5G4EA

S. enterica hisa mutant d10g, dup13-15, q24l, g102a, v106l
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
220
Chain Sequence
MIIPALDLIGGTVVRVVRLHYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTALKSPDVVKGWFERFGAQALVLALDKQVASGVSLEQLVETYLPVGLKHVLCTDSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords SULFATE ION
total genus 66
structure length 220
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4eA00
2OX1A 4JYDA 3W1QA 4FIRA 1YLVA 2E6FA 4FX8A 3PBUA 3O6DA 3FIGA 1EWEA 4Q4KA 4R53A 4NNCA 1JUKA 4RZ4A 4M7SA 4NNBA 2WNQA 3H55A 4XUGA 1WXJA 2NXGA 2GQAA 2WQPA 1H50A 3PG9A 5C5YA 1R30A 2YW3A 1AMKA 3OVPA 1TTQA 1XBXA 2BSLA 1GG1A 2XN2A 2Z1BA 4JXCA 2QCGA 3C6CA 3W7HA 4UNKA 4I7UA 3T78A 1WYIA 1W3NA 1W54A 3GIYA 3IVTA 5CPOA 3E12A 3G1YA 1SSDA 3BG3A 1AG1O 4QISA 1KBJA 2E6DA 5G4EA 4POCA 5KTLA 1GYLA 1TQJA 3IIZA 4QIUA 3PF3A 5LGZA 2C13A 2ZRXA 3M41A 3MJYA 4FNRA 2ZRYA 5D05A 3NO5A 1IXOA 1YDOA 4LS1A 2XN1A 4WZHA 4IUOA 1OHLA 2FJKA 3P80A 3GDRA 3IEBA 1PV8A 4Z1AA 4O19A 4ZQCA 4M6QA 4O1CA 4FNQA 3HPZA 1F5ZA 1FWTA 3LHYA 3QMTA 3OHIA 3LTYA 4O1BA 4XWUA 1ICPA 5BMXA 4S1FA 1TYGA 5KZMA 3CIWA 4IGHA 4K8EA 3PBYA 2X1SA 2RFGA 1X1OA 3M5VA 5EA9A 4A3UA 2ATSA 2WO5A 3C0JA 3SGUA 3DAQA 1QPRA 5DLCA 1ME8A 3W7EA 4N9BA 1THFD 3LB0A 1H1YA 5HMSA 1KFLA 3O07A 4MOZA 2F84A 1D9EA 2I9EA 4XZ9A 1FXQA 4UR7A 1OJXA 1ZENA 3W1PA 4EF8A 1O95A 3R12A 1XDMA 4LW7A 1LDCA 3NQEA 1OF6A 2XFWA 2QCEA 5KSWA 1IXPA 1SW3A 4M5PA 5K7JA 3M7WA 4O52A 1SFLA 2FPYA 1MZHA 5C55A 1RPXA 1JR1A 1TTIA 2RKXA 1H7WA 4JN6A 3KRZA 5BNKA 3LHTA 1FWWA 4Y96A 4NU7A 1VRDA 2CLHA 1J4EA 4YLWA 3S1VA 2G96A 2J88A 4JDBA 1LOLA 2ZZ6A 4HNVA 1DJQA 3CPRA 2PC4A 1EP1A 5G1TA 3W1UA 3IGUA 4MZ8A 3UQNA 1B4KA 3PB0A 2VFDA 3GLCA 5LZLA 3R8RA 3NL3A 3W7CA 4OWGA 1QPOA 2QUUA 4EWND 2HSAA 4JD4A 4CNPA 1PVNA 3W7GA 4DF2A 1XCFA 2WJZA 5IM51 3LV5A 3LRMA 2Z0IA 3AJXA 2DZTA 1Z41A 3NNTA 5TQLA 3PR2A 4G1KA 1T8XA 3RLVA 3PBVA 4ML9A 2G97A 1TV7A 3N73A 1AW2A 4O28A 2NV2A 1I2RA 4UTTA 3W7NA 3QM3A 4UMAA 5EL1A 1MEIA 1OFQA 3HMJG 3QSRA 5CPMA 3C2OA 1RQEA 4IJBA 3W1MA 1TB3A 2RDTA 3ZWSA 3PC0A 4UFKA 3ZS4A 1YXDA 1V7YA 2Y6ZA 4UTJA 2VENA 3VCRA 4FNSA 1NF7A 4Y6GA 1Z44A 1VHCA 3KVMA 1O60A 2ZDRA 3OEXA 4OQVA 2ZRUA 1WDWA 1WBHA 2CLIA 1M7PA 2G5WA 4FXRA 3TKFA 3STGA 1F2JA 5D2YA 1KM6A 3ANYA 1P0NA 2YFOA 1YTEA 3WK3A 4HNTA 5D2WA 5HJLA 5K4ZA 3G1XA 3T40A 3U2OA 4NJKA 3KAOA 4WD0A 4CNOA 3GX9A 4GE8A 1W5MA 1OK6A 3W88A 4PL1A 3S5OA 3ATYA 1RV8A 3WJYA 3W7KA 2ZYFA 2PCQA 3QFEA 2V81A 3TSBA 2HMCA 3DI0A 3B04A 2C14A 3FA5A 1TSIA 3O1NA 3LCHA 4LC6A 3HGJA 3LCLA 6TIMA 3P61A 1QWGA 1L2UA 3Q2DA 3TW7A 1VZWA 4O16A 1FDYA 2ZRZA 1I2PA 4RJEA 2ZA3A 3WK1A 1C9DA 3OBKA 4CQAA 3LCWA 2QR6A 1ZNNA 4L4LA 4N4QA 4MFDA 3DXIA 3HPSA 1KLYA 2Z6JA 3W76A 2YYUA 4LTSA 4PODA 3MBFA 1N55A 4AF0A 3W1NA 4KFNA 3OIXA 4A29A 2DZPA 1RR2A 3QRHA 3GK0A 1K8XA 5AHEA 2DZXA 6ALDA 2CLKA 3W7LA 2NZLA 3S5YA 3LCGA 4EIVA 2FTPA 5LNUA 1ZJIA 4WX2A 3LLFA 4CCDA 1SO6A 2YCEA 3GDLA 5EKYA 4ZMGA 1FUYA 2C19A 3P81A 3W2MA 4U28A 2V2CA 4JTTA 3W6YA 3JRKA 3R89A 4JX4A 1JCYA 1DV7A 5FEPA 3LRLA 1YDVA 3NPVA 3I65A 3KRSA 1TPDA 1XC4A 3LBCA 1FCQA 1Q3NA 1Q6RA 3EKZA 2ZRVA 1WBJA 4TMBA 2VC6A 4B5NA 3BARA 2VELA 1ZAJA 2C3ZA 4ZQRA 4IOTA 4WOZA 4I9AA 1VYPX 1AW5A 5H91A 4MZYA 2Y85A 3G0SA 1CI1A 1LORA 1SZEA 2VKZG 4UR8A 4DELA 2FFCA 4DPQA 4O4VA 3NPXA 2VFGA 3P62A 2VFEA 4NJJA 3G1AA 2WV8A 4ZVJA 1AK5A 4X22A 3TV8A 3TE9A 4UXDA 3P82A 3JR2A 1K7XA 4HPXA 4FNTA 5D38A 5LHFA 3UD6A 1Z42A 1K03A 1W5QA 3GAYA 4PC8A 2QCFA 3S1XA 3FJLA 4BK9A 1ADOA 4GUGA 3MI6A 1DHPA 1LYXA 3KRUA 2V2DA 2VOMA 3STCA 4OE7A 3S6DA 3LTSA 2YW4A 1UB3A 3CC1A 3GDMA 3BPWA 5C2XA 3BG9A 5D02A 1LTDA 1NVMA 2JGQA 1ME9A 3P74A 1H61A 4PA8A 1BKSA 2EKCA 3EWUA 1ZFJA 4C1KA 4DEFA 2P0OA 4O11A 2CWNA 1XBYA 3KFTA 1KM1A 1W3TA 1BTMA 5CGQA 4HKPA 1OFDA 3F1QA 3LXAA 1HL2A 1KFKA 2Q8ZA 2OT0A 3TJXA 5DCEA 3W7RA 4FNUA 2BXVA 2GVLA 3NM3A 1J5TA 2QJHA 3MHUA 1L9WA 4EF9A 2J9YA 4MFEA 1FDJA 5C6MA 4GWEA 1LBFA 5HUOA 3BLFA 2NX9A 1FX6A 2XN0A 3DH7A 1I2OA 4JTSA 1IF2A 1GVRA 4JX6A 3QEZA 3NXFA 2J6XA 3USBA 1SO4A 4RLIA 3QC3A 1H63A 4UFJA 3EX2A 3O16A 2B7NA 1KM4A 1SSGA 2E5BA 5L6UA 2Z6IA 4A22A 1OX5A 3TQVA 1XXXA 3TJLA 3EB2A 2V8ZA 4O53A 5J5RA 4XQ6A 4WJEA 4NZFA 3VE7A 3P67A 2C18A 2E1DA 3IGSA 4O50A 2FIQA 2BTMA 4MYXA 4K39A 1K02A 1QR7A 2W6RA 1TPC1 1LRQA 3BV4A 3LCXA 3STEA 4GRSA 1HUVA 2G95A 2RHGA 3NDOA 3P8JA 3MI3A 4K8HA 3MBDA 4JEQA 3W22A 4KFOA 3ZR4A 3W2UA 3C52A 1RQHA 1KV8A 1H60A 4Z0SA 3TU9A 3MWAA 1A5CA 2IQTA 2DZUA 2NWSA 4MVAA 3NQGA 3W83A 1DL3A 3CWOX 4PTNA 3NYZA 1PS9A 1TPFA 5BOOA 1LM1A 3IVSA 4RK8A 3MI2A 2O7QA 2V2HA 3KXQA 4JIQA 4QITA 4YMZA 1R2SA 3T7VA 3N9SA 4RXGA 1C8VA 1FCUA 2KZHA 4E0CA 1YXCA 4YL2A 5DY3A 3UWYA 4OT7A 4NXSA 1MXSA 2A7PA 3TMQA 1FXPA 4NVTA 1IXQA 2EGZA 3PAJA 5E93A 4MY8A 2OCZA 2OMAA 1EPXA 3E96A 3I68A 4QAIA 1ZY9A 4OV9A 5FF4A 1YPFA 3WJWA 3W74A 2QF7A 3TDFA 3UWZA 1DKWA 4OHQA 4E2BA 1SFJA 2AGKA 3LOTA 1GVQA 3C2RA 1EWDA 1QOPA 5KZEA 4HN4A 1OX4A 5KMYA 4WUIA 1HO4A 1MSSA 1TO3A 3C61A 3RLUA 3O06A 3SJ3A 1GWJA 1LZOA 2E77A 4RKAA 3NQVA 2FB3A 3FOKA 3G8EA 3GYEA 4IQLA 5I3KA 2DZVA 1HFBA 2VFHA 3P5YA 5D04C 5CZ0A 4JYEA 3RF9A 