4TMCA

Crystal structure of old yellow enzyme from candida macedoniensis aku4588 complexed with p-hydroxybenzaldehyde
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
399
structure length
399
Chain Sequence
MSYMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAPGNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFNAIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHGITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIENRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRARAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQATLDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYTFTKEGYTDYPSYEESVAKGYKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Old yellow enzyme
publication title An Engineered Old Yellow Enzyme that Enables Efficient Synthesis of (4R,6R)-Actinol in a One-Pot Reduction System
pubmed doi rcsb
source organism Kluyveromyces marxianus
total genus 152
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tmcA00
2FIQA 3SFKA 5HMSA 1F2JA 4R34A 2A7NA 4LS0A 1M7OA 1LBLA 3PB0A 3LCWA 3N2XA 3I65A 2E77A 3ABOA 1EX5A 1F76A 4LTSA 3NQ8A 3O6YX 4ORMA 1G7UA 1TRIA 2PRLA 2A21A 1QWGA 4GE8A 5F4SA 4GRSA 3A5VA 1BWKA 3FKRA 4HNVA 1TB3A 3LOTA 4QAIA 1O95A 3W7IA 4DO6A 2ZZ4A 1SW3A 3MP3A 3DGRA 4ZQPA 2A7RA 2WV8A 2CLEA 4QITA 2VEMA 3MWAA 2GPTA 2ZTJA 1XUZA 2VENA 3S1VA 1Z48A 2X1RA 5HR6A 1TTQA 4NJKA 3QW3A 3S1UA 2GQ9A 4YLWA 3FA5A 5K4XA 4CCEA 2DZXA 1LRQA 2ZYFA 3ATZA 1QNVA 2ABAA 3W1XA 2A7PA 2YW3A 3DFNA 1KV5A 3ZFHA 1C8VA 1DHPA 3HPXA 3N9SA 4UFLA 1LYXA 1KM5A 4JGDA 3G1HA 4IOTA 5GVJA 1BEUA 2QDHA 5KSWA 3GYEA 1XFBA 2B0MA 1HO4A 3L5LA 2YX0A 1YTEA 3E02A 2NLIA 4DQWA 2Z6JA 1SSGA 5AHEA 2B7QA 3O8AA 3WJYA 1LBFA 2ZQ0A 4IGHA 2QJIA 1H7XA 1L6YA 1VYPX 1VGAA 3TC6A 4EIVA 4ZQMA 1LOLA 3A23A 3HIJA 4UTMA 2H3BA 5FF0A 2BZNA 3IVUA 5BRBA 2X1UA 3GXTA 4N2YA 1RQEA 4JIPA 3TAKA 3DFSA 3E12A 3V1PA 4ML9A 4K37A 3G0XA 1KFJA 2XN2A 3NQVA 3F4NA 3KVLA 2Y85A 4AVFA 1ZNNA 3T40A 2ZDRA 3HMJG 2TSYA 4GFSA 1X1ZA 3FYPA 3IGSA 2F84A 3W1QA 3R13A 1YPIA 4JTJA 5KZEA 3W72A 5CPNA 3NGJA 3N14A 5K7JA 4PL2A 4Q32A 5G2WA 1L9WA 3GR7A 2NUYA 4Z08A 4UMCA 2PCQA 3MBDA 3O6CA 3WK3A 4JTSA 1EP2A 3GXPA 4IJBA 2WSYA 3LHVA 2FPYA 2Y7GA 1GPWA 4OU1A 1CX9A 3IIOA 1JCYA 2ZCGA 3LBCA 4FEZA 1DORA 1XKYA 1O94A 1OYBA 1K02A 3IV3A 3P74A 5D05A 4TIMA 1TPUA 5HUOA 1S5WA 1A5CA 1TV7A 3G0UA 3IVSA 2BLEA 4MYXA 1J2WA 5CG7A 1ZFJA 1T0OA 3KAOA 1TQJA 2JK2A 3IIZA 5G1TA 2NV2A 4YCOA 4H4IA 4PFMA 1OVDA 4I9AA 5K9DA 3DHDA 2Q3OA 3NA8A 4R7JA 4LY8A 4Z1CA 4DXVA 2QUUA 5KITA 2QDGA 2E5CA 4WZHA 1THFD 2E1DA 1X1OA 3A9IA 1RD5A 4IMEA 1IXQA 4M7TA 4FNPA 4N6FA 2DZVA 4ONVA 3BO9A 4MPQA 1H7OA 3EXTA 1H1ZA 1OX4B 3BK0A 4EF8A 3RFAA 4WY0B 2R94A 5AYXA 4LC8A 3N2MA 3WK0A 4ZL1A 3KHJA 1I2NA 3EEGA 3YPIA 3G1XA 5KTLA 3UXDA 2OX1A 3KRUA 2KZHA 2PRMA 1L6WA 1H7RA 3UY8A 3O6DA 1JJKA 2A85A 1TQXA 1TJPA 2G96A 2BWGA 5F1VA 3TX9A 3NYZA 3G1SA 3HBLA 3G22A 3TW7A 1FQ0A 3ABSA 2A5HA 1WBJA 3PBUA 1P0NA 1RR2A 1W31A 2C0AA 3M6YA 3L67A 3P7YA 2ISVA 1M6JA 2Y88A 1A5AA 3W2JA 2V82A 3I68A 1MO0A 3PF3A 3GDKA 1SO3A 3GK0A 3W7DA 4O4VA 4OWGA 1WX0A 4FNTA 2NZLA 5AOUA 2VFIA 3W70A 2CFFA 3SSJA 3PSWA 2ISWA 2W0UA 1FWWA 4HT3A 3OVQA 2PURA 2B7OA 1EWEA 3RF9A 1EUAA 1PHWA 2YXGA 3W88A 1X6UA 3B04A 1F7BA 3P5YA 1J5TA 5C6MA 3LXAA 4EOUA 1EP3A 4NJGA 1TPVA 3JRKA 2V0TA 4OT7A 1G6CA 5A5WA 1XBVA 1JQXA 2C1HA 3G0SA 2YFNA 1IXPA 4ZQNA 1IXOA 2H3DA 4NJHA 2WNQA 3NPUA 5MHBA 1EWDA 2VC6A 4O17A 4GUFA 3MBFA 5EYWA 3M9YA 3DENA 4IPJA 3S1XA 3CWOX 1TSIA 3TCEA 3M0ZA 1H5YA 2QCHA 1TYGA 1OABA 3D0CA 2DP3A 5D2WA 4OV9A 3NO5A 4PTNA 3GB6A 1DQWA 3UWUA 3QC3A 2OCZA 1A50A 4ZVJA 1W5OA 1KM2A 4LWWA 4E2BA 1VCFA 1XDMA 4FNQA 4BWLC 1VQTA 4GUHA 1QPQA 3VFLA 1JRBA 3W75A 4BR1A 3DZ1A 1RZMA 1IIGA 1XC4A 1TRDA 3NQ2A 2ZZ7A 3A22A 2ZFAA 4XTIA 4O53A 1SO6A 2RKXA 1ME7A 3PULA 2NUWA 3EKZA 1R47A 2Z0IA 4UTTC 3GXNA 4Y90A 3TMLA 4RXGA 1SZFA 1FUYA 3CPRA 3W83A 4NZJA 4GNJA 4HNNA 3THAA 4OHQA 1MZHA 1ZAJA 4RV8A 3S9YA 1GTHA 1W3TA 2X2GA 4E0CA 2FLIA 3FFSA 2NX9A 2FDSA 1TPDA 2JKAA 3EXRA 1BKSA 2DORA 1KTBA 3CTLA 5KMYA 4YMZA 4MUZA 4RZ6A 5E0KA 3G1YA 3O63A 5K3VA 1IF2A 1H51A 5AC7A 3UWQA 1GVSA 5HWJA 4BI6A 5HULA 5BMWA 1N8FA 1TV5A 3VCRA 1FXQA 2WJZA 3W2UA 3W87A 2V5LA 4HPXA 4LS1A 1H61A 3M5VA 1DV7A 4WY0A 4WUIA 4LVAA 1KM4A 3IIXA 3LXBA 1AK5A 4O54A 4UFMA 1TJRA 3W73A 4AHOA 1VCGA 2QCLA 4XBKA 3UD6A 1G4PA 3WFAA 2CLFA 1OK6A 1W5NA 4M5PA 1L6SA 4UTKA 1EA0A 1G7VA 3VI2A 1W8SA 3EB2A 3IIVA 3W1PA 3M7WA 1HFBA 4KFPA 4Y8FA 3W1NA 3L5AA 3NQFA 1O60A 2ZZ3A 2I14A 3OIXA 2J9ZA 5H91A 3UWYA 1WYIA 3HG5A 1FX6A 3CHVA 1YYAA 3CWNA 1ME9A 4TU1A 4WXYA 3GLCA 1JRCA 4JEQA 4OQVA 4LVBA 4K39A 4JICA 1QPRA 3G1FA 3STEA 1ZHAA 4N6EA 5AYZA 2ZZ5A 5D2YA 1QDSA 5AHLA 1VLIA 3B4UA 5K9XA 4FX8A 4PC8A 3NL5A 2E6DA 3SIZA 2QCNA 1QMLA 4NNAA 3TH6A 3TFXA 1H7WA 3T78A 4FO4A 3QW4B 4X2RA 1UUMA 2J9XA 3W7GA 1KM0A 4DPQA 2Y7FA 5I3IA 1JR1A 4LU0A 3JR2A 5F2IA 1SU5A 3U8GA 5FF2A 1F5ZA 3ZWSA 5FEZA 3C2RA 3TAOA 4QNWA 5AYYA 5CZTA 5C2XA 3DFOA 4LVFA 4NNCA 4POCA 4FX6M 2GUUA 3PG8A 2EHHA 4JY9A 1W54A 4GUGA 4YCPA 4ADUA 2CLKA 3DFPA 4M6QA 1G4SA 4R53A 2B4GA 1W1ZA 3EX4A 2CWNA 3LHYA 4Z0JA 1F6PA 1YDOA 4MFDA 1M7PA 4CQ9A 2CZDA 2H6RA 2VKZG 4MY9A 5DY3A 