4TMCA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588 complexed with p-hydroxybenzaldehyde
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
399
structure length
399
Chain Sequence
b'MSYMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESVAKGYKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old yellow enzyme
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Flavoprotein
total genus 152
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmcA00
3PSWA 2ZFAA 4WD0A 3TFXA 1YYAA 3G1VA 1KM4A 4ZMGA 3E9AA 1GTHA 3EXSA 3IIOA 1WV2A 1O60A 4MZ8A 3UXDA 3GZ3A 1F74A 4OBTA 4BK9A 3KFTA 3W7HA 4QSHA 4IMFA 2CLOA 2NXIA 2YXGA 1DV7A 1X6UA 2YR1A 1QO5A 5BRBA 4Z1AA 4NT0A 4O1DA 1A5SA 3TXVA 1DORA 3W1XA 3FKKA 4JYEA 3PB2A 3UXAA 3DZ1A 2VFGA 4BI7A 3IGXA 3E12A 4ZQOA 1FQ0A 4PCFA 1DVJA 5AC6A 2I9EA 4JTJA 3QSRA 4UFMA 5F4SA 3QC3A 3STFA 5AHMA 4BWLC 3BPWA 4LRTA 1T99A 2NUXA 4UTWA 1GWJA 2E6DA 3UPWA 4RKAA 2NV2A 1Q6RA 4NZJA 2CLFA 5DXXA 4FF7A 3S1XA 3MI3A 1EUNA 5L6UA 5EMUA 3R89A 2A6LA 2F84A 4OT7A 3NA8A 1WBHA 4L4LA 3UWYA 3HJZA 2RHGA 4UTIA 1D9EA 1JJKA 4N6FA 3W6YA 3WJYA 1GQNA 2DJLA 4IX2A 3DHFA 3QJAA 3TQKA 3W2KA 1JR1A 3OVPA 4QNEA 3BLIA 5LKYA 1XC4A 3E0IA 3UY7A 3G1SA 1QWGA 2J24A 1SR9A 2E6AA 2A0NA 2ISSA 1NF0A 1LOLA 3O07A 5D37A 4A29A 3DHDA 3OG3A 3DKLA 4AH7A 1H50A 1KFJA 3PM6A 1SFLA 5I3HA 1I45A 2VFFA 1KV5A 2ZZ1A 2QR6A 1QR7A 1Q3NA 4R33A 4AEOA 4MIMA 4E2DA 1B4EA 2YZRA 3W9ZA 5LNWA 1OK6A 2V82A 4JX4A 4O1CA 2BWGA 4LU0A 1O94A 2TYSA 3GAKA 2VEKA 2FPTA 2PCQA 1VRDA 1I2OA 2OZ0A 1WOAA 1TPC1 1KFBA 2HSAA 3W1MA 1RQEA 1P5BA 3WJZA 3IGUA 2OX1A 3WJSA 4B5NA 1XL9A 1W5QA 3HMJG 3H54A 3MBDA 3G1HA 3MP3A 1LROA 3GNNA 1Z44A 2C13A 1G6CA 4HNNA 4YL2A 3C8FA 1JRBA 5FF0A 3E02A 1CW2A 4XUGA 4JEQA 3DBPA 3I68A 5CG7A 3WK1A 3ZS4A 3P5ZA 2E6YA 4MVAA 5D2XA 1JQVA 3HG3A 4O17A 5LGXA 5AHNA 4ZQNA 5CZSA 2YYUA 1TV8A 2E68A 3W3OA 5HULA 1EWDA 1LP6A 3FYOA 5AHLA 1EPXA 4GJ1A 2GOUA 1VCGA 3N9SA 4JR5A 1VPXA 5CPMA 3MWAA 1FCQA 5G5IA 1UB3A 3T4CA 4EWND 1HFBA 4NZFA 4UNKA 3LV6A 2Y7EA 5U7SA 1FXQA 4GUFA 5HWJA 5K9CA 1YLVA 3TH6A 2VC6A 3UWVA 1LOQA 4UTMA 1Z48A 5I3IA 3CU2A 1K8XA 1AMKA 1R30A 2Y61A 3CPRA 3SY5A 3OBKA 2PE4A 2YPIA 2QJGA 4IMCA 1KLZA 5LHEA 3QMSA 3W7PA 3B0UX 2CLKA 3W7KA 2GQ8A 3DAQA 1JCYA 4IPIA 2WPBA 1QCWA 2OT0A 4DBDA 1UCWA 4Y96A 3SECA 4DF0A 2GJLA 3TXZA 3FIGA 4IPJA 4FNQA 4R53A 3R13A 2J88A 1VZWA 2JGQA 4LWWA 3TK7A 3GDLA 3B05A 3M41A 4WY0A 2QCEA 4LUJA 2HMCA 5G2WA 5AHIA 1QPRA 1TV7A 3MYPA 4ZQCA 5F2MA 5KINA 4OU1A 4IQLA 4RZ6A 5HMSA 3GB6A 3STCA 4K7VA 3L5LA 1H61A 1UBSA 5HR7A 4Z0JA 5I3KA 2ZZ5A 3C2OA 1V5XA 4DEFA 3FKRA 1MZHA 1VYPX 4KFPA 3M1ZA 2R8WA 3W1NA 3IIXA 4JIPA 3NAVA 4P61A 4QNWA 3LCHA 1OYCA 4JNMA 3U8GA 1ZAIA 2Y89A 3L5MA 1TQXA 1JRCA 1CI1A 2QDGA 1QOQA 2J6XA 4DQWA 1QAPA 1LZOA 4XBKA 4E2BA 4WOZA 4AWUA 1KM1A 4MOZA 4LV4A 1KFCA 4M6QA 5CGQA 3THAA 5C55A 3UWWA 1I8JA 5F4XA 3W71A 3JR2A 5KTLA 1SZNA 1AW1A 2G97A 1S3HA 2XN1A 3LTSA 1VJIA 1EEPA 2NX9A 4GNJA 4QJ1A 5T26A 1F6PA 3UYCA 3W86A 1ZHAA 4NXKA 4O13A 2B4GA 5D03A 3EWWA 3G1FA 1H7WA 3LHUA 2NX3A 4GXMA 5I3JA 4WOQA 5HR6A 3C2RA 3THQA 5HUOA 3NM1A 4BI5A 3GXPA 4ZL1A 3HQ1A 3PG9A 4M6VA 3UQNA 1OF8A 2QCNA 2AAMA 1SO5A 4UMAA 2DZUA 2HTMA 4JTKA 2DU2A 3PS7A 1YTDA 4ZZ9A 3EX2A 4JGDA 3ZWSA 5I3GA 1UJPA 5D2VA 3TJXA 2V9DA 4D2JA 1ZJIA 4UTWC 5D02A 3B0VC 2GJNA 5BMWA 3ABSA 1D3HA 2E09A 4H4IA 4IUOA 1OFBA 3TSMA 3BLEA 4TR9A 2Q3OA 2QEZA 2QAFA 3EWZA 5DCEA 4PODA 3U2OA 3G1XA 1VS1A 1G7VA 2ZRXA 2E6FA 2NZLA 1YXDA 4I7UA 3M0ZA 3ABOA 5H2ZA 4NX0A 4FX7A 3W1PA 1NVMA 5FEPA 1HL2A 1KM3A 1OX4A 1FUYA 4UFKA 4TX9A 3NPUA 1GPWA 3W1LA 4Z1DA 2RDUA 3MI6A 1TRDA 1ML1A 3EB2A 5BNKA 4LUIA 1OX6A 3EWBX 4OWGA 3TX9A 3JS3A 3MMTA 3SW6A 1QOPA 1LBLA 3G8RA 3LRKA 2ZTJA 1O4UA 5CSRA 4Y8FA 1GVRA 3M16A 1L6SA 4NNCA 4MY9A 1GVQA 2ALDA 3OEXA 2FLIA 1VYSX 3S42A 5K9DA 2ZTKA 2YGYA 4PFMA 2Z6JA 1GJPA 1TMHA 2WNQA 3UD6A 1WQ5A 3N3MA 1K02A 1X8FA 2YDAA 5U4NA 2QUUA 1KFLA 5LNVA 3M7WA 3UNDA 2DJXA 4N4QA 4LVFA 2DZSA 1FWRA 1SW3A 4CNNA 5J5RA 5DXYA 4DF2A 2NXGA 8TIMA 4N9DA 1WAUA 2WNNA 2Y85A 1O95A 4HPJA 4O57A 3G22A 4I7VA 2Q8ZA 1AK5A 3QQ0A 3C52A 3DI0A 4TMBA 1KW1A 3MJYA 3B8DA 5EL1A 3TFCA 3I7QA 1ICPA 2TSYA 1FWWA 4NJGA 3WJWA 2QCLA 1ZENA 3BGJA 1YPFA 2A85A 3PUDA 3INPA 1YTEA 3FFSA 5EPDA 1TRIA 5FEZA 4ALDA 2CZEA 3W7NA 2EAWA 1BTMA 1UASA 1H7OA 2OMAA 1OFPA 1F2JA 2YFNA 1XDMA 3S5OA 4OQVA 4JTIA 5BW6A 2CU0A 1WOBA 4GE8A 1MEHA 2ZRWA 1YADA 1H63A 1TTIA 4AF0A 4A3UA 1OFOA 1HUVA 1KTCA 3B04A 3S1UA 1SZEA 4JYFA 2DZVA 4PH6A 2X1UA 3G0UA 1ICSA 4Z1CA 1P0NA 3W1TA 3DKJA 1KM6A 3HG5A 2AGKA 5CZ0A 3GNDA 1KM2A 4O10A 3G1AA 2KZHA 3O6CA 1OABA 4EVZA 3F4NA 3B03A 1F5ZA 1SO6A 4MJMA 1VCFA 2A7NA 2CFFA 4ZQMA 3GKFA 4UCGA 1EX5A 4FIQA 1YDVA 2FJKA 4AMAA 1HG3A 1G69A 1NF7A 3Q2DA 2B0MA 4DPPA 4AB4A 1DJNA 1B4KA 3DGRA 4LW7A 1WXJA 1ME9A 2C15A 1G4TA 2WKJA 3W7OA 1A53A 3MHFA 1J2WA 4Y9AA 4XWUA 3B0PA 3CTLA 4RZ4A 4ADSA 1R2RA 4RCXA 5HINA 4LY8A 1EWEA 4UIOA 1TPWA 1RQBA 5AB3A 5AYXA 3L2IA 3QFEA 3STGA 4Z08A 5EKYA 1GVSA 3BG3A 2PC4A 4XQ6A 5D2WA 1DHPA 3MP4A 2QCCA 4ICNA 5FF7A 4L4MA 1RR2A 3L0KA 2JBMA 2CWNA 1OF6A 4A2RA 2NV1A 3IIZA 1LBFA 1SZGA 4JX5A 3KRUA 1N55A 1HTIA 