5G4EA

S. enterica hisa mutant d10g, dup13-15, q24l, g102a, v106l
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
220
Chain Sequence
MIIPALDLIGGTVVRVVRLHYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTALKSPDVVKGWFERFGAQALVLALDKQVASGVSLEQLVETYLPVGLKHVLCTDSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 66
structure length 220
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4eA00
4M6PA 4RK8A 1LOLA 1W5OA 2JGQA 3VI2A 3KRUA 3Q37A 4HPXA 1YDOA 1PS9A 2X1TA 1W1ZA 1VCGA 4RXGA 2ZA3A 3T55A 2G5WA 5G1TA 4HKPA 4JTKA 5EA9A 5H91A 4TX9A 3NA8A 3UY8A 3FYOA 3D0CA 3W7JA 4DEFA 4YL2A 4EF9A 1GVFA 1H7WA 1SU5A 3NZRA 1YXCA 3EWWA 5IBXA 1BWLA 3TAKA 2QUTA 4DF0A 3PR2A 5CZJA 3S5OA 4NQ1A 1K03A 4NUWA 3VCRA 4UFKA 5HWMA 1JULA 3G24A 3W70A 4UTWC 3TU9A 5D05A 1LOSA 4X9SA 3GAKA 3FOKA 2E5BA 1DV7A 2YYTA 3GNDA 4FNQA 3QRHA 4IQLA 1TPH1 2C13A 1QNVA 1L2UA 1LBLA 2VFGA 4LTSA 3O6CA 4AAJA 3SGUA 1OFAA 4BI6A 4OV9A 4MZYA 1YPFA 1T99A 3VE7A 4MZ1A 2A2IA 3NM1A 3NYZA 3OHIA 3W7EA 4UTLA 3DFTA 2QJGA 5AC7A 3CHVA 4AHPA 3B06A 1G4EA 2E1DA 2E5CA 4NJIA 1QPNA 2CZDA 5U7SA 3LLFA 4GXMA 3EX2A 4UFHA 3S1UA 4OV4A 2YX0A 3HPXA 4GE8A 3QPZA 4Z1CA 1B4EA 2DORA 5AFDA 2X1UA 3LERA 3PVFA 3QMSA 1LROA 5K3VA 4A21A 3TE9A 1XUUA 3O6YX 1SZNA 4K39A 5FF3A 4UTTA 4HN4A 3W7GA 3L2IA 3HGRA 3STCA 1TTIA 1KFLA 3LI0A 4LV4A 5C2XA 3E49A 1VCFA 4IX2A 1R46A 1G4SA 2OX1A 2QR6A 2ZA1A 4YCOA 1QR7A 3UZJA 1LRNA 3PUDA 5F4WA 1SUXA 3ELFA 3GIYA 4MKNA 1OG0A 4KFPA 4XKYB 2C1HA 4MJZA 5CZ0A 1VYPX 3UWUA 1VYRA 4OU1A 2RFGA 3LGEA 4E0CA 3QSRA 2PRHA 1QMLA 5D2WA 5DY3A 4NX5A 1TV7A 3W7OA 2C6QA 3TR2A 3KXQA 1H63A 2Z1BA 4HT3A 5A5WA 5D2VA 2ZZ5A 2VFDA 5AC8A 4XTDA 1E51A 2G96A 1AW1A 3LHUA 3LCWA 4BF9A 3A21A 3W1MA 2JKEA 1T0OA 2ZTKA 3O16A 1D3HA 5FF0A 1K7FA 4Q32A 3QQ0A 2WSYA 3NPWA 3H54A 1GTEA 2V82A 3BLIA 3GVGA 3ABQA 1GVRA 1PV8A 4LS1A 2GVGA 1FCUA 4P61A 3DKJA 1XL9A 3EKZA 3WFAA 2X2GA 3VKJA 4E38A 4XWUA 3T78A 4CCDA 2VEMA 4IPIA 1F7BA 1WOAA 2G95A 3GDMA 3TSBA 2Z2UA 4JX4A 5BRBA 1XBZA 3RK8A 2F7FA 5EYWA 3TJXA 4AF0A 5T26A 3NM3A 5KMYA 3PY2A 2E6DA 1EP2A 1JRCA 2ZYFA 3OVPA 1H61A 2GJNA 4FNRA 4GBUA 3EEGA 1DHPA 1KV8A 2DJLA 1YXYA 3W84A 3NQMA 1VR6A 2H90A 1VH7A 1OABA 2A5HA 4OBTA 3TFCA 1TQXA 2X1RA 1F74A 4FIRA 3QPYA 3I68A 4NJGA 1GJPA 3TIMA 1AG1O 2XN1A 3LRKA 4X22A 3C2EA 5G2WA 1ZHAA 3P7YA 3GLCA 4CLMA 2B4GA 3GZ3A 1H7PA 1YYAA 1O4UA 1LLWA 4O14A 2RH9A 4OGZA 1DKWA 2JGYA 3TQ0A 3DFNA 4K37A 3NO5A 1VGAA 3TX9A 2DZWA 2CZFA 4K36A 2OCZA 5FEXA 1EPXA 1M6JA 4WXYA 3I65A 5TIMA 3QZEA 3PBUA 4NU7A 3JRKA 4NZFA 4X3ZA 5AC6A 5DCBA 3EXRA 4P2VA 4AB4A 3O6DA 2O7QA 4X2RA 3ABRA 4M5PA 3A5VA 3KRSA 2GPTA 4R53A 4EVZA 3UYCA 3LRMA 5DCDA 3T44A 4FX7A 3S0CA 1ICSA 1YDNA 4LV9A 3STEA 4JTSA 1BKSA 3CT7A 3NQ2A 1X6UA 4ICNA 3W86A 3TJLA 5C54A 1IGSA 3WJYA 4Y9AA 4DPPA 1OYBA 1ZAHA 2J27A 1X1ZA 4KFNA 2JBMA 2WNNA 1HFBA 3BW4A 2NLIA 3BGGA 5EY5A 1S3HA 5SWUA 3QMRA 3C61A 3LHZA 1SZGA 3TMLA 3W88A 5KZMA 4S2BA 2Q3OA 1WA3A 1F2JA 2ABAA 2QKFA 3W2MA 1NEYA 3CEUA 4ORIA 5CSSA 1OFDA 5D38A 4DPQA 2RHGA 5EPDA 1S5TA 3NQDA 3TK7A 4ORMA 4O54A 3QQ1A 4CQ8A 3HF3A 3TXZA 3W71A 1TPB1 2VELA 3IIVA 4UMAA 3G1XA 1A5BA 2QAPA 2NX9A 1XBXA 3W2JA 4TO8A 4ZMGA 1NAL1 2J9XA 3S5ZA 4ZQPA 4AWTA 3HPSA 3LCFA 2VKZG 3W1AA 4JGDA 2V81A 3FKKA 4AWSA 1GWJA 4JTEA 3W1RA 3TW7A 4UNKA 4AEOA 2C18A 3CWOX 3HGSA 5HMSA 3STGA 4MY9A 3LBMA 4MLRA 3NG3A 3WK2A 5AHLA 5D37A 2QCCA 4DBEA 5LHEA 4ZQNA 2G97A 4K38A 5G2HA 2XFWA 1WX0A 2ZRVA 5K9DA 1XFBA 1K8ZA 1O5KA 3R12A 4ZVJA 2Y89A 4JEQA 1SZFA 2TMDA 1W31A 2H8XA 3DI1A 3TQKA 3LLDA 3QC3A 3PBYA 1I2RA 1FWTA 3W23A 1W37A 3L5MA 4ML9A 5AHFA 2ZZ3A 1BWKA 3MI6A 1RQEA 1AL7A 1LP6A 2VFIA 3OVQA 2DP3A 1EIXA 3GR7A 2UV8G 4MUZA 3UWZA 1PHQA 2ZQ0A 3EWXA 4S1FA 2TRSA 2VEKA 2B7PA 3C8FA 1YDVA 4L4LA 4O4VA 4RZ6A 3B03A 3MW7A 3RLUA 4MY1A 3NQCA 1CX9A 1OYCA 1H7OA 1WBHA 1G69A 3H55A 1ZAIA 4Y90A 4OQVA 1NF7A 3T4CA 3DENA 1TTJA 3BK0A 1R47A 5BNKA 3IEBA 1OJXA 1WBJA 4NNBA 4POCA 4RLIA 1HO4A 3G1AA 1OK6A 1XBYA 2Y61A 1JUBA 2JKPA 3W7PA 4O8RA 2NXIA 5I3GA 4JTUA 2I14A 3N9RA 4O18A 4FX6M 3KAOA 1B3OA 4LW7A 5HJLA 4Z1BA 3ZWSA 2ATSA 3W7HA 1T8XA 3NQ6A 1ADOA 2J6XA 3CC1A 1OX4A 3M1ZA 3N73A 2DZVA 4YXGA 4K8HA 3IVTA 4MFEA 3TKFA 1KM3A 2OMAA 4WUIA 5DXYA 4B5NA 5EBUA 2V8ZA 1JJKA 4OT7A 1MEHA 2ZRYA 1FCBA 3INPA 3NNTA 1GG0A 4NVTA 2CLEA 1EA0A 4UXDA 1B4KA 3QW3A 4NJJA 1QCWA 4Y6GA 2HS6A 2DZPA 4UFMA 5EMUA 1LZOA 4LRTA 4W9TA 3W1QA 1W3NA 1EWEA 2QCNA 2ZCGA 3Q58A 1DBTA 3C3NA 3O63A 1H62A 3DFOA 2C14A 2Y62A 4JTIA 3M9YA 1WV2A 2E77A 2YDAA 5FF2A 1W8SA 3U2OA 3NOEA 4JDYA 3PSWA 4BR1A 3W1UA 3B04A 1EP3A 3QW4B 4MZ8A 5CPLA 3HBLA 5CZSA 3RMJA 4RX0A 3DHFA 8TIMA 2FDSA 1JCXA 3GDLA 3EWYA 1MEWA 5K2ZA 4DO4A 3DI0A 1P4CA 2NX3A 4XQ6A 1FCQA 2V9DA 4O52A 3RF9A 1W3IA 1NFBA 3W7CA 4JICA 3NQGA 1A53A 2VXNA 3JS3A 1GOXA 3M7WA 4EOUA 1LDCA 1SZEA 3P74A 1XC4A 3NPVA 4S2CA 3HO8A 1HO1A 3G1FA 1WAUA 5I3IA 4IMDA 3WK3A 1TV8A 3SIZA 1KM5A 3IGUA 1H1YA 2E6YA 3UQNA 2GVLA 4HNVA 4WY0B 1I2QA 3HMJG 4AMAA 1TPFA 1W5QA 4IMFA 2NV1A 4O17A 1CI1A 3NL6A 3NR0A 3TQVA 3HOJA 3FYPA 4TR9A 4Y96A 4MIMA 4Q33A 2QAFA 2ZRXA 3EX6A 3L65A 2AGKA 1LBFA 4LVDA 3B0VC 4U4MA 4XBKA 1YTDA 2OJPA 1KM2A 