3BQUC 1HHJB 3QZOA 3U9PH 3KM1A 3VOHA 3I65A 1ACYL 4ZZKA 3LCGA 5HK4A 5DD6B 2WHKA 2PDBA 4ZFFA 3PIQB 2PN5A 4GVFA 3QC6X 2HLFC 1KRBC 4HN8A 3LV3B 3PREA 3OVQA 1KGCE 4Z7WB 4UQDA 1XIHA 1UQZA 3STPA 4Q2ZA 5FM5O 3MX0B 5ITBL 4G7RB 3EFFB 1CGWA 4ODVH 4C4UA 4K1GA 3PYCA 1QEWA 5CD3A 2Z7UA 4P59H 3SY0B 5GGUB 2HT2D 5EYWA 1XF2B 5J13B 1VACB 1FHUA 2YXOA 4EOWL 2OKMA 4BZYA 5F1NB 1KIPB 5FLUA 3BPCB 2B0SL 2FH8A 4NILA 4YXHH 3VMOA 2XSXA 3FQXA 3G1AA 2R29H 4JY6A 2ENPA 1BSIA 2D0HA 2C18A 3IDJB 1IVLA 3MA7B 1SJCA 3W70A 3QQ4A 5I8OH 3FEMA 3GSOA 5E95B 3WN6A 5T1LB 4LU0A 4HPNA 2FECL 2Y1VA 2JQMA 2DT3A 4OCYL 3KGUA 4MNJA 4Z7UA 1PEWA 4BFNA 2EVHA 5IB1A 3NOYA 3NPWA 5JIKA 4A7SA 5E8OA 1BDYA 1DVXA 2NDGA 3SIZA 2GTWB 1UZ8B 4N9BA 4O2CA 5CSRA 5EUOA 4IEFA 4HK6A 4UV4H 1SN2A 5BOEA 3BP5B 2L3BA 5I18L 3I2CL 1QZ1A 3KLHC 3H9ZA 1JCKA 4ZB2A 1KCUH 4HJFA 5BMFL 4HYWA 1P84K 2EXWD 3JWNE 1FWIC 3TO2A 3ZHNA 1OABA 3NOIA 3WF4A 1HWGB 1BQSA 1BYPA 2E40A 4OQVA 3ARGB 3RA7H 3O06A 1CF1A 1ZGDA 2BVPA 4P8QA 3B8VA 2VN4A 1R5VA 1ZHBB 5G4EA 4H8HA 4XNMA 2FCBA 4DWHA 3QV8A 1T1WB 1FFQA 2WQVA 4UM9D 4RDQG 1UCWA 4OCWL 3M07A 3V9FA 3P0VH 3DVFA 4QTHA 3VOGA 3Q2WA 1QLRA 2XG4A 3U9WA 3UYCA 4Z3GA 3HQ1A 5IJVB 5D5MA 2I9UA 3DKLA 2PTWA 1F3DJ 4LOCA 5C8JA 3REWB 5REQA 1Y6KR 3THAA 4LV9A 1GZHC 1CLZL 1MDRA 3C60A 1LG1A 4PWKA 4O2FB 4TKWA 4RRPM 1QWHA 4M6PA 4F7TA 3CK0H 3A4AA 5TTRA 4H0GA 3PB2A 1MCDA 3GYRA 2I27N 4AEFA 3KBSA 4XMLH 1W56A 3IRPX 4Q6XA 3ZMNA 4O9HH 3R18A 4LCIH 1GAFH 3UTQB 1MJUL 4WTXA 4W8LA 3NQFA 1DKWA 25C8H 5C8BB 3LMJL 2Z9TA 4XTRD 2KDYA 2MWCA 3B0PA 1DBTA 1JCNA 3RGBA 2FZ3B 2VCBA 4B5SA 3Q8BA 2ZUYA 4WW2A 3MMTA 3L17A 4Q8TA 3SE9H 1YUHB 5AKTA 4D9LL 1EEPA 3EJYC 4G7VL 4V1YA 5E51A 4PSRA 1OP3H 4TUOB 3RTQD 2RD0A 2G3MA 5MHSD 3MLRL 5DRZB 5SWZA 5CAHA 4N0CD 2VJ8A 3KOXA 1MCNA 4N9GA 3L7EA 1TV8A 1NEYA 4H8WL 4KQ3H 4Z7OF 4C6NA 1IHIA 4HIJA 4M4RA 1OINA 3W57A 1RCQA 3MLYH 4MJIA 4HNNA 4FR1A 2XQ0A 3N4FA 1HXKA 1JV2B 2HVJA 2E9IA 3KPRA 5KSUA 1G7MA 3Q2NA 3P6LA 2FATH 3EOAB 3FB8B 1A6VH 2P8PB 3TBWB 2A6JA 2VO5A 3FQ4A 1NFPA 3JVFC 3R2GA 1TTUA 5TE4H 3KP0A 1QFWI 3LRHA 3QSRA 3OKOB 5IWLA 3LVTA 3HNVL 3F6JA 3BPWA 3O3DB 2XIMA 1JPHA 4FZ8H 3PAZA 5KN5B 5DWUH 2WXJA 1FCGA 4DZHA 3ESVF 2W0FA 5M03A 1NLBL 2RACA 