4A22A 3WK2A 1B9BA 1VYSX 3I7QA 2R91A 1NF7A 4UFJA 4LRTA 1OG0A 3G1VA 1ML1A 2GVGA 5DY2A 2P10A 5K9CA 3NOEA 1JCXA 5J5RA 4BWLA 4H3DA 4I7WA 4JTIA 4UTWC 4LV4A 4X22A 2QCEA 3M1ZA 3C0JA 4HNTA 4LW7A 1NEYA 1YDVA 4YL2A 4JTGA 3W1MA 5EL1A 3KVKA 4UTHA 2H90A 3FS2A 4CQ8A 1RPXA 5AB3A 1GYLA 5C5YA 4PL1A 4UTTA 5CPMA 1KLYA 4XKYB 3PG9A 4N9BA 1G67A 5FF4A 5I3FA 2ATMA 4M6PA 1S3HA 1VJIA 4UNLA 3DU0A 1YTDA 3MYPA 4ZMGA 4O8RA 3W7MA 5LNVA 4Q33A 1XDLA 2V9DA 4QQ3A 2E6FA 3NM1A 4JXCA 4OBTA 3HQ1A 4AWSA 1K03A 3LHUA 3E49A 1OFOA 3VE7A 4DBEA 4PH6A 4EF9A 5HWMA 3R8RA 3B0UX 3RK8A 2HTMA 3PBVA 4FNRA 2AQWA 3CM4A 2ZZ1A 5T26A 1W5QA 3O05A 4KFOA 3W76A 1SZEA 3OVPA 2NX3A 3WK1A 2CW6A 1AW2A 4YWIA 4UTUA 1QOPA 3W6YA 3GZ3A 2C3ZA 3GAYA 4DF1A 1OHLA 3SR7A 1TPEA 1VHNA 3TDFA 1WDWA 5CSSA 1YPFA 1U5JA 3S6DA 3P84A 3HJZA 2DZTA 5HJLA 3QSTA 4JY8A 3MYOA 1DJNA 1QPNA 1K7EA 1A5BA 4GXMA 3N9RA 3MMTA 3TUUA 3RNDA 2CZ5A 2H8ZA 3I6RA 3A24A 3M47A 3MJYA 4O0ZA 3GNNA 1WOAA 1VLWA 1B57A 3KRSA 4CCCA 3TFCA 4UCGA 1FCQA 1VS1A 4ADSA 5J5DA 1B4EA 1SUXA 3M41A 3TC7A 4O10A 4CCDA 2A6NA 4HPJA 5F2GA 3L9CA 4K8EA 1NF0A 1KV8A 3NPWA 3QMTA 5D32A 4HHPA 3W2KA 1WA3A 1FWRA 3EXSA 3L0GA 2NWSA 4BK9A 6ALDA 5D37A 4MY1A 4OV4A 1LRTA 1P4CA 3ABQA 5CPOA 4Y6GA 1DJQA 1JVNA 1T96A 3UWVA 4Q4KA 4ALDA 3W74A 1K8XA 2W6RA 3BLIA 1GWJA 4WQ6A 4QIUA 2UV8G 1AL7A 2GJLA 2V5BA 2ISSA 1XBZA 2D73A 3EWBX 1X8FA 1QCWA 3NDOA 1TTJA 4UTJA 2RDUA 5TQLA 3G24A 2WQPA 1KTNA 2I1OA 5LSMA 4JN6A 3TROA 1GYNA 1W37A 4O0KA 4I7UA 4A29A 3W2LA 2EF9A 2J6XA 3AO0A 4DF0A 5G5IA 3TSDA 1N7KA 3O15A 1XCFA 1LORA 3OHIA 2EAWA 3UWWA 1FCVA 4AHPA 3GDMA 1MEWA 1QPOA 8TIMA 3VE9A 2QUVA 3W7LA 4BI7A 2H8XA 3BGGA 3EX1A 2YDAA 4RXFA 3B0PA 5SWUA 3P5ZA 1FWSA 4IXXA 1GT8A 4LUIA 3B8DA 3LI0A 3O07A 2A0NA 1R2SA 3ZS4A 1XUUA 5LZLA 2C18A 1V7YA 4MVAA 1QOQA 3P8IA 4YXGA 1K8YA 4LT9A 4MY8A 1DVJA 5AC8A 4O13A 2GVLA 4MIMA 1LLWA 3RLVA 3STGA 1MXSA 3P82A 1ZJIA 2EKCA 3G1DA 3W23A 5BMXA 3LCFA 3NQCA 3F4WA 1V5XA 3TSMA 1UASA 3GIYA 3SI9A 1EUNA 4O4WA 3L21A 1DBTA 2V8ZA 2VFEA 1OFQA 4UTWA 3B03A 3KXQA 4PEKA 4JTHA 2DZPA 1TTIA 3G8EA 6TIMA 2ZRYA 3MP4A 5BNKA 3BG5A 2G95A 3P81A 1D3GA 4GBUA 1LP6A 1I45A 2FPTA 5LNWA 1TCDA 3TW6A 3THQA 4OGZA 2DZSA 4WOQA 4Y96A 3BW3A 4DO4A 4ZQRA 3DH7A 3TKFA 1TIMA 3SJ3A 5ABTA 1YXYA 4JTFA 4K7VA 1HL2A 2ZZ2A 4AXKA 1BTMA 2QCMA 1TMHA 2Z6IA 4K36A 4GJ1A 1LOQA 3BW4A 3P61A 3K30A 3UY7A 4MOZA 4JYDA 5I3KA 1DL3A 4JDYA 1SW0A 4P2VA 2PE4A 4PA8A 3CIXA 5F4XA 1E51A 4IWWA 1FDYA 3GDLA 4R33A 2W79A 4A2SA 2ZRXA 5CZ0A 2AGKA 5FEPA 3NEVA 4E2DA 1SFJA 3PSVA 1JCLA 4MJZA 2NXHA 2OT1A 3B06A 1XM3A 4K8HA 4DELA 3MW7A 2A6LA 2PRHA 3EWUA 5BOOA 3W7NA 1OFPA 4K6AA 2TRSA 2WSRA 3O06A 2IQTA 3HGJA 1CW2A 1FDJA 4UFIA 2RDTA 3U2OA 4UUIA 4Z0SA 3S5NA 3ATYA 5EY5A 3UPBA 2JKEA 3LCIA 1Q3NA 1FBAA 1OF6A 2RFGA 3O16A 2CLIA 4RK8A 1WXJA 3NR0A 2E5BA 3CC1A 5F1UA 1LDCA 1IGSA 2VFFA 2XN1A 1R46A 3NPVA 1ME8A 3LV5A 4LUJA 5I3GA 1H62A 1F73A 1JCNA 2ZTKA 3S1WA 2DZUA 3MHFA 3QM3A 2VEPA 3FLUA 3UZ5A 2F7FA 3INPA 5HNRA 4LNYA 1SFLA 4FIQA 1IIHA 5D33A 3STCA 1UJPA 2HS6A 4HNUA 3IGUA 3FEMA 3P67A 4IXHA 3M5YA 3QQ0A 1JQVA 1KFLA 2WOQA 4M7SA 5F4WA 1Q6OA 2RHGA 3PS7A 5FF3A 1Q45A 5LHFA 3EWXA 7TIMA 3PWAA 3PY2A 3CQ0A 4JD4A 2B7NA 1TPC1 3ZWTA 3HOJA 2V2HA 3G18A 2X1TA 1SPQA 3R5EA 2ZRVA 3M16A 3LRLA 4NQ1A 4KWVA 3SW6A 3DKJA 4MYAA 3HPSA 2GOUA 2FTPA 1O5KA 1RQHA 2QKFA 3LXCA 3TV8A 5IBXC 1Q6RA 3UXAA 3W86A 4I7VA 3G1AA 3TK7A 3HPZA 2QAPA 1QAPA 4NU7A 3NVTA 1KBIA 1EEPA 1C9DA 2QUTA 4JTUA 1XBYA 4FX7A 3MHUA 3UYCA 4JYFA 2FJKA 2PC4A 3LCGA 1OX4A 2NWRA 2XN0A 4RJEA 1ICQA 4AAJA 1PV8A 3DI1A 1LM1A 1FY6A 4NX0A 3MP5A 4GWEA 4NZFA 5TBOA 2X30A 3DI0A 3SGUA 3BARA 2WNZA 3W3OA 1A53A 1WV2A 5KINA 5DCBA 5D02A 1I4NA 4JS3A 4UTLA 4K38A 2RH9A 4QNEA 5IM51 1Q6LA 2NUXA 1GTEA 4U28A 2QJHA 5TIMA 1KM3A 2EPHA 3S0CA 2QR6A 3QEZA 4GC4A 4O18A 4WD0A 3LGEA 5HQEA 5CZJA 3NQGA 4XQ6A 3TA6A 5AN7A 4IMGA 3T7VA 4Y9AA 4IX2A 3W1RA 1JCJA 3L65A 4MZ8A 3HGSA 4A3UA 2Y89A 5FF7A 5F2LA 3C8FA 2ZBTA 1Z42A 4O11A 4LRSA 4JTKA 2QJGA 1HUVA 1XI3A 4WOZA 5KZMA 3KVJA 3NQAA 3QRHA 4FXRA 1MEHA 1W56A 4PCFA 3EKLA 1PCWA 2QCFA 4N02A 4JX6A 5A8GA 4HSOA 2E09A 3NQDA 3LCHA 3P62A 3O1NA 3QPZA 3EX3A 1CI1A 1EPXA 4UTIA 2X1SA 3NZ1A 2A4AA 5K4ZA 3LHTA 3W9ZA 1VC4A 3N3MA 1SZGA 3NL6A 1XL9A 5DXYA 5EKYA 1Q6QA 1QO2A 3G3MA 3M44A 5AC6A 3BGJA 1VYRA 2Y63A 3TNOA 4NJIA 3A21A 3GX9A 1PCKA 2CU0A 2QCGA 2NX1A 3MHGA 3IEBA 3S5YA 5CGQA 1EIXA 3FJ6A 1T99A 3GDTA 5LNUA 3W7EA 1ZAIA 3C2OA 4WY0F 2Q3RA 4XZ9A 3W7CA 1UCWA 1GQNA 1W5MA 1YXCA 1Z44A 1HO1A 1KFKA 1G4TA 5U4NA 1Z41A 3MI3A 3QQ1A 4UMBA 2WPBA 3TIMA 3QZEA 1P5BA 5LGXA 1R30A 4CNNA 5U7SA 3P8JA 2YYTA 3R89A 3W1UA 1OFEA 1GVQA 5KZDA 1H1YA 4MFEA 4TR9A 5CKSA 1S5VA 1D3HA 1KFCA 1KFBA 4K7YA 2OZ0A 1KBJA 2P0OA 5D2VA 4JTLA 2C16A 5FEWA 1K7XA 1I2OA 3HG3A 4JYEA 2ZRWA 2YYUA 5E93A 3LX9A 1KM6A 3S5OA 1VHCA 3C61A 5G2IA 3EWYA 1M5WA 4JDBA 2V2DA 1UB3A 3KFTA 2JBMA 1A5SA 5IBXA 2G5WA 1HTIA 3PM6A 1B4KA 1HG3A 4XBSA 4G1KA 3BW2A 3RU6A 2J88A 1TV8A 3JS3A 1QO5A 2J27A 3W7PA 3P60A 4N4PA 1LZOA 3W85A 1WQ5A 3KRZA 2WSQA 1VCVA 3PBYA 1R2TA 2LLEA 3L0NA 1OX6A 1PHQA 1KW1A 1GZGA 4WJEA 1T8XA 1I2QA 3C4UA 5D2XA 3DKLA 4UR8A 1ZAHA 3QSRA 5AHNA 5D09A 4NUWA 1SO4A 3PUOA 5K2ZA 2WO5A 3LDVA 3N34A 2E6AA 3IGXA 4JX4A 