3LRLA 5FI8A 3H53A 2Z6JA 3IGXA 4FXSA 1ME9A 1VZWA 4N6EA 5CKSA 2V5BA 3C2FA 1FXQA 3R89A 2QDHA 4XBSA 5FEWA 4ZQCA 2WSRA 5FEPA 2QCEA 3LHWA 4LT9A 4NJKA 3HG2A 3E0IA 1KA9F 2W79A 1AW5A 2RDWA 5DBUA 2YYUA 1AL8A 5H2ZA 3W22A 1F76A 3E02A 5HR7A 4GUFA 4Q4KA 3S5YA 3LTSA 2V2CA 4JYDA 4MYAA 1VHNA 1DQWA 4UTJA 5LZLA 4UIOA 3B05A 1QPOA 1XDLA 5E93A 3DKLA 4D2JA 1V5XA 4OE7A 1O5XA 3N14A 4PL1A 4CQAA 3P62A 3L0KA 3EWUA 4IPJA 2ISVA 4M7TA 5G1YA 5K4XA 4ZQRA 1FX6A 1JR1A 5DELA 1U5JA 1G4PA 2BWGA 4PTNA 4NJHA 3TH6A 5AHIA 3W2KA 4O13A 3UWWA 3NDOA 4E2DA 3PULA 4WX2A 2GOUA 4MY8A 4HIBA 3W6YA 1SR9A 2YFNA 5HUPA 4JTLA 1R2RA 1IF2A 4LY8A 4LVAA 3GXNA 3RLVA 3TC7A 3WJXA 1P1XA 2XN2A 4CNNA 1TPWA 4LRSA 1GTHA 4GJ1A 1W5NA 1S5WA 4GNJA 1N8FA 1KFEA 3E9AA 2CZ5A 2VEPA 3Q94A 4O16A 1G6CA 4WZHA 5FESA 4DF1A 5K4ZA 3OBKA 3QH2A 4IMGA 5HULA 4OHQA 3GK0A 4AHQA 4E2BA 3PG8A 1R30A 3M6YA 3HG3A 3P67A 1WOBA 4N9EA 1EUNA 5U4NA 3FFSA 3HG4A 5D2XA 5TQLA 2J9ZA 2GQ8A 2A0NA 5DY2A 1EUAA 4O11A 3SECA 4FX8A 1XI3A 1GT8A 3S1XA 2FLIA 3G3DA 3L0NA 5D09A 1TPUA 1JRBA 1NSJA 3GNNA 3TXVA 2PCQA 4IXXA 1G67A 2ZZ4A 3TCEA 1VQTA 3PC0A 5HUOA 3S6DA 3QMTA 3ZR4A 3C2VA 2EPHA 3G0SA 5DN1A 5LNSA 1W54A 1S5VA 4LNYA 1H7XA 5LNRA 2HS8A 1IIHA 1XBVA 2QCDA 3MMTA 3V1PA 4QM1A 4RZ4A 2CLHA 4GC4A 1UASA 1TMHA 3C52A 3HPZA 1ZY9A 4NNAA 4KKXA 4JTTA 1L6SA 1DQXA 3V75A 1DJNA 1Z41A 1SW3A 1Q6OA 3UD6A 3L21A 5AB3A 3C0JA 1ICQA 1G7VA 5CPMA 3G0XA 1LRTA 3BLFA 3HGOA 4DXVA 1JCNA 4Z1AA 1D9EA 4L4MA 2E68A 5F4SA 2PRMA 5BW6A 3UPBA 4N6FA 4PEKA 1BTMA 1MSSA 3NL3A 1EP1A 5HINA 2FQIA 2A7NA 5EL1A 1WXJA 3DBPA 3A5FA 5HR6A 2D73A 2NX1A 1L9WA 3R2GA 2ISWA 4MJMA 4NXSA 1FBAA 4QAIA 3MHGA 1A5AA 4O1AA 3UWYA 4UUIA 4G1KA 1TJRA 5G5IA 4R33A 3I7RA 1ICPA 1C29A 1TV5A 4CNPA 2ZZ6A 1G4TA 4UMCA 2OT1A 1ZALA 4NZJA 2YW4A 3W7QA 2Y7DA 2QJHA 2YR1A 2V0TA 1KW1A 2GUUA 1XKYA 3BW3A 1PIIA 2RDTA 2C0AA 4UTUA 3GDRA 1CW2A 1KM0A 4UCGA 2J88A 3M5ZA 4FHAA 4O53A 3IIOA 4NX0A 3Q2DA 5CG7A 3WJZA 2H3BA 2YCEA 4TU1A 4AF0B 3GAYA 5LNVA 1X8FA 2E09A 2QCHA 3M16A 4WY0F 1W5PA 4WXZA 1QO5A 3LXCA 3SI9A 4A3UA 2WNQA 1VJIA 4IXHA 1KFCA 4M7SA 5FEZA 3CTLA 3YPIA 2R94A 1KFKA 1JCYA 2KZHA 2W0UA 5J5DA 1UB3A 3LTPA 5D2TA 5DLCA 1QPQA 3W2LA 4I9AA 3BW2A 4UFLA 4O28A 1O60A 1Q6QA 5CPOA 1M5WA 1HL2A 1FUYA 3G1DA 1Q45A 3W2NA 3OG3A 4FNUA 4JR5A 4Y8FA 3U6WA 4LVGA 5CGQA 1Q6LA 5F2GA 1U83A 4O1BA 5KITA 5AYZA 4DELA 2B7NA 2CLIA 3ANYA 4NNCA 3SFKA 3O8AA 3LOTA 3R8RA 4JTGA 5BMWA 2WV8A 1M7OA 4UFIA 1KBIA 1FDZA 2V30A 1K02A 3CWNA 3AO0A 5BOOA 4LS2A 3G18A 3WK1A 1OFBA 5LNUA 3EWZA 3F4WA 2ZRWA 1SFJA 4K8EA 4JX5A 5DXXA 3ZS4A 1YTEA 4I7VA 5E0KA 1RPXA 4IGHA 1C9DA 3KOFA 3OIXA 5AHNA 3G1YA 3A24A 3CPRA 3M43A 4RJEA 4XTIA 3LCIA 3LXBA 2CLKA 1K7XA 3KHJA 2BZNA 1VPXA 4O4WA 1LM1A 3PAJA 4A2RA 1DOSA 2A1YA 5C6MA 1KV5A 3THAA 3TUUA 4DO5A 2NUWA 2CZEA 2FPVA 4OWGA 2ALDA 3LCXA 1JCLA 3S1VA 1PCWA 1H51A 1FWWA 3CIWA 3S42A 4YMZA 2J24A 4HSOA 3TMQA 4JTFA 1F6PA 5D30A 5DCEA 1WDWA 3DGRA 1RVGA 3KVJA 1KFJA 2H3DA 3GB6A 1TIMA 1TYGA 2E5DA 2Y7EA 3L9CA 1O94A 1SO3A 1WQ5A 1RD5A 3TROA 4UNLA 4GFSA 4EWND 2C19A 2NWSA 4K6AA 1H7RA 1F5ZA 2FPTA 1SSDA 2ZBTA 3G0UA 3QF0A 3DZ1A 5F1UA 3MYOA 4O50A 4H6KA 2GQAA 1H1ZA 4FEZA 3T7VA 3MI3A 4PH6A 5CSRA 3P84A 4N4QA 3P60A 3NQ8A 4YCPA 1PHWA 2Y7FA 4GWEA 3LHTA 1FQ0A 1Y0EA 3CM4A 4Z0JA 1LORA 2PE4A 4JY9A 1VC4A 3VFLA 3L5LA 2ZDRA 2VFHA 3MYPA 3GDKA 1D3GA 4QITA 2NXGA 2A4AA 2H8ZA 4A2SA 1EEPA 2ZZ1A 1JQVA 3HIJA 3R13A 3GXPA 3W9ZA 1PCKA 1GVSA 1EB3A 1UBSA 1IXOA 4TIMA 2QDGA 3W7IA 4MVAA 4EF8A 3G1SA 3TC6A 3M5XA 5KZEA 7TIMA 4PFMA 3W3OA 3BLEA 3RFAA 3CIXA 1UCWA 2OZ0A 2V2HA 1TREA 3DFPA 3C4UA 3OA3A 3M0ZA 1MXSA 4Z0SA 1UJPA 3PBWA 4MYXA 1YXDA 1LCOA 1G7UA 1QPRA 4UTIA 3E96A 4H4IA 4BWLA 2FIQA 4N9BA 3TV8A 3C2OA 1KFBA 1B57A 4BFAA 3MBDA 3MJYA 2TPSA 2V2DA 3EX4A 1OVDA 1JUEA 3NQVA 3A22A 3KRZA 3N9SA 3B0PA 3W2UA 4WQ6A 4JDBA 1MEIA 4YLWA 3FJ6A 3FLUA 3MHUA 2ZRUA 4XUGA 3SY5A 3K30A 1KTBA 3EX3A 3S8HA 3TNOA 3M47A 4J9JA 5F2MA 1DL3A 3LM7A 1ZAJA 2FPYA 1TSIA 1OX4B 5CZTA 3BVJA 3WJSA 1FWNA 4ADTA 4O1DA 4ALDA 4KWVA 1PVNA 1I8JA 2FFCA 1PL9A 4PODA 1THFD 4FNTA 4GUHA 5LKYA 1F73A 4JIPA 5I3JA 1ZFJA 2WPBA 3SW6A 3LX9A 1VS1A 4RCXA 4ZQOA 2VENA 4C1LA 1QFEA 4AVFA 3W87A 1SO6A 4YWIA 3KX6A 4MLJA 1TO3A 4O57A 1TRDA 3W74A 4NT0A 1OHLA 3BV4A 4WD0A 1LYXA 1FCVA 3GYEA 5HWJA 4QJ1A 3E12A 1F6KA 4IMCA 4JXCA 4JTJA 2Y85A 3W72A 1SO4A 2NWRA 3DAQA 4WJEA 1W0MA 3LCHA 3PF3A 4ADSA 1QOPA 1ZENA 1FWSA 1P0KA 2QUVA 4O1CA 2EGZA 3C2RA 1GEQA 4DF2A 2YGYA 2VC6A 5AOUA 1TRIA 2YXGA 1VYSX 2VFEA 1K3UA 3USBA 1LOQA 3FIGA 3MP4A 2Y70A 3N2XA 1GG1A 2EF9A 3BG9A 3W76A 4CQ9A 4RXFA 3F1QA 5FF4A 2Q8LA 3B0UX 1RV8A 5K9XA 1PE1A 4UFJA 4LU0A 2EKCA 3IIZA 1A5CA 3PM6A 4FB7A 2CLMA 5GVJA 1HTIA 3DXIA 2P0OA 1ME7A 1FDJA 2B7OA 2R8WA 3UNDA 4JTHA 1V7YA 1OF6A 1QOQA 5HNRA 2JK2A 3PUEA 1IXNA 4RZ5A 2WKJA 2YFOA 3OVRA 3O07A 4TMBA 4O10A 2Y6ZA 1LRQA 3GDTA 2QF7A 1R2SA 2CFFA 3ZWTA 4O0KA 1W3TA 2CWNA 3NQAA 4A22A 2CLOA 2AAMA 2VOMA 3EXSA 4ZQMA 4JD4A 1SPQA 2GJLA 3G8RA 1F05A 5LGXA 2WNZA 4BWLC 3M5YA 3G8EA 2B7QA 3GXTA 4XKYA 4O0ZA 2WQPA 4HNUA 1TQJA 2ZRZA 3IVUA 1YADA 1ML1A 1Z44A 1ZJIA 2E6FA 5D03A 1I2PA 2TYSA 4RKAA 1OFEA 5HWNA 1AW2A 4HNNA 