3I6RA 4M7SA 3CEUA 4ORMA 1CX9A 1J5TA 3TC6A 1F6KA 4UUIA 1OJXA 3LCGA 5GVJA 4IXXA 3PG8A 1JCNA 5F4WA 3W7JA 1JULA 3RLUA 1DKWA 1M7PA 2QUTA 2GVJA 3BW4A 4YLWA 2ZA2A 3E96A 3SR7A 2QCHA 4P2VA 4S2CA 4G1KA 3PC0A 1KV8A 3QSTA 1K7XA 1SFJA 3O8AA 2XN0A 3KHJA 4ZQRA 4RLIA 1DOSA 4GUGA 4DF1A 4CCEA 3TMQA 1ZALA 2QKFA 3W1QA 4TMCA 1F76A 2QCGA 4IWWA 4JTLA 3LRMA 2ZZ2A 4DPQA 4YMZA 2A7RA 2Y7GA 1DQWA 3VE7A 2HS6A 5AHFA 1XI3A 2I14A 4KKXA 1NEYA 4ZVJA 4JTUA 2CLLA 1TTPA 3DFOA 2CZ5A 3QPZA 4IMEA 4N02A 4LC8A 3IIVA 1TJPA 1TJRA 2G5WA 4JY9A 4RZ5A 4K8EA 3R5EA 5D32A 1OFDA 3O06A 1JVNA 2CLHA 1FCBA 1OFRA 4FX6M 3PB0A 1C29A 3QW4B 3W2JA 3QQ1A 3BW2A 1TB3A 1ZCOA 2ZRVA 3F03K 3QMRA 1KBIA 2Q8LA 3NDOA 4FXSA 4HHPA 4EIVA 4FNPA 1W8SA 4UTKA 4Z0SA 2NX1A 3PWAA 3BGGA 1M5WA 4UXDA 3W23A 5DN1A 1TTQA 2J9YA 1ZAJA 3HBLA 4WX2A 2AQWA 4IX0A 1W3IA 4LT9A 1PHWA 1PCWA 1VHCA 4CQ8A 1PL9A 1L9WA 3HO8A 4WUIA 3GIYA 3LHVA 1K7FA 2PURA 4GUJA 4BFAA 1R47A 4UTJA 4NJKA 4XTDA 3TSDA 3PBVA 4HN4A 1MEIA 4N9BA 3W7MA 2V0TA 3EEGA 5D05A 2Y63A 4HSNA 4UR8A 5D33A 5K7JA 2FB3A 1W3NA 2TPSA 4CLMA 4U4MA 5CZJA 4DBEA 3GXTA 5FEXA 3GVGA 3LCIA 3GDTA 4H3DA 2BSLA 3E49A 2C18A 2WV8A 2HS8A 1H51A 1XUUA 2QCDA 1VCVA 3NQVA 4JY8A 4ADUA 1LLZA 3TJLA 2V2DA 3SIZA 4KFNA 3W7EA 3CLMA 3C3NA 4PC8A 3BG9A 4FIRA 2P0OA 4JIQA 1XM3A 3C61A 1ONRA 3P74A 5G4EA 2Z6IA 5AOUA 3LTPA 3LLFA 2YYTA 5HQEA 3NQ8A 5EYWA 1RV8A 4RXGA 1H5YA 3O1NA 3UWUA 3NXFA 3QW3A 3KVLA 3NQGA 4NUWA 1J4EA 3RU6A 3S6DA 1TPVA 2B7NA 3EX1A 3GKAA 5IBXA 3DFQA 1H1ZA 2VFIA 4K36A 2ZZ3A 5LNUA 1LBMA 3UY8A 3TU9A 3TW6A 5HUPA 3N2MA 1LRTA 3G0SA 3R2GA 4LC6A 1BWKA 3W7LA 3M5XA 3P84A 3TV8A 4O16A 4LV9A 4I9AA 3ABRA 2XFWA 2NWSA 1C9DA 3LHWA 3HG4A 1QMLA 3N9RA 4S1FA 2YX0A 3ANYA 2RH9A 1H7NA 3P62A 4C1LA 3VKJA 4PA8A 2V2HA 3HPSA 1H7PA 1QPQA 3C6CA 1G4EA 5DBTA 5LZLA 5D2YA 1R2SA 2ZBTA 3PF3A 5AFDA 4LS0A 3C56A 3FEMA 4UC5A 4FXRA 3LXCA 5CSSA 1A50A 4RXFA 1AW2A 3LTYA 1VLWA 1M6JA 2C19A 2Q3RA 3C2FA 4K39A 2WNZA 3S5NA 4Q4KA 4NX5A 3GAYA 1EP1A 5AN7A 3HOJA 5AYZA 1SW7A 2Y6ZA 4O1AA 3EKZA 4R34A 5LHFA 3TSBA 4JTHA 3T44A 4LNYA 5TQLA 1GEQA 5G2IA 3OHIA 3QZEA 1PIIA 3NOEA 3BG5A 1SO4A 3C2VA 2Y62A 1E51A 4MY8A 1W5OA 2ZQ0A 2ATMA 2X16A 3W07A 4X9SA 3F4WA 5KSWA 4JICA 4AAJA 3LERA 4FNRA 1I2QA 4DELA 5FESA 3N19B 3UPBA 4NXSA 1OVDA 1ME7A 4UR7A 5D38A 4FNTA 5D04C 3UWQA 3W72A 3V75A 3M5YA 4TO8A 4RJEA 1PE1A 1A5BA 1MXSA 5G2HA 1GZGA 3EWYA 3JRKA 3T78A 3KXQA 3O16A 3NL6A 2BZNA 2PRHA 4XZ9A 3WFAA 3LX9A 3G1YA 3O6DA 4O0KA 4KFOA 3UZJA 1RZMA 1GYLA 4LOCA 3LLDA 1XBVA 3EXRA 3PBYA 4MYXA 3PULA 3BV4A 4NNAA 2A2IA 4ZQPA 3V1PA 4FB7A 4BR1A 3GR8A 1ALDA 4CCCA 2RDTA 3BW3A 2E5CA 2P10A 4UFIA 2YFOA 3NPVA 3NQCA 4X2RA 2EPHA 4S2BA 2JKPA 1X1OA 4XBSA 2UV8G 2V2CA 3RK8A 2X1SA 3I7SA 1G4PA 3A5VA 2ZZ6A 1K8YA 1XCFA 1WBJA 3N2XA 3P81A 5FF2A 1KLYA 2C16A 4QISA 4MZ1A 1SW0A 4NNBA 3H55A 1LCOA 3L5AA 4O1BA 3TKFA 2GQAA 4JDBA 1BWLA 4O18A 4UTTA 3PY2A 4X22A 2LLEA 3TIMA 3VFLA 2RFGA 1LOSA 4R7JA 5CPOA 2R94A 1GYNA 4O4WA 3P60A 5F1UA 1F73A 3C0JA 1H7RA 1HO1A 4NJIA 2I1OA 2IQTA 5F2LA 2NLIA 4O52A 3KVMA 5H91A 3CIWA 2TMDA 3R8RA 4ORIA 4EF8A 4I7WA 4XKYB 4QIUA 5EA9A 2G96A 3STEA 4O28A 4WY0B 5DY2A 4GC4A 4H6KA 3NL2A 4Q32A 1XUZA 1RPXA 3TDFA 4BF9A 3GYEA 3A24A 2CZFA 2QF7A 3NPXA 5FI8A 1K7EA 1W5PA 3IIPA 4K6AA 1YDNA 1L6YA 2JKEA 3CM4A 2R91A 1P1XA 1AG1O 4GWEA 3S5ZA 2CZDA 3GDMA 3NEVA 1FCVA 3W1AA 2ZRZA 3PR2A 1ICQA 3W2NA 4N2YA 1T96A 3TMLA 4HT3A 5C6MA 2ZYFA 3L67A 2YW4A 1JUBA 2TRSA 1WYIA 3SGUA 4A21A 3MW7A 1GG1A 4QM1A 2WSYA 3CWNA 3WK2A 3WK0A 1L2UA 3W2UA 1JCLA 5AC8A 4KWVA 4AWSA 3USBA 1RVGA 2ZZ7A 4JX6A 1OFEA 5IM51 3G3MA 5IBXC 5ABTA 1LLWA 3CHVA 1IXOA 2FFCA 1EA0A 4UMBA 4MJZA 3P80A 2Y70A 4YCOA 5E0KA 1DJQA 1DQXA 3NZRA 3DFNA 3UWZA 1KTNA 3GDRA 3MUXA 5KITA 4K7YA 3W1UA 2B7OA 4UMCA 3LHZA 1TPDA 4NQ1A 4GUHA 1FDYA 5HWMA 2XN2A 3IRDA 2V8ZA 1SO3A 3LHYA 3TE9A 1QPNA 1SSGA 4AWTA 3HGRA 3CEPA 1GOXA 3O15A 3M6YA 4E38A 3NQ7A 1GTEA 3W7IA 4O50A 1EIXA 5K4XA 3DH7A 1RD5A 2Z1BA 5EBUA 3KVKA 4QQ3A 1OX5A 2WO5A 2QCFA 2QCMA 3LDVA 3N73A 1LRNA 1L6WA 3TCEA 3EXTA 3A5FA 1FBAA 5CZTA 3T7VA 2VEMA 4UFHA 4CNOA 3NG3A 2E1DA 5DELA 1ME8A 3PBWA 3LRLA 3I7RA 3SGZA 3ABQA 2EKCA 3W7GA 3DENA 1IXNA 4NJJA 1GVFA 2GUUA 3D0CA 3SJ3A 1B9BA 3HF3A 3FA5A 3L0NA 1PHQA 3BO9A 1FDJA 1LTDA 3M47A 1F05A 4JTFA 3M5VA 2YCEA 2R14A 2BLEA 1FCUA 3TNOA 1DBTA 1PVNA 3NQDA 5E1QA 4HNTA 1NFBA 5CKSA 3VE9A 4WQ6A 5K3VA 3HGOA 2VFDA 3G8EA 4PL2A 3UZ5A 4EOUA 3LI1A 1K03A 1KM0A 3O63A 1WX0A 3GLCA 3P82A 1YXCA 2A21A 1Q45A 3W70A 3P61A 2FQIA 3NR0A 4JDYA 4OV4A 4ONVA 4MUZA 3TR2A 2A5HA 2V30A 2E5DA 1Y0EA 3EX3A 1D3GA 2CLEA 4JS3A 2ZZ4A 2QJHA 2EHHA 1HO4A 3KVJA 3U6WA 5TIMA 5AYYA 3L0GA 1VH7A 1Q6LA 3O05A 5G4WA 4WJEA 2QJIA 2VFEA 5CPNA 2RDWA 2OCZA 2BTMA 4M6PA 1IIHA 1SZFA 3MI2A 4NVTA 3S5YA 3WK3A 3CB8A 3Q58A 3SFKA 2FB2A 1K3UA 3W74A 3KRSA 5FEWA 2BXVA 7TIMA 1G4SA 2WJZA 1MSSA 1KFKA 1MO0A 2NXHA 2WOQA 4PTNA 4TIMA 2FDSA 2OJPA 3BARA 3LCWA 1KTBA 1JCJA 3BK0A 5SWUA 1GVOA 1XBYA 3W2MA 3OIXA 1Q6OA 4DO6A 1SQ7A 3MHUA 1QDSA 4AF0B 4JD4A 4KWWA 1QO2A 3A21A 2VENA 1JUEA 3B06A 3FS2A 2ISWA 5K2ZA 1I2NA 1I2RA 2NWRA 2P1FA 2E5BA 5LSMA 2EF9A 2H3BA 2O7QA 1N7KA 1S5VA 3W76A 3P7YA 3LXAA 