5G4EA

S. enterica hisa mutant d10g, dup13-15, q24l, g102a, v106l
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
220
Chain Sequence
b'MIIPALDLIGGTVVRVVRLHYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTALKSPDVVKGWFERFGAQALVLALDKQVASGVSLEQLVETYLPVGLKHVLCTDSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 66
structure length 220
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4eA00
2A6LA 4POCA 2ALDA 1GYNA 2Z6JA 1UCWA 3PY2A 4LVAA 1J4EA 4BI7A 3NA8A 4Y6GA 4MZYA 1W5OA 3VI2A 3G24A 1TO3A 1JCJA 4O4WA 3FKKA 2VOMA 4NUWA 3ABRA 4LUIA 3MYOA 2QF7A 5KSWA 2ABBA 1Q6QA 3M7WA 3BW3A 3QH2A 4HNVA 1C8VA 2H8ZA 1ZCOA 1F05A 3D0CA 5H91A 3LRLA 1I2RA 1VGAA 2YX0A 3ATYA 2YW4A 3DXIA 3FLUA 4U28A 1HL2A 1K03A 3TDFA 4LS0A 3TX9A 4Q4KA 1LM1A 4AB4A 5T26A 3OHIA 2Q3RA 4A22A 1Q3NA 2ZQ0A 4IQLA 1H50A 1H7WA 3LCHA 3LGEA 3NPWA 2J24A 1CW2A 2Y7GA 5CZSA 3DI1A 2YCEA 1M7PA 1H7XA 2DZTA 2ZA1A 4FIRA 3QW3A 1RQHA 4RX0A 3W1MA 4RZ6A 4DBDA 1KM3A 1K7EA 1PVNA 1IXQA 2H8XA 3L5AA 3MBFA 2ISWA 3QEZA 3N2MA 1B3OA 2YFOA 3W07A 4NJJA 4QQ3A 2YPIA 2FPVA 4O1DA 4UFLA 1TPC1 2JKEA 4OBTA 1X7FA 1HTIA 5D03A 3TJXA 3TNOA 3W2NA 4O19A 1OFPA 3LXBA 5HUPA 3NR0A 1ICSA 4K8EA 1KFCA 3S0CA 4I7WA 1PE1A 5LNSA 4NNBA 3O6DA 4JTGA 1VLIA 5BMXA 5F4SA 1SW7A 1TJPA 1KM5A 3R5EA 3M43A 4LRTA 3M47A 1Y0EA 4M5PA 2C3ZA 2WSYA 1WQ5A 1QCWA 1RQEA 3MMTA 4AAJA 1AW2A 1GVQA 3W7GA 1B57A 1BEUA 2Y7FA 4JIPA 3I65A 3S5NA 4XKYA 4DXVA 1OX4A 5AOUA 1W5MA 1FCQA 4CQ8A 1HUVA 3P74A 2ZZ1A 3O15A 3CB8A 3DENA 3U2OA 4ALDA 1QPRA 7TIMA 5AYYA 3W22A 1KA9F 4MYXA 5AHMA 4DBEA 1SZFA 1SQ7A 3TAOA 3W7NA 3W1RA 5EPDA 1JCNA 4HPXA 5D32A 3TW6A 3B0PA 4NJKA 3W2MA 2QJIA 3PM6A 3NOEA 3LCWA 1N8FA 4X3ZA 2E09A 2CZEA 3LHTA 3I7RA 3S1VA 1ZALA 3M5XA 3W88A 4CNPA 4WOZA 3I7SA 4UFMA 1GVSA 1GJPA 3BK0A 3FIGA 3WJZA 3HGJA 3HPZA 2V0TA 1G6CA 1ME7A 1KBIA 3A21A 4O0KA 3G1VA 3P81A 3F4WA 1CX9A 3N73A 2NX9A 3THQA 3P67A 1OYAA 3ELFA 3LHYA 3O1NA 2FB3A 1PS9A 1RR2A 4JICA 3LHWA 2OX1A 2VC6A 5G2HA 1HG3A 4NZFA 3A24A 4FNUA 5FF0A 1UB3A 2RFGA 3N14A 2W79A 4JTTA 3W2UA 3W7PA 5LSMA 1GZGA 4O28A 2CU0A 2QUTA 4WY0A 4XTDA 1VHCA 5DBTA 5DCEA 1ME8A 5D2YA 3RK8A 3PS7A 3UWQA 4AWUA 4LT9A 4Z08A 3MHUA 1XDMA 1SW3A 3V75A 3CWNA 3RLVA 4A2RA 3HG3A 3TC6A 1S3HA 3PG8A 1G4TA 4L4LA 1OK6A 4CCCA 4UTWC 4LC8A 3UWUA 1THFD 2Y88A 3LV5A 3BARA 4GXMA 2ATSA 5K2ZA 2Y70A 3PBVA 1V5XA 3NGJA 2P10A 4KWWA 1IXPA 2ZRYA 3HQ1A 2Z2UA 4WX2A 4IMGA 3L5MA 1JCYA 1EP1A 4O11A 3ABSA 1R47A 5G4EA 3OEXA 3S8HA 1H7RA 4KFNA 1MSSA 3BGGA 3VKJA 1JRBA 4WZHA 1L2UA 2X1RA 3CU2A 5G4WA 3G1DA 2BLEA 1VHNA 5CGQA 2DZSA 4LRSA 1IXOA 3AJXA 3HBLA 3HF3A 3OBKA 5H2ZA 4OE7A 2AAMA 4LC6A 3G8EA 3JRKA 3VE7A 3W85A 3U8GA 3BVJA 1DBTA 3C2FA 4Y8FA 3OVRA 4UMCA 3LHVA 1TPDA 3NQ2A 4HNUA 4JY8A 2FIQA 4C1KA 5KINA 1ZFJA 4JY9A 1P1XA 1SO4A 4FEZA 2PC4A 4NZJA 4RJEA 3S5OA 3ABOA 4ZQPA 4ORIA 4PC8A 1SFLA 3TQVA 4FF7A 4MY8A 4Q32A 5LGXA 4MZ1A 4CNNA 2ZA2A 4FNRA 5C54A 3GLCA 5AHIA 4NJGA 5I3IA 4HT3A 1QWGA 4MPQA 3TU9A 3NQVA 3GXNA 1A53A 3W2KA 3NPUA 2NZLA 3SFKA 3P61A 3G0SA 3QRHA 2AQWA 3QMSA 2I14A 2JGYA 2LLEA 2RHGA 1YPFA 3W23A 1IXNA 2X1SA 3NPVA 1YYAA 4RK8A 2GPTA 2C19A 1LBLA 4O50A 2X30A 4FNTA 1OG0A 4PL1A 1TQXA 3L21A 4LVBA 1TTQA 3MW7A 3KVJA 3PVFA 1LBMA 5KZDA 3CEPA 1WYIA 3LBCA 1U83A 4AF0B 1FDZA 3R13A 1QAPA 3W1TA 2Y7EA 1KLZA 4WOQA 3GDLA 2TYSA 4U4MA 1I8JA 3OIXA 2XFWA 4N9EA 3RFAA 4NJHA 4GE8A 2HS6A 3HG2A 1O94A 1QFEA 3T40A 1RV8A 3IIXA 1ZAHA 3LB0A 3M44A 4IMFA 2Y63A 4ADUA 3B04A 4AXKA 2Q3OA 1JQXA 1P4CA 4QM1A 3NQ8A 3N19B 3P62A 3U6WA 3BGJA 5IM51 3GKAA 1A5SA 1PL9A 4LW7A 3SGZA 1UUMA 3STCA 4UTKA 3IV3A 3LTSA 5FF2A 2FLIA 1VYRA 2C16A 1SUXA 1GYLA 4OGZA 2FFCA 2Y89A 3Q94A 4UNLA 1ICQA 3PUOA 2A2IA 3LI0A 3TSMA 2J9YA 4GWEA 3UWVA 3F4NA 5A5WA 2WKJA 4A3UA 1JQVA 2A21A 2TRSA 2E6AA 4ZL1A 5I3KA 3PR2A 3W72A 2GJLA 3WJXA 5I3FA 3LOTA 3LHZA 3NL6A 1G4SA 1TPFA 4RXGA 1O4UA 2YDAA 3O05A 1ONRA 3W7CA 2G97A 4JIQA 4Z1DA 3W1XA 1GTHA 4JTFA 1YXYA 5EY5A 3VE9A 4K38A 3P8JA 4DF2A 3DGRA 1H62A 4XTIA 3L65A 3K30A 5E0KA 3PAJA 1YXCA 1SO6A 2JBMA 4UTIA 4UFIA 3W71A 4O14A 6TIMA 5KTLA 3MI3A 3GAKA 3W84A 5HMSA 1IGSA 1YDVA 5FEZA 2GQ8A 1FDJA 4O1BA 1RD5A 1DJQA 2ZBTA 1W3TA 2G95A 4ADTA 3MP3A 4RXFA 5DBUA 2JKPA 1LBFA 2QCEA 3LLDA 4X9SA 3E96A 4PA8A 5FEWA 5TBOA 4MKNA 5HINA 4ORMA 4O16A 1DHPA 1NAL1 1AW5A 4R34A 1PIIA 4DELA 3TR2A 2V81A 2A0NA 4UTJA 1DQWA 3S6DA 4M6VA 2R91A 3C61A 3GDRA 5HJLA 3W7RA 3QFEA 1F6PA 4K39A 5LKYA 2X16A 1H1YA 3JS3A 1W0MA 5KMYA 2A7RA 4MLJA 3KXQA 4OHQA 5LHFA 2ZRVA 4JTUA 3W7KA 3P84A 1I2QA 3S5ZA 1Q6LA 2BTMA 1UASA 4AMAA 3TJLA 1K8XA 5IBXC 4IOTA 4I7VA 4WD0A 3P5YA 4RLIA 4FNPA 4Y90A 4MOZA 1WA3A 4X2RA 2UV8G 1RQBA 2A4AA 3L0NA 1AL7A 1Z48A 4CLMA 2GVLA 1WX0A 2F7FA 5G2IA 4UTTC 2ISSA 3RU6A 1W54A 3MI6A 1D3GA 3DH7A 1FXPA 1DOSA 4ZQRA 4ADSA 2QDGA 5AHLA 4MLRA 5FI8A 2ZRWA 4IGHA 2DU2A 2CLOA 2A85A 1NFBA 2BX7A 1L9WA 4YWIA 3SW6A 3UXDA 1ALDA 1SSDA 3W1QA 1KM2A 1OF8A 3EX4A 2EGZA 3W7DA 1SZGA 3PWAA 3NQGA 1G4PA 4GNJA 1P0KA 3G0UA 3S42A 1I2NA 4JEQA 2QJGA 3LM7A 3UXAA 3BO9A 5BW6A 1DORA 1VYSX 4MZ8A 1ZENA 1LTDA 1TSIA 2ZZ5A 1PHWA 4KWVA 1I4NA 2EKCA 2GVGA 3W7LA 1GWJA 3C8FA 4OT7A 3QPYA 1LLWA 3LRMA 