1ZRQA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 6.0
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
281
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGADRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 281
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zrqA00
2FMNA 4JNZA 1ZP3A 1TIWA 1B5TA 4O8AA 1ZRQA 4JNYA 3IJDA 3ITGA 1ZP4A 3FSUA 3E2SA 2FZMA 1V93A 3APYA 2FMOA 1ZPTA 3APTA 1TJ0A 2FZNA 1TJ1A 3E2QA 3E2RA 1TJ2A 3FSTA
chains in the Genus database with same CATH superfamily
5BRBA 2D2JA 3K46A 5AHIA 4PUWA 2OTDA 4KIEA 2OWWA 1TPVA 3B0PA 4PRRA 3BLFA 1W3TA 1XIBA 4HGXA 1Z6KA 3N2MA 4S2BA 4CNSA 3ZJ8A 3WH6A 3CMJA 3W2LA 3AMGA 1Q63A 2KZHA 3PZTA 3OTRA 4LWWA 3AMCA 3S2NA 3LM3A 3ANUA 4LB4A 3DFYA 3KVLA 3P82A 3STCA 3WQPA 2ONEA 2PRMA 4CVUA 3H70A 4JKLA 5E9AA 3CLMA 3KOZA 2QZRA 4FR6A 3T42A 4M80A 1TV4A 3G1XA 1WZLA 4K3ZA 3HG3A 2GJXA 1ENUA 2Z1WA 1UPPA 3DECA 3MU7A 4EANA 4M24A 1B2YA 1OX4B 2FVKA 3OBEA 3VOFA 1K9FA 3GXMA 5LNUA 3S9YA 3HMCA 3SR7A 4RPPA 1P0BA 4JN6A 5CC3A 4F4RA 2VEFA 1H0GA 1JDAA 1OZMA 4LH8A 3HO8A 4YHGA 3WF3A 1GOOA 4NJGA 1P5BA 3WEZA 1TJ2A 5C71A 2OZ3A 3WMCA 1FWJC 1Q6LA 1HKJA 2PC8A 2FJUB 5DCBA 3PB2A 5TF0A 2XFFA 1EO7A 1J0HA 2GOKA 3NZQA 4FSAA 3MSGA 1AA1B 3CU2A 1JCNA 3GXFA 3L4UA 5CXPA 3WF4A 3DERA 4MMWA 1KFCA 1V79A 4GH3A 4HA4A 1VHCA 1LROA 3RIKA 3D47A 4QEHA 1E43A 2FZBA 4PB5A 1JZ3A 4ROPA 3WYZA 2B81A 4E5TA 1SFLA 3WQWA 3GXDA 4IHCA 4QQUA 3BW3A 2Z7GA 1Z32X 4PZVA 2X1TA 1ESWA 2NT0A 4C6OA 3T40A 4UWMA 1LLOA 2FTWA 5FF4A 1Q6EA 2CNCA 2ZZ2A 3S83A 4D1IA 4WSJA 3QR1A 1J6OA 1LZOA 4JIEA 2J8FA 4Z1DA 2RH9A 3VKAA 1W1IE 1BLIA 4MZYA 1E56A 4HU8A 4KEMA 4MPQA 4LYRA 3GVWA 1C8QA 3KBNA 5LA1A 3T78A 1LBMA 3WFLA 1L6FA 4XD3A 4IPJA 2ZXAA 3LHTA 2Z24A 4OBRA 5DMMA 4ZE5A 1UMYA 2OX4A 3CWNA 4JZ5A 2PP0A 4WSHA 4PCTA 3UZZA 3LDVA 2OOGA 2VNCA 1IIHA 2YCKX 3CEPA 3ZQ9A 4H9UA 1I0DA 5BU9A 4GJJA 3VFLA 2FHBA 4MNLA 1JDFA 3ABOA 1GNXA 3AHVA 5CPQA 2CZVA 1XLKA 1XCXA 3MUY1 3BLIA 5HANA 2XYLA 2X0HA 1XQKA 2XGBA 3QGKC 3A4AA 4F79A 1UZ1A 3B06A 5DO8A 3PK7A 4XZBA 4H8HA 3WN6A 4HMCA 1BGGA 3WLSA 1RXOB 4ATWA 4QLJA 1MZRA 1ZJHA 1JYWA 4PYSA 2BMBA 1KFKA 4NVTA 3S2JA 3USZA 1BSIA 1MSSA 3U8GA 1QU4A 3CB3A 2BS9A 1R7OA 1W3JA 2OOFA 1A3WA 2A2IA 3G22A 2FB3A 1S2WA 4HBKA 1CXLA 4ZL1A 1RVGA 1RCQA 5DBUA 3SURA 4QTGA 3R8GA 1SW7A 3KLLA 3ABSA 3CMGA 5GNXA 3S2LA 4O12A 2ACRA 4QG6A 4JCMA 3OGVA 2C14A 3A3WA 2DY3A 2PF0A 4BR1A 4X0VA 1YBQA 1LP6A 3PZQA 3URAA 4FNQA 4WKHA 2D3NA 4ATLA 1A5UA 1PS9A 1UH3A 2CBJA 3I4KA 3NM3A 5A95A 2MNRA 2QUMA 1O5RA 1N8IA 3CT7A 2QCEA 1HX0A 3N9SA 1MDLA 1X97A 4WOQA 3O6YX 1TUXA 3NJ3A 4BCEA 1PHQA 4B3LA 2ZDRA 1REQA 1GQIA 2ZXQA 2HMCA 3MCMA 4PUNA 3LN3A 2V3FA 2X40A 4ICNA 4PODA 3HN3A 5AC5A 5GJMA 3DC0A 2PGWA 5LIWX 2B7OA 4DQWA 2IQ0A 4MWAA 3MVIA 2PDJA 2DZAA 3UJFA 2V2CA 2WLYA 4GA8A 2R9RA 2OSWA 4KF1A 1PO9A 1PWLA 3VX1A 2VFFA 2Z2UA 1NY1A 3MJMA 4IX2A 3KCJA 1A0CA 2A3AA 1DVJA 3L2MA 1UHVA 1GOIA 1E6PA 1L0PA 4NAFB 4S3EA 3JVAA 4B91A 4O1CA 4C6KA 2F38A 2ZRZA 4FX7A 2Q09A 3W7GA 4IQJA 1VKFA 1OFQA 2V8ZA 3JR2A 3OYZA 3RLUA 4DLMA 3CIXA 1Q6GA 3EXTA 4XD4A 4DF0A 4XB3A 1HL8A 4OVXA 3KW3A 5DCEA 1VPXA 4BJHA 5HK4A 4FLQA 1RD5A 4PB4A 3UPWA 4O14A 4DJFD 1UBSA 3VD9A 4ZO6A 2PWGA 4ZOEA 2OWCA 3W29A 4EAYA 3PJWA 2TPSA 3MSDA 1Z48A 2GL5A 1K4HA 1XCWA 3C86A 4ECLA 2VDIA 1JFHA 1NVMA 3W71A 3LLXA 4DO5A 3A4XA 1SPQA 3WFZA 4PBGA 3SY5A 4M6VA 2BY0A 2PDLA 1XRVA 3NQDA 5AC7A 4GI8A 1V03A 2VC6A 3N4EA 3R0UA 3DFPA 1A47A 3H2FA 5HQEA 4RR4A 3R8RA 1QOPA 2VEKA 3MP3A 4MAZA 5DRIA 3SN4A 3GUWA 3KOXA 4DWSD 3FY1A 4IM4A 5ABFA 2B0MA 3GQYA 2VR2A 4JHOA 2EG8A 3POHA 3BCFA 