3HF3A 3M47A 1BWKA 5C54A 1KA9F 4H3DA 3L2IA 1S5VA 5FESA 3TNOA 3ZFHA 1LBLA 1KBIA 3NL6A 4JX5A 4IXXA 1I45A 2A0NA 3DFOA 3STFA 4QSHA 5E0KA 1M6JA 2P1FA 2AAMA 1G4SA 1H1ZA 5U4NA 3SIZA 1OFBA 1U83A 3TROA 2QCHA 5D37A 1RVGA 4RV8A 3L0KA 1TIMA 1VJIA 5F2GA 2JKAA 3TQKA 2Y7EA 3GXNA 4JY8A 1VCFA 4PCFA 3ZWTA 5AHMA 4YCOA 3BG5A 1ZCOA 3EXSA 3NZ1A 4A2RA 4AHPA 4JY9A 4LC8A 4NQ1A 3L66A 2YR1A 5FF0A 4N6EA 3MYOA 2ZA1A 5LNSA 4RXFA 1QMLA 2PRLA 3W87A 3MP3A 3NA8A 3EWZA 2C6QA 1HTIA 1P0KA 1LLZA 1WV2A 2H90A 4IX0A 3TX9A 2Q3OA 5D33A 4EVZA 3OA3A 1W37A 1WOBA 2CZDA 5SWUA 2GVJA 1JUBA 2QDGA 3LDVA 3DFQA 5AC7A 4LVDA 2QJIA 2QKFA 1QCWA 2E5DA 3W7PA 2RH9A 3UNDA 1UASA 4ADTA 2TYSA 1ME7A 3EWXA 3V1PA 3AO0A 4CQ9A 4RZ6A 4JDYA 3P84A 3OG3A 4AEOA 5LGXA 3DFSA 3M1ZA 3MUXA 4KWVA 3DHFA 3KVJA 3KX6A 2NX3A 4HSOA 1UCWA 4FF7A 5F1VA 2JKEA 2NXHA 4PL2A 3N2MA 3NQAA 2DU2A 3L5AA 2CLEA 1GEQA 3MMTA 4UMCA 5DCDA 4Y90A 1I8JA 1VLWA 2JGYA 1OG0A 4GBUA 3U6WA 5G2IA 1ZAIA 3HG2A 5EYWA 1UJPA 2Y63A 5AFDA 1A53A 3GXPA 5DXXA 5F2MA 1QO2A 1TPH1 3EX6A 1DVJA 1OYBA 3HG5A 4UNLA 4GUFA 3R13A 3BVJA 1LRNA 3L5LA 4QQ3A 2ZBTA 3PM6A 1M5WA 1OYAA 3S5ZA 3CTLA 4IX2A 4Z1DA 4MY9A 3C56A 1LBMA 2E6AA 3C8FA 1YPIA 3CU2A 1H7NA 1GVSA 1LROA 1X1ZA 2A21A 3BW3A 4IMEA 5K9DA 4LUJA 5D30A 3G18A 5I3FA 2DP3A 1EP2A 5MHBA 4S2CA 3NQ7A 4UC5A 4CNNA 3PULA 2Y70A 2ZCGA 2X1TA 3LHZA 4WY0F 3S5NA 3LHWA 2BWGA 1TPUA 2B0MA 3E49A 1XDLA 3B8DA 1G4EA 2X1UA 5FF2A 3M5YA 1XBZA 3L9CA 2NXIA 3EWWA 2FPTA 1JQXA 5IBXA 2QAPA 3U8GA 2NWRA 2X2GA 2VFFA 4UTWA 4N02A 1QAPA 3NZRA 4LOCA 3W75A 3LLDA 1OVDA 3KVKA 3SI9A 4ICNA 4IMGA 4XBKA 2J9XA 2ZRWA 1TPWA 4BWLC 1U5JA 2GJLA 3TAKA 1H7OA 3I7SA 2WNNA 4MIMA 1SU5A 5EBUA 3CEPA 2ISSA 1VCGA 1KFBA 1GYNA 1K3UA 4A21A 4BI6A 1SZGA 4GXMA 3W2NA 2CLOA 5CZSA 2ZA2A 4AHQA 2TMDA 4LRSA 4WXZA 2OT1A 2EHHA 3TFCA 4K36A 3NG3A 4O0KA 3P60A 3G1VA 2QCLA 2Y61A 3TK7A 2V9DA 1XFBA 3A24A 3G1DA 4N9EA 3CHVA 3YPIA 5HNRA 3HBLA 3DZ1A 1K8YA 4NJGA 3BGJA 1OFAA 2QJGA 1TTJA 2FDSA 3TCEA 3SW6A 4E2DA 1X8FA 1DQXA 3DI1A 3FYOA 3IIOA 2W79A 1EX5A 2QCDB 1J2WA 4AMAA 3O8AA 4O17A 3FKRA 4OBTA 3QQ1A 3LGEA 3PBWA 4N2YA 1QPQA 2Y7FA 3VFLA 3B0UX 4LV9A 1MEHA 2V5BA 1G69A 3NL2A 3M43A 5DY2A 4BF9A 5HINA 2BX7A 3W7MA 5CPLA 4PFMA 1TTPA 1TMHA 1I2QA 4DF0A 2WSRA 3TSMA 4KKXA 1UUOA 4XKYA 5K4XA 3HG4A 2ATMA 3IRDA 3DU0A 4O18A 4OV4A 4PEKA 1W8SA 1TREA 1G7UA 4JTJA 2GUUA 3BW4A 4TX9A 4MKNA 4DBEA 4HT3A 2YYTA 3LERA 2QUVA 4MUZA 2OJPA 1VYSX 4MJMA 4DQWA 3FFSA 5A8GA 3EX3A 4M6VA 5G1YA 4X9SA 3CWNA 4P61A 2X16A 3DFNA 3D0CA 3M16A 1EUAA 4ALDA 5DN1A 1VC4A 3B4UA 4S2BA 3QMSA 2D73A 4WXYA 1YTDA 4MLJA 1AL7A 1VLIA 2RDUA 2ZZ5A 5TBOA 3BLEA 4CCCA 3I7QA 4ADSA 2V82A 2E6YA 1F6KA 4ZQMA 3E02A 2NUXA 2GQ8A 2A7NA 3GAKA 4JGDA 4UFMA 3CQ0A 4TR9A 3RFAA 5D2XA 3UY8A 3K30A 2PE4A 1DJNA 3QYQA 3TFXA 4NT0A 1E51A 4GUJA 2GOUA 3C4UA 2R94A 1YYAA 3G8RA 2NUYA 4LVBA 1DOSA 3PUOA 4Z08A 3TC7A 4UCGA 5AYZA 3WK2A 2ISVA 4GNJA 1LOSA 3PY2A 3G0XA 4C1LA 2H8XA 5HWNA 3C2FA 3NQ8A 3QSTA 3KHJA 3RMJA 1KTBA 3N3MA 3MW7A 2TPSA 1NSJA 3NVTA 4WY0B 3L65A 4XBSA 2PRMA 4QM1A 2TRSA 2ALDA 4UTMA 1KFEA 3LM7A 2ZQ0A 3GB6A 3G3MA 3A22A 3W84A 3W1RA 1P1XA 4O8RA 1SW7A 2Q8LA 3QH2A 3HOJA 1VHNA 1JRCA 2Y62A 4UTLA 5G2WA 4DF1A 3T4CA 4DO4A 1H62A 1NFBA 1SZNA 1O5XA 3UPBA 2HS6A 3NQCA 3QPZA 2NV1A 3Q94A 2P10A 3F4NA 1GTEA 5D09A 3GDKA 1YXYA 5AN7A 1LP6A 1AW1A 3T44A 3L21A 3QW4B 1G4TA 1KTNA 3ABQA 2B7OA 4IMFA 2YFNA 1Z48A 3TQ0A 5J5DA 3S8HA 4LS0A 2GQ9A 3G1FA 1XM3A 2C1HA 1YTKA 3IIVA 5EY5A 4WY0A 4BFAA 3NQ2A 8TIMA 1I4NA 1Q45A 1T96A 3INPA 1SO5A 1G67A 2V30A 4ONVA 3O05A 1KFCA 3W73A 3G1SA 1RD5A 1OFPA 3SZ8A 4XTIA 4R34A 2EAWA 3P8IA 1OFRA 1DQWA 3MP4A 4Y8FA 1ZHAA 3G0UA 3W7OA 1SR9A 1W31A 2B7QA 4Y9AA 1VCVA 4MY1A 4R33A 4ZL1A 3M5XA 5ABTA 3UZ5A 2GVGA 1WX0A 3UYCA 4M19A 4ORIA 2DJXA 2Y88A 3QW3A 1K7EA 3TR2A 3RNDA 3W70A 2QAFA 3LXBA 2WKJA 3MYPA 4KFPA 1W5NA 1K7FA 3L68A 1XL9A 4UTKA 3DKLA 4O4WA 1GOXA 1BEUA 1OYCA 2YX0A 2GJNA 5IBXC 1V5XA 2E09A 4K7VA 4UTTC 1P4CA 4W9TA 2VEMA 2ZTJA 1PCKA 5AYYA 3UPWA 2I14A 4HSNA 3NM1A 1O5KA 3LRKA 2UV8G 1AL8A 3MHFA 3C2VA 2I1OA 3PUDA 3LI0A 4AWUA 4EOUA 1PHQA 4IMCA 3CLMA 1W0MA 3FYPA 1LCOA 3M6YA 4KWWA 5L9FA 3A9IA 4RX0A 4NJHA 3UWVA 3RK8A 5HQEA 2HS8A 1FCBA 3THAA 1GZGA 3G1HA 1KTCA 3SGZA 1K8ZA 3TH6A 3HIJA 4ORMA 2ZZ7A 4Z1BA 4U4MA 2OZ0A 5AHFA 1GJPA 4WOQA 1NAL1 2CLMA 3M5ZA 4Q32A 4FXSA 1LOQA 4E38A 1KM5A 1WA3A 2NLIA 3QMRA 5LHEA 4JYFA 1O94A 2A4AA 3NOEA 1A5AA 2B7PA 2VXNA 4LVAA 4ZZ9A 3DFPA 4UTHA 1OX6A 1SZFA 3M44A 5FF3A 3W07A 1F76A 3FKKA 5HR7A 3LTPA 4I7VA 1VQTA 4XTDA 4FX7A 3GZ3A 2VEKA 2BLEA 1A50A 4IWWA 3TA6A 4K37A 1L6WA 1WQ5A 2V5LA 5DBTA 1YADA 3EEGA 4CLMA 3GXTA 4NZJA 1IIHA 1TV5A 2LLEA 4BWLA 5I3IA 4ZQPA 5FEXA 2ZZ1A 4HNNA 3WJSA 1OFOA 1NF0A 2YGYA 1PCWA 3B0PA 3DHDA 1Y0EA 5TIMA 1M7OA 4UTIA 3MO7A 3P5ZA 1ICSA 5BRBA 1IIGA 1FBAA 2YZRA 4O0ZA 3PS7A 2QCNA 3LX9A 5AYXA 3NPWA 1XUUA 4FX6M 1F05A 1JCJA 4O1DA 3GR7A 4OGZA 3VE9A 3B03A 3DBPA 2CU0A 1DBTA 4JS3A 1A5SA 3B0VC 4UTWC 4TO8A 2WSQA 3BW2A 2HTMA 3S0CA 1GT8A 2DORA 1SW0A 4GUIA 4BI7A 3TUUA 3NQ6A 4JTLA 5CZJA 1QDSA 4H6KA 3LI1A 3P7YA 3BO9A 3LHUA 3SY5A 3O6CA 3W2KA 5FI8A 2Z2UA 3GR8A 4K38A 5I3HA 4LT9A 3W3OA 1TPEA 