3NEVA 4CCDA 3LTPA 4XWUA 3SJ3A 2CLHA 1X6UA 4Y9AA 4NNAA 1EB3A 1VLWA 3NYZA 3QW4B 4A2SA 4BF9A 2R8WA 3CQ0A 2GOUA 3E02A 4ONVA 4R53A 5I3GA 1Z42A 1LRTA 2DP3A 2VFIA 1MEWA 3UWWA 1MO0A 4EIVA 1EA0A 5A8GA 4UFKA 2FPYA 2E68A 4LY8A 1YTKA 2V82A 4OV9A 3W73A 3LBMA 3HPSA 1BTMA 3IGSA 3UYCA 1VZWA 3CIXA 1ADOA 1N7KA 1XUUA 3H53A 2HSAA 5AYXA 1QDSA 2E6DA 2E77A 5DLCA 1WDWA 2PCQA 3G18A 1NF7A 4LUJA 1XXXA 1WXJA 3W6YA 3GAYA 1W8SA 3L66A 4HSOA 2NXGA 2EPHA 5D2XA 3TSBA 1T99A 4JTLA 1GEQA 3EWYA 3A5VA 2QCNA 3GZ3A 3LHUA 1JCLA 3R89A 3UWZA 2VEIA 4M7TA 3M41A 3MUXA 1ML1A 4BR1A 1K7XA 3MYPA 4O12A 3QQ1A 1RZMA 4QAIA 2V5LA 1OYCA 1QNVA 2PE4A 1H7NA 3GR7A 4N9DA 3MP4A 1KW1A 4R7JA 5FEXA 3NQ6A 3W7IA 1LOQA 5K9CA 2Y7DA 3P5ZA 2GUUA 4LOCA 3W83A 2QCDB 2VENA 3IEBA 1IF2A 1RVGA 5DXXA 1YTDA 2C15A 3H55A 1KFEA 4CNOA 1NEYA 1SPQA 2B4GA 1KM6A 1O5XA 4A21A 4JS3A 2O7QA 4PCFA 4CQ9A 4YXGA 5F2GA 4N2YA 2CLMA 3MP5A 4XUGA 5D05A 2IQTA 4GC4A 1N55A 1S5TA 3TC7A 1KM0A 1G4EA 2YFNA 1SU5A 4K7YA 5MHBA 2E5DA 1H7OA 2BWGA 3E9AA 2OZ0A 3IGXA 4GBUA 4ZMGA 5F4XA 3QMTA 1FWWA 4N9BA 3WK0A 3HGSA 5DCDA 4FXSA 1GQNA 3NNTA 3QSTA 3TW7A 4FX7A 2Y62A 1JR1A 1JVNA 3STFA 1GVOA 4JYDA 3CT7A 4TO8A 4P2VA 3USBA 4IXHA 3G1HA 4D2JA 3HG5A 1C29A 4GUJA 3ZR4A 3C2VA 3HB9A 2E6YA 4N9CA 2DJLA 3PF3A 1QPOA 1FWNA 3OVQA 4Z1CA 3HG4A 1E51A 3L0KA 1FWTA 3F1QA 5F2LA 3ZFHA 4IX0A 2WNZA 3HIJA 3FFSA 3IRDA 3M6YA 4N6EA 2NLIA 1GT8A 2CLKA 4R33A 3G3MA 3C2RA 1MEIA 1SR9A 3EX3A 4O13A 1ZHAA 2HMCA 1H63A 2RKXA 3QMRA 4JGDA 5E1QA 2WQPA 2Q8LA 1FX6A 1PHQA 5G5IA 4DO4A 3B0VC 5E93A 2VXNA 3ATZA 1QOQA 2RH9A 5AN7A 3RNDA 1VH7A 3W86A 1EUNA 4FXRA 1Q6RA 4EF8A 3EX6A 2QUVA 5AB3A 3PBWA 3T7VA 1TMHA 1D9EA 3WK3A 2VFFA 5D38A 3HGOA 5U7SA 4FIQA 2V30A 3GVGA 4HNNA 2E1DA 2B7NA 1G67A 3THAA 3INPA 2PRLA 4NT0A 3UPWA 1VQTA 1OFOA 4RZ5A 5FF3A 1EIXA 1UBSA 4XZ9A 3BW4A 1LRQA 2QDHA 3CC1A 2PURA 2C1HA 5K7JA 3H54A 2QCHA 1Q6OA 2NUXA 3SR7A 4QJ1A 1F76A 1KV5A 1KBJA 1UUOA 2OMAA 1O5KA 3BG3A 3W7JA 5K9DA 2ZRXA 4HNTA 2WJZA 1FCVA 4UTWA 4DEFA 4YMZA 5BNKA 2FDSA 3TH6A 1FCBA 4EF9A 3JR2A 2DZWA 5SWUA 3T55A 3O8AA 2J6XA 4AF0A 4HIBA 1H7PA 2H3BA 4IPJA 2ISVA 5CZJA 1FXQA 1TQJA 4MY1A 3PULA 3FEMA 3HGRA 1GVRA 2NV1A 3UZ5A 5CPOA 3G22A 2CZ5A 3HMJG 1KLYA 4AHQA 3CEUA 1M5WA 4MUZA 5LGZA 2C14A 3GDTA 1FDYA 3IIZA 3DI0A 4XBSA 2B7OA 5DY3A 3NG3A 4L4MA 5I3HA 1EUAA 4J9JA 2X2GA 3GIYA 1TV8A 4HN4A 4S2BA 2RDWA 1W1ZA 4JYEA 5EKYA 4RKAA 2P0OA 1S5VA 2QKFA 2TPSA 5CPNA 3STEA 1K8YA 1R30A 1EWDA 5FESA 3W7QA 3QQ0A 4UTMA 2TSYA 3G1AA 4CQAA 4ZVJA 1R2SA 1XFBA 4WY0F 2YZRA 3VNDA 1U5JA 2I1OA 4JXCA 2CLFA 1R2RA 2B7QA 3DFQA 2CZDA 2QCGA 4NX0A 1T8XA 3I7QA 1TPWA 3KRUA 1JUEA 3LV6A 4O8RA 3WFAA 4RR4A 3BG9A 2V8ZA 4I9AA 3DHDA 4Z0JA 2E5BA 3MO7A 1EX5A 2NV2A 3EX2A 2Y85A 4UR8A 1NF0A 5L9FA 4K6AA 1WAUA 3O6CA 4MVAA 3IGUA 1TCDA 4I7UA 1YADA 2CWNA 3WJYA 2NUYA 5D2VA 3GNNA 4JR5A 4WXYA 2CLIA 3WK1A 2B7PA 2I9EA 3NQAA 3BLEA 3EEGA 5BOOA 5C5YA 3CLMA 5KZEA 4WJEA 5ABTA 5HR7A 3NQ7A 1P5BA 4O10A 5CPLA 1XDLA 1TPB1 1H1ZA 2A5HA 2J88A 1VC4A 1T0OA 3MJYA 4AHPA 1A5AA 3C2OA 4UNKA 1OABA 3B8DA 1WV2A 1QPNA 2QCLA 4M7SA 1WOAA 1W3IA 4LTSA 3P80A 4NNCA 1ZAJA 3LCIA 3TSDA 5CSRA 1ZNNA 4TX9A 3FYPA 3DFOA 3NQDA 4IPIA 3OA3A 5DELA 3LXAA 1H61A 5HWMA 1OFBA 1OFAA 1QO5A 2OT1A 2Z6IA 1L6YA 3QC3A 1X1ZA 4Q33A 3T4CA 1I2OA 3L9CA 5D37A 3R8RA 1DVJA 2GJNA 3TK7A 1K02A 2VKZG 4FNQA 4S2CA 5LNVA 3G1FA 4MJMA 4AVFA 4NU7A 1B9BA 4BWLC 4XQ6A 3EWZA 3F03K 1F2JA 4H6KA 4O57A 3T78A 3MWAA 3T44A 4QSHA 3BW2A 4BK9A 4JX4A 2NWSA 2VEKA 2NX1A 3FKRA 4Y96A 2O7SA 1H51A 1G7UA 1NSJA 5AC7A 2V2HA 2E5CA 1OK4A 3V1PA 1LLZA 3NQEA 4BFAA 3R12A 3SGUA 5C2XA 2NUWA 4G1KA 4JDYA 2OCZA 5LZLA 1LDCA 1QMLA 1GVFA 1EPXA 3NQCA 1ZJIA 3NM3A 1LORA 3PUDA 2P1FA 3W2JA 2J27A 1F74A 2VFDA 2VFGA 2GQ9A 3TMQA 4DO6A 4LS2A 4FX8A 1KFBA 2Z0IA 1SZEA 5FF4A 4WUIA 1TB3A 1MXSA 2WOQA 1TPEA 1SW0A 3PG9A 2NWRA 3P82A 2YYUA 2DZXA 3IVTA 1SO3A 3S1XA 3MI2A 4Z0SA 4X22A 3C0JA 1OX6A 1GTEA 5J5RA 4JTKA 4BI5A 3LRKA 1QPQA 4O15A 3UD6A 1R46A 2DORA 4ZQCA 5FEPA 2GVJA 5KZMA 1Z41A 3G0XA 3AO0A 3OG3A 2OJPA 1DKWA 3EWUA 4M6PA 1CI1A 2PRMA 2ZZ6A 3NL5A 4OU1A 4MIMA 3NL3A 4M19A 2ZRUA 4GUGA 4UCGA 4UR7A 3QPZA 3TXZA 5HULA 3BPWA 1FCUA 1X1OA 3DKJA 4E2BA 3W1LA 1MZHA 2Q8ZA 1TIMA 3EKLA 5HNRA 4TIMA 1SFJA 3SI9A 4O54A 5IBXA 1XBXA 3NM1A 2H3DA 1YDOA 4ICNA 2A7NA 1KV8A 1MEHA 3WK2A 1HO4A 2J9ZA 4YL2A 5DN1A 1LZOA 1B4EA 3RLUA 2DZVA 2HTMA 2X1UA 4GUIA 3SECA 1BKSA 1XL9A 2YXGA 4K7VA 4IJBA 2YR1A 1ZAIA 2QCDA 2V9DA 4WQ6A 4KFOA 4ZQMA 5G2WA 3A9IA 1O95A 3MHFA 4LWWA 3ABQA 3EXSA 1J5TA 3GR8A 1PCWA 4Z1AA 2AGKA 4NVTA 3TE9A 3EWWA 2C0AA 4DQWA 5HUOA 3B05A 1OFRA 3W9ZA 1EEPA 3TA6A 3DU0A 4Z1BA 1QR7A 5FF7A 1GOXA 1VS1A 1H5YA 3LCFA 2CLLA 1YPIA 4IMCA 5AFDA 1FUYA 4IUOA 4RV8A 5K3VA 5CZ0A 3PB2A 1JUKA 2CFFA 1K3UA 4ML9A 3W1PA 2DZPA 3QYQA 2WO5A 1A50A 3W1NA 2D73A 4LVGA 3IVUA 3L2IA 3M9YA 3FA5A 3HPXA 3Q37A 1EP2A 2FJKA 3TCEA 1AL8A 3QSRA 2VELA 4JD4A 1IIGA 3HOJA 4QNEA 3L68A 3M5VA 2QEZA 3BG5A 3I6RA 1R2TA 2PRHA 3NDOA 1EP3A 4AWSA 1XKYA 2Y61A 3TFXA 3W1UA 5EL1A 4H3DA 2ZA3A 3O16A 1TRIA 4XBKA 4LVDA 2J9XA 4E2DA 2GQAA 3FJLA 1W31A 4JX6A 2NX3A 1FWRA 2A6NA 3TIMA 3C6CA 5AYZA 3E12A 5LNWA 1M6JA 