3T2QA 3ZLFA 1EQPA 3UWVA 2FZNA 4Z2JA 3BOLA 1K02A 4PMRA 3RJYA 1CX9A 4KCUA 4AIEA 5CCZA 3C2FA 1R9ZA 3R94A 4JNMA 1NOUA 4EXQA 3G3DA 3S0CA 1NF0A 3MUIA 2YW3A 3UY7A 4L1GA 1S2CA 3ITGA 3DHUA 4BHYA 3GNRA 3CHFA 2YCEA 4LGXA 4PCNA 3EYPA 3W2NA 4MSSA 4POCA 3PAJA 1THFD 3THAA 4HSNA 3THQA 1V7YA 4GMEA 1JZ6A 4OJYA 1FTXA 3WMBA 4ZCWA 3TYZA 3ARXA 4P7OA 4DF1A 1JAEA 3GR7A 1GOQA 4PE8A 2BOGX 1L8NA 2RUSA 3FX4A 4ENLA 1TPDA 5D09A 3I4EA 2QPSA 4JCLA 4JFVA 4C6FA 4PMNA 1OSEA 4DY1A 4K38A 4JNZA 2X16A 1YRRA 5FAJA 2ZRUA 4N02A 1I8JA 2OWXA 2TRSA 3BARA 2OELA 3CHDA 3UXIA 3OOQA 4KRZA 1RLDA 2BVDA 2OKOA 1XV8A 2PDUA 3URQA 1EJVC 4L80A 4ZTXA 3TZFA 2J75A 1JCMP 4WIWA 3PBGA 3WJSA 5EMKA 3B8IA 2I1OA 3OLIA 2NX1A 2J78A 1SFSA 3TLQA 2Q3RA 3EWWA 3RPDA 3CJPA 5F2IA 3R89A 4A6GA 1XICA 1VBHA 4LYQA 3AJXA 3KS6A 3P84A 1P1XA 3NYDA 2D0HA 2PWHA 1TWZA 1NP2A 4Q3MA 3OZMA 1KC7A 4IQDA 2CBUA 4C6JA 2FKPA 2GQ3A 3BW2A 4QCEA 2PWDA 3FHQA 3ARVA 3W82A 1G7VA 1TPH1 3IUDA 3RLVA 3BH4A 4I7VA 2PRLA 3CQHA 2GSJA 3KBSA 2ZWYA 3OPSA 1UR9A 4PMUA 2DZUA 1WDPA 2XIMA 3L68A 3CB8A 2A79A 3A4WA 1UWSA 4LCSA 3KHJA 2J77A 4AY1A 4J40A 4UZUA 4LBSA 2NX9A 1OINA 4W7VA 4AVFA 3O15A 2DT0A 3NZPA 4UUIA 1QUMA 4KGLA 5C9ZA 1XM3A 1LG2A 4OUEA 3Q65A 4DZIA 2G3JA 4B5NA 4LNCA 2E9LA 1VJSA 2PU0A 4CN4A 4LX4A 2E6DA 5KZEA 2VR4A 1XXXA 2DSZA 4RZBA 3ZR4A 1W1A1 1GKRA 2A7NA 3FVDA 1J0ZA 1MXSA 1GORA 3SI9A 3ALFA 4DUOA 4GABA 4GD0A 5LXXA 4MZ8A 1DWJM 4O18A 3GR8A 4AX6A 4F9DA 5LIYX 3PTDA 2VEGA 5FJTA 3V36A 1O66A 3QRHA 1QBAA 4GJ1A 3B0VC 4BQ3A 4W9TA 4H6KA 1NTHA 3BAWA 3MP5A 1IIGA 3PZIA 4AUBA 3F4NA 4OV4A 3I7QA 1KXTA 4HHMA 5LA0A 2XZ7A 3DI1A 2WB5A 5D4YA 2BDQA 4RDWA 1TZZA 4ZFCA 2WZHA 1V3LA 3CL8A 1OEPA 4QGCA 4ICMA 1ECEA 2AKMA 3ARUA 1F3WA 3C61A 3W1RA 1QR7A 3W85A 4ZSTA 1XH2A 4NXSA 3GTFA 3L7RA 1V02E 4JDBA 1W9PA 4IT1A 1YTKA 3S3GA 1ZBVA 4O52A 1VBUA 3CYVA 2XVGA 1BQGA 1WE5A 3BSGA 4UOJA 4JTTA 1WDQA 1J12A 5F7UA 4DYKA 4LFYA 3QV7A 1S39A 4M29A 4IJBA 1O1ZA 3HM7A 3O16A 5HJXA 3VU2A 4L56A 4LUJA 1L6GA 3G3MA 4LW7A 1XKYA 1B54A 1NIUA 3ONCA 4PULA 3WNLA 4GUIA 4HZ6A 2W92A 3NPWA 2BHYA 4UNIA 1EOKA 1E51A 4UFJA 3VNZA 3LBOA 4HSHA 4E0CA 1J93A 1AQ0A 3AWOA 2V6AA 1W1YA 3LGDA 1SR9A 4GI9A 3LXAA 2QXWA 4HSOA 3GSMA 4N42A 1B4KA 3B0YA 4FB7A 3FLUA 3QOKA 1JXKA 2D2HA 3B9DA 3KRZA 1P7TA 3O63A 1EFZA 3PF3A 4KEZA 5F4XA 3ORWA 1LCOA 4AF0A 1FRBA 4HA0A 3RYSA 3FA4A 4LVDA 2OX1A 5D8WA 2JK2A 3W6LA 1JGIA 4G5DA 3UGRA 5JBEA 4GLEA 1R2RA 3GLCA 3KE0A 3R0KA 3S5NA 3A3HA 4DXKA 2CKRA 1MI3A 4GNJA 5LYRA 5AHLA 2POTA 1W5OA 3GD6A 2Y1HA 4OZOA 4G2DA 4GUGA 2YSWA 1ZJIA 2YOCA 1H7RA 4XUGA 4BZYA 3U2EA 1VFUA 1O4UA 2QVNA 4AD4A 3W53A 5D2YA 3WLKX 3GBDA 2ZE3A 4FLSA 5C70A 5C8BB 2WMGA 3E0IA 1KCLA 3H6OA 3IGHX 2IPWA 3W7QA 4Q4KA 3I7SA 5IRPA 2HQAA 3AMLA 2J6VA 3BW4A 3PFMA 4BFAA 3E38A 3TE9A 1VBRA 1V6WA 4D6HA 2QJJA 4EACA 3H4GA 2ZZ5A 3BG9A 4Z0SA 4I5UA 4PTXA 1K8YA 2Y8UA 4B3ZA 3G1SA 1I2PA 4WR3A 1ZAHA 3BJSA 3ES7A 3GG7A 1G6CA 4ZSUA 2OGJA 4W8LA 3ATZA 1BPLB 4Z17A 4H8VA 1BRLB 4A3HA 1S3TC 2DW6A 3N9KA 4UFIA 4R53A 1PKLA 3MPGA 4WXZA 2INFA 2V0TA 3DESA 5E6YA 4LAOA 2PDYA 3VIIA 4XAYA 6REQA 3KL5A 4Z2IA 2E8ZA 3LENA 5D37A 3TTYA 2FIQA 2R6OA 4KETA 2BASA 3E5PA 3PM6A 1VJZA 1ZZMA 4H6QA 4GKLA 1ML1A 2B7QA 3UBPC 4R7OA 4PMZA 3I10A 3CPRA 3L23A 4HKPA 5M3WA 3GVVA 3KRBA 4NZ5A 1WB0A 3A21A 3GC2A 1OFPA 4NU7A 4P2VA 5D33A 5G2WA 4DJED 2V63A 1UD4A 3GDBA 4OGZA 3KAOA 1RUSA 2XM2A 1DWAM 3SCQA 4MG4A 1AH4A 4HNCA 3QZAA 1A4MA 1FDZA 3LI1A 4TOQA 4H8NA 1PZ0A 2BOFX 1IZKA 4HCDA 3W7LA 3U2ZA 3M16A 1MRAA 2VI0A 8XIAA 3MUAA 1ICQA 1FWHC 1PDYA 2R24A 3TYDA 2B4GA 1X39A 4X2PA 1UYQA 3E9AA 1LLWA 3S47A 3VE9A 4UZSA 