3VKJA 1FDZA 1MEIA 3DXIA 3IVTA 3QF0A 3IIPA 3S8HA 2BXVA 3ZR4A 4O50A 3ANYA 3BPWA 3LHWA 1K7FA 2VELA 3E0IA 3SY5A 2YR1A 1TREA 1BWLA 1IXNA 3GNDA 3M5ZA 1O4UA 2TYSA 4LV9A 4S2CA 3A5FA 1OFRA 2C14A 3PB2A 4FNUA 4ZQCA 4P61A 2CLHA 4O1BA 4IMFA 3PVFA 3H53A 4JR5A 4BI5A 4DPPA 1TPFA 1TTPA 5FI8A 5D04C 3LLFA 1QFEA 3LCXA 3T44A 3HF3A 1U83A 3L0KA 2YSWA 1SQ7A 1LROA 2O7QA 4N9CA 3SECA 1DOSA 3NXFA 5CPLA 2YW4A 3MI6A 5AHFA 4AF0B 1GG1A 3ABRA 3NQ7A 3EWZA 4IMCA 4L4LA 4MKNA 4O28A 3DHFA 4UFKA 1GG0A 3W1TA 2ZRUA 2YZRA 1FCBA 4FIRA 5DCDA 4O52A 4MJMA 3H55A 4RX0A 1ZALA 3E96A 4HSNA 4CQAA 3PUEA 2QCCA 3Q94A 4NVTA 3IRDA 2Z1BA 1R2RA 2C19A 4NNBA 3TJLA 5G2HA 4NT0A 1B3OA 3M5XA 5F2MA 4L4MA 3DAQA 3OBKA 4RZ4A 4Z1DA 2ATSA 4B5NA 2I9EA 1PL9A 3QYQA 1OF8A 3E9AA 2FQIA 3F1QA 2ZA1A 5D38A 3BLFA 5I3HA 3WJWA 1GVFA 1TPH1 3I7SA 2AAMA 3L5MA 1YXDA 3G8RA 4O14A 2WNNA 3TXZA 2C6QA 3HG4A 2V81A 1AMKA 5DBUA 1F74A 3MI2A 2BSLA 4IUOA 4AB4A 4MLRA 3LCLA 4FHAA 5LKYA 4PODA 1SR9A 2DJLA 4FNSA 5L6UA 1TO3A 3R12A 4AEOA 3PC0A 1K8ZA 2A1YA 1JUBA 4IX0A 4A21A 3LTYA 4WX2A 3GDRA 3NG3A 4HKPA 1YDNA 3DBPA 4NXKA 5LNRA 4NJJA 5HR7A 4LS2A 1NSJA 3FKKA 1NVMA 3PUDA 1TPWA 2VXNA 4LC6A 3AJXA 3BG9A 3Q37A 1GEQA 5FEXA 1W5PA 4H6KA 5DELA 5D30A 5DXXA 1SW7A 2Y61A 3HG2A 1FXPA 2E6YA 2VEKA 2ZA3A 1KTCA 5EPDA 3LERA 3QH2A 3C52A 4NXSA 4O16A 1P1XA 3F03K 2Z2UA 3C2FA 1AW1A 1H50A 4XKYA 4TX9A 5DN1A 3LTPA 4GUJA 3LV6A 3KX6A 1W3IA 2VFDA 5LGZA 3W7KA 4TO8A 1LLZA 4E38A 3W1AA 4QSHA 4CNPA 3LRKA 1AG1O 1YLVA 3W07A 3NQEA 4Z1BA 5HINA 1RVGA 1WAUA 5LNSA 3WJZA 4O12A 5EMUA 3CEUA 4HIBA 2R8WA 3I7RA 4IPIA 1VRDA 3W2MA 4Z1AA 1G4EA 4RKAA 3W7OA 3TQ0A 3PBWA 2JGQA 3DFTA 3FJLA 1ICSA 3GAKA 4N4QA 1WOBA 4JTEA 5DLCA 1GJPA 3PAJA 5AFDA 3P80A 1FCUA 4JTTA 3OEXA 2GJNA 1LRNA 1I2PA 2YGYA 2XFWA 3B0VC 2ZRZA 3N19B 1SZNA 2J9YA 4O15A 1ZCOA 3UWZA 3NL2A 5DCEA 1AW5A 4AMAA 3U6WA 4S1FA 1DKWA 1H63A 1GVRA 2GQAA 5H2ZA 3UZJA 1D9EA 5BW6A 3BG3A 5EA9A 5I3JA 1SO5A 1NAL1 3TXVA 3NL3A 2CZFA 1F05A 4M19A 2P1FA 5D03A 1KM1A 2CLOA 1EB3A 4A2RA 2VFHA 3C3NA 3UPWA 4BF9A 3VNDA 3BLEA 2JGYA 2Q8LA 3W7RA 5LHEA 4CNOA 4W9TA 2CLLA 3CEPA 3NZRA 3TJXA 3NNTA 2VOMA 3KOFA 1OFBA 3FOKA 4JNMA 2JKPA 3QMRA 2QCDB 4UNKA 2CZEA 2VFGA 3B05A 3OG3A 1OYAA 4AF0A 4C1KA 4JIQA 1OYCA 4RLIA 2NXGA 1ICPA 1UUOA 1L2UA 5AHMA 5AHIA 1KFEA 3L66A 4X9SA 4XTDA 3EWWA 1G69A 3C56A 3DFQA 1ZY9A 3QPYA 3TR2A 5EBUA 2HMCA 4MZYA 1TPB1 3TSBA 3HGOA 2Y62A 4U4MA 1YADA 4WXZA 3W2NA 1OX5A 3ELFA 3WJSA 2FB3A 5E1QA 2OT0A 2ALDA 3W7HA 3R2GA 4UR7A 3H54A 3T4CA 2BTMA 1PVNA 2ZZ6A 3QJAA 2QEZA 4S2BA 1VPXA 3LRMA 4DO5A 3KVMA 3W7QA 4ICNA 4CLMA 3W71A 2C13A 4J9JA 4TMCA 4RCXA 1JUKA 3W22A 4JX5A 2DZWA 4O57A 3HO8A 3GR8A 4QISA 3S42A 5DBTA 4EWND 3TU9A 4DF2A 3M43A 2Q8ZA 2Y6ZA 4KFNA 4QJ1A 3CT7A 3CU2A 4UXDA 4AH7A 2V30A 3RMJA 3V75A 3NAVA 4O1AA 3GKFA 4FB7A 1NFBA 2CLMA 2ABBA 4HN4A 5HWNA 4IMDA 5CSRA 1GVOA 3OA3A 4DBDA 1EP1A 4RZ5A 1XXXA 1RQBA 3FIGA 1SSDA 2OJPA 4TMBA 1OFAA 3Q2DA 3GVGA 3LTSA 1WBHA 1ONRA 1AL8A 5G4WA 3TE9A 1VR6A 3QFEA 2E5DA 2RDWA 1W3NA 4IQLA 1H60A 4EVZA 2YFOA 3NPXA 4C1LA 3PR2A 4O1CA 3FYOA 4XUGA 1DQXA 4GUIA 1ZENA 1H7PA 3LB0A 4ADTA 4AHQA 4X3ZA 4D2JA 3EX6A 2FPVA 1Y0EA 3W1LA 3LM7A 1JULA 1PIIA 1I2RA 3MUXA 3HB9A 1X7FA 4NX5A 5G4EA 2B7PA 3LLDA 1OJXA 4MLJA 2HSAA 4N9DA 1QR7A 1KLZA 2EGZA 5G1YA 3RLUA 4LVGA 3BVJA 2C15A 1FWTA 4UMAA 3L68A 2FFCA 3C2VA 4UFHA 3CB8A 4M6VA 2QAFA 5D2TA 4AWUA 4AWTA 1LBMA 5C54A 1O5XA 2TPSA 2WKJA 3LBMA 1N55A 4UIOA 2GVJA 2NV1A 1F6KA 3TMQA 3OVRA 4ORIA 1OK4A 3C6CA 2OMAA 4N9EA 1UBSA 2YCEA 1MSSA 1OFDA 4O1DA 3STFA 3CLMA 4DEFA 3TQKA 1S5TA 2ZA2A 1JUEA 4MZ1A 2FB2A 1W0MA 1P0KA 2NXIA 3LI1A 3BV4A 3TQVA 3SZ8A 3HGRA 2V2CA 1VH7A 3T55A 2DJXA 1JCMP 3C2EA 4ZQOA 3S5ZA 1LTDA 2BX7A 4XWUA 3W84A 2Y7EA 2QCDA 3USBA 1YTKA 2DU2A 2X16A 1FWNA 2Y70A 4FF7A 1ALDA 4FXSA 1K3UA 4KWWA 4ZZ9A 1PE1A 2G97A 1XBXA 2E68A 3CIWA 3L2IA 4LVDA 2VEIA 2TMDA 4RR4A 4LOCA 1LOSA 1ADOA 3SGZA 1LCOA 4UC5A 5C55A 5CZSA 3EX2A 3NQMA 1I8JA 3LHZA 3WJXA 3QMSA 4KKXA 1VZWA 2A2IA 2QF7A 4QM1A 3GKAA 5L9FA 2J24A 1H7NA 2O7SA 1RV8A 2GQ8A 3UQNA 1KA9F 3NM3A 4O19A 3MO7A 2R14A 4OE7A 3NQ6A 5HUPA 3UNDA 3W7JA 3Q58A 2Y7DA 1GOXA 1C29A 1PS9A 1J4EA 4BFAA 3N73A 2YPIA 3G3DA 5FESA 2HS8A
chains in the Genus database with same CATH superfamily
3TTOA 3WQ8A 4R34A 1CPUA 3PZOA 3SDOA 4QE5A 1NQKA 3T07A 3LCWA 4A3HA 1C8YA 4ZODA 3CUXA 4AISA 2PRLA 4IT1A 1QWGA 2W92A 3I3EA 1TB3A 3LZ3A 3F2DA 2HNHA 3MP3A 2PWGA 3VAVA 2WV8A 4GIEA 2PDYA 1Q65A 4GPNA 2VENA 4JTAA 3TC3A 1Z48A 4FF5A 4NJKA 5AVNA 1NOWA 3ITXA 4FR6A 5K4XA 3GG7A 1XLBA 5REQA 1EBHA 1K6WA 1QNVA 2A7PA 4QP0A 1KV5A 2JIWA 4GQGA 1AQMA 1C8VA 3HPXA 7REQA 4UFLA 4E4FA 3BH4A 4B5XA 4I8DA 4E5TA 2YX0A 1GKRA 1XP3A 5AC5A 1W9PA 2QT3A 1LBFA 3GG1A 1ZBWA 1L6YA 1R9XA 3KTCA 2PWVA 4EIVA 5AKQA 1TE1A 1HIZA 2BZNA 3IVUA 1FWFC 4LX4A 3GXTA 4N2YA 1PWMA 3TAKA 4FA3A 1EHNA 3SSZA 4K37A 3RHGA 2X0YA 4H9VA 1NWSA 3KVLA 2Y85A 3VZYA 4AVFA 1ZNNA 3T40A 2ZDRA 4FOKA 2YCJA 4QAWA 3AYRA 2TSYA 3G1RA 1V6WA 1BWVA 3IGSA 2DIJA 2YA0A 4B5TA 4JTJA 5KZEA 1Q7QA 3SFWA 4LAOA 3URBA 1MVYA 3N14A 4Q32A 1L9WA 4KETA 2NQLA 4Z08A 3BLKA 1MW2A 3GXPA 3OLGA 4AIEA 1Y8BA 2FPYA 2Y7GA 1GPWA 4IMAA 1XDJA 5DRCA 3VCNA 3URQA 4IF2A 3UXLA 2F6UA 1BYCA 3H2MA 2ZCGA 