4QE5A 5KVMC 1OAZH 5IJBC 3ZWTA 5DMKB 3DGBA 4IHCA 3WJXA 3OB0K 4K8HA 4I0KA 4GW4B 3LKQA 1JTPA 1P1ZA 3IV8A 4EE9A 1I2RA 1Z9AA 2DZAA 2WC4A 2EJ1A 1DJIA 4BXVA 3ZLFA 3R13A 4YXGA 4R8WH 4P5MA 2NY0D 2H6UA 2E6QA 5CZVH 4OUUB 4IQLA 4K39A 4LDCA 3WO3B 2ICCA 1DYSA 3MBWB 1I1FA 5IKCB 4AGQA 2MHAB 4MXVF 1CNVA 2BRRL 1RSCA 2VAAA 5CBAA 1FZKB 3U0PA 3BK0A 4PJ8A 5HATA 1HHJA 4LANA 2Z35B 2DQTL 2CHRA 4N20A 2RFXB 5DD6A 4H9TA 4LF1A 2J6EL 1JXKA 3GMNB 3PIQA 1H5BC 3LV3A 5CEWA 2VM3A 4Z7WA 3D52A 5DUML 2G30A 3MX0A 4JD4A 3EFFA 4Y5VA 3PTKA 1AQ8A 1EX0A 3SY0A 2OSLB 5GGUA 1IC7H 3FJ6A 3KVMA 3QPQC 4JY9A 4KMTH 3QJUB 1XF2A 3W11C 4ZUWB 1VACA 4I6VA 5F1NA 1KIPA 1S5IH 5JPMB 4PH6A 4DP8X 3VXPB 1N3NB 3V55A 3BPCA 4NUWA 2D3LA 3ZKXC 4GI8A 5DZLA 3VUSA 4ODHH 4V15A 2W80C 1W2VA 1QRND 2YX0A 4ETYA 1H51A 3M6YA 1RBAA 3ABLB 3IDJA 3PJUA 1VAHA 4G5AA 3DOPA 3MA7A 5AFDA 3AS1A 3QIWB 3K6SB 4H4NA 5KSAC 4B5XA 3S7GA 4EN3C 3TYUA 1JF5A 5BJTB 3OHMB 4OQTL 5D02A 3FQUB 5K7JA 4AIOA 2FX7L 5KVGH 4PJXF 2HSIA 4JKKA 3MKKA 3F7PC 5ILTH 4HVBA 2HRPH 1B0RB 4ATTA 4MKSA 1NUFA 2B2XH 2GTWA 4WFFE 1UZ8A 4W9JC 1AJ2A 3N9KA 3O8XB 5K93A 4OLWH 3X17A 3L3HB 1IARB 3NPVA 1L6ZA 1V0MA 3BP5A 1ICPA 4Z7OB 3QI9C 4X9IA 1PZBA 2O5XH 4JPWL 1H1YA 5DZ9A 1MPAL 1WGVA 2A21A 4WRLA 3IF1B 1CURA 3TA3D 3AACA 3VKKA 3N4EA 1GYNA 4JFQB 3LV6A 4N1EA 2I56A 1B2WL 3PRZA 4JR9H 3SYCA 1ZHBA 5T9BG 1GVOA 3SE3A 2EBNA 2P80D 4C59B 3FTVA 1T1WA 5LCVL 4G6JL 4G8GB 1J5OH 3QCTL 3E1F1 1GTFA 4JTCA 2I5YL 3FIGA 3BWWA 4QEEA 5D9SB 3ETTA 4ONGL 3BZGA 1I85A 2Z4TA 2VDRB 2HUHA 4U3XA 1FL5B 4FI6A 5E9AA 4HZ7A 4M1CD 5IJVA 4DNLA 3OKLB 3REWA 4O1DA 4PB0H 4RKAA 4OLUL 1KBWA 4PB3A 5DCDA 1IGML 5ALBL 4OLXH 1JD7A 4O2FA 2EHHA 3RI5F 5DD3L 4YJZL 3ZVIA 4G9FD 1YTEA 2GTQA 3LZ5A 3E2HB 1KBJA 5AD0B 3VFLA 1YEKH 4ZX3A 1YVLA 1OPGL 1XI3A 2BJML 5C0AB 1ZLWK 3QEUB 2CLEA 2QSCL 4QJ3B 2GEEA 2RCSH 4ECNA 3UTQA 1XHGA 3OBKA 5FF0A 1BVNT 4Z0BH 3ISIX 3U9PL 4GYJA 4F1SA 3IU3B 5LNDA 1E9ZB 4KDVA 5GZNA 3CPGA 3ZKMC 3OKDB 3MCG1 4QOKD 3NQBA 4BBWA 4FABH 3EX1A 2FZ3A 5F2LA 5AYXA 2AEWA 3N91A 1KMGA 4OJDH 4KKLD 1IEXA 2VDMB 1YUHA 1E30A 2JKAA 1YDVA 4M8UA 3JV5A 4XOBA 4GY1A 3NSFA 4LPTA 3GSVB 3BIAX 4ZXBA 1QNSA 2WK2A 1CGVA 2ZAGA 5GGRY 4WFHD 2J73A 5DRZA 1KB3A 1Q0XH 3QYSA 