1UJPA 3N2XA 2C6QA 5KITA 1JULA 3C4UA 1P0NA 4JDBA 4HHPA 1H60A 4O17A 3LTYA 4JTSA 4IWWA 1KFJA 4PL2A 4QNWA 2FQIA 3Q58A 1X8FA 2FPTA 4E0CA 2EAWA 4UXDA 3L0GA 2ZZ7A 3L67A 3BV4A 5F1UA 1XBVA 2ATMA 2Z1BA 1TTIA 4O1AA 2JGQA 2DZUA 4MFEA 3SY5A 3TMLA 3CIWA 3TROA 4KKXA 3G3DA 3TAKA 3ZWTA 3G1YA 3P60A 4N6FA 2C18A 1XUZA 4WXZA 4AH7A 4O53A 1TJRA 4GUHA 3GYEA 4K8HA 3TUUA 3GNDA 3GXTA 3B4UA 1DV7A 5BMWA 4FB7A 3E49A 3N3MA 1A5BA 4FHAA 5D02A 1OHLA 1HO1A 2WNQA 5D30A 2VEMA 3NO5A 1OVDA 1GG0A 4QISA 3ANYA 5G1YA 1IIHA 4JTHA 4RCXA 1YXDA 3QM3A 2XN2A 1VCFA 4OQVA 4GRSA 4UFHA 2CLEA 1VPXA 2R94A 3LERA 4IX2A 1XBYA 3W1AA 1VJIA 5I3JA 1F73A 5HWJA 3W76A 2ABAA 4YLWA 5C6MA 2EF9A 3EWBX 4UFJA 3SZ8A 3MHGA 1F5ZA 3KFTA 3S1WA 5CPMA 1W37A 5EMUA 5LNUA 1VR6A 1AK5A 1F6KA 5AC6A 5D2WA 3KVKA 4NQ1A 4DPQA 1FWSA 2F84A 5C55A 2H6RA 2R14A 4B5NA 3CWOX 4XKYB 1OX4B 3EX1A 3SSJA 3QJAA 1K7FA 3FJ6A 4PH6A 5AHNA 2CZFA 1PV8A 2OT0A 1LCOA 1C9DA 2WNNA 3LCGA 3NVTA 1LYXA 2BXVA 2WSRA 4HPJA 3UY7A 3WJSA 2DJXA 4MFDA 1G7VA 5AC8A 5DXYA 5K4ZA 3VFLA 4O4VA 5D2TA 3P8IA 2G96A 1RPXA 2QR6A 4O52A 3TFCA 1LOSA 1SO5A 1DQXA 5EA9A 3GXPA 3W7OA 1TTJA 3PB0A 4LU0A 1Q45A 2ZYFA 3YPIA 3C2EA 2CW6A 4CCEA 3LCXA 5EYWA 3IIOA 1PCKA 3TQ0A 1JCMP 5GVJA 1YDNA 3QZEA 1Z44A 4PODA 4ZQNA 8TIMA 2NXIA 1I45A 4JTJA 5CSSA 3TKFA 3FS2A 3C56A 3S9YA 1XM3A 4MJZA 3N34A 3BLIA 3W2LA 3I68A 1KFLA 5F4WA 1QOPA 4GUFA 3GB6A 3B03A 3E0IA 1ICPA 4UTUA 2H90A 3A5FA 4O0ZA 4PEKA 4JTEA 1K8ZA 2JKAA 3KRSA 4K36A 3NZRA 4WY0B 5TQLA 1S5WA 3PUEA 3GDMA 2V5BA 1TV5A 1I2PA 1SZNA 3MBDA 4JX5A 3NL2A 3PSWA 1LRNA 4JNMA 3GX9A 3M0ZA 1ME9A 4QIUA 4P61A 4TR9A 3CTLA 4NJIA 4UC5A 4BI6A 2RDTA 3B06A 3OVPA 1LROA 2EHHA 1V7YA 3FOKA 2QAFA 5K9XA 1AG1O 3KHJA 4LVFA 1FBAA 5CZTA 2ZTKA 1BWLA 1VYPX 3VCRA 2WV8A 2X1TA 3LLFA 4NX5A 2W6RA 1KTNA 2C13A 5J5DA 4IMDA 1XCFA 2ZTJA 3DFSA 1OF6A 3O63A 1KTBA 3LXCA 1W5PA 5F2MA 4DPPA 5HR6A 3KVMA 3S5YA 4IMEA 1TTPA 5DY2A 4S1FA 3N9SA 3DFNA 1XC4A 2FTPA 1OX5A 3GK0A 5K4XA 2QCCA 1W5NA 4H4IA 3STGA 3LCLA 1W56A 3N9RA 4UMBA 1W5QA 1OJXA 4UTHA 4TU1A 3ZS4A 4JTIA 3KOFA 4IXXA 4DF0A 3EWXA 5G1TA 4JN6A 4DF1A 1TRDA 2WSQA 3DZ1A 4MY9A 2QCFA 3EXRA 3UZJA 3HJZA 4ZQOA 3LI1A 3TV8A 1TPH1 1NVMA 1TYGA 2YYTA 2QCMA 2B0MA 4HKPA 5DCBA 1KTCA 3PSVA 2TMDA 4N02A 4W9TA 2YGYA 4MYAA 4E38A 1GPWA 3NPXA 2QAPA 6ALDA 4GFSA 3RMJA 2WPBA 1XI3A 4OWGA 4FNSA 3NQMA 2G5WA 2VEPA 1W3NA 5CKSA 5BRBA 5D33A 1O60A 1F7BA 1DL3A 4LV9A 3KAOA 3EB2A 1DJNA 1TPUA 1WBJA 3QF0A 1GG1A 4UMAA 3W74A 1YLVA 3P7YA 4FX6M 4QITA 5HQEA 5LNRA 3O07A 3ZWSA 5HWNA 3W87A 4TMBA 2KZHA 4LS1A 3UQNA 4A29A 4YCPA 4AEOA 3NAVA 3W7MA 1B4KA 4UIOA 1VCGA 3G1SA 1BWKA 2FB2A 4FO4A 2QJHA 1G69A 3EKZA 3B0UX 2ZZ4A 2NXHA 1M7OA 1A5CA 4C1LA 3Q2DA 3DHFA 2JK2A 4NXKA 1TV7A 1LOLA 3PC0A 5AHEA 3O6YX 3L5LA 4NXSA 3W70A 1LP6A 3PBUA 1KM1A 4PTNA 2W0UA 3SIZA 1KM4A 4EVZA 3G8RA 3NQFA 3CHVA 4BWLA 5LHEA 5AHFA 3CPRA 2E6FA 4DO5A 2ZDRA 1OFQA 5TIMA 3RF9A 2YW3A 3DFTA 1FQ0A 4AWTA 3LX9A 3W7EA 1AW1A 2A1YA 1JRCA 2ZRZA 1QO2A 4K37A 3DFPA 3UNDA 3UPBA 1TREA 2VFHA 3DKLA 4AHOA 1OYBA 3C52A 3IVSA 3WJWA 5CG7A 4KFPA 1AMKA 3M5YA 4O1CA 2RDUA 3O06A 4PFMA 4RZ4A 3A22A 3EXTA 5L6UA 4UTLA 3TXVA 2HS8A 3IIPA 1SSGA 3PBYA 3UY8A 1HFBA 2Y6ZA 3FYOA 3W75A 5F2IA 1JUBA 3A23A 3S1UA 4N4QA 3BLFA 1TPVA 2XN0A 3GKFA 3W7HA 1D3HA 1FY6A 3G1XA 3CM4A 1KFKA 1ZY9A 3KRZA 1L6SA 3NXFA 3KVLA 3M16A 3M5ZA 4YCOA 2A7PA 3R2GA 5EBUA 3GDKA 3LDVA 1VRDA 2YSWA 2QUUA 2ZFAA 2BSLA 3DBPA 1JJKA 4N4PA 3IIVA 1L6WA 1VCVA 3W3OA 1JCXA 4EWND 3HO8A 5D09A 1YTEA 4O18A 1J2WA 1XBZA 4HSNA 2VFEA 4GJ1A 2BZNA 5F1VA 4LV4A 3NZ1A 1EWEA 2V2CA 2ZCGA 5U4NA 1OFEA 3DAQA 4JYFA 1OFDA 3KX6A 4UTTA 1WBHA 2V2DA 4M6QA 5D04C 4LNYA 2ZZ3A 3TQKA 2XN1A 4TMCA 3UWYA 3M1ZA 4OV4A 1WOBA 4UUIA 4EOUA 3C3NA 4ZZ9A 1T96A 2ZZ2A
chains in the Genus database with same CATH superfamily
2A6LA 3SGGA 2ALDA 5M1TA 3NA8A 1XR2A 1UPMB 3G24A 2W91A 1SYTA 5CPSA 4GY7A 4LUIA 4DB7A 1DWFM 5KSWA 2ABBA 3QGVA 2CBIA 3BW3A 3QH2A 3W0KA 4AWEA 2QULA 3IS4A 9CGTA 1NFGA 2D69A 3BJFA 4P8XA 1HL2A 1K03A 4YJ5A 3TDFA 3WNNA 4B5WA 3ZQ9A 3RR1A 1YX1A 3OHIA 5IHSA 3S2MA 1XYAA 4YTQA 1Q3NA 1WDPA 2JE8A 2ZQ0A 4IQLA 1H7WA 1Z8AA 2NQHA 1V8EA 1AQ0A 2ZXDA 1H7XA 3GVVA 3ME3A 4RZ6A 1E4LA 1PVNA 3W1MA 1IXQA 3L5AA 3BLKA 1F8MA 1B3OA 2YFOA 4DRSA 1J2BA 4QQ3A 3CUIA 1OEPA 4QJ3B 2FPVA 5DT7A 1ZS2A 4UFLA 5IXEA 1TPC1 3AAMA 4QTGA 2Z1XA 4FXFA 2CHRA 2QGYA 4HJFA 3MUCA 3TJXA 1J10A 3MS8A 3W2NA 3LZ3A 2PS2A 3LXBA 1AD1A 1UR3M 3S0CA 4I7WA 1XWYA 2PTWA 1V6WA 5LNSA 4NNBA 1QASA 1BGAA 2DV0A 3RIKA 1SW7A 1KM5A 4BEQA 4IJRA 1C90A 1Y0EA 1U33A 4M5PA 2C3ZA 2WSYA 1FWGC 4E8CA 1BEUA 3R1ZA 1UKQA 4RW5A 3EGJA 5AOUA 4V27A 4DO7A 2PDUA 4OBRA 2W92A 1HUVA 3CMFA 1VFSA 7TIMA 1PX3A 3V36A 3TAOA 1UD6A 5EPDA 4HPXA 5D32A 1GZ1A 3KS6A 3U2CA 3W2MA 3LCWA 3WO8A 3LM3A 2E09A 4OOZA 1IEIA 5FSDC 4J3SA 3PZ9A 4S3JA 2EXOA 3M5XA 4CNPA 2VC9A 4UFMA 4L56A 3ONBA 1K8CA 2V0TA 1G6CA 3WBEA 2W61A 4P8WA 3T07A 4O0KA 3WNMA 4L1GA 4Y2WA 3OQEA 3REQA 4IM4A 2BXYA 1KO0A 3TLQA 1MW2A 1SFSA 2FB3A 3QOKA 3PZVA 3LHWA 1Q4WA 3NQBA 3WQDA 3VOHA 4HOXA 3A24A 4DIAA 1UB3A 5E6YA 4B90A 2PP3A 3UXIA 1IGWA 1GZGA 5M2FX 2CU0A 1HZYA 3WL0A 3TONA 1ME8A 3UWQA 