5G4EA

S. enterica hisa mutant d10g, dup13-15, q24l, g102a, v106l
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
220
Chain Sequence
MIIPALDLIGGTVVRVVRLHYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTALKSPDVVKGWFERFGAQALVLALDKQVASGVSLEQLVETYLPVGLKHVLCTDSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
total genus 66
structure length 220
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4eA00
2B7QA 3SI9A 1TPH1 1KM1A 4R34A 3W1RA 2BWGA 1HL2A 1NAL1 3PY2A 4UTTC 2ZRWA 1LRTA 4M6VA 1D3HA 1QMLA 1ZENA 4HKPA 3TROA 3NQAA 2ZRYA 1HTIA 2B7OA 3W88A 3I7QA 3W2LA 4WD0A 1FCBA 1WV2A 2GQ9A 3G1XA 1PHQA 3L65A 1TPC1 3Q2DA 4X9SA 3LB0A 2R14A 4N6FA 3VE7A 4Y96A 1F6KA 1K8XA 1T96A 1G69A 4NZFA 4U4MA 1SZFA 2Y62A 3G1HA 3U8GA 3FFSA 3EXTA 3M7WA 3QSTA 4HNTA 5F2GA 2A4AA 2C3ZA 4I9AA 3L0NA 1OF6A 3QF0A 2H6RA 4MLRA 3O8AA 4ZQCA 3W84A 5F4XA 2DZTA 4TO8A 1W3IA 1KM3A 3F4WA 4M19A 5LKYA 2VXNA 1TPVA 2DZPA 4JDBA 1O94A 2XFWA 4WQ6A 3HF3A 1H60A 4G1KA 4Q32A 2Z6IA 1ZAHA 5C6MA 3GDKA 1CI1A 1W8SA 1QDSA 3FA5A 2GQ8A 1ICPA 3QM3A 3S42A 3TMLA 4TMBA 2A1YA 3TNOA 3YPIA 3E02A 4JNMA 4X2RA 4JICA 1BWKA 1TB3A 2HMCA 4OE7A 2VELA 4WOZA 4LC8A 4JR5A 1GPWA 4BR1A 1WAUA 3P84A 4AVFA 1T0OA 2ZQ0A 3NG3A 1QPQA 1H51A 5I3HA 3LCIA 3O6YX 1SFJA 5TIMA 3NM1A 3W1AA 4KFPA 5G2IA 3CWNA 1YPFA 3A9IA 5G2WA 3TJXA 1OHLA 1OX6A 3W7HA 2EHHA 3WJXA 2V2CA 1RR2A 2DU2A 1KV5A 1OFOA 3DKJA 2C19A 2C16A 2QCHA 4ZVJA 1PE1A 1CW2A 1ALDA 5I3IA 3U2OA 3S9YA 1KM4A 2FB3A 2ZZ6A 5TBOA 2ZA2A 2H90A 2ZTKA 4YMZA 3MHUA 2NWRA 4IXXA 4R33A 5H2ZA 3KVMA 1A5CA 4DF0A 3LXCA 3E96A 1ME7A 4LRSA 3Q94A 1UUMA 3IEBA 3LOTA 2A6NA 2CZDA 4O1BA 3G3MA 3EB2A 4GBUA 3RU6A 1XCFA 3V75A 5FEWA 4MZ1A 3A22A 3U6WA 5BMXA 4LVFA 3BVJA 3GK0A 3MHFA 2Y7EA 4O1AA 2DZSA 1I2NA 1TRIA 4OT7A 4JTEA 3FKKA 1FUYA 2J9ZA 5F1UA 2YX0A 1DJNA 3MI3A 4H6KA 5FF2A 3IVSA 3BLEA 5CZTA 1YXCA 3MP3A 4LRTA 2V5LA 2J27A 5EPDA 4XTDA 5AC6A 4UUIA 1VLIA 5CSSA 1VH7A 4O10A 3B0UX 4OHQA 1JCYA 5DXXA 3G1VA 3L67A 3LHTA 3C61A 3HGSA 3RF9A 4Z1DA 3B04A 2B4GA 1ZAIA 2XN2A 3OG3A 3QPZA 5HUOA 1IGSA 2DJXA 4JTLA 1EB3A 3GVGA 1P4CA 5DBUA 5C5YA 2Y6ZA 4EF8A 4IMGA 5U7SA 3CT7A 2WNNA 1NVMA 2GOUA 1PHWA 1B4KA 4MZYA 4O1DA 1B9BA 3TV8A 1RQEA 1W0MA 4WY0F 3CIXA 2PRHA 4UFLA 2GUUA 3GX9A 1VZWA 2VFDA 3TR2A 3M43A 3SY5A 1LDCA 3M5YA 4OGZA 4CNPA 1G4PA 3INPA 5KZMA 3UZJA 2E1DA 2YYTA 5D03A 1QO5A 3TFCA 1OX4B 3DHDA 3P81A 2AQWA 3BARA 3L0GA 2VFIA 1W3TA 3W76A 3THQA 2ZCGA 1MEIA 3G1AA 1TTPA 5IBXC 2WJZA 2AAMA 2QAPA 5CGQA 3QMRA 3GXTA 3A23A 2QUUA 3W7MA 3W7EA 3BW3A 1JCMP 4JTTA 2CZ5A 2X1UA 1FWRA 3PSWA 4AF0A 2Y61A 1O95A 1OFRA 4JX6A 3MO7A 3EKLA 3BGJA 2CLEA 5HUPA 5EY5A 2E5BA 4NJKA 4IMEA 1QPRA 4NNCA 3IRDA 3H55A 4GC4A 1ZCOA 3NPXA 1VYPX 1F6PA 2V2HA 1GVFA 1JCXA 1SFLA 1GG0A 3HBLA 2DJLA 4RR4A 2A6LA 4JTGA 2QUTA 3KAOA 1IIHA 1EP2A 4UTIA 4BK9A 3LRKA 4UR7A 3S1WA 1SO6A 5DN1A 2I9EA 1GWJA 3NPWA 1S5WA 2V0TA 3KVJA 3MUXA 5AC8A 1RQBA 5G2HA 3HGRA 1FBAA 2OX1A 5AYXA 5FEZA 4AEOA 1NFBA 4OV4A 3E9AA 1W31A 1V5XA 4IXHA 1YXDA 2YW4A 4Q33A 1YTKA 3EWYA 4TMCA 4GFSA 1SW0A 4OBTA 1ZALA 3LX9A 3SZ8A 4FXRA 2DZXA 3NM3A 3NNTA 5SWUA 1B4EA 3IIVA 3W74A 3QMSA 5AYYA 5K4ZA 4NJGA 5E93A 4NQ1A 2FPYA 5G1YA 1G7VA 1FXQA 3BLIA 1UCWA 4A21A 2GJNA 4CNNA 1VQTA 3N34A 3S1XA 4O28A 1ICQA 2UV8G 2FJKA 5LHFA 3DFOA 2GJLA 1TSIA 4K8HA 1EP3A 4JX5A 4ADSA 1RZMA 3W23A 3S5NA 3TSBA 3BG9A 3LCFA 4MZ8A 1EPXA 1I2RA 2ZZ2A 3G1FA 4M6PA 5G1TA 2G97A 3W22A 3EWZA 4LVGA 1VGAA 3I7SA 1VRDA 4C1KA 1P5BA 4LWWA 5K9DA 2VEKA 1DQXA 1TV5A 3WK3A 3LLDA 4O50A 5HNRA 4CCDA 1AG1O 3KRZA 1PV8A 4Q4KA 1L9WA 3NPVA 1OX5A 1AMKA 4CNOA 3C4UA 4EWND 1S3HA 3MP4A 4AH7A 4LVBA 1J5TA 1EEPA 2BXVA 3N2MA 3LCGA 3S5ZA 2YFOA 2FB2A 3JR2A 3G22A 1VLWA 1OFDA 3L5LA 1Q6QA 2A21A 4LOCA 5DELA 3QW4B 5HWMA 1S5TA 3S1UA 4JTFA 3M9YA 4JDYA 1FDJA 3CHVA 4ZQRA 3SJ3A 3UZ5A 3G3DA 4BWLA 5LGZA 3W2MA 1FWSA 2NXIA 3O07A 3SW6A 5FF3A 1DKWA 4LT9A 1LLWA 4XBSA 1WXJA 3GR8A 5AHMA 4TX9A 5DCBA 3KHJA 3PM6A 4C1LA 4MY9A 1MEHA 3W86A 5LNVA 1VPXA 1TRDA 3DFPA 2CWNA 4UTMA 2YPIA 4ZQPA 2YR1A 3W73A 1JCNA 5BW6A 4DF1A 5EA9A 5T26A 4OU1A 3LHZA 3H54A 1XC4A 1TJPA 3NO5A 2JKEA 4FNQA 2H8ZA 2JGYA 1H7OA 4Z0SA 3W87A 3TK7A 5AFDA 4WX2A 3SSJA 2QCNA 1G4EA 2Y7GA 3GXNA 4XBKA 1GTHA 5HR7A 3TUUA 3IIOA 3DGRA 3UXAA 1PVNA 2Q3RA 4S1FA 2ZFAA 3LRLA 4PC8A 4BF9A 3OVQA 3LRMA 3PSVA 1EX5A 4JTHA 5J5DA 3W7RA 1RVGA 1K02A 1EIXA 1LOQA 3GYEA 3KXQA 2X2GA 3Q37A 4IMDA 1RPXA 2CLFA 3F1QA 3PS7A 3KOFA 4PL2A 2OT0A 3B03A 3TMQA 3RFAA 5FI8A 3TJLA 1QPNA 3IVUA 3RLUA 1X6UA 2WOQA 3NQ6A 5HWJA 4LVDA 3GDTA 4M5PA 4QISA 1JUEA 5BRBA 2A7RA 4KFOA 1VC4A 1Q6OA 3NQ8A 3HMJG 2BLEA 2Y63A 2NXHA 3P74A 3M5VA 4YCPA 1C8VA 3BG3A 1RQHA 3DFTA 2BTMA 4EF9A 2A7NA 2CW6A 1QPOA 1Z42A 1JUKA 1K8ZA 3QH2A 4JYFA 2FFCA 2C18A 1OVDA 3W75A 3UWWA 4UTKA 3EX2A 4K36A 3DI1A 3O6DA 4LUIA 5K9CA 3NR0A 1W37A 4DO5A 1TMHA 2FDSA 3I68A 3QZEA 1TO3A 1R46A 4JYEA 3UPBA 1NF7A 3L2IA 5A5WA 4JYDA 4NX5A 3E12A 1KM2A 2TRSA 3DI0A 3P80A 3GNDA 1Z41A 5KINA 3C2OA 4LUJA 4UNLA 4GUGA 2PRMA 1F2JA 4PEKA 4R53A 1W5QA 4A22A 3VNDA 1GTEA 1LRQA 3M0ZA 4K7YA 3CTLA 4FEZA 4UFMA 1KM6A 5D32A 4UMAA 2HTMA 2R94A 3EXSA 1T8XA 1N7KA 1GVQA 2FLIA 3OEXA 