2WZIA 3UWUA 2ZUUA 5AZEH 1OFDA 3AY4A 5EZJB 3TJHC 2NY1B 5AVYB 2Q6ZA 4YXHL 2CBPA 1B90A 4N9EA 2C6QA 4JTUA 3PDGA 3RDTB 4AIBA 2CLPA 1R3IL 3GBEA 1VLIA 5I8OL 1L6GA 5CZKA 2IWFA 1TPB1 3HV8A 3WF1A 3CU2A 1AOZA 4PJEE 1JV2A 5CZXD 1ONWA 2PCQA 2WOYA 3WUFA 2P0IA 2NX3A 3EOAA 4IG2B 3FB8A 2P8PA 4Q89A 3FPXA 3W02A 3TBWA 1CWVA 5IHHA 4YLWA 2XQBH 5DS8B 3GNMH 5LZLA 1YNQA 1URLA 1IXNA 5BW6A 1FNGB 5KAQF 3LLFA 3OKOA 5A6BA 1RMFH 1IGSA 2W9DH 3T0TA 2VLJB 3O3DA 4QXWA 2L7EA 5KN5A 5K9DA 3QHOA 4NUGL 3VW3H 4PJXB 5HHMB 1UIPA 2LTQB 3E2QA 3MRGB 2C9SA 3WLTA 4JO1L 5BXFB 3OZMA 4MLRA 3UYRH 2J8HA 1YO4A 3RVVD 4Z3HA 3UY8A 2ATPB 3O7UA 3RA7L 4PRBB 5DMKA 5KUKA 1E6ZA 2GUUA 4DF9A 4GW4A 1W16A 4BI6A 1EXUB 2JF6A 3P0VL 1A7QH 4C7GA 4QS5A 3WUWB 2VD8A 2NLYA 2G0LA 3EKZA 3S5LG 3MSPA 2YBGA 4W4OC 5EU5B 4OUUA 4OHQA 5KANI 3MBWA 3TEUA 3V0IA 3U9UB 5IKCA 4LVHB 5INCB 4BHUA 2MHAA 5FEZA 3L68A 3L45A 3QUYC 1FZKA 2VP8A 2VI0A 5GRUL 3CH1B 3CK0L 4XC3H 3KRZA 2YN5A 2Z35A 4AKPA 2QFRA 6FABH 2E86A 5DTFB 2RFXA 3OSVA 4XMLL 3OVRA 2IAMD 3CZGA 4O9HL 1GAFL 1Q63A 1GGOA 2P10A 1SQ7A 4LRTA 3WQVA 4Q9QH 3W23A 4XWOC 4FDWA 5JMUA 5E5LA 3RN6A 2FVNA 2V6AA 25C8L 3CTTA 3U0WL 2OSLA 2ISDA 2I17A 3SE9L 2EF9A 1DBMH 4ZUWA 1V7AA 1TUFA 1SN0A 5JPMA 1GVQA 1XBVA 3VXPA 1N3NA 3B40A 4TVPD 5C0CE 5INDA 4TNVK 4B5ZA 1EAOA 3LI1A 2UY4A 1FSKB 1FHGA 2XTSA 2K45A 5IMLB 4XZBA 1JDEA 3BG3A 2FLMA 2QTVA 3QIWA 3K6SA 5A2KH 4TN9A 4WK2B 2K4WA 2BODX 3CSBA 5BJTA 3DSNB 3HQOA 2ZOKB 3SGEH 3ESOA 3FQUA 3GTIA 3PAUA 3QJFB 4JHMA 1XTMA 3GH5A 4XPTH 1XC6A 3BQUB 2WXMA 4E3TA 4CJ0A 3FONB 3HPFA 5KYNA 3G1XA 1B0RA 1FWJC 5L6UA 4GZJA 3BCFA 3L95B 3O8XA 2FATL 4X99B 1K9TA 3L3HA 5HYSG 1A6VL 1X39A 2VRKA 4JN1H 3TN5A 4PRRA 4UTKA 3ATDA 1UR9A 4KGJA 1GT8A 4JEJA 5EB8A 3WNNA 2VIRB 3CB8A 5TE4L 3IF1A 1E0OB 2NW2B 1L6WA 4NKDB 2O1AA 4W5UA 4FZ8L 3HPLB 5DWUL 1HZKA 2DWYA 5FA4B 5LIXX 4K7VA 2V37A 2VEPA 1AQKH 4HMNA 5T5NG 3HZVB 4G8GA 4ZOAA 4HSHA 4UILH 3CIXA 5D9SA 2ZOLB 1TELA 1OT1A 5M94B 1OAZL 2EEDA 3D3VB 1FL5A 3MV8B 4LY4A 3UEZA 4LHJB 1Z48A 4GAYB 4J2MA 4PLNC 3OKLA 1RP8A 1EUAA 4RDYA 4OGYL 2XQYG 3N1GC 3CUFA 4JHAH 3MVSA 1CX9A 1KTRL 4MM1A 1LWHA 4XK2A 4R8WL 3TROA 5CZVL 5IQMA 5AD0A 2F2HA 1TV5A 1FWRA 4ES8A 3TJEH 1VEMA 5C0AA 1RERA 3QEUA 