5F2GA 3VCRA 3R12A 1KM5A 1IXQA 4O14A 2QDHA 3NNTA 4UTTC 1PS9A 3KX6A 3TC7A 1MEWA 3LBMA 3NZ1A 2V5LA 3ATYA 3C4UA 4W9TA 1OK4A 5E93A 3ZFHA 4MZYA 4MYAA 5I3FA 5DY3A 1U83A 3LXBA 2H3DA 5BOOA 1YPIA 4UFLA 4WXYA 3A22A 2H90A 2YSWA 3LM7A 5G1TA 4JN6A 3FJLA 5KZEA 1FWNA 1QNVA 1KBJA 4IMDA 3W87A 4A2SA 1SU5A 4J9JA 1W31A 3M43A 1I2PA 1ADOA 5FF4A 2X1RA 1VR6A 3EWUA 4O11A 3KOFA 1K8ZA 1WA3A 2CLIA 4BI6A 4MY1A 3CC1A 3W22A 2CLMA 1NSJA 4IJBA 1QPOA 3L68A 4JTSA 3SSJA 1FY6A 1H1YA 1XXXA 1TIMA 4UTHA 4LVAA 4LVBA 4HNVA 5AC7A 1C8VA 4K38A 4MFEA 3W7CA 4N9EA 3ELFA 4DO4A 2Z2UA 1IGSA 4LS1A 1PCKA 5MHBA 2JKAA 1S5WA 5C54A 2H8ZA 4LVGA 4MKNA 5A8GA 3W7QA 1AW5A 1Z42A 3IVTA 3S9YA 1LM1A 2FTPA 2J9ZA 3G3DA 2C14A 2VFHA 3QEZA 4O0ZA 4UTLA 4YWIA 4MLRA 4U28A 3FJ6A 5KMYA 3DXIA 4MPQA 3QYQA 3W7DA 2VEPA 3NGJA 2NUYA 3NQMA 1SUXA 1W5NA 3Q94A 3PUEA 1B57A 1SPQA 2ATSA 1LRQA 1A5AA 4GRSA 3TQVA 1B3OA 2J27A 5L9FA 3CQ0A 4O12A 2FIQA 3HGJA 1TYGA 3MBFA 1GT8A 3G1DA 2DZWA 2GPTA 5BMXA 4JXCA 3GX9A 3TW7A 5J5DA 3I65A 2DZPA 2ABAA 3NQ6A 3LOTA 2X2GA 1TPH1 1DL3A 4RX0A 1Q6QA 4O54A 2C6QA 5DCBA 1S5TA 5DBUA 4HNUA 3HG2A 5D2TA 5G1YA 3S0CA 2Y88A 4XKYA 3M9YA 4O53A 3P5YA 4AVFA 4DXVA 2DORA 2A1YA 1AL8A 2ZA3A 3NQAA 1FWTA 2GVLA 2W6RA 2ISVA 3NL3A 1LORA 1P0KA 3DI1A 2A6NA 4HKPA 3ZR4A 5CPLA 3T40A 1IF2A 1IIGA 3NM3A 3FYPA 3RF9A 4RK8A 3PSVA 1TPFA 3LCFA 3MP5A 4JYDA 4HSOA 1UUOA 3HPXA 1ZNNA 3QRHA 1VQTA 1FX6A 4IMGA 1EUAA 1W5MA 1AL7A 4LTSA 1X1ZA 3N34A 3RNDA 4K8HA 3M5ZA 3TQ0A 4EF9A 1H62A 5LNRA 2A7PA 2RKXA 1TQJA 2WSRA 3RFAA 4WZHA 3DFTA 3ZWTA 1OG0A 1KA9F 3GDKA 4CQAA 4HIBA 2GQ9A 1TTJA 2WQPA 6TIMA 5DLCA 3N14A 2EGZA 3HIJA 3O6YX 1LYXA 2C1HA 2VXNA 1PV8A 2ZCGA 3W73A 1VYRA 4OHQA 2V81A 1JCXA 2X30A 4NJHA 1V7YA 2FPYA 3QM3A 2Y7DA 4QITA 1RQHA 3L21A 3IEBA 5KZMA 1LDCA 2WSQA 3QF0A 2C3ZA 2W79A 3LBCA 1KFEA 4PL1A 3QH2A 1G7UA 2ZA1A 4WY0F 3SI9A 2B7PA 3TA6A 2ABBA 3SZ8A 3S8HA 1O5XA 1TREA 1W3TA 1H60A 1WDWA 3PAJA 4PEKA 1O5KA 3L65A 3W85A 1W1ZA 4XTIA 1W37A 2VEIA 1I4NA 4BWLA 1YDOA 1TPUA 1OHLA 3QPYA 2QCDB 2H8XA 2VELA 2JGYA 5K9XA 4OGZA 2YW3A 3NO5A 4IXHA 3IVSA 3BVJA 3M44A 3CT7A 3OVQA 2CW6A 3PUOA 4N4PA 1OYBA 3W88A 4MFDA 2DZTA 5C5YA 2ZDRA 2Z0IA 3CWOX 3G0XA 4POCA 4AHOA 3QMTA 4NU7A 3EX4A 2O7SA 3Q37A 2H6RA 3LCXA 3T55A 1ZFJA 1TSIA 1XFBA 4FX8A 3W1RA 3LHTA 4MLJA 3HPZA 2DP3A 4OE7A 5HWNA 1Z41A 1VC4A 4Q33A 3VNDA 5D30A 1BKSA 1OFAA 4TU1A 1T8XA 3AO0A 2X1TA 4JTGA 4E0CA 3WJXA 5FF3A 2OT1A 3K30A 2JK2A 3W2LA 4YCPA 3YPIA 1EP3A 3GXNA 4FHAA 3G18A 5F1VA 2ZRYA 1JUKA 3PVFA 1SSDA 3NVTA 4HPXA 2G95A 3MO7A 1EB3A 4FO4A 1GG0A 4UFJA 4LVDA 1T0OA 4CCDA 4LRSA 5C2XA 5K4ZA 4Y90A 1JCMP 3NYZA 4Y6GA 4K37A 1JQXA 4QAIA 2C0AA 2BX7A 4FNUA 1M7OA 3F1QA 4AHQA 1ZAHA 5KZDA 3TAOA 3HB9A 1OYAA 2DZXA 2VKZG 1R46A 1VLIA 4ML9A 4OV9A 1UUMA 2QAPA 3TAKA 3VI2A 4RV8A 4C1KA 3NQFA 4M5PA 3IGSA 3KAOA 4M7TA 2QUVA 3OVRA 1VHNA 3LGEA 4GFSA 3EX6A 4CQ9A 4WXZA 3P8IA 4AHPA 3NPWA 3W7RA 4O8RA 3LI0A 5D09A 2B7QA 4GBUA 3EWXA 1YXYA 3TROA 3HGSA 3P8JA 2PRLA 1P4CA 1XKYA 1TO3A 4GUIA 1N8FA 5A5WA 3S1WA 2VOMA 3L9CA 4N9CA 5DCDA 3RMJA 4O15A 4O19A 1XBZA 2PRMA 4YXGA 3G24A 4M19A 4UNLA 3BLFA 3W75A 1NAL1 4JTEA 2Y7FA 2NUWA 4X3ZA 5AHEA 2GVGA 3L66A 1BEUA 4ADTA 1ZY9A 3FLUA 5HJLA 5F2IA 1FWSA 1QFEA 4IGHA 3NQEA 3H53A 4IOTA 1TPB1 3IVUA 3MHGA 3NQ2A 3DFPA 1EP2A 1VGAA 3LV5A 2ZRUA 3ATZA 4FNSA 1TCDA 4CNPA 2J9XA 3P67A 1XDLA 3MYOA 4N6EA 1W0MA 1OFQA 1TV5A 3S1VA 3AJXA 3A9IA 3W84A 3GR7A 2V5BA 4RR4A 1YTKA 1IXPA 2D73A 1TPEA 3A23A 1F7BA 3DU0A 4DO5A 1XBXA 3C2EA 3FOKA 3NL5A 4LS2A 4Z1BA 2FPVA 1OX4B 4UTUA 3B4UA 3PBUA 1G67A 3LB0A 1FDZA 5EY5A 1THFD 1U5JA 3OA3A 1X7FA 4AXKA 1H7XA 6ALDA 3CIXA 1A5CA 2W0UA 3TUUA 5LNSA 3KRZA 1W54A 5LGZA 1FXPA 1R2TA 3EKLA 3GK0A 3RLVA 4A22A 2F7FA 3LCLA 3IV3A 2A4AA 5TBOA 4JTTA 5HNRA 4FEZA 4O4VA 1W56A 2E77A 3W83A 3DFSA
chains in the Genus database with same CATH superfamily
1E6XM 3MUIA 3G1VA 1XLCA 4GI9A 3GNXA 2X42A 2YA1A 1UHVA 3IIOA 4MZ8A 3GZ3A 2YA0A 4U33A 3ZO9A 1XIEA 3C2YA 1UBPC 2G8ZA 3AS0A 3AS2A 1UD6A 1JZ4A 2QT3A 4NT0A 2DPEA 5A6SA 4QE1A 1I1XA 1VFLA 2VWSA 3KRBA 1J01A 1XH1A 1J9YA 1O66A 4AZCB 1EC8A 4R9XA 4MWAA 1J93A 3DZ1A 4BI7A 5BOFA 3NYDA 4PCFA 1DVJA 3QSRA 4XZMX 1VEPA 1LT8A 3RPTA 1XWYA 3VYLA 3S1XA 1QI0A 3MI3A 1P0DA 4MKSA 2A6LA 4OT7A 1WBHA 2RHGA 1JJKA 2IKGA 3QN3A 4AZHA 2DIJA 1XLIA 3DHFA 3QJAA 5A8MA 4ATDA 2QDDA 1XC6A 1QWGA 1TZZA 2J24A 3KM8A 3H8AA 2A0NA 1S2CA 1NF0A 4A29A 3DHDA 4AH7A 2A3CA 4DYJA 2RGLA 1SFLA 3K4WA 5I3HA 3FDKA 2QR6A 1EXPA 3BOFA 3W0KA 4R33A 4MIMA 1ZU8A 2D20A 1TUFA 5CC3A 1OK6A 4R3UA 2V82A 2E40A 1BSIA 4LU0A 1O94A 1PWLA 2VEKA 3GM8A 1R87A 1W3JA 2PCQA 1VRDA 1I2OA 1JL8A 1ODUA 1J6OA 2OZ0A 1Z3NA 1TPC1 3VOFA 1VBUA 1KFBA 2EO7A 1V6VA 1WXYA 4B91A 3IGUA 3CQIA 1U5VA 3WJSA 4B5NA 4JPGA 4AC1X 4G7FA 2BY3A 3HMJG 1G01A 2FJUB 4FXFA 2WHKA 2HWGA 1Z44A 2VI0A 3TJIA 3I6EA 3WSUA 4HNNA 4YHGA 2XIIA 4OECA 3E02A 4TVDA 3ARZA 3DBPA 2F61A 2G3NA 3TN6A 2E9MA 6TAAA 1JDFA 3WLRA 4MVAA 3MS8A 5D2XA 1JQVA 3HG3A 4O17A 5AHNA 1EWDA 5AHLA 4GJ1A 1VCGA 1VPXA 1QW8A 5ABHA 4QQUA 4OJYA 1UB3A 3SUVA 1HFBA 4UNKA 5U7SA 4GABA 1YLVA 2V5DA 2X8RA 3UWVA 1Z48A 2WVVA 3NFUA 3KCOA 1F8IA 4LB4A 1K8XA 2V5CA 4JQ1A 