3LBCA 4FEZA 2XVLA 1O5RA 1O94A 1WZKA 1V93A 4A3YA 3ITYA 1A5CA 3A3XA 4C7FA 1KXVA 2BLEA 3B8UA 1R3VA 1HL9A 5LXXA 3KAOA 4ZFMA 5G1TA 2YDRA 2HEJA 1S2CA 1UZ1A 1U5HA 2VVSA 5K9DA 5A69A 4R7JA 4MTVA 2QUUA 5KITA 2W91A 2E5CA 4L1WA 4WZHA 5JBEA 4IMEA 1RD5A 1IXQA 1JI1A 4FNPA 1UHVA 4MPQA 4GI8A 3VC6A 3OYXA 4WKHA 1H1ZA 1VBGA 3CH9A 3CHEA 1SMAA 3WK0A 3KHJA 4PFHA 1XIEA 3KRUA 3B8SA 4ERIA 2VHLA 3MKVA 4AZGA 1JYVA 2GJRA 1CGVA 4MAZA 1JJKA 5E70A 1TQXA 4L7ZA 2G96A 4S3EA 3MMWA 1WDSA 2PUZA 1EJUC 4XZIA 4REQA 3FK4A 2QLYA 1FQ0A 1QOXA 3AIEA 3HV9A 1WBJA 3KWSA 4L9XA 1P0NA 1AFSA 1RR2A 8RUCA 2C0AA 2VX7A 4PUMA 1A5AA 3I68A 1SO3A 4G1NA 2IPWA 4NZ3A 2B81A 3UR8A 2YOCA 1WX0A 4J3VA 4A8LA 1XIGA 4GO8A 4PMJA 4XVEA 3UF9A 1I0DA 5AOUA 3RM9A 2D0FA 3KBJA 3ANUA 2TODA 1WDDA 1X6UA 5D9MA 3W53A 3P5YA 5C6MA 2QV5A 2OELA 1E40A 3A4JA 3L4UA 1XPYA 4W84A 3DGBA 3HTWA 3AXKA 3GG0A 3IPWA 2BHYA 1W1VA 3PJWA 5JUVA 4NJHA 1LUCB 4KGLA 5MHBA 1EWDA 4KGJA 4S3CA 3TQPA 4RL3A 3M9YA 1E1FA 4FK9A 3CAQA 2FZBA 2QCHA 1QPKA 2OSYA 1V3JA 2YCLB 1VRXA 3GB6A 1S5NA 4YYCA 5JH2A 3UWUA 3DYPA 3QC3A 1A50A 1EO7A 4ZVJA 1W5OA 1KM2A 1MQQA 1VCFA 1YNQA 5HMFA 3ME3A 2X05A 3MB9A 3KTXA 1VQTA 3WBXA 3VFLA 2VP8A 3W75A 2CKRA 3RG6A 4C1NA 3AYSA 4XTIA 4H2CA 2HNEA 1E6PA 2RKXA 1ME7A 3AC0A 2Z0IA 5I03A 1WKEA 4Y90A 1SZFA 3VD9A 3CPRA 3W83A 4NZJA 4I5UA 4RV8A 1GTHA 5FJRA 1UPPA 2FLIA 1XYAA 4B15A 5LIWX 2XH7A 2DZBA 1BKSA 3SY1A 3U7VA 5KMYA 4YMZA 4MG4A 4AD1A 4EANA 4RZ6A 5E0KA 3GSMA 3G1YA 1W1B1 3ARWA 3ECQA 1VFLA 1WXZA 5AC7A 4R9OA 1RCXB 1GVSA 3N6JA 1B0IA 3PWGA 4BI6A 1YE6A 1N8FA 3GY1A 3VCRA 5A6TC 4IIFA 4HPXA 3FGCB 3E0LA 4J28A 4F2BA 4J1OA 3IIXA 1VCGA 3WFAA 1YE4A 2UWFA 1JZ7A 1OK6A 1W5NA 4M5PA 4CKQA 2CCRA 3S83A 4CGTA 2XTKA 1G7VA 3VI2A 4G8TA 4M0XA 3EB2A 3M7WA 4KFPA 1K6AA 3DERA 3W1NA 3L5AA 3U48A 3MCNA 1JAKA 5H91A 2EPOA 3TR9A 3CHVA 1YYAA 1EO5A 1R3TA 3DYMA 3MMUA 4DVOA 3B3DA 4WXYA 3KBMA 4LVBA 1QPRA 1UD4A 1YBQA 4QGCA 2VQTA 2ZZ5A 5C2CA 4QSFA 2GFTA 4PC8A 2ZWZA 1PX8A 1BAGA 2QCNA 1QMLA 2VDHA 3MUIA 4FO4A 3QW4B 2J9XA 3R79A 1KM0A 4B3LA 2O92A 4HK5A 4DPQA 3RGTA 4JQ4A 2YBTA 5I3IA 1JR1A 1JFXA 3A47A 3CZGA 1SU5A 5FF2A 3C2RA 2CNCA 4DJFD 4NNCA 4FX6M 4B4FA 2CBUA 3PG8A 1J6OA 4AY8A 4H00A 5DMLA 2CLKA 5A6SA 4M6QA 1G4SA 2PU0A 2ZE0A 2Z1KA 1H0GA 3H26A 2B4GA 4HNOA 2J79A 4BS0A 4Z0JA 1DTNA 1F6PA 4CQ9A 5LXEA 1B9BA 3KZPA 2RDXA 3VMPA 4D72A 1DJWA 1NIUA 1UUQA 3W29A 3EOOA 4B91A 2O9TA 5K9CA 4HU4A 4WLCA 3NOEA 1ZSXA 4JTIA 4UTWC 3A4AA 4YL2A 2VRQA 4JTGA 3PNZA 2ZICA 1ZCCA 1IZCA 4HK6A 2GWGA 1GYLA 1EF3A 4LEFA 2YIHA 1KLYA 3PG9A 1XLJA 1G67A 2IXVA 5AYBA 2ATMA 1VJIA 1YTDA 4ZMGA 2YA1A 3H6OA 3N4EA 4I9MA 3NSXA 1R85A 2YBVA 1GW1A 3NM1A 3CS2A 3L4ZA 5BRQA 2GDVA 2FDMA 3VTRA 4DBEA 4F9JA 1DPMA 2QPSA 1C91A 4FNRA 1WAWA 3TLLA 4RV3A 4EK7A 3BQ5A 3CM4A 5T26A 2J62A 3O05A 3W76A 1E4NA 5C9WA 3UP8A 1QOPA 3GAYA 3K4WA 1VHNA 3M0MA 5F7UA 4QLLA 3TDFA 1WDWA 4QLJA 1JIBA 3LQLA 3P84A 3HJZA 4ECLA 2DZTA 1ZJAA 3GIQA 3MYOA 4AZIA 1QPNA 4YTTA 4LJ3A 1NFGA 1PWLA 1CIUA 5FJPA 3GNNA 1RP8A 1VLWA 4E2VA 1DXEA 4J3SA 3GTIA 1B4EA 4GMEA 2PGRA 3M41A 2V5JA 4LF1A 3TC7A 2HXTA 1XSKA 4PUJA 1UD3A 3L9CA 4K8EA 2BGNE 1BVNP 3FAXA 3QMTA 1MDLA 5D32A 5CC3A 3MDWA 2D22A 3SGGA 2NWSA 2XGZA 4KQNA 4PTXA 3PPGA 4GVFA 3RRXA 6ALDA 4DXKA 1LRTA 5BWAA 1IWBA 3LNPA 4XD6A 1GVIA 3VOFA 3SUTA 4Q4KA 3W28A 4HCDA 3BLIA 2W6RA 1Q7ZA 1A5NC 2WC3A 2VNCA 4FALA 1AL7A 3V0UA 1ADSA 1V0KA 4PMDA 3WDPP 1KWGA 1DJZA 1X8FA 1R9YA 3SRKA 3SCPA 2EPNA 1BFNA 5H6HA 2RDUA 4LAKA 1XFCA 2G41A 4C6BA 2D2GA 2NV9A 3TROA 4HA4A 4O0KA 3W2LA 2J6XA 1VP5A 1OM0A 3O15A 1XCFA 1LORA 3OHIA 1FCVA 3WD1A 3NZQA 1QPOA 4AD3A 4GZEA 4JEJA 4W7VA 3BGGA 4H8HA 2YDAA 3Q67A 3TCSA 2E40A 3B0PA 1FWSA 1GT8A 1GZJA 2V3DA 3S2LA 3ZS4A 3Q4DA 5T9BG 4C65A 3P8IA 3WH8A 3MVIA 1K8YA 4LT9A 4MY8A 5CC7A 4D8ZA 1LLWA 4KS0A 4D6FA 3UZXA 2DGAA 1MXDA 1ZJIA 1Z3NA 3LD5A 4PTVA 4PULA 3F4WA 2V67A 3ZJ6A 5E5CA 3GIYA 1EUNA 4S3FA 3L21A 3TJ4A 1OFQA 4UTWA 4A8NA 3LM3A 3OZOA 2DZPA 3TZNA 3U4AA 4H7VA 2YB4A 1TJ1A 1B31A 1QHOA 2O55A 5BNKA 1JDFA 1LP6A 2Z27A 1L2QA 1B3WA 2DZSA 3UESA 1FWJC 2AQVA 3BW3A 3O0FA 1TIMA 3W38A 1VF8A 4AXKA 1GOQA 2QCMA 2Z6IA 4K36A 4E6MA 4GJ1A 1BSLA 4PEEA 2JE8A 1LG2A 3UY7A 4MOZA 3QTPA 4JYDA 2J13A 1DL3A 1A0EA 3CIXA 3W25A 5F4XA 2GOKA 5LA2A 3GDLA 1BYDA 4R33A 5CZ0A 2PDFA 4Q4SA 3PSVA 2NXHA 4B9YA 2J7GA 3MW7A 2BDQA 1VIZA 1QW9A 2WSRA 1EH9A 4C6DA 5BZAA 3V0SA 4GO9A 3FXGA 3HGJA 2MANA 3GUWA 1FDJA 1A3HA 3U2OA 4Q6XA 1AJZA 2PTZA 1E4MM 3BQ6A 3LCIA 3I6EA 1Z9AA 3RUBL 5FIPA 4JQ2A 2CLIA 4H9MA 1PTDA 3CC1A 5F1UA 3MY9A 1DE6A 1TVLA 3LV5A 2Y5SA 2ZTKA 1JCNA 4OOUA 4W7UA 3UFYA 3S1WA 5M3WA 3MHFA 3POHA 2RAGA 3STCA 4XBJA 2AGTA 2YXOA 4JNZA 1X8CA 4MNJA 2CHRA 2WOQA 2RHGA 2INFA 1J12A 5GJPA 1JNEA 4EXQA 1US3A 2VOTA 3AXHA 3EA1A 4E8CA 3SADA 3AWOA 3CQ0A 1P0EA 3WLLA 3K5XA 2CHNA 3TYUA 1TPC1 4D6HA 3HOJA 3ZXWA 4PBGA 1E6XM 3R11A 3M16A 3LRLA 1U1JA 5A2AA 2PWFA 3GNRA 3IJ6A 4MYAA 3VILA 4Y9NA 4LALA 2OZ8A 2FTPA 1O5KA 1JPKA 4J3TA 5IBXC 4AD4A 1S2WA 1US2A 1C8XA 3W86A 3GNPA 4ASTA 3AUJA 2E1WA 1KRBC 5C8BB 1VPQA 3WD3A 5A95A 1JDCA 1UC5A 4FX7A 4JYFA 3ALGA 2FJKA 2PC4A 3LCGA 1OC5A 2XN0A 4KWUA 1A4LA 3I10A 3MP5A 5BXSA 4I6VA 4NRSA 2WNZA 1A53A 2Z29A 4JQ1A 4F0RA 1GOKA 5D02A 4AZCB 4HMEA 