4MS6A 3OIXA 3FA5A 2WOQA 4GUJA 2W66A 4XNAA 1P84J 4XB8A 3W1TA 5E2UH 1FLTX 3BCJA 3IGAB 4GXPA 1YN7B 3IU3A 5C0EA 3NJMA 1K2DB 3OKDA 3BO9A 1H2JA 1ZS2A 4R3UA 3ZKSD 1PIIA 5C2GA 1IKOP 2VDHA 2XZAH 4UB0H 2NY3D 5CBIA 3W1XA 2VSDA 3GSVA 1V0NA 4OGXL 3QJQB 3AISA 5ES4B 3UGUA 1IC7L 2BOFX 4IYKA 4ZX4A 3WNJA 3VX1A 4KMTL 1UWGL 1JRHH 3VB9A 1FC2D 1E5AA 4WUUD 4BCEA 2ZAIA 5EZJA 1T04B 1COBA 1DVFC 2WHLA 4HCDA 2VW4A 2IDFA 4ODHL 2EDEA 2ICWJ 1UQYA 4KMLB 4NU7A 3RDTA 4IMKA 1RH8A 1RJQA 4PJ5D 4DQWA 4JOMA 1DJNA 2C34A 1H50A 3M44A 3NQEA 5LVEA 3LERA 1V0LA 1QKZL 4A04A 2CERA 2QCLA 5E03A 1GS8A 2YD0A 2E7BA 4IG2A 1JPIA 3O2DA 5CJQH 1NEUA 1P1VA 4MVAA 3SAZA 5ILTL 5DS8A 2HTLD 4Z08A 1AZUA 2HRPL 4XR8C 3EWDA 1M6JA 1FNGA 2B2XL 1I2QA 3HI1B 1VB9A 4LSUH 4OFKA 1PCSA 1OHQA 2D23A 3IV3A 1ZK9A 4OLWL 2FBOJ 3RG6A 4S0HA 2VLJA 1GYCA 5KW9H 4HCLA 1U1UA 2DI7A 2F6KA 5D7HA 4PJXA 2O5XL 3K4WA 3S3CB 2X2YA 3MRGA 1NDVA 1J93A 1YDYA 5DT5A 3WD3A 5BXFA 5IIEB 1T1ZB 2DVTA 3DH7A 2ATPA 2VITB 2P50A 4PRBA 5I3FA 1YY8B 4NQ1A 4Y8EA 2DEXX 1CK0L 3LPPA 2E1WA 3VDHA 4DJDD 3KPSA 7ODCA 2ACRA 3BGAA 2CHNA 3D05A 1EXUA 3HVNA 4ILSA 4TSAL 4B0MM 4HJGB 3V6ZB 4Y9NA 3WUWA 3QR2A 4FGMA 2MTPA 5JO5B 1BZ8A 2A3CA 5EU5A 4GPNA 2OFJA 4PB0L 4J28A 3U3HA 2VDRH 3U9UA 5INCA 4GBXC 5DWPA 5ADOH 4U6TA 4ZODA 2OW6A 2BERA 2VVSA 2J75A 1WD9A 1TUPA 4QWWC 2IC2A 3RJYA 2Z0UA 5EN2B 3CH1A 5ANME 2VDGA 4IFKB 3EW3B 2IMNA 3QFJE 5DTFA 1SMDA 1BTMA 4GY4A 4I5BA 4JANB 4ATDA 1C3FA 2IQ0A 1M03A 3S5OA 4YX2H 3N6HA 2Y7LA 4Z0BL 4OFYD 1AACA 2EIDA 4WTZA 1KQYA 4H83A 2PYEE 3K72B 3I9GH 4FABL 4PM1A 3EXLA 2BDQA 4AI7A 1KBVA 1T8QA 4DOHB 2V4LA 3RRXA 3IN0A 2PWEA 1Y8BA 1JFQH 5AYYA 2A6IB 5B3JE 1M71B 3V0VB 4RA0C 2NSMA 2YEVB 4F15C 4Q4PA 3C8NA 2UUDH 5FGBC 1UEMA 2YRBA 1AOHA 4B9FA 4L3EE 1UB5B 1Q0XL 4A2DA 3VI2A 5IMLA 3A67H 1ZXQA 5AZEL 2H47C 1KG0B 1PZCA 4MZ2A 1RJLA 3DSNA 3OKNB 3CMFA 2ZOKA 5CU5A 5I75C 2XV0A 1TZOA 4I0PB 3QJFA 2XWBB 3BQUA 3FONA 5BS0B 1ONXA 3LRMA 3MLZH 4NT6B 4IJRA 1CDJA 4PJAF 3QZLA 4RNHA 3AITA 4P23C 3L95A 3T6VA 4X99A 5RUBA 3ZTJG 1NQKA 1H5BB 5KVEH 3Q13A 3WLOA 4KWUA 4GI9A 4U05A 3R10A 4RX0A 3GNML 2EPMX 3BZEB 5C0ND 2VIRA 3H2EA 2NW2A 4NKDA 1RMFL 3O2DH 4OFQA 5BZZA 5GJPA 5BNKA 2EDQA 1E6OH 2FSEB 3J27A 1T6MA 