3UGRA 3N2TA 5JXQA 3MHUA 3ITCA 1H0IA 2WVTA 4C6DA 2PZ0A 4CCCA 4LC8A 3UWUA 3L7RA 5HMEA 2KAUC 1ZRQA 3II1A 4WEVX 4GXMA 4JKMA 3WDIA 4OVXA 4KWWA 1IXPA 2ZRYA 4BF7A 1JGMA 1E73M 4CEXC 4CQCA 1MXDA 1Q6GA 1JCYA 4I8DA 2C8NA 4DZIA 5G4EA 4HQVA 1H7RA 5E6ZA 1VBJA 3BGGA 3URQA 3PHAA 3V5CA 1VBHA 2X1RA 3KS5A 3UZZA 3BDKA 1VHNA 4IQEA 4HP5A 2D20A 4L65A 1IXOA 3LQGA 5DQPA 3PBMA 3RGTA 5CCZA 1GJUA 3G8EA 3U8GA 1F3EA 1PDZA 3RM9A 4WJ8A 3U3HA 4XK2A 4Y8FA 3LHVA 4NASA 4A8IA 3S1GA 5KINA 4JY9A 4IIFA 4NZJA 3BLDA 4AX7A 4O8AA 2B81A 1TWWA 1WXYA 4L4OA 1UZ4A 2WVUA 2Y5EA 2X0SA 1XPYA 4IP4A 4MKVA 3IRSA 1J96A 3ZYZA 1T41A 4AZ7A 2J77A 4LUSA 2ZDSA 5AHIA 3RR4A 5AC4A 5TF0A 1UR9A 4XZMX 2Z25A 1SMDA 4PRRA 3PPHA 4MPQA 4S23A 3NQVA 3W2KA 3NPUA 3DC8A 2VO5A 1XF0A 2AQWA 4GVHA 3U0HA 3W24A 3BOLA 3W6LA 3NPVA 1TA3A 2C19A 1LBLA 3GR4A 3H70A 3PVFA 1LBMA 3W37A 3T4WA 1B3VA 4L9YA 4FK9A 7TAAA 2CIPA 3L2LA 3O0FA 1QAPA 4HCHA 3K4AA 1MYRA 4U4MA 1I8JA 1EH9A 2XFWA 4N9EA 5CC6A 1GONA 1XD1A 4NY2A 2P8BA 1O94A 3CUHA 4UBPC 3LB0A 3B97A 3AZTA 4HBKA 4Y7EA 2WMHA 2Q3OA 1P4CA 3W00A 2XVGA 2PF8A 2D0GA 4IPNB 1A5SA 1PL9A 2O9OA 5CG0A 4RNJA 3N15A 5FL1A 4J3TA 2FLIA 4L1WA 1QT1A 1R9XA 5E0CA 2VP8A 1MRAA 1S5MA 3HQOA 2FFCA 2Y89A 5A6BD 3PUOA 4DJED 1NWRA 3G5EA 3K5XA 1CLVA 3H24A 3IJ7A 1BXBA 3SCUA 4GZJA 4MAVA 1JQVA 2A21A 4D8ZA 2E6AA 5I3KA 1JZ5A 2PAJA 3WJXA 3ARPA 2EJ1A 5H8MA 3MV01 3WCZA 5LA1A 4F3HA 4KH2A 2YDAA 3O05A 4QSFA 4EPKA 5CSYA 1TZ7A 5JBFA 1GTHA 1YXYA 4JKLA 3EDKA 4KGJA 1YRRA 4DF2A 2F2HA 3F5LA 1UH3A 3F4CA 4UTIA 3W71A 6TIMA 3S5SA 1WB0A 4KT2A 5HMSA 4ROQA 1YDVA 4B92A 4R9OA 3A4AA 4O1BA 4JCLA 1I6NA 3WBXA 4RXFA 2JKPA 1RBLA 4MADA 2QCEA 3LPFA 3UA4A 2D2OA 4WHBA 5TBOA 1XYZA 1EDGA 4MG4A 5DRCA 2BASA 1EX1A 1NAL1 1PIIA 4R3UA 5DX7A 2V5JA 4J27A 3L23A 3BJTA 3D47A 3QTGA 1PIGA 4YPJA 3SDOA 4L80A 2RJGA 5C0QA 1R0MA 2R91A 3M0MA 3GDRA 5HJLA 3QV6A 1ZZMA 1F6PA 4EKJA 1H1YA 2INFA 1KCKA 4Z2LA 2HK0A 3JS3A 3AUOA 4B2DD 1W0MA 2Z2AA 4OHQA 3I4EA 3QTPA 3W7KA 3P84A 1T7LA 3ZLFA 1UASA 4NZ4A 4WLCA 4IFKB 4RLIA 3XIMA 3U4FA 5BRQA 2FMNA 3L0NA 2ZVRA 4E2OA 1DIEA 2ADAA 3ZMRA 5D9NA 1QWKA 4MDPA 1GVYA 1PO9A 4ZQRA 3T8QA 2QDGA 5AHLA 3JVAA 4MLRA 2ZRWA 4IGHA 4DYEA 1S3TC 2BX7A 4C90A 1KM2A 4IFRA 1OF8A 3ARVA 3W7DA 4RUBA 3PWAA 4IT1A 3NQGA 3GQYA 2D3NA 3HA1A 2IXVA 3BO9A 1HKWA 3GHSA 1I60A 1R85A 1EOMA 5LIYX 1I4NA 2EKCA 2WHLA 1FWCC 3CV7A 3C8FA 4OT7A 4AISA 3QPYA 3VC6A 4CCDA 3LTPA 3SJ3A 2JALA 1DWAM 3LMZA 2E28A 4A2SA 4BF9A 4R53A 3AU2A 1Z42A 4AIEA 1E4MM 2E68A 5D9MA 1L0PA 2V82A 4PTWA 3VO0A 4DBWA 4PBEA 3R8HA 1V3IA 4EANA 1BTMA 3BAJA 1YHTA 5ECUA 3UYCA 2FTYA 3CIXA 1VEPA 1JF5A 4UTFA 1N7KA 4L4PA 2DEPA 2VC7A 4H00A 2BODX 1QDSA 2PDCA 3WQ8A 4XG1A 4LYKA 5DLCA 2Z29A 1TVNA 1NF7A 1WXJA 3GAYA 3L66A 3BANA 4Q8PA 5D2XA 4CD7A 3C86A 2WB5A 3A5VA 4JIRA 3LHUA 4ILSA 4WGXA 1PTGA 1DXEA 1IZKA 3UWZA 3U7VA 1XLDA 3M41A 1ML1A 1K7XA 3MYPA 4O12A 1M7JA 4AD1A 1KCLA 4Q4MA 1QNVA 2PE4A 3WLKX 3MQTA 1CGTA 1W1IE 2DFAA 2DSZA 1ZJHA 4N9DA 1GW9A 3SUVA 1EYEA 1ZGDA 3NQ6A 3PK7A 2VNCA 3BCDA 4K1WA 4LOCA 2Q8XA 3M0LA 3IUIA 1DJXA 1I9CB 4GQQA 3H55A 8RUCA 2Q02A 1NEYA 3UVIA 4H6QA 1O5XA 4H01A 1FWFC 1CXLA 5DEZA 1QW9A 4HN8A 1OIMA 1SU5A 2OYLA 7CGTA 4X2PA 5MHBA 2BWGA 2HNHA 2OZ0A 1HJWA 2D1ZA 5F4XA 2PDXA 3WQ5A 2DH3A 3WK0A 1QOXA 2G3FA 3PAOA 2KX9A 1S38A 4FX7A 4ERIA 3STFA 5BWFA 4JYDA 4TO8A 2JFEX 3OA5A 5CJMA 3WDQA 1HKJA 4KCUA 1C29A 3EOOA 4GABA 3HB9A 3L4UA 4JQ1A 1WKFA 4GJIA 3DX5A 4Z1CA 1E51A 3F1QA 3ZFHA 3BLLA 2WNZA 3FFSA 3IRDA 5LIUX 3IV8A 3CAKA 1PDYA 1MEIA 1EBHA 4O13A 2JIEA 1H63A 4LFYA 4KCVA 2UZ9A 1EYWA 5E1QA 2WQPA 3VDCA 1FX6A 3UJRA 3PZTA 1PHQA 5DO8A 3QZ6A 5E93A 1SJAA 1E9YB 3R43A 1UKPA 1P7TB 2OELA 1D9EA 1MW0A 4CD4A 4EXAA 4FIQA 4C6EA 4HMEA 1LQ0A 2V30A 3AMGA 3GNPA 1HIZA 1UPPA 4JTCA 1PZ0A 4QEEA 1PIFA 3GDBA 3D3AA 3MMUA 3UPWA 5LYRA 3H2FA 4RZ5A 4XZ9A 1UBSA 4A4AA 2XIQA 1Y8BA 3N25A 5HDRA 3FDGA 1B3XA 1ESWA 2PURA 2C1HA 1TUXA 4HOZA 2GDUA 2ANUA 1MZRA 2AKMA 3RUBL 1DWIM 2QCHA 3C0SA 4QQUA 4LEFA 4D1JA 5EMYA 3BG3A 4E4FA 5K9DA 1Z69A 4UTWA 1XISA 3W29A 4NRRA 2NSOA 3CH0A 1FCBA 1GHRA 4FLOA 4ZCWA 3O8AA 4DUOA 2XVKA 1H7PA 2H3BA 4G56A 5A8OA 1R7OA 4B15A 1UD4A 3HM7A 3PULA 3FEMA 1JYXA 3HGRA 4W87A 2YL5A 4NAFB 4WRHA 1GVRA 1V08A 4H6EA 3MV11 3HMJG 1FFQA 3D46A 1R87A 4R85A 3AYTA 1V7AA 2F6XA 1H5VA 1M5WA 3CEUA 2G8ZA 1BVNP 3IIZA 3NG3A 4CU8A 4J9JA 1R8LA 4MWAC 3WH9A 2I57A 5A6LA 1SJDA 3CS2A 3NURA 3G6MA 4KEZA 1ZU8A 4RKAA 1JZ6A 5I00A 3KE0A 2TPSA 1R30A 3W25A 3WQPA 4CQAA 5A69A 2WW5A 1I75A 2VUYA 4WY0F 2PI6A 4V15A 4AX6A 4PMQA 3VNDA 1CB2A 3MC5A 3T1GA 1R2RA 3IUDA 2CZDA 3HTWA 3VGDA 1H41A 4NHVA 4HCLA 1JUEA 4Q4RA 1VIWA 2DVXA 3DHDA 4Z0JA 2MANA 2E5BA 3WNKA 3LUTA 4K6AA 4OZOA 4LGXA 1W6TA 3AQUA 1R86A 3IGUA 4I7UA 4A8RA 5FJOA 1EBGA 2GJXB 4ERGA 2I9EA 2GSEA 3AHZA 5CGMA 4GGBA 5BOOA 1KKRA 2C1GA 4O10A 4DVOA 1GORA 1TPB1 2J88A 4N42A 1T0OA 3ZT7A 3MJYA 1VFHA 1E0VA 3C2OA 4UNKA 1A0EA 1OABA 1X8CA 5GNZA 5LA2A 4KRZA 2VOTA 3E2RA 4QJ4B 3ANUA 3WBWA 3TSDA 1DWGM 2QT3A 1KB3A 2G3IA 5M17A 3BAWA 2PGFA 3WLRA 2OWWA 1OFAA 3RU8X 2WPGA 2ZX9A 2WZEA 2PDBA 1W9UA 1DVJA 1T6MA 4OFCA 4Z2KA 3MY9A 1TWZA 1K02A 4IFKA 4FNQA 3VFCA 1Q65A 1NP0A 