4NAFA 3WNLA 3OBKA 2ZUVA 2YPIA 4IMCA 1KLZA 2H9AB 4E6MA 3Q67A 5BRPA 2XGZA 3W7PA 3L4YA 4INFA 2WLYA 2UY2A 4B3ZA 1JZ3A 4A3YA 3CPGA 3R13A 1VZWA 3APGA 3Q65A 4LWWA 3TK7A 3WZ0E 4UZSA 1LF1A 2PD5A 3QZ6A 1X39A 2QCEA 2HMCA 4HCDA 3T2QA 3K1GA 3MCOA 5AHIA 1QPRA 3ABZA 1QPKA 2O4QA 4Y9MA 5F2MA 5KINA 4OU1A 4RZ6A 4TV6A 1ISZA 1FWFC 4DJDC 3GB6A 1UBSA 2Y1HA 4Z0JA 1MQRA 1V5XA 3FKRA 1VYPX 1EYEA 5BWAA 4KFPA 3M1ZA 3SO7A 2Y0FA 3M46A 3WN6A 4QNWA 3RX4A 1TQXA 1JRCA 1CI1A 1JNDA 2YBVA 1QOQA 4B9YA 4DQWA 4Q7IA 4F79A 1XG3A 4R88A 2YCKX 1KFCA 1LQ2A 4M1RA 5C55A 1PAMA 3SRHA 3H70A 4U31A 1S3HA 3BDKA 4GNJA 3UYCA 1F6PA 3WG6A 5D03A 5REQA 3U3HA 1Q66A 3G1FA 1H7WA 4OKDA 3OLIA 4GXMA 5I3JA 4P8WA 5HUOA 2HRWA 1XCXA 1W9XA 1EJXC 2IPJA 4OFCA 4FLSA 4M6VA 3KP0A 1PYMA 3P6LA 2OKTA 3UQNA 4J3SA 4WDUA 4ICCX 2IQDA 2IPWA 3R43A 2BGSA 2OLHA 4JN8A 4JTKA 1AA1B 3RM8A 1JYXA 2XH0A 1YTDA 4ZZ9A 4G8TA 1UJPA 4S23A 1ZJIA 4UTWC 2GJNA 3ABSA 4BF5A 4O1EA 3AUOA 4H4IA 1NELA 1OFBA 2MNRA 3OGRA 1E6NA 3VNZA 4FLRA 5DCEA 1ZP3A 4PODA 3ZIZA 3U2OA 4KS0A 2J13A 2QV4A 3IRSA 3M0ZA 2UWFA 1ZBWA 4A4AA 4B16A 3WLSA 1OX4A 4UFKA 2OWXA 4Z1DA 2FDMA 2RDUA 5BNKA 3BOXA 4LUIA 2IKJA 4N42A 3ANUA 3TX9A 3SW6A 3G8RA 2ZTJA 5CSRA 2YB4A 2WMIB 1WUEA 2PWUA 2A3EA 1VYSX 3S42A 5K9DA 3RM4A 1UWUA 2YGYA 2PTXA 4PFMA 3V36A 3W26A 1HKKA 1I60A 4MNKA 1TMHA 2WNQA 3RUBL 3CQHA 4BKNA 1K02A 2V63A 3CGTA 1KFLA 1KBBA 2DJXA 4GVHA 3TYAA 1YBQA 4LVFA 4D8AA 1KRAC 4I5RA 4QFUA 1Q7QA 4US5D 4N9DA 2WNNA 1J11A 4GI8A 2VGBA 1O7AA 1UR2A 4PMJA 1BTCA 3RX2A 3JW7A 1JPHA 3C0SA 2Q8ZA 3IJ6A 3MDUA 1UC5A 4L9XA 5A3HA 2YL6A 2I16A 1GOQA 3QTGA 1K9FA 3T07A 3PANA 3W02A 3BGJA 4HZ8A 1YPFA 2A85A 5GPRA 1JDAA 4Q4PA 1XIHA 1TRIA 3S2JA 3TC3A 1RLCL 4GO8A 5C2CA 2CZEA 1MWOA 1RUSA 1H7OA 3MMWA 1V6XA 3WFZA 3WEOA 4F9DA 4EPEC 1MEHA 2ZRWA 1YADA 4A3UA 3UA3A 2Y5SA 1IQ8A 3GBDA 4HA3A 4YTQA 1JGMA 4JYFA 2DZVA 3G0UA 4Z1CA 1P0NA 2VZTA 1D7FA 4CVWA 4AWEA 3VDHA 1IR1A 3AZRA 4GQ0A 4IISA 3AC0A 4O10A 1ZSXA 3NZGA 4LCQA 5HANA 4EVZA 5A6KA 4CVUA 1F5ZA 2YBTA 4L4OA 4MJMA 1B1YA 3M0YA 2CFFA 3GKFA 4AX7A 3HFYA 1EX5A 1YDVA 2RAGA 1HG3A 4AW7A 3Q2DA 4DPPA 4AB4A 2GJXA 2IPGA 4Y9OA 4QX4A 3DGRA 1CLKA 4L6OA 3B0YA 3WF4A 2CZVA 3T42A 5EU9A 2C15A 4OUIA 1TKKA 1J2WA 3KOZA 2AL2B 3B0PA 3EYPA 3SAZA 1R2RA 3ZQ9A 4NKCA 1GJUA 5HINA 3GIQA 1TPWA 4HOWA 1E5NA 3SY1A 4NI8A 4DNMA 1FWCC 2PC4A 3ONBA 4EP8C 4IPNB 1JDEA 1D8CA 1EGZA 1WP6A 2VJXA 1RR2A 4J2MA 3EOSA 4W93A 3WQOA 2Y8KA 4J3ZA 5CJNA 1HTIA 4M7SA 1ECEA 3NVDA 5LYRA 3QHOA 3M4HA 2X7WA 4UUIA 3LCGA 1EH9A 4IXXA 4LUTA 3W7JA 1A5UA 4QCFA 5C7HA 1M7PA 4NZ4A 3AUJA 2ZA2A 3SR7A 3CAWA 4P2VA 2J8TA 1KV8A 3WYZA 1K7XA 3AS1A 3O8AA 3ZT7A 5M1TA 1DOSA 3W1QA 3BAIA 2CIPA 2A7RA 1AJ0A 1QW7A 4QLJA 1JGIA 1UZ1A 1SJBA 1RBLA 2VO5A 3SM0A 1V3LA 3DFOA 3FJNA 2OLSA 3WUGA 2GOKA 3WF3A 4LC8A 1TJPA 2G37A 3URQA 3WDQA 1TJRA 3PBMA 2PTZA 2BOEX 3L4WA 4IPLA 1LL6A 1TE6A 5D32A 1OFDA 3CUGA 3O06A 2Z7GA 3SRKA 4V15A 1OFRA 3PB0A 3QW4B 2FGZA 3EWDA 1VRXA 3HA1A 1ZCOA 3TONA 4FS9A 4RW5A 1BLIA 4HZ7A 3ARYA 1FWAC 4IIGA 1JD9A 5HNUA 1EHNA 4FNPA 4C6NA 3PWAA 1MVYA 1PKLA 3WLIA 2OOFA 4L5ZA 1YKWA 5A2AA 4IX0A 4LT9A 2PD9A 2Q01A 4AD5A 1PCWA 5B7YA 4AG0A 6XIAA 2AKZA 1L9WA 3CQJA 1VP5A 1ZRQA 2W66A 2OR2A 2E9BA 4AZGA 3PBVA 1P6CA 4N9BA 2OZ3A 2D24A 5D05A 1UD4A 2Y63A 1W3NA 2TPSA 5HJYA 4DBEA 4HMNA 5FEXA 3GVGA 7PTDA 2DSWA 1C8YA 2BSLA 3E49A 2C18A 1DEDA 2W27A 4ICMA 2WV8A 3WF0A 1H51A 4D6IA 4ADUA 1YX1A 2R1NA 3LPPA 3SIZA 2GDVA 4MUPA 1F8MA 3SCOA 4PC8A 1UH2A 1T8QA 1XM3A 1ONRA 5G4EA 4HNCA 2D23A 5AOUA 3FAWA 3LLFA 4UCFA 3NQ8A 1RV8A 1H5YA 2J74A 3O1NA 3UWUA 3AYVA 4ZXOA 4AIBA 4NL1A 5IBXA 2P88A 1H1ZA 4C1NB 2QJMA 1IEWA 3N2MA 4XSLA 4D8LA 3G0SA 3FA4A 3LA4A 3WF2A 5HPCA 3REQB 1BRLB 2VNCA 2VDIA 3MY9A 3WCZA 1Z7AA 4TVCA 2W3ZA 3COTA 5DQPA 1FWHC 3ANYA 1H7NA 4B2DD 5EMLA 2V2HA 3AFBA 1QPQA 1G4EA 1LL7A 1OZMA 3GO2A 5AZ1A 3UBPC 9XIAA 3SCRA 2YL8A 5DO8A 3HZ3A 6ENLA 3QC0A 1PB0A 4LS0A 3WDJA 1TJ1A 4B5SA 3A3XA 5CSSA 3WNPA 3SUUA 4RXFA 2PU0A 3PNZA 3K8MA 3TYUA 3GDBA 4NX5A 5FSDC 1EP1A 4CQBA 3DG6A 2Y6ZA 1QUMA 4R34A 3T44A 4FOKA 4LNYA 1GEQA 5G2IA 9RUBA 1PIIA 1XX1A 4MWAD 3GY1A 4LNCA 4DZHA 1EA9C 3BURA 2WC3A 1SO4A 3BG5A 3R8GA 5JH1A 5KZ6A 3N11A 1E4MM 2BY2A 4QSFA 1BD0A 2DFAA 2HE5A 2O0TA 4X9SA 2FVMA 4JICA 4AAJA 3UXLA 3BCFA 2OODA 3S2MA 3BANA 2WC7A 2F6XA 4NXSA 1V3KA 1KCXA 1OVDA 4XAGA 2J8FA 2VCCA 4FNTA 3TYDA 3W72A 1F3WA 5D4YA 4D1JA 3M5YA 4J2PA 2OSXA 1MXSA 3EWYA 3GVWA 3JRKA 3H7UA 4PFHA 4XVDA 4QGCA 1QXLA 1OC6A 3G1YA 4HMEA 3BLOA 3UZJA 3UG5A 2G3FA 4F0MA 1CZ1A 2A2IA 4ZQPA 1E9ZB 4W8BA 3UG3A 2Z2AA 3AJ7A 3OIHA 4CCCA 1ALDA 1X38A 3EPOA 2RDTA 3GC5A 2WVTA 3THDA 3VTRA 1S2TA 3FSTA 4UNIA 4AZIA 2E5CA 3CZLA 3NPVA 1F4HA 2Z26A 3LS9A 4AY1A 4IJCA 4IIBA 2EPHA 4XIAA 3UZZA 1P6BA 3CS2A 1R7OA 2V2CA 4G1NA 3K5XA 1TV4A 3RK8A 3I7SA 4XKMA 4Z1YA 3W6LA 1M01A 1K8YA 4AD1A 4DZ5A 4FP1A 3K13A 4DWDA 3W00A 4NNBA 3JU2A 1LCOA 4JDBA 1C92A 1ZJBA 1BWLA 3S9IA 3PY2A 2A79A 3AISA 4HCHA 3MUY1 4NZ5A 4R7JA 2BASA 3GXFA 3B9AA 3CZKA 1HO1A 1E70M 1Q63A 1RY0A 4MPKA 5F2LA 2VTFA 4O52A 5FSEC 3AHYA 3CIWA 2TMDA 1A5OC 1X7IA 1GEHA 3ARRA 1EF3A 1FRBA 4GYJA 5EA9A 2DV0A 3NGFA 1TFVA 2EPOA 3MVTA 4PUNA 