3EA2A 1CXFA 3IJIA 4BF7A 1VQTA 1T5AA 1PTAA 3XISA 4AIUA 1ZLPA 1WYIA 3VNYA 5HNRA 4AEFA 1GVFA 4PRTA 3B4UA 3AIRA 3VFCA 2EPNA 2Y7GA 4I8DA 3SUTA 1VIWA 2QUNA 1MFVA 2IW0A 3M47A 2FHCA 4MAVA 3W70A 1HP4A 1X1NA 4I6VA 3CIWA 2D24A 4L5ZA 3CHVA 1O7AA 4MZ1A 4MY9A 5FF2A 3OIHA 2YW4A 1QW9A 3ZS4A 3GY1A 2POZA 1JZ7A 1XYCA 2V81A 1IEXA 1DE5A 2Z27A 3M5YA 4IFKA 4AZ7A 4R88A 5GJPA 4CCDA 3ZSSA 1MWOA 3KVJA 4L65A 2EPLX 1FP9A 1TVNA 3W1LA 2VRKA 1H5YA 1S5MA 2C19A 3TYAA 2Y70A 3CPUA 1PHWA 4AZCA 1FHLA 5D2XA 1B3WA 4Y90A 5LSMA 4GZEA 4J28A 3BC9A 4JAWA 5T91A 4IH3A 2DZBA 3FSTA 4GXWA 4YXGA 5BCAA 1ZGDA 1J8VA 1WOAA 2FB2A 3F5LA 2ZX7A 4BQ2A 3U9IA 2Z29A 4UFLA 2JF6A 1H1ZA 3NSNA 1ONEA 3RCNA 1UIOA 4J2PA 3W7OA 2HE8A 4TO8A 2IPJA 4FOUA 3STPA 2H6RA 2W3ZA 3H12A 4IIBA 1QWGA 2R1PA 2JKPA 1EEPA 1GUVA 1ODUA 2O7SA 3IRSA 4XSLA 4DX3A 1EIXA 2QJHA 1V8EA 4X61A 1LL4A 3TQ0A 3TTQA 4KWSA 3TVAA 4H9TA 1YADA 3AYVA 2JBMA 3EXRA 4H9YA 4LYKA 2YFNA 2XIOA 3BGGA 2GUBA 4LC8A 4Z1BA 1JPKA 3AS0A 3N73A 3EA3A 4HIBA 2XUCA 1R38A 1DHPA 3WK0A 3UNTA 5A5WA 3IJQA 1FWGC 1TJ0A 2OR2A 2O9TA 2VFIA 4LS1A 1PXGA 8A3HA 3LG3A 2NUWA 4KWOA 4CD7A 5EBUA 1F5ZA 2DPEA 3WQ4A 1VFTA 4QLKA 3HGRA 1UOKA 1A50A 1E40A 3EOSA 1JGMA 1TTPA 5GPRA 2WW5A 5ECUA 2BV9A 4JKKA 3E0VA 1CBGA 1VBJA 1S2TA 2GVGA 3TYCA 3UW6A 3GDRA 5CSYA 4FMVA 3AUOA 3QW3A 2CWNA 1W32A 5AZ0A 2VC5A 3GM8A 4V33A 4IP7A 1UUQA 3LPOA 1XLEA 2DZPA 4HK7A 1W56A 5JIPA 3M7SA 4XX6A 5CPOA 2I5QA 3IIPA 4K2SA 1BG9A 4JD4A 3EWXA 3NZ1A 2Z26A 2YL6A 3WKZA 4C6EA 2HK1A 4HK5A 1K9TA 2YDSA 3QQ1A 3PTQA 2HTMA 2PDWA 1LWJA 3AXHA 1UP0A 5I00A 2R8WA 1G4EA 4WUIA 3TN4A 1QO2A 3GDKA 2QS8A 2PWEA 3WLRA 4AWUA 3MI3A 3NSMA 3B8VA 2PBGA 4LT9A 2VFGA 2WVVA 3LCGA 1V77A 3RR4A 1P0KA 5FJUA 1W37A 5HNTA 1I60A 1M04A 4GVHA 3UJSA 2FMOA 5I3HA 4UMCA 2P8BA 2E5BA 3P8JA 2DUXA 4W93A 3DFTA 4A3QA 4IL0A 1H7WA 4UIOA 4AXNA 3PTKA 2CEQA 1QRQA 2WKJA 5A6KA 3VCNA 5D03A 1KR0A 1TJRA 1OFAA 1JD7A 3PZVA 4XISA 1W3NA 3QC3A 3YPIA 1CW2A 5AYZA 3ALGA 3VI2A 3D6NA 1M68A 1TO3A 5A6AA 2H3DA 2PDMA 5HNUA 3IIXA 2X1IA 5DF0A 1J0YA 3FKKA 3B8SA 4RPQA 1BWLA 1GGOA 3UG8A 2G4JA 3D0CA 3FK4A 3PP7A 4HMEA 1K3UA 5CGQA 3P60A 1JIBA 1RJQA 1R85A 3NQEA 3FS2A 4KEVA 2DUZA 2VHLA 2ZUWA 5HXMA 3G1AA 5LZLA 7TAAA 2HVMA 1UUOA 2WK2A 1MZHA 1NM9A 2SFPA 5CG0A 2O9OA 3HPZA 3USBA 4A35A 3K1GA 3EWYA 1M53A 1K1DA 3LZ5A 3KOYA 2OZTA 2I16A 2TYSA 3QGAC 1UJPA 1FXQA 2Z28A 5AC8A 3EZ4A 2YR1A 3HJZA 3ZT7A 2FTYA 1F05A 1ISZA 2CLKA 4HQVA 3ITVA 1ZTVA 4QQ3A 2NWRA 2YYUA 1S1PA 2O55A 3IGSA 3TKFA 1SFJA 5GJNA 4S38A 4NF7A 1SO6A 1OC6A 2PEVA 2YXOA 2ABAA 3R4IA 3B8UA 1DQUA 4L4LA 3KWSA 3RN6A 1WDSA 3S8HA 3F5JA 5IBXA 3BAXA 3WO8A 1GVIA 3K4DA 1SU5A 3ARQA 1TA3B 5AC4A 1XD0A 3NFUA 3NSXA 2EGZA 1VEMA 2X2YA 1QK0A 1X1ZA 2WANA 4GRSA 5KINA 4M3PA 6CGTA 4X22A 2BBFA 3RG6A 4C1NA 4QAIA 3BAJA 4XSMA 1UKOA 1OB0A 1EGVA 2W79A 4A21A 4AZIA 2REQA 3WCZA 1WKFA 1AODA 3DHDA 2VRQA 2YPIA 2Z4GA 5A2AA 1RJRA 3GU9A 2J13A 1PKYA 4QFUA 5D30A 1E4MM 2DFAA 4BEQA 4PRWA 2EBNA 4EOUA 1XH1A 4JICA 1FFQA 1KBIA 1Q4WA 4DJFC 3BWWA 2QPXA 3ZXWA 4DEFA 3BV7A 2Y7EA 2BHUA 1LT8A 4UTHA 2J27A 4MB4A 1L2UA 1V6TA 3GG8A 3W22A 1PX3A 1W5QA 1TIMA 4J27A 2CZFA 5LGXA 3NM1A 2GVLA 5CAHA 4H6RA 5KMYA 1A80A 5JU6A 2CZDA 7ODCA 4K7YA 2CBIA 1TPB1 2O92A 4HOXA 1IXOA 1HJXA 4M0XA 1CWYA 5BW6A 2QJNA 4D9PA 4MVAA 1IV8A 5HMEA 4I3GA 1TPC1 5I03A 4AEOA 1Q8AA 3CHEA 5A6TC 1IT7A 1O60A 4MYXA 1VS1A 3S1UA 4GBUA 3IANA 1HKKA 4DWSC 3WF2A 4N6FA 5C2GA 3WBXA 1ZRQA 3PTMA 1W5MA 3WQOA 1LBLA 4RE0A 3S42A 3W1PA 2IUZA 4LEQA 2PDIA 3L4VA 4A22A 3BMWA 3UYIA 4JYEA 1ADSA 3MKVA 2H3BA 4ZQRA 1ME9A 3HBLA 4FOJA 4RDYA 4GQQA 4JQAA 1Q6FA 1V3KA 