4U28A 1HP5A 1E3XA 1XG4A 1B2YA 1LT7A 3QEZA 3VDAA 4IG2A 4O18A 4WD0A 1EYWA 2QDDA 5CZJA 5TNVA 1HL8A 3TA6A 1ODUA 4IMGA 3T7VA 2OO6A 4Y9AA 1JCJA 1CCWB 1OZMA 3A4XA 4A3UA 5C9UA 3C8NA 5F2LA 1TG7A 2ZBTA 1Z42A 4O11A 3HURA 4M56A 1S3TC 2FZ8A 3QVQA 1HUVA 4RDWA 1XI3A 2BHUA 4JL2A 5KZMA 3QRHA 2PLMA 3HA1A 2XHYA 5A6BA 1BF6A 2QCFA 3MV11 2BY0A 4N02A 4JX6A 5A8GA 2E09A 2INZA 3O1NA 4U2ZA 3EX3A 1EPXA 3NZ1A 4GNVA 3SCWA 3LHTA 3WQOA 2YJQA 1SZGA 3NL6A 4UNIA 2C1GA 3SBFA 2PTWA 3G3MA 1Q63A 3JU2A 1ITUA 4G6CA 5BRPA 1VYRA 2AMGA 4AXNA 4FS9A 1VBHA 1XLGA 3GX9A 3E2SA 2G0WA 1OY0A 2QCGA 1PAMA 2NX1A 2V5CA 3MHGA 1DIDA 2WKLA 2EJAA 3W7EA 1I60A 3SRHA 3C2OA 4XZ9A 3TN6A 1W5MA 4WR3A 4AC1X 4F2TA 2HXUA 5XINA 4E8GA 4RDYA 5U4NA 4UMBA 3TIMA 1PZ3A 2VD8A 3QZEA 3HMCA 5LGXA 4CNNA 1EJ7L 2YYTA 1TKKA 2RGLA 3KEHA 3AU2A 3WH9A 4WDUA 4Z2GA 1RAKA 3TWBA 1XIFA 4YPJA 1R8LA 1I0BA 3FJ4A 3QBUA 3WFLA 4OECA 1KFCA 3WD0A 3EMQA 1KFBA 4MAVA 1A3WA 3QV9A 3C86A 2OZ0A 2P0OA 1T7LA 3LYEA 1I2OA 1D7KA 3V36A 4K2SA 1YHTA 5E93A 3LX9A 1FFQA 3AU6A 1Z89A 2GSHA 3EWYA 3QLLA 2JBMA 1A5SA 3PK7A 3ICJA 5IBXA 3K4AA 3PM6A 3WF2A 1HG3A 4XBSA 2J88A 4XX6A 2J27A 4RE2A 1NOFA 1VEMA 4N4PA 4HN8A 4AVNA 4PUDA 1C93A 2CZVA 1TFVA 1VCVA 3LNMA 1R2TA 2LLEA 3VIGA 1J6PA 1E4LA 1OX6A 5I3DA 1S2TA 1GZGA 4WJEA 3H2NA 1TV2A 1W9VA 3T0BA 3CH0A 2OWXA 5CXPA 2DUZA 3ARVA 4NUWA 4ACZA 4QJ5B 5K2ZA 2PDPA 3EYPA 3UA4A 1O68A 1IR2A 5HPCA 2DZAA 1XYLA 3DXIA 2BXVA 3KLKA 3BPWA 3VXGA 2QZRA 4AFYA 3TW9A 3PPFA 2VRJA 2J75A 1K7FA 2YR1A 2P53A 4OFCA 1TREA 1ZQ5A 5BOFA 3GQYA 1OFRA 4JOMA 3U2ZA 1J0JA 2INEA 2CLHA 1CXEA 1C7TA 3B9DA 1TTPA 3UZZA 1XCWA 3LLFA 4GIAA 3T44A 1SJDA 2I56A 4M80A 2VWSA 1UG6A 2O0TA 3CPUA 1DOSA 5CPLA 3BJSA 2YW4A 4Q7BA 5AHFA 3EWZA 4A4AA 4L4LA 4MKNA 3AZTA 3N13A 2ZRUA 4UQ9A 2YZRA 1GVYA 4QXIA 2D23A 1UWUA 1O1HA 2WJDA 1Q2SA 6XIMA 6PTDA 1BGGA 4CQAA 4C60A 1TVPA 1FOBA 4C5YA 3Q94A 4J3ZA 2D20A 4S23A 3SIMA 3IJDA 4GYJA 4AZBA 4JQAA 3WF3A 3DAQA 1NTHA 4F9DA 3S6TA 2I9EA 2FQIA 2OQHA 5C7HA 4A3RA 4ZA0A 2C6QA 3BOLA 5M2FX 2WAGA 5DBUA 1E0TA 3LG3A 5LKYA 2XWEA 4AX6A 4AEOA 1SZRA 3L4VA 3PC0A 2C8NA 4IX0A 3ALFA 3LTYA 2Y8UA 1FWIC 1Q66A 2A3LA 2W62A 1NSJA 4HYRA 3FKKA 2VXNA 4DUOA 3BG9A 3OJGA 2DSKA 1GEQA 2P3EA 1SW7A 2Y61A 1K4HA 1QU4A 5IRPA 5CLTA 3WY1A 3DCPA 4NXSA 1P1XA 2Z2UA 1PSCA 3LV6A 5C7VA 1W3IA 4CQBA 4CD7A 2JIEA 4J3WA 3WL0A 4TO8A 1J0ZA 4AWEA 4CNPA 2O9RA 1XIDA 3QHNA 3W07A 5HINA 1RVGA 5LNSA 2YXXA 1V3HA 5HA7A 2QGHA 1UH3A 4HIBA 3OZYA 5I0DA 4GY7A 5AECA 2V5KA 2WCSA 4Z1AA 3W7OA 3PBWA 3U9IA 4JTEA 4DBUA 1QK0A 4DM2A 4L5ZA 5AFDA 3NWRA 3P80A 4ZO6A 2CXGA 4R7WA 1GONA 3SM0A 3OGRA 1LRNA 7ENLA 2YGYA 2ZRZA 1EC9A 1W9XA 2NQ5A 1JNDA 4R27A 1BYAA 2FHBA 5A3HA 3WNNA 3D5HA 2PA6A 5LIKX 1LL4A 4TV6A 4DUWA 5H2ZA 1JL8A 1EZWA 2DV0A 2E67A 5EA9A 3G6MA 1SO5A 3L4XA 4S38A 2CYGA 1TZZA 4M19A 2X41A 1KM1A 4A2RA 2Z4GA 1E43A 5DANA 2VFHA 3C3NA 1B3ZA 4H2HA 5LHEA 4W9TA 2CLLA 1HJQA 3K2GA 3NZRA 3S47A 3TJXA 3VOIA 4AG0A 2WZMA 2Y5EA 1REQB 5AVHA 2JKPA 1VD6A 2CZEA 3B05A 4C1KA 4PN2A 1DJXA 2Q09A 2XPKA 1KFEA 2G3FA 3C56A 3UR5A 3KM8A 1EYEA 2FMNA 4UCFA 3TR2A 5EBUA 2BASA 3K1GA 1R0MA 3HGOA 4MSSA 4U4MA 1OX5A 3WJSA 1VEPA 3FDKA 4P8WA 5M17A 1JPHA 2FB3A 4KBXA 1WDQA 5A6KA 1TWWA 1UQYA 3S4TA 3H54A 2V6AA 3MPGA 2BTMA 1PVNA 2BVTA 3ARUA 3W7QA 4R9XA 2NQZA 2IPJA 4J9JA 1PDZA 3IRSA 4MADA 4WIWA 1JD9A 4HD5A 5MKGA 2O9PA 2XH0A 2DZWA 3OTRA 3CASA 3GR8A 4EWND 3BZJA 4YTRA 3M0IA 4MJ4A 3EDKA 1MW3A 3DFHA 4AH7A 3O7UA 5XIAA 1A0CA 2DQXA 2XVPA 4O1AA 5TAOA 1NFBA 2CLMA 5BYWA 3B0YA 4HN4A 5EMKA 4IMDA 2PDWA 3WO8A 3JW7A 3WLPA 1BF2A 4DBDA 4LBUA 2C0HA 3BURA 2ZADA 1SSDA 3CZKA 4TMBA 2CBJA 2VX5A 1OFAA 3Q2DA 4X60A 4ZGYA 3AALA 1IGWA 4F0SA 2XM1A 4UQDA 1CNVA 1FA2A 4LB4A 3TE9A 2BGSA 2RDWA 4HQVA 4EVZA 3NPXA 2R82A 4O1CA 1DWHM 3MO4A 3FYOA 1DQXA 2O4QA 5D4YA 2X7WA 1TX0A 4ADTA 4IP4A 4AHQA 3P0XA 3UR7A 4F48A 1Y0EA 1WP6A 3WNOA 4BCEA 3LM7A 3DN5A 4MDOA 3MUXA 1M65A 1OJXA 5EMLA 4R5EA 2PDIA 2HSAA 1AODA 3ITCA 2DSWA 4QCFA 2PZ0A 3QFWA 4LVGA 1VJSA 3C2VA 4ROQA 4J5NA 4ACYA 3CB8A 3MT1A 4EPBC 4AWUA 5I6SA 5C54A 1O5XA 3GHUA 3KUMA 2HK1A 4ZSUA 3U5YA 1P6WA 1F6KA 4ORIA 1XF0A 1OK4A 1US0A 2R1LA 3C6CA 2YCEA 2JEPA 1PKYA 3STFA 2GDUA 3TYCA 3BAJA 2PF0A 3I4EA 3TQKA 2FMOA 3HJEA 5B7ZA 4NY2A 2FB2A 3ES8A 4PMNA 1CZ1A 4M82A 4HJWA 2NXIA 3V7PA 3U2CA 3LI1A 2HPMA 4XZNX 4HCHA 2V2CA 2EEXA 1MXGA 3T55A 3C2EA 4Q8WA 1RJRA 1TX2A 5HNTA 1U1UA 2QCDA 2DU2A 1Y65A 4US5A 1Z69A 4EXAA 3OU8A 3CIWA 4J35A 4LVDA 2QW5A 3W26A 2TMDA 1X6NA 5CZSA 3UG8A 1CGXA 3LHZA 4NKCA 3QMSA 3BTNA 4DZHA 1RLDA 3P0WA 2HE8A 1VZWA 4QM1A 4IFOA 3AS2A 5L9FA 3QR0A 4UOQA 5HOSA 1UROA 4PMXA 1RV8A 1QRQA 1LL7A 3MO7A 4GQBA 1KRAC 3NQ6A 1FP8A 4GACA 3W7JA 3WLIA 3QGVA 3V3WA 2PLCA 1U2YA 1IQ8A 5FESA 4DZIA 2ZC1A 2HS8A 1Z7AA 1CLVA 2XG9A 1E72M 1GOIA 1FWEC 4LS0A 1M7OA 3PB0A 4AUBA 2AAAA 4KRZA 2E77A 5JIPA 1FWHC 1F76A 4ZE5A 4ORMA 1S1RA 1TRIA 1TUXA 2VUYA 4XD3A 3H2EA 4GE8A 5F4SA 1BRLB 3FKRA 4HNVA 4D8LA 1UD6A 4HU0A 4DO6A 2F8QA 3PZVA 2ZZ4A 1SR0A 4YWSA 3BOFA 2A7RA 3WNPA 3P93A 2CLEA 4QITA 2GPTA 4V28A 2J7BA 3S1VA 4P8VA 3N4AA 3AROA 1TTQA 2IXUA 3QW3A 3S1UA 4CCEA 1Q6GA 2DZXA 2WLZA 1EJTC 1GQLA 3ATZA 3WF1A 4B5SA 4F4RA 4GLEA 3ZFHA 3ZVIA 1LYXA 4L4PA 1KM5A 4MJ2A 4JGDA 1GCYA 3G1HA 