4LGXA 3V18A 4GC4A 3VIOA 4W8AA 3ID7A 2F38A 1TUXA 4C5ZA 2PGWA 3GYEA 3A24A 2PDPA 2CZFA 3USZA 5FI8A 1W5PA 3XINA 4HPHA 3WBEA 1UC4A 2I5IA 4LQ1A 1EJWC 3LYEA 3WLQA 3NEVA 2FKPA 1ICQA 2ZX7A 4N2YA 4Q4RA 1NY1A 1VJSA 3ARUA 4JQ2A 3SGUA 4A21A 3MW7A 3VM5A 4ZO8A 3WK0A 3S2NA 1L2UA 4JKMA 4KWVA 5I7GA 1C91A 3UEQA 2VRJA 2BGQA 2ZZ7A 3SN1A 2F2KA 4DBWA 3G3MA 3I3EA 3TYBA 1MYRA 3CHVA 2XWDA 2XFFA 1M53A 1DQXA 1MQPA 1SFTA 3UWZA 4PZVA 4UTFA 4JCLA 5A8QA 1DJIA 2NLYA 1RLDA 3BLKA 4W87A 3TYZA 2QMKA 1PTGA 3V0TA 4L65A 1Y7VA 3UERA 4NILA 3W1UA 2DVTA 2FZ8A 4OBSA 4PBGA 2YDSA 3LHZA 4NQ1A 3N1AA 1XS2A 4GUHA 1FDYA 5KETA 2XN2A 3PJUA 5GNZA 2V8ZA 1UA3A 1ZBCA 2PB1A 1ONWA 3TEVA 3WQFA 2Z1WA 3VA8A 1CTNA 1GYMA 4JAWA 4MG4A 3FGCB 2W91A 3NQ7A 1GTEA 1CEOA 4AQLA 1AODA 1RD5A 4U2YA 3TZFA 1OX5A 3HQNA 2QCMA 3MUAA 3TCEA 1FBAA 5CZTA 3T7VA 3EA1A 2J6VA 3NWRA 4CNOA 3NG3A 2OGJA 5DELA 1EJSC 3PBWA 4ZOAA 5BCAA 2EKCA 4PN2A 3W7GA 3OZOA 3DENA 2VHLA 1GVFA 1VENA 3CYJA 2PLCA 2NQ9A 2JALA 3FA5A 1PHQA 3DYMA 4G7EA 1F05A 4JTFA 2WYSA 3QR1A 3QR3A 4D6EA 3CAQA 3K46A 1E73M 2YCEA 1SMDA 1ZJAA 2BLEA 1VBJA 3U7VA 5E1QA 1KWKA 1IT8A 3T4WA 3UZ5A 5LIKX 3F4DA 3LI1A 4PTWA 3DERA 1E72M 3POHA 3W70A 1IWBA 3P61A 2EG6A 3TR2A 2V30A 1Q2SA 4AU0A 1Y0EA 3E74A 4MDPA 2O9TA 1PDYA 2Q09A 3ARWA 3J7HA 5TIMA 1J12A 3LZ5A 4P8XA 4K2SA 3KZPA 4HK7A 2OCZA 4DUWA 4H2CA 4M6PA 3WK3A 3CB8A 3SFKA 1KKRA 2OYKA 2FB2A 4UOJA 3AHZA 2C79A 3W74A 5CH9A 1QHOA 3DC0A 4KRTA 2WJZA 3BAYA 4Q8QA 3CMFA 4RDYA 2IKIA 4PB3A 4PTNA 1OG6A 3H21A 1OZQA 3RPMA 5LIXX 1ISYA 3SCWA 1XBYA 3UJSA 4BY3A 3QV7A 3AZSA 2P8BA 1JUEA 3CB3A 5K2ZA 5LIWX 2NWRA 5LSMA 2E5BA 4Q4OA 4HYRA 5CEWA 3QFWA 2O7QA 1KO0A 1S5VA 3W76A 1FWIC 5G1MA 4C6DA 5F2GA 3VCRA 1EO7A 2OU4A 1PS9A 3KX6A 3MKCA 2ZUWA 3NZ1A 1SJAA 3OB8A 4S3KA 3V5CA 3XIMA 5I07A 1QK0A 2OPJA 4W9TA 4MYAA 5DY3A 3LPGA 5BOOA 2GDUA 4WXYA 2H90A 2YSWA 2Z25A 3WDRA 2Z4GA 3WD4A 4L61A 1L2QA 5C9RA 1TWDA 3WMSA 4UOZA 4M29A 3W87A 3L2LA 4A2SA 4J9JA 3M43A 1I2PA 1KXTA 4MMWA 2CLIA 3WLHA 3VD7A 3SSJA 2D2HA 2EXOA 3TQPA 4S39A 1TIMA 4REQB 4TQTA 4HNVA 4LVBA 3U2EA 3IK2A 4WKHA 4K38A 4N9EA 4DO4A 4WCJA 1PCKA 1IGWA 6CGTA 1OY0A 1JFHA 1JZ8A 4H8HA 3V1HA 2P5NA 5HJXA 4DWSC 1LM1A 2FTPA 1S2WA 3G3DA 1EEXA 2BHZA 2VFHA 3PNUA 4A8RA 4HA0A 2D69A 4O0ZA 1X1NA 5FJTA 4YWIA 5KMYA 2VEPA 3QQWA 4ZEPA 4KQNA 3VIPA 3KDNA 4E8CA 1B57A 1QNOA 4OBRA 1V77A 3UP8A 4GY0A 1B3OA 3GH4A 3E2SA 2J27A 4DM2A 5L9FA 3HGJA 3NDYA 2XSXA 3OZYA 4FI4A 1OCQA 2QUMA 2X2GA 3IACA 4Z2GA 2QS8A 2DQWA 4O54A 2VC5A 5G1YA 1S2UA 2Z28A 4AVFA 3HU7A 3HN3A 1FWTA 2J25A 2GVLA 2BVYA 1LORA 1OCBA 9CGTA 4XB3A 1W3HA 3ZR4A 3F2CA 4GKTA 3MUZ1 1IE7C 1W2PA 3NM3A 3H2MA 4KH2A 1GORA 1ZNNA 4Q8WA 4LTSA 3N34A 2ZUUA 3GNOA 4AX6A 5HMEA 3CNYA 3TQ0A 2RKXA 1Q6GA 2WSRA 4WZHA 3DFTA 1JYWA 4IF2A 1KA9F 3UCQA 4C6IA 2X2YA 4ZSTA 4CQAA 1TTJA 3ZLHA 5DT7A 1PIFA 2EGZA 3HIJA 1LWHA 3N14A 1LYXA 2VXNA 2VZSA 2ZCGA 4QEHA 4LCRA 3C86A 3APYA 3IK4A 3QM3A 3GU9A 4M51A 3L21A 3KBWA 1V51A 4JFVA 3CZGA 1LDCA 3QF0A 1LJYA 1V08A 2EQDA 2YJQA 3QH2A 4WY0F 2R1KA 4KGLA 2ABBA 1TA3B 1H60A 2WHJA 4A05A 4PEKA 3W85A 3AHXA 1W1ZA 2PWFA 1W37A 4BWLA 1EPVA 5C71A 1OHLA 3QPYA 2ZE3A 2VELA 4OGZA 2YW3A 2ICSA 1T5AA 5I09A 3NO5A 3BVJA 1E4IA 3M44A 3CT7A 1UWQA 1PO9A 4PB5A 2O9PA 3URBA 3OBEA 3VU2A 4Z2IA 1OYBA 2AL2A 5C5YA 3KBSA 4D6DA 2Z0IA 3G0XA 4POCA 4AHOA 4NU7A 1VFOA 1E40A 2H6RA 5LA0A 4DUXA 3OLDA 1F4AA 2YB1A 1ZFJA 1TSIA 1XFBA 3AU2A 4FX8A 5BXRA 4M3PA 4MLJA 2DP3A 1LUCB 5JIWA 3MJMA 3VNDA 2PF0A 4XISA 1KRBC 1OFAA 1T8XA 2OOGA 4MKVA 4E0CA 5FF3A 3STPA 4H83A 3OA5A 1GVEA 3K30A 2OXNA 4LYKA 1UMLA 4FHAA 1Z89A 3CUIA 4W7VA 5IFTA 2CYGA 3NVTA 3E0LA 3B9OA 1EB3A 4A3QA 3C0QA 4X61A 7ENLA 2ZX9A 3KHDA 2E67A 4LVDA 4XK2A 4LRSA 5C2XA 5K4ZA 1O68A 3W53A 4GZJA 4K37A 3QOKA 3TWAA 1FH7A 3AMDA 4QAIA 2C0AA 2BX7A 4ZB5A 2VEFA 4AD0A 1M7OA 3F1QA 4AHQA 1JEZA 1GKQA 1ZAHA 1OYAA 2DZXA 4MB5A 4OV9A 2QAPA 2QNEA 3VI2A 4GG9A 4C1KA 2VC7A 1QK2A 3BGAA 4M7TA 2QUVA 1AH0A 4GYKA 4GFSA 1PZ1A 3HV8A 4L1XA 5DEZA 3CWHA 4DJFC 2B7QA 4Q4MA 3BZJA 7REQA 2BY0A 1EX1A 1XKYA 4C6BA 1W3LA 3WLMA 4GUIA 1N8FA 4AZ7A 2VOMA 3L9CA 3RMJA 1LQ0A 3UZYA 1XBZA 4H7CA 2VRKA 3AIVA 7TAAA 5AVNA 3G24A 3BCDA 4M19A 4HA1A 2WMJA 1K77A 5AHEA 1ZY9A 1R3YA 5F2IA 4PUDA 1XP3A 2P0IA 3H53A 1AFSA 1M41A 3WL1A 4Z2LA 1J10A 3MHGA 5JBDA 3DFPA 1EP2A 3LV5A 4OUEA 3VNYA 2BDQA 3WLJA 3VKCA 5KEZA 2VC9A 2AOSA 4HHLA 3R58A 1TWIA 3FY1A 4P7OA 1OFQA 4O1FA 3AJXA 1MXGA 2YZ5A 1YTKA 1GNXA 5C7VA 2NV9A 1UUQA 1KXVA 1TPEA 4XVEA 3DU0A 2ZC1A 2FPVA 1SJDA 4KGJA 1B9ZA 4WSHA 1A3HA 3SCSA 2XG9A 4GLEA 4E2OA 4GZ7A 3WKZA 4GPNA 6ALDA 4E8DA 3JZUA 1MNSA 1BXCA 2W0UA 5LNSA 4WEVX 1DJHA 5M03A 1U5HA 3EKLA 4E4UA 3PZGA 1VFFA 4LAZA 4M8UA 2F7FA 1UD5A 4CN1A 4CUCA 3OZPA 1L8PA 1H4PA 2E77A 1UH3A 4CD4A 2ZFAA 4WD0A 3HURA 2DY3A 3E9AA 4DI9A 1TVLA 1KQYA 1WV2A 1O60A 1BHGA 2QGHA 3UXDA 1F74A 3GVQA 3KDOA 4C65A 3W7HA 4QSHA 3PP7A 3TZNA 1QRQA 1DV7A 1KNWA 1QO5A 1KRMA 4J3UA 2OZ8A 5AECA 5BRBA 2DVXA 3QXBA 4O1DA 1A5SA 3REQA 3VMOA 1DORA 3B9EA 2QPUA 3M0MA 5C0QA 4C7GA 4PRTA 5CXPA 3UXAA 1BYDA 4QRNA 3VC6A 1UZDA 3EGJA 3E12A 1F3TA 1WDPA 2J78A 3AICA 4UB9A 3BPWA 1B90A 3N04A 3UPWA 4AZ5A 1P0BA 2DH3A 