4IPPA 4QSFA 2VZTA 3UWQA 2QCMA 4NZ4A 3ZWSA 3OA3A 4IQEA 1H3GA 1IEVA 3N6JA 4DYJA 2HSAA 4NAEB 3WNNA 3VCRA 3LRLA 4JIQA 3GYEA 3FJ4A 3EMCA 4FA3A 1C93A 3QF0A 4JDYA 3VINA 3UJRA 1PAMA 1A5SA 1SW0A 2XSAA 1AMKA 3L5AA 2ZA3A 4H04A 3NIYA 3KZSA 2UY3A 2EPMX 3VAVA 3N9RA 2NWSA 3KUMA 1OZQA 3UYCA 2OVLA 2VZOA 3SCNA 1HJWA 3GXTA 1M01A 1JG9A 1TZ7A 4H00A 4U28A 1AH0A 4HNUA 3WSUA 1VPQA 3GC4A 3D3FA 3VABA 1ZCOA 3G8RA 1VF8A 1F8IA 3HOJA 2QCGA 2WAGA 1MW3A 1VIZA 3K5XA 4FP1A 4QE4A 4L6HA 3IUHA 2PBOA 2ZUVA 2NV2A 2VVSA 3DU0A 3M46A 2QDEA 3P81A 2OQHA 5IFPA 3V0TA 7A3HA 4YVXA 1RA5A 4N9EA 4DUXA 5GQBA 5REQA 3KTSA 1F4AA 4QISA 3FIGA 1P6CA 3F03K 3NL2A 3PUGA 1UH4A 1V3IA 1YLVA 3LCFA 1ZJAA 2OYMA 2QAFA 1TMLA 1TREA 4D1JA 1VENA 4O11A 5KEZA 1JCLA 1JZ2A 4EVZA 5C55A 1KTCA 4H3DA 4IIHA 4AD5A 1PZ3A 4GINA 4I8YA 3TW9A 2E3ZA 1XBYA 4C6LA 5CZTA 4DZ5A 3UWWA 2PCEA 4IMDA 3H7RA 4HN8A 2QKFA 2C91A 2PPGA 3Q37A 2NUYA 2P5NA 2DSKA 4LCQA 3P6LA 4OECA 1TB3A 2WO5A 1EF2A 2XH2A 3GVRA 3EB2A 4QEEA 4ZQOA 1YDNA 3IEBA 2XN2A 3T09A 5ENLA 1E0XA 3PPCA 2O0TA 4O1DA 3HZ3A 2PLKA 4BEUA 5K7JA 3I3EA 4E8CA 4JTUA 3EOOA 1E15A 1XX1A 4HYWA 4AX7A 4BKNA 1WAUA 4DBUA 3EEGA 2PURA 4JNYA 4Y8FA 3F4VA 4CCZA 3H21A 4P61A 3N12A 3TTEA 1W1TA 1ZENA 3MMTA 3SIZA 2Y4SA 3W86A 1YTDA 1Q65A 4MWAD 2Q6ZA 4Z2LA 3DYMA 4KCVA 2ATSA 1BQCA 2JF7A 3HQNA 1JZ8A 1KXHA 4E3TA 5CZ0A 4H7VA 3WY1A 3NOEA 4XZNX 4HMDA 4Q8OA 4E4UA 1VFSA 1PPIA 2VQUA 1BKSA 4B5SA 4NNBA 4JY8A 1FOBA 1GYMA 4AY7A 4YL2A 1JI1A 2XPKA 4D6CA 4N7QA 1NFGA 1CGUA 1CB2A 1F8MA 2X1SA 1GONA 4H2HA 2FJKA 3RGTA 3ZIZA 3XIMA 1JVNA 1PTDA 3E0WA 4AYSA 4L4OA 3WQDA 4INFA 4IFRA 4G8TA 4YVVA 3E96A 1NOWA 4GGHA 1V3MA 3OGRA 3NNTA 4LEFA 4IXHA 3WBEA 4B9ZA 1KCXA 6ENLA 2QR6A 2ABBA 3FJNA 1VR6A 3CT2A 3WL1A 3D5HA 2ZOXA 3LM7A 3TROA 5FI8A 4GY1A 3GIYA 2QHAA 5HUPA 1Q85A 1EXBA 4IISA 4AEEA 1KM4A 3AIBA 3NTYA 3K30A 3WQGA 1EUAA 3CGTA 2X0YA 2EO7A 2DZVA 1M65A 3E2VA 4D6JA 1W17A 4GX9A 1JUKA 3M1ZA 1ICSA 4GX8A 3CAWA 1A5CA 4NNAA 3CV1A 2G50A 5CBBA 5I07A 3LY0A 4TV6A 2VTFA 3F2DA 2FGBA 4HZ8A 3A5VA 1DWHM 4O1EA 5AVHA 5FF7A 2VX5A 1Q66A 3BLKA 4QS5A 2EQDA 3G18A 2J24A 4OU1A 1RCXB 3SB0A 4AXKA 2AAMA 1NFBA 5I7GA 4Q8UA 3U7VA 4J3VA 4WKAA 5G4HC 4UR7A 2VCAA 1BXCA 4J3TA 3ZVHA 1QDSA 3TONA 1O5XA 1DYSA 4HCLA 3B0XA 2VFEA 3RDKA 4OOUA 3DOPA 3KXQA 1A5OC 1CXIA 1XIEA 3FXYA 1OFRA 3NEHA 1ISWA 3CUZA 1I1XA 3R2GA 3KX6A 4GY7A 1Q5MA 2CHNA 3N4FA 2ZRXA 5L6UA 2MUCA 3BLLA 2YCLB 3BDKA 2DP3A 1NAL1 4FR1A 4W7WA 1H51A 4QS6A 3P2VA 1LOSA 3QBUA 3LRMA 3Q58A 3WDRA 3BSHA 4FHAA 1OT2A 2JQXA 3QXBA 4PEEA 5FD0A 1LORA 1UWTA 3WH9A 1QTWA 4P7LA 4MWAE 3M4HA 4GIRA 2PGFA 2J7BA 1G4SA 2WC3A 1TTJA 3KZPA 1FP8A 2VX7A 3U57A 4XZLX 2QULA 5I02A 4HPGA 3TQPA 2HEJA 1SZRA 3O7UA 1YQ2A 3IVSA 1XLMA 4MY1A 1F07A 1E55A 3W2KA 5HNNA 2WBGA 1H50A 5G4WA 3VGHA 1KQZA 2E67A 3CASA 1NWUA 3UR8A 4YS1A 4W88A 4JS3A 2OSXA 4MB5A 3O8AA 3WQ8A 1ONWA 1CTNA 4EPBC 3SDOA 2WKLA 3LK6A 2GK1B 1XDMA 1MRQA 1NWTA 1F7BA 1WKYA 3MO7A 3MI2A 2YA1A 3IJ8A 1LWHA 1ZAJA 4MJ2A 4KQNA 4J3WA 3STGA 1V3HA 5DCDA 1UD6A 4AZBA 1IYXA 3FGCB 3K2GA 2RGLA 1D7KA 3PY2A 1IHIA 4RUBA 2ZA1A 4YTUA 1JR1A 3W38A 2GGGA 3HQPA 3H55A 1K7XA 1X8FA 2Y24A 3GNNA 1B3OA 3PUDA 4Q7IA 1UZ4A 1W6TA 4GI6A 4W86A 4ICCX 1Q3NA 3N2BA 1JD9A 3H2CA 2NSOA 1V7AA 3HPSA 4JGDA 2GDUA 3WJYA 3H54A 3KVKA 4DJEC 5DY2A 4M56A 3LLFA 3CQIA 2ZXDA 2G0WA 1XLFA 5CZSA 3HQ1A 4XBSA 5E0FA 4NRSA 4OFCA 3BPWA 2PCQA 3AYTA 2JEPA 4Q4PA 4LAKA 4E3VA 1PUDA 1F3XA 4UCFA 5EMYA 2RHGA 2IKHA 1MMFA 4NYUA 4AWEA 3W02A 3W2MA 3L67A 1UD2A 1HXJA 5DN1A 3AS1A 3A12A 1WO2A 4E4FA 4QNWA 4FEZA 4MJ4A 2EEXA 4O10A 4RK8A 4UTTA 1S5WA 5BZAA 1B9BA 3ONBA 