4TMCA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588 complexed with p-hydroxybenzaldehyde
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
399
structure length
399
Chain Sequence
MSYMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESVAKGYKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Old yellow enzyme
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Flavoprotein
total genus 152
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmcA00
3QPZA 1FX6A 3R13A 2V0TA 1VRDA 1YPFA 3BO9A 4GRSA 3R5EA 1SO5A 1FCQA 1SZGA 3KAOA 3SFKA 5AOUA 1T0OA 2P10A 3L0KA 4N02A 2PURA 2ZRUA 1EP3A 1KV5A 2YYUA 1SZFA 3TUUA 1K7XA 5AHLA 2ABBA 5U4NA 3NQFA 1TPB1 3C6CA 2QEZA 3TQKA 3PWAA 4QNWA 1KLYA 1TQJA 3BG5A 4WQ6A 4ZQRA 3T44A 3PM6A 1P1XA 3HQ1A 2DJLA 4QITA 3DFNA 2EHHA 4IXXA 3DKJA 3HPZA 2QDGA 4TO8A 2V5LA 1CX9A 1LOSA 3EKLA 3NXFA 2Y6ZA 4LS2A 4XKYA 3TSMA 4B5NA 3KRUA 3HF3A 3GKFA 4QSHA 3E12A 1JUKA 2NLIA 2B0MA 1FDJA 4DO6A 2E1DA 4RXGA 2OX1A 2A5HA 1KFCA 1SO4A 3DI0A 3LXAA 3LRMA 3LBMA 4GUIA 4M6QA 1ZNNA 3M5ZA 3QMSA 4O14A 3GXNA 3E0IA 3GVGA 3IIPA 2XFWA 1HUVA 1FWNA 4IMEA 5FEXA 4R34A 2P1FA 1AW5A 3N2XA 3N2MA 4UR7A 1KLZA 2GQ9A 4P2VA 1TV7A 2J88A 4H3DA 3W74A 3W87A 3DKLA 3GZ3A 3T40A 4YCPA 4HPJA 4FNSA 4JYEA 1OF8A 4K37A 3LCFA 1R2RA 2J9YA 4M7SA 4MZ8A 4AVFA 5BOOA 4PH6A 3LCWA 4ICNA 1JCXA 4N9EA 1YDVA 4NXKA 4OT7A 1B9BA 3W1NA 4GFSA 1UCWA 3W75A 1O5KA 5LHFA 3ABOA 3JRKA 4Y90A 1OHLA 1H60A 4WY0B 1OFDA 2E77A 1QAPA 3TW7A 4TMBA 5K4ZA 2Y70A 1DHPA 2YZRA 4ADTA 3TXVA 3DBPA 2PRMA 4MLJA 2NXHA 1NVMA 3GAKA 4N2YA 3H55A 3NL2A 2A7NA 1VCGA 4E38A 5A5WA 3SECA 3LHUA 2CLOA 4JN6A 1TPEA 2YW3A 2HS6A 1I2PA 4MOZA 3TH6A 1ZCOA 2CLMA 3HG2A 2X1SA 1R2SA 5DLCA 3ELFA 1VS1A 2ZA2A 3C2OA 2E09A 3LX9A 3MHUA 3QPYA 2BZNA 3MBFA 1DORA 3B03A 3BVJA 4JEQA 2DZVA 3DXIA 4LVFA 1TPUA 2QCFA 5AHMA 2J24A 3IEBA 5DN1A 3TFCA 1TPFA 4C1KA 3KVLA 5HMSA 2BXVA 3ZS4A 3ZWSA 5AYXA 1LBMA 3W2KA 2G96A 4O28A 3B8DA 5BNKA 3BGJA 1JCNA 2YPIA 1A5SA 3L0NA 3KVJA 4JDYA 3C56A 4E0CA 2DZXA 1PCWA 4XZ9A 1KM4A 4ORIA 4UFJA 2WV8A 1QFEA 4EF8A 4GWEA 4L4MA 2QF7A 5HR7A 3S6DA 1JR1A 3QW4B 2V30A 3C4UA 3FS2A 3BW2A 2Q3OA 4FNPA 1NF7A 4KWWA 2CLKA 5EPDA 3CB8A 1W3TA 3A22A 3A9IA 1MZHA 2CU0A 5IM51 3TMQA 3O6DA 3FKRA 3PUDA 3SIZA 1YTKA 4WD0A 1W8SA 2G97A 4NT0A 4WXYA 1Z41A 1OFRA 2Q8LA 3MJYA 2ZBTA 1FBAA 1EPXA 4LVAA 5L6UA 3W7CA 1K8YA 4RZ5A 4O12A 2NXIA 2C16A 3PAJA 5HJLA 4X22A 2DU2A 1LYXA 2VFEA 4XUGA 2Y62A 4LOCA 3PB2A 2J9ZA 4A21A 2C13A 1F73A 3G22A 3V1PA 4EIVA 2WSYA 3MI6A 4FO4A 3W2LA 5LHEA 1EP1A 3M16A 4BWLA 3PR2A 1OG0A 5CZ0A 4CCEA 4IMCA 1LRQA 3MI2A 5BRBA 3HPSA 1EUAA 1W0MA 1THFD 4LWWA 1R47A 3SJ3A 2WO5A 3THAA 1LRNA 2QCDA 2ISSA 1NFBA 2V8ZA 4WZHA 3P74A 1PS9A 1SU5A 4ZQCA 2X1RA 4FXRA 3G1YA 3VE7A 5KINA 1F6PA 4FIRA 2Q3RA 4RV8A 1YTDA 1Q45A 6ALDA 4Y8FA 2CW6A 2DZWA 1TCDA 1XC4A 1B4EA 1WX0A 4BI7A 3W7JA 2VEPA 4CCDA 3W72A 1NSJA 3G1XA 4JD4A 4PL2A 3WK3A 1KM3A 1VR6A 1EIXA 3W76A 3UXAA 3O15A 1SZNA 3EB2A 2X1TA 1SFJA 3WJZA 5L9FA 2QUVA 1U5JA 1QO2A 4AWSA 2NZLA 4OU1A 4QQ3A 5K7JA 8TIMA 4UIOA 1K02A 1GOXA 1TPWA 1FY6A 5DXYA 1I4NA 2VXNA 4JTLA 4AHPA 4UTJA 2FLIA 2QDHA 1VPXA 4UFKA 3N19B 1LP6A 2EGZA 2RDWA 4DEFA 4IQLA 2Z6JA 1EEPA 3W1LA 4UMAA 4IMGA 3SR7A 1MEWA 4FB7A 5AYYA 2W0UA 2WJZA 2ZA1A 3E49A 2FQIA 3EKZA 1SPQA 3S8HA 1G7VA 5H2ZA 4HSNA 4MY8A 4LC8A 1O4UA 1OF6A 1T8XA 3PY2A 5LKYA 3I65A 1VJIA 1QMLA 3TJXA 4GUFA 4O13A 5SWUA 1M6JA 1GJPA 2VFIA 1QPQA 1H51A 1H1YA 1H62A 3ATYA 2P0OA 1H7WA 3DFQA 5I3FA 4ALDA 3HO8A 1W5MA 5F1VA 3N14A 4AB4A 1I2OA 2R94A 1E51A 1N55A 2WQPA 3P8JA 5F1UA 1PVNA 3TJLA 3HOJA 2Z2UA 3W1XA 4PEKA 4M19A 2FB2A 1QPNA 4LVDA 1OFAA 4K38A 1LTDA 2CZ5A 2ZZ6A 1ZALA 4C1LA 2I9EA 3NDOA 3PULA 2ZZ1A 2ZZ5A 1GVQA 1BEUA 3GDTA 3BLIA 3MW7A 2GQ8A 4LNYA 4IWWA 2Y61A 1DBTA 3NQVA 4JY8A 3W7QA 4WX2A 5I3IA 1X6UA 4JYDA 1P4CA 3EXTA 4JTUA 4FF7A 2DZSA 4LRSA 1TRDA 3M5VA 1X8FA 4K8HA 1RQHA 1SR9A 4MZYA 1KA9F 4K6AA 4AH7A 1H63A 3HB9A 3G1FA 5AFDA 3GYEA 2ZZ2A 2AGKA 4UCGA 2H3DA 4GJ1A 5DELA 3I6RA 3CWOX 2VEMA 1FDZA 1PHWA 3GR7A 1WXJA 3MYPA 3W1PA 1YYAA 1LOLA 3C52A 3UY8A 3NL5A 1YPIA 1TRIA 2Z6IA 1SSGA 3QF0A 1W3NA 2E6YA 3LLFA 1KM1A 1A5AA 3W22A 3NQ7A 3H53A 1VZWA 4GE8A 3LCLA 3EX3A 5DCBA 1F6KA 3TKFA 3F4WA 2E6AA 4JTTA 1Y0EA 3T4CA 4YLWA 4NX5A 4BWLC 5C6MA 2C14A 4AWTA 2PRHA 1F5ZA 3LDVA 3HMJG 3IIOA 3NZRA 4ZVJA 4UFHA 3PUEA 1AG1O 4OV4A 4I7UA 3P5ZA 3HIJA 3W84A 4K7YA 1H7NA 1GTHA 4EOUA 5AHNA 1TPC1 4I7VA 3A5VA 2QR6A 1I2NA 2EF9A 2ZRVA 3BW3A 3NEVA 1JCLA 1UUOA 4PC8A 4QNEA 2ZFAA 1LRTA 2GVJA 1I2QA 2LLEA 3PG9A 3ZFHA 1C9DA 3CM4A 3PBYA 4MPQA 4O19A 4JXCA 3F4NA 4M7TA 2GUUA 3W1RA 3ABSA 3KHJA 1EB3A 4JNMA 1P5BA 2Z1BA 3DENA 3S9YA 3UYCA 3W71A 2CZFA 4O52A 3B0VC 4IGHA 1O5XA 2KZHA 1V7YA 2WPBA 4K39A 4JX6A 4WY0F 5CG7A 1H50A 1G4PA 3EWZA 1XDMA 2V9DA 5EBUA 3LV5A 5T26A 3Q58A 1A5CA 2ZDRA 4JR5A 3H54A 1HTIA 2H90A 3SI9A 3PB0A 3TW6A 1A50A 1FWSA 5H91A 1XL9A 3TROA 1LM1A 4J9JA 4N9BA 4UTIA 5J5DA 5K3VA 3NG3A 1KTCA 3NQ6A 4M6PA 4OV9A 1MEIA 1KM2A 1LDCA 1RZMA 4AHQA 5LNUA 4JYFA 3TX9A 1NF0A 2VFDA 3IVUA 1Z44A 1IXQA 1KTNA 1ME9A 2PRLA 5D38A 1KFLA 5FF0A 2DZTA 4HSOA 3FIGA 3ZWTA 3DFSA 2TRSA 4H4IA 2QAPA 