4C7FA 1WZMA 1Q6RA 2V3EA 5DXXA 4FF7A 2J7DA 1I9CB 1TWZA 1EUNA 3N4FA 5L6UA 3FAXA 3GXIA 5C9ZA 4L4LA 3UWYA 3HJZA 4UTIA 1D9EA 3EEZA 3MC5A 2DSZA 1GQNA 4IX2A 5DX7A 5CAHA 1RH9A 1JI1A 3O7UA 3U5UA 3TQKA 3W2KA 1A5MC 1JR1A 2PP1A 2R1MA 1CXIA 3F5JA 3G1SA 3UXIA 4I5UA 5IHSA 3PPHA 1LOLA 3CUHA 3OG3A 2V5KA 5EMKA 1H50A 5ABEA 1I45A 2B81A 3KL3A 1KV5A 3C8NA 4K68A 3W9ZA 5LNWA 3S3GA 3KBNA 2NQZA 2CPUA 1CXEA 3GAKA 3VD4A 2FPTA 3W38A 1DYSA 1WOAA 3BOLA 2HSAA 4GI6A 1HXJA 5BU6A 1XL9A 4LEQA 1A3WA 1ZCCA 3H54A 3G1HA 3AIRA 4LXFA 3CV2A 1G6CA 4B9ZA 2VGGA 3M0KA 1ISXA 4YL2A 3I6TA 3C8FA 1JRBA 4WRHA 5FF0A 4DZIA 1CW2A 3PUGA 3ZS4A 4UQEA 3P5ZA 2BY1A 5A6JA 4XD3A 2VGFA 4QG6A 1E15A 3GUWA 1UP3A 4Z2KA 1TV8A 1UPMB 4Z2HA 2GOUA 5I77A 5ABFB 3MWAA 4EK7A 1B3WA 3I4EA 4AD3A 1XSIA 4J1OA 4XZNX 1FCQA 2X1IA 5G5IA 3R0KA 4V2XA 3KTCA 3CMJA 1XIDA 1UA7A 3LV6A 2HZGA 3OPSA 3VC5A 5A8PA 4LBSA 1L8NA 1RP8A 4FZIA 2E3ZA 5I3IA 1CDGA 1R30A 3CPRA 4YHEA 4KETA 2QJGA 1A3XA 5LHEA 1H3GA 3B0UX 3W7KA 4IPIA 3HFTA 1QCWA 1YRRA 2OT0A 4DBDA 3MSDA 1EBGA 3AIWA 1W1IE 1RALA 3SECA 1FKWA 2WXDM 4FNQA 3IV8A 3PK7A 3GE7A 3SUTA 1CWYA 3QY7A 1C93A 3ITYA 2Z1SA 3H22A 2OLAA 3WBYA 4LUJA 4IQDA 1QWKA 4MSSA 3GTFA 5CC6A 1HZYA 3VDCA 4W89A 3L5LA 4U5IA 1H61A 5HR7A 3M6DA 2ZZ5A 5I3KA 4DEFA 3NSMA 3W1NA 1EZWA 2QZRA 3L4TA 3DFYA 1Q2RA 1W1YA 3EOLA 3U57A 3T0TA 2FMNA 1OYCA 4PRWA 2JEPA 3NXLA 5CAKA 4UOQA 5CGTA 2F6UA 4IP5A 4WOZA 4ZO6A 4ZO7A 4M6QA 4CD7A 4NYYA 2PTWA 1AW1A 4JFWA 2G97A 1VJIA 2NX9A 4QJ1A 3VOJA 4H6EA 2KX9A 2B4GA 3W27A 3LHUA 4HBKA 3UCDA 3KCJA 3H26A 4W85A 4WOQA 5HR6A 3DCPA 3DFHA 4ATWA 1F3EA 1Q8JA 2D2GA 4JCMA 1V79A 4NAEB 1TV3A 2QCNA 2IXUA 2DZUA 3TP4A 4PYSA 2I17A 1U2YA 1DXFA 1OBAA 1UIPA 3F2DA 3BCJA 3PS7A 2HCVA 3EX2A 1V0NA 3AHTA 2WHLA 2WNWA 4D2JA 2GYIA 4AIOA 2E09A 4IUOA 2Y24A 2XISA 1GOWA 3BLEA 1KRCC 2WW5A 4PMNA 2Q3OA 3HMCA 3FGCA 3VKAA 2QEZA 4ZSUA 1E3ZA 4GXPA 1VS1A 3T6CA 1US2A 1G7VA 3SDOA 1YXDA 1PJ9A 4KIEA 3TCSA 4PUJA 1FWEC 4FX7A 3W1PA 2BS9A 4UBPC 2E1WA 4PR4A 3EZ4A 1FUYA 4TX9A 5FOOA 1GPWA 4FA3A 5B7ZA 3MI6A 4OWGA 1QOPA 3GVRA 3THUA 1LBLA 1XV8A 3LRKA 1VBHA 4Y8FA 1W9PA 4NF7A 3URAA 4MY9A 4PUEA 2XH4A 3IANA 4NRSA 4B5TA 5FJJA 2FLIA 1T40A 2BOGX 5I0DA 2G4FA 4YTRA 2ZTKA 3SUSA 3W4RA 1W1TA 8CGTA 1GJPA 3UD6A 1X8FA 2YDAA 4NG3A 4P7QA 4N4QA 2YBUA 1ADDA 3TN4A 4CNNA 5DXYA 4DF2A 2NXGA 3TWBA 1U1JA 8TIMA 1WAUA 2XINA 2Y85A 1A5KC 1O95A 4HPJA 3ALGA 4O57A 3VNKA 1OM0A 4IIEA 4DXXA 4HMDA 3QQ0A 3C52A 4H8VA 3DI0A 2RJGA 1KW1A 1LLOA 3WMBA 4C6KA 1KC7A 4TTGA 1ICPA 1YHTA 4NJGA 1ZENA 4BQ2A 3MVIA 3PUDA 1YTEA 5EPDA 4M6UA 2J62A 3W7NA 2EAWA 3ZJ8A 2OMAA 5JIPA 3VKDA 2BXZA 1E1FA 1MXDA 3S5OA 2QXWA 4JTIA 2CU0A 3BJTA 2PPGA 2HPIA 3B04A 4FSAA 4AZ6A 3KBVA 4H9UA 1E4NA 1MW1A 1ICSA 1GPFA 3NTYA 1K70A 3DKJA 2POTA 3HG5A 3ARXA 4OOUA 4LF1A 5CZ0A 2NVCA 4GJIA 2NW0A 3A4JA 4H04A 2KZHA 3EDDA 4C6FA 2GGHA 3ITVA 3I3DA 1FTXA 1XRFA 1SO6A 1VCFA 4ZQMA 1P6WA 3PZOA 3K8LA 2B0MA 4C5YA 4A8NA 1H49A 4HZMA 4Q6JA 4IL2A 1G4TA 3RLGA 2EPMX 1E71M 4Y9AA 4XWUA 3AAMA 3CTLA 4ADSA 2WCAA 3BV7A 1IT0A 4LY8A 4UIOA 3R25A 3QFEA 1NJJA 3ARSA 5C9XA 2J4GA 4GY1A 3BG3A 1RXOB 1DJGA 3AIBA 2PUZA 3IJLA 5D2WA 4OTKA 4P7LA 3VCCA 3ZLFA 5FF7A 3Q45A 2BFGA 3RPDA 4FXJA 1OF6A 2NV1A 1E0XA 1WUFA 1SZGA 4NSBA 4EANA 1N55A 3KWSA 5EB8A 4FLQA 3CEUA 1V02E 4GMEA 4L1WA 1WZAA 4D71A 4XZWA 2FFIA 1XGZA 2PGEA 1E9IA 1AQ0A 3WH6A 3PG8A 1JCNA 5F4WA 1R3QA 1DIDA 1DKWA 3KOYA 2QUTA 4YLWA 3E96A 2O9OA 4S2CA 3PC0A 3QSTA 1GZJA 2XN0A 3DYPA 1TMQA 1WDSA 3D5HA 4ZQRA 4RLIA 1RK6A 2JFEX 3VIHA 3TMQA 5CPSA 4PMVA 1F76A 3PZMA 3QV9A 1V3MA 4DPQA 4YMZA 2Y7GA 1KFWA 2GZXA 4Y9NA 4ZVJA 1OT1A 4JN7A 3ZSSA 4IMEA 1TWWA 2SFPA 4MADA 3IIVA 2G5WA 1GOIA 4K8EA 1XW8A 4ATLA 4DUOA 3AHVA 1JZ2A 1JVNA 4DWSB 1E6PA 2CLHA 4FX6M 3IAQA 3DG7A 1GVIA 4ERGA 4N0RA 3ISIX 3F03K 3OG2A 1R9ZA 3TYCA 1QU4A 1KBIA 4HHPA 3BJSA 1QBAA 1FA2A 3LMYA 1UR4A 3MZNA 2NX1A 3BGGA 3WQ6A 5LXXA 5DN1A 2Y8VA 1ZAJA 3HBLA 2W62A 4RNFA 1CXFA 1W3IA 4B3KA 1VHCA 3QOMA 2QDEA 2QIWA 5ECVA 4MWAE 1PL9A 2Y8UA 3HO8A 2Z1XA 4WUIA 2B31A 2FZDA 1P1MA 3AWOA 4AD4A 4UTJA 5FA5A 4KF1A 3TSDA 3FXGA 3N2OA 3EEGA 8XIMA 4QTGA 5D33A 3NDZA 5K7JA 2FB3A 1TA3A 4U4MA 4C6QA 1E4LA 1UWAA 1PIGA 4LYPA 4F0LA 4ROPA 3GDTA 4H3DA 5D9MA 2PZNA 1SGJA 2J66A 1W1VA 2DT3A 3NQVA 3TJLA 2V2DA 5I79A 4KFNA 3O9NA 4Q7NA 4FIRA 4JIQA 3P74A 2OZTA 3LTPA 1RJQA 1ODZA 5HQEA 1TCMA 5EYWA 2GFTA 1O12A 1QNSA 2X41A 2Z1VA 3NQGA 4NUWA 1J4EA 3S6DA 2NT0A 3TTYA 5EMMA 1W9DM 2IS7A 4CEUC 4TOQA 3BLLA 4UQAA 4F4RA 2Z00A 4LC6A 1FKXA 2INEA 1G9HA 1XYBA 3TV8A 1XLJA 4GO9A 1HIZA 4LV9A 4I9AA 3SSZA 2UY5A 3IUHA 2JQXA 2XFWA 3IWPA 4D1IA 3GWQA 1E6QM 4Q7BA 3H2NA 2YX0A 4XAYA 3WNOA 2AQVA 3P62A 1B3XA 4AEEA 2CITA 4C1LA 3HPSA 5DBTA 2WBGA 5HATA 5D2YA 1R2SA 4YJ5A 3PF3A 3H6OA 5GNXA 3SN4A 3SCVA 1V93A 3C56A 3FEMA 3WIJA 4B92A 4Q8PA 4UC5A 1XJBA 5AY7A 2ZVIA 1WXZA 3FHAA 1VLWA 4HHMA 2HBXA 3VZYA 4EXQA 4Q4KA 3OQEA 5A69A 5AYZA 4CGTA 4O1AA 3EKZA 2FTYA 4FOUA 3B4YA 3WMCA 1E1CB 1QW9A 1R3SA 3LLXA 3UJFA 3E2QA 4PMRA 3ARPA 3ITGA 2Y62A 3R11A 4MY8A 1VB9A 1W5OA 3PTMA 1GHSA 2ZQ0A 3QY8A 2OQYA 3KE0A 2JF7A 1VFUA 4JQAA 4GIRA 4XZBA 3F4WA 4IFKB 2QQ6A 4B4HA 4E8GA 1B31A 2L5HA 