3ABSA 1KA9F 3L9CA 2W79A 3DBPA 4UR8A 3QW3A 1N8FA 2ZDRA 2E77A 1VHCA 4NXKA 4RK8A 3C6CA 1KTBA 5CPMA 1JUBA 3NPUA 3MI2A 1LBMA 1SZEA 2PE4A 4AHPA 2V9DA 4K7VA 4KFNA 3CPRA 2I1OA 3TW7A 2X1SA 3IGUA 3UD6A 4WXYA 3GB6A 3EWUA 1C29A 3MBFA 3Q58A 3DFSA 1G67A 2NUXA 1TV8A 4Y9AA 3STEA 4QIUA 3NQDA 1M7OA 3IIPA 4KKXA 3W2NA 4WXZA 5H91A 4XQ6A 2ALDA 3VKJA 3TKFA 1FY6A 1O4UA 2WKJA 1YXYA 3K30A 3NQFA 3CEUA 3C0JA 1XBXA 4NXSA 5TQLA 2HS8A 3NL6A 4CQAA 5MHBA 4IGHA 4TU1A 3C56A 5DXYA 1B57A 4PL1A 3GKAA 1FDYA 2R8WA 4N9DA 4IX0A 4I7VA 1SPQA 4LC6A 1KW1A 3HPSA 1M7PA 4O4VA 3T7VA 3GKFA 1GVOA 4FX8A 3TA6A 2E6FA 3LTYA 3W1XA 4DQWA 2QCMA 2XN0A 1QR7A 4UTUA 2JBMA 2E5CA 2YZRA 4TIMA 3SIZA 3T78A 4JEQA 3TC7A 2Y85A 1BWLA 3NGJA 4O52A 3W1MA 3NL5A 3W83A 1X7FA 2OZ0A 5BOOA 3LHYA 5I3KA 3W70A 4HIBA 1OFEA 3NZ1A 1X1ZA 3TU9A 1NEYA 3MYPA 1FCQA 5HJLA 4QNEA 2FIQA 3LHUA 2LLEA 2C1HA 4GUHA 2ISWA 4YCOA 2X16A 3CM4A 4LTSA 3GR7A 3RMJA 1ONRA 3G1DA 4Y6GA 1H63A 4L4MA 3TFXA 1IF2A 5LNUA 3ZFHA 5AHFA 4O15A 2VFEA 2YYUA 4FXSA 1TCDA 4PFMA 2R91A 1H50A 1S5VA 1H7NA 1Q45A 1FCUA 5A8GA 1PIIA 4UFHA 5AHEA 1QOPA 1TTIA 5AN7A 3M44A 1JCJA 2ZA3A 2CLOA 2A2IA 4MY8A 5ABTA 3NXFA 1TQXA 2X30A 3IIZA 1OFBA 4JIQA 1FWWA 2J6XA 3MWAA 1MXSA 1HO1A 2JK2A 4BI5A 4BWLC 2C0AA 4MPQA 4RKAA 4Y8FA 3MHGA 3TQVA 2BX7A 3PBYA 1YTDA 1A50A 3LCHA 1KLYA 2WSRA 5DY2A 3WJYA 1VYSX 2XN1A 4MUZA 3F03K 5D2YA 1GQNA 5AOUA 3M41A 5CSRA 4LY8A 4MOZA 2A7PA 4MLJA 1JJKA 3W71A 4A2SA 4EVZA 2J9XA 3QJAA 1TREA 1VCVA 3PR2A 4RXFA 4XWUA 2TPSA 4E2DA 1O60A 3EXRA 5EKYA 1R2SA 4XKYA 2VC6A 3DXIA 2WPBA 4DXVA 3NQVA 1UJPA 2YFNA 1VS1A 3L5MA 1GG1A 3FKRA 3FOKA 3S5YA 5F4SA 4IJBA 4NVTA 2ZZ1A 4FB7A 3OBKA 1XFBA 1LCOA 3PBVA 4AWUA 1GJPA 1SR9A 4E38A 5D2VA 5C2XA 3SR7A 4NX0A 2Q3OA 3VE9A 1KM5A 3NDOA 3G24A 3RLVA 1K7FA 3R5EA 5G5IA 2QCEA 1LBFA 2NXGA 3VCRA 3LM7A 5FEXA 3LCLA 3IVTA 3W1NA 4JGDA 3WJZA 1I8JA 1LLZA 1RD5A 3GXPA 3NEVA 4R7JA 3N14A 3W7CA 1JCLA 3IIXA 1TQJA 3KRSA 3BG5A 3HGJA 4JTJA 1A53A 1DL3A 3LBMA 1QFEA 5D2XA 2VEIA 3TQ0A 1V7YA 1FX6A 2YW3A 4ML9A 2GVLA 1G4SA 4MYAA 2G96A 3OHIA 2DZUA 5F2MA 3SGZA 3LI1A 5G4WA 4RZ6A 1QO2A 3GNNA 2P1FA 4AXKA 3UY7A 4K8EA 1KBJA 3PULA 4UFKA 3NQ7A 2A0NA 1YPIA 4P2VA 5L6UA 4MY1A 1XL9A 3HG4A 4QSHA 3WK1A 5CZJA 3I6RA 3C8FA 2YGYA 5KTLA 3TXVA 4I7UA 4FNPA 3NQEA 2ZYFA 4RV8A 4A2RA 4J9JA 2ZRXA 2Y7FA 2CLLA 1K3UA 4LS0A 2E09A 2H8XA 3BW2A 3BK0A 3G18A 3FIGA 1HUVA 1ME8A 2CLIA 1G7UA 2WO5A 2NUWA 4OV9A 3W2UA 3C3NA 3R12A 1SW7A 3SFKA 5KZEA 1QCWA 4H3DA 1J2WA 3FYOA 3MI6A 1L6SA 2JKAA 3W7GA 3C2RA 3W07A 3TAOA 2JKPA 2WQPA 1C9DA 2NZLA 4O11A 3G1SA 3UYCA 2QKFA 3T44A 3G8RA 2GVGA 3LERA 4MYXA 4WY0A 1F73A 3CQ0A 1LTDA 2YDAA 2QJHA 3BV4A 4ORIA 2YSWA 1SSGA 1B3OA 4POCA 4E0CA 3UPWA 4ZZ9A 3W7KA 3TX9A 4UFIA 3HO8A 1GYLA 5I3FA 4L4LA 5D04C 2Z2UA 1A5SA 1F76A 3GDRA 4OWGA 5C54A 1LOSA 1XI3A 4Z1CA 3BLFA 4MFDA 1ZAJA 1I4NA 3N9RA 5D05A 3M16A 4UMCA 1HO4A 3EWBX 3CIWA 3SGUA 3W1UA 2X1TA 5AHIA 4MFEA 2ZZ3A 2VENA 3LCXA 3O6CA 3LLFA 5HR6A 1NSJA 1TPB1 5CPNA 1YTEA 3B06A 4ZQNA 3UXDA 1E51A 1QAPA 5HMSA 3L68A 3DENA 3UWVA 1WBJA 4LS1A 1ICSA 4Z0JA 4UNKA 2IQTA 3TIMA 1FXPA 3N2XA 4O18A 3UWUA 4NU7A 3NQMA 1W54A 1OYAA 3R13A 2WNQA 3A5VA 2ZRVA 2HSAA 3FYPA 2F7FA 1QNVA 1XUUA 4O54A 2EF9A 1TIMA 3ABRA 4JD4A 2RH9A 3B4UA 4X3ZA 3W1PA 4HPJA 3E0IA 2CLMA 4BFAA 1CX9A 2ABAA 1W5MA 1PS9A 4FX6M 5FF4A 4AF0B 3TE9A 4RZ4A 3GZ3A 1P1XA 5DY3A 2H3DA 4QITA 2GQAA 4I7WA 7TIMA 2CU0A 3BGGA 3P62A 3MJYA 1KFKA 4A29A 3ZWTA 3P7YA 4QJ1A 2QDGA 4M6QA 1OG0A 5AYZA 1Q6RA 4HPXA 1SO5A 4DEFA 3LXBA 2ATMA 1GVSA 1H62A 3PUOA 3MW7A 4Z1AA 1XBVA 3E49A 3TQKA 5EYWA 1D3GA 3USBA 1DORA 1KFLA 4LW7A 3W2KA 5LHEA 5K3VA 5F4WA 3W7JA 2FPTA 5D33A 4M7TA 1QWGA 3RNDA 3V1PA 3W72A 1DV7A 3HGOA 1KLZA 2WSYA 1SQ7A 2TYSA 1MZHA 3EWXA 1W5PA 3LTSA 1IIGA 5F2LA 1P0KA 2C14A 3G0SA 2Y7DA 3G8EA 4NNAA 2RDTA 2QJGA 1SO4A 3O63A 4O14A 3ZS4A 4AB4A 4CCCA 4ORMA 4QM1A 4ZQMA 3CU2A 3GIYA 2TMDA 2CLKA 4GJ1A 5CG7A 1VCFA 2YCEA 5D37A 2G95A 4S2CA 3TH6A 2V2DA 4ONVA 4WUIA 3P60A 1DQWA 4S2BA 2KZHA 3P5YA 1A5AA 3LV6A 2J88A 1TPWA 1O5KA 2E68A 4MVAA 2ZTJA 4WOQA 1HG3A 1ZJIA 3QQ1A 3MBDA 3UQNA 3STFA 5K2ZA 1OYCA 1MO0A 1Q6LA 3GLCA 5CPOA 4UFJA 4K38A 5AB3A 5CKSA 3P61A 2YXGA 3DU0A 2FPVA 3HOJA 4GRSA 1XUZA 2J24A 1SZGA 3HG5A 2VKZG 4XTIA 5AHNA 2C6QA 4N02A 2V30A 2EGZA 3QSRA 4NT0A 4GUJA 4NZJA 3EX4A 3W7DA 6TIMA 1YADA 2OJPA 4O17A 3LHWA 2CZFA 4QAIA 1XXXA 2QAFA 2J9YA 4UTWA 4ZL1A 1R47A 3NAVA 3AO0A 3JRKA 2DZWA 5AC7A 1UB3A 2G5WA 3EX3A 4UC5A 4DPPA 2NX1A 4Z08A 4NUWA 3W1TA 1BTMA 2Q8ZA 3HG3A 4BI6A 5CZ0A 4GUFA 1J4EA 1DVJA 1LORA 3W7LA 2I14A 1GYNA 4E2BA 4YWIA 1Z48A 2VEMA 3QMTA 4WZHA 3PUDA 4QQ3A 5HINA 3FEMA 4AMAA 4JTUA 5F2IA 1G4TA 4DO6A 4UTHA 3AJXA 2F84A 4AHQA 2QCFA 1I2PA 1OF8A 1K03A 5EMUA 3DKLA 1XKYA 1VHNA 5FF0A 2B7PA 1K7EA 5D30A 1KFJA 1M5WA 3QYQA 3STGA 1Y0EA 3H53A 3NQCA 5EL1A 3TAKA 1SSDA 2X1RA 2NX3A 4KWWA 4UMBA 2V82A 1L6YA 2H3BA 3LBCA 1JR1A 3CWOX 3M47A 5KZDA 1AL7A 1XM3A 3PVFA 4DBEA 1SZNA 3TSDA 1OJXA 1OX4A 1YYAA 4YXGA 2E6YA 1IXNA 1WX0A 1Z44A 3PWAA 2DP3A 5HWNA 3NYZA 3P67A 5E1QA 1H1YA 2QDHA 3W7NA 1H7WA 5LSMA 4GNJA 3EX6A 5DBTA 3IGSA 4MJMA 2RHGA 4ADTA 1GVRA 5BNKA 3C2EA 1I2OA 5BMWA 