1ZCOA 3SZ8A 2Q8ZA 3KVLA 4KWWA 5F2IA 5EKYA 3PG9A 2J9YA 1H5YA 2NXHA 3M41A 5BMXA 4AH7A 6TIMA 3L66A 3NQ7A 1BEUA 3IVSA 4IOTA 2C16A 2VFFA 5I3FA 2NZLA 5D32A 2ZTJA 3NQFA 5HQEA 2A85A 4PA8A 3S1WA 2ZZ2A 3DU0A 3PB2A 4N02A 1FY6A 1KTNA 3FJLA 4HHPA 4M6VA 5K7JA 4QISA 3U8GA 3FA5A 4NXKA 3QSTA 3MUXA 3W7NA 1GPWA 4LWWA 3TFXA 2ABBA 1RQBA 3VNDA 3LI1A 3BGJA 4UC5A 4FNPA 2WO5A 3TDFA 4I7UA 1LBMA 1J2WA 3IGSA 3N19B 1L6YA 1B9BA 1K8XA 4LUJA 1DORA 3W1PA 1JQXA 3WJWA 3LDVA 3W85A 1X7FA 3NXFA 1WYIA 4FIQA 3W83A 1W56A 5AYYA 3QM3A 4M19A 4K7VA 1LTDA 3QFEA 5D04C 3KVMA 2QEZA 4LVBA 4A29A 2QCMA 4UTKA 1NF0A 2BX7A 1KM1A 4LC6A 3N3MA 4UMBA 4LOCA 3UY7A 3NQEA 1TTPA 5D33A 3QEZA 3B8DA 3MBFA 4ZZ9A 3FKRA 1RQHA 4N9CA 3DHDA 3LV6A 4N2YA 1I4NA 2FJKA 3UZ5A 3W7KA 1SW0A 2QCLA 3W7MA 5IBXC 4AWUA 5I3HA 4H3DA 1VHCA 5D2YA 5G4EA 2YW3A 2V5LA 1QWGA 1K8YA 2R14A 1SQ7A 3O15A 2I1OA 1FXPA 2CU0A 1T96A 1DVJA 3KVKA 4N9DA 2QCDB 2QCFA 1J4EA 3TSMA 1TB3A 1TJPA 1VRDA 3EKLA 3LXAA 4FNSA 1QAPA 4MFDA 2X30A 3SGZA 5KTLA 1ZNNA 3BG3A 3EXTA 4K7YA 1M7PA 3ABSA 2PC4A 1SSGA 4O19A 2IQTA 5G2IA 1VLIA 4ZL1A 3P61A 3P81A 4R7JA 3PBVA 5F1VA 1L6WA 3LB0A 3A23A 2PRLA 2QCGA 3MP3A 4RV8A 3N2MA 3TAOA 5C55A 3UWVA 3F03K 3ABOA 4DO6A 1XCFA 1OX6A 2BTMA 3UXAA 2CW6A 5G4WA 3FS2A 5F4XA 4MPQA 1P5BA 3LBCA 2WJZA 1C8VA 3I7SA 2CLLA 3NL5A 5L9FA 3R5EA 1RZMA 3IRDA 3P5YA 2ZFAA 3ATYA 1A5SA 3CQ0A 1N7KA 2BSLA 2BXVA 4BI5A 3VE9A 3PWAA 4PCFA 3L0GA 3LHVA 1FWRA 1KBJA 3B4UA 3O06A 4CCCA 2O7SA 1ALDA 1Q6RA 3LCGA 3CLMA 1GVOA 2XN0A 4AXKA 1KTCA 3TA6A 4UTTC 3RU6A 1QDSA 1AK5A 1R2TA 3IV3A 3TW6A 3L5AA 2EHHA 3G3MA 3UPWA 3W73A 5LNWA 4R34A 1GYNA 2HSAA 4JYFA 4PC8A 6ALDA 4Z08A 4GRSA 4TMCA 2C3ZA 3ATZA 1YPIA 1FDYA 3NL2A 3PS7A 2JKAA 3HQ1A 2EAWA 2X16A 2B0MA 1W5MA 5CPNA 3L67A 3G1HA 1O95A 2HTMA 1H50A 1EWDA 1XDMA 5J5RA 3A9IA 5KZDA 1MZHA 3LHYA 1GVQA 3W7RA 3RNDA 4KFOA 3EWBX 1GZGA 4GUJA 4C1KA 2Z6IA 1P0NA 1QO2A 4M6QA 3NGJA 1SO5A 5E1QA 4IJBA 3DFSA 1KLZA 2Y88A 3W1LA 3W75A 4N4PA 1H60A 2ATMA 2YSWA 1TPEA 4CNOA 1IIGA 1XXXA 4IUOA 3LTYA 3I7QA 4FF7A 5A8GA 4Z1DA 1OYAA 3F4NA 4QQ3A 4GUGA 5ABTA 3CEPA 3HJZA 4HPJA 1DJQA 2P10A 3QYQA 3W7DA 4O15A 2QUUA 2AQWA 4PL2A 5LSMA 4JY8A 2Y63A 3NAVA 1A50A 1Z48A 2W6RA 3MWAA 3NZ1A 5KINA 2DZTA 4IX0A 2ZZ7A 1YLVA 4BI7A 2HMCA 3G1VA 3EB2A 5D02A 2GQ9A 1ME8A 4QIUA 5AHEA 2YPIA 3TSDA 2Z0IA 3EX1A 2C15A 3P82A 1UUMA 1EX5A 3I6RA 3LCLA 3GKFA 1K7EA 3W1NA 3GKAA 4DQWA 2RDUA 1SFLA 5AHMA 2NV2A 4HSNA 3BARA 2A7PA 1TPVA 2FB2A 2FB3A 2WOQA 2RKXA 2QJIA 1XUZA 3MHFA 4RR4A 4IMEA 4LS0A 3NVTA 2ISSA 3PSVA 4UR8A 2A21A 3MP5A 5AYXA 5LGZA 3IIPA 5C5YA 3HG5A 1TPDA 4CCEA 2LLEA 3SR7A 3HGJA 2A6NA 1VCVA 1JCMP 4BK9A 2FTPA 5L6UA 3MO7A 3W1TA 2E6AA 5DBTA 3OEXA 5F2LA 3SSJA 4XZ9A 1SW7A 3CU2A 5FF7A 3M5VA 1J5TA 5IM51 3M44A 3P5ZA 3THQA 3CB8A 4LC8A 2WSQA 4UTWA 4JNMA 1ONRA 3NPXA 3S5NA 4AHOA 3W1XA 4IWWA 4UTHA 3P80A 1X1OA 3STFA 2YZRA 3O05A 3BG5A 4LUIA 3JR2A 1N55A 2GVJA 2VEIA 4HNTA 3N34A 3NPUA 2A7RA 1OFOA 1HG3A 4O12A 4JIQA 4UR7A 4QNEA 1Q3NA 1H7NA 4WY0A 3O1NA 1GQNA 4JS3A 3P8JA 1UUOA 4FXRA 1RR2A 2H6RA 4I7WA 5KSWA 1KM6A 3FEMA 1LLZA 2DZUA 3UWQA 4JN6A 1HUVA 2TSYA 3W07A 3GX9A 3C56A 3BPWA 3DFQA 3PUOA 4EIVA 1JVNA 3QJAA 3T40A 1OFPA 3WK0A 4FO4A 3NEVA 4U28A 4ADUA 1OX5A 1TCDA 1Z42A 2DU2A 2NUXA 4WOQA 4GUIA 1I2NA 1NVMA 3AJXA 3MI2A 5K9CA 3KFTA 1VLWA 2F84A 1JUKA 2DZXA 1OFRA 4JYEA 2CLFA 3C6CA 2R91A 4WOZA 3HB9A 1TPC1 5TBOA 3IIXA 3W7LA 2ZA2A 3UXDA 1XM3A 1IXQA 2DJXA 1OFQA 2NUYA 3BO9A 1JCJA 1YTKA 4ONVA 2OT0A 1MO0A 3DH7A 4DBDA 4QNWA 2Q3RA 4LVFA 3G22A 4UTMA 1KLYA 1GYLA 1OK4A 1AMKA 2BLEA 2P1FA 3L68A 1TTQA 3P8IA 1KM4A 2PURA 2I9EA 3GR8A 1OF8A 4JX6A 5AN7A 5I3KA 1I45A 3LV5A 4MOZA 2A6LA 3S9YA 3SJ3A 4QSHA 3PB0A 2DZSA 2X1SA 5MHBA 1I2OA 5LHFA 2Y7GA 3ZFHA 1IXPA
chains in the Genus database with same CATH superfamily
4YVXA 4M8UA 4RK8A 1LG1A 4IP5A 3VI2A 3QC0A 2E1WA 3KLLA 1PS9A 2X7VA 4C6PA 2IKGA 5HMEA 4RXGA 3QV6A 3VZZA 1E40A 3VIGA 5H91A 3NZQA 1XQKA 3UY8A 3FYOA 4DEFA 1IWAA 1M65A 3RG6A 3GH7A 3EWWA 1P6BA 3C3UA 1K6WA 3PR2A 5CZJA 5CGTA 4QROA 3QGKC 3VCRA 3ZQ9A 4UFKA 3W70A 6PTDA 4UTWC 1LOSA 3TQPA 3WNLA 3WX7A 2A3CA 5E6YA 2ZUSA 2ZUTA 1V02E 1DV7A 1LF1A 4EAYA 2W66A 3M0VA 2UY5A 3F5LA 3QLLA 2OOGA 1L2UA 3I6TA 3WEOA 1HL8A 3FJ4A 4LTSA 2B31A 4MZYA 2FGBA 5TD4A 3BXWA 2HXUA 4GVFA 3QY6A 1QPKA 3E5PA 3W7EA 4UTLA 4L56A 1V03A 4S3EA 3CHVA 4AHPA 1G4EA 2VVNA 4NJIA 5U7SA 1XIIA 4GXMA 5T9CE 4UFHA 3A4WA 3S1UA 3U5YA 3SCPA 1JCTA 1NH6A 3U57A 3RCNA 3QPZA 4Z1CA 2Z1XA 4ERAA 2ON3A 1JZ8A 1LROA 4WIWA 1R9YA 3VDCA 4GINA 4DYJA 2V5JA 1XIMA 1UPPA 3W7GA 3WMLA 4EPDC 1KFLA 2O92A 3E49A 4IX2A 2HPIA 4F9JA 5AC5A 2QR6A 2ZA1A 3PUDA 3RO6A 4H01A 5F4WA 1SUXA 4MKNA 2G3JA 1TA3A 1W9PA 4L61A 1VYRA 3AMDA 3LGEA 4B2DD 1ECQA 3RITA 2PRHA 4XAGA 5DY3A 1N8IA 2NQ5A 1CXFA 5M5DA 1XP3A 1H63A 5D2VA 3LUTA 4ZA0A 3VABA 2ZZ5A 1E51A 3T05A 3U7BA 4BF9A 2PDKA 4HOXA 4X0NA 2OOFA 1XGEA 2WMGA 3HPAA 3H54A 4RDVA 1GTEA 3GVGA 1UKTA 1CBGA 1K9DA 1GVRA 2J79A 1M03A 1PV8A 3CJPA 2D2JA 3W25A 4P61A 3LGGA 4AWEA 3VKJA 2BY1A 1ZQ5A 1F7BA 2OWXA 2FJUB 3EWDA 4D6JA 3PJUA 4FLSA 3DUGA 3TSBA 1BF2A 2Z2UA 4JX4A 1XBZA 3UETA 2GJXB 3V18A 3NM3A 4LF1A 1LWHA 