2FFIA 4IOTA 1Z6KA 1BEUA 2WM0A 3GYEA 5GPRA 2QS8A 2YLAA 3EAUA 2NLIA 1YX1A 1SSGA 4DAIA 9RUBA 2GJPA 4GKLA 2QJIA 3W24A 4HPNA 3DG6A 3A3HA 4ZQMA 3A23A 3HIJA 4UTMA 2H3BA 3WQGA 5BRBA 4H04A 3KCJA 4JIPA 3DFSA 1Q85A 1XHGA 3V1PA 1EXPA 4AZHA 3G0XA 4K8GA 2PTDA 1XG3A 3D3FA 4XAZA 3HMJG 4JFVA 4ENLA 4GFSA 3FYPA 5CAKA 1ZLPA 3W1QA 2YA2A 1YPIA 3DESA 1X97A 3WMLA 1F4AA 3NGJA 2XSXA 2OU4A 5K7JA 3GDBA 2NUYA 4UMCA 2PCQA 4JCMA 3O6CA 4JKKA 3ID7A 2R1PA 4C6QA 3LHVA 4PMVA 1OGSA 3N17A 1JAEA 1WCGA 4OU1A 4XAYA 2X2YA 1C90A 1CX9A 4GFIA 2GJXB 1JCYA 4KEUA 4H9XA 1YRRA 2J7EA 3TWAA 3GVQA 4UQCA 1K02A 1UW9A 3CMGA 5D05A 2FVLA 4LF2A 3UGVA 1TV7A 3G0UA 1J2WA 1XGZA 2V5DA 1J0KA 4PMZA 3E6EA 5H8PA 1TQJA 2JK2A 2GUYA 1IE7C 5DO8A 5CZKA 3SCQA 2XIOA 4QS5A 1OBAA 4MKVA 3V18A 4H4IA 1OVDA 2WC4A 3IJ8A 3QR3A 3DHDA 3NA8A 3T2OA 4Z1CA 2V3EA 3PTMA 1ONEA 3A9IA 4N6FA 3BO9A 1NFPA 3EXTA 3HN3A 3BK0A 2A3EA 3NXLA 4L4OA 3RFAA 3OBAA 4QG6A 4C91A 4WY0B 4IGMA 4Q4RA 4ZL1A 3EEGA 2Q6ZA 3YPIA 1MMFA 3ITOA 2PRMA 3DHUA 4P8XA 1S38A 1XLFA 1OB0A 3APGA 4IPLA 2BWGA 3TX9A 4KCTA 2OLAA 2I16A 2ZWYA 1L0PA 3TW7A 3BSHA 3B9EA 2XINA 3ABSA 3FHQA 5HPOA 1R7AA 2ZXBA 2V69A 1HJSA 1QXLA 6REQB 1M6JA 1R5YA 2V82A 4TX6A 3GDKA 3W7DA 4O4VA 1FWAC 4CUCA 4R88A 4Z2JA 1DIOA 2OODA 2HK0A 2VGIA 2BS9A 2NZLA 3W70A 3PSWA 4ZO8A 2FGZA 4UOJA 3KRBA 5DQPA 2PURA 2B7OA 4Q8NA 4UR9A 4BA0A 1EUAA 2XGBA 3B04A 1ZRQA 2DW7A 1TMLA 1UWRA 2XZ9A 4I90A 4OT7A 5A5WA 5JVLA 1JQXA 1W6TA 3G0SA 5DFAA 3NO3A 3OVGA 3SQMA 4ZQNA 1C92A 1BXBA 1KR1A 2BOGX 4M8UA 3AFBA 1IXOA 2H3DA 1GYMA 2VTFA 4GC3A 3NPUA 2DH2A 4IIGA 4GX9A 3MBFA 2D0GA 4NASA 3PHAA 4IPJA 3OGVA 1TYGA 1ZJHA 3KS6A 1V3KA 2DP3A 4OV9A 4DWSD 1DQWA 2I5IA 1KC7A 4Q8UA 3OLEA 5E9AA 1UD2A 3KW3A 4XV0A 4FNQA 4BWLC 3QY8A 2D0HA 4GUHA 3GTXA 4AEEA 4KWOA 1XC4A 2NT1A 2ZFAA 4O53A 3U2EA 4ERAA 1UIOA 3TMLA 3M0VA 5MF5A 4L56A 3UT0A 4V2XA 3QR1A 1F07A 4OHQA 1ZAJA 3S3GA 1W3TA 5FSEC 3W00A 3FFSA 2NX9A 2JKAA 3EXRA 3DC0A 1GHSA 2DORA 2IPFA 3WF0A 5JQ9A 1U30A 3CQJA 1E4IA 3O63A 1GHRA 5K3VA 1IF2A 4KH2A 1H51A 4I3GA 4W87A 5HWJA 1A80A 1CWYA 2AL2B 4HOWA 1SJCA 4FMVA 3POCA 5HBFA 4DJED 3A3WA 1V6VA 3VIOA 1TV5A 1FXQA 1DWIM 2WJZA 1Q2RA 3W2UA 2VR4A 1DQUA 2X09A 4B92A 4WUIA 3JZEA 4LVAA 5FJJA 4UFMA 3NDYA 3W73A 2QCLA 2D2HA 3RX4A 3UYIA 2ZDSA 1W1A1 2PWEA 4QHRA 3VNZA 3W1PA 5FAGA 4KCVA 3S2CA 2PMQA 3OIXA 1ZZMA 4B16A 3L2MA 1LQ0A 3CWNA 2VM8A 1ME9A 4OQVA 1TV3A 1V8EA 2OGYA 4LBRA 1AVAA 3VFCA 2PGFA 5AYZA 1O1ZA 1QDSA 3QZ6A 5AHLA 3B4UA 5K9XA 4FX8A 1XRTA 1FHDA 2AQOA 2PDNA 3TH6A 4KWSA 3K13A 4L64A 1HKMA 1HT6A 2XISA 1D7FA 3NSNA 3U8GA 2G50A 2QMKA 1W2VA 1B90A 3TAOA 4QNWA 3KL0A 4LVFA 3AHZA 2GUUA 3QY6A 3L7RA 4JY9A 1W54A 2REQB 4PSPA 4GJIA 3H8AA 1REQA 1WZAA 3TYZA 4WDTA 4HVXA 4ZB0A 4NAFB 4ADUA 3DFPA 1ECEA 4R53A 4XZWA 3F5LA 3R8GA 1JZ8A 2Q71A 4K68A 2IKJA 3ARYA 2AKZA 2HVOA 2OLHA 1XRVA 2VURA 3LS9A 1EOKA 3EOSA 4UWMA 1UZHA 3H70A 5HMEA 2H6RA 5DY3A 5AZ0A 4A22A 3WF4A 3WK2A 2IW0A 2FH6A 1NF7A 4LRTA 4B4HA 2CERA 2CESA 4JTDA 1A47A 2YDSA 3ZIZA 5BOEA 3FV9A 4MM1A 5J5RA 4BWLA 1B3YA 1NDZA 3KL3A 2Y8VA 4AY1A 4CU6A 4HNTA 2WPGA 1NEYA 1QASA 1IEIA 4UTHA 2H90A 1RPXA 5AB3A 3AQUA 1E5JA 5CPMA 4IL2A 4XKYB 5I3FA 3SRDA 3T0CA 1XYCA 4M6PA 3GYCA 4UNLA 3GXIA 1E55A 4O8RA 5LNVA 4XISA 1XDLA 3WG6A 2WMHA 2QIWA 2E6FA 1MW0A 4JHZA 3BL3A 3FXYA 4QR6A 1M3UA 2DFAA 1W8GA 1GK8A 2J6VA 3R4IA 2QULA 4H9TA 1L8PA 3LPPA 4EF9A 3ZO9A 3PBVA 4CU7A 2AQWA 1KXQA 4MWAD 2ZZ1A 3WBWA 1W5QA 1SZEA 1XYZA 2CW6A 1AW2A 1TELA 2Q8XA 4S3AA 3W6YA 3WLNA 3WDJA 1FWGC 2C3ZA 1R7OA 1OHLA 3SR7A 5FJUA 5CSSA 1YPFA 1U5JA 2X7VA 5IHSA 5HJLA 3QSTA 4JY8A 3BDKA 3J7HA 4DWSC 1A5BA 3RJXA 2Q02A 3TUUA 3RNDA 3A24A 4MDPA 1NARA 1WPCA 4O0ZA 1WOAA 1B57A 1LL6A 3AXMA 3QHMA 2BOFX 4G7EA 3TFCA 4UCGA 1KO0A 1OC7A 5J5DA 4GVGA 4PSRA 4O10A 3HU7A 2PGEA 3LK6A 3GWQA 1ZBKA 1KV8A 3NPWA 3GH4A 4U5IA 3W2KA 3EXSA 1FWRA 5D9OA 2E3ZA 1N82A 4ZO7A 5HATA 1MRQA 4MY1A 4W8AA 1P4CA 5D9PA 1UKSA 3SCSA 4V27A 4Y6GA 3TTYA 2ZUNA 2ZX5A 1WDPA 4HCLA 3UWVA 4F0HA 4E8DA 1MNZA 4QIUA 5EGRA 5FAJA 2UV8G 4HYWA 3V1HA 3UVAA 4QE4A 2Z1SA 3NTYA 1W9DM 2ALRA 3DHPA 3NDOA 1NP2A 1KQZA 3ENLA 1RA0A 2WQPA 3P6LA 1POKA 5CG0A 5LSMA 4JN6A 5IDZA 2OXNA 1W37A 3ANVA 4UOZA 1P1MA 4DYJA 2EF9A 1E6SM 3AO0A 1G9HA 4ZTXA 1BTCA 3FSUA 3LSCA 3ZYZA 4AHPA 3GDMA 4F79A 1MEWA 8TIMA 2QUVA 4AIOA 3M0YA 4NZ5A 2P3ZA 4OUIA 4J3XA 3VD5A 2ZKMX 3P5ZA 3A4WA 3O07A 2A0NA 3R7MA 4HA3A 4PRWA 1XUUA 3QV6A 4IUGA 1V7YA 3T0TA 5LZLA 5BU6A 3OQEA 4YXGA 1Y5VA 2G4FA 4OUEA 4O13A 4MIMA 3STGA 3CPGA 3P82A 5JH1A 3G1DA 3W23A 3NQCA 1V5XA 4ZENA 3TSMA 1UASA 3TZFA 3MMDA 3ZVHA 5IFTA 5EMMA 3N11A 4JHMA 3KXQA 1TTIA 1XIHA 3F2BA 3JVAA 4WGXA 1GGOA 3OBEA 4XVDA 2ZRYA 3MP4A 2D2JA 3BG5A 2G95A 4DAFA 3AISA 1D3GA 1RA5A 4ZB2A 1I45A 4ZFCA 3V4BA 4KT2A 1BRLA 3TW6A 4WOQA 5HXMA 1Q6EA 2NQHA 2J25A 2Y2WA 3I4KA 4B9ZA 3SJ3A 2WK2A 1JG9A 3R25A 5JIWA 4JTFA 2ACSA 4NAEB 3SUWA 4IFKA 3DEQA 1F4HA 4IP7A 2G37A 3BW4A 3K30A 8CGTA 4JDYA 3M7SA 4P2VA 2PE4A 1I1WA 1TUFA 2ISDA 3S2JA 3SCRA 4XIMA 1JCLA 2A3HA 2W66A 1GUVA 3B06A 2XFYA 3PZNA 4JIRA 4C7DA 2A6LA 4DWSA 1OFPA 4EPDC 2TRSA 3O06A 4RDVA 4D6GA 4UZSA 3CNYA 4UFIA 2RDTA 2MUCA 1EA9C 4CN4A 2JKEA 1IZKA 3HQOA 1FBAA 2HE5A 4S3BA 3TTSA 5A2BA 2VUNA 1O5QA 1XSIA 3VGFA 4HZ6A 