2YCEA 1OK4A 1L2UA 1XBVA 1TMHA 2ZRWA 3EXSA 3GAYA 4EVZA 1G69A 1QNVA 4PFMA 4MJMA 1TQXA 1OVDA 3G8RA 2RHGA 2JGQA 1A53A 2ZTKA 3OBKA 3W7EA 3HBLA 5DBUA 3M6YA 4DXVA 1X1ZA 1GTEA 1QR7A 2X1UA 3GLCA 3FJLA 4POCA 3S42A 2ZQ0A 4O1CA 4R53A 3BPWA 2FPVA 1G4TA 2X2GA 1TTPA 2O7QA 2YR1A 3G1HA 4BI5A 2V81A 3DH7A 5KZEA 5EY5A 5G2HA 4UTWC 2R14A 1TTJA 3UWUA 2GVLA 3SY5A 1GYNA 3W7PA 2UV8G 3FLUA 3G24A 5G1TA 3OVQA 4QIUA 5FEZA 4UTHA 3ABRA 2A2IA 3M47A 2WSRA 5D33A 4N9CA 2CLHA 3DFOA 2OMAA 1KV8A 2GQAA 2HS8A 5KZMA 3C2RA 4LS0A 4O1AA 3LERA 3TFXA 1W31A 2WOQA 4MFEA 4UTKA 1FCVA 4Z08A 4MYXA 1G4SA 1M7PA 4HHPA 2X30A 3IV3A 4GXMA 4CQAA 1GG0A 5AC7A 1PCKA 3HG3A 3P84A 4O4VA 3PBUA 3WJYA 5F2IA 4RZ4A 3BGGA 2A6NA 2V5BA 3DZ1A 5D2YA 4JX4A 3O05A 5D05A 4GUHA 2FIQA 1RPXA 5I3HA 3TQVA 1JJKA 2AAMA 1BTMA 1PHQA 2YX0A 3USBA 5G1YA 1DJNA 2I1OA 4TMCA 1GVSA 3S1XA 3TQ0A 1VHNA 3O6YX 3VFLA 1VGAA 2TPSA 4ZQMA 1A5BA 1MEHA 3BK0A 4DO5A 1XUZA 1J5TA 2V2HA 1VHCA 1ZFJA 4Q32A 4UR8A 4A29A 1AW1A 3RMJA 4IPIA 2QCHA 4NJKA 5AHIA 2ZZ7A 3HG5A 2HMCA 3W1AA 3AJXA 3R89A 4UTUA 1SZEA 1S5VA 2GOUA 2TSYA 3GNNA 3HGSA 1GEQA 1OFPA 3CC1A 4FNRA 2OT1A 5LNVA 1LLWA 3I7SA 4O1DA 3RK8A 3S0CA 4Z1DA 1R2TA 3M44A 2C18A 3CU2A 4YWIA 3TA6A 1FQ0A 1JULA 1ZAHA 3U6WA 2DORA 4MLRA 2CFFA 5IBXC 1B57A 1YLVA 3FJ6A 3MHGA 1QO5A 4O57A 1EWDA 3ZR4A 1XCFA 3EX2A 4AF0B 4NXSA 3LOTA 3PSVA 2O7SA 4OHQA 3M1ZA 1HG3A 3P60A 5DBTA 3TV8A 1I45A 3LRLA 3LTYA 3TDFA 2Y7EA 3L5AA 4LS1A 5E93A 1RQEA 4MVAA 3DU0A 5BMXA 3KXQA 1OYBA 3S5YA 1TIMA 1FWTA 2TYSA 4FNQA 3QQ0A 3C2VA 1SFLA 3TXZA 2CLFA 4NQ1A 1XBZA 4Y6GA 3WJSA 4EF9A 4GC4A 5AHEA 3WFAA 1I2RA 5HUPA 4DF1A 1K3UA 2J6XA 2JKEA 1YDOA 3FYPA 3W2NA 1VLIA 1XFBA 5C54A 4G1KA 2C15A 1OX4B 1JUEA 3GR8A 4JTHA 4JTIA 4MIMA 3QH2A 4OWGA 1D3GA 3KRZA 3CTLA 1WAUA 3L68A 2NWSA 1VYRA 1BWKA 4S1FA 1GT8A 3EX4A 3A23A 3UPWA 3UWWA 4O0KA 2GVGA 1M5WA 3EWWA 1W1ZA 3CHVA 3HPXA 2WNNA 2CZDA 1WOAA 3B04A 1LROA 3TR2A 1TB3A 3QMTA 4DPPA 2B7OA 4ADUA 2Q8ZA 3O1NA 4MFDA 2B7QA 3TIMA 1XDLA 4K7VA 3NQCA 3NZ1A 4XTDA 4UMBA 3B05A 4EWND 1ICPA 1TTIA 3CEPA 3UQNA 3IGUA 3MBDA 1HO4A 4DPQA 5CZSA 4FNUA 3W3OA 3GDMA 2C19A 4IUOA 1J4EA 5DCEA 3NL3A 1YXCA 3PVFA 1UJPA 4WY0A 3MHFA 1CW2A 1W5OA 4W9TA 1Z42A 1QCWA 2RH9A 4LY8A 4ZQPA 3UPBA 4QAIA 5HULA 3LI1A 5HWJA 2ZCGA 3QJAA 1EUNA 1NEYA 5LNSA 3A21A 1OYCA 1F7BA 3NM1A 4IOTA 1ZHAA 4AEOA 1G7UA 2QCLA 5CPLA 1AL8A 2RDTA 3PG8A 5I3GA 4BF9A 3AO0A 2E68A 3A24A 1EA0A 1D9EA 5TQLA 3QMRA 5KZDA 3W1UA 1ZY9A 4JS3A 3O07A 4FHAA 2W79A 5FEPA 3W6YA 5GVJA 1AW2A 3B4UA 5HWNA 5KTLA 5ABTA 4UTLA 3W85A 2GJLA 1JCMP 2QCEA 2G95A 1HFBA 3TCEA 1KM5A 1S3HA 1KFJA 4LUIA 2NV1A 3GXTA 3LM7A 3G3MA 1TYGA 2QKFA 1R30A 1IIGA 2NWRA 3GIYA 3LHVA 4XTIA 5K4XA 4DF2A 3I7QA 3LHYA 1GQNA 3FOKA 3MUXA 4AF0A 3NQ8A 3QYQA 2OJPA 3VCRA 4NJIA 1DQWA 4ONVA 4JTKA 1LZOA 4PTNA 3SSJA 3P67A 3TK7A 1PV8A 3EX1A 5AB3A 3L21A 2C1HA 4FIQA 1XM3A 2QAFA 3CT7A 4RLIA 1OFBA 5EMUA 1PE1A 1GPWA 4KFNA 3SGZA 4NNAA 4YMZA 3KOFA 5AHFA 2ZRZA 3PBVA 1K8ZA 3W1QA 2DZPA 2V2DA 1RV8A 3QSRA 3CEUA 1H7RA 1JCJA 4JIPA 3LI0A 5F4XA 5K9CA 2BX7A 4UFLA 2ATSA 3ANYA 3WJWA 4CLMA 4QJ1A 5FESA 1G67A 3M43A 3MYOA 3STFA 2J27A 1TPDA 3W7MA 3UWQA 3NPVA 4NU7A 3CPRA 3VNDA 3QFEA 5EL1A 2E5CA 5FF7A 4HNUA 1DVJA 2H8XA 4S2CA 3T78A 1VLWA 1IGSA 4UTWA 2GJNA 2E5BA 4UMCA 2A85A 7TIMA 3RNDA 3M5YA 3Q37A 3Q2DA 1Q6QA 3O6CA 2F84A 3V75A 1SSDA 4CCCA 1FWWA 4M5PA 4PCFA 3WK2A 4QM1A 4O16A 1SUXA 3DGRA 3PF3A 4A2SA 2XN0A 1TV8A 2VFGA 1Q6RA 4O54A 5C5YA 4OBTA 3NQDA 4JY9A 2EKCA 3MO7A 1DL3A 1F74A 3W7NA 3NPXA 3C3NA 4X3ZA 1SW7A 1XUUA 4ORMA 1Q6LA 1GYLA 1H7OA 1AK5A 1KBIA 2YDAA 4AMAA 1H7PA 1S5WA 4U4MA 3G1DA 4XKYB 5HQEA 1LOQA 1S5TA 5LGXA 4BK9A 4Z0JA 4HIBA 1G6CA 3NNTA 1HO1A 2A4AA 5CSRA 5K9DA 2VOMA 4WJEA 4DELA 3W1MA 1J2WA 3MP3A 1EX5A 2QJIA 2DZUA 2VFHA 2BTMA 4K8EA 5I3JA 4R7JA 5EYWA 1KBJA 2ZA3A 3LXBA 3LB0A 3UD6A 3S1UA 3UZ5A 3EWUA 3EWXA 3W23A 1VQTA 2BSLA 1JQXA 2FB3A 4WXZA 3S5OA 3LCIA 1TJRA 3LHWA 4HPXA 3RFAA 4CNOA 3JS3A 4YL2A 3G0XA 3DHFA 4LV9A 5D2WA 1OFOA 5LGZA 1W5NA 2R91A 3CLMA 3KFTA 4AXKA 1W37A 2FPTA 4UNLA 3R2GA 4DQWA 1BKSA 4LTSA 1WOBA 2H3BA 2NUWA 3TE9A 2OZ0A 3GK0A 3BLFA 3L67A 1WDWA 2HTMA 4BFAA 4O18A 1TSIA 5IBXA 4JX5A 3NR0A 1GWJA 3M0ZA 2JK2A 2FPYA 1UASA 3EWBX 1TO3A 1DKWA 3DFTA 4QISA 1ICQA 4ZQNA 3KX6A 3TC7A 2CLEA 3W70A 4GBUA 3W83A 1EP2A 4IMDA 3WJXA 5C2XA 1BWLA 3W7HA 3W07A 3HJZA 1KW1A 3EWYA 3M41A 5FF3A 4FEZA 2C6QA 4IMFA 1FWRA 3QM3A 5CKSA 3N3MA 1AMKA 3TAOA 1QDSA 4WOQA 2RDUA 3P82A 3NQMA 3G1SA 2E5DA 2Y63A 3O8AA 2FTPA 4JIQA 2CWNA 2YW4A 3S1WA 1G4EA 2BWGA 3KRSA 4JGDA 4DO4A 3W2MA 5E0KA 4Y9AA 1WBJA 4FX7A 5CSSA 5EA9A 3N9RA 1LORA 5K9XA 4TR9A 4IJBA 1KFBA 2WNQA 4S2BA 2CLIA 3TNOA 1H1ZA 2DJXA 1RQBA 4BI6A 2TMDA 4LVBA 5D09A 3O63A 1W56A 1TPVA 1P0KA 5D02A 2XN1A 1XI3A 3C0JA 3A5FA 3P80A 2A6LA 4KKXA 4UNKA 3SW6A 4AHOA 1AL7A 3S5NA 1L9WA 1WBHA 4X2RA 4WUIA 2ZRYA 1IIHA 2RKXA 3I7RA 3TSBA 2JGYA 3NGJA 1X1OA 5FI8A 1YDNA 4LRTA 3F03K 2R8WA 4MUZA 3OVRA 4AAJA 3HGJA 3IVSA 2H8ZA 3Q94A 4NUWA 2F7FA 4MY1A 4ML9A 1F2JA 5TBOA 3W2UA 1SQ7A 1JRCA 3ABQA 4Q4KA 2A21A 4U28A 4N6FA 4XQ6A 3W7LA 5E1QA 5F2MA 3OIXA 4NZFA 2V82A 1VCFA 4NJJA 3U2OA 4RKAA 1MO0A 3QSTA 3S5ZA 