3PY2A 4MJ2A 3BZGA 1H61A 1QI2A 1KV8A 3NQMA 3WZ0E 4OBTA 2Q6ZA 3TFCA 1TQXA 3N4FA 2P8CA 1GJPA 3TIMA 1AG1O 4XISA 4AU0A 1R3WA 2ZXDA 3C2EA 1ZHAA 4DIAA 3RM9A 4JNZA 4PRTA 3GZ3A 1H7PA 1LLWA 3SCSA 5C2CA 1DKWA 2GGIA 3GNRA 4C6OA 3ES8A 4KEMA 4L9XA 1X96A 4MM1A 3P2VA 4K36A 5CZKA 2OCZA 1NWSA 1QOXA 1EPXA 4OOUA 1I60A 3IK4A 2X0YA 4UOJA 4LALA 4PTMA 1IWBA 3GC4A 4X3ZA 1XV8A 5DCBA 3EXRA 3G1RA 3KRSA 1E0VA 4PULA 3NDZA 4QS6A 4QJ3B 3I3EA 5DCDA 3CTTA 1Q6EA 3M0IA 1FFRA 3STEA 2MUCA 3ZR6A 1W1B1 4J3VA 4ICNA 4CQBA 1R0MA 4Y9AA 2J27A 1ZP3A 2NLIA 3BGGA 4M1RA 2I5GA 1S3HA 1OIMA 4IFKA 4EXQA 2GK1A 5I78A 1CGYA 2Q3OA 3NIYA 3K13A 1E0WA 5BYWA 2QKFA 2W61A 3QY7A 3SN4A 4DPQA 4GBDA 2RHGA 1S5TA 3PZVA 1J0KA 4ORMA 3PBMA 4ZO9A 4XUYA 1W2VA 2XVGA 4CQ8A 3WEMA 3HF3A 4U3AA 3OLIA 1TPB1 2PODA 5B7ZA 2HWGA 3DX5A 2VR5A 3NSMA 4ZMGA 3CQJA 1TZZA 1JDAA 1WAWA 4ZQPA 1C3FA 3HPSA 4IZGA 1J79A 2O4MA 3IJQA 4JGDA 2J13A 1AJZA 4UNKA 2PGWA 3CWOX 4GX8A 3CQKA 5HMSA 4MY9A 1S2TA 4GNVA 3NG3A 3B9AA 1IEWA 4V1XA 3WF4A 4ML4A 1CT5A 1EDGA 1ENUA 3PWIA 2XFWA 2GSEA 2YL6A 4LBRA 1HQTA 3E2VA 3TTSA 3R12A 3DYOA 4JEQA 4KIEA 3ZZ1A 3TQKA 3LLDA 1EF3A 3SQMA 3EDJA 3LENA 2OSXA 5AHFA 3EA3A 1BWKA 2X40A 1U1HA 1PKYA 3QXBA 2VFIA 5AZ1A 1ODUA 1MWOA 2UV8G 4S1FA 2TRSA 1BSIA 3BSMA 1UP0A 1JD7A 3C8FA 4WJXA 3B03A 3MW7A 4KW2A 4MY1A 2DSKA 1CX9A 3ABXA 2Y0FA 3H55A 1ZAIA 4Y90A 2XFRA 4KH2A 4LEFA 1OJXA 4X2PA 1MQRA 3G1AA 5ABEA 5CLWA 2FDMA 3CXOA 3AXMA 4O8RA 1GVIA 3N9RA 3TN5A 4LW7A 3FN9A 2OLAA 3VNZA 4Y7EA 4E2VA 2WCGA 1Q7QA 3CC1A 4PUJA 1P6WA 1OX4A 2YCIX 4JBRA 2DZVA 4YXGA 3AU6A 1TR1A 4MFEA 1U1JA 1UD3A 1Y5VA 1NDZA 1GG0A 1EA0A 4AZ5A 3EOLA 4F40A 2CHNA 4Y6GA 3WBEA 2HS6A 2XSBA 5GJNA 4G56A 4JFUA 1W3NA 4LBUA 1EWEA 2QCNA 3WD1A 3Q58A 3VNYA 4H7ZA 5CBJA 1XLGA 2C14A 4CD7A 3L4YA 2Y62A 2WM1A 4JTIA 2BOGX 2E77A 2YDAA 3ZLFA 2PMQA 5FF2A 2VMFA 4J2MA 3U2OA 3NOEA 4BR1A 5LIUX 3V1HA 5CPLA 4L1WA 3HBLA 3AAMA 3WLKX 2DSWA 2FDSA 3W6LA 3GDLA 3S47A 1J11A 5A2BA 2NX3A 4XQ6A 1FCQA 2V9DA 4Q3MA 3W27A 3EBVA 4YJ5A 1WB0A 3NQGA 3EMCA 1GOXA 3M7WA 2VWTA 1SZEA 3V16A 3Q45A 3RAOA 4H9VA 2VL4A 3G1FA 1N8WA 3WK3A 3WUFA 3VIFA 1RJPA 2QJMA 1ISYA 3HMJG 3PZ9A 3KCOA 2NV1A 4O17A 3NR0A 1D8WA 1L8NA 4Y96A 4MIMA 4Q33A 1HJUA 3LU2A 3R25A 2ZRXA 3EX6A 1XSKA 1YMYA 3B4YA 5HNUA 3WL1A 5I79A 3C86A 4HD5A 5FI8A 1NELA 4FXSA 4QDPA 1ME9A 2EPOA 4N6EA 3URBA 3LMZA 1VB9A 2OEJA 3R89A 2G3NA 4ZO6A 4ZQCA 1DJYA 2HK0A 1VEOA 3LHWA 4MADA 1S38A 4I90A 3HG2A 1KA9F 4QS5A 4H8UA 3AYRA 3WG6A 3VD9A 4K1GA 1QI5A 4LGXA 3BQ5A 4K1WA 3LTSA 3MMUA 4JYDA 1VHNA 1HJSA 1MUWA 3N2OA 5C0QA 3T2QA 2PWGA 3B05A 1UUQA 3SFWA 2TAAA 1ZB5A 2DPEA 5BOFA 4PL1A 3VOIA 1J10A 3B9DA 3WUBA 2R6OA 4XVEA 4DM2A 4ZQRA 1WDDA 1JR1A 2O55A 4PTNA 1MMFA 4PZVA 3L4ZA 3UWWA 3NDOA 1JXJA 4F0LA 4E2DA 2GOUA 1T41A 1A5NC 1IHIA 3MB9A 3M4HA 2ZE3A 4JTLA 4UZUA 2PA6A 2JEQA 4OZOA 4LY8A 3H4WA 1EO7A 1B0IA 4CNNA 2EXOA 5CGMA 4GJ1A 1W5NA 3WQ8A 3B8IA 4H1ZA 1LWJA 2CESA 1AZ1A 1KFEA 2Z28A 1VBUA 1GKQA 3Q94A 4ZFMA 5FESA 4RZBA 5HULA 4OHQA 1JPKA 3GK0A 2J8GA 3HG3A 3P67A 3CLWA 5U4NA 3HG4A 2BXZA 3ORWA 5D2XA 2J9ZA 1FH9A 2A0NA 2DT0A 2D23A 5CC5A 1EUAA 1VBHA 1GT8A 2FLIA 3KWSA 4JTCA 1CGWA 4KETA 1GJWA 5D09A 3RX2A 3GQYA 1JPIA 2RJGA 2ZZ4A 1VQTA 3PC0A 4HNLA 4RNFA 3AMLA 5LNSA 4I9TA 4H9TA 1MYRA 2HJPA 1H7XA 1PKNA 1XBVA 3IK2A 3ARSA 4E2OA 4HN8A 1SMAA 5RUBA 1TMHA 1ZY9A 2ZUWA 3SCUA 3GC2A 3RPMA 1D7KA 3H4GA 1DJNA 3SUWA 4Z1YA 3L21A 5HMFA 2Q02A 1W1PA 4XD3A 3ME3A 1MNZA 5FJOA 1JZ7A 3BLFA 3HGOA 1TVNA 1D9EA 3H6OA 5F4SA 2PRMA 4IG2B 1A47A 2E4TA 7ODCA 2HV5A 1GCYA 4GFIA 4PUMA 4BCEA 4C1NB 4MNKA 4ECLA 4AY8A 4AIUA 1GK8A 3OYXA 1A5AA 3ZO9A 1UD5A 1TJRA 3EGJA 1ZZMA 2X0HA 2D69A 2ZZ6A 3VM7A 1E0XA 1ZL1A 4NZJA 3S9IA 1UZHA 1H1NA 4GI6A 4S3KA 4H6EA 2QJHA 4P7RA 2VCCA 3WQ6A 1E3XA 4ZO7A 2GUUA 1NM9A 2R1NA 1PIIA 1V3HA 4UTUA 3GDRA 4LAMA 1EOKA 2GVEA 1V79A 1KM0A 2EEXA 4UCGA 2P5NA 4XK2A 1XSJA 2G3MA 1UC4A 1FWCC 2YDSA 5LNVA 4TU1A 2E09A 1B3VA 4KPLA 3VM5A 4IL2A 1Z89A 2PBGA 3DYMA 4S3DA 2ISDA 3SI9A 4XV0A 4A3UA 1CGTA 2V5KA 3YPIA 3W28A 4H04A 1E1CA 1QPQA 5LIYX 4UFLA 2XGIA 1EO5A 1O60A 5CPOA 1HL2A 1FUYA 4AFYA 1Q45A 3UA3A 5C9RA 4FA3A 1M7JA 3OG3A 5BXPA 4Y8FA 3E2RA 4KWSA 1TX2A 4QX4A 1U83A 4DELA 2B7NA 4AY7A 4MWAE 2D22A 4IP4A 5C2GA 3L4TA 4XX6A 3FVDA 1TZ7A 4V1YA 1FDZA 4HOWA 3BLKA 4H2CA 4AZBA 4OBSA 1W6TA 5FKYA 4PUUA 4G6CA 3A24A 3T0CA 3CYVA 4A35A 2CLKA 3GDBA 5LIWX 1W1VA 4JCMA 1VPXA 1LT7A 3THAA 2ZKMX 1GVYA 2NUWA 4PMQA 2FPVA 5DEZA 1ZTVA 3S1VA 1UWIA 1FWWA 4D6DA 3CIWA 4HSOA 3TMQA 4JTFA 5D30A 5DCEA 3DOPA 3DGRA 4ZCWA 2OLHA 1YBQA 4MSSA 3QR0A 4HTBA 1YHTA 1XRTA 1PIFA 2JF6A 3E6EA 2VX4A 1CECA 3OZPA 5JMUA 7A3HA 3HQPA 1XH0A 3G0UA 3W0KA 2GQAA 1H1ZA 3FVMA 4CD8A 1ZLPA 4UB9A 4N4QA 2P8BA 3JZUA 3NQ8A 3A12A 3ZVHA 1Y0EA 3GTIA 4EXAA 1Q4WA 3VOCA 3N4EA 3K46A 5M1TA 4C7FA 5JBFA 1ELSA 2NXGA 4JL2A 1M1BA 1VJZA 2A4AA 2ZZ1A 2JALA 4LAZA 3HIJA 1C8QA 3HPFA 1PCKA 3Q65A 1EB3A 2QDGA 3W7IA 2HBXA 2DZBA 3F4VA 3VILA 3M5XA 5KZEA 2QJNA 7TIMA 4H9YA 3BLEA 1UCWA 2OZ0A 3DFPA 3ZOAA 4FMVA 3OA3A 3M0ZA 3D3FA 3DCPA 3I3DA 3V36A 4GXPA 4W8AA 3W6MA 4H4IA 3MBDA 2TPSA 2VZUA 3NQVA 3SCWA 1VFFA 4X61A 3W2UA 3FJ6A 2AL1A 4LUYA 