2YPIA 2DZWA 3M9YA 2CLLA 1S5WA 4O14A 2X1RA 4JTHA 1F73A 1RZMA 4HNUA 4X3ZA 3GNNA 2VEPA 4JTFA 2H6RA 3LBMA 5GVJA 2A6LA 3DKJA 1N8FA 1TJPA 5A5WA 3TAOA 3CB8A 4Q33A 2WPBA 1ALDA 4R7JA 4OU1A 3IIPA 1JULA 3LHVA 5E1QA 3FEMA 1ZAHA 2JBMA 5CKSA 1VH7A 3NR0A 3H53A 4O13A 1FWNA 3O63A 4NX0A 5CZTA 2FPVA 1KW1A 3VKJA 5LNRA 4DXVA 5G5IA 5HULA 2CW6A 1QPNA 1EEPA 2JK2A 4N9CA 3ELFA 1DORA 2DZSA 3TMLA 3GDTA 5DELA 1BWLA 3GKAA 3CM4A 2AQWA 3H54A 3QZEA 1FWSA 5D03A 3N19B 3IV3A 4O15A 3TXZA 1JCXA 2WOQA 1N7KA 3HGRA 4NNAA 3R5EA 3L0NA 3W1XA 1RQBA 1FWRA 3FS2A 2H3BA 5K9XA 4DO6A 3ABSA 4HPJA 1JQVA 4QJ1A 3B05A 3NL5A 3W7DA 1SO3A 2ZFAA 3TC6A 4GC4A 3NQMA 3W7QA 3G3DA 7TIMA 3A23A 3PG8A 3VNDA 3QQ0A 5KINA 1SUXA 3WK0A 2QEZA 4I7WA 4MZ1A 4X2RA 3PB2A 3UZJA 1ICQA 5KITA 1TJRA 3HB9A 1KLZA 3N2XA 4Z0JA 1VS1A 2W0UA 3PSWA 4AB4A 1G6CA 1OX4B 2WSYA 2TSYA 1IXNA 5D2TA 4N9DA 2BZNA 1WAUA 4IPIA 4PH6A 5U7SA 1X7FA 3B06A 4AHOA 4AAJA 1FQ0A 3QF0A 1QO5A 4AF0B 2E68A 1JUEA 1EUNA 3NAVA 2J27A 5FF7A 4AWTA 4IXHA 5AC6A 2V0TA 3KVLA 1PL9A 2Y89A 1C29A 1GTHA 1KM2A 4MPQA 4FNPA 5FEWA 1G7VA 3WJZA 1TRDA 1X6UA 3BK0A 2A2IA 4IMDA 3A5VA 4NX5A 3GKFA 3E0IA 1HO1A 2NUWA 1PE1A 4AWSA 1VYRA 1KV5A 3I6RA 1P5BA 4UFLA 5BMWA 1L6SA 3LCIA 4WQ6A 5LKYA 4LVFA 2YXGA 1T0OA 3EXTA 3N9RA 3S1UA 4YCPA 4UIOA 3RU6A 3W1TA 5F4XA 2QUTA 5G4WA 3C2EA 2CZFA 4K6AA 3C3NA 4HIBA 5H2ZA 4JICA 3G24A 1D3HA 3W1LA 1NEYA 3L0GA 4UTUA 3W1AA 1GVOA 1I2NA 1GVFA 3ATZA 3M0ZA 5BW6A 3EXRA 2VEIA 1S3HA 2H8ZA 3KOFA 1S5TA 1JCNA 3W72A 3W7IA 5AB3A 4FEZA 2A1YA 4JTKA 4M6PA 2J24A 3EWBX 4JNMA 4JTIA 3TSDA 1QFEA 1W3IA 3W9ZA 4AVFA 3CT7A 3L67A 3ABRA 4A2SA 3L5MA 5KZDA 1CX9A 4LWWA 4DO5A 5DXYA 1JRBA 3WJXA 4QNWA 4GJ1A 3S1WA 3SECA 2QCDA 1EIXA 3DFTA 1H7PA 1H7XA 2ZZ4A 3DGRA 1TQXA 2ISWA 3DENA 3UXAA 3W2JA 3LXCA 3O15A 2CLFA 2FQIA 3W7JA 1LRTA 3UWQA 1R2RA 1H51A 3HJZA 3IGXA 3S42A 4J9JA 5HWJA 1WOAA 3VI2A 4LNYA 3TIMA 5DBUA 3Q37A 2VFIA 3CEUA 4DPPA 1TCDA 3PSVA 5AHNA 4LY8A 5HR6A 3SR7A 4JTEA 4O54A 3IVUA 1MO0A 2F7FA 4O10A 5CG7A 1CW2A 2R14A 2Q3RA 1EB3A 3F03K 4LUIA 3MP5A 2A85A 1UUMA 1G4PA 3ABOA 4MLRA 5F4SA 3F4WA 3NQFA 3NGJA 4RCXA 1B9BA 1JVNA 1YDNA 1SPQA 2FB2A 4LS2A 4DBDA 4IPJA 4TIMA 3BGGA 5T26A 2ZTKA 3EWYA 1Q6LA 1TRIA 4L4MA 1H7RA 2GPTA 4P2VA 3R2GA 1QNVA 5HWMA 2E5CA 3OVQA 3QJAA 4TU1A 3EKLA 1XKYA 5F2IA 4D2JA 1R46A 3TW6A 2C15A 5D32A 1QOQA 5CSRA 3NQDA 3PUEA 4LV4A 4JTGA 4FIQA 1F74A 4HHPA 2Y7GA 5I3GA 5EMUA 4TMCA 1T99A 2QDHA 1TV8A 3V75A 2CZ5A 3W2LA 3S9YA 2YDAA 4ADUA 2PURA 1EP3A 4JTUA 5LNVA 2O7SA 2DJLA 3I7RA 1EA0A 1ML1A 3MHGA 5D2VA 3LV6A 4AXKA 3HO8A 4N6FA 3E9AA 1OABA 4N4PA 3NEVA 3QPYA 4H4IA 1HG3A 5K3VA 3HPXA 1Q6QA 1KM0A 2NX1A 3A21A 5AHLA 2A5HA 4RR4A 1XI3A 4ZQNA 3WFAA 4GUHA 4JR5A 1ZALA 4XKYB 3PWAA 5EPDA 4QNEA 4NXKA 4UUIA 2ZZ3A 1PHWA 2QCCA 4YWIA 4LRTA 3TXVA 1VGAA 1SQ7A 4UMBA 3LCFA 5F1UA 3A5FA 2ABBA 2EPHA 5DCBA 1F7BA 2YSWA 1XUZA 3FJ6A 1A5BA 4NUWA 1UBSA 3Q58A 2A6NA 2ZZ2A 1VR6A 2J9ZA 4FO4A 4RZ5A 3W71A 1W1ZA 3UWUA 2C0AA 2QCMA 4O12A 5AHIA 3PVFA 2FLIA 4MJZA 3T55A 1IGSA 1JCMP 3HGOA 3N14A 1L6YA 1MEWA 4LU0A 1B3OA 3SFKA 5CPNA 3NPUA 5I3JA 1Q6OA 4BR1A 5LSMA 1LLWA 3N34A 2R91A 1PIIA 2X30A 2WNZA 1KFJA 1W56A 3EX4A 1JCLA 3GVGA 3W85A 3W86A 3JS3A 1O4UA 1GQNA 4GFSA 2RDWA 1OFEA 2H3DA 5K9CA 5AC8A 2PRHA 1TPVA 4K7YA 1GG0A 3SSJA 2C16A 4JIPA 4MYAA 2Y7DA 1D3GA 4AH7A 4NJIA 4UFHA 2CFFA 3GNDA 3BLIA 3G22A 4YXGA 4CQ8A 5F4WA 1B57A 1R2TA 5K2ZA 5AOUA 2A7RA 2CZEA 2R8WA 3EX1A 1H5YA 3HQ1A 4BI5A 3OVRA 2ABAA 1FCVA 5G2HA 1JJKA 3HG3A 1OK4A 3O6YX 5F2LA 2EF9A 4O1AA 5CSSA 1XBVA 5LNWA 4ZQOA 2JKPA 4FHAA 1B4EA 1FY6A 1ONRA 3FLUA 1W5OA 5HUPA 3W23A 1F6PA 4FB7A 2B4GA 1R47A 4Z1CA 3THQA 1KM3A 3UWWA 4LVGA 1GPWA 1W5PA 4CCEA 1FDZA 1VPXA 3CIXA 3HGSA 3IIXA 4UFIA 5FEZA 1TPB1 1OF8A 3UXDA 4M7TA 3UY7A 4O57A
chains in the Genus database with same CATH superfamily
2OX1A 3W1QA 2EPOA 2F6KA 1RK6A 1R3VA 5BWFA 4MKSA 3FIGA 4Q4KA 3A4JA 1XIDA 1JUKA 4RZ4A 4M7SA 4NNBA 3H55A 2NXGA 2GQAA 1GHRA 2ZE0A 5GNZA 2E8ZA 4J27A 4RNIA 1ZGDA 2XVNA 1WDDA 3GHSA 4JXCA 3EB3A 2Z29A 3C6CA 3W7HA 3G5EA 4I7UA 4XB3A 4GHRA 1W3NA 1XLHA 3IVTA 5AVNA 3S2LA 2NQJA 3RR4A 4W87A 1BQGA 1U1JA 5BOFA 1HVQA 2WMKA 4HTBA 5A8QA 5E09A 1TQJA 5A6JA 3PF3A 2D0HA 1G94A 4PTXA 3MJYA 4XZNX 1RPKA 5D05A 1IXOA 4WZHA 1OHLA 3P80A 3WD2A 3IEBA 3ZLGA 1L2QA 2QHAA 1J2BA 3QR0A 4W8AA 4ZB5A 1F5ZA 4S1FA 3THDA 4K8EA 3NZPA 4HBKA 1DWAM 3PBYA 2YA2A 1G9HA 3LY0A 2X1SA 1VFSA 4J3TA 4A3UA 1H4PA 3C0JA 3IUIA 1XHGA 3DAQA 4M24A 3W7EA 1UKSA 6TAAA 2VCAA 3O07A 3GE7A 4MOZA 4QHRA 3UW6A 2I9EA 4HZ6A 1EA9C 3W1PA 1O95A 2V3DA 3R12A 1XDMA 1JYVA 1CGXA 2HNHA 3L2MA 4M5PA 5K7JA 3CUXA 3RMEA 4K8GA 2IXVA 4TQTA 1RPXA 4OECA 1TTIA 4UOJA 1KXVA 2Y4SA 1EHNA 5BNKA 1XGEA 3WDHA 1VRDA 1ZBCA 1QNQA 3S1VA 4E4FA 4Y7EA 2J88A 2ZZ6A 4HNVA 1DJQA 3KDOA 3CPRA 2PC4A 2VP8A 4L4OA 5EFDA 1B4KA 3PB0A 3JZEA 3R0UA 3IUDA 2YLAA 4OWGA 1QPOA 3JU2A 4KH2A 4CNPA 1UH2A 2HBVA 4WJXA 4DF2A 4W4QA 1XCFA 1W1B1 2WJZA 3WQ8A 3AJXA 2DZTA 3NNTA 5TQLA 3PBVA 1TV7A 5D9OA 3AWNA 4O28A 4S3DA 1I2RA 4DBSA 4UTTA 1MEIA 5CPMA 3C2OA 3PJWA 1RQEA 1E4LA 3W1MA 2RDTA 3ZWSA 3WBEA 5AYBA 2Y6ZA 3C2YA 1XINA 4UTJA 2VENA 4F9JA 1XIEA 3KVMA 1O60A 