3LRKA 2ISWA 1ICSA 1B3OA 5KMYA 4KWVA 3OHIA 3P8IA 5FF2A 3NYZA 4MZ1A 2VC6A 2ABAA 4DBDA 1ZENA 2C3ZA 4XWUA 3MP5A 1HL2A 2QCCA 3HG4A 1IXPA 4BR1A 5F2GA 4A22A 4MJZA 5U7SA 3FA5A 4NJGA 3UWYA 3R12A 3W1TA 2ZTJA 4PODA 3IRDA 4UTTC 3L65A 2ZZ4A 1ADOA 4O50A 4GUJA 4RCXA 3G0SA 4GNJA 3MP4A 3P5YA 3W7IA 4RX0A 3LGEA 4YCOA 1OYAA 3L5MA 3FEMA 3G18A 2QCDB 3DHDA 2G5WA 5D04C 3E9AA 4DF0A 2C0AA 1K8XA 4LVGA 4O17A 4IX2A 2H6RA 3TU9A 4UC5A 4CNPA 4NVTA 4CQ9A 3U8GA 4TX9A 3STEA 3VE9A 5D2TA 4JTGA 1C29A 3PBWA 1GG1A 3QW3A 2V2CA 4NNCA 4I7WA 5AC8A 2BLEA 2Y85A 4HNTA 1F76A 3D0CA 2Z0IA 1FXQA 4Y96A 3VKJA 3UNDA 2RFGA 3ATZA 1GZGA 3C61A 4O10A 4ZL1A 4O11A 2NXGA 2XN2A 5AC6A 3DAQA 3T7VA 5G2IA 4NZJA 1C8VA 5LNWA 2PE4A 3G3DA 4JDBA 4FNTA 1XXXA 1GVFA 3DI1A 3O16A 3RLVA 4JTEA 2A7RA 4LU0A 1DJQA 1YXYA 3QZEA 3IIXA 3OA3A 3P7YA 1K7FA 4UFMA 4OGZA 2QCMA 1N7KA 4E2DA 3THQA 4UFIA 1OFEA 3G8EA 2WKJA 3I68A 3G0UA 2QCNA 3UY7A 1H61A 1OFQA 5HNRA 4FX6M 1FUYA 3W7GA 4RR4A 1CI1A 1ZJIA 5G2WA 5I3KA 3T55A 3B0UX 1D3HA 5HWMA 3G1VA 4PA8A 3C2EA 4O8RA 3LHTA 3TAKA 4M6VA 1SW3A 4IX0A 1WYIA 1TTQA 3NQEA 1JUBA 1K7EA 3G1AA 4O15A 1ME7A 4O1BA 4X9SA 3NA8A 4XBKA 1TV5A 3W88A 1XBXA 3DFPA 4N9DA 1I8JA 4RXFA 3BG9A 1K03A 5LSMA 5CPMA 2ZZ3A 4HNVA 3LHZA 5EKYA 4H6KA 3E96A 4E2BA 5BW6A 6TIMA 4ADSA 3GDLA 4HT3A 2DP3A 4N6EA 2JBMA 3HGOA 2ISVA 1JRBA 2YYTA 3E02A 4ZMGA 3BG3A 4CNNA 1ONRA 1GVOA 4IPJA 2ZRXA 4RJEA 1PL9A 5KSWA 1VYPX 2QJGA 2B4GA 2Y7DA 2YGYA 5CGQA 3IIVA 4IXHA 2FFCA 2FJKA 4WOZA 1U83A 4ZZ9A 4Z0SA 1Z48A 3TSDA 5C55A 2ALDA 2Y88A 2IQTA 3STCA 1YXDA 5HINA 3CWNA 1GVRA 1OJXA 1EWEA 3NPUA 1ALDA 4L4LA 4HNNA 1RVGA 3NPWA 1FDYA 1QOPA 3GB6A 1L6SA 3RF9A 5A8GA 4I9AA 3MI3A 4LW7A 1NAL1 5DY2A 4JTSA 5DY3A 3BLEA 4O4WA 3M5XA 4R33A 3BARA 4CQ8A 1QPRA 2VEKA 5TIMA 2NX1A 2NV2A 1M7OA 1QPOA 2PC4A 5HR6A 3W7RA 2ZYFA 2FDSA 4TIMA 3UXDA 3TC6A 5BMWA 1XBYA 3GDRA 3FFSA 3NO5A 1VH7A 2AQWA 2A0NA 5D03A 3GX9A 4TU1A 3W9ZA 3R8RA 1LCOA 3L0GA 5J5RA 4OE7A 5LZLA 2OCZA 2VKZG 3HGRA 5D2XA 4P61A 2JKPA 3NQGA 1OABA 4Z1BA 4K36A 4OQVA 3S1VA 1ME8A 2YXGA 3B06A 3OVPA 3YPIA 3C2FA 2YFNA 3KVMA 3QQ1A 2NUXA 3B0PA 1KFEA 1H7XA 3C8FA 3L9CA 3NQAA 2I14A 3QEZA 4O0ZA 1SO6A 3N34A 3GNDA 4LC6A 2HSAA 4GUGA 4N4QA 2B7NA 1LBFA 1F05A 3W2JA 3IGSA 4AWUA 5DXXA 1YTEA 4MYAA 5FF4A 3NL6A 3LCHA 2QCGA 3P61A 1DV7A 4FX8A 1IF2A 2YSWA 1JCYA 1OX4A 3O06A 3UZJA 4UUIA 3UWZA 2E6DA 1UBSA 1WV2A 4UXDA 5D32A 4UTMA 1RR2A 1PIIA 3P81A 3W73A 3L66A 1ML1A 5DCDA 2EPHA 1VYSX 1Q6OA 4NNBA 5CPNA 3NOEA 1W3IA 1KM0A 5G4EA 4RZ6A 2PCQA 3EXRA 3LCXA 5FEWA 2A7PA 1VC4A 3LV6A 1W54A 3N73A 2J9XA 1DQXA 1R46A 4HKPA 5D37A 5MHBA 4N4PA 1FCBA 4KFOA 5G5IA 3JR2A 4JTFA 2OT0A 3L5LA 4MKNA 1TREA 2NX9A 4MY9A 1WQ5A 1TPH1 1B4KA 1ZAIA 3GKAA 4LT9A 3IGXA 2NX3A 1L6WA 3QRHA 3BW4A 2WNZA 4LUJA 1JQVA 3IIZA 2NUYA 2CLLA 2VEIA 3W7KA 1RD5A 3MMTA 1VCVA 1IXOA 3CQ0A 5CZJA 5AYZA 3OEXA 3CIWA 4A3UA 1Q3NA 4NX0A 3BV4A 1UB3A 1XKYA 3LXCA 3GXPA 4JICA 3PUOA 4RK8A 2EAWA 3M9YA 3UWVA 3TMLA 1KFKA 2WSQA 3LCGA 3K30A 2D73A 4ZQOA 3NAVA 4HN4A 1IXNA 4UTTA 2YFOA 5F2LA 3SGUA 2W6RA 1L6YA 1T99A 5AN7A 1N8FA 3M7WA 4O53A 3RU6A 3L2IA 3VI2A 5K2ZA 3STGA 4JTJA 2Y7FA 1OK6A 1ZAJA 4YXGA 5F4WA 2JKAA 3LTPA 1O95A 5CZTA 3RLUA 1P0NA 3WK0A 4Z1AA 3LTSA 1V5XA 1LLZA 1FXPA 5D2VA 3CIXA 1FCUA 2Y7GA 4A2RA 3KVKA 4PL1A 2E6FA 2Y89A 3MWAA 3NVTA 4DBEA 1KTBA 1MSSA 3N9SA 5CPOA 2X16A 3QC3A 5D30A 1W5QA 3SZ8A 3PSWA 4D2JA 3NM3A 2A1YA 1MXSA 1KM6A 1SW0A 2QUTA 3F1QA 4Z1CA 2B7PA 1O94A 2QUUA 3PC0A 4Q33A 1O60A 3PS7A 5F4SA 1JVNA 2VELA 2QJHA 5G4WA 4LV4A 3W7OA 4FXSA 3INPA 3EX6A 2GPTA 2VENA 3EEGA 1QWGA 1T96A 4KFPA 1W5PA 3IVTA 2VFFA 3WK1A 2CZEA 2ATMA 3GDKA 5HUOA 1TJPA 3OG3A 1YADA 1OX6A 1H5YA 3LLDA 5LNRA 3FKKA 3FYOA 5KITA 3P62A 4NJHA 4XBSA 3LBCA 1OX5A 3W86A 1X7FA 1WA3A 1UUMA 1DOSA 1LBLA 1QOQA 3W7DA 3NQ2A 1SO3A
chains in the Genus database with same CATH superfamily
2UY3A 5DEZA 4LB3A 3W00A 3G77A 3DC8A 4B9ZA 3SFKA 1TMLA 1ISYA 1Y5WA 5HMEA 3VU2A 4N02A 2PURA 4CQDA 1MRQA 3KCLA 4E4PA 1E9IA 5J04A 3TUUA 1LG1A 5U4NA 1XIDA 3NQFA 3SCOA 3CPUA 3ZSSA 3BXWA 2ZUMA 4N0RA 3TQKA 3VIGA 4QNWA 4XK2A 3T44A 4A8RA 3PM6A 1P1XA 4H7CA 4QITA 4H8HA 4IXXA 3DKJA 1XH0A 3A3HA 4LS2A 5A6MA 2UZ9A 3GKFA 4QJ4B 4QSHA 4HZ8A 1IT8A 1OG6A 4QEHA 1B3WA 1R8LA 3HU7A 1CLVA 3AICA 4KEZA 4GUIA 1K6AA 4M80A 1GJWA 3PJXA 4GNKB 3CV7A 5AY7A 3B9DA 3GU9A 3ZJ7A 1KLZA 2GQ9A 2VZVA 3P3BA 4X61A 3BMVA 1OC5A 3WH6A 1OF8A 4MZ8A 4AVFA 3BJFA 3LCWA 1MWOA 1QJWA 3T8LA 1JCXA 1XS2A 1YDVA 2EEXA 1B9BA 1GK8A 1B3VA 2I16A 5LHFA 4DJFA 2Z1KA 5CAHA 1J9YA 4WY0B 2G3IA 2GGHA 2E77A 1VP5A 3CQJA 1M01A 3BQ6A 1D7FA 1YDYA 4UQDA 4IG2A 4HYWA 1ITXA 3A3XA 3RN6A 2ISFA 3TXVA 2BB0A 4YTQA 1OINA 4IM4A 3EZ4A 1DTUA 4MDOA 4Z2LA 2WWCA 5A5WA 3LHUA 1TPEA 1C8YA 4MADA 3ELFA 1VS1A 2C91A 9CGTA 3ZYZA 3CH0A 2E09A 3KBSA 3EDDA 1EBHA 3BVJA 1VBRA 2V68A 4GQ0A 1TPUA 2QCFA 2J24A 3L2LA 3B8TA 2QQ6A 1EKOA 3BOXA 4J3UA 5ABGA 3GHUA 3A4JA 2G96A 3GTNA 4K3ZA 2PUZA 3WDPP 4C6NA 1PX4A 5BNKA 1JCNA 4XIMA 3RLGA 3L0NA 3KVJA 4E0CA 1CXIA 4XZ9A 4UFJA 1V08A 1M03A 1QFEA 2WM0A 3OZOA 2OELA 2ZDSA 5HR7A 1JXJA 3QW4B 2V30A 5EMMA 3KWSA 2X1IA 2WQDA 2Q3OA 4FNPA 2QGHA 5EPDA 3ZOAA 1JFHA 3A9IA 1MZHA 