2ZZ4A 4FF7A 4BI7A 2ATSA 2Z0IA 4IUOA 3GDLA 1GOXA 3ZR4A 3B8DA 3RK8A 3B0VC 1WOAA 3MMTA 4O19A 1I45A 4MJZA 5CPLA 3A24A 3N3MA 1F5ZA 5FF7A 4H4IA 4JXCA 1VYRA 4DPQA 4RX0A 2VFGA 4FO4A 4DF2A 2JGQA 1N55A 2ZRZA 4IPIA 3NA8A 1W1ZA 3TDFA 1U5JA 4O8RA 3L5AA 4W9TA 1FQ0A 3O1NA 4PTNA 1JQVA 1BEUA 5D2TA 2ISSA 1X1OA 3M1ZA 4RLIA 4AHOA 2A85A 2V81A 3LHVA 4JN6A 3KVKA 4JY8A 3QFEA 2NLIA 1ME9A 3DFQA 1TV7A 4FNUA 2P0OA 3BW4A 5FESA 4LVAA 3ATYA 3G0UA 5HQEA 3T40A 1MSSA 4A3UA 3G0XA 3CC1A 3G1YA 3HPZA 4X22A 4NJIA 4RZ5A 4LV4A 3TC6A 4HNVA 1Q3NA 1IXPA 4D2JA 2ZRUA 4CLMA 1XDMA 3TW6A 1SUXA 2D73A 3W7IA 2QJIA 2O7QA 4YLWA 1ZNNA 3W6YA 2RDUA 1YDOA 1DBTA 3NOEA 4PA8A 4PH6A 3TCEA 4MKNA 3W7OA 3W7PA 2W6RA 4IPJA 3SECA 1JRBA 4Y90A 1LROA 1KV8A 1DHPA 1G6CA 3CLMA 2EPHA 2QCCA 1T99A 3ABQA 2P10A 3T55A 1OFQA 1WOBA 3O15A 3W9ZA 2TSYA 2DORA 1WBHA 1OK6A 1PCWA 2VFHA 4FIRA 4O0KA 1M6JA 3O05A 4FNSA 4UCGA 3FJ6A 5DLCA 5HULA 2QR6A 4N2YA 4ZQOA 4CQ9A 1FCVA 1BKSA 2ABBA 1VJIA 4AWSA 3S6DA 3HB9A 3DFNA 4RJEA 2RFGA 2A5HA 3OIXA 3NZRA 3L21A 1XDLA 1X8FA 2PCQA 1KFBA 1ZY9A 1TTQA 3HIJA 4EOUA 3N73A 3W2JA 3WJSA 1XBZA 1WYIA 2C15A 1EA0A 3WK2A 3R2GA 2QCLA 3DHFA 3QEZA 5J5RA 1RV8A 3A21A 3PB0A 2RDWA 3DZ1A 2ZZ7A 3M6YA 3S1VA 4JTIA 3UY8A 3UWZA 2QF7A 3CB8A 4DO4A 4YL2A 3PG9A 3HPXA 6ALDA 3WFAA 1KFEA 4UTTA 1U83A 3NQ2A 1NF0A 1KFCA 2O7SA 1TPUA 4AAJA 3D0CA 3FLUA 1AL8A 2E6AA 4P61A 1GZGA 1K7XA 2Y89A 3HQ1A 2CZEA 2DZVA 1OFPA 3B0PA 3LI0A 3LGEA 1AK5A 4HNUA 1W3NA 3PG8A 4JX4A 5F1VA 3UWYA 1F74A 1R2TA 2WV8A 2BZNA 4GUIA 1DJQA 4O13A 1L2UA 4O57A 4QNWA 3WJWA 4UTWC 5K4XA 1A5BA 3P82A 1OYBA 3ZWSA 5L9FA 4GWEA 4AWTA 3ANYA 3S5OA 3PF3A 3HJZA 3DH7A 3O06A 1FWTA 1H1ZA 1JQXA 3NQGA 5K7JA 1XBYA 1YLVA 4ZMGA 2GPTA 1YDNA 4LV9A 5D38A 4UIOA 3P5ZA 2PRLA 1KBIA 4HNNA 1KM0A 4WJEA 1F7BA 3NVTA 1KTNA 4O4WA 2Y70A 4HHPA 3C2VA 3TXZA 1LM1A 3EX1A 3N9SA 3S0CA 1JULA 1O5XA 4UTLA 5CZSA 1OABA 4N4PA 1JVNA 4N9CA 4LNYA 3L66A 3JS3A 4UXDA 4FIQA 2FQIA 1LBLA 1TPFA 4JS3A 3R8RA 3UWQA 5KITA 1UASA 4K37A 3OVPA 1L6WA 2QEZA 3BO9A 3QQ0A 1VR6A 1SO3A 2QUVA 3P8IA 3GAKA 2QCDA 2NV2A 4CQ8A 4HSOA 4B5NA 1EWDA 3L0KA 3PBUA 1LYXA 1LP6A 4XKYB 1ML1A 1LZOA 1THFD 2BSLA 2QCGA 3KVLA 1DOSA 1LRNA 5EBUA 3R89A 2B0MA 2WNZA 4ICNA 1D9EA 3W7QA 1FDZA 2Y88A 3QC3A 3STCA 3FJLA 3LTPA 4ALDA 4JTSA 1P0NA 1VCGA 3F4NA 3UNDA 1UUOA 3P8JA 3O16A 3N19B 2CLHA 3PAJA 1WQ5A 3EEGA 4NJJA 1TPDA 3LXAA 4Z1BA 1YDVA 3FS2A 5D02A 1EWEA 2E5DA 5LNSA 4XZ9A 1OK4A 1ZHAA 1UBSA 3EWWA 2C13A 5G4EA 5I3GA 1KTCA 1TPEA 2RKXA 4IMCA 4N4QA 3S8HA 4PODA 1AW1A 3ATZA 1IXOA 4DELA 3ABOA 3TSMA 3I7RA 3LV5A 5LZLA 3DAQA 2WSQA 1EUAA 5DCEA 4ADUA 1GT8A 3W1LA 2CFFA 5LNWA 4XUGA 1JRCA 5AHLA 2B7NA 4CCEA 3IV3A 1WDWA 3OVRA 1SU5A 2FTPA 1QOQA 2VEPA 2NWSA 4NNBA 3KRUA 1W56A 1FWNA 2NX9A 4U28A 4N6EA 4NJHA 1K8YA 1R2RA 1TJRA 2OMAA 5C55A 3VFLA 2V5BA 5D2WA 2EKCA 3LDVA 2ZZ5A 4HSNA 4K39A 3NL2A 4IX2A 1H5YA 1OFAA 4JIPA 1AW5A 2ZBTA 4O12A 5GVJA 2PURA 2Q8LA 5LGXA 2PC4A 3VI2A 3KFTA 4O53A 3GAYA 4O16A 1PCKA 2VOMA 3QPYA 2W0UA 3HG2A 1TTJA 1H61A 3B05A 3OA3A 2GVJA 4GXMA 4TR9A 1LOLA 5E0KA 4LU0A 4EIVA 1PL9A 4RCXA 1SW3A 3CEPA 3PUEA 5U4NA 5I3JA 5KMYA 1HFBA 3PBWA 1ADOA 4OQVA 4IQLA 4O0ZA 2OT1A 4JY9A 5KSWA 3I65A 3W1QA 1ZFJA 1GEQA 2ISVA 3EKZA 4N9BA 2Z6JA 2HS6A 3MYOA 4MIMA 4FHAA 1R30A 4JTKA 4DBDA 4N9EA 1W5NA 3M5ZA 5IBXA 5DCDA 1MEWA 3M5XA 1H7XA 3C2FA 3A5FA 4HN4A 4WY0B 3T4CA 3MP5A 3LCWA 3ELFA 4IMFA 3GDMA 3QRHA 4FNTA 2VFFA 3NL3A 4IWWA 5LNRA 2AGKA 4RXGA 1H7PA 1IXQA 1H7RA 4M7SA 3BPWA 2EAWA 1WA3A 4FNRA 4IOTA 3THAA 5D09A 3W3OA 2ZA1A 2NUYA 2Z1BA 3KX6A 3WK0A 4PCFA 8TIMA 3PC0A 3C52A 2NV1A 2E6DA 4K6AA 4HT3A 2V8ZA 3PB2A 1EP1A 1F05A 2QCDB 4UTJA 4O1CA 3IGXA 1AW2A 5IM51 2OCZA 1TYGA 1W5OA 4GE8A 1EUNA 5K9XA 4LS2A 1I2QA 5FEPA 3W85A 4KWVA 4FX7A
chains in the Genus database with same CATH superfamily
2B7QA 4Q4QA 1TPH1 4R34A 1BRLA 3W1RA 5TD4A 2HVNA 2BWGA 1NAL1 2Z1KA 3GQYA 4GI9A 1XF0A 5KETA 4W7UA 1D3HA 5I02A 2B7OA 3MANA 3WQWA 3R0KA 2RUSA 3POCA 1WV2A 5XINA 3G1XA 3KCLA 3L65A 1Q2SA 2XH4A 3GY1A 2F6KA 1KQYA 4N6FA 4JN8A 4D6EA 1LT7A 3CYJA 2OYLA 1TZ9A 3G1HA 3M7WA 1H0IA 3VGEA 5E9XA 4HNTA 1WO2A 2A4AA 2EG8A 3L0NA 4IIEA 1NQ6A 4Y8EA 1GVIA 1GOQA 4Q8VA 2OZ3A 1E9ZB 3NDYA 4D6JA 4JDBA 3VD9A 1US0A 4GQ0A 1DJIA 3QHOA 5C6MA 4G5DA 1ZAHA 4V33A 1UIPA 3WH6A 5I03A 3VAVA 3TNOA 3YPIA 1QUMA 4X2RA 4JICA 1XYAA 4R85A 4RNJA 4HOXA 1BWKA 5REQA 4AZIA 4WOZA 4LC8A 5C71A 5DANA 4Q8UA 1V03A 3WY1A 4J3WA 5A2BA 4GI8A 2X1IA 1T0OA 1GQLA 1QPQA 1H51A 5I3HA 3LCIA 1QBAA 5DT5A 5TIMA 3QGAC 2WZMA 2WHMA 1KRAC 2EJ1A 1UWRA 3FGCA 4KFPA 3ZT7A 3CWNA 2WM1A 1KFWA 1Z7AA 2WC4A 2VGIA 1OHLA 2EHHA 4Z2GA 1RR2A 3MB9A 4OBSA 3WQ5A 4CNUA 1QXLA 2DU2A 3FDGA 2C19A 2EPOA 3VDBA 3QVQA 4JQ3A 4J3XA 4DN1A 3KZSA 2ZZ6A 4QG6A 1R85A 3G5EA 3WLRA 3H24A 1ODUA 2J13A 3KVMA 5DT7A 5CAHA 4DF0A 2OKOA 3E96A 3ZM8A 1IEQA 1WZMA 4JTCA 3VIPA 3KS5A 4JKMA 4L1WA 1XCFA 2UY5A 3LU2A 4Y2WA 1T6MA 4H19A 9XIAA 3T0AA 3GK0A 1M41A 2DZSA 4KW2A 4U5KA 3UCCA 4OT7A 4TV5A 4O1EA 3G6LA 2WNWA 2DT2A 3W02A 3N4EA 3IVSA 2JF6A 3BLEA 5CZTA 1YXCA 3MP3A 4C5ZA 5EPDA 3EMCA 4DXKA 2IXVA 5CSSA 3VIGA 4B3KA 1VH7A 3HU7A 1M01A 4I5XA 4HCDA 1HKJA 3KOZA 