4OQVA 1Y65A 1B0IA 1WDWA 1DJGA 1WBHA 2CLIA 1KBLA 3STGA 1KRCC 2YFOA 1CXFA 2V5CA 3WK3A 4HNTA 5CJ5A 5K4ZA 3G1XA 3T40A 1CYGA 4R9OA 3U2OA 3LBOA 3QFWA 3GX9A 3W88A 3S5OA 1P1MA 4YHGA 5F7UA 4AQLA 1RV8A 4AIUA 3W7KA 2PCQA 2OX4A 3TYZA 1POJA 1B9ZA 3QFEA 4IHCA 3DI0A 2XVKA 3ITGA 4LC6A 3SDOA 4CD5A 2PODA 1B3VA 4ACZB 3P61A 4WJ8A 4J7RA 3E0VA 1XQKA 2GGGA 3T42A 4GI9A 4Q4QA 2QUMA 3Q2DA 4GJIA 1VZWA 4HD5A 5HA7A 4HNOA 3VKKA 2ZRZA 3AS1A 1I2PA 5DT7A 3WK1A 4CQAA 4IUGA 1ZLPA 3BAKA 9RUBA 1FH7A 3FVDA 2PD9A 3P0WA 4MFDA 2Z2AA 1OQFA 3ARPA 1CXEA 3W76A 4LTSA 3CQHA 3WENA 3WLHA 4XX6A 4DYJA 1E0WA 4PODA 1SVDA 4NRSA 3QTPA 3M0HA 3HFTA 2DZXA 1J0ZA 6ALDA 1WKDA 3IAQA 3LCGA 4EIVA 4DI9A 4DJEA 3LLFA 1SO6A 5AVHA 3UZYA 5ECUA 1W1YA 3AROA 5EKYA 1FUYA 3P81A 1QNPA 3ABXA 4W7UA 3R89A 1AFSA 3WH7A 1JCYA 1DV7A 1ZBWA 1IWBA 4H9YA 1B3WA 1U30A 4NP7A 1CGWA 2PS2A 3VINA 1FCQA 3WD1A 4L6HA 2ZE3A 3EKZA 2J8GA 1V3MA 1L8NA 2HWGA 4V27A 3BMVA 3BARA 2VELA 3KCLA 5JBDA 2C3ZA 1ZL1A 2PWDA 3VNIA 4IIDA 1MDRA 3B3DA 3JVAA 2VKZG 4UR8A 4DELA 5CC6A 4NJJA 1DXFA 3PTMA 3WMLA 1OGBA 4GZJA 3TV8A 4UXDA 3JR2A 1TZ9A 4GH1A 1JFXA 1H0IA 1AA1B 4PRTA 1FWJC 4PC8A 3GIQA 4GUGA 1ODZA 1DHPA 1LYXA 3MI6A 2V2DA 1QJWA 3OZOA 3S6DA 4LANA 4Q8TA 3KBMA 4XUYA 1E0VA 1UB3A 3T05A 4DX3A 4GYJA 2J47A 5D02A 2OSYA 4GACA 1ME9A 3IJDA 1H61A 3UR5A 1BKSA 1M7XA 1V6YA 2EKCA 3EWUA 3LPGA 1ZFJA 5A8NA 2HXTA 4C1KA 4O11A 2CWNA 4PMZA 1XBYA 4XAGA 3KFTA 1BTMA 5CGQA 4ZO9A 3WY1A 3W0KA 1OFDA 3PN8A 3N6HA 1KFKA 3I3EA 2IS7A 2OT0A 3GM8A 3OYXA 4C1NB 1TUXA 3MHUA 4S38A 3A64A 4GWEA 5HUOA 2F38A 1I2OA 3SN4A 4JTSA 4C6NA 1B3ZA 2Z00A 3USBA 1SO4A 1SJDA 3QPEA 2BXYA 4A22A 3TQVA 3DG3A 1XXXA 2YL6A 4O53A 4U2ZA 1MW2A 5I6SA 4XQ6A 2G3JA 2H9AA 2C18A 2ACUA 4I9MA 3EWDA 4K39A 4YVVA 3CH0A 3NCOA 2W6RA 3TN4A 4UQDA 4GYKA 4EP8C 3LCXA 1HZYA 1HUVA 4GI6A 2OEKA 3I6TA 2EJAA 2WW5A 3HPFA 1D8CA 1HKMA 1H60A 2CC0A 5I07A 3TU9A 3MWAA 4MWAD 3U48A 3W83A 4D6IA 1CEOA 1T8QA 4JTDA 3CWOX 5FAJA 1EZWA 5BXPA 5BOOA 3O7UA 1EC7A 3IVSA 4RK8A 3EWCA 3KXQA 4JIQA 3KS5A 3CV6A 2D23A 1R2SA 2VJXA 2KZHA 5DY3A 4OT7A 1PB0A 4WKFA 2FTWA 3TMQA 1FXPA 4WIWA 4NVTA 3RITA 1U1HA 3FHAA 5E93A 4JPGA 2OCZA 1EPXA 3E96A 3I68A 2Q01A 4PN2A 1ZY9A 3WJWA 4WDXA 4KCUA 1NWRA 3TONA 3KOWA 1XDJA 1K4HA 2WK2A 1TE6A 5C7HA 2AGKA 2WVUA 1EWDA 3WQWA 5KZEA 1OX4A 3NZQA 4LQ1A 3AUJA 1XQLA 2PDJA 3C5QA 3GS6A 5IFPA 4JNZA 2E77A 2FB3A 1UOZA 3S6TA 3FDGA 1UW9A 4O8AA 3GUGA 1XH0A 3CJPA 4O1FA 3IJ6A 4F0MA 2QMJA 4XD3A 1CB2A 4Q4MA 3TWAA 5FESA 3BSGA 1R7OA 1XSKA 3TNOA 3ZFHA 3V4BA 3DFOA 4PR4A 3ARXA 1M6JA 2AAMA 1J11A 2GVYA 3DG7A 3I4KA 2DDXA 1OFBA 5DEZA 3H6OA 1U83A 1UR2A 1PX4A 1TUFA 3CUFA 2Y7EA 3GXNA 4LUTA 3K4DA 2QDEA 4YCOA 3BG5A 4JY9A 4NQ1A 1F3WA 2Y5JA 3L66A 3MYOA 5I77A 2ESCA 2ZA1A 1QMLA 2BY2A 1H11A 3EWZA 1P0KA 4HMEA 1OCQA 1LLZA 2V5JA 1WV2A 4N0RA 3TX9A 3S9ZA 4IFOA 1WOBA 2OGYA 1XR2A 2CZDA 4LCRA 1IZCA 3WNLA 1EPVA 3KBJA 1E15A 1J18A 2VGIA 3H2AA 1QCWA 4MMWA 1EXBA 5EMYA 4DNHA 1E4NA 1XSIA 2OQYA 2I56A 3FXYA 5I2UA 4NIRA 1OBAA 3GZAA 3RM8A 3A4WA 1CGYA 3BURA 3EDJA 3P84A 3K2GA 4W86A 3OGRA 3DFSA 1RH9A 3GC4A 3VUSA 2OOFA 3LZ3A 2FHFA 5G1MA 1VFLA 4UR9A 1RHCA 1UCWA 4FF7A 3GC2A 3UG5A 3VD7A 5A6AA 2FZDA 3NQAA 2CLEA 3GNXA 3BV7A 1GEQA 3MMTA 4UMCA 5DCDA 4YS1A 4JFTA 4RUBA 4GBUA 1ZAIA 5EYWA 3TTQA 1R3RA 1A0EA 3SIMA 1IZKA 4Y8EA 1QNOA 1OYBA 3HG5A 2DSWA 3ARQA 3BVJA 4QQ3A 4UB9A 1ZCCA 4FOUA 5T91A 3S9IA 3PJUA 4IX2A 4ATDA 4Z1DA 2HVNA 4KRTA 2OELA 4N42A 1PUDA 1YPIA 3IJLA 1LROA 3R11A 3VZXA 3CO4A 5I3FA 1EP2A 4S2CA 1XLLA 1Q85A 3TYDA 4HOWA 4UC5A 4CNNA 1FHUA 2PLKA 4H7CA 2Y70A 2J7CA 3BWWA 3NWRA 2X1TA 4WY0F 1JZ5A 1TPUA 4M6UA 1XISA 2VGGA 3UVAA 1PWLA 4PZVA 4UQBA 1XDLA 3CO8A 3UG4A 3B8DA 3H2NA 5HATA 1G4EA 4EE9A 4I5RA 1HXJA 3L9CA 3WZ0E 3B9DA 1V03A 2EPKX 1HP5A 3H12A 4HMDA 1VIZA 2QAPA 3WQ6A 2NWRA 2BGSA 2E1WA 4UTWA 4PEEA 1QAPA 1W91A 1OVDA 1EJXC 4UBPC 1AH3A 1XIIA 3U0HA 4TTUA 3CEPA 1XLAA 1K3UA 4A21A 1ISWA 3U7BA 1VKFA 3IUHA 1A0CA 3MSGA 1UWRA 2ZXQA 4GXMA 2BOGX 4GY7A 3W2NA 2TMDA 1YE6A 4WXZA 3NOYA 2EHHA 3REQA 3TFCA 3G1VA 4KETA 4WCJA 5HDRA 3YPIA 3CLWA 3WNNA 3N4EA 4NYYA 5CPTA 3ZSSA 3HQPA 3O8AA 4HJFA 1UIOA 4OBTA 2VNCA 3QQ1A 4LUTB 3FYYA 4Z17A 2FZ9A 2GGJA 4GCXA 1GVIA 3KTSA 4HK6A 1OC7A 2JEPA 3W7MA 4WK9A 3FW6A 1K77A 2VX5A 1UZHA 3WLRA 1TJ2A 3TSMA 2DVUA 2POZA 4KKXA 1K6AA 3HG4A 2PTZA 2ATMA 1RK5A 3IRDA 1MRQA 3DU0A 2XIIA 1AD1A 1IWPA 1TREA 3D3FA 4JTJA 4RPPA 4HT3A 2YYTA 3TN6A 4MUZA 2OJPA 3U4FA 4DQWA 3FFSA 1HGYA 5A8GA 1W1PA 2YDRA 1J6OA 1NP2A 1EO5A 4P61A 3DFNA 3D0CA 1EUAA 5CPSA 5DN1A 1VC4A 3B4UA 2NQHA 2Q6ZA 1Q13A 4LY4A 4WXYA 1XD0A 4FF5A 1NQ6A 1FRBA 3MCNA 3LQLA 1AL7A 2ZZ5A 3ZT5A 2DGAA 2YJQA 3BLEA 2BB0A 3I7QA 1S2WA 1X1NA 1PYMA 4JOMA 4UFMA 3JW7A 3DC8A 1MWOA 4E2OA 2PE4A 3TFXA 2AQOA 1OIFA 1X38A 4Z08A 1LWIA 5EMMA 4D8ZA 3U4AA 1GYMA 1O5QA 2J8TA 5KETA 1VRXA 3AU6A 3CPGA 4H9ZA 3GFZA 3QSTA 1P6BA 2P3ZA 3FAXA 1KTBA 1XW8A 5CLTA 3NVTA 3L65A 3Q65A 4XBSA 1TFVA 4QM1A 2TRSA 5RUBA 4AW7A 2YKKA 2V5KA 3LM7A 2ZQ0A 3GB6A 1MVYA 4LBRA 3DUGA 4O8RA 3VMOA 1VHNA 1JRCA 3FX4A 2X7WA 5CBBA 1US0A 2ACQA 4GX9A 2QPUA 2VQUA 2CHNA 2UZ9A 1NFBA 5GJMA 3L4VA 4I9JA 5T8GA 4ATLA 3NQCA 1ITCA 