2UY4A 4AVFA 3CIVA 2QPSA 4H6KA 3MWAA 2D22A 3Q67A 1FVPA 3S2JA 4Y9PA 2PLJA 3UJSA 3FKRA 4RNIA 4Y96A 1EXBA 4QCEA 1CGUA 1W2VA 3WH8A 3UPMA 1LLZA 1R9ZA 3NQEA 3AC0A 2WSPA 4NZ1A 3SGUA 5C2XA 1RPKA 3AIBA 2YL8A 4G1KA 4JDYA 4YVXA 1E71M 1LDCA 4S3CA 4M51A 5E9XA 1RK5A 5CAKA 3NQCA 4GC3A 3VX1A 3HQPA 3PUDA 2P1FA 3RX2A 2J8FA 3IJ9A 3FAWA 3ARQA 3EDFA 3TMQA 1RD6A 3W53A 1MXSA 1TPEA 4JL2A 3KWXA 2NWRA 4WCJA 2YYUA 3RJXA 3LBOA 4WVXA 3VZYA 3C0JA 2Y4SA 4XV0A 4NP7A 1GTEA 4JTKA 3KTSA 3LRKA 3LD5A 1EF2A 4P8VA 2Y1HA 4D1IA 3GHRA 1WKEA 3WG6A 1Z41A 1NFPA 3EWUA 4AEEA 1CI1A 4E2VA 4OU1A 1F07A 4M19A 3UFYA 2ZX7A 3ZZ1A 4UCGA 3TXZA 1X1OA 4E2BA 4IJCA 2PCEA 1WUEA 1EDQA 1KCXA 4C7DA 3N29A 5C9XA 3MKVA 3ZXWA 3ICJA 3DERA 4XISA 3AISA 2FHFA 2NT0A 4I5RA 2BVTA 1EQPA 1TWIA 4JIHA 1CB7B 1HO4A 3GG8A 3GUWA 5DN1A 2XIOA 1L8PA 2DZVA 3ARRA 3P0XA 2OWXA 3SECA 4MNKA 1O5QA 4D8LA 4K7VA 4XZIA 4GY1A 3ANVA 1A49A 4NKCA 4KFOA 3RO6A 1ADDA 3GIQA 3ABQA 1JDCA 1J5TA 1QW7A 3EXSA 3FX4A 3GR8A 1PCWA 3V18A 4Z1AA 2AGKA 4NVTA 3NSNA 3E38A 2C0AA 1I1WA 2J74A 4J5NA 4IIGA 1GVEA 3B05A 1O1HA 4FLQA 4BF5A 4Z1BA 1KQYA 3GFXA 2D0FA 4R7OA 3H4WA 1BLIA 3E0VA 2EO7A 3FSTA 5AFDA 4RPPA 5K3VA 5CZ0A 1JUKA 1EGZA 4ML9A 5D8WA 1LL7A 1K1DA 3OG2A 2XIMA 2WO5A 4AIBA 3W1NA 3MCNA 4HNLA 2D73A 1KRCC 4LVGA 1E6SM 1TCMA 3M0JA 1K9FA 3QSRA 2RJHA 3EA3A 4JD4A 3VZZA 1IIGA 4LB3A 1WPCA 3M5VA 1VEOA 1R2TA 2PRHA 4AWSA 4ZOCA 1XKYA 2GDVA 4PMUA 2DSUA 3K8MA 5A8MA 2X2YA 4UQDA 2UBPC 2GVEA 4E2DA 1S2CA 1IWAA 2EEXA 4DXKA 4H7ZA 5GJMA 1JI2A 5AYZA 5LNWA 1B54A 4IFOA 2OLSA 4PMNA 1XLMA 3QR1A 4Y9OA 1P7TA 2V5KA 4HHPA 2C79A 1JL8A 3LTYA 1OD0A 3GU2A 1KFJA 4QDPA 4QNWA 1PX4A 2E9LA 2VRQA 3V16A 1QNQA 5A2CA 2PBOA 5JBEA 2ZZ7A 5A1AA 1R3QA 2E40A 3HPFA 1E72M 4O1AA 4L61A 4MFEA 3TMLA 3CIWA 3PNZA 3ARXA 3VINA 1IEQA 2POTA 4NG3A 3BAXA 3SUSA 1XUZA 4WXZA 4AH7A 4GUHA 3USZA 4C7GA 4JFSA 2XHYA 3GNDA 2QDDA 3B4UA 4FB7A 1DJIA 2WNQA 1VB9A 4RCXA 3RG6A 3S6TA 5AECA 1V6XA 3QM3A 2XN2A 1UG6A 3DG7A 1T8QA 2CLEA 2YA2A 1VPXA 3LERA 3RX4A 1V77A 2Z1WA 4ZTXA 4W8AA 3WBAA 3ZOAA 5HWJA 3LEPA 2YBUA 3HURA 1K6AA 4P7RA 3W76A 4NAFA 4YLWA 4UFJA 3IJ8A 2ISDA 4WDUA 5CBBA 2I5QA 1F5ZA 4AU0A 1VR6A 1C91A 2F84A 2H6RA 1V3HA 2NT1A 2QPXA 3SSJA 4PMOA 2XFFA 3QJAA 4C65A 4OJYA 2ZADA 1QATA 5AHNA 2CZFA 4JFTA 1BWVA 3P0WA 4MSSA 3LGDA 4RE3A 3CJPA 3UY7A 3AXIA 3WJSA 5DXYA 3IANA 2G96A 1BYCA 2QF8A 2QR6A 5CQ1A 3OU8A 3PFMA 1LOSA 2Z26A 5EA9A 2CW6A 4HTYA 4CCEA 1EO7A 3VOIA 2ISFA 5EYWA 1J5SA 4KESA 1JCMP 3VC5A 3FHQA 2EJAA 1L2QA 3LQLA 3QZEA 1BXCA 4HA4A 3U9IA 2NXIA 3WUEA 3C56A 4KEMA 1XM3A 1E55A 3BLIA 5TAOA 4S3BA 4RDWA 4GQGA 3QV7A 4GUFA 4S3GA 3B03A 1BTCA 3O2LA 4AD3A 1C3FA 3A5FA 5CZKA 2GJXA 4O0ZA 3QLDA 3B9NA 4K36A 2VDHA 4KPLA 4HPHA 2A3CA 1S5WA 1NH6A 3EEZA 3PUEA 4I5XA 1Y5XA 2YDQA 4HU4A 4PMXA 4PSRA 1SZNA 3MBDA 3URBA 4REQB 1LJYA 1ME9A 4DX3A 4TR9A 3CTLA 1ITXA 4BI6A 1UD3A 4S38A 3LY0A 3OVPA 2QVNA 2W67A 5GJPA 2EHHA 4B4HA 3SBFA 4GLEA 3AOFA 5HK4A 4ECLA 4WSKA 5I24A 3OOQA 1JAKA 4V1XA 1ZBKA 1VYPX 3P3BA 2HE8A 2X1TA 1ADSA 3LLFA 1JNDA 4NX5A 2VZSA 3RJYA 4PCTA 4J3WA 2EPKX 2ZTJA 3DFSA 1OF6A 1TMQA 3NZGA 4XAGA 3LXCA 1XC6A 4DPPA 3S5YA 6A3HA 1A47A 1IWPA 1TTPA 5DMYA 3N9SA 4OOUA 5K4XA 2HJPA 3QY8A 1YNYA 1BYDA 3WLSA 1KBLA 1YMYA 3PNUA 1ISZA 2Y2WA 1OJXA 3MZNA 4JTIA 9XIAA 3KOFA 3R94A 4JIIX 1ITUA 2WSQA 4B4FA 3UZJA 4J2MA 3W26A 3W02A 4Z2IA 1ZP3A 3LI1A 1C7TA 3LG3A 3WD0A 1B2YA 5I0DA 5PTDA 1EHNA 1F61A 2QCMA 1O5RA 2B0MA 2X0HA 1OGBA 4CU7A 3F5KA 2PWVA 4JTAA 4HKPA 3AXXA 4MYAA 3WDJA 1EDTA 1GPWA 4IICA 3AZSA 5G1MA 2ZUVA 4XO6A 2O4MA 1W3NA 4MM1A 3AIUA 5CKSA 1RBAA 4ZA0A 5D33A 1AD4A 4X63A 4QHRA 4FR6A 3FSUA 1XIJA 1BQGA 2XISA 3P7YA 1OM0A 3O07A 1X97A 3W87A 4TMBA 1A5OC 3SQMA 4D6DA 4JKKA 3AFBA 3W27A 4FP1A 4YCPA 1NWUA 4GMEA 3EKZA 3AHYA 4LY4A 1F3TA 1UC4A 3B0UX 1HXJA 3BZJA 2NXHA 4AC1X 3Q2DA 3EMCA 2JK2A 4IG2B 1PTDA 3AMCA 3PC0A 4GVIA 3KOYA 3L5LA 5AY7A 4ZBCA 1LP6A 3PBUA 1KM1A 4PTNA 2HPMA 1KM4A 4GIAA 3CK5A 4PEEA 5LHEA 2E6FA 4PUJA 2DT0A 4S3FA 5TIMA 2YW3A 3R0DA 1RVKA 4HHMA 1JRCA 1MUCA 1M3UA 1QO2A 1UJQA 3UNDA 3UPBA 2WLZA 3FVMA 2VFHA 3N3TA 4A8LA 3VD3A 2FVKA 3O06A 4DI8A 4PFMA 1BD0A 1AJZA 2HS8A 3IIPA 3NWRA 3GHUA 2Y6ZA 3F2CA 2QUMA 1JUBA 1Q2SA 2GVYA 4MJ2A 3W7HA 2HVOA 4XZWA 1D3HA 4TUFA 5HQLA 4L9XA 5JU6A 1QHZA 4V33A 3CM4A 4EAYA 3QFWA 4Z1YA 3I4KA 2YSWA 2ZFAA 4PGLA 2W66A 3FDKA 2BSLA 1QNRA 1VFTA 2DGAA 4NSBA 3IIVA 1L6WA 4B5VA 4GZIA 3N6QA 3KW3A 2BZNA 3O7UA 4F66A 1G5AA 4LAKA 4H7VA 1PYMA 3WLQA 2V2DA 3KBJA 5D04C 1PBGA 3UWYA 4OV4A 4EOUA 1LQ2A 3C3NA 1BF6A 3WDPP 5HOSA 4POCA 1REQB 2DPEA 1UCWA 5HA7A 4LVAA 5BYWA 1O6IA 4BI7A 1IR1A 1W5OA 1TO3A 2FMOA 3LS9A 4O4WA 2PDPA 1MFVA 5J8LA 4KWUA 1W9PA 3ABRA 1J6OA 2QF7A 1ODUA 5D9OA 3BZGA 1Q6QA 1U5VA 3SN1A 2H8ZA 1ZCOA 1Z7AA 2YX0A 3ATYA 1UR4A 2OR2A 2YW4A 3FLUA 3FN9A 4YHGA 4PR4A 4JN7A 3V4BA 1H50A 3LCHA 5CZSA 3DI1A 2YCEA 1RQHA 1KM3A 1K7EA 2H8XA 2ISWA 2EQDA 2RGMA 1Q85A 4U2ZA 3VOCA 2YPIA 3OODA 4O1DA 1R5YA 1W1VA 4UR9A 2JKEA 3E5BA 4OBTA 1X7FA 5D03A 1E1EA 5HUPA 3HN3A 4F8XA 1KFCA 4E3VA 1W9VA 2FGLA 1PE1A 4PB3A 1WKYA 3EB3A 3O6DA 3OP2A 4JTGA 1EGVA 4XZBA 1U1HA 4O1FA 5MF5A 1IZJA 1EGMA 1G9HA 1TJ0A 1WQ5A 