4OHQA 4DBWA 3CMFA 4PUWA 3LHTA 3RF9A 1KC7A 4Q8OA 1X39A 2B4GA 3OG3A 1YRRA 2DJXA 4JTLA 1MXDA 2PPGA 3CGTA 5BZAA 2E3ZA 2PLKA 5DBUA 5C5YA 2Y6ZA 1RJQA 3LYEA 1EOKA 2WNNA 3EWCA 1JYVA 1NVMA 2XWDA 2PRHA 3A12A 3WQEA 4D8ZA 3PZIA 3SY5A 1P43A 1HKMA 3VOFA 3INPA 1OCQA 2E1DA 1E15A 3TFCA 3DHDA 3P81A 4XD3A 2GGGA 5CXPA 3W76A 3THQA 4DBUA 1MEIA 1JPHA 1H1NA 4ES4A 1XYZA 5IBXC 5I6SA 2AAMA 2QAPA 3ITXA 3PAOA 3QMRA 3KW3A 1ZP3A 3CPUA 2QUUA 2IPJA 2ZWYA 2X1UA 1FWRA 4AXNA 1QATA 1V6WA 4W4QA 1O95A 3KEHA 4XAZA 4RE4A 3DHPA 3A3HA 2R1KA 4JEJA 2AAAA 5EY5A 2Y0FA 2P50A 1WXYA 2E5BA 4NJKA 3L4YA 4NNCA 3SRFA 3H55A 1WDRA 3WQPA 1HIZA 3MY9A 3NPXA 4A3RA 1GVFA 4LBUA 4B5UA 3AXMA 2QUTA 3KAOA 1E4NA 1EP2A 5JBEA 4GACA 3LRKA 3VOHA 3TWAA 4ZXOA 5IDZA 1S5WA 5CJ5A 1YBQA 3GVQA 2V0TA 2GDQA 1RQBA 4LANA 2XG9A 1FBAA 5DQPA 7TAAA 2I5IA 3VKAA 2YCLA 5AYXA 5FEZA 3LY0A 1K9TA 4AEOA 1PB0A 4OKDA 1RPKA 3WLJA 4IXHA 4J2MA 4E4FA 3RDKA 1YTKA 3EWYA 1SW0A 1TZZA 4ZGYA 1BXNA 2OSYA 1ZALA 4FXRA 3VIFA 3TN5A 3NM3A 2RGLA 1NOWA 3BJTA 3OYXA 1J93A 5TNVA 3T08A 5E93A 4OOZA 5G1YA 4HMDA 1UCWA 2Y5JA 3TC3A 1MNZA 4CNNA 3RR4A 4C6FA 3S1XA 4O28A 4AMCA 3S2LA 2X0SA 4RW3A 5C9XA 3NCOA 1EGVA 5LHFA 3BAYA 2I56A 3VZXA 1EP3A 4B5XA 4JX5A 1RZMA 4GXWA 3E2RA 3T2QA 3LCFA 4ZB0A 1QWKA 3G1FA 5GJMA 4M6PA 3FAWA 3W22A 1VGAA 1BLIA 1VRDA 5K9DA 1J6OA 1V3JA 2VEKA 1DQXA 3GFXA 4KETA 4CCDA 1AG1O 3ALFA 2VGFA 1OX5A 4J4KA 2VRJA 4K68A 3C4UA 3MP4A 3WQGA 2AGTA 1J5TA 3LCGA 3S5ZA 1SFSA 1D8WA 2OOFA 5IFPA 1OFDA 3L5LA 4IP7A 3DG6A 2A21A 5HWMA 3C0LA 4JTFA 4DVOA 1RH9A 3CHVA 2OLAA 3GW0A 1EPVA 4BWLA 5HA7A 1FWSA 5I79A 3O07A 3CL6A 3WSUA 5HNTA 3SW6A 3VGDA 5BRQA 4LT9A 1WXJA 3CZEA 1O6IA 3GR8A 3KE0A 1IGWA 1VPXA 2CWNA 4P5UA 4B2DD 1FHDA 5BW6A 4IISA 3H54A 3IAQA 5BROA 3NO5A 3AIVA 5A1AA 5H8MA 2Z1SA 2H8ZA 2JGYA 1EDQA 2FMNA 3W87A 1S5MA 3TK7A 2WPGA 4US6A 1ZBVA 3SSJA 5A8MA 1G4EA 3BLPX 4D8AA 3GXNA 1GTHA 4EACA 4QDPA 4U2YA 3UXAA 2Q3RA 3W0KA 3H2AA 1CDGA 1XLFA 2GJXA 2VQTA 3PZGA 2HNHA 3H2FA 4RNHA 1XRFA 3C0QA 1K02A 3VC6A 1UPMB 2WKLA 3KXQA 4OJYA 2X2GA 4OUIA 3Q37A 4IMDA 1RPXA 4QR6A 4MTVA 4PL2A 3TMQA 4M3PA 3SADA 5ECVA 4LJ3A 3GDTA 4PRWA 1CGVA 2A3CA 9XIMA 3L7RA 1VC4A 1Q6OA 1C8QA 2DZBA 4L9YA 2BLEA 2Y63A 3P74A 4D6HA 4YCPA 3USZA 1C8VA 4HK6A 2PDPA 1PSCA 3T0DA 1VF8A 4EF9A 1QPOA 3BLKA 1K8ZA 1F8MA 4JYFA 2FFCA 2C18A 1BFNA 1W1IE 3LQLA 3NR0A 1W37A 2FDSA 3DCPA 3QZEA 1Q66A 3HZ3A 1CGYA 1R46A 4GY7A 4J40A 2DSUA 4JYEA 1J11A 4Q4SA 1KM2A 2TRSA 4KEMA 3ZT6A 1Z41A 3WNOA 3GTIA 3C2OA 4JPGA 4U3AA 4P8WA 4UNLA 3D6NA 4OTKA 3TCSA 4XX6A 4FMVA 4S38A 2PA6A 4K7YA 1V0NA 4FEZA 4UFMA 4FSAA 4WJ8A 4LXFA 2CKSA 4Y9MA 1KR1A 1N7KA 1XIMA 5CPSA 3WF2A 1GVQA 2R9RA 4GY1A 3GG8A 4LEQA 1KA9F 3FHQA 2XIBA 3ISIX 7PTDA 4UR8A 3QW3A 1VHCA 1H11A 1FH7A 1HJQA 3NPUA 4QG8A 1LBMA 2J7DA 2PE4A 1BYAA 1Q8AA 3WLMA 3CPRA 2I1OA 4W5UA 1G94A 5CJNA 1XICA 3GB6A 3MBFA 3Q58A 3QOKA 1TV8A 3STEA 1TMQA 1NTHA 4G7EB 4IF2A 4W5ZA 3E3HA 1W9DM 4WXZA 5H91A 2Y24A 1O4UA 5LYRA 4M0XA 1GKPA 1E6PA 2HS8A 4CQAA 4XB3A 3TYAA 3C56A 1B57A 5HQLA 3GKAA 4WDTA 4A4AA 1KW1A 3AIBA 1GVOA 4V1XA 3NSXA 4M6UA 3G77A 1QR7A 3HMCA 3MMUA 4AQLA 1PEZA 4D6FA 3RO8A 4WLCA 3SIZA 3T78A 4V27A 4AY1A 4JEQA 4PB5A 1BWLA 2O9OA 3MDWA 5IDIA 5HANA 3W83A 1X7FA 3BQ6A 3LHYA 5ENLA 3W70A 7XIMA 2IPFA 2X7WA 4LX4A 1X1ZA 3NZGA 3EGJA 3MYPA 3FK4A 4QNEA 2Z4GA 3SCWA 3V0TA 1AQ0A 1ONRA 2OWCA 4F9JA 5HMFA 4Y6GA 2VZSA 4O8AA 4M51A 1CWYA 4GK8A 5AHFA 4O15A 2VFEA 4C65A 4HOZA 2KAUC 2WAGA 3PP7A 2R91A 4AFYA 1H50A 4ZR8A 3CQJA 3GTXA 2BASA 2HCVA 3UXKA 2WWCA 4UFHA 5AHEA 2DT1A 1UP2A 4FOUA 4L56A 3C8NA 4LYQA 1JCJA 2CLOA 3M7SA 1TQXA 1EHNA 3HQPA 3P0XA 4C7GA 2QXWA 2WBGA 1PKYA 2GFTA 1A50A 3B0YA 2GGHA 5HJXA 4KGLA 2XN1A 3A3WA 3H70A 2WMJA 4LY8A 2BFGA 4MOZA 2VCCA 4AW7A 3WH5A 1P7TB 4EVZA 2GSHA 4FLRA 6REQB 2UY2A 2TPSA 4GNKB 3VKCA 3EXRA 5ECUA 4XAFA 2G3FA 2OGYA 2GUBA 3FKRA 3L5MA 1R5YA 1M1BA 3FOKA 3S5YA 4LUSB 4IJBA 4FB7A 1UHVA 2H9AA 1AQMA 4Q8PA 4IP5A 3B97A 4NX0A 3D47A 3IWPA 3A3XA 4W88A 4GIRA 2GWGA 3R5EA 4GYPC 5G5IA 1DE6A 3DESA 1FFQA 4H9UA 4CKQA 1J2BA 4WSKA 4AZ5A 2VWSA 3LM7A 4IG2A 5FEXA 1Y65A 4QS5A 2OQYA 3CXOA 3REQA 1BGGA 4DB7A 4MWAD 1JCLA 4IHCA 4B4FA 1LF1A 3WENA 3K4WA 2J77A 4H9YA 3LBMA 1XIFA 2I16A 4CCZA 1UKSA 1XH2A 1MWOA 3IK2A 4MYAA 3EDJA 3THDA 3B8SA 1E6SM 2DV0A 1CPUA 4HCHA 4BCEA 3EMQA 1W9XA 3K4AA 4NYUA 3UY7A 3NWRA 2PZ0A 4XZHA 4DJDC 5C7HA 4F3HA 4P2VA 2Z2BA 3QY8A 1AH3A 1XL9A 4PCPA 4QSHA 1OADA 3WK1A 3TP4A 3C8FA 2WMFA 3UG3A 1OT1A 3TXVA 3ZYZA 2PLMA 3UR7A 1V4YA 3H21A 4GYJA 3N6HA 1K3UA 1NQKA 1EQCA 4OFCA 3UZXA 2E09A 2H8XA 3BW2A 4H41A 3BK0A 1ME8A 2J47A 1UD3A 3E74A 1EXPA 2NUWA 3CAVA 1AJ2A 3L2LA 3SFKA 1QCWA 1J2WA 3FYOA 3GBDA 2OPJA 3CTTA 3W7GA 4GQBA 2C7FA 4NF7A 2VHLA 1XG3A 2VRQA 2NZLA 2NV9A 2QKFA 3E38A 2EKGA 2QJHA 1V7AA 4ORIA 3GIPA 2FH8A 3TX9A 1GYLA 2W3ZA 2WHLA 2Z2UA 5DRCA 4ZFMA 3BLFA 5FJRA 1KCKA 1AA1B 3N9RA 1WDQA 3M16A 1U2YA 4KH2A 1F07A 2PP0A 1OINA 5HR6A 5EMKA 3LGGA 5CPNA 3EPOA 2ZUWA 5FD0A 3UXDA 1E51A 2BP1A 1KGUA 3L68A 1RCOB 4JCLA 1WBJA 4AZ6A 4KRUA 1ICSA 1TE1A 2BGQA 4UNKA 1UWQA 3N2XA 4OECA 3UWUA 2WNQA 3I10A 3QY6A 2QJMA 4HTYA 3LEPA 4LUTA 4JQAA 1XLKA 1E9IA 1QNVA 