1LDCA 3H2AA 3SQLA 1R3SA 4BQ3A 4HK7A 3QM3A 3CL7A 3RCMA 3WBYA 3FLUA 4WK9A 5CH9A 4CD5A 4FIQA 1XLDA 3OGSA 2OO0A 1UJPA 3PZIA 3IGUA 1TR9A 4IIDA 4S3JA 4QROA 3PTKA 4F66A 4M7SA 5F4WA 1Q6OA 3SCNA 3SO7A 3PS7A 5FF3A 1Q45A 5LHFA 1X96A 3WQPA 1OIMA 3ARZA 3PWAA 3AMGA 1HKKA 3ONBA 2PDGA 2OFJA 1K9FA 3G18A 3BZGA 5JMUA 3UERA 3VIHA 3AIBA 1ISWA 4HMNA 4MF4A 1QNSA 1RQHA 3TV8A 4GABA 1IT7A 3BCFA 1GVEA 4TQTA 2WMIB 1QAPA 4YIWA 4NU7A 3B4YA 3NVTA 1XGDA 2GVYA 2FJUB 4JTUA 3C0SA 1HW6A 3MHUA 3UYCA 2WVVB 5DMYA 1V6XA 3EKGA 2ZUWA 1WUEA 1PV8A 2BXZA 1LM1A 3WH7A 4WDXA 4TVCA 1FY6A 4NX0A 1SFTA 3WN6A 1GJWA 3CB3A 5TBOA 2X30A 4QDPA 3T1GA 3SGUA 3JUGA 3UVIA 3W3OA 1KBKA 3QTGA 3GXMA 1M1BA 3ARXA 5KINA 1V0MA 3BAIA 4UTLA 4XD5A 4QNEA 3MANA 1GTEA 2RJHA 3UJEA 1LWJA 1V08A 1KM3A 4NSBA 2ZX6A 3S0CA 3LGEA 1C8QA 4XQ6A 2BBFA 1XYMA 4PBFA 3ZR5A 5J8LA 3FSTA 4GX8A 1UR8A 2OZ3A 3VIMA 2PU1A 1C9WA 4MZ8A 5A8QA 1KB3A 3CJPA 3WQFA 2Y89A 3VU2A 1PKLA 4LRSA 7CGTA 4JTKA 4WOZA 3KVJA 3NQAA 1XKJA 4AVOA 3LBOA 3EOEA 1MEHA 1PCWA 1BYBA 3C3UA 3NQDA 3P62A 5EFDA 1UR4A 5BXPA 3RPTA 3GU9A 5A8MA 1F8MA 4UTIA 1NJJA 1FWDC 1RLCL 1VC4A 1OC6A 3CL8A 1JGIA 4L9YA 1M01A 1JZ4A 5DXYA 5EKYA 5KEZA 2DPEA 3M44A 3QYSA 2HQAA 1M41A 3IARA 5CCZA 2OSWA 2VD9A 3A21A 2WMKA 3D46A 1OT2A 4DM1A 4OBRA 4RUBA 4JN8A 2UBPC 5CGQA 4LUSB 1W1PA 1T99A 2KX9A 1VENA 4YJ5A 1BXNA 4W86A 1OEPA 4Y8EA 2XVKA 3FY1A 1G4TA 1R6WA 3MI3A 1RHCA 4EXBA 1R30A 3EWDA 1HQTA 1JZ2A 2WMFA 1OFEA 1GVQA 5HDRA 4P7LA 1H1YA 2WSPA 4MFEA 1E9YB 5D9NA 4TR9A 4H01A 4XD4A 1B30A 2X8RA 1CT5A 2D1ZA 1QWKA 1WKDA 1LLOA 3APYA 1EC8A 1K7XA 4ATLA 4JYEA 2OYMA 4PCPA 2X0HA 1IWPA 4DUXA 2YCIX 1KM6A 1VHCA 4CN6A 4FAMA 4GBDA 3OPSA 2P88A 2V2DA 1UB3A 3MDUA 3WD2A 1JXKA 4F3HA 3KDNA 4JIHA 3GHSA 2PDLA 2WJFA 2W61A 3RU6A 1TV8A 4TV5A 3W7PA 2ZX7A 3H24A 3GZAA 1LZOA 5I77A 2QV4A 3W85A 3RPDA 3PBYA 2EG8A 2W3ZA 1PHQA 3IJIA 3WLQA 3PPCA 3C4UA 2PTXA 4UR8A 5KETA 1V51A 4S3DA 1FKWA 1OZQA 1MUWA 2VZUA 4D6EA 2MNRA 1TJ2A 1MEIA 2ZVRA 4PUEA 3S8HA 1E1CB 2I5QA 4I9TA 4O50A 3LHWA 4S3KA 1XIJA 4NF7A 4RNHA 5DT7A 4ML4A 4WJ8A 2CITA 3RM8A 3REQB 1BWLA 1O4UA 2H9AB 4S2CA 3WL1A 3PB2A 1NWRA 4P61A 4WJXA 4O1BA 3PVFA 2PP0A 4BI5A 1TPFA 3WUGA 4KEMA 5D04C 3LCXA 4K1WA 5C70A 2O7QA 1DP0A 1DE5A 4N9CA 3NXFA 4AF0B 3ABRA 3NQ7A 4IMCA 3CQIA 4O28A 3DHFA 2HZGA 5I06A 1GG0A 3RCYA 5ENLA 4W5UA 2JQXA 1FCBA 1VBJA 4M29A 5FL1A 3SN0A 3H55A 4RX0A 4YVPA 1UMLA 1QTWA 1HXJA 4NVTA 1U22A 4NNBA 3CZJA 5G2HA 4NT0A 1M9HA 4L4MA 4J2PA 1GORA 4Z1DA 2ATSA 4B5NA 3P2VA 3F1QA 3GNXA 3BLFA 1GZ1A 2AAMA 2X1IA 3L5MA 1XS2A 1T6MA 3QKEA 3G8RA 3VVGA 3V16A 2WNNA 3TXZA 2SFPA 4QBXA 4UZUA 3W27A 2V81A 3WIJA 4EPKA 4IUOA 2BNJA 4FHAA 2DJLA 4FNSA 5L6UA 3N15A 1A5KC 2WW5A 1OD8A 3ZJ8A 1OIFA 4WX2A 3WMSA 4QE1A 3GDRA 3VK5A 4P5UA 3ONCA 1YDNA 1VJZA 4RNFA 3GR4A 4LS2A 4CEXC 1TPWA 1QI3A 4N0RA 1MFUA 5HMDA 4AW7A 4AZ6A 4H6KA 3UXIA 1ZUAX 2JF6A 3A6OA 1VFFA 3BAWA 2CC0A 2E6YA 3GTNA 2C1IA 3TYAA 1KTCA 5EPDA 3C52A 5I5RA 4PTMA 1AW1A 1H50A 1RSCA 1AD4A 4XKYA 4TX9A 3FCPA 4PRTA 5LGZA 5LIUX 3GFYA 4JPGA 1IEVA 1LLZA 5ABFB 3ARRA 4I5RA 4E38A 3W1AA 1MNSA 5EMYA 1ZP3A 1AG1O 1YLVA 4LUTA 3S1GA 4DRSA 4JTRA 3NQEA 4H6RA 1WAUA 3WJZA 4OZOA 3ZJ7A 3I7RA 1VRDA 3W2MA 1G4EA 1UPMB 4HU3A 3WLHA 4AMCA 2POTA 1HGWA 2PDUA 3PAJA 5C9XA 1XYFA 3M6DA 3R0DA 3OEXA 5DF0A 2GJNA 2L5HA 1I2PA 2PP1A 3GXDA 3E74A 2XFWA 5CQ1A 2J9YA 2OYKA 4W88A 4U10A 3NL2A 5DCEA 1J96A 3U6WA 4S1FA 2Y4SA 1RP9A 3VNYA 4DJDC 4V33A 2GWNA 1LWHA 4LB3A 3TXVA 3NL3A 2CZFA 3T9PA 4URIA 1MUMA 2V63A 3CAKA 3VNDA 2WJEA 1UOKA 2JGYA 2Q8LA 4M24A 1ONXA 4CNOA 1C7SA 2QQ6A 2VL4A 1EJWC 1OFBA 1TA3A 1D2KA 4PBEA 4JNMA 4UNKA 4XKMA 1HKWA 4WEVX 2VFGA 3OG3A 2J66A 3AMLA 3BMVA 4JIQA 4RLIA 1L2UA 1POJA 5AHMA 3H23A 3BANA 4X9SA 5EU9A 1AH0A 3DFQA 4WRHA 4ES4A 1TPB1 5XIMA 2RGMA 3N1AA 1PUDA 4ZB5A 4X0VA 1HJUA 2ALDA 4OOZA 2ACQA 3AHXA 2VEGA 3R2GA 4UR7A 3T8LA 2ZZ6A 5BROA 1D8CA 4S2BA 3LRMA 4ICNA 4CLMA 3OG2A 3W71A 1J2BA 2PDQA 1KGWA 1RUSA 3GBDA 3VNIA 4RCXA 1JUKA 1D3CA 4JX5A 3VABA 4O57A 1W1YA 4PTDA 4QISA 2QJNA 3WDIA 4DF2A 1QK2A 3M43A 2Q8ZA 3DUGA 5CBBA 4QJ1A 2W63A 3PTDA 4DNHA 3CU2A 3EZ4A 4QLKA 1TWDA 3V75A 4BEQA 1AZ2A 1UWAA 1TVNA 3NAVA 4KIRA 3PBGA 3GKFA 4FB7A 2JF7A 4D1JA 1AZ1A 4U3CA 5HWNA 1HGYA 5CSRA 3BOXA 3OA3A 3FYYA 3CHFA 1EP1A 4HA1A 1XXXA 1RQBA 2PSNA 4FZIA 2IS7A 5KZ6A 2CLPA 2YCKX 3GVGA 3EDEA 3LTSA 3UNTA 2J7FA 1AL8A 3TTQA 7REQB 2R1MA 4A8IA 1EKOA 4U3AA 3VOGA 3QFEA 1KD0A 2EG6A 1W3NA 4KF1A 2PBOA 5M03A 2VC7A 1YIXA 3PR2A 3VZXA 2ZXQA 2QJJA 4GUIA 1H7PA 2PCEA 3M07A 5I7GA 1HVQA 3GNOA 3W1LA 1JULA 2ISFA 3HB9A 3EEZA 4NX5A 3OODA 1M04A 3MUZ1 1TR1A 1JZ6A 1RD6A 3EPOA 3RLUA 3KOWA 4H1ZA 4B3ZA 4Q7NA 1XC6A 5D2TA 3BGAA 4LBSA 3RLHA 3C2YA 1FH8A 2GVJA 4UIOA 2NV1A 3TMQA 3N04A 3B9NA 5T9CE 4N9EA 2OMAA 3WNKA 1OFDA 2PS2A 1OCQA 5IDIA 4DEFA 4C6PA 1UR9A 1PBGA 3H2OA 2YLLA 2TAAA 4MZ1A 1JUEA 4DJDA 4LYPA 2QNEA 4ZXOA 3LSBA 1E3ZA 5EBAA 1X1NA 3MC5A 1FVPA 3LN3A 3HGRA 4BY3A 2VZTA 3RLGA 2J77A 2DJXA 4FLOA 3KL5A 1JCMP 4ZQOA 4X9YA 2GLKA 1E56A 1WXYA 2UY2A 3QOKA 2EO7A 3USBA 5A6BD 1YTKA 1ELSA 1A0DA 1BVWA 2VR2A 4EE9A 2G97A 1XBXA 1ZJBA 3L2IA 2VEIA 4LXFA 4PB3A 4LOCA 1UA7A 4UC5A 4XG1A 2DDXA 3KBVA 2C71A 3NQMA 1I8JA 1L8NA 3MCOA 1P43A 1RJQA 3RDKA 1NOUA 