2P10A 1GTEA 5D09A 3UJ2A 3GDKA 3MANA 2GJXA 1JPDX 3L21A 1X96A 1KCXA 1G4TA 2B7OA 2WLZA 1Z48A 4FOJA 4WKAA 3ARTA 2PZNA 4LS0A 2GQ9A 3A3XA 1XM3A 2C1HA 3IIVA 4QDWA 5EY5A 4AD0A 2NQZA 3ITOA 1Q45A 4PMXA 1T96A 3BOLA 4H2CA 1KCZA 2J75A 4Z2HA 4WGXA 3PZ9A 3W73A 4J5NA 3L7RA 2OVLA 2H9AB 3VIFA 5BCAA 1WZMA 3G2GA 3ZMRA 3SZ8A 3GXMA 4HP5A 2YBTA 1SR0A 4AY7A 2DZBA 4Y8FA 2CCRA 4Z42C 4J3ZA 2OYLA 5FJTA 4TVDA 3URBA 4AZIA 1TJ1A 4GVHA 4ORIA 4NL1A 4C1NA 5C9UA 4EAYA 5CJNA 3TR2A 4Q8MA 2QAFA 1W5NA 1K7FA 2ICSA 1I6NA 1XL9A 2ZWZA 3EOUA 4G6CA 1GOXA 1BEUA 2RGMA 5IBXC 1AD4A 1GKQA 3WQEA 4UTTC 4AIOA 2ZTJA 1ODUA 2PDNA 5AYYA 3MHFA 2I1OA 2CBIA 4H7VA 4KEVA 5ECVA 1FWCC 1S5NA 2DQWA 3CLMA 2RAGA 5LIYX 3KBNA 4ZXLA 4NJHA 3RK8A 2HS8A 4XAFA 1GZGA 1EOKA 2GK1A 3EA3A 1KTCA 1V3LA 3TH6A 3HIJA 4XAZA 1US3A 2QPSA 4U4MA 1GJPA 2HBXA 2QYGA 4K68A 3MV01 5DO8A 5DMNA 1M68A 3H4XA 1WA3A 5LHEA 2A4AA 2GGEA 1XYBA 3AFBA 2B7PA 4PMQA 1OX6A 5FF3A 3W07A 3TC3A 4I7VA 4XZIA 4XTDA 1WQ5A 1WZLA 2I17A 5DBTA 3EEGA 3GXTA 4IZGA 1TV5A 1YQ2A 2LLEA 2FYMA 3KTCA 1PEZA 2DT2A 2ZZ1A 3AWOA 1LG1A 3DN5A 1E6ZA 1PCWA 1Y0EA 2X7VA 5TIMA 1DEDA 5HJXA 4DZ5A 3A12A 3L4WA 3P5ZA 4HCDA 1ICSA 3PPFA 3UWEA 1FBAA 2VVSA 2YZRA 5AYXA 1PO9A 2UY3A 1WDSA 3AUOA 6A3HA 2PBGA 3M0XA 2GWNA 1VBUA 2QLYA 3SUTA 1O66A 4MHBA 4XVDA 1J01A 1C9WA 2HTMA 1N8WA 4RNFA 3GW0A 4JIEA 1GT8A 1AQMA 4GUIA 1QNRA 4BI7A 3KHDA 3EBVA 3N2TA 3TLQA 4F79A 4W85A 4H6KA 5I79A 1D3CA 3SY5A 5FJJA 4KEZA 1GZJA 1XCWA 1YNYA 3W2KA 4EXQA 2PP1A 2WNWA 1DYSA 3W3OA 1UQZA 3PZQA 3VNLA 1RUSA 2VOTA 2CLLA 3GG1A 2X1RA 1EC9A 2VM8A 3VNKA 2VEPA 2H6RA 5GVJA 1H5VA 2VTFA 1WB0A 5REQA 3IACA 5A5WA 3CQIA 1RA5A 1IT0A 3LHVA 4AISA 3FA3A 3FEMA 2AMGA 4WSKA 4JIHA 2OXNA 4L4PA 1TJ0A 1AH4A 5I7GA 1E6RA 2OB3A 5IRPA 2O4MA 2BGNE 5G5IA 4GQGA 3APGA 1A5OC 3CHCA 4EX4A 2Z24A 1BWLA 4DYEA 3F5LA 2XJ7A 1TZZA 3H54A 3QZEA 5BWAA 3OZPA 3N19B 1JCXA 1N7KA 3HGRA 3ZM8A 1VBRA 3EKGA 3GTHA 3WLJA 3WF2A 1BVNP 4DO6A 4HPJA 1V3IA 4DUXA 1VB9A 2PWEA 2QT3A 3T4WA 3NL5A 1M41A 3W4RA 2J8FA 3AHYA 3G3DA 4A8RA 3WQVA 3VD4A 5M5DA 4XSMA 2QEZA 4MZ1A 4X2RA 1OC6A 3UZJA 3BJSA 1XLBA 1YBQB 2OEJA 2W27A 5KITA 3GQYA 4KW2A 1FWHC 3OGSA 1DIEA 4OIFA 4PMVA 3T0BA 3N3TA 3S2MA 4B9YA 1F3TA 2TSYA 1IXNA 3SCTA 3HU7A 4MPKA 5U7SA 4UOQA 1X7FA 2GSEA 3GSMA 4PE8A 3BAWA 1V6UA 5FF7A 2E68A 4FAMA 4H01A 4AWTA 4MSSA 1GONA 1CBGA 2Y89A 1UYQA 4J2MA 4MPQA 1JDCA 5A6MA 1WCGA 2MUCA 4P7OA 4PUKA 1G7VA 4P7LA 3WJZA 3VVGA 3F2DA 3BK0A 2A2IA 5C2CA 5ABGA 5DX7A 1FOBA 5CAHA 4QQUA 1DP0A 4A8NA 3I6RA 3SCNA 3W01A 1P5BA 1L6SA 4WQ6A 4LVFA 2YXGA 2FKPA 3EXTA 3W82A 3N9RA 5A94A 3NXLA 1BYDA 1MQPA 4UIOA 3RU6A 4Q8OA 2WB5A 4MNKA 3SY1A 2OODA 3C3NA 4JICA 4CVUA 3L0GA 3V0SA 1QASA 3EXRA 1S3HA 3KOFA 1K9EA 1S5TA 1JCNA 3SJNA 3TLLA 1W9DM 4FEZA 3GHUA 3AS0A 1BYCA 3BLLA 2PDIA 2J24A 3EWBX 1GQLA 4AZ6A 5E70A 4BZYA 3TSDA 4H9VA 4AVFA 1ZUAX 4DLMA 1K1DA 4A2SA 3S46A 3QOMA 2PLMA 5DXYA 1JRBA 5CBJA 3UERA 4QNWA 4GJ1A 4WGHA 1KB3A 4AZGA 3KWXA 1H7XA 3UXAA 1TQXA 3DENA 3O0KA 2FQIA 4X2PA 3PANA 1JDEA 1R2RA 3HJZA 3IGXA 1UD6A 4M8UA 3S42A 5HWJA 1WOAA 1VIWA 3BMXA 3VM5A 3BGAA 4GNVA 4D71A 1P0BA 3GWQA 4DPPA 3S83A 3R25A 1EGMA 4I8YA 2VQTA 3NSNA 2R14A 2Q3RA 3WLOA 3MP5A 3CHDA 3FA4A 2YLLA 3TYCA 2A85A 1UD8A 1UUMA 3CZGA 1KKRA 2W63A 4MLRA 3F4WA 3WQOA 1B9BA 1GJUA 2CBJA 1SPQA 4LS2A 4IPJA 3OQEA 4DWSD 3CMFA 2Z1WA 1FWDC 4HZ7A 1UC5A 2ZTKA 1ELSA 1IZJA 1IQ8A 1JDFA 3WH6A 3R2GA 8CGTA 2AL2B 1E6PA 3GO2A 4F0RA 3VTRA 2BNJA 2NQLA 4Z2LA 1HJUA 5D32A 1R7AA 3MUCA 3LEPA 4YVXA 1M7JA 3PUEA 2BVYA 4ZB0A 3MCOA 4PB5A 2BG5A 5EMUA 1AUSL 3IPWA 2QDHA 1OB0A 4EPDC 3AISA 3S9YA 4ADUA 3BXWA 4JAWA 5BYWA 2QVHA 3AXKA 3PK7A 4FXJA 3A9BA 3LV6A 1BXBA 2OWWA 2YOCA 1Y7VA 4ZGYA 3UCCA 3E9AA 2OO6A 4N4PA 3WNMA 4HA1A 1PXGA 1Q6DA 1KM0A 4IP5A 1HKWA 2A5HA 1EJVC 4ZQNA 4D6DA 4GUHA 1ZALA 3ZR5A 2NT0A 1MUMA 1SFTA 5T9CE 1G5AA 4J40A 1U33A 3RX3A 2ZZ3A 1PHWA 4P7NA 2QCCA 4IIGA 4YWIA 3TXVA 1OIMA 4KCWA 1JG9A 1OADA 5F1UA 3PP7A 4AZHA 1KR0A 5DCBA 1F7BA 3FJ6A 4NUWA 3CAQA 3UR8A 3LG3A 2Z1KA 1OG6A 4FO4A 3USZA 1LQ2A 4MJZA 3RPTA 2XH7A 5LXXA 3HGOA 1CDGA 1W1VA 5LA2A 3AMDA 3NPUA 5I3JA 1LLWA 1MW1A 2R91A 3WSUA 2X30A 3RPDA 2RUSA 4K1WA 1XLJA 2WNZA 3NURA 1KFJA 3EX4A 1MZRA 3GVGA 5A6KA 3BCDA 4MGGA 5A6LA 3B8TA 1IR1A 3AIEA 1J96A 1TPVA 3SSJA 1SYTA 4R88A 4PRRA 4UFHA 2A3CA 3WH5A 3N4AA 4A05A 4ZOAA 5K2ZA 2X8RA 4HYRA 4BI5A 3OVRA 5G2HA 3WLPA 4TOQA 2D0GA 1XX1A 4ZQOA 2JKPA 1B4EA 1ONRA 4XZBA 4MKVA 1W5OA 3HQNA 1F6PA 4W8BA 2AOSA 2QDDA 3UWWA 1YIXA 1Q2SA 4LVGA 1GPWA 4FP1A 1OM0A 1M1BA 2PF8A 1TPB1 1LUCB 3UY7A 5HNNA 3KCOA 3PBUA 3O6DA 3OJGA 1JYWA 2F8QA 4ASTA 4PMRA 1YNQA 2AL2A 4Z2JA 1H50A 1RCXB 1V6VA 1R30A 1V02A 1AMKA 2PWFA 1VEPA 2BSLA 1KFWA 4AZBA 2W62A 2XIBA 4UNKA 5BU6A 1WYIA 5CPOA 1NFGA 1R3QA 1J0YA 3G1YA 1YKWA 1HVXA 3CHFA 1XYZA 2EPMX 2PEVA 1KBJA 1MNZA 2D2GA 2ZRXA 3K1GA 1J10A 1KWKA 1YDOA 4LS1A 1M53A 4IUOA 3IJ8A 2FJKA 3GDRA 2PDXA 4JCLA 4Z1AA 4O19A 1EJSC 4X0VA 4M6QA 4FNQA 4GYFA 4REQB 3M0LA 1NH6A 1KWGA 3WLQA 4IGHA 2DIKA 2Q8XA 4YTRA 2RFGA 4JIRA 1TA3A 3M5VA 4CU8A 3POCA 2OEMA 5EA9A 2VMFA 2ATSA 1RJPA 2WO5A 2BVWA 1TZ7A 3LB0A 1H1YA 5HMSA 4AD4A 4Y9OA 1A5NC 4ZOEA 1OJXA 3F4CA 