3SY5A 1V6UA 3A64A 1UZ4A 3M47A 4J9JA 3HN3A 1XICA 1TSIA 5CZTA 3WJSA 3UZWA 1FWNA 4KEUA 1A0CA 3C0LA 4C6BA 4FNTA 1F73A 1ZFJA 2G8ZA 3GWQA 2J78A 1VS1A 4HHHA 1TE6A 2VENA 2XIBA 5EMMA 4AVFA 1FWBC 3W87A 4PSRA 2P50A 3CWHA 1GQIA 4IIDA 1PX3A 1G5AA 1WZKA 4NT0A 4WD0A 1B3YA 4IHCA 3GU1A 1FCVA 3GYEA 1NDVA 4IMCA 4P7NA 1A5UA 3NTYA 3W72A 3MZ2A 4ACYA 2W9MA 4JOMA 1W0MA 4L6OA 3PF3A 3OG2A 1QOPA 4PMOA 4AD1A 1XLLA 2VJXA 2YGYA 2AKMA 2OSWA 4DYKA 4ZR8A 5AOUA 2YXGA 2Z26A 4NZ3A 2VFEA 1K3UA 4FR1A 1LOQA 3KTCA 1S2WA 1J01A 2WC4A 5FA5A 3N2XA 3MCOA 2XYLA 1X6LA 3WLNA 4AW7A 3W76A 1E43A 3EWCA 4RXFA 3AIRA 3CUGA 3F1QA 2Q8LA 1WXYA 1PE1A 4UFJA 1OC6A 1V0LA 4A3RA 5LXXA 4IFOA 7REQA 1CYGA 1QHZA 1SZRA 2EKCA 1A5CA 1GW9A 3TEVA 4YTUA 4Q8PA 4B5UA 3T4WA 5LYRA 3DXIA 1ME7A 2AL2B 4JTHA 1HP4A 5HNRA 5LIXX 3PZNA 2Q71A 3PUEA 3O07A 4TMBA 5AVHA 1TVPA 1LRQA 3N6QA 1BXBA 3GNOA 3MANA 2DW7A 1W3TA 4QR6A 4A22A 3EXSA 4YHGA 1F05A 1XCXA 3G8EA 1RAKA 1WXZA 3FGCA 1SJCA 4XKYA 1ADDA 2G4JA 2RJHA 4H41A 1TQJA 3WNKA 4EX4A 3DECA 3QKEA 2E6FA 2WHJA 5D03A 4QRNA 3KBMA 3SZ8A 2IXUA 4KWWA 5EKYA 4WDXA 1H5YA 3M41A 5BMXA 1DQUA 1UKOA 3NQ7A 7ENLA 1KXVA 3CL7A 2VFFA 2FZ8A 2NZLA 2ZTJA 1EL3A 3U2CA 3S1WA 3DU0A 1FWEC 2E0PA 1JAEA 5AY7A 1FY6A 3H12A 2WMKA 5K7JA 2VGGA 4GI9A 3MUXA 3WQPA 4AZGA 1E56A 4QBXA 3W7NA 1XLDA 1GPWA 1RQBA 2XVKA 2ACUA 3N25A 3TDFA 4HCLA 1LBMA 1Q7MA 4GQGA 3ICJA 3IGSA 3N19B 1L6YA 4LUJA 1J12A 1DORA 1JI2A 1E71M 1MI3A 3RXZA 3NXFA 1XRFA 1ZPTA 3W83A 5I03A 5H1WA 3CMGA 2EPNA 3H2CA 3IRSA 4NL1A 5MKGA 2QEZA 4UTKA 4C91A 1KM1A 4LOCA 3J7HA 1AODA 5D33A 1KCKA 3FKRA 4ZZ9A 2HROA 4J35A 3W7KA 3WQVA 4H3DA 1U1UA 1VHCA 5G4EA 2V5LA 2I1OA 2D2HA 2VD9A 2I57A 3KVKA 4AQLA 4N9DA 2P3EA 2AOSA 3PZQA 1K77A 3EKLA 1XHGA 2BGNE 4H6QA 3DN5A 1QAPA 3GXDA 3EXTA 1M7PA 2WMIB 1QNRA 2PC4A 5G2IA 1VLIA 3G6MA 4PE8A 1AQMA 1VPQA 4ZL1A 4TQTA 3WQWA 4R7JA 3PBVA 3TJ4A 3LB0A 3AHXA 3MP3A 3HZ3A 5C55A 1OINA 3KL5A 2QIWA 1XCFA 2BTMA 3PBGA 2CLPA 4MPQA 3HFTA 4H83A 3I7SA 3CHEA 4M24A 2ZFAA 3KDOA 3ATYA 3QR3A 2BSLA 2PU0A 2HZGA 3CAKA 2D20A 1E3ZA 4QEEA 1QI4A 1RUSA 3S1GA 1EJSC 1JDDA 4LX4A 2O7SA 1DE6A 4YPJA 2O4QA 1DJIA 3FA4A 3KCLA 3BOXA 4H9UA 4UTTC 4XAPA 3OQEA 1R2TA 3L5AA 1ODZA 3G3MA 5DF0A 5LNWA 3AYVA 2HSAA 2J66A 4S3FA 2C91A 3SQSA 1IEIA 2OEMA 1BGAA 4CKQA 2X16A 1W5MA 4A8IA 5CPNA 4JFWA 2BG5A 1FKXA 2P0IA 3BWWA 5J8LA 3H7UA 1KWGA 1JAKA 3B8VA 1UKSA 2D1ZA 3EWBX 2JE8A 3SUSA 4C1KA 2Z6IA 3UBPC 1P0NA 1QO2A 3NGJA 3RLHA 3ARWA 1SO5A 4H2HA 5FD0A 2J8TA 3NJ3A 1KLZA 2XINA 3W75A 4N4PA 2QVHA 4PR4A 1K8CA 2QUNA 3ZLHA 3OLEA 4FF7A 4J3TA 3F4NA 2OFJA 5BU9A 3R0DA 3GS6A 2XIJA 1J96A 5ABTA 2B81A 2OGYA 2WC7A 5DX7A 3B40A 2WWDA 1DJQA 1CLVA 3QYQA 3K1GA 1X6NA 3ITLA 3W7DA 4H6RA 2AQWA 4B3KA 2WAGA 4M81A 2OO0A 1Z48A 2W6RA 3NZGA 3THCA 3NZ1A 4ZB0A 3N29A 2DZTA 4BI7A 3EB2A 5CSYA 3GUGA 5BWAA 2GQ9A 5AHEA 1AJ2A 2YPIA 3IUDA 2VC5A 1UUMA 3MSDA 5REQA 1EX5A 1KCLA 1J9YA 3I6RA 3KZSA 1IZJA 2W62A 5AHMA 3S2MA 4TTUA 1C9WA 1NOFA 3IJ6A 1FHUA 6ENLA 1TPVA 1V0KA 4UQEA 1TJ0A 1U2YA 3N12A 3O7UA 1U30A 5AKQA 1XG4A 2PD9A 4RR4A 1R3RA 4LS0A 3NVTA 4UR8A 1OB0A 4CD5A 2A21A 2RGLA 5AYXA 5LGZA 3IIPA 2OB3A 2YL5A 2PC8A 3WLTA 2GUYA 1PSCA 4P5UA 2X42A 1BHGA 4BK9A 3PJXA 5F7UA 6CGTA 4QDWA 3OPSA 3OEXA 3UU0A 4UQCA 4XZ9A 3CU2A 2WSPA 4QAWA 4HNOA 4UOZA 2DUAA 5FF7A 4BJHA 4IFRA 1XIHA 4H00A 1QHPA 1W8GA 5D9PA 3THQA 4LC8A 3OZYA 1ONRA 3S5NA 3O6AA 1V02A 2A3EA 3EB4A 3MSYA 3W1XA 4IWWA 3L2LA 2VDIA 3P80A 4M0XA 1WCGA 3TN4A 3N34A 1OFOA 4WY0A 3WQEA 2VDHA 4LNCA 4JS3A 3PZOA 1WO2A 2AQVA 2J7GA 3CAVA 3SM0A 2QUMA 5CCZA 4GI8A 1XLEA 3H4XA 2H6RA 4I7WA 3CL8A 3H2EA 3UCQA 3FEMA 1ZBWA 2VZSA 4W7WA 3TLLA 1JNEA 3CBWA 4FK9A 3GX9A 4M56A 2XGZA 1PWLA 3C56A 1RD6A 2OPJA 2PZ0A 1ZBKA 3TN6A 3BAKA 1M01A 4CNUA 4J3ZA 4W7UA 1OFPA 1EJUC 4FO4A 4ADUA 3MSGA 4B9YA 4ACZA 3M7SA 4DJFC 4KERA 3KL3A 2IPWA 4WOQA 4CN4A 2XVNA 3AJXA 2ZUMA 1DWAM 4DJED 1JUKA 2DZXA 2Z7KA 1MRQA 2CLFA 3C6CA 4WOZA 3WLOA 1TPC1 4U5IA 4XIAA 3UXDA 4Q8OA 1XM3A 2DJXA 1EHNA 3B0YA 2Z7GA 3RM8A 1EXBA 2VT0A 4LYQA 1JCJA 4L9YA 2OT0A 2W92A 1MO0A 1XWYA 1KCXA 1D2KA 1TZ9A 4B16A 3P8IA 1VENA 2REQA 4JX6A 3KTSA 5AN7A 1Q85A 3LV5A 2A6LA 3UWEA 3SJ3A 4QSHA 2V68A 3EDFA 5MHBA 1OCNA 1HW6A 3GD6A 1XYZA 1LOLA 1W5OA 2JGQA 1YDOA 3DHUA 2X1TA 1W1ZA 2H9AB 1KC7A 4JTKA 4TX9A 3LZ5A 4EF9A 4L5ZA 2QUTA 1J6OA 4Q6JA 3UVIA 4J27A 2HE5A 1JULA 3THDA 2BGQA 2CETA 5D05A 4YVPA 4W84A 3OBEA 3GAKA 4S23A 2E5BA 4D6EA 3GNDA 3TNBA 1QTWA 3W53A 2IMRA 1F4HA 4QG6A 1CLKA 4YHEA 8A3HA 5DRIA 1QNVA 1J2BA 1AMYA 3VGEA 3QBUA 3Q67A 3VIHA 2VFGA 2V3GA 4WDTA 3VIMA 4FLRA 1YIXA 2PDXA 4OV9A 4QJ5B 4ZTXA 3VE7A 5AVNA 4MZ1A 1A49A 3VIOA 2YBTA 1CPUA 1WUFA 3OHIA 3REQA 4P8WA 4MKSA 2INFA 4Z17A 4UR9A 1UWQA 3QY8A 3B06A 4ICCX 2PDMA 4HZ8A 2E5CA 1J93A 6TAAA 3KE0A 1DIDA 3VOJA 3GHRA 3IACA 3IUIA 1EIBA 1F6YA 1OGBA 4OV4A 3ITVA 2J7CA 3HPXA 2CHOA 3UCDA 1LT8A 1J0JA 5AFDA 3KBNA 3B9NA 1XIDA 3TE9A 4J4KA 1FHDA 5D9OA 1V3JA 1ADSA 1I0BA 1TTIA 2INEA 4LV4A 1PZ2A 3PZGA 1G4SA 4IQJA 2QV5A 2Y2WA 4HK6A 3V3WA 1X7IA 3AISA 4LFYA 4W89A 2I9UA 4XZNX 3AUJA 5CJMA 1WE5A 4KFPA 3GM8A 3OGVA 2YCLB 5I2UA 4DM1A 3UWUA 1YDYA 3JW7A 4OU1A 3PPFA 3ZIZA 4NX5A 2C6QA 