4F40A 1QR1B 3HPLA 5FA4A 2VC2L 3S9ZA 5I00A 1AKJD 1ACYH 3ITTA 4MDPA 5DANA 3FT3B 1HO4A 1BHGA 2XWZA 3ZKXB 3HZVA 4LVDA 4IP5A 4C4BA 2CLLA 4QSHA 1F4AA 5F7DB 3UG8A 4W9EC 2J12B 2ZOLA 3D9AL 3P0YH 3D3VA 4BUGA 3MV8A 1TJHH 4DJFD 1S1RA 1C8XA 5KSAB 4EN3B 4X42A 1SF5A 4XMXA 1VC4A 5TJWK 4GAYA 2O26U 5FKPB 1TQWA 1TE1A 1GJIA 3PV7A 3DXAB 1IQDB 5GGTA 3MZGB 1I8IB 4MJ6B 3EWCA 1EEUA 4DP9X 3QYQA 3HTWA 5GS2H 2B0MA 4D9PA 1A8JH 1P5VB 2E56A 2CAKA 4XISA 4LEEA 1CO1A 4ZVJA 3QI9B 2C71A 4RPPA 4FFZA 3B3BA 4XC3L 3IGAA 4WJKB 1YN7A 3CFEB 6FABL 5JPNC 1K2DA 4WK0B 1UA7A 4AZCB 3AYRA 1MG3C 3L1GA 3ARPA 4ICMA 4LHUB 1CBJA 4MJHA 1EL3A 4Q9QL 1THAA 3QH3B 4F37F 3J7HA 5FUCC 4F0LA 2FHCA 1RULL 4PGEB 4WOZA 1SFTA 2AGJH 1UURA 3QUZB 2ISVA 1UZ6E 5I18H 2RUSA 3K3QA 1ET8A 3HLAB 4IIBA 2NV9A 3UROR 1JPDX 3TW9A 5BMFH 1HCZA 1PLBA 3S2LA 2ZYSA 1HTIA 1T04A 2BS9A 4MPKA 1GZHA 3IUHA 1LVEA 3O9WD 4BD4A 3PWNB 3BRFA 2C3ZA 5FJJA 4JM4H 4NZ8A 2QVNA 1WCQA 4FNQA 2VGFA 3QWOB 4JIEA 1GW9A 2GYIA 3CNKA 4N8CL 4LUJA 2BIMA 1QSEE 2XH7A 2KT6A 5TDOB 1BWWA 2MSPA 3O6AA 4OBRA 4QRSB 1YEIL 4YC2C 1UM5L 1OCCB 4XPTL 4J3TA 1K5NB 3STBA 1WDSA 2QJIA 4E6MA 5AVQB 1JCTA 3GBNH 4HWEH 2NVDA 1DQKA 3HI1A 2DIEA 3OJDB 4DN1A 2CZEA 3XISA 3NXFA 2OGJA 4UTHA 1T2QH 3T77B 2ZDSA 3BX7C 4JN1L 1UP0A 1NBYB 1XB6A 1U8QB 3WY2A 2BSDA 4HEPA 3U2CA 4GO9A 2P47B 5LHFA 3QAZC 4PJAB 1UADC 3FTWA 5IIEA 1T1ZA 5EB9A 3QJHB 4Y9FA 4NQVB 4MB1A 4A7UA 3IMRA 4F5CE 4RX4A 2VITA 5HNUA 2VGGA 5CPMA 1YY8A 3N2BA 1AQKL 3CSTA 4UUIA 2VX7A 3ZGHA 3G5XB 2CITA 4IBTA 1CL7H 4UILL 3NIFE 4HJGA 4D0CB 3V6ZA 3DFSA 1O4UA 3BQVA 4G59C 5C09B 5HR7A 4FQHB 4L9LC 5JO5A 2OQYA 3IEBA 4MNQD 2AI0L 4E41E 1YMME 2WSQA 4DYJA 2EPKX 5EU4B 1QK2A 1SJBA 2X2GA 2Y1ZA 2Z7YA 3ET9F 3S3PA 4WZ9A 4E68A 4OQTA 4JHAL 4BJHA 3P54A 4RMUA 2J1ZA 1Z8AA 3P11H 5EN2A 4IFKA 2QTEA 3L5WA 1QO5A 4FFWC 3FU7B 4FF5A 4POUB 2Y2WA 5GGTH 4JANA 1GL4B 1CYGA 2Y0SA 1JZDC 2YMTA 4WXYA 1F3XA 4W86A 2GUBA 1BV8A 2E6FA 5KZ6A 5LO7A 5E2UL 2O61B 2Y7SA 2OQJB 2VMDA 3AQXA 1OO2A 2FDMA 3K72A 3VXQB 5CR1A 3MRJB 4EAYA 4FFZH 4TX8A 3W7CA 1Z9PA 1BFNA 2XZAL 4TXEA 5DA4A 2A6IA 2BP0B 4UB0L 2WIIA 1M71A 4O2CB 3P9MB 3V0VA 3QXAB 1KJ3L 4PS8A 3HNVH 3WZ0E 5LCVA 3UZWA 3FH5A 3SFKA 1ZTXE 3VRJB 1UB5A 2WZMA 1OQFA 