4XZLX 1GOMA 4HN8A 3TCSA 3CNYA 7ODCA 2QCEA 5KSWA 1SW3A 4ILSA 1XGDA 4O52A 2FPYA 4GIYA 5C70A 2RKXA 3M7SA 4S3BA 4BA0A 1YEYA 2J4GA 2CWXA 3SCRA 4C6OA 1LOLA 1E6NA 2BASA 4CD6A 4GZ7A 3MV11 5G1TA 1PDYA 2VCCA 3ZZ1A 4Q3MA 1S2TA 3H2EA 2VFDA 4IIHA 3GLCA 3N04A 4HYVA 3W53A 3N9KA 3NL3A 3W7CA 2Z1SA 2QUUA 5HBFA 4KRZA 3N11A 2Z0IA 3UEQA 3PR2A 1EQPA 4G1KA 3RLVA 4JKMA 3U7VA 2GDUA 4ML9A 1TV3A 4X9YA 4C91A 2PGWA 3W7NA 1XIGA 1QI4A 3KL0A 4FR1A 4HMCA 4IJBA 5FJUA 1PPIA 3W6LA 3PC0A 4UFKA 3ZS4A 1YXDA 3OTRA 1KKOA 2QV5A 2F6UA 1NF7A 2ALRA 1R9YA 1Z44A 6CGTA 3APYA 4I5XA 2CLPA 4DLFA 4FXRA 3KDNA 2WJEA 2VZVA 1Z69A 3ANYA 5LA1A 1YTEA 3LPPA 3KCJA 1B3XA 2NLYA 3XIMA 4HNLA 2WHMA 4WD0A 1OK6A 1OCJA 5HXMA 4FALA 4DM1A 3ATYA 3WJYA 4Q4PA 1F07A 2GQ3A 4L7ZA 2V81A 4AC1X 2D2JA 1R8LA 3TTYA 3CAVA 3VGBA 1EJRC 1TSIA 3HGJA 3S2JA 4E4PA 6TIMA 2VT0A 2O9RA 4L5ZA 1QWGA 1V77A 1NDWA 5BROA 1TVPA 2JQXA 2DQXA 4LNCA 1S1RA 3TW7A 3B8VA 1FDYA 1C9DA 3BMWA 3FJ4A 3GC5A 5GQBA 5I78A 3ES8A 2QR6A 5DFAA 2WYSA 4N4QA 3RUBL 4JFVA 1RJQA 1GOKA 3M0JA 1E6QM 2XFRA 3P93A 3DXIA 4V1XA 3HPSA 2Z6JA 2WZTA 2YYUA 2EBNA 4MJ2A 1DTUA 4ZO8A 1N55A 2PAJA 2PLCA 3OIXA 4KGJA 4A29A 3L23A 1S1PA 3VXGA 2CLKA 4JNYA 1PAMA 4JEJA 1CTNA 1HJWA 2FTPA 4AVOA 4AUBA 4WX2A 3JUGA 4QEHA 1W9UA 3W6YA 5ABEA 1JGMA 1RVKA 3QC0A 3VMNA 2V3EA 3U5UA 5DF0A 3UJRA 2HV5A 2C1GA 3F4VA 1XC4A 3TTEA 2X41A 4MWAB 3VOIA 4GZIA 1WBJA 3OIHA 4TMBA 4AX6A 4B5NA 3GD6A 2YBVA 1Q7MA 3W81A 1ZAJA 1R85A 3CAWA 4WOZA 4I9AA 1VYPX 3ZJ6A 3QV6A 1AW5A 4MZYA 3G0SA 1KD0A 3TWBA 3NPXA 1EC8A 1OZMA 3L4YA 3P62A 1UD5A 1AJZA 3E2QA 4ZVJA 1U2YA 3G77A 3TE9A 1A3HA 1PTAA 3H4WA 3NIYA 4HPXA 5LHFA 4B3KA 1Z42A 1V4YA 1K03A 3GAYA 2QNEA 3W26A 2QCFA 5CH9A 4BK9A 1ADOA 1ZJBA 4O0QA 2WPGA 2VOMA 3STCA 3LTSA 4UTFA 2YCJA 3DIPA 2G3IA 1BSLA 3VAVA 1LTDA 1NVMA 1XPYA 4GVFA 3OB8A 2NSXA 3K5XA 4AZ7A 1C90A 2P0OA 1UKPA 4TVUA 5D9PA 2R1MA 3AYRA 3T2OA 3NDZA 2FH8A 4H8VA 3TJXA 4FNUA 3AHTA 3WEZA 4XZWA 3WF4A 1EZ2A 4KBXA 2PC8A 1QI3A 4HGXA 4EF9A 4MFEA 1JNEA 5C6MA 2ZICA 1R6WA 3BLFA 1FX6A 2XN0A 3MY9A 4H8HA 1XYMA 4KCTA 5CGMA 4EANA 3AI0A 1GVRA 4JX6A 3QEZA 3QC3A 1H63A 3CL7A 3R7MA 3RRXA 2B7NA 3QV7A 2E5BA 2Z6IA 1H3GA 1VFUA 2X42A 3CZJA 2INZA 2V8ZA 5H8UA 2D24A 3V3WA 1IGWA 1JIBA 3QV8A 2YA1A 1EIBA 2HE8A 3CH9A 3AXIA 4NZFA 4QTGA 1HL9A 3E2SA 1XP3A 2FIQA 2PDWA 5FJPA 2BTMA 4PTVA 1JYXA 1QR7A 2BHYA 4AXNA 3ZOAA 5HMDA 3P8JA 2QGHA 4QGCA 3QR1A 3UJSA 3W2UA 3C52A 1RQHA 5MKGA 4MG4A 3NQGA 2ZX6A 4BQ4A 3WDJA 1PS9A 2E3ZA 1LM1A 3ARWA 2FGBA 3MWCA 4QITA 3HV8A 1JDDA 4YMZA 3T7VA 3M0VA 4E0CA 1R38A 1YXCA 3FSUA 3GIPA 4PMDA 3UWYA 3I4EA 4PUMA 1UBPC 1MXSA 3CHEA 3UVIA 2EGZA 1E5NA 1AZ2A 4MY8A 4RDZA 1NP0A 4AYSA 1UROA 3CAKA 5FF4A 5D8ZA 4UQ9A 1BVZA 3W74A 1GKPA 1J5SA 4H04A 3DYMA 3UWZA 1DKWA 2R9RA 4OHQA 4WVXA 3R43A 4D8AA 1SFJA 4YWSA 4HN4A 4G2DA 4WUIA 1E40A 1TO3A 3C61A 4EACA 3O06A 1XG3A 2FDMA 1IEWA 3AXMA 1CLKA 1CECA 4L9YA 4ZEPA 4ICMA 4IQLA 2DZVA 2HXUA 1HJQA 1JXJA 3WL0A 5D04C 4D8LA 4JYEA 6REQA 3RF9A 1EX1A 3M47A 1VEOA 1TWIA 5C54A 3KRBA 4R3UA 4XIAA 1JPMA 3BICA 3ARRA 1NWUA 4US6A 3NL6A 4JX5A 4IXXA 1I45A 3DBNA 3T0CA 4NAFA 2P1FA 4MDPA 1NQKA 1H1ZA 3VOGA 3CZLA 4JBRA 5U4NA 3NTYA 4YNGA 3OU8A 3SIZA 4TXEA 3W25A 4B92A 4ZO6A 1RVGA 3L0KA 1TIMA 3BLPX 3VGGA 2JKAA 2FZMA 4JY8A 1PKNA 4PRWA 1GORA 1ZCOA 4AHPA 1HNYA 1Q65A 3FGCA 4PMNA 3ORWA 4ZO7A 1UKTA 2PDUA 2C6QA 1HTIA 5J8LA 2Q3OA 4GQBA 2DIJA 1XICA 5MKGB 3GXIA 3C0SA 1ISVA 2O4QA 4HA0A 4WSHA 5AYIA 1UJQA 4HU3A 5C0QA 1EGZA 2GVJA 1OZQA 3EPNA 3DFQA 3WQFA 2HRWA 2XIQA 5LIWX 2E67A 2QKFA 3QKEA 1KGUA 2RH9A 3UNDA 1UASA 3KE0A 4KCVA 4TVCA 3UG3A 3V1PA 4DI8A 2G3NA 3AO0A 1A5UA 4H00A 4CQ9A 4AVNA 3T0DA 1VJSA 4JDYA 3E1F1 1KQZA 2VL4A 3VZZA 3C3UA 4AEOA 5LGXA 3MUY1 3MUXA 4KWVA 5I0DA 4G1NA 3KVJA 4CCZA 4GI4A 2NX3A 4HPNA 4GYPC 3GXDA 1UWTA 5F1VA 1MRAA 3AYSA 4PL2A 2PDKA 4ZTYA 1UG6A 1VLWA 1OG0A 4FXFA 5G2IA 3HG2A 4PULA 3NO3A 2DEPA 1A53A 3GXPA 4YTQA 1L6GA 4QP0A 1QATA 1DVJA 2FMOA 3H7UA 4GK8A 4B15A 4P7QA 1IYXA 4RE0A 4KMQA 4A4AA 2ZBTA 3PM6A 1M5WA 3K8LA 1JZ7A 3KP0A 2XGZA 1C93A 1UP0A 3E5PA 2HZGA 3C56A 2E6AA 4Y9PA 4B5XA 4LB3A 4ZR8A 5K9DA 3CV1A 1SMAA 3NFUA 3G18A 2Y2WA 2DP3A 2EG7A 4UQCA 5MHBA 3NQ7A 1E3ZA 1I0DA 1UKOA 2ZCGA 4EXAA 4OBSA 4CKQA 2DW6A 2VZTA 3E49A 1AQHA 1R5YA 1J79A 2X1UA 4H9MA 3R0DA 5FF2A 3OA5A 4IGNA 2NXIA 3EWWA 2WCGA 5IBXA 3VGEA 3U8GA 2X2GA 4H8UA 2SFPA 2VX7A 4N02A 3U2ZA 4LSBA 4NI8A 3W75A 1TE1A 3WLMA 4ICNA 1AQFA 1KRMA 1BSIA 2ZRWA 1TPWA 1U5JA 2GJLA 3TAKA 1H7OA 1M65A 3ES7A 4HZ8A 3E0LA 4MIMA 2ISSA 3PBGA 4GYPA 4PCPA 5LYRA 4KPLA 4IL2A 1GNXA 2OGJA 2OPJA 2CLOA 1PBGA 4AHQA 4R5EA 3DYPA 2OT1A 3NG3A 3P60A 2QCLA 4P5UA 1XFBA 3A24A 3G1DA 4YPJA 2XG9A 5IFTA 1ZTVA 2P3EA 3BGJA 1OFAA 3GNRA 3TCEA 1X8CA 1YPXA 5CSYA 3DI1A 4AG0A 3LNPA 4O17A 4LBUA 2PDGA 3AMGA 3RU8X 1OCBA 4IIFA 3PBWA 3RAOA 1UD2A 5M2FX 1MEHA 1OINA 2V5BA 5IDZA 3WF0A 3NL2A 4BF9A 2YL5A 5DY2A 3PTDA 3KS6A 4DB7A 4GZEA 3MT1A 5CPLA 4PFMA 3E3HA 2IXUA 1TTPA 1I2QA 2C79A 4G7EA 3LD5A 1QHZA 1UUOA 3WH9A 4XKYA 3W6MA 4M51A 2PU0A 4PEKA 3VABA 1NOWA 1G7UA 3D3AA 2J7HA 4MKNA 2FJUB 3M6DA 4KERA 4S3GA 3OGVA 4DBEA 1O12A 1OC5A 1V3HA 2GUBA 2QUNA 1VYSX 3EX3A 