8XIAA 1K6WA 3MMTA 1GVQA 3W7GA 4F0HA 3ARUA 2Z28A 2Y7FA 3DECA 7REQB 1XDJA 1G94A 4U5KA 4XAFA 3P74A 3BCFA 2ZZ1A 3O15A 3VD5A 1KRMA 1RAKA 3W22A 1W3JA 3W7NA 1XSIA 1HT6A 1W1B1 3TW6A 3B0PA 4ML4A 4UZSA 1EC7A 3PM6A 1EC8A 4RZBA 4X3ZA 4A3QA 2ZICA 5FAGA 4HB7A 2HWGA 4AUBA 5A2BA 3UEQA 3LHTA 3S1VA 2FGZA 3I7SA 3Q45A 3GVQA 3WJZA 3HGJA 3FJNA 2VZTA 1AJ0A 4E8GA 2G3MA 4RE0A 1ME7A 3A21A 3G1VA 3HJEA 1TELA 3N73A 4DJDC 2NX9A 4QE1A 1KNWA 1HKKA 3THQA 4IGNA 3MUZ1 3P67A 2I5GA 3O1NA 4IPLA 3ITLA 4JICA 2PDYA 4PCNA 4S3AA 2OX1A 2VC6A 3R79A 4WJXA 5FF0A 1GW1A 2OEMA 2XU2A 1E40A 3H2AA 2QUTA 1VHCA 3RK8A 3PS7A 5DANA 3E74A 4AWUA 4LALA 1B31A 1XIEA 3V75A 3CWNA 1XJBA 3HG3A 4REQA 1S3HA 2EG8A 3PG8A 1G4TA 3BICA 4GH3A 1OK6A 2OEJA 2IMRA 2ZWYA 4DWSC 2XVNA 2O9RA 3LV5A 4DNHA 1MI3A 4GISA 3BH4A 5E9AA 1OSEA 1FTXA 4WX2A 4IMGA 3A47A 3L5MA 4HNOA 1AA1B 1HJXA 1EP1A 4O11A 2Y8KA 3OGVA 2DIEA 2ACQA 2JEPA 3WELA 4D6CA 5HPCA 3OEXA 5CJ5A 1KXQA 4KFNA 4D71A 3VKJA 2AMXA 3OLIA 1JDFA 1JRBA 3KL0A 7A3HA 2PSNA 4WZHA 3CU2A 2BLEA 4C60A 4ZSUA 1UROA 3PTKA 3WH7A 2DT1A 5H2ZA 1E6ZA 1RCOB 4LC6A 3JRKA 1PPIA 2ZUSA 3W85A 3N4EA 2XFYA 3WMCA 4P8UA 3NQ2A 4IP5A 2QXWA 1J93A 3CTTA 1RCXB 1QW8A 2J7GA 4MAZA 3AIEA 3S5OA 1IV8A 4DJFA 3H2MA 4FF7A 1L8NA 4G8TA 4W84A 3U57A 4BA0A 5T9CE 3M4HA 4ZO7A 2Z1KA 1JI1A 2PLCA 1DJZA 1ZCCA 1BQCA 3TU9A 5A6JA 4U5IA 1A53A 3TYDA 2IKJA 3SFKA 3ZO9A 1NQKA 1XIFA 4GOAA 3G0SA 2BHZA 1LWJA 4AD4A 2Q09A 3H4GA 2X1SA 1YYAA 4RK8A 3SRFA 1UP2A 3L21A 3WF1A 4L5ZA 2F61A 4WDWA 3THCA 1TX2A 1XQKA 2PTZA 3ARTA 3EPOA 2L5HA 2Y7EA 4Z2HA 2VQUA 1W3LA 4WOQA 3GDLA 3H2NA 4HMCA 2TYSA 1UWUA 4IG2A 4Y8EA 4Q7NA 3OYZA 3RFAA 1TUFA 4NJHA 4GE8A 3HG2A 3T40A 4QDMA 3NOYA 1QNPA 4AXKA 1JQXA 3NQ8A 3FGCB 3P62A 3BGJA 4GXWA 2P8CA 3WQWA 4IF2A 3STCA 3LTSA 1TWDA 1V93A 4UOJA 3ZR6A 1GYLA 4OGZA 3Q94A 3LI0A 3MKCA 4QCFA 1JPIA 4IHCA 3S2LA 3AS1A 1U2YA 1LWIA 2C71A 1CDGA 3QY7A 2I17A 1QK2A 5CPQA 3GZAA 1AMYA 2TRSA 2E8YA 4ZL1A 2OKOA 3PR2A 5FA5A 3B8TA 1PKLA 3W72A 2GJLA 1R6WA 3MDWA 2BY1A 3LHZA 3NL6A 1G4SA 2YL6A 1E6XM 4M8UA 3W7CA 3E2QA 4GGHA 4Z1DA 1B3ZA 3C0LA 1XHGA 1XCXA 3WQCA 3P8JA 3DGRA 1VFMA 3WF4A 1VKFA 4A3YA 3K30A 3CHDA 1YXCA 1SO6A 2JBMA 4UFIA 4UWMA 3GAKA 3W84A 3NFUA 1L6GA 3QOMA 1RA5A 5FAJA 3N1AA 1RD5A 1W32A 2ZBTA 1W3TA 6TAAA 4ADTA 4YYFA 3MP3A 5A6BA 4Y9MA 4DJEA 3WNOA 1ZJBA 4HA0A 4F40A 4X9SA 1E56A 5I79A 1CPUA 3BAIA 4MKNA 4ORMA 5BU6A 1DHPA 4CVWA 1AW5A 3A4XA 1SGJA 1REQA 4QS5A 2PTXA 4YVPA 1AQHA 2FZNA 3S6DA 4M6VA 3C61A 2VX4A 4M1BA 3UJEA 1EIBA 2FZBA 4W8BA 4L6OA 4Q8MA 4XVDA 3TC3A 5KMYA 4MLJA 1G1YA 7PTDA 4AZCB 1UR8A 5A8PA 1UP0A 4JTUA 1FWAC 1R7AA 3GY1A 4KRTA 1I2QA 5FJTA 3S5ZA 2BTMA 5BZAA 4DLFA 3OGSA 3NEHA 1GK8A 4FNPA 4Y90A 3VILA 1B5TA 1WA3A 4AYGA 2W27A 1AODA 1EJ7L 1Q7QA 5D9PA 2A4AA 3WLNA 2WJDA 1WX0A 3EOSA 5G2IA 2ISSA 4M1RA 3DH7A 2J7CA 3T0DA 2QYGA 1U1JA 1EO5A 2JIWA 2CLOA 2A85A 1NFBA 1ALDA 1SSDA 2HISA 4N7QA 3W1QA 4AD2A 6XIAA 1US2A 3PZQA 4E4PA 2J7FA 1UR2A 4D9PA 1P0KA 3G0UA 4JEQA 3AZRA 1O66A 3URAA 1DORA 4B2DA 4Q4SA 3GFZA 1HP5A 3QBUA 1TSIA 2PU0A 2I56A 4GACA 4UZUA 3RCNA 3U7BA 1A5NC 3NEVA 1KXVA 3LRMA 1TMLA 1NARA 4XWUA 4CD8A 3CUJA 3TJ4A 3OHMB 3BLOA 7REQA 1YQ2A 1E4NA 4NNAA 1EB3A 3M0YA 3NYZA 1C92A 4GPNA 5IRPA 1GZJA 4JHZA 1MO0A 4EIVA 1EA0A 1LG1A 1EL3A 4R27A 3WQ4A 4ZXOA 4KRUA 3LBMA 1PZ2A 2G4JA 3TZFA 3SFWA 4BQ5A 1XUUA 3H53A 3WQFA 4W93A 1OWQA 4ZO6A 2E6DA 4BKNA 3ZT6A 4AY1A 4PTMA 2PCQA 2IPWA 4LUJA 4HSOA 2NXGA 2EPHA 1AZ1A 3TSBA 4EXQA 5T91A 3EWYA 3VKBA 2QCNA 2XGZA 2VEIA 4M7TA 4ZOBA 4BR1A 3KBSA 1RZMA 4QAIA 1ONEA 3PFRA 5B7YA 3MP4A 1NM9A 3CZKA 4E6MA 1KW1A 2PDLA 2Y7DA 1HL8A 3I10A 3P5ZA 1JZ4A 5CC7A 1WDQA 4J3VA 1RVGA 3B9EA 4CNOA 1SPQA 3SCQA 4ICMA 3N4AA 1XLAA 1KM6A 4PCFA 1UA7A 5F2GA 1KXTA 3MP5A 4XUGA 3SADA 3F5JA 1N55A 3TC7A 1KM0A 1G4EA 2YFNA 2IS7A 4IL2A 4GQBA 3WDHA 5AC5A 4GBUA 4ZMGA 5CLWA 4XD6A 1IR2A 3NSMA 4FXSA 1GQNA 3L4YA 4JNYA 3DBNA 3NNTA 3SO7A 1JVNA 1UA3A 5MKGB 3T6CA 4IXHA 1ZSXA 3KBMA 3HG5A 1SJBA 1BAGA 2D0HA 2E6YA 2HXTA 2DJLA 3PF3A 1D2KA 1QPOA 3OVQA 3HG4A 3L0KA 4BHYA 3OTRA 5FKYA 3TZNA 3L4ZA 4IIEA 3WLMA 4EXBA 1QI0A 3T05A 2WYSA 1NQ6A 1KRBC 3BV7A 2HMCA 2ESCA 5BROA 1P6BA 8XIMA 1NU5A 3ATZA 3D3FA 1ISVA 1Q6RA 4EF8A 4HK7A 1ZPTA 4JQAA 1DIDA 5AB3A 4GIRA 3T7VA 2DW6A 2VFFA 1J01A 5D38A 3HGOA 4MB4A 4C6IA 1G67A 3THAA 2PRLA 4KIRA 2AL2B 1AUSL 1VQTA 4C5ZA 1OFOA 4J3XA 5A94A 4S3EA 1EPVA 1UZHA 4MNJA 3DGBA 4H9TA 1A0CA 2ONEA 3SR7A 2NUXA 3OO2A 4QJ1A 1KV5A 3N2OA 4ZO9A 4CNSA 4YTSA 2XJ7A 1FCVA 4DEFA 1LLOA 4TX6A 3VM7A 4LX4A 1FWDC 3EA1A 1V6UA 3JR2A 2DT3A 5SWUA 4WKHA 2J6XA 3A4WA 2EKGA 3B9OA 3VOGA 3PTQA 4IPJA 4K2SA 3VKAA 3VD7A 4HHLA 5CZJA 4FOKA 2AQOA 1BVWA 1TQJA 1VFLA 2SFPA 1XLJA 1C8YA 2NV1A 4JHMA 2NQLA 3G22A 3L4TA 3MJMA 5LGZA 2C14A 5C2GA 1FDYA 1XGEA 3FGCA 3BWWA 3GYCA 4L4MA 3ABXA 2W63A 5HANA 3GIYA 4QG8A 2WWDA 1TV8A 4S2BA 1J0JA 1HKIA 3WMBA 4HVXA 1EF3A 1VIZA 3E1F1 2P53A 2QKFA 3WEOA 1PXGA 5CPNA 2HPIA 1K8YA 3C2YA 5FESA 1Q7MA 1BGGA 2QIWA 2TSYA 2V3GA 4Q22A 5C7VA 4GX8A 4ZVJA 1WDSA 1R2SA 2C91A 4B3KA 1XFBA 3B4YA 4DWSB 2WQDA 2B7QA 4HCDA 1TZZA 2BY2A 1T8XA 1TPWA 4O8RA 4HA3A 3WFAA 4RR4A 3CYJA 1XLGA 1EX5A 1RSCA 4UR8A 