4JIIX 4HPJA 5C9ZA 2ESCA 3R4IA 1PS9A 5FF4A 4AF0B 1WZKA 3IANA 2ZUMA 5DY3A 2H3DA 4NIRA 4JN7A 4GJIA 1VEMA 3EAUA 2PDMA 3VIOA 3MJYA 4DLFA 2RJGA 3W01A 2VGGA 4M6QA 3WEOA 5AYZA 2KX9A 4P8XA 3LXBA 5BWAA 7ENLA 3OHMB 1GVSA 3AAMA 4BZYA 2XH2A 5EYWA 1D3GA 3S3GA 1DORA 1K6AA 3W2KA 3E5PA 5K3VA 4ZENA 3EOLA 3WLQA 3W7JA 4EANA 2FPTA 1DV7A 2D3NA 3HGOA 1KLZA 4V15A 4GKTA 1TJ1A 4PN2A 2J79A 2C79A 2O9TA 1YNPA 1BWVA 1I75A 2RDTA 1X38A 4PTXA 2GDUA 3AZTA 1ISZA 1C8YA 4LB4A 1P0DA 4ZQMA 3CU2A 2A3BA 4ACYA 4ZSTA 3WL0A 2CBIA 2GDVA 2YCEA 4EX4A 1E71M 3TH6A 3E0WA 2V2DA 4WUIA 1XLAA 1A3WA 1F9CA 1DQWA 2KZHA 4QE4A 1A5AA 1TPWA 1O5KA 4MVAA 3ZVIA 3N29A 4WOQA 3AXKA 1OYCA 2BXYA 1PIGA 3CHFA 1X1NA 5AB3A 2IQDA 5AC4A 4BY3A 1XUZA 5D9NA 1SZGA 2VKZG 5AHNA 1POKA 4NT0A 3T9PA 3W7DA 6TIMA 3DOPA 4O17A 3GH7A 2QAFA 4UTWA 3AMLA 3CWHA 3NAVA 3AO0A 3BZGA 2DZWA 1YNYA 2C0HA 4LUYA 4UC5A 2NT1A 5A8QA 2PEVA 2NX1A 4Z08A 4BI6A 1J4EA 3VIKA 4GZEA 2I5GA 1DVJA 4L6DA 2I14A 4B2DA 2PTYA 4E2BA 3IJ8A 2Y8VA 4L1XA 3QMTA 4WZHA 3SRDA 4QQ3A 1S2TA 2XVNA 3C86A 5F2IA 3VX1A 4ZSUA 1NP0A 1ZTVA 3ARYA 4AHQA 2QCFA 1K03A 5D30A 4R88A 1M5WA 3STGA 4NSBA 3K1GA 1SSDA 2X1RA 2BV9A 4W86A 3SO7A 1UPPA 2V82A 5I2UA 5HDRA 2PGEA 4K1WA 1JR1A 3M47A 1O5RA 1AL7A 1XM3A 1E5NA 2J8FA 1SZNA 1O12A 1XSKA 1CGTA 2E6YA 3WDIA 3TYCA 5HWNA 3GXDA 3P67A 5E1QA 3H2CA 4PMQA 3W7NA 1H7WA 5LSMA 2HVMA 1YKWA 3IGSA 2BMBA 5C2CA 1CT5A 4MJMA 4QRNA 2DY3A 5BNKA 2F2HA 2YZ5A 2ZZ4A 4IQDA 4KCUA 1NWUA 4BI7A 3EWDA 3OPSA 4IUOA 3GDLA 2E28A 3LZ3A 4J3VA 3BDKA 3MMTA 4WR3A 1EC8A 2PS2A 4IFOA 2FZ8A 1OZMA 4RDZA 5FF7A 3WF3A 4RX0A 4DF2A 4F2BA 4KCVA 3L5AA 1BD0A 1IEIA 1TX0A 4C91A 3W81A 2R1MA 4AHOA 1R86A 1ONWA 3CUZA 3UCDA 3UXLA 3BTNA 1W9VA 2V81A 5IHSA 4KBXA 4QLKA 5PTDA 1JEZA 2D2JA 1POJA 2NLIA 1E6ZA 2P0OA 1PX8A 2WVUA 3GSMA 1UH2A 3G0UA 3VD5A 2YL5A 4L64A 3AJ7A 1R8LA 3K13A 2WBKA 3WMLA 3SCTA 4LV4A 4QP0A 3UW6A 1IXPA 3DEQA 2WXDM 4CLMA 3TW6A 2O55A 2D73A 3W7IA 2O7QA 4YLWA 1ZNNA 2OLHA 3AROA 3QOMA 4S3DA 2J62A 4IPPA 2FTYA 1HNYA 1RJPA 3CH0A 1BSIA 4Y90A 1KV8A 3CLMA 2EPHA 3L4UA 4AY7A 4KERA 3BOFA 3W9ZA 2XYLA 3VIJA 4ICCX 1V0LA 2DORA 3RRAA 3AICA 1EIBA 2VFHA 4FIRA 3VTRA 3V4BA 3FN9A 5DLCA 4ZQOA 4CQ9A 1QNSA 4XZLX 1R9YA 3EDEA 3TYDA 2ABBA 4U31A 1L8NA 5KZ6A 2ZWZA 3SQLA 1HJUA 1KRMA 4PTDA 3HB9A 1SM9A 2D1ZA 4I6VA 4RJEA 2RFGA 3T07A 3ARZA 1O1ZA 1X8FA 1KFBA 3HIJA 3TZNA 4EOUA 3N73A 3EA2A 1FH8A 3WK2A 1ZLPA 3R2GA 1W1YA 3DHFA 3QEZA 5J5RA 1W8GA 3C2YA 4ICMA 3S1VA 3CB8A 4ZCWA 3VM5A 3WF4A 2XIQA 4YL2A 3OGSA 1KFEA 4C7FA 1VKFA 3QKZA 4HMNA 2VL4A 2PLCA 3D0CA 1GZGA 1K7XA 2WJDA 4A8NA 2GL5A 3QGVA 3GXMA 4MSSA 2HNEA 3AFBA 4B91A 3AXXA 1L2UA 1X97A 3C0SA 4UQAA 8A3HA 2XUCA 1KWKA 2VD9A 4AWTA 3ANYA 1QJWA 3PF3A 2ZXAA 3O06A 1NY1A 3CT2A 3F5KA 1YLVA 4ZMGA 2F6XA 2GPTA 3WD2A 4D6GA 2Q01A 3PJUA 1YDNA 2P0IA 7CGTA 5D38A 2VRKA 2J7CA 1WPCA 1XYLA 5LIYX 4MB3A 1UZ4A 4A3QA 2X05A 2VVNA 4HHPA 1E4LA 3GE7A 3EX1A 3VA8A 1IWAA 4YU1A 2INZA 1OABA 4Z2HA 1JVNA 1EF2A 3R58A 1C91A 3STPA 2D2OA 2DDXA 4XAYA 2FQIA 3T8QA 4XAGA 3R8RA 2ICSA 5KITA 1XDJA 3CHCA 3VYLA 3IUHA 2REQA 1VR6A 2OTDA 1ZRQA 3WLIA 1XRSA 4GIYA 1EYWA 4ZO6A 4CQ8A 3MWCA 1LYXA 4XKYB 2WK2A 1THFD 1KO0A 2VGBA 2BSLA 2PDQA 1CXIA 3ORWA 3SQSA 4MWAA 3FJLA 4GGHA 1JGIA 3F4NA 3KTSA 4M81A 2QUMA 3RJXA 4NP7A 4G8TA 2G3MA 3O16A 4V1YA 1JDFA 4Y9OA 2CLHA 4Q4PA 1WQ5A 1M7XA 3LXAA 1Z3NA 3R11A 5LXEA 4PUDA 5LNSA 1IEWA 4XZ9A 1TPEA 4JNYA 4PODA 4DJDD 3EDFA 5I78A 1IXOA 2VZVA 4C60A 1CGUA 3ABOA 3SRHA 3DAQA 3PANA 4XD5A 1GT8A 1K9FA 5LNWA 5RUBA 5DX7A 2PTXA 5AHLA 3VIMA 4CCEA 3SY1A 3OVRA 2Z27A 4CN1A 3KRUA 5IRPA 4KRZA 1E56A 1FWNA 4FLOA 3TOPA 2NX9A 2FYMA 4N6EA 5A8PA 1M65A 5E6YA 1FWCC 1TJRA 2OMAA 5JMUA 3VFLA 1EKOA 1V93A 4PUMA 2ZZ5A 4HSNA 4B5TA 1H5YA 1AW5A 1ZB5A 4O12A 5GVJA 2PURA 4PRTA 3ZJ8A 1GEHA 1ZZMA 4KWUA 3VI2A 1V02A 3KFTA 4O53A 4HYWA 1G01A 1PCKA 4H83A 1BYCA 4S3KA 1ZPTA 5EMJA 5FJOA 4HPGA 2W9MA 2QNEA 1UR1A 2WVVB 4HA4A 4TVUA 2GOKA 1K9DA 1I1WA 4RCXA 2BVDA 5KMYA 4GC3A 3N1AA 3WMBA 2QUNA 4OQVA 5ABFB 3FA4A 4MDOA 2OYMA 4JTDA 5KSWA 1DTUA 1HVQA 4PEEA 3QR1A 2PU1A 5A3HA 2X40A 3MYOA 4FHAA 4DBDA 2XIJA 3GXIA 1E0VA 2HDJA 4GX8A 1W3LA 5IBXA 1T41A 1H7XA 1PAMA 3C2FA 4P7QA 3A5FA 5AY7A 4HA3A 2WZEA 3ZQ9A 4H2HA 3T4CA 2VX7A 2QV4A 4IMFA 2UY4A 3QRHA 4FNTA 2VFFA 3NL3A 5LNRA 3OU8A 2RAGA 4J1OA 4B5VA 5XIMA 1H7RA 3BPWA 3THAA 2WCAA 2WZHA 4IOTA 1FHLA 3U7BA 3E1F1 4ZO7A 2FH6A 1B3ZA 3FVMA 2Z1BA 2CIPA 3SURA 3WK0A 4R27A 3CH9A 3KL3A 3VNZA 1R38A 1DWJM 3R10A 2Z1WA 2QCDB 2D0GA 3P2VA 1QI5A 3KBJA 4KIRA 4MJ2A 2YIHA 1LG2A 1RALA 5FEPA 3W85A 2DT3A 2DZAA 4FX7A 3T2OA 4DUWA 3SI9A 4CU6A 4YHEA 2R82A 3PY2A 2EPNA 4M6VA 3Q67A 4HKPA 3NQAA 1HVXA 1HTIA 1U5HA 1UQYA 2W63A 1I9CB 4WD0A 4PTVA 2PDLA 1MMFA 2XFRA 3Q2DA 1AH4A 3G1RA 3LB0A 4L80A 4OBRA 4X9SA 3QHMA 5A2CA 4Y96A 1T96A 1G69A 1XS2A 4NZFA 3ARRA 1F3TA 1ONEA 3EXTA 4QDWA 4I9AA 5CPTA 1OF6A 3PBMA 1MFUA 3BCJA 2ACRA 4TTUA 2IPGA 2CHOA 2HZGA 2I7GA 4F4RA 1PYMA 4TO8A 1KM3A 3LSCA 4M19A 1LUCA 2DUZA 1TPVA 2PTZA 3C3UA 1O94A 3OZMA 1P6WA 3HF3A 4NZ3A 4XK2A 1J6PA 2I5QA 2Z6IA 1Q8JA 2PZNA 1HP5A 3GDKA 1CI1A 3FA5A 3QR0A 1ICPA 3S42A 5JIWA 1Z32X 3CAKA 4YTTA 3E02A 2V68A 3RLGA 