2R1KA 3KXQA 2Z1BA 3SY8A 5A5WA 1FFQA 2F8QA 4ATLA 4PMRA 4NF7A 3WF2A 5AC8A 3OO2A 2G96A 4GGHA 3KS5A 3UGRA 4NASA 1A0DA 5HK4A 5CJNA 3W1MA 3RYSA 1CZ1A 1D3HA 1K7FA 3QQ0A 3EPNA 4XZIA 2WVVB 2V63A 1US0A 3THUA 3LLXA 2GVGA 2JQXA 5FL1A 3FW6A 5LA0A 3T78A 4LQ1A 2J7HA 3NWRA 2G95A 2F7FA 3TJXA 2DIEA 5KMYA 4E3TA 2OU4A 1Q7ZA 1EP2A 1JRCA 4F2BA 3GR4A 4B4FA 2GJNA 4WRHA 2E67A 4GBUA 2PDPA 1BPLB 4C6CA 3W84A 2E8YA 1F74A 1KKRA 3QPYA 3I68A 3WNPA 4ZENA 4IQEA 4ERIA 4GC3A 2X7WA 1GORA 4G7EA 4KCUA 1BVZA 3SADA 1P48A 5DRCA 2B4GA 3A3HA 2WMHA 1YYAA 1O4UA 1MDLA 4HCHA 2WJFA 4PUDA 2RH9A 1REQB 2FZ9A 2JGYA 3TQ0A 2F61A 2WVSA 3TX9A 1DJXA 1I0DA 3HA1A 4UQDA 2CZFA 1JF6A 2A3BA 1D7FA 1SGJA 1W1YA 3T07A 1JZ6A 1M6JA 4Q8QA 4WXYA 3I65A 4QLJA 2AKZA 2ACQA 4PN2A 1OT2A 1JI1A 4DXKA 3TOYA 2O7QA 4X2RA 4M5PA 3H70A 2UY3A 2GPTA 1PZ1A 3MC5A 3AI0A 4I8YA 3VOGA 1IT0A 4JTSA 2OO6A 1BKSA 3CT7A 1GUVA 3ZVIA 1R87A 3GVRA 1X6UA 1AH4A 3KHDA 3WJYA 5E0FA 4TXEA 1EC9A 2C71A 3OVGA 5CBBA 4YTTA 4LYPA 2WNNA 2X2YA 1HFBA 4IJRA 3QMRA 2YB1A 2ISFA 3TMLA 1SZGA 1H4PA 5KZMA 3CZJA 4US5A 3CV2A 2ABAA 1NEYA 3CEUA 4ORIA 5CSSA 4A4AA 3PFMA 1CB7B 3UERA 1EDQA 5EBAA 5E0CA 3TK7A 4O54A 1TWWA 2IW0A 1NWUA 4GX9A 4LCRA 2Z1VA 3VDHA 2O9PA 3OQ8A 1GYMA 1YE6A 1MFVA 1M3UA 3PPHA 4MGGA 2PB1A 3G1XA 2QAPA 1WKYA 2YZ5A 3LEPA 1XGDA 2GYIA 1GOWA 4QJ4B 3S5ZA 1EH9A 4NYYA 1FHLA 4GLEA 3ZJ6A 2VKZG 4DXXA 3PFRA 4EXBA 2V81A 3CUXA 4XVDA 1DP0A 4JTEA 3TW7A 4AEOA 3WK2A 1RK5A 3IJIA 5AHLA 5D37A 3M64A 4PFHA 4HU0A 3OYZA 3P93A 2G97A 3XINA 1WX0A 4LANA 3ZMRA 4W5UA 1UR4A 3UJSA 4ZVJA 1SZFA 2PTXA 3G5EA 1R85A 2TMDA 3VNMA 1EZWA 1FWTA 3ITOA 3W23A 1YX1A 2ODOA 3DDMA 4IICA 1AL7A 3GR7A 5I09A 1UC5A 2PI6A 1M53A 3UEQA 2VEKA 4F2TA 2B7PA 1GKRA 5T91A 4L4LA 4JQ3A 4RZ6A 3RLUA 1W3KA 4HK7A 2PUZA 2XPKA 2NQHA 1R3SA 1UZDA 2WHLA 4LB4A 1NF7A 4YS1A 3T4CA 3BK0A 1WBJA 4J3WA 1ONWA 3GTXA 4NNBA 4RE3A 1QWKA 4POCA 3GZAA 3CPUA 3DYPA 1H2JA 1PWMA 3VTRA 2Y61A 4GQBA 1JUBA 2JKPA 2UBPC 2NXIA 3LG3A 1XYFA 2I14A 4FX6M 3KAOA 5JIPA 5HJLA 3ZWSA 4Z1BA 4WLCA 3ANUA 1E9IA 1OIFA 3GIPA 4LAKA 3W7HA 1ITUA 3NQ6A 2J6XA 1B3XA 3GW0A 2XFYA 3W38A 1WP6A 2DT1A 4WUIA 5DXYA 4B5NA 1AA1B 3URNA 1OBAA 2FHBA 1JJKA 3BURA 2ZRYA 3INPA 1QW9A 1KB3A 4UXDA 3GO2A 1OGGA 4NJJA 3PNUA 5C7VA 4UFMA 3I3BA 1OGSA 3D5HA 4AC1X 1NP2A 2EKGA 1P0DA 1JYVA 3ZVHB 3T9PA 2C8NA 3PSWA 3BLPX 3W1UA 3B04A 3LNMA 3QW4B 1T8QA 3NO3A 4KCVA 3WBWA 4OVXA 3RLGA 1K9FA 2DUZA 4TX8A 3PTMA 3W29A 1C8YA 3N2TA 4U2YA 4O52A 3RF9A 1NFBA 3W7CA 3I4EA 3P0XA 4B15A 4W88A 1CTNA 1LDCA 1EQCA 1T6MA 1XC4A 2W67A 2WKLA 1VIWA 2BDQA 4PCTA 2ASHA 4X9YA 1WAUA 4IMDA 1KM5A 4EPBC 1H1YA 3UQNA 4BQ2A 2CITA 1TPFA 1W5QA 1VBGA 3VDBA 3KOZA 3NL6A 3QOMA 4HMEA 4Z2GA 3FYPA 4TR9A 1E6ZA 4GISA 1XLIA 4JTRA 5AECA 2QAFA 3L65A 1SVDA 2AGKA 5DT5A 1EKOA 2X09A 4JKKA 4Q8TA 3IGXA 5BXTA 1EJXC 3LYEA 4ROQA 1FXQA 1KGWA 1Q5MA 1JFHA 1HGWA 1H49A 5FEWA 2C1IA 2CIPA 3WQFA 2QCEA 1L6FA 1BYAA 4LT9A 4NJKA 3ZJ7A 3E0IA 4AMCA 2W79A 2MANA 3PJTA 1F76A 2FGLA 5I77A 3E02A 5HR7A 1WKDA 4Q4KA 2QXWA 4K8GA 1F3EA 2V2CA 4TUFA 3AIQA 2IPGA 1QPOA 3CASA 3QGAC 3DKLA 1V5XA 4CQAA 4KBXA 2ISVA 5G1YA 1FX6A 1NFPA 4QLLA 2BWGA 3KW3A 4UZSA 3TH6A 4LYRA 3VDAA 3PULA 4MY8A 3LN3A 3W6YA 1DJZA 3UVAA 2FH8A 3ZT6A 4GD0A 2XIQA 2AMGA 1R2RA 3VPLA 3UYIA 1IF2A 4LVAA 1UPMB 4FAMA 1ZSXA 2ZDSA 1P1XA 2XN2A 3EOSA 1TPWA 1PO9A 1GTHA 1KRAC 4GNJA 1PYFA 1N8FA 3EYPA 3FV9A 4O16A 1G6CA 3OBKA 4DWSB 1UOKA 1X98A 3M6YA 3GG8A 2OWWA 4N9EA 5HA7A 4MDPA 1WZMA 2GQ8A 3PAOA 4GJJA 3U4AA 4O11A 4FX8A 3EPOA 3O0KA 4PSPA 3G3DA 1Y8BA 2WC3A 4UNIA 1XD0A 1TPUA 3WDJA 3VKCA 2PP3A 5FSEC 3TXVA 2PCQA 2W63A 2VGBA 3QV8A 1G67A 3C5QA 1IWPA 5HUOA 4Q22A 2VOTA 3UCCA 2UY4A 3GFZA 1W54A 4LNYA 4WEVX 5LNRA 1IV8A 1IIHA 4L64A 2QCDA 3V1PA 4QM1A 3B8SA 4GC4A 1UASA 4PB3A 4C65A 3U3HA 3HPZA 3NURA 1OC5A 2J7BA 4KKXA 4JTTA 2AAAA 4A8LA 4I6KA 3V75A 3GH5A 4HNCA 1Q6OA 3NEHA 4UOQA 5AB3A 4MWAA 3C0JA 1ICQA 1NDWA 1A3WA 4DAFA 3NSNA 3NOYA 1OG6A 2CZVA 1JCNA 4Z1AA 3AROA 4MKVA 1H09A 3UXLA 3R0KA 4L4MA 1XGZA 3L4XA 5BW6A 2RGMA 4N6FA 5E5CA 4FLOA 4HP5A 1EP1A 5HINA 3DBPA 3HMCA 1EF2A 2D73A 2NX1A 4KGJA 4RDWA 1S2VA 2DUXA 3AZSA 1LQ0A 3V5CA 1FBAA 4QAIA 4L1XA 4UUIA 2WKGA 2BVYA 3TTQA 4Q8VA 2AQOA 1UHVA 5G5IA 4R33A 3I7RA 1LLOA 3H26A 3VMOA 1OCJA 3TYCA 3AC0A 1PYMA 2Z2AA 1ZRQA 2XWDA 3A3WA 4E4FA 5BZAA 2GUBA 2OT1A 3W7QA 1OM0A 3MV11 2PDIA 3S9ZA 3UZZA 1XKYA 1IQ8A 3BW3A 4YTRA 2RDTA 3I6EA 2Z29A 3WH6A 3WSUA 2OLSA 4DUVA 1CW2A 2WANA 1RHCA 2Z2BA 4G2DA 5CAHA 4FHAA 3IIOA 5CBIA 1Q8AA 5CG7A 3WJZA 4AF0B 2YL8A 3H2AA 1X8FA 3M16A 5XINA 4Q7IA 5H6HA 3UJRA 1OY0A 3CMFA 3MDUA 1C92A 6REQA 2BB0A 4HA0A 3FXGA 5DLCA 4I9AA 2OQYA 4Y9PA 4NAFA 1GW1A 3VZXA 4FNUA 3UG5A 2PWHA 4JR5A 1TKKA 4LVGA 1EFZA 1Q6LA 5F2GA 2FMOA 3ITTA 4O1BA 3WIJA 3ANYA 3SFKA 4MWAC 1R3QA 4XAYA 2WV8A 3PJWA 4ZTYA 3ZXWA 1UYQA 3CZ8A 2EPMX 3BSHA 4ILSA 3AO0A 3WMSA 2VVSA 3WK1A 3WBYA 3GNXA 3WQ5A 1ESWA 2YBUA 3F4WA 1RH9A 4H19A 2Y4SA 4ZODA 4HYWA 3D47A 3GG7A 5TNVA 1RPXA 4IGHA 2AGTA 3KOFA 5AHNA 4GG9A 1HF6A 3CPRA 4RJEA 1K7XA 3S2NA 4HU8A 2D0FA 1FWDC 2BZNA 4A2RA 1DOSA 3K5XA 4DO5A 3H21A 2CZEA 4FOUA 4OUEA 3LS9A 2EJ1A 3LCXA 1BQCA 2J24A 3UGVA 5C9XA 