1CQKA 4DN4H 5JA9A 1KNOB 9RUBA 4YGAB 3DJRA 5EBUA 1KG0A 3K81A 1NLBH 3IWVA 1YPFA 1AGDB 1NC2B 3OKNA 1D5MB 3N9SA 4QRRD 3DESA 3ORWA 4I0PA 1AKPA 1X4YA 2XWBA 4Q4KA 1S3RA 3QUYB 3IS0X 3TN0D 3GUFA 4OD3H 5BS0A 3AROA 4NT6A 1W5MA 4XKMA 3AM8C 4QTHB 3L5HA 1CD9B 1IIKA 3HG1E 2F68X 4D6CA 2Y0FA 2OMNA 3VNZA 4JO3H 4F8TA 1H5BA 2A1YA 5CJQL 3Q44A 4M7TA 3OJ2C 3BZEA 4JK0D 4N5ED 5F7BA 1FDZA 3EWWA 3X1EA 3W0WB 3B06A 4BRJA 2FSEA 2F8QA 3A3YB 2WLIB 3R06B 3M0YA 2IDUA 5KW9L 3H9SE 1I75A 1QR1A 1MI5D 1O5DT 4JVWA 5DHEA 4QT5B 4GIAA 3FT3A 2WSKA 4ZAKC 2NZ9C 2FO1A 2F19H 2NYYD 3QKZA 5F7DA 5EU6D 3B7RL 2CJTA 2CZVA 2QAPA 1O1HA 4LSBA 4YSPA 1SZRA 1WRFA 2F2KA 1JFXA 2Y7NA 5KSAA 5DUMH 4EN3A 1SUJA 3SFWA 4OZIF 3HI6H 1R34A 2WYTA 1GY1A 5FUOH 5FKPA 3T09A 3DXAA 1IQDA 1X5FA 4L0YA 2ZTKA 1I8IA 4MJ6A 1YPZF 3SYAA 1CPUA 4NJIA 1EZVX 5C07B 1F8TL 2D31A 1M6UA 1P5VA 5FYKE 2UVFA 3GKZA 2VDRL 5FSEC 3KS0H 3QI9A 4GKOA 1OC7A 3VNJA 1DWHM 4MKNA 3EKGA 3WBDA 4UIMB 4OQTH 4GZEA 2VAJA 4DPQA 4QRTB 3OF6A 4A37A 5D9PA 4AZCA 1SXBA 4PGJA 3R5EA 4D72A 3L2LA 4H9YA 1WZLA 2R2CA 4LHUA 1I1XA 4CN1A 3QH3A 1NFIB 1NIDA 3OAUH 5KZMA 2X3AA 2CBOA 4JFXB 2F38A 3E74A 2J5WA 4XD3A 4U6HB 2ZRXA 2ZF9A 4PGEA 4MD4B 1FNHA 1F8IA 1E4HA 3I9GL 3FUDA 3QUZA 3GMQB 3RHWK 4E36A 1QFHA 2DYRB 3HLAA 3BGGA 4S3KA 2ZOXA 3SRKA 1MPAH 4AWTA 1JFQL 1FOBA 1FWWA 3F2DA 4X6DF 1OE1A 1ZHNB 4AGOA 4DF1A 3OLGA 1M56B 3GI9H 1NJJA 5KZDA 1J9QA 4RGOH 3B6SB 3PWNA 5CGQA 3GAYA 1ETB1 4L0PB 4NUQA 4CNNA 4TQHA 2DQHL 3W71A 4FL4C 4ESKA 4P2VA 3QWOA 2D9QB 2P28B 1JGDB 5LCVH 3WNKA 4G6JH 3QCTH 4XIMA 4LP4A 4N2CA 5IOPB 5LNSA 2VW7A 1UUNA 5TDOA 3B1TA 3EZ8A 2OO0A 3BMXA 4ONGH 3EXJA 1PHWA 4QRSA 4XNBA 5DFVD 3HI5L 1YECL 2ALWA 1BM3H 1K5NA 2VR9A 2D4DA 1C8VA 4MSSA 3VVGA 3QULB 4BWLC 2G3FA 4CQ8A 1DEEB 3OJDA 1EJ7L 3CZEA 1DBAL 3VX0A 5HPCA 3TC3A 3F05A 4GYPC 5E8NA 3T77A 4UYQA 4KK9D 1NBYA 3P80A 1U8QA 2AK4D 3Q4DA 2I60H 4PA8A 4LIQH 3K1KC 5HHOB 1H9DA 1OPGH 1HX0A 2WO4A 4PRPE 3O2DL 2VAAB 3A4WA 2PCYA 4PJAA 1E6OL 3W74A 5IJKC 2MIZA 3L9RB 3QJHA 4NQVA 2V2HA 3MUXA 6ALDA 3CDFA 3FS9A 3BT2H 3BG9A 2FMOA 1ISWA 2UV3A 4ZMLA 1DVFB 4L3CB 4YPJA 2A9NL 3G5XA 2P3EA 2Y5TB 4ADSA 2CZ5A 4D0CA 4UOJA 3ALGA 4IOFD 3P0YL 1HU8A 3GFXA 5C09A 3ABOA 1TJHL 4FQHA 3QUMB 