3MDUA 3AMDA 3Q45A 3RR1A 2ZDSA 3H53A 1PCKA 4AMCA 3PSVA 3F7JA 1AMYA 3OO2A 1JI2A 2DSVA 2AGTA 3RJXA 1T8XA 3N04A 3MZ2A 3UXKA 1BTMA 1N8WA 1XC6A 2NVDA 2IQDA 3LGEA 4E38A 2ATMA 2X7WA 3UESA 1HGYA 2G37A 2O56A 5A8PA 3BGJA 3ZO9A 3HPFA 2XH4A 4FZIA 4EF9A 5K9DA 3WL0A 4JTDA 1OCJA 5DELA 4WY0F 2V68A 1RA0A 3PBMA 2G5WA 1PYFA 2ZC8A 3O1NA 3OQ8A 1V6XA 4O53A 1AJZA 3R58A 4PTNA 4CD5A 3VKJA 1XP3A 3N6HA 3WK2A 4KKXA 2B31A 1OX4A 5EA9A 1XRSA 4S3CA 4G7EB 1A3XA 2Q02A 3CTLA 4C7FA 1VCGA 3UWYA 1WZAA 1Z8AA 3DYOA 2UBPC 1SGJA 3TC6A 4V28A 3AWNA 1OYBA 1KCKA 5E6ZA 5HMSA 2G3IA 3V5FA 1GOMA 5MF5A 3TWBA 2Y63A 4ZQNA 1PWMA 5DT7A 5AYIA 3PZGA 4GFIA 3UXLA 1FWRA 3TCSA 4Q4SA 3W73A 5LHEA 2CZEA 1E5JA 1IXPA 1ELSA 2YXXA 3W25A 1EDQA 3UCDA 2J7CA 3VTRA 1PX8A 3IPWA 1A5LC 2WMIB 3H26A 3AXXA 2CHOA 1JAKA 3ITCA 4D6IA 3LCHA 4TV5A 4O19A 2R1MA 1RR2A 4G7FA 3LBMA 4H4IA 2EPOA 4DO6A 4OBSA 3E6EA 1S3HA 4ERIA 1GQKA 5JIWA 4HNTA 2BY3A 4ZB5A 1DHKA 1MXDA 4AVOA 1Z42A 1OC5A 3GH4A 2PFHA 1FCBA 3TAKA 2GVJA 4F0SA 1V93A 2J6XA 4UQ9A 4WF7A 5KZMA 2Z2AA 1ZBCA 4HNLA 4LALA 2AQVA 3CM4A 2ZUSA 4ERGA 2QF7A 3KBJA 1KFEA 1X6NA 5CJNA 3CWHA 4I9MA 2FHFA 1QI0A 3CK5A 2OLSA 3KDNA 3S46A 5T9BG 1VZWA 5LGZA 1GYNA 4AB4A 3PZ9A 3GNXA 2VCCA 1DIKA 1GEHA 2VYOA 3B9NA 3PN8A 4AU0A 1BHGA 1IZJA 2V5BA 4GXMA 5K2ZA 2KAUC 4Q4OA 3WQFA 1DORA 4PMJA 1KV8A 4O8AA 1QVBA 1XLJA 4XZWA 3E12A 3W7HA 5DEZA 1ECQA 3MV11 3VIGA 4F2TA 3FAXA 1KV5A 1LL7A 3C2RA 3FNDA 3ABZA 3CUFA 3UF9A 3VKDA 3KP0A 5H6HA 2I17A 1ADOA 3BSMA 2GYIA 3ES8A 5BOOA 3EGJA 1SJBA 4CCCA 3AMKA 4B3KA 5C2CA 3VGFA 3AXMA 5A94A 3H23A 1L6YA 3M9YA 3PWIA 1H1YA 3CIVA 2CCRA 2XG9A 1E70M 3BMXA 5I79A 4AC1X 3VOIA 3VD7A 1MW1A 1WPCA 4HZ7A 1H63A 5B7YA 3SRDA 3HV9A 2OG9A 4GQBA 2Z1VA 4US5D 1T8QA 1JCYA 1IEQA 5KITA 4FF7A 1D9EA 1IXNA 2IKGA 4HHPA 1QW8A 2JIEA 2Q8ZA 4AZ6A 2IS7A 5D32A 3W7MA 1VCVA 5HINA 3WJXA 4P8WA 2NLYA 5CAKA 1TPWA 4E2DA 5DRCA 3GUGA 1EJXC 2NZLA 5HAOA 1WKEA 3ARYA 4WDTA 2IKJA 4HPJA 3ARPA 2FFIA 3KEHA 3RPTA 1TELA 4AFYA 2Y7DA 3WQEA 1CI1A 1EQCA 4AZ5A 1IZCA 4S39A 2DT1A 2RDUA 3RU8X 2WSKA 5CBJA 1K9DA 3EBVA 3G8EA 1NU5A 3GDLA 2ISDA 4PL2A 1UKTA 2YB4A 3MYOA 3WFAA 3HURA 3CUJA 4KCWA 2NQ5A 2FDSA 4K39A 3LCIA 2VX6A 3KFTA 1GOXA 1GVRA 4EPEC 3IRDA 1WZMA 2Z25A 2EAWA 3M43A 1AZ2A 1EA0A 1TX2A 3FAWA 4QM1A 4GOAA 1HVQA 1S46A 1B90A 1OVDA 2PTDA 4A3RA 1XCFA 1C91A 2PZ0A 5A6MA 6XIMA 5IHRA 2OGYA 2DUAA 4DO4A 2ZX5A 1VYPX 3G1HA 5BMWA 2VVNA 3U6WA 9RUBA 2HCVA 3P7YA 3GNPA 4QX4A 4UQEA 3VM5A 1CXHA 2VWTA 4FS9A 3T08A 1JCTA 4NP7A 1M7OA 3OYXA 3N18A 3CAQA 3NQMA 3FDGA 4Y6GA 4DVOA 1XDLA 4IIEA 4CEUC 2PTXA 2G3NA 3W87A 1YEYA 1LOQA 3URBA 3G77A 3WNPA 5DT5A 3N6QA 3UJ2A 1PE1A 4NAFA 1U1HA 1QOXA 1DKWA 2ZTJA 1U5JA 1MO0A 1OBAA 1WUEA 4ZO9A 1J10A 4HJFA 4MKVA 3CLWA 4F2BA 4OV9A 2C8NA 3EB3A 2QYGA 4F0MA 1X96A 3NYZA 3VNMA 4F40A 4GVIA 4AC7C 5EFFA 1OHLA 3FSUA 2GLKA 3NDOA 1JPIA 4HZMA 3SW6A 1CXKA 1RK6A 3O6CA 1K77A 4G56A 2PDNA 1GG0A 1GT8A 3M64A 3WH8A 4MB3A 2QCNA 5HJYA 1W1PA 4GCAA 1YNYA 3TNOA 4P5UA 1BVZA 1FWSA 1YXCA 1W9DM 3M41A 3OU8A 4PTWA 3LHYA 3RILA 3T0TA 3IJ6A 3S1XA 4XIMA 1RSCA 4RNFA 2VR5A 1WQ5A 2NX3A 3C6CA 2OLAA 4NHVA 5K9XA 4U31A 1FWCC 2DDXA 3QQ0A 4ZO7A 3WF0A 4XV0A 1LQ0A 3B9EA 3LCXA 1BYDA 1XLCA 3NVTA 1AQHA 1FWFC 4PTDA 2V30A 2P3EA 4G1NA 2WMJA 4JQ1A 1ZNNA 2EXOA 4NSBA 3TTOA 2EPHA 1M5WA 3P5ZA 3EMZA 1WZKA 4Q4QA 1E4IA 2DQXA 4DAFA 1EP2A 3GE7A 3PC0A 4MOZA 1IGSA 1B3YA 5CSUA 1PZ1A 2BGQA 1VFMA 4BF9A 1GHRA 3NUKA 2QCFA 1JF5A 1XGZA 3KBVA 4QROA 4A2SA 4NZCA 2IPFA 1KO0A 1S5VA 2RDXA 2GQAA 4H7CA 1VRDA 4MNMA 4NZ3A 3TMLA 5AHNA 3GS6A 3F4DA 1YNPA 3C2EA 1JCXA 3QPYA 2VJXA 5I3GA 2NV9A 3WG6A 