3T0TA 4HA3A 4MWAB 1NARA 3PNUA 3PUDA 3SIZA 1EIBA 1W8SA 1ZL1A 1Z41A 4XSMA 1UUQA 3W02A 2A3LA 2ZBTA 1NH6A 3W7CA 2E28A 3LG3A 4GIYA 4LCQA 2X05A 1UD8A 1J10A 4JL2A 3PB2A 1P7TB 2EPNA 4FO4A 1EP1A 3M16A 4OOUA 3TYEA 3GTXA 4H2CA 3PR2A 2NVDA 3N9KA 3VCCA 4DJFD 1S2CA 3MI2A 1BRLA 3HPSA 1UP2A 3BAIA 2Z7KA 4LWWA 1V0MA 1R47A 2V63A 3SJ3A 2WO5A 4WZHA 4GD0A 4C7DA 2DSUA 4FIRA 4X63A 1D2KA 1DIDA 1VAHA 4KF1A 4CVWA 4ATWA 3WL1A 1YTDA 3FJNA 1I0DA 3ZVIA 4QTGA 4AEFA 1PWLA 4BI7A 1NIUA 4L9YA 1H5VA 1NSJA 3GC4A 4JD4A 4LJ3A 4JFSA 3W76A 2WHMA 5A2CA 4XZHA 1GGOA 2EO7A 3UWEA 1SFJA 5L9FA 2DH2A 4AWSA 4OU1A 5K7JA 2BOEX 3UA4A 2PCEA 5DO8A 2AGTA 1FY6A 5DXYA 2AAAA 2VXNA 4IP7A 3GC2A 1VPXA 4HA0A 3AIQA 4AYGA 1E1FA 3VNYA 4HTYA 4OECA 1ZJAA 2CBVA 2EGZA 2RDWA 2Z6JA 3LD5A 3NSMA 3W1LA 4IMGA 3SR7A 4REQB 4HJFA 3L7RA 4GZJA 2WNWA 3V18A 5AYYA 3CV1A 3KDNA 3QTGA 1G5AA 3GIQA 2IPFA 4GQRA 1VEOA 1TA3B 3FEQA 3EKZA 3HQPA 3S8HA 5D4YA 4LEFA 1XRFA 4MY8A 3KCJA 3BMXA 2JFEX 5LKYA 3OIHA 3VKDA 4O1EA 3V35A 3GZAA 1H1YA 1XINA 1H7WA 5I3FA 4ALDA 4NRSA 2DZAA 2R94A 1XSKA 1GOMA 3VOFA 1C8QA 4M19A 4OVXA 1QPNA 1ZALA 4C1LA 3ERPA 2TODA 3UFYA 2XDFA 2PTWA 4G7EB 3T9PA 3N6JA 4WX2A 1P4CA 4JTUA 3QHOA 1WZKA 3WUBA 1RY8A 1MNSA 4K6AA 2B31A 1H63A 2WJDA 4V1YA 3G1FA 3UVAA 4GJ1A 1GVIA 3TYBA 2VEMA 1HGWA 2XIJA 3GR7A 1CXFA 4C6PA 2CKRA 3MYPA 2XZ9A 3NL5A 2OSXA 2Z6IA 3QF0A 1W3NA 4NG3A 1A5AA 4JQ2A 3NQ7A 3GG1A 1YKWA 4JFUA 1F6KA 1V03A 2E6AA 4YLWA 1QW7A 4AWTA 3MUZ1 3LDVA 3HMJG 3IIOA 3T1GA 4F2UA 4XIAA 4UFHA 2D22A 5FJPA 1UZDA 3CUZA 1H7NA 1EX1A 4EOUA 5AHNA 3SUWA 2RGLA 1XSIA 3ARYA 3R25A 1UZ4A 1ODUA 4RZBA 1RCQA 3BW3A 4C91A 3NEVA 3L4WA 2VUNA 3PBYA 4JXCA 1QHOA 4JPGA 1K9FA 4M7TA 2BVTA 2GUUA 3NWRA 3W1RA 4ZB5A 1EB3A 1GOKA 3AIUA 3DENA 1EHAA 4L4OA 3UYCA 1E56A 4O52A 1BD0A 5IXEA 4MKVA 3VC6A 1VJZA 2KZHA 1V7YA 4K39A 4WY0F 5EMYA 3F5KA 4KH2A 2UBPC 3O9NA 3H6OA 4U5IA 3VDGA 2GGGA 2DT1A 2ZDRA 1I6NA 2EPKX 3H54A 2CETA 1HTIA 3SI9A 3TW6A 1E55A 2WMFA 2J66A 3NG3A 4A8NA 1DQUA 4M6PA 3BE7A 3F2BA 5CLWA 3O0FA 1KM2A 4BF5A 1UPPA 3VIPA 4Q7IA 3VKBA 3OGVA 1NF0A 5A94A 3IVUA 4DM2A 3S9IA 1ME9A 4HSOA 2PDUA 4JIRA 1VPQA 3B97A 2TRSA 4H4IA 4RDVA 1OK4A 1IEWA 1BQCA 1XBVA 4L7ZA 4EVZA 1G69A 1OVDA 2RHGA 3T4WA 3M46A 4WK9A 4F66A 3HBLA 3M6YA 2A79A 2KAUC 3C2YA 3S2MA 4E8GA 3IACA 1DTNA 3BPWA 4LUTA 2YR1A 2EJ1A 2V81A 4PUEA 5KZEA 4UTWC 3XINA 1TTJA 4H8UA 2GVLA 3OQEA 3QV6A 4HU3A 4YTTA 3D6NA 1KRAC 2WJEA 3ABRA 2PGRA 1DWHM 2WSRA 5D33A 1A0EA 1XD1A 3AMLA 2OMAA 2GQAA 4GNVA 2CZVA 3C2RA 4DRSA 4O1AA 3VX0A 4NL1A 2WOQA 1EDQA 3B40A 4Z08A 4X60A 1M7PA 3OGRA 4G2DA 4CQAA 3BAYA 4DVOA 4JCLA 2JQXA 1F9CA 4B90A 4M0XA 2CBJA 1UZ1A 2J7HA 4LAMA 4JX4A 3O05A 1OBAA 2FIQA 3AUOA 2BY2A 2AAMA 4MB4A 1GZJA 3USBA 5G1YA 3SURA 4CN4A 4WIWA 2G4FA 3TQ0A 2L5HA 1OADA 3MMUA 4PMVA 3V7PA 1VGAA 1OD0A 4QS6A 3SDOA 4GHRA 1XIJA 4RW3A 1MEHA 3SCWA 2QVNA 3DUGA 2V2HA 1VHCA 2DDXA 4EANA 2QDDA 4CN6A 1CGVA 1X96A 2IPGA 5AHIA 3W1AA 3AJXA 4UTUA 3WNPA 1SZEA 3UZYA 1CNVA 2PSNA 3GNNA 3ITYA 1OFPA 4Q7NA 4IGMA 5ABFB 2QNEA 1LWIA 2C18A 4YWIA 1FQ0A 1RCXB 1POJA 4R7OA 3TYCA 1XLGA 3RPDA 1JL8A 4PSRA 2O0TA 7ODCA 1EJVC 2W67A 4MKSA 4O57A 1EWDA 1AA1B 4ZEPA 1OC6A 2QXWA 3WQ4A 4CU8A 3KS5A 6TAAA 2QDEA 2PDKA 1MQPA 2PGEA 4LS1A 3BSGA 4Q8VA 3MA8A 4MVAA 4HVXA 1JDDA 1BAGA 3S5YA 5E6ZA 3SCSA 1CXEA 3AU6A 2XVNA 1XLDA 4D6GA 5A2BA 3VM5A 3R94A 3TYDA 1X6LA 1K3UA 2BOFX 4FK9A 3W2NA 1VLIA 2VCCA 4AZHA 3ZLFA 4I6KA 1JEZA 2NVCA 4OWGA 2PF0A 1JPMA 1VYRA 4S1FA 1GT8A 1LQ0A 5TF0A 2V5CA 1OC7A 4BCEA 3OLDA 3T0BA 2Q6ZA 4AFYA 1R3YA 4DPPA 1UROA 2B7OA 4ADUA 2Q8ZA 4FMVA 3O1NA 2W63A 4MFDA 1ZPTA 3KTXA 4F0KA 2XH4A 3CHEA 1ICPA 3MUCA 3UQNA 3MBDA 2GUYA 1HO4A 1LQAA 3CUIA 4FNUA 2GJRA 3W3OA 3GDMA 4XVEA 1Q66A 3R6IA 1J4EA 1VEPA 2CKSA 1DIKA 4D6HA 5C9RA 1UA3A 1QCWA 1HJWA 2VP8A 5HULA 1TCMA 2ZCGA 3VNZA 4DUXA 1WE5A 2O55A 4C6EA 4Z17A 3AXHA 1W1YA 3A21A 1OYCA 1F7BA 4S3BA 3K1GA 2C79A 2QCLA 5CPLA 3CV6A 1AL8A 1S2WA 1Q5MA 3HFYA 3K4AA 3BUVA 3WQVA 3BLLA 4B3KA 5C9XA 4IFKA 1E9YB 5HWNA 5KTLA 5ABTA 5BXRA 4ZB0A 3WZ0E 4P8XA 3V5FA 2QCEA 1KM5A 1S3HA 4FS9A 5DRCA 4FXFA 4JL1A 2PODA 4F8XA 2QKFA 3TTQA 2NWRA 3GIYA 4LALA 4XTIA 5K4XA 6REQB 3EDEA 1S2UA 3R7MA 3MUXA 1SMDA 4ZXLA 4E8DA 1HJXA 3VCRA 2PP0A 3O3RA 3GDBA 4NJIA 1FRBA 4JTKA 5DMMA 4PRTA 3EYPA 4ML4A 1PAMA 2W9MA 4UQ9A 5AB3A 1V3HA 4RDWA 4YVXA 3SGZA 3U7VA 4UTFA 2HDJA 2OVLA 4TV5A 3VTRA 1V79A 2WVSA 2ZRZA 3PBVA 2V2DA 1JCJA 1XH2A 1UWIA 2D3LA 3S4TA 3PPHA 1KCLA 4IJRA 2VOTA 3WJWA 4CLMA 1KWGA 1E73M 4AIOA 3T07A 4DWDA 1ONWA 3STFA 4AZ6A 1BYAA 3VNDA 3IJ6A 2PWFA 3QFEA 1DVJA 5HJYA 5AC4A 4MJ2A 1I9CB 1IGSA 4UTWA 2GJNA 3CMFA 3AWOA 4UMCA 7TIMA 3KBVA 2PDFA 1JZ5A 3Q37A 3Q2DA 4YTRA 3KRBA 1SSDA 2VEGA 4NAEA 2R1MA 4KMQA 3CUGA 3VMOA 3L4YA 3SGGA 3PF3A 2VFGA 5C5YA 3W53A 4QXIA 2EKCA 2UY4A 2VURA 2NSXA 1Y7VA 3W7NA 3NPXA 3DG3A 4IGSA 3PUGA 1Q6LA 1GYLA 1F4HA 3NCOA 4AZGA 4P7QA 3IARA 1UIOA 4MNLA 4U4MA 5HQEA 1S5TA 4ZCWA 4Z0JA 4Y9PA 3NNTA 4HYRA 1HO1A 5CSRA 2PWUA 2DSKA 3W1MA 1J2WA 1ZS2A 1E9LA 2DZUA 5EYWA 1KBJA 1UQYA 2PBOA 4Q4SA 5BRPA 2HJPA 5M17A 2Z00A 2QZRA 2PDXA 3VUSA 3S1UA 4GY7A 3EWUA 2YKKA 3GFXA 2PTZA 1TWIA 2VYOA 1KR1A 3ZMRA 3VKKA 