1ZJAA 4X9SA 1AODA 3XINA 2X16A 1WO2A 3WN6A 4OUEA 4S2BA 1GW9A 3WQ5A 3R58A 1YTDA 2R1NA 4NILA 3U2EA 4MLJA 4CCCA 3DECA 4Q6XA 4ADSA 1KXHA 2V82A 3OYZA 4ZQMA 3CQJA 4YTSA 3CQ0A 5BXTA 2C91A 3K30A 4S3CA 2ZWYA 3ITTA 4J1OA 5BXRA 4CEXC 3C4UA 4I90A 2XISA 3G8RA 4LVBA 2JF6A 2Z1VA 3A6OA 4B3LA 4UCGA 1M9HA 5AYZA 5BZAA 5KZ6A 2ISVA 4XKMA 4GNJA 3EDEA 3DX5A 1LOSA 3PY2A 3G0XA 2C7FA 2H8XA 4C1LA 5HWNA 3C2FA 3NQ8A 3RMJA 1FFRA 1BXNA 1RXOB 3BZJA 4F66A 2TPSA 5AZ0A 4WY0B 3QOKA 2PRMA 2ONEA 4M80A 3B4YA 4UTMA 1KFEA 3G3MA 3A22A 4DBUA 3OOQA 5I02A 3W1RA 4DUVA 5IDIA 4HJWA 4JZ5A 1C7TA 3QV9A 3QH2A 3HOJA 3MUIA 2F6XA 5D4YA 4DF1A 5H1WA 1H62A 4Q8PA 3R10A 1SZNA 2WWCA 4TX8A 2HS6A 4MNLA 5JBEA 4XD5A 4KF1A 1OD8A 2NV1A 3Q94A 3QPZA 3GU1A 3F4NA 1RSCA 1YXYA 3AZRA 3MPGA 1Q8JA 1KTNA 3EPOA 2YFNA 3BLDA 3VOJA 3TQ0A 3G1FA 5KEZA 3MS8A 4DUWA 4WY0A 4L56A 4BCEA 4WDUA 4XG1A 5EGRA 3INPA 2IKHA 1SO5A 1Q6GA 1A0DA 4RZBA 4J3WA 3G1SA 3S6OA 1TCMA 4AEEA 5JH2A 5XIAA 4YHEA 4NAEB 4BEQA 1E0XA 3CASA 1K9FA 1DQWA 4LBSA 2MANA 1SR9A 1OSEA 3CK5A 1Y5WA 2B7QA 1VCVA 4GQQA 2OYMA 3LSCA 5ABTA 2YL8A 2GVGA 4C7FA 4E8GA 3UYCA 4AIEA 2F61A 4FOKA 3QW3A 1K7EA 4HCLA 3W02A 3W70A 3IRSA 3EMCA 3LXBA 2CNCA 1DE6A 3PZMA 1OWQA 4GX8A 4O4WA 4KRUA 3FNDA 1OYCA 4K7VA 3PZGA 3UPWA 2I14A 3CL8A 4CGTA 2UV8G 2CKRA 5G4HC 2P53A 3LI0A 1W0MA 4ES4A 3M6YA 4KWWA 3K46A 5A3HA 3ZSTA 4C6EA 2QJMA 4GY1A 1FCBA 3AIRA 1TWWA 3T08A 1E72M 4P8XA 4HMNA 1K8ZA 3AOFA 4OOUA 2VO5A 4JTCA 4ORMA 4HHMA 5M1TA 4QG9A 2PDLA 3FSTA 1NTHA 4W89A 4LGXA 4R85A 5A2AA 2NLIA 5CCZA 1A5MC 4JYFA 1O94A 2QF8A 4DJFC 1J0HA 3OHMB 4ZZ9A 4UTHA 1SZFA 1TV4A 3RGTA 4EPBC 1JAEA 4GFIA 2VEKA 3SQMA 4K3ZA 3UXLA 3V16A 1YADA 1H0GA 1W9VA 1JF6A 1MW3A 1W17A 1IIHA 1NOFA 3LZ5A 3TYUA 4URIA 1BQCA 5CG0A 1NF0A 2YGYA 3N25A 1XRTA 2D1ZA 2E28A 4I9TA 4LUSA 3B0PA 3LQGA 4A3QA 1K70A 3GRIA 1QUMA 1E9ZB 1B54A 2QCNA 3LX9A 3OLGA 2J79A 5MF5A 1FH9A 1YX1A 4XO7A 4HPGA 3F5JA 3B03A 2PMQA 4JS3A 4TO8A 1JPHA 1W8GA 3EDDA 2XSBA 3K8MA 1SW0A 3TUUA 2W3ZA 3NQ6A 3N29A 4NG3A 3SY8A 4MNJA 4E8CA 3LI1A 1UWQA 2XVLA 3ZLHA 2VVNA 3TVAA 4FR6A 3QY7A 3O6CA 1BG9A 5FI8A 3I6EA 4K38A 3CYVA 4MB4A 3LPFA 4KIEA 3WO8A 1S5WA 1GJWA 4O14A 2P50A 4HNUA 3T07A 3MDWA 3GNNA 3LBMA 2A6LA 4WR3A 1N8FA 4NY2A 3VILA 3MMDA 3TAOA 2XHYA 3CB8A 2VC5A 4OU1A 3PZOA 3HV9A 1ZAHA 5CKSA 1VH7A 3N4FA 1FWNA 2YCKX 3O63A 4H7ZA 5HQMA 1UC4A 4Q8QA 5CEWA 3OVGA 2PWGA 5CZTA 1JPKA 1EDGA 1ONWA 3QHNA 3GFXA 4QX4A 3F7JA 4N9CA 4DAFA 3ELFA 4G7FA 3TMLA 1E3XA 3GDTA 4KESA 1BYAA 3G6MA 2IPGA 2AQWA 2YDSA 1FWSA 3OLEA 2Y8UA 3TTSA 4OUIA 2WOQA 4DHGA 4NNAA 4OFCA 1MXDA 3W1XA 1JEZA 1FWRA 4LAKA 2H3BA 5K9XA 3ABSA 4JFUA 3RLGA 4C7GA 3B05A 2ZFAA 5B7ZA 4GC4A 1QU4A 4QEEA 3SN0A 3PG8A 5KINA 1EBGA 3WK0A 2WWDA 4I7WA 3PB2A 1CGVA 2BV9A 1HX0A 1TJRA 3N2XA 4QDPA 4Z0JA 1RCOB 2BOEX 2W0UA 3AIQA 4JQ1A 5D2TA 4M29A 4AYGA 5C9RA 1EDQA 4R9XA 4FZIA 4KWOA 1TWDA 1FQ0A 4AAJA 4IJRA 2VGFA 3AZTA 2CXEA 3NAVA 1IEQA 4IXHA 4RW5A 5AC6A 4KEUA 1PL9A 3RDKA 1GTHA 3AALA 2A3AA 5BOEA 4PMOA 1ENUA 1IT8A 2D2OA 1JYNA 1OD0A 1X6UA 2JIWA 4NX5A 2ANUA 1HO1A 1E71M 1VYRA 1J6PA 4UFLA 3WMCA 3A4AA 3F2BA 1T0OA 3B9EA 3S1UA 2WMJA 2J7EA 5D9NA 1L0PA 4YCPA 3WBWA 3LUTA 4C60A 1W1TA 5A8MA 5H2ZA 1NJJA 2YCIX 1D3HA 1S38A 1GVOA 2C8NA 4J3VA 3M0ZA 5BW6A 2VEIA 4V28A 3UPMA 4GO9A 2XZ9A 3W72A 3W7IA 1J93A 4ZE5A 2O56A 4GIAA 4DWSA 1H09A 3FGCB 2ZUMA 1Q6CA 2FTYA 2VR5A 3RM4A 3CBWA 1NFPA 5KZDA 3VU2A 2G4FA 1CX9A 4LWWA 4L1GA 3HURA 3TN3A 4HA3A 2Z26A 2I5GA 3ITCA 3DFTA 1YMYA 1VBHA 3W7JA 3SUUA 3SCOA 2WJDA 3GNOA 3UWQA 2BDQA 1REQB 2J66A 4GO8A 3H2FA 3O6AA 4U3CA 3WFLA 5DBUA 2VFIA 3CIVA 3PSVA 5A6BD 4AZ5A 3RXZA 4O54A 2F7FA 4O10A 1CW2A 1BRLB 3GH4A 2CBVA 4F40A 1G4PA 3IWPA 1AQ0A 3NQFA 3WLLA 2OR2A 3NGJA 1JVNA 3T2QA 1JZ3A 4TIMA 2HCVA 4I6VA 4W8LA 3EWYA 3P14A 4E3TA 3UT0A 1H7RA 1ZBKA 2QIIA 4AEFA 4P2VA 4DZIA 4TU1A 4XD4A 3PZUA 4HNCA 1JXKA 1WZAA 2G50A 5CSRA 1FWGC 2ZX8A 4FIQA 4JTGA 2I5QA 3URAA 4TMCA 4JKKA 2CZ5A 5TD4A 3IJ7A 2JFEX 2PURA 5LNVA 4H2HA 2O7SA 1Q63A 1EA0A 2E25A 3MHGA 4S39A 4A3RA 1CLVA 3BQ6A 4AXKA 1KGXA 1T7LA 3OO2A 4N6FA 1BF2A 3T81A 1OABA 4EXBA 1UHVA 4GG9A 4LF2A 5AHLA 5JXQA 2YBUA 1XI3A 5ENLA 4JR5A 5XINA 3GW3A 3ARZA 3WQ4A 4UOZA 4PCTA 3VGHA 5EPDA 4QNEA 3SM0A 3AICA 1M04A 3KBVA 4Q4OA 4LRTA 2ACSA 3LCFA 1R86A 2O55A 1OY0A 2CESA 3A5FA 2XH2A 2PU1A 1A5BA 1E55A 3Q58A 1G01A 1E1CB 1OEPA 4C6QA 4CNTA 2GZXA 2TAAA 3W71A 1JCTA 1W1ZA 4PUEA 5AHIA 3PVFA 3T55A 1CIUA 4LU0A 3SFKA 3HM7A 5CPNA 3GXFA 1Q6OA 2ZUSA 3WKZA 3N34A 3QLLA 3AS3A 4ERIA 4L9XA 3VD3A 2Y0FA 1JCLA 2A79A 4QDMA 5I06A 1O4UA 4GFSA 4A8IA 1H1NA 4K7YA 4NASA 4ZFMA 2Y7DA 1M3UA 4AH7A 2CFFA 4JHMA 7CGTA 2FGZA 3GNDA 3VCNA 3BLIA 3G22A 3VNMA 5ABFB 3WBXA 3HFYA 5F4WA 3SUWA 1VEMA 4X0NA 1B57A 2X0HA 5FJIA 2A7RA 2R8WA 4X60A 3HQ1A 3THCA 1FCVA 1E5JA 1S2VA 3BAJA 5AECA 1OK4A 1EH9A 2EF9A 5CSSA 1XBVA 5LNWA 5HNUA 1X6NA 1FY6A 4C90A 2GSJA 5HUPA 3K8KA 1KM3A 9CGTA 1J12A 1W5PA 4DWSB 4TV6A 2V67A 3BTNA 3GVWA 1JPIA 5FJOA 5EMLA 1OF8A 3AU2A 4BY3A 4IQJA 1QBAA 4U31A 4JYDA 5FL0A 5A6SA 3CMJA 3AIWA 2PWHA 2E40A 3UR7A 4LXFA 4NNCA 1DIKA 5A8PA 1WXJA 2DT3A 2WQPA 3FY1A 3P3BA 3PG9A 1OT2A 1V8EA 5C5YA 3C8NA 4GGHA 