1G1YA 1F6PA 3VMPA 3LBOA 5DMMA 2J25A 1RVGA 1XF0A 1KFJA 2H3DA 2ZX6A 1SM9A 1O94A 4B5VA 1CENA 1J0YA 1RD5A 3GUWA 5KEZA 4XSLA 2WMFA 4I6VA 3BJSA 2C19A 2NWSA 4DY1A 4K6AA 5H8MA 3KUMA 2FPTA 3DZ1A 5F1UA 3GSMA 4H6KA 1R6WA 5D4YA 3T7VA 2BVTA 3LZ3A 3R4IA 2D2OA 3N11A 1QI0A 1S1PA 4AIBA 3GXFA 1E9YB 1PHWA 3BOFA 1EA9C 3LHTA 3FCPA 1QK0A 1VC4A 4FS9A 4LUTA 1ECEA 3MYPA 4ZSUA 2H8ZA 3B97A 2VUYA 5CLTA 1NOWA 4D1JA 5DMYA 1UR3M 4EF8A 3TC6A 3UT0A 3VFCA 1BWVA 2BOFX 3W3OA 4KRUA 3CIXA 3XIMA 2WSKA 2W3ZA 2ZOXA 5HDRA 4TOQA 1PZ3A 1YXDA 3E96A 3VUSA 1BRLA 1UP3A 1KFBA 4AIEA 1B57A 3W00A 4FXFA 3A22A 3KRZA 4RPPA 3L23A 5BRPA 3B0PA 4I9JA 1F61A 2ZICA 3SRFA 4I8DA 3T0AA 4EK7A 1YRRA 4XUGA 1SJBA 3K30A 3TNOA 2FPYA 4PMVA 5GJPA 1UW9A 2D24A 4O1DA 1PVNA 5JQ9A 1I8JA 4KWOA 4UCFA 1PIGA 2G50A 2QPUA 4GUHA 5LKYA 3PZUA 4JIPA 5I3JA 3FA3A 3QHMA 4ZQOA 1O7AA 1QFEA 4B3LA 3T8LA 4YWIA 5C9WA 3NYDA 4R85A 1TRDA 5T8GA 5A94A 2OGJA 4L80A 1OHLA 5HMDA 1LYXA 3EOEA 4QJ1A 4FPSA 5T9BG 2QT3A 1W17A 2A3HA 4PMUA 4F2UA 1TE1A 3OLGA 4JTJA 3GXIA 1ZCCA 3CV7A 4WJEA 5BROA 2EJAA 4TV5A 1OADA 2P53A 3SN0A 3LGDA 1P0KA 3EKGA 2QUVA 1Q2SA 1XIEA 2G37A 2GZXA 4O1CA 4S3BA 4E4UA 3BSGA 4TV6A 2PDJA 1LWIA 4DUXA 1YNYA 4OFCA 5I07A 2VC6A 1TRIA 5GJMA 3FIGA 3MP4A 4MB1A 1GG1A 2EF9A 3DERA 3GHTA 4CQ9A 1MXDA 5FF4A 3GVQA 3VGFA 3CV1A 3R1ZA 2XM2A 1L2QA 1HTIA 1EJWC 2B7OA 3UNDA 4J2PA 3T6CA 4IPPA 4ZGYA 3PHAA 4KGLA 4RZ5A 3OVRA 2Y6ZA 1R2SA 4I5RA 1DJGA 3ZWTA 2CWNA 4AISA 4V15A 2E28A 2BNJA 2VOMA 2CHRA 5HNNA 4ZQMA 3KOXA 1SPQA 2VR2A 4GO9A 2PLJA 1H0IA 3M5YA 3E38A 5FIPA 2PGRA 4HBKA 2P3ZA 2PWVA 3P3BA 3GXTA 2ANUA 4GYPA 3WLLA 3FSUA 1ML1A 1Z44A 2FZMA 4HZMA 1OFEA 5HWNA 1PZ0A 4HNNA 4FOKA 2QW5A 2GJRA 1XRSA 2NQLA 5F2IA 3ZR5A 2J9YA 2NXHA 3JVAA 6TIMA 4XAFA 1E9ZB 5D9NA 3AXIA 3OGSA 1BEUA 2DH3A 4Q4SA 4F0HA 1QJWA 5I3FA 4H9ZA 4DWSD 3S4TA 1UA3A 1J18A 3FJLA 4HHPA 4QISA 3U8GA 3N9KA 2HCVA 4NXKA 3QSTA 3TC3A 1GGOA 1MW2A 4NIRA 3TFXA 3VNDA 3GVWA 2BXYA 5CC3A 3BGJA 3EAUA 4QP0A 2WO5A 4I7UA 1K8XA 1SJAA 3MS8A 4Z42C 3WJWA 2VD8A 1HJVA 4NI3A 3DBNA 5CSUA 4U10A 4FIQA 1WYIA 5AYYA 1TX0A 2E3ZA 4M19A 1AFSA 1LTDA 3PN8A 1BLIA 5D04C 5A6JA 4KMQA 4PBEA 2BX7A 4F0MA 4LC6A 2WLYA 3OJGA 4NAEB 5BOEA 2J75A 1TTPA 2CBJA 1BXCA 4DB7A 4GCAA 3MBFA 3H2NA 4N9CA 1RCXB 1Q63A 4R27A 2FJKA 1AQHA 4RV3A 2QMKA 1SW0A 2QCLA 2XZ7A 3W7MA 2J7EA 3VKAA 5D2YA 4NZCA 3QTGA 4M29A 1QWGA 2R14A 1SQ7A 4WDWA 2FHFA 2CU0A 1VFLA 4YTSA 1T96A 1DVJA 2ZE0A 3CHDA 1WDPA 3TSMA 1I1XA 1TJPA 3K8KA 1VRDA 2R1MA 5FOOA 3HQOA 4AIOA 3I4KA 3SGZA 5KTLA 4GZ7A 1ZNNA 3BG3A 1V0MA 3WY1A 2VEFA 1ZP4A 2IQTA 1PDZA 1VF8A 4O0QA 1KBKA 3P81A 1PEZA 2DSZA 3CUFA 1HJQA 4IP7A 3A23A 3GVVA 5JVLA 1XIBA 4RV8A 2ZADA 5LIKX 1UWUA 3N2MA 4GYPC 3UWVA 2V3FA 3ABOA 3BL3A 1RLCL 4OIFA 5E9AA 5F4XA 3BMXA 3LBCA 3SUVA 2O9OA 1C8VA 4D9PA 2CLLA 5L9FA 3R5EA 4QFUA 1OCQA 2NSXA 1POJA 3P5YA 3CQ0A 4A3HA 3TYEA 4BI5A 1DWIM 1PTAA 4GVHA 3LHVA 3M07A 4JQ1A 3O06A 3WLJA 1GVOA 3ECQA 3K4AA 3QR1A 4GH1A 1KGXA 3BGAA 4REQB 2C7FA 3NUKA 1AK5A 1A0EA 2DQXA 2OELA 3MUCA 3W73A 2Q8XA 1AD1A 3C8NA 3WLSA 3RRXA 2I16A 5DMNA 4AD2A 4TMCA 1YPIA 4BEUA 3NL2A 4AX6A 3PS7A 2EAWA 2PDLA 3M6DA 4GQRA 1DIKA 1W9XA 2GL5A 5C8BB 3D6NA 1P7TB 1KXHA 1B3WA 3F2BA 3LHYA 1GVQA 3W7RA 3BICA 3LSBA 3AU2A 1GZGA 4GUJA 1F3WA 5CXPA 4M6QA 2DVXA 4CUCA 4IJBA 5FAJA 1TUFA 2J7FA 2GWNA 1H60A 4Z2KA 4W8LA 1TPEA 4CNOA 1IIGA 4IUOA 1EJTC 2D3LA 4OECA 3SRKA 5A8GA 3ARUA 4QQ3A 3GFYA 2WVUA 3A13A 1TMLA 2DV0A 2QUUA 5XIAA 3APYA 4LCQA 1RCQA 2Y63A 1A50A 3LPOA 3MKVA 4QQUA 1PJ9A 4IX0A 3VOFA 1ONEA 3TSDA 3WH8A 2NQ9A 2BVDA 2C15A 3LM3A 1A4MA 4OOZA 3LCLA 3UZXA 4DQWA 2RDUA 4PTXA 3ZT5A 4HSNA 3BARA 2WOQA 2RKXA 4PMDA 4W93A 4RDYA 5C9ZA 3NCOA 2BHUA 2PTWA 3MMWA 4D6HA 3MP5A 4GY0A 4CCEA 3N3TA 2LLEA 3SR7A 2A6NA 1O12A 3F2DA 1JCMP 3EDKA 4GPNA 4F0KA 4DJFD 3T0DA 1L8PA 3SSJA 4ROPA 2PGEA 1SW7A 3LMYA 3H23A 3WO8A 1PKLA 2BP1A 3ZM8A 4JNMA 3SCRA 4CVUA 1I6NA 1Z8AA 2BODX 1X1OA 4LUIA 3R10A 3IJ9A 3H2OA 3NPUA 2Y24A 4JIQA 1IEQA 4UR7A 4J3XA 1Q3NA 4RW5A 4FXRA 1RR2A 1FH8A 2VTFA 1LJYA 5KSWA 1KM6A 2XU2A 2DZUA 4S3AA 3OTRA 4HHLA 2OQHA 5C9UA 3DFQA 3BC9A 3PUOA 4EIVA 4BQ5A 1DXFA 4GY7A 1X97A 4C90A 4I5UA 4R9OA 3T40A 3N04A 4MMWA 4IJCA 2OXNA 4U28A 1XCWA 4QG8A 3LPPA 4EWJA 1HKIA 1V3MA 2DU2A 1NFGA 1GQJA 1I9CB 4FI4A 4PTVA 3ZSSA 1FTXA 4MPKA 1NVMA 1MZRA 1VLWA 3VGBA 3T09A 3CV6A 4JYEA 3W37A 2PP0A 3E74A 3W7LA 2NUYA 3BO9A 3D3AA 3SEPA 1YTKA 4NRSA 3AHYA 4DBDA 4LVFA 1QVBA 3G22A 4OJYA 1OK4A 2OVLA 2P1FA 3L68A 3VUPA 4IPNB 1KM4A 3GR8A 1US3A 4HA3A 3B9OA 1JGIA 1W9VA 3S9YA 3PB0A 2X1SA 5FL0A 4UBPC 2Y7GA 1V0NA 3ZFHA 1OSEA 1XLCA 1XC6A 4XB3A 3DC0A 1V6XA 4M6PA 3AWOA 3KRUA 5FJRA 3HU7A 4HPXA 2NT0A 4DVOA 3K4DA 4LJ3A 2YL9A 1JZ4A 1VCGA 1EDTA 2YXOA 2ZA3A 3T55A 2G5WA 3ES7A 2ZX9A 5G1TA 5EA9A 4UQ9A 3NA8A 6XIAA 4WR3A 3TW9A 5I23A 4YIWA 4YL2A 3UR5A 2CPUA 1KO0A 2EG8A 1YXCA 3NZRA 1AUSL 4HJWA 3V4BA 5IBXA 1BWLA 3TAKA 3M0KA 4DF0A 2WYSA 3MT1A 4NQ1A 1K03A 4NUWA 3MSRA 2FZBA 3G24A 4D6CA 4DLFA 5HWMA 3BJTA 1OWQA 3TU9A 2BOEX 2VURA 4X9SA 3FOKA 4C6MA 2Y1HA 1GHSA 4JQ2A 1GOQA 4Q8MA 1TPH1 3B8WA 2D3NA 2WZTA 3LA4A 3ANVA 1GHRA 2C13A 1Z69A 3QZAA 3MPGA 2R9RA 3T2OA 3O6CA 