1CBGA 4MF4A 4L1GA 4DJEC 4C6JA 2I56A 2WJFA 4BQ3A 3SY1A 2FPTA 4DQWA 3I10A 3VCNA 4K68A 3WQEA 2H3BA 4PMNA 3TE9A 2J77A 4AZ7A 3TQPA 3WLJA 1UASA 5FCZA 3EWBX 1TV4A 1NWUA 3U9IA 3U57A 4R3UA 1TO3A 3WY1A 2BVDA 4J3XA 3U48A 3WUEA 3B9AA 1HN1A 4JHOA 4L5ZA 2VGBA 1EP2A 2ZUTA 4IMDA 5C2XA 6PTDA 1DJXA 1XLHA 4ZXOA 2HVMA 2CIPA 3W07A 3PZQA 4O8AA 2C6QA 1Z32X 5CKSA 4UBPC 8XIAA 1HNYA 4PMXA 2E5DA 2YCLB 2EG8A 1E1CA 3O8AA 1XJBA 2FTPA 2OXNA 2GVYA 4H6EA 3LN3A 4GG9A 1G4EA 4JGDA 5E0KA 4Y9AA 1WBJA 3T81A 3GXFA 4NP7A 3N9RA 1YX1A 1JAEA 5MKGB 5DX7A 4GYKA 1RQBA 1V0NA 2DVTA 4LVBA 3A47A 1TPVA 1E70M 3WH8A 1NOFA 5D02A 1HIZA 1XI3A 2PF8A 1GKRA 1QI4A 4XG1A 5HJXA 3LNMA 2A6LA 2VX4A 1BXCA 3SW6A 1AL7A 4EAMA 1GHSA 2V3EA 2ZRYA 3SFWA 1VEMA 3I7RA 4ZSTA 4PCTA 3TSBA 2PPGA 5FI8A 4F9DA 4UNIA 3F03K 3TC3A 2R8WA 9XIAA 4AAJA 2HK1A 3Q94A 2R24A 3UR5A 2F7FA 4MY1A 5ABHA 4ML9A 1F2JA 1XIGA 3WFZA 4UQEA 1EQCA 4HSHA 1VFFA 2UY2A 3CHDA 2DQXA 2XIBA 3KUMA 3QPEA 1VCFA 2WANA 1FWHC 1VFMA 5HATA 4KRTA 4B9YA 8XIMA 2ISWA 1ICSA 1VFSA 3ZT7A 4IQDA 1TR1A 4KWVA 3OHIA 3KLLA 3NYZA 5TD4A 4LXFA 3WNMA 2ABAA 4DBDA 4DNMA 4JHMA 2WVVB 2QCCA 1OGSA 3QV7A 4V33A 2PGFA 1C90A 5U7SA 2OEMA 3W1TA 3UWYA 3R12A 2XVKA 3ZLHA 4JTRA 1XH1A 4RCXA 3G0SA 4GNJA 1GOIA 3P5YA 4YCOA 1FH9A 3G18A 4AYSA 8A3HA 3DHDA 1JPHA 1Z89A 4PMRA 2Z26A 1E9ZB 1ZJBA 4GPNA 2OFJA 4CQ9A 4HK6A 3STEA 5D2TA 1WDRA 1C29A 1REQB 2V2CA 3SIMA 5AC8A 4WKAA 4BY3A 2PDIA 3GQYA 2GYIA 3KWXA 3VKJA 4ZO6A 1DXIA 4HP5A 5REQB 4O10A 3S83A 3DAQA 3T7VA 3M64A 1CGUA 4FXJA 4NZJA 5G2IA 3KBMA 4RE4A 3FHAA 3AIWA 4Q8QA 3WEZA 1XXXA 3DI1A 3UJ2A 3CZKA 4W5ZA 1DJQA 3K2GA 4GVGA 3IIXA 3CQKA 3CJPA 2VTFA 2DH3A 4LYPA 5EU9A 1FWAC 3THQA 3WLOA 2DIKA 5DT7A 3G0UA 3UY7A 1MDRA 4FX6M 3GXIA 5I2UA 3JUGA 1ZJIA 5CBIA 1D3HA 3CZ8A 3G1VA 1BSIA 4O8RA 2X0YA 1WYIA 4NAFB 1TTQA 3GU2A 1OM0A 4O15A 1NY1A 4O1BA 4X9SA 2VL4A 3NA8A 3IJLA 1TV5A 3ZJ6A 3IUHA 2ZZ3A 1CGYA 3LHZA 2Y8VA 3E96A 1A3HA 2Z7GA 4HT3A 1PYFA 4N6EA 2JBMA 4FI4A 2ISVA 4OZOA 1UC5A 2YYTA 3U2EA 3E02A 4AZCB 1XHGA 4ZMGA 3BG3A 5I5RA 1GVOA 4IPJA 3SRFA 4W8AA 1X97A 1FFQA 1WZLA 3VIMA 4LNCA 3R8GA 4NZ1A 5CGQA 1SM9A 4OOZA 1JAKA 3TSDA 5JVLA 3S2LA 3G1RA 1X38A 2Y88A 1XDJA 1S2TA 1ISZA 3STCA 1YXDA 1GVRA 4L4LA 1A0DA 1RVGA 1FHUA 1NWTA 4NY2A 3PJWA 4NIRA 4AD1A 4DXKA 3DYMA 3GVRA 5A8GA 3P93A 1VBHA 3FAXA 3N15A 1NAL1 5DY2A 2ZIDA 3BLEA 3N2OA 4G7FA 4O4WA 3MMWA 3M5XA 4CQ8A 4E4UA 3CHFA 4YJ5A 5H1WA 1QPOA 2HWGA 2CXGA 2G37A 3W7RA 3W01A 4TIMA 2IQDA 4DI8A 1HL8A 2WHKA 3FFSA 3S5SA 2AQWA 5CPQA 4OFCA 3VGGA 3QLDA 3L0GA 3EPOA 4OE7A 2WB5A 2VKZG 3VYLA 4U2YA 3HGRA 4DZIA 3PTKA 4P61A 1EFZA 3H2EA 1SJAA 4OQVA 3S1VA 3B06A 3C2FA 4WRHA 2YFNA 2NUXA 3BCDA 4DN1A 2R82A 3I6EA 5LIUX 3C8FA 3L9CA 3QEZA 3WDRA 1SO6A 4RL3A 3N34A 4N4QA 1AMYA 1G94A 4DXXA 1F05A 5FACA 3PAOA 3AQUA 3W2JA 4IIBA 1E0TA 3ABXA 1YTEA 4E6MA 1ZP4A 5FF4A 3LCHA 1HJUA 1GEHA 3PBMA 1KFWA 3UWZA 3ID7A 1UBSA 4MHBA 1RR2A 3P81A 3WD2A 1MQQA 3W73A 3GWQA 2IPWA 1QW9A 1ODZA 1Q2SA 3F2CA 2EPHA 1EOMA 4QJ5B 1Q6OA 4NNBA 4WKHA 1KM0A 3EXRA 4LFYA 1W54A 2EPOA 1SFSA 1PXGA 2J9XA 4W8LA 1UP0A 4HKPA 3PNZA 5D37A 5FIPA 1FCBA 4KFOA 4QCEA 2V67A 5FSEC 3MS8A 3L5LA 1A0CA 1WQ5A 1TPH1 1Q6EA 3CTTA 3GKAA 2J8GA 1HVXA 1AQ0A 3QRHA 2PLCA 5FJJA 1JQVA 3IIZA 7XIMA 1U2YA 1DJYA 2BY3A 3W7KA 2OG9A 2NLYA 5GJNA 4DJED 4PMDA 1IXOA 3CQ0A 5CZJA 3H2MA 2AL1A 2BXYA 4WSJA 3CIWA 1UWQA 4IQEA 3WBXA 4AX6A 1M1BA 2EAWA 4DUOA 1TWZA 2Y4SA 3TMLA 1MNZA 2WSQA 3LCGA 1V6TA 1XW8A 5F2LA 1DWFM 3H2OA 1T99A 1UD4A 2GL5A 3MU7A 1N8FA 3KZPA 4QG6A 1K8CA 4I5UA 4BEQA 3GH4A 3EEZA 1ZAJA 1NWRA 5F4WA 5CZTA 4JKLA 1UKSA 1P0NA 3CZLA 4HCDA 3I4EA 1BYBA 4MNJA 1VBJA 5MF5A 1DYSA 1BPLB 4HOWA 1KTBA 1MSSA 3DERA 3IGHX 4Q4RA 3CLWA 1J0KA 3VX1A 4JN8A 1I75A 3NQBA 3HTWA 4GXPA 4Z1CA 1O94A 2QUUA 3FXGA 3PC0A 2QIIA 3W0KA 2QJHA 2ZVIA 3NUKA 5G4WA 5LA2A 4L80A 3EX6A 4GCXA 1XPYA 3EEGA 2G4JA 1QWGA 3DG6A 2WM1A 3GG7A 4NRRA 3R8HA 4JIHA 5HQLA 2VFFA 1OZMA 1DWIM 1AODA 3CAKA 1H5YA 4NJHA 2BVYA 4BQ2A 1OX5A 3UR2A 2WWDA 1LBLA 1QOQA 1SO3A 1F3TA 5EBAA 2QJNA 2J75A 4MG4A 1YPFA 2E3ZA 3BO9A 4GIRA 4GRSA 4HZ7A 1TR9A 1SJBA 4HZ6A 3KAOA 1KWKA 2J7EA 5AOUA 1IZJA 1T0OA 3LPOA 4J35A 1X7IA 1EP3A 5I6SA 3UR7A 1K7XA 4ZSUA 1RY0A 5AHLA 2OSWA 3SUSA 3K4DA 4ZTXA 4QDPA 1XR2A 1CCWB 3H4GA 4HK7A 2QEZA 3C0QA 4HN8A 4IH3A 4LANA 1TQJA 4GVFA 4WQ6A 4ZQRA 1WPCA 3UCCA 1UC4A 3ITOA 4JFWA 3DFNA 2EHHA 2VD9A 3HPZA 2BFGA 2QDGA 4TO8A 1CX9A 4XKYA 4UZUA 5KEZA 4YYCA 1O66A 3KRUA 3K1DA 1Q85A 4C5ZA 3MSDA 4PR4A 3E12A 2NLIA 3N4EA 4F9JA 4C90A 6A3HA 4DO6A 4HB7A 2E1DA 2A5HA 5T9CE 1HGYA 2XH2A 3E5PA 4FOUA 5EMKA 3LBMA 1FWBC 3QMSA 1A3WA 1DP0A 3DHUA 3E0IA 1RSCA 1B2YA 2D0GA 3NZPA 3OQ8A 1HUVA 1UG6A 1FWNA 1TX0A 4D6IA 4IMEA 4GVIA 1W3KA 3B9OA 4XZNX 4P2VA 3DKLA 4YCPA 1TJ0A 3OGSA 4HPJA 4M7SA 4PH6A 1HW6A 4OT7A 4JBRA 1VF8A 3W1NA 4GFSA 1O5KA 2ZUUA 2E7FA 3JRKA 4Y90A 1QAPA 3ITLA 1E5JA 1AH3A 4GQGA 4JFTA 2W62A 2J7FA 2Y70A 1DHPA 3HFTA 4ADTA 2PRMA 3PK7A 1PKLA 3COTA 1NVMA 3H55A 2A7NA 1VCGA 3SECA 2AL2A 3AYTA 2YW3A 1RHCA 2HS6A 3VIFA 3HG2A 4GI9A 3EGJA 4UQCA 3LQLA 1HJQA 1UQZA 2ZA2A 3PZTA 4QJ3B 3C2OA 4MDPA 4GFIA 3WMCA 4L56A 1DPMA 3MZ2A 3MBFA 1DORA 2UY5A 4JEQA 