2NLYA 3E0VA 2QF7A 2EPMX 3GKAA 4YTQA 1CEOA 2PPGA 2O7SA 1UR2A 3S9ZA 2DVTA 2WYSA 3GC2A 3ITTA 1J9YA 2E7FA 3MCMA 3RU8X 3Q58A 3RRAA 1MQPA 2Y7DA 3WEOA 1V0LA 1BHGA 3RJYA 1EGVA 3CHDA 1J4EA 3CZEA 2A79A 4GK8A 2DIEA 2FIQA 3AS3A 3SFKA 5HMSA 1KR0A 3N2XA 3IUDA 3ABOA 4LTSA 3MSDA 2PGWA 3IV8A 2Z1XA 3EDDA 3O6YX 1G7UA 1JXJA 3NQ8A 4REQB 3I3BA 3BWWA 4GRSA 3A5VA 3MVTA 4QAIA 1O95A 2WVVA 3CV6A 1PTGA 2VEMA 3MWAA 2ZTJA 4JIIX 1XUZA 4ZSTA 3TP4A 2X1RA 5HR6A 4L80A 4YLWA 3H2CA 4DZAA 2GQ3A 1LT8A 3W1XA 3DFNA 2PP3A 4Z2LA 2VC5A 4XZBA 3P14A 3CZLA 4C6FA 5GVJA 2QDHA 1XFBA 1YNYA 3V35A 1YTEA 3E02A 4DQWA 3E3HA 4W5ZA 3O8AA 4G9PA 4Q7IA 4IGHA 2WANA 3VD4A 1H7XA 2Z7KA 1W2PA 2R24A 1U1HA 3ABXA 4MB5A 1VYPX 5I07A 3VUSA 1CXIA 3TC6A 3PUGA 1LOLA 1UD5A 4Q6JA 5FF0A 2X1UA 4E2OA 3LQGA 3E12A 2Z2BA 5LYRA 1EF2A 3BAKA 4PMYA 1KFJA 3FN9A 3NQVA 1H2JA 3RR4A 2VZOA 2XFFA 4X61A 1X1ZA 2E25A 1TIWA 2F84A 1FTXA 3R13A 1QUMA 4IGSA 3CXOA 5CPNA 5G4HC 5I2UA 2C7FA 4MB4A 4PL2A 5G2WA 2UY5A 2ASHA 3GXFA 1XISA 1V6YA 5DRIA 4JTSA 1EP2A 4L1XA 4AD0A 1AQHA 5FCZA 1PPIA 2WSYA 3IIOA 1IHIA 4LPCA 2BY3A 4HOZA 4RE0A 5B7YA 1DORA 3L4TA 3VZZA 3SCTA 4Y2WA 1TPUA 4YVXA 5HUOA 3F4DA 2PDJA 2FH8A 4MYXA 1TCMA 1S2UA 3IJQA 1KBLA 4H7CA 1ZFJA 1T0OA 4AIBA 2QMJA 4GY0A 3IIZA 3N6QA 1VFHA 3THUA 4IH3A 4B3KA 4BHYA 1TV4A 4I9AA 3IAQA 2FGBA 4LY8A 4DXVA 5CC5A 5J04A 4M7TA 1X1OA 1T8QA 4ONVA 2DZVA 4GYFA 1I75A 1OX4B 1EQPA 2VDGA 2YKKA 2R94A 3N2MA 1WUFA 3NDZA 4R85A 3BCJA 3H7VA 5GJNA 4NZ4A 5KTLA 4C6NA 2OX1A 5CJNA 2OQLA 1L6WA 1H7RA 2IKHA 2Q01A 3COTA 7TAAA 3XISA 4JFUA 3GFZA 1NM9A 2NSOA 3NYZA 1K70A 1JZ5A 3HBLA 4L6HA 2CKSA 1UZ4A 3G22A 1AJ2A 4YVVA 1MUCA 5AY7A 1EJVC 4IQEA 4WSKA 5LA1A 2DY3A 4L65A 2DSUA 1DHKA 3CLWA 3P7YA 2BVWA 2Y88A 1BQGA 1NWTA 2YBUA 5AZ1A 3W2JA 5G1MA 3W6LA 1MO0A 2J47A 3PF3A 4P7RA 3GK0A 1EGMA 2PF8A 4OWGA 2J4GA 1XLIA 5BWFA 1MW1A 4M51A 2F6XA 3VMOA 4FNTA 1R3WA 2IMRA 4XAFA 2ISWA 1FWWA 5LIXX 4HT3A 1G1YA 4LCSA 1W1IE 3RF9A 1FH7A 1PHWA 4Q4OA 3KS5A 3W88A 1F7BA 2OG9A 1EP3A 2VYOA 3JRKA 2V0TA 3VNLA 1T41A 1XBVA 3PFMA 3BLPX 1K4GA 1SM9A 3V5OA 4GVHA 4HNCA 5M5DA 3H7UA 1JPDX 1EJSC 2VC6A 2P8BA 2WZTA 5EYWA 1QBAA 3CWOX 2CEQA 1WZLA 3TCEA 1OABA 3AJ7A 3D0CA 1GQKA 5D2WA 4Q4PA 3NO5A 3WFZA 3VIKA 4HYVA 3E1F1 1I6NA 3BJFA 3AXIA 3TONA 3ZR6A 3VDBA 3LENA 3BC9A 2OCZA 4DB7A 3C0QA 4LWWA 3ITVA 1XDMA 1XLEA 2DT2A 1OGGA 3VIIA 1F3EA 4PTWA 1JRBA 4B5UA 4JCLA 4I9JA 3DZ1A 1RZMA 1IIGA 1TRDA 3NQ2A 4E3TA 5BU9A 2Z25A 2A3AA 2BODX 3PULA 2NUWA 1R47A 4UTTC 1BLIA 4KCUA 3D3AA 4RXGA 3WMBA 1ZGDA 3A9BA 4GNJA 4HNNA 3THAA 4J40A 3BMXA 3S9YA 2X2GA 3HQNA 2D69A 4E0CA 4DI9A 4CCZA 2YDQA 4PGLA 1TPDA 1KTBA 3CTLA 1V6TA 4DZ5A 3UXKA 4OVXA 4HSHA 4LUYA 1NWUA 4GIRA 4HGXA 2HRWA 2AL1A 3AMCA 3WSUA 2IQDA 3LUTA 4R7OA 3QGKC 3R1ZA 4HZ8A 5HULA 2EXOA 3WQVA 2DW6A 1L6GA 4M6UA 5T8GA 2V5LA 4IJRA 4WSJA 5CSYA 3RN6A 4D6CA 1KM4A 1AK5A 1Q13A 3LGDA 4MNLA 1N8IA 2HV5A 1WDRA 4XBKA 3UD6A 3ERPA 2G4JA 1L6SA 3CHCA 4UTKA 1EA0A 1BSIA 2IPGA 3LGGA 1VBRA 3IIVA 1HFBA 3GC5A 1O60A 2ZZ3A 2I14A 2J9ZA 4HOXA 3UWYA 1WYIA 1FX6A 1I9CB 3B8WA 2QUMA 4WKFA 1KRMA 4PB4A 4S39A 4K39A 3HZ3A 3STEA 1ZHAA 4GQRA 2QVNA 2ZVIA 5ECVA 2WMJA 3NL5A 3BV7A 2E6DA 3KOYA 1LQAA 4NNAA 4JN7A 3TFXA 1XQLA 1V03A 1H7WA 4H19A 3I6TA 3VM7A 4X2RA 1UUMA 3W7GA 4CD4A 1DWFM 4GZ7A 4KPLA 4NI8A 2OEKA 3JR2A 5F2IA 3SAZA 3EGJA 1F5ZA 5C2XA 2WM1A 1WE5A 2FTYA 5FJIA 4POCA 2VCAA 1GW9A 3THDA 1UR3M 1JI2A 3TYDA 2WNWA 4YCPA 4F0LA 3B8VA 5TD4A 3VKBA 4W93A 4BJHA 5CAHA 1LUCA 4TTGA 1EDTA 3FW6A 1EOMA 1W1ZA 3EX4A 2CWNA 3FVDA 1XLKA 2QVHA 1JPIA 2YCLA 2A3CA 2VKZG 1TWZA 2ZIDA 3ZLHA 1VYSX 3I7QA 4JTCA 2R91A 4UFJA 4KW2A 1OG0A 1ML1A 1UKQA 2GVGA 4ZOAA 3CV2A 2OWCA 5IFPA 1JCXA 4DUVA 3GG8A 3QGAC 4X22A 1UMYA 3TN3A 3ARQA 3M1ZA 3EB3A 4MPKA 2WHMA 3OYZA 3AHVA 3FS2A 1OINA 4PL1A 4US5D 4UTTA 4UQEA 3ZT7A 7PTDA 5I09A 2BMBA 4GA8A 3DU0A 3MYPA 3ZJKA 3F2CA 3W7MA 1CB7B 4Q33A 1Y5WA 4Q22A 2VVNA 3O0KA 1UP0A 4XK2A 3H12A 1MWOA 1H4PA 2XDFA 4OBTA 1K03A 3LHUA 3E49A 4UTFA 1OFOA 4X0NA 3EBVA 4PH6A 4NP7A 5HWMA 4PR4A 3R8RA 3B0UX 3RK8A 4FSAA 3KZSA 4J3UA 3QC0A 2YB1A 3TYEA 4Y7EA 4QTGA 2YL5A 1BG9A 4PB5A 3U5UA 4WF7A 3OVPA 2ACUA 1WNOA 4YWIA 2P8CA 4UTUA 1ISYA 4DF1A 3FGCA 1TPEA 1J0YA 3HM7A 1KCXA 4WDWA 4GH1A 4X2PA 1B9ZA 3S6DA 3OQ8A 5H8MA 3GTFA 2F2KA 1P0BA 1E0UA 1K7EA 3VINA 4GXMA 3GHRA 3N9RA 3MMTA 3H4XA 1JD7A 1RBAA 2JEQA 4JAWA 3WELA 1UYQA 3MJYA 1KKRA 1QI2A 2XM2A 1FCQA 1VS1A 2PB1A 4ADSA 1W1TA 4W8BA 1SUXA 4CCDA 2A6NA 4HPJA 4ICCX 5F2GA 2PDKA 4RW5A 3R94A 5I23A 1NF0A 3FDGA 2HBXA 4BK9A 1FHLA 1FP9A 4H9ZA 3BLOA 3ABQA 2EG7A 1DJQA 1UWIA 2Z24A 3M0XA 1JVNA 4JFSA 5C9RA 1T96A 1DWGM 2WBGA 4ALDA 3W74A 3IJ7A 4WQ6A 4XUYA 3ZSSA 2GJLA 3ZQ9A 3VNMA 1XBZA 4HZMA 1GQJA 3NEHA 3MWCA 3QLDA 5CSUA 2D73A 3EWBX 1QCWA 2R1NA 3N9KA 1SGJA 1HKIA 5A2CA 3G24A 1KTNA 2I1OA 1QI0A 1UOZA 3MZNA 1GYNA 4B2DA 1XLHA 5C0QA 2XUCA 4IHCA 1PEZA 5G5IA 1TMQA 1N7KA 3D6NA 3LMZA 1B3XA 3UWWA 5EB8A 5E09A 4LCRA 2DSVA 1N2VA 3EX1A 1I1XA 1SJAA 4F8XA 4RXFA 3SB0A 1XQKA 5SWUA 4IXXA 4V1XA 3B8DA 1R2SA 2C18A 4MVAA 1QOQA 5HNUA 1GKPA 2FGLA 2QGYA 2ONEA 5FD0A 3RLVA 3JZUA 5BMXA 4AY7A 2ZC8A 1H41A 3SI9A 3EWCA 3UZYA 2XWDA 3VO0A 1E0VA 2V8ZA 6ENLA 4H8VA 4JTHA 3GHTA 3G8EA 3VGHA 3E2VA 3AIRA 1EQCA 2RUSA