3OVPA 1TTQA 4M81A 1GG1A 2XN2A 2Z1BA 3URQA 2QCGA 1PZ2A 3BC9A 2P88A 3CYJA 2ZX9A 1EYWA 4M1BA 4CNSA 3W24A 1SSDA 2OKTA 4A35A 1XLMA 1POKA 1GW1A 5FIPA 4QISA 3WQGA 1BF6A 5KTLA 2EQDA 3S5SA 1Q6FA 4FNRA 2W4XA 4G8TA 2O9TA 4JTRA 3POHA 1JI2A 3E5BA 3PUGA 2WVTA 2VCBA 3QY8A 1PV8A 3RHGA 4ZQCA 2EXOA 1VD6A 4O1BA 1ICPA 4XWUA 5BMXA 2DSZA 1UR8A 3QZ6A 3FAWA 5A6TC 1NU5A 4NZ5A 2WHJA 2DSVA 3BCFA 2X05A 3VDGA 3FV9A 4V15A 5DLCA 4N9BA 1THFD 1UA3A 1V0NA 2ZXDA 4XZ9A 1FXQA 4UR7A 1P0DA 2GOKA 2D3LA 3UJFA 2ZVRA 1FKXA 2ADAA 1CXKA 1CCWB 3NQEA 2XFWA 5JQ9A 1IXPA 2X40A 1JZ8A 3EOLA 1JR1A 5DRCA 4R7WA 3EDKA 2AKZA 3AYTA 3LHTA 1JI1A 2PUZA 1C8QA 1FWWA 4FMVA 4NU7A 4BQ5A 4IPPA 2OLAA 2CLHA 1J4EA 2G96A 2XU2A 1MQQA 3S3GA 4JDBA 2AMXA 5FJRA 1EP1A 3ARYA 3RJYA 4MZ8A 3WFZA 8RUCA 5LZLA 1U5VA 4H41A 2WC7A 4PB4A 3E38A 2HSAA 4JD4A 1PVNA 3K13A 1ZPTA 3LRMA 4U5IA 1Z41A 1B1YA 3KL3A 3UXKA 3E0WA 4UQEA 3VDBA 4LAUA 1AW2A 2NV2A 2WJFA 1CLXA 2E7FA 3NDYA 1JZ6A 1FP8A 3QSRA 3RLHA 2VEFA 1TB3A 2R24A 1JNDA 1E9IA 2YCLB 4LAMA 1P43A 1X97A 4E4UA 1AJ0A 4FNSA 3VX1A 1C8YA 1MUWA 4GVIA 1VHCA 2ZDRA 1KCLA 1H2JA 2ZRUA 3TKFA 7REQB 2ZKMX 4D9PA 4U5KA 5HAOA 1F2JA 5D2YA 1KM6A 1CENA 3KEHA 5D2WA 5HJLA 1QTWA 2KAUC 1QI0A 4JHOA 3E74A 1GZ1A 1YHTA 3VGDA 3KAOA 3UJEA 1ZP4A 2AAAA 4GI8A 4NRRA 1GQJA 1R9XA 3T9PA 1F8MA 1IR2A 4Q7NA 1UKQA 1Y8BA 2YXXA 3TSBA 2HMCA 3FA5A 2YL9A 3O1NA 3N2CA 3KOXA 3LCLA 1MFVA 1W32A 2PDPA 3A13A 1ZZMA 2DT1A 4MB5A 2PWUA 4L6OA 1LWHA 1E9YB 4DJFD 2G3FA 4KQNA 2ZUTA 2RGLA 4RJEA 2ZA3A 3W27A 3TZNA 3E2VA 1HGWA 3LCWA 2J7GA 2WKLA 3APTA 4FS9A 3KLKA 4L4LA 4QJ4B 3C86A 3ZT6A 4A3YA 4GABA 1RAKA 4E8DA 3MBFA 2PGFA 4P8WA 3GK0A 1K8XA 1TWSA 3A4XA 3PPCA 1FHDA 2W5FA 2UY4A 3S5YA 4CQBA 3B9NA 5LNUA 3WNOA 5E5CA 1ZJIA 1NWSA 3R94A 4G9PA 5AY7A 1IWAA 4U28A 4JTTA 1A4MA 3JRKA 4Q8VA 2ACRA 4B4HA 4JX4A 4JL1A 2V3GA 3FK4A 3LRLA 3UA4A 1YDVA 3NPVA 3KRSA 4BJHA 2V38A 3EPMA 4V33A 3WLSA 2VYOA 1TPDA 2FVLA 1YBQA 4L61A 2DT0A 1GVEA 2O92A 2ZRVA 3TTOA 4QE1A 1ZP3A 3LM3A 5A69A 5M03A 1CZ1A 2IQDA 3SRFA 4DXXA 2EKGA 4IOTA 1HF6A 3VUPA 1W9BM 4AD3A 2Y85A 1O1ZA 3VX0A 1W3HA 1E6SM 2WM1A 4DPQA 1QBBA 4O4VA 3MSYA 2VFGA 2VFEA 3G1AA 1JDAA 1AK5A 3VC6A 4X22A 4JN8A 1K7XA 4FNTA 3PPHA 3UD6A 3EDFA 3PZIA 1W5QA 1CXLA 4YVPA 3FJLA 2IQ0A 2G41A 1Q5MA 3SRKA 2VWSA 4OE7A 4PBGA 2YW4A 4GJJA 3GDMA 3BG9A 3H70A 3UG8A 4GBDA 3QGKC 3LGGA 1RBLA 3P74A 4LB4A 2QJNA 4PA8A 4IPLA 1MW0A 2E0PA 4DEFA 1KM1A 3QN3A 9XIAA 3VKDA 4LYKA 1V0MA 3F1QA 4LF1A 4DVOA 3W7RA 1J5TA 4XV0A 3WH8A 2QJHA 4PUWA 1L9WA 1FDJA 2X2YA 3BSMA 2NX9A 3DH7A 4IM4A 1IF2A 1VF8A 4ICCX 4ZB2A 1Q6EA 3NXFA 2J6XA 3GTNA 3LLXA 2VRQA 4UFJA 3EX2A 1SSGA 5L6UA 5HK4A 3TJLA 4JHZA 2PSNA 3BCJA 1K9TA 1C3FA 5J5RA 2DVTA 2PTDA 3N6QA 3LN3A 3P67A 3IGSA 4H19A 4O50A 5GNXA 4MYXA 1X6LA 1PX3A 3BLOA 3CZKA 1LRQA 1ZBVA 2G95A 2RHGA 3RM9A 3S1GA 1QW8A 8XIMA 3MBDA 4JEQA 3W22A 2FZ8A 1NOUA 2J77A 1KV8A 2FH6A 2NWSA 4MVAA 4J4KA 2BS9A 3K4WA 3SEPA 3RCNA 1XLFA 1LL7A 3NYZA 3H8AA 5ABHA 4NZ1A 4QE4A 2Y5EA 2XIJA 5EB8A 7XIMA 3N9SA 1C8VA 1FCUA 1I75A 3GTIA 2X09A 2C0HA 3LYEA 4WEVX 1PKYA 2A7PA 3VDAA 4LYRA 3DYOA 1UD3A 3GNPA 2OMAA 4QAIA 2WLYA 2GK1B 1PZ3A 3WLTA 4AIBA 4KGLA 1FKWA 3QVQA 2PDBA 1YPFA 3QY6A 4QS5A 4IH3A 2J78A 3TDFA 4S3KA 4UNIA 2VDIA 1QPKA 3MZNA 1I9CB 3UESA 4AY8A 4M56A 2UY2A 4E5TA 3MMUA 1BPLB 4LUSB 2FGLA 2DH2A 3RLUA 4RPQA 3WL1A 1A47A 3SJ3A 1M03A 1LZOA 1XYCA 3NQVA 3SRDA 3FOKA 1OCNA 1WKYA 3PNUA 3G8EA 1DHKA 3GYEA 3PJXA 2PPGA 1ISXA 4B5WA 3P5YA 5CZ0A 4IMAA 2GWGA 4O1EA 3HF3A 1SJCA 1ZU8A 1E4MM 4Q7IA 1UPMB 1XLDA 5FA5A 3N15A 1EDTA 3L2IA 3O9NA 2G8ZA 4I5UA 4QJ3B 1KBIA 1W3KA 5E0KA 1DWJM 2VR2A 1EBHA 1Z9AA 1UA7A 5HQLA 3TROA 1PKMA 2QCHA 3VMPA 4MWAA 1VJIA 5F2GA 3TQKA 4H9UA 2RDXA 2WZEA 1X39A 5AHMA 3NZ1A 4A2RA 4LC8A 9XIMA 1EQCA 5FF0A 4N6EA 5LNSA 3NA8A 2HROA 2F9RA 4PFHA 4MTVA 4IX0A 3ITLA 1KO0A 3DFYA 4LCSA 3VIGA 1N82A 1ECQA 5JVLA 3SCQA 4DAIA 1WXYA 4INFA 4UQAA 5SWUA 5B80A 4J35A 4HOXA 1UR9A 1JUBA 2QDGA 1MMFA 3OPSA 4MB3A 2VUYA 5AC7A 4LVDA 1FWFC 1W2VA 2E5DA 3IAPA 3EEZA 4ADTA 4GOAA 5JIPA 1ME7A 1VFOA 2CYGA 4B16A 4RZ6A 3NUKA 3LMZA 3CT2A 2CERA 4DJDD 5D9MA 3M1ZA 3EOEA 1XLKA 3DHFA 3KX6A 4HSOA 2NVAA 1T5AA 4DJFA 2JKEA 1MYRA 4QCEA 3L5AA 3ICJA 1X98A 1Z32X 1R9ZA 2XSAA 4Y90A 2Z4GA 1FVPA 1I8JA 3V36A 2JGYA 4YJ5A 3U6WA 2GDVA 1UH4A 3WCZA 5J04A 3GG0A 4IT1A 1UJPA 2G37A 4HHLA 2Y63A 3MUAA 1Q66A 1SGJA 5BRQA 5DXXA 2Y8VA 3VD5A 1XYAA 1TPH1 3EX6A 4XAPA 4L1XA 3B8WA 4D6EA 3GBDA 4GUFA 3AMKA 1Q7QA 3H4GA 1LRNA 3L5LA 4WSJA 3P2VA 5HNTA 1OYAA 2Z7GA 3D46A 4MY9A 2ZUVA 4C6KA 1LBMA 3C8FA 3CU2A 4OJYA 1ONEA 3L2LA 3BW3A 2QV4A 4IMEA 1DE5A 4LUJA 4C7DA 2PTWA 4PBEA 3KTXA 4B90A 3PULA 5I24A 1TWZA 3S5NA 2BWGA 4W93A 2B0MA 5A8OA 1XBZA 5EFFA 3FHQA 2FPTA 1JQXA 1ZS2A 4ZXOA 3RYSA 1SJBA 2I7GA 3ARVA 4LEQA 4Q8WA 4LOCA 5GJPA 1J0JA 4MUPA 4IMGA 1A3WA 1E9LA 2X1IA 4BWLC 3I7SA 2WNNA 1SU5A 5EBUA 3SCSA 1XLGA 1CNVA 1VCGA 4GC3A 3WD4A 1GYNA 4BI6A 2XSXA 5FD0A 2EG8A 1SZGA 4F4RA 2NVDA 5CZSA 2ZA2A 4LRSA 4K36A 1RBAA 1WP6A 2V9DA 1V6XA 2QJGA 5D8WA 1TTJA 2FDSA 1KC7A 3SW6A 3H23A 1X8FA 1DQXA 4AD2A 4PMUA 5PTDA 3FYOA 2EEXA 3GU9A 2WANA 3SCVA 2W79A 1EX5A 2GL5A 2QCDB 1J2WA 4AMAA 2QGYA