3QR3A 1UYQA 3TOYA 3THUA 1ZLPA 1EC8A 2MNRA 1VIZA 2E0PA 3TFCA 1TPFA 1EJTC 4C1KA 3EB4A 3KVLA 5HMSA 5FJTA 3MDWA 1XGZA 3ZWSA 3CUXA 2J4GA 4JEJA 4B5VA 3W2KA 1JD9A 2V3FA 4C6FA 1F6YA 3B8DA 3BGJA 1CENA 1A5SA 4CD4A 1PTAA 2DZXA 3W27A 3PWIA 1E4MM 3F5LA 4S3DA 2CYGA 4L4MA 1JR1A 5LIKX 4M82A 3GE7A 4CKQA 3LUTA 3CB8A 4AZIA 1V3LA 3A22A 3M0KA 7A3HA 3TMQA 1XGDA 3B0YA 1ZU8A 1R9YA 1MRAA 5A8NA 3OODA 3R0DA 4NT0A 5FL1A 2R1LA 1Q13A 1RJRA 3IJ7A 3MJYA 2Q8LA 1FBAA 5L6UA 4GC3A 1E6QM 2FZMA 4MGGA 4YYFA 3GY1A 2QT3A 2VFEA 4B2DA 4M1BA 4QLLA 4WHBA 4XUGA 2Y62A 2J9ZA 3NXLA 1F3XA 2C13A 4A21A 4EXQA 4V28A 3WUFA 3V1PA 1ECEA 1NQ6A 3MI6A 3V16A 1HL9A 2Z4GA 5LHEA 4YPJA 3MCMA 4H9YA 1W9DM 3D5HA 4CCEA 1ECQA 1LRQA 5BRBA 4CGTA 5DMLA 4UWMA 1EUAA 2Z27A 1WP6A 1OY0A 1W0MA 4XD6A 4EX4A 4PBFA 3WF1A 1MUCA 1R38A 3THAA 1LRNA 2QCDA 1NFBA 3S1GA 4KRUA 1PS9A 3GS6A 3AXIA 2X1RA 1JYWA 4FXRA 5CBJA 1EGZA 3VE7A 2Q3RA 2YLAA 4YU1A 4RV8A 1Q45A 6ALDA 4Y8FA 4PTWA 2C71A 1LL4A 5D8WA 3W7JA 2ZXDA 3G1XA 2BBFA 4PL2A 3WK3A 1UH2A 3BSHA 1SMAA 1XYMA 5FAJA 1YPXA 1SZNA 2EPMX 1D8WA 5JBDA 3WJZA 1TVLA 2FZNA 1QO2A 3TA9A 3O0KA 8TIMA 1DWAM 1GVYA 3APYA 1ZZMA 4U5KA 2OSYA 4TVCA 4AHPA 3ARTA 4Y7EA 1RD6A 3EOOA 1F4AA 7REQB 4UFKA 1HKMA 4IQLA 3E5BA 3LSBA 1EEPA 2WBGA 4UMAA 2CLPA 4PTMA 1QVBA 2CC0A 4M24A 4P8WA 1XCXA 2W0UA 1AZ2A 1X6NA 2WJZA 3HPFA 1XP3A 4L1XA 1POKA 4I5XA 3E49A 4JQAA 4J3TA 1SPQA 2ZX6A 1XRTA 1G7VA 1Q8AA 1VENA 4KEUA 3T08A 5D8ZA 3L4VA 3HM7A 4HSNA 5EFDA 1DIOA 2VDHA 2GUBA 2QJJA 3PTQA 5A8MA 2IQ0A 4F79A 1QMLA 4O13A 5SWUA 3WELA 1GJPA 2VFIA 1QPQA 3DFQA 1OGBA 1QRQA 1W5MA 3WDQA 4AB4A 4DLFA 1I2OA 2DT2A 3WEMA 4IIGA 3IK2A 3BAXA 2PTXA 4IZGA 4LVDA 1IT7A 4K38A 1XC6A 1LTDA 3DG7A 3IK4A 4S38A 3ZQ9A 3WQCA 3ZT6A 4Z1YA 2I9EA 3PULA 3VC5A 1UHVA 1JDFA 2ZZ5A 1GVQA 2GQ8A 1QI3A 4IWWA 3ABZA 3NQVA 1RLCL 3W7QA 1X6UA 2QYGA 4Y2WA 4FF7A 2DZSA 1P0DA 3B9EA 4LRSA 4H1ZA 3RO6A 1VBGA 1RQHA 3PFMA 1KA9F 3HB9A 2A3HA 1P0EA 1L2QA 4AXNA 1T6MA 2REQA 1PHWA 3BICA 4DYJA 1R3TA 3D3FA 1A80A 1LOLA 4YHEA 4FOKA 4B5WA 2E6YA 1KKRA 3K8LA 1KM1A 3W22A 3IS4A 2XZ7A 2VI0A 1VZWA 2G8ZA 2OLHA 3G6MA 3TP4A 4XZLX 4ZFMA 3T4CA 2YLLA 3NJ3A 4BWLC 4GI4A 4Z42C 3NZRA 3VOGA 1XF0A 1J6PA 4OV4A 5GPRA 1VFUA 3W84A 4K7YA 4Q4QA 2D2JA 4J3WA 2GDQA 1DWGM 4ZGYA 3E74A 4I7VA 3WLIA 1I2NA 1FWGC 4WDUA 3RITA 4YVPA 3P0XA 4QNEA 4PC8A 1UUOA 1LRTA 2GVJA 3P0WA 2LLEA 1QATA 1F3EA 1C9DA 2FZ9A 3SCQA 2IUZA 2DW7A 3OU8A 1QNRA 3LGDA 1BF6A 1CXKA 1Z6KA 4JNMA 2Z2AA 2Z1BA 3AS0A 4Q7BA 1EQPA 3NEHA 2ZADA 3PZGA 4DYEA 2WPBA 3VOHA 1H50A 1G4PA 2GJPA 1MI3A 2DW6A 1XDMA 3EWZA 3SUVA 2V9DA 1KBLA 1PTDA 5T26A 4HMCA 4MSSA 4XX6A 4GLEA 1M68A 1ZUAX 2EG7A 5HK4A 3GNRA 1A50A 3ANVA 1FH7A 3D3AA 3GH5A 2DV0A 1XL9A 3AI0A 4NASA 1JIBA 2CBIA 1KTCA 3NQ6A 3R1ZA 2PLKA 3EMQA 5I7GA 4AHQA 5LNUA 3WQFA 2J25A 3TX9A 2AQVA 2VFDA 4JNYA 3GUWA 4C5YA 5F7UA 5D38A 1KFLA 2DZTA 4NZ5A 1EGMA 1VPYA 3FIGA 3W37A 3DFSA 2QAPA 1TMHA 2ZRWA 3GAYA 1QNVA 4MWAC 4OBSA 2JGQA 2ZTKA 4Q6JA 4GO9A 1XV8A 3PANA 4DXVA 3WNNA 2X1UA 3FJLA 4GYPC 5E09A 2BODX 4HZMA 5HMFA 1UPMB 2VVNA 1G4TA 1TTPA 2O7QA 1TMQA 1TE6A 3AZTA 2X42A 2R14A 2HISA 4G1NA 1GYNA 3SY5A 1TX2A 2YBTA 1LL6A 5G1TA 3OVQA 4H6RA 4BQ4A 4F40A 2A2IA 5M5DA 5CAKA 4N9CA 1KV8A 3UA3A 3AIBA 1KXTA 3WN6A 1O68A 4MFEA 3WLMA 4UTKA 3SCVA 3WBWA 1S39A 1H0GA 3H2FA 2Q09A 3O2LA 4WLCA 5IFTA 2IXVA 3AC0A 2X2YA 5D9MA 1E72M 3HG3A 4NILA 4O4VA 3PBUA 3WJYA 5XINA 3BLOA 1AD4A 4J1OA 3UZZA 2A6NA 3P2VA 3FX4A 5T9BG 4GUHA 1RPXA 1J0ZA 1JJKA 3WD1A 4LX4A 1BTMA 1PHQA 3V0TA 3KBWA 2I1OA 3BURA 2QIWA 4PCPA 1VHNA 4CNSA 3PTMA 3ONBA 4ZQMA 3AUJA 1XUZA 1J5TA 1Q8JA 3AYVA 4UR8A 2WMHA 4A29A 1OB0A 4NJKA 4W5UA 1S5VA 3N11A 3HGSA 1GEQA 2GLKA 1XLCA 1TZ9A 4FNRA 4QHRA 3STPA 5LNVA 3DYOA 3I7SA 2WC7A 2BGQA 4IP4A 3NTYA 1UD2A 3RUBL 4CD6A 1R2TA 4B5TA 3AHYA 1ZAHA 1J79A 4ZB2A 2PWDA 4MLRA 3UG4A 2CFFA 1YLVA 3FJ6A 2I5QA 2FZ8A 1KC7A 3EX2A 3A9BA 4IISA 3NYDA 4NXSA 2DGAA 2Y5JA 5DBTA 2MANA 3BC9A 5EMJA 2VNCA 2FGZA 1ADSA 3WFLA 3QOKA 4DX3A 3I6TA 1OYBA 1Q6CA 5CPTA 2ZX5A 3EOLA 4KGLA 3C2VA 1CPUA 4V1XA 3EDFA 1I2RA 3OOQA 3QOMA 4QE1A 5E9AA 3FDGA 2JKEA 1KGUA 5C54A 4GX8A 3R0UA 4G1KA 1R0MA 1OX4B 1JUEA 1QOXA 1A5UA 4JTIA 3KRZA 1B54A 1WAUA 3L68A 4KBXA 2NWSA 1BWKA 4GX9A 3AMKA 3WQGA 4ZOEA 3N29A 3UPWA 3UWWA 2GVGA 1M5WA 1JDEA 3CHVA 1IR1A 2CXEA 2PDGA 3HPXA 2WNNA 1EO7A 3TR2A 1TB3A 2OEKA 3AWNA 3QY8A 3CXOA 4ERGA 3N1AA 3TN3A 3AHTA 1LJYA 4ASTA 1OEPA 3C0SA 4K7VA 3NQCA 4P7RA 3CEPA 4NAEB 4S3CA 1TKKA 5GJMA 3R11A 4BS0A 1NELA 2XSXA 1J8VA 5CZSA 2FHCA 1FWCC 4LAZA 4XO6A 1YXCA 4WY0A 1UR4A 1IEVA 4W9TA 1Z42A 2RH9A 4ZQPA 1GONA 5HWJA 3MV11 1EUNA 5LNSA 2PAJA 3NM1A 4H01A 4KGJA 2V5KA 2XIMA 2PDYA 4IIHA 4DBUA 3N2BA 3VK5A 4QE4A 5I3GA 3A24A 1TIWA 5TQLA 5A1AA 2P50A 3QMRA 1ZY9A 4JS3A 3SSZA 3UG3A 1TWSA 3ANUA 5GVJA 2QV4A 1B5TA 3LNPA 4GINA 3WDJA 4UTLA 4OIFA 3MUAA 2JIWA 2G95A 5BWFA 4LUIA 3EBVA 5BU6A 2NV1A 3GXTA 2RDXA 1TYGA 1HKVA 1R30A 1IIGA 1JYNA 1L6FA 4YTSA 1GQNA 4KS0A 3FOKA 1Y8BA 2F6KA 2PDBA 4KWOA 3VA8A 3BL3A 1CB2A 5HDRA 2PA6A 3RCNA 3GW3A 3V36A 3SQLA 4S3EA 3SSJA 2P8BA 3LBOA 1WO2A 3KDOA 4Z2JA 1PV8A 3EX1A 3LS9A 2C1HA 3PJTA 2QAFA 1UR0A 3AYRA 1E71M 4C60A 3F7JA 