1TB3A 2HMCA 1OCBA 1YIXA 1EO7A 4AVFA 2CERA 2ZQ0A 1UOZA 3KDNA 2AMGA 2B31A 4BHYA 2EBNA 4Q4OA 3F4CA 4AEEA 2YDRA 3AU2A 1YPFA 3WQ4A 1JZ3A 2R6OA 2J75A 1CXHA 3F2CA 1AODA 3DKJA 4ZVJA 2DSKA 1H49A 1CW2A 1MW2A 2VVSA 3CUJA 2ZA2A 2H90A 3JUGA 4YMZA 3ZIZA 3VDGA 1A5CA 2OSXA 2P88A 4AX6A 1TG7A 3PHAA 5BWFA 3LOTA 4RNFA 3N18A 3G3MA 6XIMA 2FVLA 4OUEA 2O0TA 1Q85A 4JCMA 2OO0A 3U6WA 1JAEA 1ZBWA 4LVFA 1KNWA 4CU8A 4H6QA 1HL8A 1F3WA 4O1AA 2Y7EA 5HNNA 3POHA 4I8DA 1TRIA 1OIFA 3PZMA 1BQGA 5BOEA 1DJNA 3MI3A 4ZO8A 4H6KA 3V36A 3LNMA 3ARWA 1NDVA 4R3UA 3WQ8A 2V5LA 2I9UA 3PWGA 1E72M 2VNCA 4YVXA 4QBXA 4XTDA 4V28A 1W3KA 3BSMA 4C7DA 3GC2A 3U4AA 2PWEA 2D22A 3N4FA 1VFLA 3B0UX 1JCYA 4I9TA 1UR8A 5DXXA 4GLEA 3L67A 2WJEA 3MUAA 4Z1DA 3QPZA 2XN2A 1ZAIA 2ZXBA 2F6UA 4AYSA 1RCXB 3WLSA 3EPNA 4EF8A 5I24A 4Z2JA 1SZRA 3RXZA 1V6YA 1YX1A 1B4KA 3ITGA 4NRRA 1B9BA 1RQEA 1DWAM 1W0MA 4UZUA 4WY0F 4F0MA 3TR2A 3M43A 2P3ZA 4CNPA 1G4PA 3UZJA 2QVNA 4M29A 3ZSSA 2OZTA 1I1XA 4AZHA 3L0GA 2NQ9A 4IIHA 1M68A 4JTQA 3MU7A 1KD0A 4MG4A 3G1AA 3WQ6A 3MVIA 4HB7A 2X7VA 2JIWA 5CQ1A 4IUGA 1KWGA 1XYFA 2VQUA 3GXTA 3W7MA 3W7EA 1FOBA 5CBBA 3HJEA 4HVXA 3V5FA 3MO7A 3ANVA 3EKLA 2D24A 3AYTA 4KESA 1M7JA 2VO5A 2GGEA 1OWQA 4IMEA 1B3XA 3W28A 1TR1A 3IRDA 1VYPX 1F6PA 2V2HA 1PTGA 3SCUA 2A6LA 4JTGA 3CZGA 5A2AA 1IIHA 2QPUA 4UR7A 3S1WA 3CZ8A 4W8LA 1GWJA 3WCZA 4PCTA 1XLEA 3HGRA 4DUOA 4U10A 3M4HA 3GU9A 4OV4A 3TR9A 3WELA 2YW4A 3ITTA 1R3TA 4F0SA 3ARTA 4TMCA 1LQ0A 2QVHA 4GFSA 3TYZA 1DWGM 2V3FA 5CAKA 1UR4A 5MKGA 1PO9A 2WVSA 1JZ5A 3MJMA 1RAKA 4IMAA 2IW0A 2HJPA 1B4EA 3IIVA 3V0SA 2Y8UA 4IIFA 3QMSA 3WNMA 5AYYA 5K4ZA 1KXHA 3ARVA 4NQ1A 3SSZA 1V77A 4S23A 2FGLA 2FPYA 3H2EA 1J12A 1JPKA 3BLIA 1KCZA 2FZDA 2FJKA 1WP6A 3A4XA 7REQB 3ZVHA 4C6KA 4UQBA 3SEPA 2V5CA 3S5NA 3TSBA 3ECQA 4PUKA 1S1RA 1UQZA 5JH2A 3GTNA 4GVIA 4HPNA 1K4GA 4MZ8A 4S3JA 4AZCB 1I2RA 2NQJA 4UNIA 5G1TA 1B3VA 2G97A 5I5RA 4JTAA 4H6RA 4QJ5B 4ZFCA 1TV5A 5HNRA 3KRZA 4Q4KA 4CNOA 2XSBA 3B9OA 2BXVA 3WLPA 4E6MA 1C7TA 2FB2A 3JR2A 1VLWA 1DJXA 1UA3A 5I3DA 1TWSA 2Z29A 3VNKA 3A4JA 2P8BA 2IUZA 7ODCA 3OP2A 1QTWA 1JD9A 3M46A 3SJ3A 3UZ5A 3EKGA 4C6OA 3KCOA 3GBEA 5CCZA 4NAEB 4Q7NA 5H6HA 4AC7C 5I09A 2WMIB 5AHMA 2ZC8A 4MY9A 3HFYA 3MCNA 4UTMA 4G7EA 2YPIA 3PUGA 2YR1A 2YJQA 3M0HA 1TJPA 4H8HA 1RVKA 3FW6A 2VMFA 2ADAA 1A5NC 1N8IA 2ZADA 3W37A 1Q7MA 4Q4MA 4E8DA 5AFDA 2WM0A 5D9PA 3NYDA 4JKLA 3TUUA 3RO6A 1WDSA 2DUXA 4PC8A 1EH9A 4X2PA 4DZAA 3OVQA 3LRMA 4B9ZA 1FWFC 4JTHA 3W7RA 4DUVA 4HJFA 3S2NA 4GYPA 1LOQA 3TN3A 1E9LA 3GYEA 1O66A 3GIQA 3WFZA 3H7VA 4NI3A 3F1QA 3RFAA 5FI8A 2ANUA 2D23A 1X6UA 2G4FA 2WOQA 3AYSA 3N6QA 4ZXLA 4QISA 1ZU8A 4J3SA 5BRBA 4YS1A 2A7RA 1NWRA 3H22A 5CZKA 1UKPA 3OZOA 3HMJG 1PKNA 2A3LA 3IJQA 4O1FA 1RQHA 3DFTA 1TA3B 4HHMA 2CW6A 3OBEA 1JUKA 1ZJHA 4GH3A 1U1UA 1UP3A 4UTKA 4GHRA 4K36A 1FWBC 3O6DA 4LUIA 4Z42C 4DJDA 3WIJA 4DO5A 4AIUA 4D71A 3ZO9A 1TO3A 3UPBA 4D72A 4JYDA 3ME3A 3E12A 3P80A 3DI0A 6PTDA 3VILA 3WEZA 4LUJA 1U30A 1OY0A 5ABGA 4O0QA 1F2JA 4HCLA 4QGCA 4FXFA 3VNDA 2WCGA 4H7CA 4DAIA 3CAWA 3S4TA 2ZX9A 2QQ6A 2R94A 3SN0A 1GZ1A 3AMKA 3UETA 2VC5A 5FSDC 2FLIA 2Q71A 3ABSA 5T9CE 3SUWA 3DBPA 3WH9A 2ZDRA 3TW9A 2WLZA 1Q4WA 2E77A 2ZVRA 4NXKA 1JUBA 1HXJA 3BCDA 1REQB 3L2MA 1E55A 4XBJA 2OG9A 1EJUC 1XG4A 1JPMA 2X1SA 4Q22A 3QR3A 3R1ZA 1R0MA 3DFSA 3MO4A 1G67A 4HBKA 3TVAA 3AS0A 4WF7A 3LENA 2XWEA 3KS6A 5FJTA 4KKXA 3W2NA 4XZNX 4XQ6A 5I00A 3S47A 3TKFA 1J10A 1FY6A 1UMLA 1DP0A 3II1A 3KUMA 3K4DA 3CEUA 5TQLA 5MHBA 3NL6A 4TU1A 2EO7A 4N9DA 4I7VA 5I77A 1CLXA 3WDHA 4LC6A 4O4VA 5FJJA 2VYOA 2BY0A 3TA6A 4E3VA 5CGTA 3M0MA 1PTAA 2CITA 4CQBA 2JBMA 3D3AA 3MV01 2AQOA 5EB8A 3TC7A 1XKJA 2Y85A 3NGJA 3W1MA 3NL5A 4DY1A 4HTBA 4EK7A 1XLMA 3OJGA 4ML4A 1XSIA 4Z2IA 2AL2A 1NEYA 3TOYA 3R6IA 4DX3A 2ISWA 4YCOA 2X16A 3GR7A 3G1DA 5EMYA 3DGBA 1QNPA 3B8IA 3TWBA 1QU4A 3FAXA 3B3DA 4P8VA 1ELSA 3MUZ1 1V51A 2YBTA 1TJ2A 2XVGA 1S5VA 1XCXA 3GXFA 2PDCA 1JL8A 5AN7A 5D4YA 2XTKA 2ZA3A 3WX7A 3NXFA 1UH3A 2J6XA 4IPLA 1HO1A 5ABHA 2JK2A 1BRLB 4BI5A 2PFHA 4HZ7A 4MPQA 3NSNA 1W9UA 4Y8FA 2D20A 3GHUA 1YTDA 3LCHA 1KLYA 2ZE3A 1QHZA 4DZIA 5DY2A 1VYSX 1Z8AA 4C6IA 1V3KA 4MUZA 5AOUA 1GQNA 5CSRA 2XPKA 2CHRA 3R94A 4MLJA 4F48A 4A2SA 2J9XA 1JNDA 4E2DA 3E2QA 3DXIA 4DXVA 2WPBA 4KWOA 3RX3A 1DHKA 3VMPA 1UJPA 4ERGA 2YXOA 2E67A 3CO8A 4ZOBA 3PNUA 4R7OA 2ZZ1A 1BSLA 1ESWA 1LCOA 1GJPA 3H8AA 1SR9A 5C2XA 3SR7A 2Q3OA 1GONA 2XZ7A 1K7FA 4JIEA 2QCEA 1LBFA 1B9ZA 3VCRA 2WW5A 3UYIA 4F9DA 3IVTA 4MNJA 1OBAA 2OFJA 4QTGA 1Q63A 3GXPA 2BY3A 1J79A 1KRCC 5REQB 3W7CA 2ZVIA 1W1PA 3NURA 1FH9A 1QFEA 1V7YA 1XR2A 2ZDSA 4ML9A 5I0DA 2HV5A 3SCPA 2GVLA 1G4SA 3WD3A 3WO8A 3RCNA 3T05A 3FGCB 1JZ2A 3U9IA 3AC0A 3SGZA 4KMQA 3AIQA 4RZ6A 3R8HA 4AZGA 5IXEA 3GUGA 3CNYA 4UFKA 3WDPP 2A0NA 4MY1A 2WYSA 3UNTA 4YYFA 1EJWC 2YGYA 3IPWA 5KTLA 3MMDA 2PODA 2GLKA 2J7HA 3EBVA 4J9JA 1E6RA 2ZRXA 2ZUSA 2CLLA 3U4FA 1OQFA 1DXFA 2RGMA 4D6IA 3BCFA 1R6WA 3FIGA 4JFVA 1HUVA 2WMKA 1G7UA 1PX4A 2WO5A 4NHVA 4K8GA 2DEPA 5HNUA 3W2UA 3SFWA 1SW7A 1LJYA 3WLNA 1ISYA 4I5RA 3C2RA 2PWVA 4FOJA 3W07A 1DXIA 2P76A 3HTWA 1C9DA 1LLOA 4O11A 3G1SA 2R24A 3UYCA 3T44A 