4AAJA 4S38A 1OFAA 2ZX8A 3WBXA 5GNZA 2PTZA 2O9RA 1T99A 5HPOA 1VKFA 3CZLA 2A2IA 3H7VA 3NM1A 3NYZA 4PMZA 1PAMA 1DWGM 3BAXA 3AQUA 2NSOA 1Y7VA 2QJGA 5AC7A 3UNTA 1WKFA 3K8MA 5CQ1A 3K4WA 5GNYA 1QPNA 2CZDA 3KLKA 1XX1A 3A47A 2R24A 3EX2A 3QHNA 1HT6A 3TTYA 2YX0A 4GE8A 3KDNA 3AS3A 1B4EA 4DJDA 2X1UA 3QMSA 1OEPA 5K3VA 4A21A 1XUUA 1SZNA 4K39A 4RNHA 3WELA 3B9EA 4HN4A 5A6BA 3CAQA 2XGBA 1ZJHA 3STCA 4P8UA 3MVTA 2XISA 2DY3A 4IG2A 4ES4A 2OX1A 3UZJA 1LRNA 1VD6A 1M68A 3ELFA 2CWXA 3LQLA 3B8TA 3EOUA 4MJZA 5CZ0A 4C1NA 1VYPX 3RHGA 3SIMA 2RFGA 4E0CA 3QSRA 7PTDA 1AD4A 1QMLA 5D2WA 3W7OA 1H41A 1EGVA 3TR2A 1QNSA 3H8AA 1XD1A 1XLKA 2DQWA 2FVLA 4UWMA 2VFDA 4YYFA 1P0BA 3ABZA 4XTDA 4A05A 3WN6A 3LCWA 4YN5A 3A21A 2CKSA 2QGHA 3CB3A 4HZ7A 3SDOA 3BE7A 3RIKA 3O16A 5JH2A 5FF0A 4Q32A 2WSYA 3NDYA 1IZKA 2YCKX 2V82A 3ABQA 1Y65A 3EA2A 1JPMA 5FJJA 2J74A 4LS1A 1FCUA 3FJNA 1XL9A 1QASA 3EKZA 4I9MA 1RXOB 2BY3A 4QE1A 2JEPA 1QATA 1QNQA 4RW3A 4WJ8A 3WL0A 3VD7A 1G94A 2VRKA 3RK8A 5EYWA 1E6QM 1UD6A 5T26A 2E6DA 2ZYFA 3OVPA 2C0HA 2YOCA 1QK2A 3EEGA 2DJLA 1YXYA 2NVAA 2X1RA 3MVIA 1MFUA 2XFFA 4NJGA 1VRXA 1HKWA 5AYIA 2XN1A 3LRKA 4HU3A 3RX4A 5IHSA 5G2WA 4JIRA 1H0GA 3GLCA 3E3HA 5HATA 3OW1A 4CLMA 3CL6A 3ZLGA 2CXGA 2QIIA 4O14A 1QU4A 4OGZA 3VAVA 3DFNA 2QHAA 2R1PA 1VGAA 4Q4QA 3IARA 3WLHA 5FEXA 1VBJA 3DFHA 1VPYA 5BXRA 3QZEA 3SUUA 3PBUA 4NU7A 3EOOA 4Q8WA 3JRKA 4DJDC 5AC6A 1AZ2A 4FF5A 4P2VA 4AB4A 3O6DA 4WGHA 3A5VA 4LBSA 4R53A 5JH1A 3UYCA 4JTAA 3LRMA 2OX4A 4FX7A 2G3IA 3S0CA 1YDNA 1JIBA 3F4CA 3NQ2A 1KGUA 3W86A 1VAHA 5G4HC 3MV01 5C54A 4GIYA 2UZ9A 1OYBA 2FZDA 2OKTA 1WKEA 3BW4A 3OHMB 4PB4A 1TV4A 3C61A 1GOMA 4FP1A 3W88A 4GA8A 4M6UA 4S2BA 1F2JA 5A6TC 3QN3A 3GNPA 3AALA 1Z32X 5FCZA 1OFDA 2AMXA 1JEZA 3MA8A 3N13A 5A2CA 3BDKA 3LQGA 3R8GA 1Q4NX 4AZ6A 5FACA 2VELA 3IIVA 4UMAA 1ZJBA 1A5BA 4P7LA 1XBXA 1JPHA 4PEEA 2OTDA 1NAL1 3EB3A 4MNMA 5IRPA 5ABFA 4QGCA 3GRIA 3VKDA 1H11A 4AWTA 4H8HA 3L4UA 3LCFA 4HYVA 4GYJA 2VZOA 1YPXA 4GH3A 3RJXA 4CN1A 3FKKA 4AWSA 1GWJA 4AX7A 3M0XA 3BLLA 2C18A 2J77A 2F6XA 3OOQA 4ASTA 4MLRA 3E2QA 1RP9A 2QCCA 4DBEA 1JYWA 1XDJA 1Q65A 1CNVA 1UOZA 5LHEA 4ZQNA 2PDUA 4MUPA 3V0UA 1SR0A 3SUTA 1K8ZA 2P88A 3COTA 1P0EA 3CZGA 2FFIA 3DI1A 2IQ0A 3LD5A 3PZMA 3O0FA 3U9IA 4A8NA 1W37A 2PWFA 3L5MA 4ML9A 4XO6A 3VIKA 1BAGA 5JXQA 4ZB5A 1EIXA 2DVUA 2PDHA 1PHQA 2G4FA 4IIBA 3TONA 2ZQ0A 2IS7A 3TN3A 3FSTA 2QLYA 1UBPC 3M0YA 3FYYA 1YDVA 4JN8A 4O4VA 1R8LA 3O9NA 1L0PA 3NQCA 1R7AA 3F2CA 3DHPA 2BVWA 4H9XA 4OQVA 5HQLA 3M0JA 2EG6A 1TTJA 1BTCA 1R47A 1BQGA 3OB8A 2IUZA 3U48A 1HO4A 1TWDA 1OK6A 1XBYA 1XIFA 3VINA 4LUSB 3W7PA 5I3GA 4E4PA 2QMJA 3KBSA 1B3OA 3SQLA 1T8XA 4DJEA 1ADOA 3M1ZA 3AMCA 4K8HA 3IVTA 3VNKA 5BXSA 4YTQA 2CNCA 4OT7A 2KX9A 1UR0A 4W8BA 4NVTA 2CLEA 2XIMA 1OT1A 1B4KA 2IPJA 1HNYA 3SCOA 1AH0A 4PUEA 2DZPA 4W9TA 4LF2A 4M82A 1EBHA 4PCNA 3O63A 1H62A 3VU2A 3DFOA 5J04A 1WZAA 3M9YA 1DIOA 1LUCB 1W8SA 4JDYA 3PZTA 1X8CA 1LQ2A 4EAMA 4MZ8A 1QNPA 1FVPA 3AIBA 2VGIA 5CZSA 3RMJA 3DHFA 1MQQA 1JCXA 3EWYA 1MEWA 4MNLA 4DO4A 5DO8A 1P4CA 3QPEA 1B9ZA 1E4NA 1W3IA 2O9TA 2DW6A 3VMNA 4F4RA 1E0TA 4W4QA 1PPIA 3P74A 3RPTA 3AS1A 3QHOA 3NPVA 4S2CA 3PNZA 1ITQA 1HO1A 5I3IA 3SIZA 3IGUA 2CYGA 2GVLA 4R9XA 1QUMA 5JU6A 4PCPA 4XAZA 4Y8EA 2EQDA 1EHAA 5BWFA 1CI1A 1XPGA 2HK1A 3VYLA 1ONXA 3TQVA 3HOJA 3MU7A 2AL2A 3VK5A 2GSJA 1LBFA 2VCBA 3B0VC 2GGGA 4RNJA 3TJIA 3VGGA 4AZCA 1JYXA 4XBKA 1YTDA 3SCVA 4EACA 1UJQA 1KM2A 2OJPA 3GHSA 8XIMA 1D3CA 3LRLA 3H53A 1VZWA 3QV7A 3VCNA 3SRHA 4AD3A 3C2FA 5M03A 2ZWYA 1BKHA 1RBOB 2WSRA 5FEPA 4URIA 5FAGA 1WDSA 4XD4A 5IOBA 2WZEA 3UF9A 3LY0A 1K6AA 1EGMA 1AW5A 3CQIA 4D72A 3BCFA 3W22A 4X0VA 3MCMA 4GUFA 4E8GA 4PMYA 1GKPA 4JIEA 3AYTA 2SFPA 2XHYA 4WK9A 4DJEC 4MYAA 1DQWA 4UTJA 5LZLA 3MJMA 4UIOA 1EXPA 1EPVA 4D2JA 3N14A 1G9HA 3P62A 3EWUA 2DT2A 1FWAC 3WH5A 4DZHA 4NJHA 1LG2A 5AHIA 1RA5A 4WX2A 4HIBA 5HANA 3RR1A 4F0SA 3EPMA 2QV4A 4Z2JA 3GXNA 3WJXA 4M1BA 2WM0A 4LRSA 1E4IA 3WDPP 1U22A 3CNYA 5BU6A 1GNXA 4WZHA 4DF1A 3QH2A 4IMGA 4AHQA 1W9BM 3MDWA 1R30A 2I7GA 5TQLA 2FH6A 2ACRA 3ARRA 4C5YA 3E0FA 3SURA 1EC8A 3S1XA 4L9ZA 1FWGC 4ZOEA 3SBFA 3VX1A 3L0NA 1JRBA 3GNNA 3BAJA 4R3UA 1VFOA 5CG0A 3S6DA 3WQOA 3WYZA 3QMTA 2EPHA 4P7QA 5DN1A 4JKMA 3MMTA 5EFDA 1I1WA 1HGYA 1YNQA 4IIHA 4JNYA 4NNAA 1EJ7L 3WMCA 2CCRA 1XRVA 2WMIA 1Z41A 2CBIA 2HISA 1SW3A 5LA2A 4CNSA 5GQBA 1UIOA 1G7VA 2QULA 3AZRA 3N2BA 2KAUC 1K70A 3U7VA 4WKFA 4DXVA 3VIPA 2A3AA 1NOUA 1XW8A 2FVKA 4QE5A 1XH2A 4NI8A 3ITXA 3NGFA 1XLBA 4PEKA 1BTMA 1MSSA 2PLKA 3R94A 3NL3A 4NKCA 2ZWZA 3ALGA 2FQIA 2VWSA 3BOLA 1WXJA 3A5FA 1NJJA 5I7GA 4AD0A 5HR6A 4W87A 2YDRA 3W81A 1TA3B 2E9BA 2PWDA 4MJMA 3II1A 4NXSA 4CEUC 3UWYA 4O1AA 2Z00A 4KEZA 3CK5A 4BEQA 3PTQA 4JN7A 1ICPA 2YJQA 1TV5A 3N1AA 1KBLA 2VZVA 4CNPA 2ZVRA 3FY1A 1G4TA 1RJQA 4UMCA 2FHCA 1XIJA 5DT7A 4YYCA 1VP5A 2YR1A 4MWAD 2DDXA 4KRTA 2UY2A 1RY0A 3SY1A 1QW8A 5EFFA 2F38A 3AFBA 1SJDA 4MB5A 2J88A 2XH7A 1HL9A 4NX0A 4HVXA 3NFUA 4Q4MA 2WJDA 1O1HA 4D8ZA 3SN1A 3A4XA 4WY0F 1A5MC 3WCZA 1HP5A 2GDUA 4PBFA 1W5PA 4WXZA 3CO8A 3V7PA 4U3CA 2DSUA 1VJIA 4IXHA 2HQAA 4M7SA 5FEZA 3CTLA 1KFKA 1JCYA 2KZHA