4YS4A 1UR3M 5EBAA 1G9NL 4Y5VB 1VERA 1SLVA 5EU4A 3PJTA 2OM5A 4U4BA 2BB0A 1R0AL 3FJNA 2VZOA 2YIHA 4UIKL 1TZ8A 1P4LB 5F7AA 5FO7B 4FXGC 1KGUA 3ATFA 4NQDD 4OVVA 4QTIL 3WAKA 3FU7A 3WS3A 4L4MA 4OZIB 4RWYH 1R3IH 2D2GA 3BUTA 2NXZC 4YZFF 2OA9A 4UFIA 2O61A 4RE3A 2OQJA 1XSKA 1QMUA 1YPZB 3GK0A 1MCFA 3UFIA 4ML9A 3SZ6A 3VXQA 1DR9A 2KHAA 4LCCC 3MRJA 4OT1L 3W7PA 3VMNA 5C2CA 5GZOD 3DGRA 2VC2B 4PMOA 3N55A 2BP0A 1L3NA 3P9MA 3QXAA 2YW3A 1J79A 2AGJL 2EE3A 2X1IA 3Q94A 2CO6B 1KCLA 3VRJA 1QTPA 1UKPA 4YBQC 4NUGH 2XI9A 3ZS4A 5PTDA 2LQRA 3RWFB 4Y9AA 5HNTA 1KNOA 3QJRB 1Z3GH 5L6YH 1AG0A 4JO1H 1AGDA 2FEDC 1NC2A 1JZHA 1LDCA 1D5MA 3W82A 4GBXB 5F9OL 3R4IA 4JM4L 2ZONA 2NDFA 3QUYA 3QQ1A 2C1HA 1AI1H 2DEYX 4DF0A 1EC9A 2A3TA 5DGQA 1Q9KB 2VLMD 4N28A 4B5UA 4X6DB 2XYCA 3K30A 4BKNA 3L3GB 4PY8I 3WLSA 3GXIA 4EN2A 1V6VA 2R2HB 5E0CA 4JRYE 3GBNL 4HWEL 4HAKA 5J8LA 4LSQL 1T21B 1N0LB 4IDLA 2ZP8A 4PJCE 3W0WA 2BP3A 2WLIA 3R06A 5IB5B 5GRUH 3IAPA 3LQAC 1T2QL 4QRPB 4IPIA 4TV5A 2PD9A 1ORQB 4HFUH 4RUBA 5IF0B 4QT5A 4F15B 1A3WA 4NO0D 3ILQC 3QUHA 3T44A 4ZXLA 2CZDA 1Z6KA 4O8AA 4BEIA 2EYSB 3MWAA 2CNCA 1LQ0A 1XF4B 3VI3F 3MOQA 1FZMB 4PB9H 3K74B 3U0WH 2VMEA 5I75B 1CL7L 4Q7NA 3DTUB 3GDMA 4Q32A 3UU0A 2A77L 3QDHA 2CBQA 3NDYE 2YSTA 4YOKA 4MWAE 4ZXBB 3ABKB 5C07A 2OWXA 4S1DD 4GAGH 3KPLB 1LOLA 5D9MA 4P23B 3Q2CA 3D0CA 4Y5YC 4ZUTB 2LLLA 3L4WA 5EZIL 3U6XS 5ESAB 2GAZB 2BP5M 3P11L 2OYMA 4UNTA 4NGHL 3SDDB 2UY6B 3S6DA 4AEEA 1I45A 3CFUA 4CSPA 3U7VA 4NIRA 4UIMA 3UZYA 2X4QB 3LHWA 2Q9OA 4QRTA 2J7BA 4CQ9A 1KC7A 1HH9B 4Y4KC 4W81A 5GGTL 1E6QM 2YN3A 2QMKA 2I32A 1M3JA 1DXFA 2WAHA 1HZLA 1J6PA 5DHXB 1NFIA 4L4TB 2J2ZB 4HG4K 4JFXA 4WEEA 4M7SA 4YSSA 4U6HA 3AIQA 1JZ4A 1VFAB 3HFFA 1FWAC 4MD4A 3FFCD 3ERPA 4HIEA 1WIUA 2QVFB 3GMQA 4FFZL 5D7IE 3LSCA 2QXWA 1XWYA 5J7CC 2WNGA 4HCRL 5SWSB 4DK3A 5D4HA 4FI4A 1EFQA 4I9TA 3AUVA 1O95A 5CIPB 1ZHNA 1O6SB 4NAJA 5C08E 4HUVB 4F0MA 3B6SA 1CFVL 4EEEA 3Q45A 3WFCH 4G43A 4B4FA 3EX3A 3E6FB 4DN4L 5TE7H 1JGDA 2AHIA 1S3KL 3CSGA 3WQDA 3DRQB 3UC2A 5IOPA 2B20A 1CENA 2A6DB 5EFDA 2P3ZA 1D3HA 3NJLA 3VE9A 3UXKA 5CSYA 1OVZA 4GIYA 3CWNA 2GJ6D 4HT3A 4JGUA 2OZ0A 4OD3L 5T3XL 5JPNB 3P60A 3QULA 2DL9A 1LQSR 4OGYH 5HGBB 1GKQA 4N4PA 1WYJA 