4A05A 3G8RA 1Q13A 4WY0A 1F73A 3O7UA 1SSGA 1B3OA 4POCA 2NQ5A 4E0CA 3UPWA 4CVWA 3HO8A 1EHAA 1Z9AA 4CUCA 4L4LA 5D04C 1F76A 3RUBL 2PUZA 3UERA 4OWGA 4IP4A 1Q6EA 3HA1A 3OIHA 1ZAJA 1GOWA 4HNLA 3DYPA 3E0LA 5DF0A 5LIXX 3WF0A 1DJGA 3BMWA 1Z69A 2YDSA 3SGUA 3SRKA 1CB7B 4MFEA 3W00A 3O6CA 4PULA 4C6BA 3N25A 4KF1A 4W93A 4ZQNA 4DIAA 2Q8XA 2YCKX 1A0CA 1ITCA 3DENA 4XD4A 1BXCA 4BJHA 1RSCA 1M53A 4LS1A 3CL8A 1EC9A 4NU7A 3BC9A 1OYAA 3KRBA 2DIKA 3CQKA 2HSAA 4XUYA 3EOEA 2F7FA 3EDDA 1XUUA 3IARA 4O54A 2ZX8A 1TIMA 3ABRA 1FWEC 4JD4A 2JF7A 4BFAA 2ABAA 4IGNA 3TE9A 1R9XA 4AVNA 5C70A 3LN3A 4Q4RA 4A8LA 3FEQA 7TIMA 4GZIA 2JEQA 1KFKA 3P7YA 4QJ1A 2OEJA 4WKAA 4FZIA 4PFHA 2DFAA 1OG0A 5I7GA 1Q6DA 3RPDA 3VIHA 2ATMA 4GMEA 3DG7A 1F61A 3VKBA 1H62A 3PUOA 3MW7A 4Z1AA 1XBVA 1Q5MA 3E49A 3TQKA 1MDRA 3USBA 5LHEA 4XO6A 5F4WA 1GKRA 4GVGA 3VM7A 3RNDA 3V1PA 1PKLA 1NP2A 1YBQB 2PWUA 3QY7A 4LCQA 3PZUA 2Q09A 4GNVA 2YCLB 3OZYA 4B15A 3VGHA 1ODZA 1PDYA 4E5TA 5F2LA 2E1WA 3VDHA 3G8EA 3NVDA 2V3EA 4MMWA 5D9MA 1B3WA 2HVOA 1HX0A 2PF8A 4O14A 1C93A 1VB9A 4CCCA 8XIAA 2CYGA 1F6YA 2QJJA 1CXKA 1PBGA 4RE2A 3GIYA 1C7SA 2TMDA 1A5KC 2QMJA 4H2CA 1MZRA 1VCFA 1OSEA 1BVZA 5TAOA 4BEQA 1JDCA 2X41A 4G2DA 4UQ9A 1E1FA 4PSPA 3BOXA 4W85A 1NM9A 2ZTJA 3VPLA 1P1MA 3MBDA 3UQNA 3CMJA 4QJ4B 1CBGA 4GFIA 1Q6LA 5CPOA 1XIEA 4UFJA 5JUVA 1OC6A 4DI8A 4H9TA 4RZBA 2YXGA 5HMDA 2FPVA 2ODOA 3HOJA 4GG9A 3KLKA 3RX2A 2HISA 1PZ3A 2GGIA 3QSRA 3ZJ6A 4B3ZA 4GUJA 1XIIA 4F79A 3H6OA 2GJPA 2OJPA 4QAIA 1XXXA 4ZL1A 1R47A 3ITCA 3JRKA 5TF0A 5AC7A 1UB3A 2VEFA 4JL2A 1UA7A 3F4DA 5A6MA 3V5CA 1I0DA 3W1TA 1JCTA 2E8YA 4I8YA 1AFSA 4DJFC 1LG1A 1G1YA 4A6GA 1GYNA 3SN1A 3U48A 1H2JA 1Z48A 2XZ9A 1K4HA 2PBOA 3CLWA 3PUDA 5HINA 1B31A 3PTMA 4JTUA 1T8QA 4UTHA 1I2PA 1OF8A 2XVLA 5EMUA 3DKLA 4R5EA 4EAYA 1XKYA 1J9YA 4IIGA 1KFJA 3NQCA 1RBOB 3WD1A 2QMKA 3MKKA 2IKGA 4UMBA 3Q65A 4CNSA 2BY2A 2H3BA 2E25A 5KZDA 4WDWA 5M3WA 3PFRA 3PVFA 4LB3A 4LH8A 1OX4A 4JL1A 1YYAA 5C9UA 3E5BA 1IXNA 1IYXA 1QNOA 3PWAA 2PAJA 1IZCA 4IT1A 5FL0A 1TVNA 2XVKA 2J66A 3EX6A 5EU9A 1JYWA 5DBTA 2RHGA 4YVVA 2GJXB 1YW1A 3LGDA 1DQUA 1OG6A 3QZAA 1XLLA 3WQVA 1J0KA 4DHGA 1O1HA 1LL7A 2VJXA 3AIWA 1KXQA 3B0VC 2GZXA 2O9RA 4NASA 2QIWA 1F5ZA 4XVEA 2O92A 1H09A 1LWJA 4EKJA 3EB3A 4H4IA 4PBGA 1VYRA 2CBUA 2JGQA 1N55A 2ZRZA 4IPIA 2HBVA 1W1ZA 4LBRA 5E70A 5JVLA 4O8RA 1XC6A 4B90A 1CLKA 1BEUA 4D9PA 2ISSA 1JDAA 4MKVA 4MWAC 1R87A 2P3EA 4RLIA 3AYVA 1EFZA 3IJ7A 4M1BA 2A85A 1GJUA 5D8WA 2OELA 4EPBC 4CQDA 3KVKA 2ZXDA 3QFEA 1GOMA 4FNUA 2AKMA 3SQMA 4LVAA 3ATYA 3BURA 3T40A 1MSSA 4A3UA 6CGTA 4WKFA 2W91A 2VR4A 3G1YA 4X22A 4RZ5A 4A3HA 2NLYA 3TC6A 4HNVA 4PTWA 4M56A 1RA0A 2CWXA 3CPGA 5GJNA 3PPGA 1KRBC 1E6XM 1K77A 1SUXA 2QJIA 1PKMA 3W6YA 2RDUA 2VWTA 1DBTA 4PUEA 4GH1A 4PB3A 1JG9A 4B4HA 3W7OA 3OTRA 4IPJA 3SECA 1DPMA 4DJEC 1TIWA 1T99A 4MB1A 3BJFA 5CSUA 3T55A 4DO7A 3O15A 3QXBA 2TSYA 1XYCA 3GDBA 1OK6A 1PCWA 2HPIA 1GUVA 1M6JA 3O05A 5HULA 4WCJA 4N2YA 2IKHA 4I5UA 3H12A 2CCRA 5E5CA 3LBOA 1VJIA 1IT0A 4AWSA 3UG8A 1QBBA 1WUEA 3NQBA 4HMCA 2BGNE 2A5HA 4L7ZA 2G3JA 3NZRA 1L0PA 1E0TA 2YOCA 3CHDA 4UBPC 3W26A 1P6CA 3W2JA 1X6LA 3OYZA 1UZDA 3XISA 4LNCA 5LIKX 3RAOA 1ZBCA 2PDXA 3UR5A 4H04A 2VZOA 2OKTA 5LA2A 1RV8A 3PB0A 4C6PA 4X61A 4ZA0A 3FA3A 3M6YA 2ZZ7A 3A4AA 4CN4A 2IKIA 4XAPA 3UY8A 4DO4A 3T8LA 1UR9A 3HPXA 6ALDA 3WFAA 3NQ2A 1KFCA 3HM7A 2O7SA 1AL8A 1HKKA 4YPJA 4BQ4A 4P61A 1RXOB 4DAFA 2Y89A 3HQ1A 2CZEA 2DZVA 4RPPA 3LGEA 4HNUA 4MKSA 5F1VA 3UWYA 1F74A 3CAQA 4GUIA 1DJQA 4QNWA 3EA1A 4NZ4A 4QHRA 5K4XA 3GC5A 1OT2A 4UQCA 3CUFA 8RUCA 1Q7ZA 2VDHA 4F0KA 5EMMA 3HJZA 3BICA 1FWTA 2BODX 5K7JA 3WQCA 1XBYA 1M03A 3DERA 4LV9A 3RU8X 3RLHA 1KBIA 2DSWA 1TV3A 3B40A 3H2OA 4IGMA 3MPGA 1KTNA 3P3BA 3EMZA 3FHAA 3H4GA 1TX2A 3C2VA 1LM1A 4YTSA 3BMXA 4UB9A 3S0CA 1JULA 1VD6A 1NU5A 4UTLA 4R7WA 4LNYA 3XINA 1DYSA 5DMLA 4B9YA 4DZHA 1TPFA 2PDJA 1XFCA 2HXTA 1VIWA 4JS3A 3EDKA 3WKZA 3ARXA 3OVPA 3RM4A 1CB2A 2QEZA 3BO9A 2O9PA 5A6JA 3QN3A 3UGVA 1KCXA 3P8IA 2QCDA 2NV2A 2E8ZA 4B5NA 1EWDA 3L0KA 1XLGA 3WQDA 3PZVA 3FYYA 2QCGA 5EBUA 3UFYA 2B0MA 1D9EA 3W7QA 1FDZA 3FY1A 3QC3A 3STCA 1NWSA 4JTSA 1P0NA 5BXSA 2L5HA 1LQAA 1GORA 2H9AB 1Z6KA 1D3CA 3UJRA 3N19B 3PAJA 4L6HA 1IR2A 2HQAA 2XH0A 4Z1BA 2C91A 1OK4A 1ZHAA 4IG2B 2BGSA 1FWJC 3EWWA 5G4EA 1DIEA 3MSGA 3THUA 5HMEA 3S8HA 1AW1A 3B8VA 3REQB 3TSMA 3PPFA 5CEWA 5LZLA 2V63A 2WSQA 1EUAA 2ZXQA 2JE8A 3MKVA 4XUGA 2G4JA 1JRCA 2B7NA 2BHUA 5J04A 2PDNA 1QVBA 2FTPA 1QOQA 1XX1A 2NWSA 3MUY1 3BZJA 3M6DA 4XZBA 3LZ5A 2VOTA 1BTCA 1W9BM 3N15A 2V5BA 2EKCA 3LDVA 4GKLA 4JKKA 4A3YA 3VUSA 3RRXA 3IJLA 2Q8LA 4GA8A 4MNLA 2PC4A 2QGYA 4K1GA 2EQDA 4QEEA 5EFFA 4O16A 3SCOA 1NOUA 3ARPA 4DUXA 1AD1A 1CNVA 5DEZA 2VOMA 4FLQA 3B05A 3AMCA 4GXMA 3OQEA 4TR9A 5E0KA 4CNTA 3GNXA 1PL9A 1DTNA 4YTQA 3CEPA 3PUEA 1UOKA 1HFBA 3PBWA 4JHZA 1ADOA 1EGZA 4G1NA 1QPKA 5M2FX 4IQLA 1WCGA 1A3HA 2OT1A 1A0EA 1UC4A 3MSYA 3W1QA 1ZFJA 1GEQA 4GQGA 2ISVA 3EKZA 3PPCA 4MIMA 1R30A 4JZ5A 4N9EA 3BLDA 3VOIA 1W5NA 5DCDA 1MEWA 5HQMA 4HNCA 4PE8A 1ITQA 2PDUA 2QW5A 1V6TA 3KHDA 2AGKA 4EXAA 1H7PA 2EAWA 5D09A 3W3OA 3AZSA 2NUYA 4BQ5A 3WLKX 