1GPWA 1X98A 1XLMA 4YMZA 1W2PA 1ADDA 1US3A 3W1QA 4ZFCA 1H7RA 3ZVHB 3GG8A 2E9LA 4JIPA 4DZHA 3ANYA 4MWAA 4IHCA 1WUFA 1R3VA 1XG4A 3URNA 4QFUA 1LWHA 2NSOA 3UWQA 4NU7A 3CPRA 1E1CB 1B3ZA 1CT5A 4HHHA 4DB7A 4EWJA 5EL1A 5FF7A 2PDLA 3ES8A 4S2CA 1VLWA 3ARQA 3FCPA 2QF8A 1P7TA 5DMNA 3CUJA 2A85A 2NQ5A 3RNDA 2P88A 3O6CA 3V75A 1CXHA 2GDVA 4O16A 3DGRA 4KWSA 2XN0A 4O54A 7PTDA 4OBTA 4JQ3A 4JY9A 3MO7A 4I9MA 2XTKA 1A5KC 3C3NA 4X3ZA 4ORMA 1KBIA 4X9YA 1LL7A 3A6OA 1OIMA 1OQFA 4LAKA 2DVUA 3SUUA 3IJDA 4AY1A 4GKLA 3G1DA 4WSHA 4HIBA 3LEPA 2VC7A 3OBEA 4LPCA 3RCMA 4LQ1A 2A4AA 2VOMA 4DELA 3MP3A 2PP3A 2JALA 1BXNA 2BTMA 1N8WA 3LB0A 1TUFA 3GG0A 3BLDA 3L23A 3BCFA 3UZ5A 3JZUA 3ZZ1A 3CASA 1O5QA 4WXZA 3S5OA 3LCIA 2VGFA 3LHWA 3WUGA 3RFAA 4CNOA 2Z1VA 1KRBC 5D2WA 4Z2KA 3BAJA 1M9HA 4REQA 4UR9A 2R91A 3CLMA 3TWAA 4UNLA 3GVQA 5CZKA 4LTSA 4TX6A 3RM8A 3WBAA 3VGFA 3GK0A 4BFAA 1WDWA 4O18A 3ITGA 4JX5A 2JK2A 2V3DA 1U22A 3BOLA 4QBXA 3SN0A 5FAGA 1CXLA 4ZQNA 1V6VA 3TC7A 2CLEA 3NGFA 2HEJA 4H7ZA 4GBUA 2CHNA 4MWAD 4E3TA 4GZIA 2G3FA 2XHYA 3HJZA 4Q3MA 3EWYA 3M41A 4FEZA 1FWRA 3QM3A 2E67A 4R85A 4WOQA 3P82A 3VNJA 3NQMA 3G1SA 2YXOA 2Y63A 1FTXA 3U2ZA 2R6OA 2YW4A 3S1WA 3B8UA 1XIHA 3RYSA 3OJGA 5EA9A 4G7EA 4D72A 5IHSA 4HU0A 4IJBA 1KFBA 2GZXA 1XRSA 3MKKA 2CLIA 3TNOA 3S2JA 3ALFA 3O63A 3CMGA 2POZA 3ARRA 1R3WA 3FHQA 3DOPA 3KL0A 3EPNA 1YNYA 3SCTA 4H83A 2XN1A 3REQA 3C0JA 1JGIA 3ZSTA 3GFZA 4KKXA 4AHOA 3AMCA 1A4LA 2NVAA 4QX4A 4US6A 4AY8A 3NGJA 1QU4A 2WPGA 4MUZA 1DXEA 3IVSA 3VM7A 5I79A 1JZ4A 4FR6A 1AVAA 2HPMA 2FMNA 4DBWA 1E0XA 4U28A 4N42A 4N6FA 3W7LA 2G3MA 2VR4A 4DWSB 4KETA 1MUMA 3BDKA 3UBPC 3W25A 1DXFA 3GHRA 3LPPA 4GISA 3U2OA 1J0JA 5GNZA 1GQKA 4GYFA 4K2SA 5DT5A 1XLIA 2FZBA 1ZENA 2C3ZA 3PHAA 4XWUA 4Q22A 3HG4A 1IXPA 5AYBA 5F2GA 3D47A 1L0PA 4W85A 2HQAA 3IRDA 1XLEA 4NHVA 1C92A 5PTDA 3MP4A 3E0FA 3W26A 3VINA 2WYSA 1OYAA 3L5MA 1LUCB 1FOBA 5D04C 3E9AA 5B80A 2D69A 1NM9A 1XCWA 2Y1HA 4O17A 4GMEA 4KCWA 3TU9A 4WGXA 3EOSA 3U8GA 4TX9A 4NNCA 3AXMA 1ZRQA 2BLEA 4ZE5A 4L4PA 1F76A 3ITCA 9RUBA 2WKGA 4A05A 5C2CA 4PYSA 4W7WA 3UNDA 1XICA 1GZGA 3ZXWA 4ZL1A 4XBJA 4CEXC 1VB9A 1C8VA 5LNWA 2FMOA 2YL5A 3BTNA 4JDBA 4BA0A 3QVQA 3RLVA 3WO8A 2A7RA 1A5NC 3CIVA 3OA3A 3P7YA 5B7ZA 4E2DA 1GHRA 1OFEA 3G8EA 2WKJA 3I68A 1QTWA 1R9ZA 2QCNA 2DIJA 1CIUA 3W7GA 4RR4A 2BHUA 3N2CA 4M8UA 4WVXA 4PA8A 1IWPA 3IUDA 1O5RA 3LHTA 1M3UA 1XFCA 2PS2A 2YDSA 2D2HA 3T2PA 4FLQA 4XBKA 3DFPA 4R5EA 3BG9A 4F2TA 1K03A 2XIOA 4E2BA 1W3JA 1HF6A 3VNKA 5BW6A 1RVKA 1V6UA 1YEYA 4W7UA 1JRBA 3QC0A 2VT0A 1PBGA 1PL9A 2B4GA 4LCRA 2ICSA 2ZXAA 1UKOA 4UOZA 2WVUA 1EC7A 3AIRA 1T7LA 1U83A 1BYDA 4AWEA 4CN1A 1UD3A 1HKWA 2E25A 4DBSA 3CWNA 1OJXA 2ACUA 3EMZA 1UW9A 3DDMA 4XD5A 3NPUA 4HNNA 4NZ4A 1QOPA 5H8MA 2OQHA 3GB6A 2J78A 1L6SA 3U4FA 3OTRA 4LW7A 4C6MA 3RM9A 3KCOA 2CBUA 5E70A 2OWXA 1SYTA 3E2VA 2Z1XA 1H41A 1RCOB 2VEKA 2NV2A 3RXZA 1M7OA 2PC4A 2IKJA 5HR6A 2R1NA 4HOXA 5ABFA 2IMRA 3GDRA 4C6KA 1CB7B 4OUIA 4MWAE 4ZO8A 4X0NA 4TU1A 2J8FA 1DHKA 5J5RA 1Q4WA 2OCZA 1WDQA 4CUCA 5D2XA 1OABA 4K36A 5HXMA 4W8BA 1ME8A 2YXGA 2YA1A 3OVPA 4DM1A 4ZR8A 2PI6A 1PTGA 1PZ1A 3FW6A 2NQJA 4XZBA 3VO0A 2BHZA 2B7NA 4AQLA 4QQUA 5DXXA 3W6MA 4KEMA 4JKMA 2QULA 4FX8A 1JCYA 2O4QA 3O06A 5BOFA 3A13A 2E6DA 2GQ3A 1WV2A 1CLXA 4UXDA 2POTA 3FN9A 2YXXA 3L66A 3WLPA 3LSCA 3E1F1 2QJMA 1FWIC 2VGIA 3T2QA 1EOKA 3EA2A 4RZ6A 2PCQA 4M29A 2A7PA 3LV6A 1E4NA 1GKPA 1KR0A 3MUY1 3WH9A 1DQXA 1R46A 2ODOA 4TTUA 5MHBA 4N4PA 1VBUA 4L9XA 2J7CA 4JTFA 3WF2A 2W61A 3QFWA 4MY9A 3N6QA 2WHLA 1ZAIA 3MKCA 3P14A 4QG9A 2DQWA 1J0IA 5FJOA 1L6WA 3CT2A 3F5JA 3SUTA 4ZOCA 2CLLA 2VEIA 3IRSA 4H9ZA 3MMTA 3OEXA 1AQFA 4NX0A 2WBKA 2BXZA 1S5NA 1JXKA 3QZAA 3DCPA 4RK8A 3GXPA 3PUOA 2J13A 3M9YA 3UWVA 2INFA 3BWWA 3AISA 1IXNA 4H00A 3SGUA 2P5NA 3M7WA 4O53A 3L2IA 3VI2A 4LYRA 1K4HA 2FVLA 2OLSA 1O95A 1BYCA 2WW5A 3OPSA 1FFRA 4CU6A 4Z1AA 2ALRA 5D2VA 3IANA 3SQMA 1RA5A 4A3RA 3CIXA 1YQ2A 1FCUA 2Y7GA 3RU8X 2E6FA 1QK0A 2X09A 4NKCA 4GACA 3QC3A 3QV8A 1W1TA 3SZ8A 4D2JA 3NM3A 2A1YA 5CG0A 3F1QA 1HKJA 1RH9A 4Q33A 1O60A 4LV4A 3URAA 4Y9OA 3ZM8A 4FXSA 1Z69A 1QW8A 1W5PA 3WK1A 4TXEA 4H9UA 3B8SA 3W24A 1RA0A 1UWAA 1J96A 1U30A 3FYOA 4YS1A 3F4DA 5LXXA 3P62A 2TAAA 3LBCA 3Q45A 5A6TC 1XQLA 1UUMA 3W7DA 4D6FA 2FDMA 5F4XA 3QPZA 1FX6A 2V0TA 1PB0A 3K8MA 3GRIA 3E2RA 1H2JA 1MW1A 4F2BA 1GUVA 1SZGA 1C93A 1E3ZA 1GZ1A 4GO8A 4KW2A 1BXBA 3IJIA 3I3BA 1SZFA 2GK1B 1W3HA 1QASA 2ABBA 2XJ7A 3TN5A 3WNKA 1TPB1 2INEA 4C7GA 2Q71A 5EMLA 2PMQA 3UW6A 1KLYA 2Y8KA 2XVPA 3HQ1A 5A3HA 3GXMA 2RGMA 3EKLA 2Y6ZA 3M0YA 3TSMA 3HF3A 1HVQA 5AVHA 3POHA 1JUKA 3HQNA 2B0MA 1SO4A 3DI0A 3SY8A 3LXAA 3KL3A 3LRMA 1XISA 3M5ZA 1V6WA 1KO0A 3GXNA 1UR2A 1FH8A 3IIPA 1GQLA 3QKEA 5M1TA 4PE8A 3GM8A 1ZSXA 2FGLA 5FEXA 2P1FA 3SM0A 3N2XA 1E4IA 3N2MA 4UR7A 5D9NA 3HQOA 1TV7A 2J88A 5A6KA 1SJDA 2Z25A 2ZKMX 3K13A 3TYUA 3W87A 3HMCA 2CNCA 1LT8A 3GZ3A 3HN3A 4AD0A 4F0SA 4JYEA 1W1A1 4K37A 3LCFA 1R2RA 3LMYA 2E1WA 3BSMA 2ZC1A 3VOJA 2OKOA 4NXKA 5C2GA 3EWCA 4Y8EA 1GKQA 1UCWA 1GQJA 2BNJA 4B5SA 1K9TA 3ZJKA 1H60A 4GH1A 1OFDA 1WB0A 5A6SA 2XU2A 2WSKA 1GVEA 3LGGA 1BVZA 5K4ZA 1UKQA 3UETA 2QV5A 