2E27H 1DEEA 1XRFA 3LQAL 2WQSA 1HF6A 4JO3L 3LHVA 4H6KA 3WIHA 2R4SH 5XIMA 1CQYA 3C5SB 5BOFA 5HHOA 4LT7A 3TW7A 4Z7VF 2IXUA 3PUDA 2CLRA 1XX1A 1QR7A 2IH3B 1IXPA 3L9RA 3IMUA 3U83A 4PRDB 1K1DA 1FL3B 2O55A 3MLTB 4OW6A 2AW2A 4LOUC 2ATMA 3BOLA 4P3DB 3V95A 1DVFA 4DNHA 3HB9A 1JPSH 2F19L 4L3CA 2JJVA 2FH6A 3GHSA 2Y5TA 3UBXI 2XM1A 4HA3A 3BXWA 3X2QB 5F9DC 1X7FA 4KTGA 4M8QA 3QUMA 1N6QL 4P4KD 2YAHA 5BO0D 4YSUA 3QW4B 1I82A 4OGXH 2DZWA 3CZKA 3HI6L 2Q8BH 4IK6A 5FUOL 2ED8A 1KPUB 4YC2B 2J7DA 4UFKA 1UWGH 2D22A 3HC2A 1P4LA 4YHGA 5T8GA 4NJJA 5FO7A 3W7OA 3UJIH 5INDB 1MZYA 1IKNC 1NIEA 2V3FA 4WEVX 4YN3A 3VI3B 1HNYA 3GD1C 3VVWA 3WEOA 2PPGA 4OZIA 1DUYB 3DU0A 1U3YA 1EGVA 2FJGB 4AKQA 3O4OC 5GVJA 5DJDB 2O0TA 2HKHL 3UYOD 2QUMA 4EP8C 3BGMB 1QKZH 3IDYC 3W1PA 1YPZA 3EDFA 3QAZB 1DE6A 4NRSA 1SFLA 3PBYA 1WBZB 4AVNA 3WDHA 3NZGA 1F3TA 2KAUC 2IW0A 4PR4A 3OGCB 2V5LA 3OAUL 3DHPA 4X4KA 5HANA 4JFFD 2IADB 4RGMC 2NT0A 4RCAA 2CO6A 4B7LA 5JNYB 4R4ND 5B3NA 3EEZA 1WSST 3ZE0E 1MJ8H 1UTDA 4EKXA 4GYKA 4L9LB 3RWFA 1UGNA 3C2OA 3KBFA 1FIGL 5C0GB 4IIZA 4Z1CA 3GI9L 1G9MC 1RAKA 3D34A 5IQ7L 4RGOL 4GBXA 3ULAB 3NTYA 1PXGA 3DV4B 3N1MC 5EZOL 5JQHC 1CK0H 4IQJA 2X0SA 3LS4H 5DN1A 4TQEL 1Q9KA 1IO4C 2XGIA 4UI2A 4TSAH 3WHE1 1RK0B 4F8OA 4X6DA 5C92A 4PRIE 2FX8L 3L3GA 3UA3A 1T0OA 1BM3L 2R2HA 1OAQH 2X1XR 3NVTA 5AHNA 2VLLB 2RDWA 1QNRA 3GD6A 1T21A 1ADDA 1N0LA 1EWEA 4XAWL 2WLYA 2HEJA 5IB5A 4K7PX 1XWVA 4WHTB 4QRPA 2QUTA 1JGEB 1ORQA 2PB1A 2DSVA 3KWTA 5IF0A 2I60L 3G2GA 4PLJD 4LIQL 1F90H 5FGBA 1IFHL 4U7SA 5I06A 5MI0C 3WIHH 1OIFA 4QRQB 1ICSA 3H2WA 5LYRA 1T2JA 2EYSA 1B0GA 4GISA 3BT2L 4HK0B 5C0EB 1XF4A 5KOMC 43C9B 3W85A 1FZMA 3I6KB 3MJ6A 1P53A 2K7QA 4EDWL 4D9QD 2E6JA 4ZK8A 2CLFA 1AO7E 1O7VA 4LQFL 4Z7VB 5FSDC 1H7RA 2VC9A 2NY0C 2FT6A 2ZVRA 1YAIA 3WSUA 2BNQB 2JJTC 3KPLA 4ZXOA 4H2HA 5EGRA 4XXWC 4P23A 4WGKA 4ZUTA 1ILSA 3W7GA 3QUMH 1S2CA 3C2YA 5ESAA 4QE1A 1PKQB 1XDJA 1F61A 2GAZA 3SDDA 3RYSA 2UY6A 4P5TC 3LBMA 5BU6A 3E49A 2UXGA 2X4QA 5FL1A 4TNGA 4QAIA 3NWRA 1HH9A 2IBZX 4RWYL 4W9ZA 1JN6B 5I6OA 2WO3B 3PQYB 5KBNC 3H4XA 4GOSA 1ZUAX 2IDSA 3T6CA 3ME3A 3MRLB 3RZWA 4L4TA 2J2ZA 3V1PA 4W85A 4HHGA 4ZAKB 5GRVK 4E2DA 5FOJA 5I6LA 1XIEA 1VFAA 5I1IL 3VGBA 4QUOA