2HK0A 4R9XA 2A3HA 3PC0A 1EDGA 2Z00A 4HT3A 4W8BA 1CGWA 1F05A 3KZPA 3BMVA 1BPLB 4UTJA 1AW2A 5T9BG 2OCZA 1S2CA 3GTFA 2IS7A 3BLOA 4LS2A 4C6EA 3EYPA 4KWVA 1UC5A 1KM1A 3WQOA 1UZHA 1E5JA 3URQA 4HZ6A 3DECA 1B5TA 4UTTC 2ZRWA 1R3RA 1LRTA 4Q7BA 1BYBA 5JXQA 2D3LA 5JH1A 3TROA 2A3AA 2QJNA 2WC7A 1G0CA 3W88A 4AY8A 4LUTB 1UBPC 1FCBA 2J78A 2GQ9A 4FR6A 2E9LA 1PHQA 1W3HA 4DWSD 2VP8A 1RY8A 1L2QA 3S6TA 1MW3A 1JXKA 2VR5A 1K8XA 4U4MA 1SZFA 4LYPA 3WUFA 4EE9A 3PJWA 2GWNA 2VX4A 5F2GA 2C3ZA 3UA3A 2ASHA 4RDYA 3O8AA 4ZQCA 3CUHA 3W84A 5F4XA 2FGZA 2DZTA 4AD1A 3BGAA 3NO1A 1S5NA 1E0XA 3QZ6A 1KBBA 3TTQA 1JD7A 3N4AA 1H60A 3VMOA 4G1KA 4JHMA 3O0FA 1S39A 2SFPA 1W8SA 5HOSA 1VFOA 1QDSA 3K46A 2GQ8A 1E1CA 3A9BA 3BAXA 4KCTA 4GZ7A 3TMLA 4TMBA 2A1YA 4JNZA 4NI8A 4JNMA 4Y7EA 3UA4A 3SUTA 4HNOA 4MUPA 4OE7A 4XIMA 3MA8A 4IJCA 4JR5A 3P84A 5JBFA 2XM2A 3CV1A 3O6YX 1E0WA 3R43A 1SFJA 3NM1A 4WRHA 3W1AA 3APYA 4ZOCA 4EP8C 3A9IA 3TJXA 4MB4A 3W7HA 3WJXA 3V0UA 3GG0A 4RE3A 2V6AA 1MQQA 1E6NA 2QCHA 5H1WA 2CBVA 1XPYA 2OB3A 4GX9A 1ALDA 5I3IA 3OB8A 2GSEA 1KM4A 4HA0A 4AD4A 2FB3A 5TBOA 3S2JA 4H9XA 2ZTKA 3MHUA 2NWRA 4IXXA 4R33A 5H2ZA 2QT3A 1ME7A 3VNLA 4LRSA 4DJFD 1UUMA 3IEBA 3UBPC 4O1BA 1J0YA 1YNQA 3CB3A 1DIKA 4GBUA 3RU6A 3SCSA 2PI6A 4MZ1A 3A22A 5HPCA 1AVAA 4ATDA 3BVJA 3MHFA 4XG1A 2V5JA 3CV6A 4REQA 5HJYA 3FKKA 4Q8QA 1LWHA 4H00A 1L6FA 5JIPA 2BG5A 1C3FA 2J27A 1GHRA 2P5NA 3UGRA 4UUIA 1ZSXA 1W91A 4PUNA 3MCOA 5GPRA 1SVDA 4O10A 1A4LA 1V8EA 1XSJA 3F5LA 1HL9A 1MUWA 1OD0A 3C61A 1JI1A 3HGSA 3B04A 3NFUA 3LG3A 4GIAA 1MDLA 3GVGA 4ZO9A 3VGGA 1PUDA 5U7SA 3CT7A 4DWDA 1EJSC 2GOUA 4AD2A 2OVLA 1EYEA 4O1DA 3PZQA 3TV8A 1TWDA 3CIXA 1EJTC 2O4QA 3QV9A 1LDCA 3M5YA 4OGZA 5KZMA 2DH2A 1QO5A 2C8NA 1QRQA 3PZOA 2WB5A 3BARA 1UKOA 3U5YA 3UG4A 3LM3A 1TTPA 2WJZA 3CQHA 4QX4A 3V1HA 3PZTA 1V08A 3H2NA 5CG0A 3BW3A 4JTTA 2CZ5A 4WGXA 1OFRA 2YLLA 4JX6A 4E2OA 3VD4A 5B7ZA 2CLEA 5HUPA 3NEHA 4YHGA 4S3AA 4GC4A 1TUXA 4AD0A 3SN4A 4PMVA 5ABEA 2J6VA 2OSWA 1GG0A 3HBLA 4Z2LA 4HQVA 3GNPA 3CQIA 3MUCA 2PTWA 4BK9A 4UTIA 3N13A 3W6MA 5DN1A 3U0HA 1NH6A 1X7IA 2I9EA 1XRVA 1RCQA 3NPWA 2DT0A 1JYXA 3DFYA 3KVJA 3MUXA 5G2HA 2J4GA 1VBGA 3VDAA 4AIBA 1NFBA 1V5XA 1XV8A 4Q6JA 3AHZA 4DJED 4LFYA 3IRSA 1UWTA 2GK1A 2IQ0A 1BQCA 1L6GA 2PWGA 4PR4A 2BXZA 3ONCA 2DZXA 3O6AA 5SWUA 1FWGC 3MQTA 5EBAA 1GVEA 3W74A 1ZQ5A 3DDMA 4CEXC 4NJGA 3M0KA 4MNMA 4EWJA 3M0YA 2GJNA 3ZMRA 3N34A 2CZVA 2NQHA 1ICQA 1UR3M 4FK9A 4RUBA 2UV8G 1OEPA 1R3WA 3DFOA 2ZKMX 1TSIA 5HXMA 3B0XA 3BG9A 1O68A 3WH7A 1EPXA 3N17A 1H3GA 3EWZA 4LVGA 3I7SA 1UKTA 4B5SA 1MFVA 4PMRA 4LWWA 4GQRA 4N42A 3WK3A 3LLDA 1L9WA 3NPVA 1AMKA 5AVNA 4EWND 2JFEX 4AH7A 2Q02A 3XIMA 1XIJA 4DZ5A 2R1NA 3N2MA 1SMAA 2YFOA 4L4OA 3G22A 1A80A 1FTXA 4BKNA 9RUBA 3P14A 1S5TA 3M9YA 1VBHA 1XP3A 2X8RA 3G3DA 4HHLA 5FF3A 1V6UA 1DKWA 2OQHA 4XBSA 4IIDA 4TX9A 5DCBA 3KHJA 1MEHA 3W86A 5LNVA 1EZWA 1TRDA 2EPMX 4A8IA 1QHPA 3W73A 4ZQPA 4NAFA 5EA9A 3F2BA 3AU6A 3LHZA 3AQUA 2DVXA 3R8GA 1N2VA 4C1NA 1IHIA 4GJJA 1R7AA 3WNNA 1H7OA 4NZ1A 1Q65A 4Z0SA 4WX2A 2Y7GA 2R1PA 1ENUA 4GYFA 1TKKA 1FP8A 2PD5A 1PVNA 4S1FA 3PTKA 2ZFAA 4J3UA 3LRLA 4GO8A 2QV5A 1EX1A 3WDQA 4BF9A 1K6WA 5HPOA 5J5DA 4TXEA 1RVGA 1GOKA 1EIXA 3R0UA 1P0BA 2J8TA 3TONA 3W53A 1WE5A 2CLFA 3PS7A 3KOFA 3W38A 2OT0A 3B03A 1XIHA 4CQCA 1QPNA 3IVUA 4HA1A 1XIGA 5LIUX 4M5PA 3VINA 1VBRA 2XINA 4J2PA 3NQ8A 1B54A 2REQB 1R3QA 3TJ4A 2F9RA 4G7FA 3VO0A 3PTQA 3JZUA 2BTMA 2BHZA 2A7NA 3QPEA 1Z42A 3QH2A 4TUFA 4BA0A 1OVDA 3EX2A 3DI1A 1TMHA 3I68A 4MWAB 1US2A 2Y4SA 1P48A 2GGJA 3NGFA 1NF7A 3QV6A 3UXIA 5FACA 3GNDA 2Z7GA 2F2KA 4GUGA 1S2UA 2PRMA 4HU0A 3AXHA 4MF4A 1WKEA 4PEKA 1TV4A 4R53A 4A22A 4PCNA 1OGBA 5A6BD 3AS2A 2WZIA 1PZ1A 3FSUA 4HU4A 4UMAA 1HJSA 3EXSA 1T8XA 5FCZA 4RDWA 3TYBA 3D46A 3OEXA 5A6AA 1ZGDA 2BB0A 3L9CA 4C6JA 2W79A 1IWPA 4RK8A 3AWNA 3C6CA 1LL4A 1KTBA 5CPMA 3WBEA 2V67A 1WKYA 1SZEA 1DIOA 3K8LA 4AHPA 2QF8A 3TW7A 1J5SA 3UD6A 4LAUA 1P0EA 1W1A1 4AWEA 3EWUA 1B30A 4KS0A 2NUXA 3AZRA 1QI4A 4PMNA 4QIUA 1OCJA 1J0JA 1EZ2A 4OVXA 3IIPA 1FHVA 3RX4A 4MDPA 2XGZA 5CLTA 2ALDA 2CXEA 3W82A 5C8BB 5JU6A 2YL8A 2WKJA 1YXYA 3K30A 3UVAA 2VX6A 4NXSA 4IGHA 6ENLA 3U2ZA 4PL1A 1HT6A 2R8WA 2PMQA 5EFDA 3F2DA 1SPQA 1UR0A 3T7VA 1IE7C 4FX8A 1EDTA 3W1XA 2PGFA 4DQWA 2QCMA 2XN0A 4UTUA 1RUSA 2E5CA 2FFIA 5A6KA 1XLCA 2F38A 1DJHA 4MHBA 3AHYA 5BOOA 4QROA 2DPEA 1A5MC 2QULA 4HIBA 1FRBA 2A79A 3NZ1A 2CESA 2VI0A 4LCRA 1FCQA 3LHUA 4UOQA 4ACZA 4U2ZA 2C1HA 3GS6A 4LTSA 1K9EA 1S2VA 1ZJAA 3VNIA 1QNRA 1JNEA 1PDZA 1IF2A 1VFTA 1T7LA 4PFMA 1YPXA 4H01A 1JAKA 2AKZA 1Q45A 4Z17A 1FCUA 2VC9A 1QOPA 3AIUA 1HN1A 3UJEA 4ZOEA 5ABTA 2A2IA 4DWSA 3IIZA 3BWWA 5T8GA 1FWWA 3HPAA 4HHHA 3MWAA 1MXSA 5E9AA 3VZYA 4GYKA 4RKAA 3T2PA 2G37A 3PBYA 1NFGA 3ITYA 2GYIA 3VABA 3AALA 1EQPA 5JBDA 3I4EA 3CUIA 4LALA 3M0XA 5D2YA 2PBGA 3M41A 2OYKA 3TZFA 3LD5A 2I57A 3CS2A 5FKYA 4BF7A 3QJAA 3APTA 3GR4A 1VCVA 3DHUA 3PR2A 1O60A 1R2SA 2VC6A 3GU1A 4I90A 1PX3A 3PWIA 2YFNA 1VS1A 3M0LA 4ZB2A 3H23A 1EO5A 2E9MA 4WSHA 3GFYA 3PBVA 4AWUA 4E38A 1LUCB 1OC7A 1A5OC 1SGJA 4U33A 3MCMA 3N6JA 3NDOA 1AQFA 3TEVA 3LPPA 4LY4A 3MUIA 3RG6A 1E6QM