4Z42C 4NZ3A 1WAUA 5HMFA 2BOFX 4MGGA 1FH7A 2CWNA 3MWCA 3UG4A 2X41A 3WLHA 5E0FA 2YA1A 3GNNA 4WXYA 1XIDA 3ARSA 3VNKA 1HGWA 2UY5A 3NQAA 1Z9AA 1H2JA 4Q8TA 1RALA 3EEGA 1RJRA 4WJEA 5KZEA 1P5BA 1XDLA 2A5HA 2R82A 4AHPA 3SY1A 1V51A 4B91A 1A5AA 2BHYA 1NDVA 2HQAA 3KZPA 3WQEA 4LCRA 1WV2A 2QCLA 4M7SA 1WOAA 2WANA 5HNTA 4LTSA 1MRQA 5T8GA 4NNCA 5CSRA 3FYPA 4KW2A 2PD5A 3GXDA 1YDYA 3O0KA 2VWSA 3OA3A 1GQLA 1H61A 1OFBA 4PULA 4DM2A 2DUAA 3MZ2A 1W2PA 3KTCA 2OT1A 2PODA 3QC3A 1VJZA 2CNCA 5AYIA 2F6UA 4Q33A 4AZCA 4AZGA 2OZ8A 1A5UA 5D37A 1F6YA 3P2VA 3RM4A 2ZUUA 2ZXBA 4MKSA 3QHMA 2GJNA 2OQHA 1POJA 3C8NA 4MJMA 3GBDA 2PTDA 4BWLC 4XQ6A 1F2JA 2HDJA 4CD5A 1FKWA 2BVWA 2ZOXA 4TVUA 5A6TC 2NWSA 2NX1A 2GFTA 4D6FA 3H7RA 2PTYA 3LPOA 2O7SA 1G7UA 1NSJA 3UA3A 5AC7A 3IGHX 1QU4A 3S2NA 3V1PA 4BFAA 2NSXA 2XGBA 4FAMA 5FJRA 1R3VA 5ABEA 3VD9A 4D72A 2E7FA 4GI6A 5KZ6A 2G3NA 3W2JA 2WMFA 3KBWA 5D8ZA 3QR0A 2VFDA 2GLKA 4MB1A 4C6BA 4DO6A 4LS2A 2V3EA 1KFBA 4HYVA 2Z4GA 4WUIA 1LL4A 3KL5A 3A9BA 5AVNA 2DQWA 2OPJA 3CZEA 2BGSA 4LH8A 4NAEB 4L1XA 4I90A 2DZXA 2HVMA 2BG5A 2OO6A 4FOJA 4X22A 3VA8A 3N18A 5J5RA 3DESA 1EXPA 2WKGA 3H23A 1V6VA 1QPQA 2CKRA 2YKKA 3BUVA 1XKJA 2DORA 2GVJA 4E3TA 3OG3A 2OJPA 1DKWA 3NL5A 1XG3A 1GJWA 3E0LA 3QPZA 3TWBA 3BPWA 2O4QA 3QYSA 4LAZA 3TP4A 2Q8ZA 4YU1A 2VZOA 1GQKA 1OC6A 5IBXA 3GC4A 3MDUA 3NM1A 1YDOA 3ZR5A 1EFZA 4WGHA 2J78A 3LSCA 1JDDA 4B3LA 2PMQA 1E0UA 2P50A 2WZHA 3OB8A 4YL2A 3U5UA 1VD6A 3NSXA 1QTWA 2HTMA 4YNGA 1TV2A 2J7EA 2YXGA 3N2BA 4BQ3A 4WQ6A 3A9IA 3MHFA 3QLLA 4LWWA 4GXPA 1Q4NX 2V67A 5BWAA 1V3MA 1XH1A 4DAIA 5HUOA 3WUBA 4MHBA 3F2DA 3TA6A 3MO4A 3DU0A 5FF7A 3UBPC 1VS1A 3LCFA 1QI4A 1YPIA 4IMCA 4NZ5A 1J0ZA 1S2WA 3GG0A 3W1PA 3DOPA 1TZ9A 2QZRA 2C0HA 3OBEA 3HFTA 3L2IA 3FA5A 5MKGA 1EP2A 4AY8A 1AL8A 1V0LA 2VELA 1DTNA 2E0PA 4QNEA 4BQ2A 3BOFA 5RUBA 3L68A 3AUJA 1Z89A 1A3HA 3W1UA 5EL1A 1FHLA 4DUXA 2XTKA 1POKA 2JEQA 2J9XA 1RY8A 3FJLA 3EPMA 1W31A 2REQB 3BL3A 2A6NA 2C1IA 3C6CA 4DZ5A 4QX4A 1D7FA 1TR9A 2WJEA 5KITA 2WMJA 3C4UA 1N8WA 4GYJA 5DFAA 2CYGA 3CBWA 4JTSA 4IWWA 1OQFA 5HJYA 3MCOA 2EAWA 4EX4A 3L67A 3VYLA 1J11A 2ATMA 4KMQA 2JGQA 2VD8A 1XFCA 2AL2A 3R4IA 5AZ0A 3RDKA 1AQFA 3O9NA 5CXPA 3P60A 3G1YA 2C18A 2O9TA 3N04A 1Q8AA 2QJNA 4O53A 4K8HA 1I0DA 3UESA 3EBVA 5BMWA 4KQNA 4G1NA 1LT7A 1VAHA 1XIGA 5D02A 1OHLA 1J12A 4TX8A 5D30A 4GYPA 3NO5A 3M0IA 2NQ5A 1GG0A 3VCNA 3BAYA 3DFHA 4OQVA 4GRSA 2R94A 4IX2A 3W1AA 4I6KA 1GQIA 2WNWA 2CEQA 2OYMA 3S1WA 4CKQA 3E2SA 5LNUA 1FWSA 5C55A 3CWOX 4U10A 2Y0FA 3EX1A 4PB4A 1K7FA 4QLLA 4PH6A 1V3LA 1NTHA 1X38A 1GOIA 4C6QA 3CL6A 2WNNA 3VMPA 2WSRA 1ENUA 3WH6A 3RPTA 2GUBA 2DJXA 1G7VA 4B5SA 5BOEA 3VFLA 2XSBA 1SJCA 4O4VA 2Y5SA 4QFUA 4TTUA 4AXNA 4DJFD 4O52A 2CHNA 4B9ZA 3GXPA 1TTJA 3PB0A 4DWSA 1HGYA 3YPIA 3C2EA 4ATWA 1FWEC 5JIPA 4WKAA 3LGGA 5FCZA 1YDNA 3FJ4A 1Z44A 4PODA 8TIMA 3I6TA 2X0YA 2FDMA 2YJQA 2WM1A 3VD4A 3N34A 3MA8A 3W2LA 1VRXA 4ZB0A 3E0IA 4UTUA 1XRSA 5I77A 2CPUA 2H90A 4JTEA 3GHTA 4WY0B 4V2XA 4CQDA 3LLXA 1KC7A 3GDMA 1UIPA 1DJHA 1TV5A 3CV6A 4JNMA 3M0ZA 4QIUA 4H2HA 1MDRA 1YW1A 1I1XA 3FOKA 4GD0A 3CB3A 4RE4A 1UH4A 3THUA 4LBSA 1C93A 2J7BA 3KHJA 4LVFA 4W7VA 1FBAA 5CZTA 5C71A 1US0A 1CBGA 4XD5A 1KCZA 1DEDA 2PWUA 4FOUA 1Z3NA 4KBXA 2VRKA 1GOMA 3UNTA 1KTBA 2BMBA 5HR6A 3TQPA 2FTPA 3TCSA 1YIXA 2FH8A 3TEVA 1OIFA 3FEQA 2BVYA 1RXOB 2XINA 2PGEA 4J7RA 4DWDA 1W5QA 3GH5A 4ES4A 4TU1A 3CQKA 2HE5A 3KOWA 4DF0A 3EWXA 2ZUWA 3RAOA 5HQMA 4PB5A 3CZJA 3ZSTA 1ZBWA 3EXRA 3URNA 2YBTA 3VNYA 2A3BA 1K77A 3TV8A 1TPH1 6XIMA 2Z7GA 4DBSA 1PKYA 2YYTA 5EFDA 1W1PA 3POCA 1MVYA 5DCBA 1KTCA 3PSVA 2TMDA 4N02A 4W9TA 3WNLA 2VTFA 1A4MA 3ZVIA 2XIJA 2QAPA 1NDZA 3HV9A 1UD2A 3RRXA 3RMJA 1XI3A 4FNSA 3NQMA 2ACUA 3TYUA 4GQRA 3MSDA 1UP3A 2ODOA 4JPGA 3OBAA 4NAEA 1F7BA 4LV9A 3KAOA 3BOXA 5GPRA 3QY6A 4PYSA 3ITGA 4FX6M 4KEUA 1SZRA 1DQUA 5LNRA 2GQ3A 3IWPA 3ZWSA 1PEZA 1V79A 3ZJ6A 4LS1A 2A3HA 4JNZA 1J0HA 1R3TA 2GL5A 2G0WA 4R9XA 5CBIA 4ZODA 3NCOA 1Z32X 2FB2A 2ON3A 3KBNA 4DXXA 2HK1A 2ZZ4A 3GTFA 2YDRA 2A3AA 2GWNA 4NXKA 1OBAA 4C7FA 4MJ4A 4EPBC 3APYA 2X40A 3O6YX 4NXSA 3W70A 3KLKA 4PTVA 4DZHA 3SIZA 2OFJA 2Y24A 3NQFA 3CHVA 5I09A 3CPRA 2ZDRA 7ENLA 1GOOA 3LX9A 3W7EA 1O12A 2ZRZA 3DFPA 4JEJA 4MDOA 3DKLA 4PN2A 3P6LA 4AHOA 3S46A 3WYZA 2BGQA 3IVSA 1HQTA 5CG7A 2FZ8A 3S9IA 5CPTA 4RZ4A 4GVFA 3AIQA 3KCJA 3TLLA 3PBYA 3FA4A 2VHLA 1F4AA 3APGA 3A23A 2XGIA 1NWSA 1S2UA 2XN0A 2HRWA 3PANA 2HBVA 3AS0A 1E6PA 4H9VA 3UCCA 4GYKA 1KFKA 3KRZA 1WZKA 1UQZA 4CN1A 3KVLA 3M16A 4FF5A 1EKOA 4U33A 1BKHA 3R2GA 3GDKA 3LDVA 2IKIA 3VMNA 3T08A 2DIKA 4P5UA 3H12A 3DBPA 1JJKA 4N4PA 4CGTA 3APTA 4F2TA 1H0GA 4EWND 3HU7A 3HO8A 3LNMA 4QBXA 3THDA 2GGEA 2O92A 4O18A 3AMKA 4P7LA 4KCWA 2VFEA 4LUYA 1BSIA 2CESA 1R38A 3SRHA 4LV4A 1RLCL 3QXBA 5U4NA 3DAQA 3UR7A 4DM1A 1OFDA 3KX6A 3IACA 1WBHA 4RE2A 3LMYA 2REQA 4FALA 2BHUA 4C6CA 3EOUA 1WOBA 4UUIA 1T96A 5I2UA 3RITA 1J9YA 3SB0A 1NDWA 1P0DA 3AWOA 1XYCA 3OW1A 3WNPA 4Y6GA 3K2GA 3VIJA 1HW6A 2HV5A 3CHFA 3VI2A 1VBRA 2E9MA 3WQ6A 1JCJA 3CUFA 3DHPA 3ENLA 3FKKA 3UR8A 3MYOA 4CNTA 4HNVA 4BS0A 3U2ZA 5H91A 3LRLA 1GKQA 1NELA 3GW3A 4GZEA 4Q4KA 1LM1A 