3UPBA 3E6EA 1C7SA 3VGEA 3RXZA 1QASA 3T78A 4WSKA 4IG2B 1M9HA 3KOXA 3KXQA 1O5QA 1U30A 3EPNA 5H8UA 5RUBA 4XZ9A 3WFAA 3LX9A 3O6DA 4QE5A 2ACUA 3ZOAA 4M24A 1NOUA 3LLDA 2XIQA 4JTRA 4WJ8A 4ECLA 5JU6A 1XBVA 3PBYA 5LA1A 4MYXA 3BV4A 2NVAA 3MSYA 3SQSA 2E9LA 4GFIA 3POCA 3CAKA 4OIFA 1F61A 4J5NA 2YFOA 2BNJA 1J0JA 3CQKA 4WLCA 1XLAA 4R9OA 2X1SA 1VD6A 2KAUC 1NOWA 5AYIA 1XCFA 3N2XA 3RCMA 3PJTA 2DSKA 4IGMA 2C16A 2BOFX 4QISA 1B3ZA 1XYFA 3H55A 3OP2A 4KMQA 4WSJA 1EYWA 3VFLA 1LOSA 3PZ9A 3T08A 5CJ5A 4AIUA 1RA0A 2I1OA 2IQTA 2NLIA 4ACYA 5DMYA 2Q71A 3UNTA 2UBPC 1ZTVA 4EAYA 5H91A 4ORIA 1IZKA 4QHRA 4EF8A 4DIAA 5BYWA 4XKYB 1ESWA 5HNTA 5I00A 5IDZA 3BICA 4B3LA 4TTUA 4ZO9A 4WY0B 3N13A 3VK5A 4H6KA 3W24A 5AC5A 4S38A 4HYVA 3TDFA 4LH8A 6A3HA 2OELA 4I3GA 1YDNA 3PZNA 2E0PA 2G0WA 3JVAA 4DBUA 4JHZA 3TTQA 3MMUA 1JYNA 3WH7A 2CZDA 3GDMA 4CNTA 2ZRZA 1HGWA 2OYLA 2DGAA 5C6MA 3ABXA 2YW4A 2TRSA 1WYIA 4QM1A 3WK2A 3W2UA 1JCLA 5AC8A 3E0FA 1C90A 3USBA 5IBXC 4LUSA 2XSBA 4W8LA 1EA0A 2Y70A 1XH2A 2HJPA 2FYMA 2ISDA 1LG2A 3DFNA 1KTNA 1KB3A 1X8CA 2QPXA 1SM9A 2BB0A 4HPNA 5KITA 1GKPA 2CNCA 4BQ3A 1OT2A 4K7YA 3KOWA 2V67A 1V02A 2V6AA 3EOOA 4UMCA 5CSYA 3L4VA 3VOHA 1TPDA 1RCQA 2OEMA 5HDRA 3IJIA 3E2RA 3QHMA 3LHYA 3UETA 1QPNA 1SZRA 2AMXA 3CEPA 4IIDA 3O15A 4E38A 3VNMA 4WHBA 1R85A 4IM4A 4O50A 5CC5A 5K4XA 1FHLA 4US6A 1QT1A 3KVKA 4Z42C 2WO5A 2QCFA 2CEQA 1I1WA 1Q4NX 3B8WA 2WVUA 3A5FA 3V5FA 5E70A 2AQOA 3ABQA 3SGZA 3T9PA 4X9YA 1HKVA 4C6LA 2WCSA 4L1GA 5ABFA 3D47A 1H0GA 4DJEA 1B9BA 3HF3A 3L0NA 1CXLA 1Z69A 2WKGA 4BZYA 2WMKA 2HE8A 2CESA 2ZWYA 3NO3A 1DBTA 2ZDSA 1PVNA 5EGRA 4L4PA 2ZE0A 4HNTA 3VE9A 1GQIA 2VFDA 4NIRA 3G8EA 4EOUA 1UIOA 2D3LA 4H1ZA 3OVGA 3GLCA 2A21A 2EPNA 1Q45A 3QZAA 2FZ9A 3QGAC 3NR0A 4OV4A 4QEEA 1BG9A 2VZUA 2WK2A 4DX3A 2E5DA 4LBUA 1TVPA 3CZJA 2QJHA 2EHHA 3KVJA 3U6WA 4PBEA 4GKLA 3O05A 5G4WA 2XM2A 3PPFA 4WJEA 1XLGA 4JL1A 3MI2A 4NVTA 1PYFA 3Q58A 4LY4A 4NP7A 5DMNA 5C2GA 5AKQA 2OTDA 5FEWA 2BXYA 2BXVA 1QI4A 1EGVA 2YL9A 7TIMA 4L9ZA 4XZLX 3IJ7A 1MO0A 2NXHA 2WOQA 1CENA 3TLQA 1V3JA 3HM7A 2OJPA 3BARA 4Y7EA 2RJHA 1JCJA 3W2MA 1Q6OA 3KS5A 4JD4A 3FS2A 4WF7A 2P1FA 3VUSA 3UU0A 2H3BA 5AYBA 5I2UA 4ROQA 3SQLA 2CC0A 1KM5A 1IXQA 2QDHA 2O4MA 3NSNA 4NYUA 3GU1A 3HTWA 1LL4A 1PDZA 5LXEA 1N8IA 4CCZA 3C4UA 2ODOA 1OK4A 5E93A 3ZFHA 2VQTA 1UZHA 4KWSA 1YMYA 2H3DA 5MF5A 1YPXA 3CV1A 2P3EA 4DAFA 1R6WA 1CLVA 2PGRA 3FA3A 4UQBA 3ANVA 3IJ9A 3GFYA 2IMRA 3LM7A 1KBJA 1ZJHA 1XH0A 2W63A 5CLTA 2ISFA 1W31A 1D3CA 1ADOA 3EWUA 4O11A 2P3ZA 3ZLGA 1WA3A 3CC1A 3W22A 2CLMA 3GZAA 3H2CA 1IWPA 3K1DA 1XIGA 1FY6A 1BXBA 1H1YA 1I0DA 4JEJA 1Q6CA 2GK1B 3GR4A 4J3TA 3MUCA 1IGSA 5CGMA 3DN5A 1J6PA 6PTDA 1S5WA 4D6FA 1XG4A 4LVGA 3W7QA 1AW5A 4A8LA 4X60A 5EBAA 3CUJA 3PPCA 2ZKMX 5CZKA 3U0HA 2XGIA 1CGYA 1JPDX 4GD0A 3QEZA 1A47A 4DJDD 3F7JA 4U28A 1A4LA 3ONCA 1DXIA 1SUXA 3Q94A 3PUEA 4E2VA 1A5AA 4GRSA 4IGNA 3CQ0A 3RCYA 4XAZA 2C91A 1GT8A 1UKOA 4UQCA 3GX9A 4E4PA 2DZPA 2HVMA 1HP5A 5DCBA 1AQHA 4HNUA 1ISVA 2Y88A 2I5QA 2YDQA 4O53A 3VD3A 4QROA 3UG4A 3N2BA 3ES8A 3A12A 3RO6A 2OQHA 2ISVA 4J27A 2E4TA 1P0KA 2REQA 2A6NA 4HKPA 2ZICA 3RF9A 4ZOCA 1TPFA 2J79A 1S39A 4JYDA 2PDIA 3VCNA 3HPXA 1VQTA 4IMGA 3M5ZA 2G50A 1I75A 2CLPA 4QCEA 5IOBA 1H62A 5LNRA 3RFAA 7A3HA 5DMMA 3LENA 4I90A 3ZWTA 1OG0A 2XH2A 2J75A 5DLCA 4PCNA 2ZX6A 3EMQA 5JUVA 2C1HA 3W73A 4OHQA 5H6HA 1D8WA 3KTXA 2X30A 5M17A 2PLMA 3H7RA 1PX3A 3IEBA 5KZMA 1PXGA 1EDGA 2W79A 1KFEA 4Q8MA 4I6KA 1G7UA 2ZA1A 2B7PA 3KEHA 3CASA 3S8HA 1TREA 2PLJA 3PAJA 3PFMA 4JNYA 3L65A 3O3RA 4S3BA 4XTIA 2EBNA 5IHRA 3AYRA 4P7RA 4H01A 2NSOA 4FAMA 1YDOA 3BLPX 1TPUA 4RDWA 2QCDB 1NWUA 2WSPA 3L23A 4ZB0A 5K9XA 1GKRA 4ZOEA 2ZUSA 3BTNA 4H7ZA 1Q85A 4MFDA 2ZDRA 3QLLA 4AC7C 1V3HA 3DIPA 3ICJA 1XIBA 2NQLA 3EX4A 2O7SA 1YNYA 3RMEA 3MKKA 6REQB 1HL9A 2WVVB 3O2LA 3WUFA 3D6NA 1MW2A 1XPGA 2IPFA 4NAFB 2NVDA 1HW6A 4QS6A 3PZUA 3LQLA 5GJNA 2OEKA 5D30A 3WJXA 3BMVA 2W61A 1N82A 3W2LA 3G18A 2XDFA 5F1VA 2ZRYA 3MWCA 4GQRA 8RUCA 1BVNP 5FAGA 3BSHA 1T0OA 2C71A 3MZ2A 1JCMP 3NYZA 4Y6GA 3OTRA 2Z2BA 4QAWA 3BL3A 2GUBA 1CGUA 1BFNA 4XG1A 1YIXA 4JTAA 4JHOA 1UP0A 1O6IA 1XIJA 3LPFA 3PZTA 2VKZG 1R46A 1VLIA 3QPEA 4M82A 2QJNA 4ML9A 3TYEA 4L6HA 3E38A 4RV8A 3WNMA 2WHMA 1P0EA 3KAOA 3UW6A 3BAJA 4BCEA 3EA2A 3LGEA 3EX6A 3P8IA 4AHPA 3P2VA 1TELA 4O8RA 5JQ9A 4UWMA 1JD7A 4Q8VA 2GDQA 1E6ZA 4BQ5A 1F9CA 1TO3A 1MUMA 4FR1A 1KGUA 5A5WA 4N9CA 2PF8A 4YN5A 5CJMA 2OKOA 1X6LA 3C0LA 1NAL1 4ES4A 3UR8A 2Y7FA 3CZEA 1GW9A 4R5EA 2FZNA 3S1GA 3SCUA 4ADTA 5HJLA 3FLUA 4IIFA 1GOMA 1ZS2A 1XFCA 2PBGA 1IEQA 1J96A 4FNSA 3ATZA 2IKHA 2VURA 1E3XA 1EKOA 1TCDA 2C7FA 3LN3A 4KRUA 4RE4A 1XDLA 2CERA 4YVVA 1VFHA 4ACZB 4ZE5A 1WKEA 4N6EA 1W0MA 4PTDA 4YS1A 5DF0A 3W84A 4LYRA 5CG0A 2Y4SA 4F0RA 1XBXA 3TOYA 2DEPA 4Z1BA 1OX4B 3B4UA 2GLKA 3LB0A 1ITQA 2QPSA 4L56A 1U5JA 3GVVA 4ZGYA 1SJCA 3CIXA 2ZXAA 1A5CA 3TUUA 3GNRA 3U5YA 3CTTA 1FXPA 1R2TA 5TBOA 1O1HA 3AI0A 4FEZA 1XYCA 2PBOA 4O18A 3DFSA 3HPFA 1BKHA 1YYAA 1KM4A 2A3LA 4ZMGA 3BUVA 3FHQA 4JQ4A 4EPBC 3KFTA 4IP4A 4GOAA 4IMFA 2CLOA 1Q4WA 2YXGA 3BSGA 4MB3A 4Z1AA 2DH2A 3TXVA 4EPKA 3ZM8A 3FKKA 3QV8A 4JYEA 2BV9A 4W5UA 