3IACA 1VH7A 5CSSA 3P61A 2HPIA 1YPFA 4IIGA 4P7QA 3W7KA 3GU1A 2BOEX 3GHTA 5HWJA 1TPEA 4I9AA 4PMYA 3TXZA 5C9RA 4DNMA 3ITXA 2X30A 2FGLA 4ZE4A 4KGJA 5I09A 2CLLA 1HVXA 5D02A 3KL3A 3WLQA 3S6DA 5DXYA 1NEYA 3VVGA 3AXKA 1UR3M 4JX4A 3VIPA 4J4KA 1EC9A 5AHEA 2CFFA 4Z1CA 1I0BA 3EMQA 3RCYA 5HMFA 1HGWA 3GFZA 1OCQA 2GVEA 5FEZA 1O12A 3EOUA 1UKPA 1G4TA 2CETA 5TBOA 8TIMA 1R3WA 5CC5A 5DQPA 3PBYA 3QR3A 1U5HA 4AWSA 2YL5A 2QJMA 3FVMA 2GOUA 3SQSA 2WHLA 2ZA2A 3DX5A 3G1VA 1BEUA 2NQLA 3KP1A 4N0RA 5H8MA 1ONXA 3BQ6A 1MYRA 3GYCA 2VGBA 4WGXA 3BGAA 2DORA 3ZT5A 4UNLA 1KGXA 1P6BA 1ONRA 1LT7A 3MSYA 4Q4RA 3DFNA 1G94A 1KM3A 2OO0A 3GXNA 3L4TA 3HG2A 1DIEA 2PDFA 4JTKA 1U83A 1DJXA 3ENLA 4K37A 4K1WA 4KERA 4WOZA 1JYXA 3QR0A 2BWGA 3ABXA 2TMDA 4ZB2A 2PDHA 2Z1SA 1EZ2A 4JN8A 4NZJA 3WQVA 3N4AA 1MEWA 4GG9A 3BL3A 4NX5A 1RBAA 2WPBA 3RO6A 1W3IA 2DH3A 3DG3A 4KFNA 3NR0A 3ZLGA 4XAFA 4MJZA 2GQ8A 4GGBA 1F4HA 1PL9A 4DJDD 2R82A 3UT0A 5GNZA 3G2GA 1Q6QA 4GI4A 1SZNA 2PDCA 2FH8A 3ITTA 1UWIA 4QHRA 3ITLA 3R5EA 2NW0A 4GNKB 4IPLA 4XZIA 2WSRA 2WLZA 3W7IA 3NOYA 1FWEC 3D46A 1MQPA 3WLPA 5DMLA 1J0JA 5EB8A 2ISFA 2FYMA 4MKSA 4N9BA 2OZ0A 2C6QA 2R1LA 1J2WA 2XDFA 4K36A 1QPNA 1G1YA 2QUTA 3WBAA 4JEQA 3UZ5A 5BROA 3RU6A 5BMXA 3CZGA 3S2MA 3LA4A 3UVAA 1TV5A 2PGRA 4AHOA 1KM2A 4C6NA 5IOBA 2ALRA 3RMEA 1I4NA 1GVQA 2WWCA 4H7ZA 4LB3A 3RNDA 2ISSA 1W9XA 1XIMA 2GDVA 3NL6A 3A47A 4HP5A 3KLKA 2W62A 2QUVA 4IQLA 1MEIA 2J47A 3I6EA 1NFPA 2ZZ4A 3B9AA 3C8NA 2YA0A 3NVDA 1DJGA 5J04A 4DZAA 3LLDA 4Z42C 2E4TA 2QGYA 4ZGYA 4DELA 1XJBA 3EPMA 5BNKA 3N13A 3BOFA 3TYBA 4IP5A 1LQ2A 4DJFA 2C16A 4O13A 4IOTA 3BANA 1YKWA 5DXXA 3W27A 4JTAA 4QCFA 3DFSA 1B9ZA 2VELA 4B5UA 1UR1A 5FL1A 5CJMA 5I3IA 3DUGA 2UY4A 5FL0A 3BV4A 2VRJA 1YPXA 2GFTA 3F2BA 2XFWA 1C7SA 2BXZA 4QE1A 4A8LA 1AUSL 1NWRA 1F73A 3LB0A 4AHPA 1SVDA 1ZCCA 1PV8A 2ZUTA 3WH7A 1A0EA 1F6PA 1MVYA 5FSDC 4XKMA 3UFYA 4ZOAA 3I3BA 3OG3A 5AHMA 1OT1A 1WXZA 4LQ1A 3A5FA 1FCUA 4ZBCA 1A5MC 1OD0A 3B40A 1ZY9A 3JZUA 1YXYA 3QMTA 3G5EA 1EHNA 3N25A 3CO4A 5FESA 4IMGA 1QI4A 1WBJA 4GQ0A 1C92A 3KCOA 1ISVA 1GHSA 3W1TA 3MO4A 3L65A 2OFJA 4U3AA 1EOMA 2O4MA 1S2AA 1MEHA 3P62A 1DWIM 3LCLA 4Q32A 1OFOA 1SYTA 1HFBA 5A8QA 3QKEA 3AS2A 1NSJA 1GZJA 3KCLA 3GC5A 2Q01A 3QV9A 2V67A 5K3VA 3PB0A 5SWUA 1FHVA 4PMOA 4JIIX 3E74A 4RJEA 3T8LA 3MKCA 2OQLA 1KXVA 1H2JA 1L2QA 1TYGA 1BG4A 4M7TA 2AGKA 2F8QA 3RITA 3VKBA 3PG8A 5TIMA 1P43A 1DL3A 1MUCA 4HOWA 3S6TA 4K8HA 1XQLA 1EBGA 4X3ZA 2HE5A 3FW6A 5BXSA 3W81A 2BLEA 4ZEPA 1M7JA 1KLZA 4IMAA 3TMQA 1AH3A 4LJ3A 1SJCA 1AJ0A 5JXQA 3EPNA 1TE6A 5BWAA 2W6RA 5CSRA 3UA3A 1LBFA 3FFSA 2E6FA 4C6CA 5AC6A 1XSJA 3T6CA 1BRLA 3NQ6A 4ORIA 2ZYFA 1IGWA 3QVQA 1UBPC 1TRIA 3K8KA 1P0EA 1PSCA 4DM1A 3A24A 3T8QA 1AL8A 4GYPC 1VC4A 4C60A 4RZ6A 1EZWA 3N15A 4N2YA 3VC6A 3S2CA 3THCA 4E6MA 4JFTA 3DXIA 2DJXA 5JQ9A 4Q4MA 4F0LA 2QEZA 3GVQA 4XKYB 1XWYA 2C79A 1UASA 1GQNA 3APYA 4I9TA 2BHZA 1IXQA 1ZS2A 3C3UA 1V0KA 2VFHA 3PZUA 2DVUA 3O0KA 1TTQA 4KH2A 5CPTA 1DJHA 4PA8A 3PJXA 1CDGA 2WNQA 4WY0B 4PUKA 2G97A 4L4MA 5H8PA 3WENA 3TZNA 3W3OA 2P0OA 1O5QA 1IR1A 4C6MA 4AY8A 1I1WA 3R43A 1I9CB 2TSYA 1DXEA 3TFCA 3DG7A 1RV8A 5HA7A 1H09A 3W7CA 4GWEA 4KW2A 4RW5A 3IGUA 2H9AB 4B5TA 7TIMA 2YKKA 3ZJ7A 2ZUUA 4WRHA 3MWCA 1LTDA 2VEMA 3RHGA 3TSMA 3M6YA 4DYEA 1MDRA 2BY1A 4Q8WA 3PZOA 2GUUA 2R1NA 1Q6CA 4N4QA 2V5KA 3P14A 2GZXA 4RKAA 1QOQA 3DCPA 3C8FA 2E1WA 1P48A 2XVPA 2J66A 3WF1A 2O9PA 3E2QA 3MMDA 3SCVA 1O94A 1DWFM 1E3ZA 2HS8A 4D6EA 3AS3A 1EHAA 4U10A 3TK7A 2W5FA 3GB6A 1JRBA 2CW6A 4HNOA 4Z1AA 4D6GA 3SCRA 1OYCA 1N8FA 3OGSA 4IPNB 3K4WA 1SJDA 3Q2DA 3VOJA 5AZ1A 1EH9A 