4KCTA 3DBPA 4NZ3A 3OLGA 3RG6A 2ANUA 4N2YA 1OT1A 3NL2A 4E38A 1TUXA 2VMFA 2J7BA 4JN6A 2CLOA 4HA4A 2OGJA 4MOZA 3JVAA 3CB3A 4B4FA 3TH6A 1FVPA 4B3ZA 1R2SA 5DLCA 3NVDA 4TVUA 6XIAA 2YCLA 4F3HA 3RPTA 1PIGA 2WZEA 1Y5XA 2WSPA 1DE5A 4AU0A 3LX9A 2H9AB 3QY6A 1YBQB 3QPYA 2BZNA 1NFGA 4FALA 1R86A 3CL7A 2DZVA 4LVFA 2D0HA 5AHMA 5MKGA 5DN1A 1RLDA 3RRXA 3NFUA 2WMIA 1KKOA 3ZS4A 2X0SA 1FHVA 1ZQ5A 4BQ5A 2NW0A 1EXBA 3HV8A 5HBFA 2YPIA 2P53A 2PDQA 4JDYA 4DAIA 1PCWA 1KM4A 1EJ7L 4Q8WA 1JDAA 1UD5A 3RDKA 3EOEA 4EF8A 1GW9A 2QF7A 3S6DA 3C4UA 2F61A 1H49A 3RX3A 3BW2A 1NF7A 4KWWA 2CLKA 2XIQA 1W3TA 2EQDA 3ORWA 3UCQA 4BZYA 3FKRA 4WD0A 1W3LA 2VDGA 2G97A 4C1NB 4CQBA 4EXBA 4H9TA 4LVAA 2DUAA 3OO2A 4ERAA 1PZ2A 1K8YA 4RZ5A 4GVHA 2YOCA 3ARWA 4X22A 2DU2A 4Q8PA 2HXUA 1US0A 4LOCA 2WVVA 1ZGDA 2FHFA 4PMYA 2YA2A 3G22A 4F0HA 4EIVA 2JE8A 2WSYA 1XQKA 3W2LA 1E4LA 1X1NA 1EJUC 3KOZA 3B0XA 4O1FA 4HU4A 3N4FA 2ACRA 5CC3A 3CL6A 5IRPA 2V8ZA 3SN1A 3P74A 4ZQCA 4R9XA 3GW0A 3V0SA 3VD3A 3WQWA 4I90A 1QI0A 1VFTA 3WQ6A 2QMJA 2RJHA 1B4EA 1WX0A 3EA1A 2VEPA 3B8IA 1QBAA 3NO1A 4IFRA 1REQA 3RILA 1QNOA 4NYUA 4NI8A 1VR6A 1EIXA 1KXQA 3KOXA 1T40A 3EB2A 2X1TA 4LYKA 2QUVA 4DJFC 1U5JA 5REQA 3TONA 4ICCX 3K4WA 4QQ3A 1B3XA 1JZ6A 1J6OA 5HNUA 2W27A 4UIOA 1K02A 1JYVA 4FLOA 4ZENA 1I4NA 1Z9AA 4JTLA 4A8IA 3KEHA 2OPJA 2QDHA 4IICA 1MEWA 4FB7A 3FGCB 3N18A 3ARVA 1PDZA 1EH9A 2ZA1A 1CZ1A 2FQIA 3PBGA 2GVEA 4KIRA 5H2ZA 3FSUA 1O4UA 1OF6A 3DN5A 1Q2RA 3WLNA 4TQTA 3I65A 4NAFA 4M1RA 3LA4A 4LB4A 2O56A 4E2OA 1H62A 2DFAA 3ATYA 3BOFA 3I3EA 5DANA 4DI9A 2WHJA 3TTOA 3TYAA 3WLRA 2D23A 3H22A 1KGXA 1E51A 1N55A 3VD9A 2Y5EA 4HD5A 3BGAA 4S3KA 5F1UA 1PVNA 3HOJA 2VX7A 3W1XA 4L9ZA 3HURA 5KETA 3EWDA 4AZCA 5CXPA 3VOCA 8RUCA 3UP8A 2HROA 2VRKA 1CYGA 4RDZA 4LNYA 3RR4A 2GJXB 4M3PA 3R4IA 4PUNA 1SR9A 4C6LA 3N2TA 2V5DA 4AH7A 2CPUA 5AFDA 1W9XA 4WDTA 2ZZ2A 4UCGA 2H3DA 2PFHA 3CWOX 3AJ7A 4IL2A 1IV8A 1FDZA 3WD4A 4B16A 1J0YA 1I60A 4EACA 2PD9A 3W1PA 1YYAA 4G56A 3W29A 1YPIA 3O6AA 3UXLA 1AH4A 1TRIA 2XVGA 3LLFA 1QK2A 4IQJA 3PPCA 4UOJA 1EJSC 3TKFA 5G4HC 3QHMA 3F4WA 1Y0EA 2HE5A 4NX5A 4Q8MA 2BS9A 3CAWA 3PZMA 3H24A 2PRHA 1F5ZA 3V3WA 1YNQA 3PUEA 5E6YA 4I7UA 3P5ZA 3HIJA 1KB3A 2QPXA 5CSYA 1ENUA 3RX4A 1QWKA 2NQ9A 2W5FA 4XKMA 1P6BA 1PUDA 2EF9A 1JNEA 4HBKA 1JCLA 2ZFAA 4LUSB 2BV9A 2BHYA 1I2QA 4CEUC 3Q4DA 3CM4A 4MPQA 4O19A 3OB8A 3F4NA 3A64A 1F61A 3TN4A 3LPFA 3ABSA 3BAKA 1ZB5A 3OZYA 1P5BA 3S9YA 3R43A 3F2DA 2CZFA 3B0VC 4IGHA 4EPKA 5FD0A 4GI8A 2FJUB 5JU6A 4JX6A 5CG7A 2BGNE 1UOZA 4PSPA 9XIMA 5CCZA 1ESWA 4GY0A 4JQ4A 3WQ8A 3LV5A 3H7RA 3Q58A 4J27A 1LLOA 4JR5A 2OR2A 4PMZA 2H90A 1WXYA 1C8XA 1FWSA 3IUIA 4QP0A 5H91A 1UOKA 1M7XA 3GH7A 3V5OA 3HPAA 4N9BA 4UTIA 5XIMA 2OYLA 2RJGA 5D9PA 4MB1A 5J5DA 2G50A 1KD0A 3UF9A 1ZBKA 1QNQA 4LF2A 4OV9A 1MEIA 4WF7A 1FP9A 4DUWA 1LDCA 2C7FA 4AUBA 2WCGA 1KTNA 2D1ZA 5LXEA 5DRIA 4J5NA 1UKPA 1N82A 5JQ9A 1XG3A 2BDQA 2J7GA 1ISWA 2YCEA 3FJ4A 3VGBA 3EXSA 4LEQA 5B7YA 3B3DA 4MJMA 4AD2A 1PDYA 1V3KA 1A53A 3AYSA 5J8LA 1VFOA 3ME3A 3W7EA 5DBUA 3VD5A 2AMXA 1GTEA 1QR7A 3ITTA 1SGJA 5HAOA 4AVOA 3T05A 3ISIX 4HJWA 3GLCA 4POCA 3S42A 3AHXA 2ZQ0A 2PTDA 2X2GA 4D6EA 3G1HA 4BI5A 3DH7A 1L8NA 1ZTVA 1MFUA 3VAVA 1DJIA 4X2PA 4UCFA 1PX8A 3CQHA 2A3AA 3FLUA 3G24A 3GNPA 1WNOA 2IKIA 5ECVA 4UTHA 4WR3A 3SB0A 3UJRA 1HP5A 2HBXA 2WZTA 3DFOA 3H23A 2HS8A 3U0HA 3OYXA 4LS0A 1W31A 3OW1A 1FCVA 2PDJA 3BCJA 3PZVA 1GW1A 4MYXA 2W4XA 3K5XA 1G4SA 2F38A 3IV3A 2HNEA 4KWUA 4ROPA 5AC7A 1PCKA 1XIBA 3P84A 4W84A 4XUYA 4FOJA 3VZXA 3FVMA 1JZ8A 4K1GA 3TJ4A 1UH3A 3R79A 5H6HA 4C7FA 4HPNA 1J12A 2E9MA 5D2YA 5D05A 2ZX7A 1IEIA 1TELA 3TQVA 3FNDA 2YX0A 2DZBA 1GVSA 3S1XA 1E40A 2VRQA 2PWGA 3O6YX 6CGTA 1IQ8A 2TPSA 1K4GA 1E1EA 1PPIA 3PPGA 3RJYA 4V27A 1MVYA 2PDPA 2V38A 1G1YA 4U31A 3FXYA 4ROQA 3KOYA 4R27A 2XSBA 1P6CA 1E6RA 5I78A 1TE1A 3EMCA 3HG5A 3R89A 2TSYA 3CC1A 5A6JA 1LLWA 4O1DA 3H2AA 4PB4A 3S0CA 3QR0A 1Y65A 2XSAA 3WD3A 3U6WA 1B90A 2HBVA 2DORA 1H09A 1B57A 5CBBA 4HNLA 5HNNA 1YNPA 1C3FA 2XGZA 3LOTA 3BMWA 3PSVA 4OHQA 4HGXA 3E0VA 1HG3A 3P60A 1A3XA 2VR5A 3TDFA 3WL0A 2Y7EA 3E6EA 3L5AA 3PP7A 2QHAA 3LENA 3ZIZA 2EJAA 5I77A 1RQEA 2CITA 3B8WA 4AZBA 2X7WA 3CHCA 1P43A 1TIMA 3DYPA 3L2MA 2Y0FA 1CGXA 5C71A 4HMDA 4FNQA 3TXZA 2CLFA 1XBZA 3UCDA 3WJSA 3VD4A 2BY0A 4GXWA 5HUPA 2J6XA 4ZBCA 1XFBA 1HJVA 2C15A 3GR8A 1F8MA 4JTHA 1H1NA 5CC6A 4J3ZA 3C86A 4MIMA 3QH2A 1RUSA 2O9OA 3CTLA 1S38A 1BTCA 3RPMA 3EX4A 3A23A 2CZDA 4RE2A 3AIVA 8CGTA 3USZA 5BRQA 3VGDA 3GUGA 3QMTA 1UR9A 5C9WA 5KZ6A 1SJCA 3TIMA 1XDLA 2I9UA 4XTDA 4EWND 1WAWA 3H70A 3KP0A 4KT2A 4QDWA 1XIIA 4MAZA 4QLJA 1EZ2A 5IDZA 1V0LA 3CWHA 3ZR6A 2C19A 4IUOA 3PVFA 3UEQA 1UJPA 1CW2A 3UPBA 1A49A 2DIEA 3KL5A 2J79A 4C6IA 4DJEA 1H0IA 2OZ8A 3LMZA 5I24A 3TYZA 1V02E 4AEOA 3WENA 2C1GA 1G7UA 5HMDA 3WQPA 2RDTA 1US2A 3HV9A 3M0XA 3PG8A 3Q67A 5FJUA 2IS7A 3AO0A 4A35A 2E68A 4IPLA 1D9EA 3N4AA 3W1UA 1DEDA 1EJRC 2WZMA 4FHAA 2W79A 1G01A 2DSVA 1BHGA 4E5TA 4ZODA 2O9RA 3V5CA 3W85A 1HFBA 3TCEA 3GTHA 3E0WA 1KFJA 3PZIA 4ZA0A 3G3MA 4PMJA 3M0MA 4BKNA 4DF2A 3I7QA 3MO4A 3UJSA 1P1MA 4AF0A 3NQ8A 1N8IA 4YVVA 3C8NA 3UPMA 1DQWA 4ONVA