1UPPA 4ZQOA 5AC6A 4LPCA 2I56A 2I9EA 3I10A 1XLLA 4JTJA 3QC3A 4PCPA 4JFTA 4BWLC 2VX7A 4AYGA 4LRTA 4HNLA 1GWJA 1Q7MA 2E6DA 3L4ZA 2X40A 3KLLA 1HJSA 1HKIA 2XGBA 3LSBA 3R89A 1DHKA 2F84A 1A0DA 4WKAA 4A6GA 4A8IA 3LMZA 4N6FA 3W6YA 3WJYA 1PZ2A 2DJLA 4PUKA 3B8IA 1FWDC 3OVPA 1XDJA 4DY1A 3BLIA 2G3MA 3KUMA 4JOMA 4JFUA 3UY7A 1SR9A 4MAVA 4BA0A 2E6AA 2ISSA 1CB2A 2WC4A 4PRRA 2D2OA 2W5FA 3DKLA 3UG8A 3PM6A 4PMXA 1ITUA 3WNNA 1EO5A 2VFFA 1UW9A 4UR9A 1EQCA 4AEOA 4E2DA 3NJ3A 1B4EA 2WM1A 2YZRA 3VOCA 1S2VA 1BGGA 1HP4A 3WDPP 3ARTA 4O1CA 2HXTA 1BVZA 2TYSA 3ARVA 3K8KA 4B4FA 3N25A 2G4JA 3A47A 3W1MA 2ALRA 4PSRA 1R9YA 3WJZA 1UWTA 4F2TA 5FJOA 3GSMA 4DNHA 1JF5A 3NURA 1TJ2A 1DE5A 4HCLA 4XUGA 3ERPA 5DMLA 3I68A 1Z9AA 3R10A 1OCJA 1NDYA 2E6YA 3AIQA 4V1XA 5LGXA 4ZQNA 2E68A 3W3OA 2XIBA 5FJRA 1LP6A 3FYOA 4QDPA 1EPXA 3N9SA 4JR5A 5FACA 5CPMA 1MMFA 3E5PA 4K3ZA 3EKGA 4PGLA 1W17A 1MW3A 3EMCA 3GU2A 1QI2A 1VEMA 1BGAA 4GBDA 2TODA 1B3YA 4NZFA 3GIPA 4AUBA 1FXQA 3OQ8A 5HWJA 4LUTB 3TH6A 4JIIX 1YE6A 2VC6A 1LOQA 3OHMB 4UTMA 1U1UA 4G5DA 2YCLA 4Y9PA 1SYTA 3DEQA 3SY5A 3S6OA 2PE4A 3FJ4A 1AUSL 2PLKA 2GQ8A 3GTNA 4HHHA 1JCYA 2R1PA 1DWGM 1S46A 3VNIA 2GJLA 3TXZA 1VKFA 3FIGA 4IPJA 4IQJA 3V7PA 5E6YA 1DP0A 2J88A 3DHUA 4YWSA 5B80A 4M56A 2NT1A 3B05A 3T05A 3M41A 4WY0A 1XD1A 1L6FA 2JIWA 2XH7A 4DJED 4DZAA 5AZ0A 5G2WA 2V3FA 4RNHA 1TV7A 3MYPA 4ZQCA 3OLEA 3M07A 4IQLA 5HMSA 2QF8A 1CXHA 2OGYA 1ECQA 4K7VA 4QS5A 3F5LA 4B5UA 3ZT6A 2DUZA 3C2OA 1MZHA 2J77A 3IIXA 4MJ4A 2FHBA 4PCTA 4ERIA 4XV0A 4F0HA 4P61A 1S38A 2XWEA 1TZ9A 3U8GA 3L5MA 3RILA 2FGBA 3IARA 3T81A 1NQKA 1LZOA 4E2BA 4AWUA 1KM1A 4MOZA 3TVAA 4LV4A 5A2BA 3UWWA 4KESA 1I8JA 5F4XA 3W71A 1CGXA 3JR2A 5KTLA 1SZNA 2XN1A 3LTSA 2ASHA 4MB1A 1EEPA 5T26A 1G94A 3P3BA 4CU8A 1UQZA 4O13A 1ZLPA 4DB7A 3EWWA 2NX3A 4WVXA 1GCYA 3AXKA 3C2RA 3ZVHA 3THQA 1LQAA 3IAPA 3NM1A 4BI5A 4ZL1A 3HQ1A 4H6QA 2J7HA 4RE3A 2GL5A 3PG9A 2DIKA 4HN8A 2ZUMA 1OF8A 2AAMA 4QG9A 4CKQA 1IZJA 2HTMA 3U7BA 2ACQA 2PI6A 2WWDA 4JGDA 3ZWSA 3GTHA 5D2VA 5GNYA 3LGGA 3CL7A 5D02A 2VP8A 1D3HA 5A8OA 8A3HA 2AGTA 3TSMA 3CK5A 4A35A 3JUGA 1XLKA 4W5ZA 3EWZA 4NRRA 1EOMA 1GUVA 2E6FA 2ZRXA 1T6MA 4I7UA 3CUXA 5HXMA 2OSWA 3SADA 5H2ZA 1TJ0A 2J8GA 4KCWA 1KM3A 3MTWA 3TNBA 3W1LA 1TRDA 3EB2A 3WUEA 1NWRA 3WELA 3EWBX 1KQZA 3JS3A 3MMTA 1SR0A 5IRPA 2UZ9A 4M0XA 1RPKA 1GVRA 3M16A 4C6EA 2ALDA 4JQ3A 3OEXA 3UJEA 3V0UA 2GGJA 1PKYA 1EDTA 4LSBA 1OEPA 4LEFA 2Z6JA 3EB3A 1WQ5A 4AXNA 5U4NA 2QUUA 4IL0A 5LNVA 1WNOA 7CGTA 3M7WA 2GVYA 2XVNA 2QJJA 5J5RA 1FWRA 1SW3A 5FCZA 3RHGA 1JF6A 4HK6A 1DJYA 5CCZA 3BH4A 2OO6A 4AZCA 1XGDA 1AK5A 1CIUA 4Q4SA 4O8AA 1MQQA 3NUKA 3TW9A 4HB7A 3MB9A 3MJYA 2NQJA 3B8DA 5EL1A 5M3WA 3LG3A 1FWWA 2XZ9A 3WJWA 2QCLA 4GX9A 1GOOA 4MAZA 3INPA 3RITA 3FFSA 4CQDA 5FEZA 1EJ7L 1GJWA 3OOQA 1YDYA 2WZEA 2D0FA 2DQXA 3G5EA 1BTMA 2QLYA 5HMFA 1F2JA 4L80A 2YFNA 1QTWA 3W82A 3CO4A 1XDMA 5EFFA 4OQVA 3IJQA 1JYVA 4X63A 2Z24A 1WOBA 4V1YA 1DXEA 2IXVA 1H63A 3WQCA 3F4CA 3PZQA 1HUVA 1C9WA 1KTCA 4GXWA 1SZEA 4X2PA 5H1WA 1LWIA 3W1TA 4BS0A 1KM6A 4RDVA 2AGKA 2PDJA 1J0YA 4JFSA 2PP3A 4LBRA 5FJPA 3KWXA 4KIRA 2Y2WA 1DE6A 3O6CA 3F4NA 3NEHA 3B03A 2PU1A 4H41A 3OO2A 3R8HA 1H5VA 4GIYA 3SB0A 2XYLA 2J47A 2F9RA 1NF7A 1DJNA 5JBEA 4LW7A 2VCBA 5ECUA 3OW1A 4DBSA 2HK1A 3TOPA 1V4YA 2DT1A 1S5MA 4RCXA 1RQBA 5AB3A 1ITCA 1U1HA 3L2IA 3RLHA 1K9TA 4Z08A 4U3CA 5EKYA 1KR0A 2X7VA 1IR2A 2JF6A 2PDXA 4XQ6A 3WBXA 4GYPA 3UESA 4ICNA 3L0KA 2JBMA 5E6ZA 1QI5A 3IIZA 2VYOA 1C8XA 3I6RA 4JHMA 2QW5A 1J5TA 3FVMA 1JZ7A 2C8NA 1UD2A 1C3FA 1QJWA 1PSCA 1AZ2A 3RN6A 1OINA 5A8NA 3BW4A 2GVJA 3TN3A 2VZVA 2FHFA 1T41A 4G1KA 3SN0A 1SFJA 1B5TA 2CETA 4PCSA 2ZX5A 2H9AA 4GUGA 1DIEA 1TX0A 3LGDA 4C60A 1GQKA 3EBVA 3LRMA 2ZZ2A 3C5QA 1Z8AA 1K9EA 1DQWA 4CNUA 5AHFA 2I14A 4KKXA 1NEYA 3PTQA 1EBHA 2CZ5A 3QPZA 1SFSA 1YQ2A 4N02A 4NZ1A 4Q22A 2GWNA 3B8SA 4JY9A 2BMBA 1J0KA 1XPYA 4YU1A 3W2JA 1LG1A 3BW2A 1S2AA 5XIMA 1AMYA 1TB3A 2OVLA 2ZRVA 2YL5A 3VGFA 3T2OA 3QMRA 2GWGA 1Q6FA 3UJ2A 3QV6A 4FXSA 4EIVA 5CC7A 4IIHA 1W8SA 3UYIA 3AMKA 4EX4A 4UXDA 3S83A 1WCGA 4NZCA 4MGGA 5XINA 1PHWA 2VVNA 4CQ8A 1XHGA 2HVOA 3GIYA 3LHVA 4RUBA 1K7FA 2PURA 2HK0A 1ZBVA 4QE4A 3T0BA 1R47A 3BAWA 5T8GA 2OSYA 4NJKA 4XTDA 4HN4A 1MEIA 3W7MA 4GH1A 3ZVIA 4HSNA 4UR8A 1BF6A 1HN1A 4S3JA 1YNQA 4DWSD 3EPMA 3GXTA 2PMQA 4DUVA 3LCIA 2YIHA 5HOSA 3KS6A 2PWVA 3CUFA 3ALFA 2QCDA 4JY8A 1VCVA 1XR2A 1KD0A 1LLZA 1XD0A 4D72A 1XINA 5I3DA 3W7EA 4GVIA 3WQVA 3CLMA 4ZA0A 3BG9A 5C70A 3C61A 3MMDA 1KBLA 4D9PA 4G7EB 1JAKA 2D3NA 2YYTA 3NXFA 2VX6A 3QW3A 4PSPA 2PWEA 3R6IA 4HJFA 3KVLA 3VILA 4PMZA 2ADAA 2DT2A 4I5XA 6REQA 2B7NA 3EX1A 2E8ZA 3GKAA 1DJZA 3DFQA 4V33A 1EJVC 4QBXA 3SJNA 1J0HA 2ZZ3A 5LNUA 3TW6A 3B97A 4PTVA 1LRTA 4IH3A 4IZGA 4B5WA 3W7LA 2P53A 3DECA 3ITLA 3M5XA 2D22A 3H4XA 4TVUA 1E9LA 3H2OA 3BQ5A 3SGGA 4NI3A 1XYAA 2PWDA 2NWSA 2C0HA 1C9DA 3LHWA 4OZOA 3WLKX 3EDEA 2WMIA 3N9RA 4S1FA 3TR9A 2RH9A 4RPQA 4EKJA 2HXUA 1JI2A 3VKJA 4PA8A 2PGFA 1H7PA 3C6CA 1OGGA 2ZBTA 3LQGA 5AFDA 1W32A 3VPLA 4AY7A 1VPQA 3M7SA 3VO0A 4KEVA 1TX2A 4MNLA 4KCUA 3LXCA 1AJ2A 1JAEA 3GHTA 1M7JA 2D0GA 1AW2A 3LTYA 1V0KA 2ZXQA 2Q3RA