2WV8A 4JIHA 3RM9A 4M1RA 2VENA 4JFUA 1CZ1A 5E93A 2EKCA 4IF2A 2YLAA 3L4XA 2Y5SA 3W7JA 3G1DA 3QSTA 4I9JA 2ZZ3A 1TKKA 3LHWA 1XKJA 3PSWA 1OGBA 4CNOA 5KETA 2PLCA 1KR1A 1UIPA 1E9LA 3TEVA 1TTIA 3N19B 4GUFA 1DJZA 2V82A 4H9XA 1B5TA 4AD1A 2EG7A 5IHSA 5G2HA 3U2CA 3I6RA 3W01A 5A6SA 1XRFA 5D8ZA 1ADDA 1E1CB 3B8TA 4ASTA 2GQ9A 4EWJA 4CUCA 2OODA 1B57A 3L2LA 1M1BA 4GIYA 5H8UA 3W2JA 4QJ3B 3A3XA 2AQOA 1GQJA 2UV8G 3G1YA 3QHOA 1JXJA 4NQ1A 4Q8NA 4DUWA 4FOKA 1U2YA 5AECA 3WDIA 1FQ0A 2BODX 1YE4A 1QW7A 1GPWA 4AG0A 3AUJA 4OTKA 2QNEA 1EF3A 1WDDA 1XYMA 1UQZA 1Z44A 1DWGM 4M7SA 3QMRA 4QBXA 1BD0A 4JTQA 4LC6A 3EWBX 2F6XA 2GPTA 1GKQA 1O68A 4PL1A 1UD8A 1MNZA 1W54A 3ZLHA 3DN5A 4CEXC 1MQQA 1YW1A 2Y8KA 1XISA 5I6SA 1TV8A 1K6AA 2D73A 2OSYA 1EIBA 6A3HA 5M5DA 2V38A 5T9CE 4AIBA 3OVQA 3UU0A 3W88A 2RDTA 3PUEA 1QPOA 2P50A 3RXZA 3GU2A 4GO9A 3B8WA 2P3ZA 4HPNA 4RX0A 4CCEA 5CEWA 4Q7BA 3TYUA 4X63A 4XAGA 1JEZA 4LPCA 1E6XM 3O0FA 2DZWA 2OT0A 4L61A 1KA9F 3M0JA 2QPUA 3V3WA 4KFOA 5BRQA 3UWZA 4XO7A 1QI5A 3U0HA 1U1UA 1FDJA 5ABHA 1L8PA 4KRTA 3W7RA 4GYKA 1G4PA 1KNWA 2GJPA 1K6WA 1A5NC 1W3HA 4PUDA 3WLIA 1EPXA 2QLYA 3W0KA 4H8UA 1KRBC 3GHRA 1VEPA 1R3RA 2FGZA 4S3JA 5DMYA 2CERA 4ACZB 3L4WA 1B3XA 2YXGA 3EAUA 4JX6A 3WLHA 3VD3A 3QTPA 3MW7A 1YPIA 4EXAA 4GUHA 5LNVA 2P88A 3OP2A 2A7RA 1B4EA 4J3ZA 4ZA0A 1FHDA 1GTEA 1NH6A 3GNOA 2Y62A 1JQXA 3NURA 2XVKA 3GW0A 1EX1A 3OEXA 1DV7A 3QFEA 4K1GA 1UUMA 3W6YA 1D3HA 1EYEA 2A5HA 3E49A 1I6NA 3VDGA 1ALDA 3GHUA 4IPIA 3GFXA 1SO4A 1KBLA 1XL9A 1K8XA 4LU0A 4GYFA 4DJEA 3WJZA 3N2XA 2Y5EA 4R5EA 3R25A 5E0KA 3OVGA 1HKVA 2YDRA 3HJEA 1M41A 3II1A 1RD6A 4URIA 4XWUA 3VC5A 4R9XA 4A3UA 1EJTC 2WCSA 4PSPA 1F6YA 1V0LA 1R2TA 4PMVA 2D2GA 2WHMA 1YYAA 4QITA 1XIIA 4U3CA 4UTLA 1HN1A 4C6PA 4E2BA 2ZUNA 4US6A 3SQMA 3PPFA 2PLMA 2BZNA 4JEJA 2L5HA 3U4AA 1OWQA 2XVLA 1PB0A 2PB1A 4JKMA 1K8ZA 2E6YA 3GZ3A 1H7XA 2E28A 4GYJA 2I57A 3QZ6A 1UJQA 3LPGA 2WOQA 3PR2A 3T0AA 3J7HA 1PBGA 1RH9A 1VLWA 2NQHA 5C2XA 5A6BD 3UVIA 3M0HA 2GSEA 2WJEA 1FH8A 1QWKA 2R14A 4FNPA 1M03A 4IZGA 4I5XA 2A85A 2AL1A 2Y2WA 5EL1A 3W1MA 1BTCA 3W76A 2A0NA 3EDEA 1RBOB 1VFOA 2V3DA 2NVCA 3OLEA 4R3UA 4ZZ9A 3W74A 4EF8A 1ZALA 3VZZA 2NT1A 2X42A 5BOFA 2PODA 1KW1A 3MY9A 2FQIA 3GAYA 2RKXA 1TA3A 4BWLC 3ARSA 1UA3A 4ZMGA 2ZRWA 2W91A 4WX2A 4YNGA 2JEQA 3K8LA 1ICPA 2ZVIA 4RV3A 2CC0A 1J5SA 4U33A 4S3BA 2QMKA 1E3XA 3HTWA 3AHYA 4TQTA 3ITYA 2YBUA 3WD4A 2Y8VA 1ZBWA 2I56A 1IE7C 3SUVA 5C6MA 1TRDA 4F0RA 3H4XA 2TAAA 4ERAA 5CZKA 4DWSB 3V18A 2NSXA 3UG5A 2YZ5A 3EX1A 5HQLA 2PDGA 3C4UA 4B5VA 3GWQA 4AH7A 1EC7A 3ATYA 4JYDA 1RHCA 3OHIA 4YU1A 4DXXA 4D71A 3N2OA 3WDPP 1US0A 4UQAA 2IMRA 5E70A 4IX0A 3ZZ1A 2P8CA 3S9IA 3VILA 1VHNA 4MDPA 5D05A 4XVDA 5D04C 1HT6A 2H8XA 4B92A 5IXEA 1RP9A 1FWWA 1VB9A 4HCHA 3T4CA 2IQTA 4R85A 5U7SA 2Y85A 2G96A 3ZMRA 2VFDA 1QXLA 3N2CA 2RAGA 1CGYA 2G8ZA 1SMDA 3GW3A 1JZ4A 2JGYA 3WBWA 2CLMA 1OX5A 3EA1A 4HU3A 2WXDM 4JXCA 2CLFA 2DZSA 4EK7A 2G4FA 1SZGA 4F0HA 5FJIA 4ML9A 1M6JA 1PTGA 4BY3A 3GIQA 2ZWZA 3OZPA 3TU9A 3GH7A 4HTYA 3ZM8A 2VQTA 5HBFA 1X98A 1W9UA 1Y65A 3W72A 3EPOA 1EDTA 5KZDA 3G6MA 3VIMA 3QV8A 1KFLA 3E2RA 1FXPA 1T6MA 1W2PA 4WEVX 1XSIA 2I5IA 2XVNA 3JRKA 1LM1A 1Q2RA 1CLKA 2GWNA 3SCTA 1TMQA 2BVTA 2J79A 4YYFA 2A7PA 2WM1A 4RW3A 2R94A 1XHGA 4FIQA 4HA1A 7ENLA 2ZADA 4PN2A 2C18A 3LTPA 4OE7A 2ZQ0A 3W37A 4H6EA 4C7DA 3QFWA 4YN5A 3CZKA 2Y6ZA 4RL3A 1PCWA 5ECVA 3VMPA 3OVPA 1QASA 2ZXBA 1GVEA 4ROQA 4NAEA 2WJZA 3DGBA 2Z1KA 3OZYA 3CH0A 4HHLA 1GK8A 2PC4A 1GKPA 1BWKA 3O6DA 4M19A 4JR5A 3CUHA 3LQGA 1WNOA 3UXAA 2W61A 4W8BA 4H41A 1MQRA 1DJNA 3O07A 4GCXA 3IARA 4JY9A 