4AB4A 5GNXA 1IT7A 3N4FA 2Q3RA 1ITQA 2GYIA 3LGEA 2J24A 2Y7GA 4F0LA 1VP5A 2ZA1A 4UQAA 3QW3A 4RX0A 4DBDA 2G37A 3MBFA 3QEZA 5JBDA 4LCQA 1UQYA 3N2MA 3L12A 3W07A 4NJJA 3KP0A 3EDJA 3T42A 3VCCA 1MWOA 3OGRA 5FSEC 3TNOA 4O19A 1OFPA 4GO8A 1HP4A 2BDQA 3NR0A 1ICSA 4K8EA 4F0MA 4PCPA 3QZAA 1VLIA 1TJPA 4LRTA 2R9RA 3UVAA 4NI8A 1XIBA 1AW2A 1J8VA 1YPXA 3RLHA 4H9XA 3I65A 3S5NA 4DXVA 4H9UA 1W5MA 1WE5A 3MT1A 4CQ8A 4H1ZA 4OTKA 3DYOA 3TTQA 3DENA 4ALDA 1M65A 3DEQA 4MYXA 5AHMA 4DBEA 1SZFA 1VFUA 1P6CA 2OX4A 4Q7IA 2YB4A 1QHPA 3N13A 3WENA 1FWBC 4LCSA 3GXFA 2RAGA 2CZEA 1FP8A 3VM5A 1YNQA 2FVLA 3I6EA 1MUMA 4XO7A 3W88A 4WOZA 5C9UA 1VENA 1OC7A 1GVSA 1GJPA 3BK0A 3FIGA 1TJ1A 3AYVA 3K4DA 1S5NA 1DYSA 3F4WA 1CX9A 3H6OA 5B7ZA 4HYRA 1RCQA 4X9YA 1OYAA 3ELFA 3LHYA 1RR2A 2VDIA 3RPDA 2CHOA 1HG3A 4FNUA 3IJDA 1FHVA 3VDGA 1EZWA 1CGVA 1XIIA 3W2UA 3W7PA 4O28A 4WY0A 1CGWA 4XTDA 5D2YA 3H22A 2Q71A 3FVDA 3V35A 4W8LA 1XIHA 3T0CA 3UP8A 4LT9A 2WC3A 1XDMA 1F4HA 1RJPA 1SW3A 4A2RA 3RLVA 4JAWA 4UTWC 1THFD 4GNKB 2NV9A 2J79A 3BARA 3DN5A 4F2UA 1GOQA 5K2ZA 2Y70A 3PBVA 1V5XA 3NGJA 2P10A 1ZTVA 3BQ5A 3HQ1A 2Z2UA 1UWRA 5GJNA 4GI9A 1LT8A 1KQZA 4H6RA 1OD8A 2ZXAA 3R0UA 2G4FA 4PZVA 1MSSA 1GYMA 5M3WA 3QHNA 3J7HA 4LSBA 4YWSA 2BS9A 5CGQA 4E8DA 3SAZA 4H2CA 4GI4A 4ROPA 3VGFA 2YLLA 1RBOB 3Q65A 3VE7A 3EB4A 3PWIA 1DBTA 1V02A 1ISYA 5DT5A 3OVRA 4GJJA 1TPDA 4HNUA 4JY8A 1DE5A 4LEQA 1ZFJA 1P1XA 1SO4A 3V5OA 1W3KA 3MSRA 1FOBA 4FEZA 2PC4A 3PP7A 2NVDA 3RRAA 3ABOA 4ZQPA 4ORIA 1X7IA 1NOFA 1N82A 1SFLA 1H4PA 4Q32A 4MY8A 5LGXA 4CNNA 4FNRA 1C8QA 3UF9A 5I3IA 5I07A 1OT1A 4HT3A 2XSXA 2XM2A 4BJHA 2DH2A 1B1YA 4QG6A 4OUIA 2OGYA 1IEVA 3GXNA 2NZLA 3P61A 4XZNX 1US3A 1R3SA 3QV8A 2I14A 4FSAA 2LLEA 2I7GA 3BSHA 1IXNA 3LN3A 2GPTA 3FYYA 2Y8UA 4O50A 2X30A 4FNTA 4PL1A 1TQXA 4LVBA 1TTQA 2XIIA 3MW7A 3KVJA 1DJGA 2J8TA 1WYIA 4QR6A 3JW7A 1U83A 2R1MA 4AF0B 4AY7A 3W38A 1FDZA 2ASHA 1H09A 3XINA 5EFFA 3W1TA 2BY3A 3N12A 1KLZA 2P0IA 5ENLA 1Y5VA 4PRTA 1QHOA 4AZHA 3WEZA 1TIWA 1UWIA 2HS6A 4KIEA 1RV8A 3IIXA 3V7PA 2QJMA 2XH2A 1WDDA 3M44A 3M6DA 4IMFA 2QW5A 3B04A 2DT2A 3KCOA 4QM1A 3BE7A 3U6WA 3GKAA 3EOLA 3SGZA 3CL8A 3IV3A 4DNMA 3UYIA 1E1CB 3STPA 4XAPA 1VYRA 2FYMA 1E5NA 2WHKA 4CVUA 2FGBA 1SUXA 4K68A 2FFIA 4OKDA 4UNLA 2W62A 2A2IA 2VT0A 4NILA 4GWEA 4Q8UA 2W5FA 3UWVA 5A5WA 5I3DA 2XYLA 4A3UA 1CIUA 2QMJA 3VNIA 4ZGYA 3UERA 1HJVA 4ZFMA 5AZ1A 3H21A 5I3FA 5JQ9A 1YE4A 1TPFA 4Q4PA 2MNRA 4RXGA 1ONRA 2G97A 2QPUA 3W01A 4JTFA 5EY5A 1CLKA 4PTXA 3VE9A 1R3YA 3A13A 3L65A 1LWHA 1B9ZA 3RN6A 3PAJA 4O14A 3MI3A 2QNEA 4HTBA 3GTHA 5FEZA 3HFYA 2GQ8A 1FDJA 2YCKX 2G95A 1M03A 5DBUA 1LBFA 4LYRA 3LLDA 4FLSA 2W3ZA 3E96A 3CMGA 2DIJA 5FEWA 5HINA 4O16A 2QMKA 1RP9A 2J75A 2PLKA 5A6MA 2V81A 2WK2A 3CO8A 1BHGA 3PJUA 3UJFA 2GGGA 2A0NA 2HZGA 4CU6A 1Y5WA 3W7RA 3QFEA 4IP7A 1Z6KA 3WFZA 2DSKA 3A3WA 4K39A 5LKYA 2J8GA 2X16A 3NZPA 3TYCA 3KXQA 1H49A 5EBAA 2ZRVA 2VMFA 4TTGA 3QV9A 3QR3A 1Q6LA 3TJLA 6ENLA 4IOTA 5CSUA 3P5YA 2PWFA 4MOZA 3VDBA 1R9YA 2P88A 4X2RA 2UV8G 4Y9NA 1AL7A 2F7FA 2GGHA 3RU6A 3ARZA 1D3GA 1RJQA 3A12A 1FXPA 4LXFA 2PZNA 4QE5A 1DOSA 4HNCA 2AAAA 2VJXA 2VI0A 2PGWA 1FWJC 4HZMA 1L9WA 5KETA 2OQYA 1Q6FA 3FK4A 3VIMA 1SZGA 1XD0A 1G4PA 5DRIA 3CUXA 1I2NA 2QJGA 2Z24A 3ERPA 1W17A 3LM7A 3UXAA 5BW6A 3ZLHA 4XB3A 3RXZA 1VYSX 4MZ8A 5T9BG 1E9IA 2VGGA 4FI4A 1LTDA 1ZLPA 2VR4A 4KWVA 1OINA 2MUCA 4LQ1A 3P14A 3W7LA 3GE7A 4ZE4A 3NO1A 2J62A 3IPWA 4UQEA 2CLHA 1TG7A 2CCRA 2FKPA 3QW4B 2A3EA 4ONVA 1XICA 3UETA 2FZMA 2YA0A 1MEWA 1WP6A 1BFNA 1TKKA 5A8GA 3COTA 4UFKA 2WXDM 1HVQA 5FJUA 5A3HA 3W73A 1A5MC 3HPSA 1JZ8A 1V0KA 3IGSA 4GCXA 1UKOA 1XYBA 1ADOA 5BXSA 4DZAA 3S4TA 1NP2A 2HSAA 1S1PA 4ZR8A 1JIBA 3K1DA 2E77A 3T0AA 4L7ZA 3M64A 3OZMA 1S2VA 1WDWA 3G18A 1UWSA 1NOWA 2AQVA 2YCLB 3ARWA 3AROA 3GVWA 4JTLA 1GEQA 1J0IA 3GZ3A 3QQWA 1V4YA 4X60A 3L4WA 1JCLA 3R89A 5BXRA 4I9TA 3AHXA 3AYRA 2CC0A 3OQ8A 3MUXA 2XZ9A 4HSHA 3KBVA 4PMZA 3QQ1A 2VC5A 3F4DA 4GVGA 2TAAA 4JL1A 1Q13A 2BY0A 3GR7A 4X0NA 3DCPA 2PWDA 3ABZA 4J40A 3N6HA 3WY1A 3RILA 4R7JA 5FEXA 3W7IA 5K9CA 2GUUA 2QCDB 1IF2A 2HVNA 1XPGA 2C15A 2E8ZA 1K4HA 1KFEA 4AVOA 2B4GA 3WUGA 1CEOA 3FAXA 5XIMA 4JS3A 2O7QA 3IARA 4YXGA 4N2YA 1AH3A 2CLMA 5D05A 2IQTA 4GC4A 1S5TA 3HZ3A 3AI0A 2Z00A 3EOEA 1H7OA 3E9AA 1W3HA 3IGXA 5JIWA 3HGSA 4DJDD 1E5JA 3TW7A 3QSTA 4Q4QA 1CTNA 1JR1A 3LSBA 1XS2A 3CT7A 3USBA 3G1HA 1DP0A 1V6YA 1OT2A 4AZIA 3M46A 3PBGA 3ZR4A 2PA6A 2VYOA 3EZ4A 4N9CA 2XSAA 5BOFA 4PCSA 4XIAA 2X1IA 3HIJA 5E70A 4GIEA 1GT8A 2CLKA 2V3DA 3C2RA 4Z2GA 1PUDA 3IJQA 1SR9A 3EX3A 2RKXA 4DWSD 7ODCA 4ICCX 3FCPA 4C6PA 1M04A 1JPKA 1MNZA 4AIOA 5G5IA 3BTNA 4W4QA 4DO4A 3B0VC 3GTIA 3SQSA 1QNOA 1TE1A 1S2AA 4LPCA 3R6IA 3EAUA 5AN7A 3RNDA 1VH7A 2P76A 3W86A 2OG9A 4FXRA 3EX6A 2BB0A 2VGBA 2WVSA 2QUVA 3LU2A 1JF6A 1TMHA 3G77A 3SCTA 1VBUA 3IJ6A 1XRVA 4W7WA 2DUZA 5LA0A 4HNNA 2E1DA 1KWKA 2B7NA 3WSUA 3INPA 4PUDA 3DYMA 1Q5MA 3RCYA 5C7HA 5FF3A 1OCNA 1EIXA 2V38A 1E9ZB 4JFUA 4QGCA 1BG9A 4L64A 2QDHA 1PB0A 3VVGA 3CC1A 1KD0A 4HPGA 4IISA 2J6VA 1V6TA 3ECQA 1UUOA 1E4IA 2OMAA 1O5KA 3AXKA 3W7JA 2WJZA 2CBVA 3F4VA 1BXNA 4I5UA 1EHAA 2BOEX 2FDSA