2WHJA 4V27A 3EWUA 3UR7A 3WIJA 3TC7A 9XIMA 4JTJA 1YMYA 3M0ZA 4R7JA 4EXBA 2ODOA 2QV4A 4ZFMA 4LUIA 4ZOBA 4PBFA 4PCPA 1J0IA 5GNYA 5JVLA 1QFEA 3NXFA 2ACUA 5F1VA 1KQYA 1RQHA 1E4NA 5ABEA 1K4GA 1RJPA 3T07A 1H60A 3PBVA 3BVJA 4M81A 1XIGA 1EBHA 1G0CA 2DQWA 3ZJ6A 1US3A 3GFYA 3MUZ1 4GUJA 3LXCA 3AJ7A 2HXUA 5TNVA 3IK4A 2MANA 3ZFHA 2PP1A 3FHAA 2W0UA 2VDHA 1Y7VA 4O15A 3N1AA 4A8IA 3VYLA 4IFOA 3PBUA 4Y9PA 2VX4A 2HRWA 1AK5A 2PWUA 3E0LA 4CVWA 3UXDA 1Y5XA 3GRIA 3N29A 3VPLA 3NDZA 1UH2A 1F6KA 2HXTA 4OHQA 2ZX6A 1H5VA 2A4AA 1ITCA 1R0MA 3BO9A 1VAHA 1I45A 1S2VA 1TQJA 1DBTA 3UPMA 4FNSA 3N3MA 3W1UA 1A5KC 3VKCA 2VT0A 4DJDC 2D0FA 1CGWA 4F0KA 1NJJA 3KS5A 1X1OA 2WVUA 1HJVA 1ME8A 3FN9A 3BTNA 2QIWA 2C3ZA 1HZYA 2AMGA 3FV9A 2PLJA 4J5NA 4UTIA 1T99A 1POJA 4C6IA 2D69A 2XN0A 4PTMA 3IAPA 4NJIA 4XZMX 4QG9A 3VOGA 3LRKA 5E5CA 2V2HA 3BJTA 3W9ZA 3TSDA 4GO8A 2D3LA 1W1B1 1KKRA 3NAVA 4Z0JA 3F1QA 1A53A 1PYMA 3NZGA 6PTDA 1IT0A 1HF6A 2ZFAA 8RUCA 3CQJA 3WQ6A 5DX7A 4IG2B 3VDCA 3DBPA 3PVFA 2J8GA 1I2QA 4GHRA 4C6DA 5FF3A 5IBXC 5I3FA 2BNJA 3WEMA 1FBAA 1JUEA 1H0IA 3AU2A 5LNSA 3MMUA 1L6WA 1EGMA 3LUTA 2O7QA 2IXUA 1UD3A 1NQKA 1RALA 2NVAA 3NG3A 1TWWA 1C3FA 2W66A 1CGTA 4HVXA 3TOPA 1ISXA 3DKJA 6TAAA 4B90A 1A49A 1UC5A 4AYGA 3LCWA 3BG5A 1GTHA 2YIHA 3M5VA 4DBEA 2O4QA 4OIFA 1BXBA 3CYJA 4WLCA 3T2PA 1EUNA 1Z41A 1KRAC 3UWEA 4LANA 2DV0A 3N3TA 5C7HA 1XLIA 3VUPA 3H2AA 2HWGA 4MFEA 4YWSA 4GK8A 4MM1A 1DXFA 3SCPA 4J7RA 3B3DA 4D8ZA 1QO5A 3SGUA 1TPUA 4GVGA 2CHRA 1EX5A 3WBYA 1ZHAA 3BAYA 3PANA 3REQB 3IIZA 2VO5A 1SW3A 4W7UA 1Q7MA 1Y0EA 3VNKA 3VOCA 4Q6XA 5FJRA 1FWNA 2F6KA 4CGTA 1KBKA 1YDVA 4K6AA 1V5XA 1GJPA 2P76A 4LXFA 2VOTA 5AHFA 2OMAA 1LUCB 3TN3A 5FOOA 3VXGA 5FJPA 1TMHA 3EWDA 4W8AA 1DEDA 2ZCGA 4X2RA 4W4QA 3P93A 3V0SA 4GACA 4PB3A 3K4AA 2F2KA 1HJSA 1GOKA 5MHBA 2YZRA 1BVWA 3BUVA 2YCLA 2XIJA 4XZHA 4LUSB 4U4MA 4PMDA 2V2DA 3WD0A 1W8SA 1R86A 3ARZA 5I3DA 1V0NA 5EY5A 2A3BA 2H90A 5EBAA 2ADAA 4PBEA 2A3LA 3CL7A 1XIDA 4AAJA 3E3HA 3IK2A 3RM4A 4C1LA 3B8DA 3K8MA 4Z08A 3WNOA 4OBTA 5DLCA 3JZEA 3NQ7A 4NY2A 3MS8A 3T2OA 1DXIA 4S3DA 1VLIA 3PZNA 1RQEA 1RBLA 5CQ1A 4IMCA 1H62A 4S3GA 4XUYA 2R91A 1H7NA 3LYEA 4IGSA 1C29A 1SM9A 2PTYA 5D2TA 4OWGA 5IDIA 4DBSA 2WHKA 4KT2A 2GK1A 3IJ7A 4H19A 3QLLA 4H83A 2V3EA 2G41A 4JTEA 3W00A 3UCQA 4ZVJA 2J9XA 2YDAA 5FKYA 3VIHA 3CUGA 1CGXA 2A3CA 3VK5A 2IPGA 4PMQA 3FGCA 4O1FA 3S1VA 5D9PA 4FF5A 1KTNA 1QNVA 4ADUA 4C6BA 1EGZA 2QT3A 1X38A 2VC7A 2CESA 2G3MA 1QNSA 3M5XA 1JCJA 4B4HA 5TAOA 2J25A 3V1HA 1G69A 2QCDB 1RPKA 3FXGA 3AIEA 2ZE0A 4FNTA 4QE5A 2X09A 1NDWA 2PMQA 3HPAA 3GAKA 4JFSA 4DAIA 1QHOA 4W87A 3W28A 3BZJA 3LEPA 2DIEA 2ZX8A 1SSDA 2PP3A 2WYSA 1HIZA 2PTWA 2VEIA 4WVXA 1YX1A 1EJRC 3RRXA 2GGIA 1KWGA 4YCPA 3SCUA 2UZ9A 3U5YA 1OADA 3TP4A 4A8NA 4ML4A 2VMFA 3ZWTA 1JULA 3NPVA 3DYPA 2WCAA 2C0HA 2GWGA 4R27A 3UERA 4XBKA 4B16A 2G95A 3T1GA 3W7NA 1AL7A 4REQB 1VBGA 2OKTA 2CZ5A 1KM0A 1PIIA 3QC0A 3MDWA 4IXXA 3LZ3A 2H8ZA 1PKNA 2Y5JA 2ICSA 3AHTA 4KFPA 2E40A 3T0CA 1XG4A 3V16A 4Q8QA 2AMXA 3LQLA 4UTWC 4NI3A 1V4YA 2KX9A 4DBWA 3W07A 1JRCA 1IQ8A 3MJYA 1EP1A 1AJ2A 1FHUA 2QDHA 4B4FA 3A9IA 2PD9A 2ACQA 4P8UA 5G5IA 1MW2A 1H7PA 4ZQPA 5JH1A 3S1WA 1TCMA 3A22A 1RCOB 2YYTA 1CB7B 5FJJA 4JTLA 3AHXA 2XWDA 3OG2A 2QUUA 1CPUA 1UP3A 1CYGA 4FX8A 4KEUA 4NYYA 1J96A 3IIOA 5A1AA 3BOXA 4OT7A 4CU6A 8CGTA 3QEZA 1B31A 3G0SA 1A5AA 3URNA 1CIUA 1R3SA 4D8LA 1GJUA 4S3AA 9XIAA 5D38A 3SUSA 1ZJBA 3SFKA 3GG1A 3WQ5A 5F4WA 3ARRA 2ZZ6A 4PSRA 4XVEA 3WUBA 4G7EA 4K8GA 1BXNA 3VZXA 3EX2A 3QM3A 5AY7A 5HR6A 4FNUA 2OEMA 4CN6A 3HFYA 3IJ9A 3NL5A 1EPVA 3MMWA 2XZ9A 4YYCA 4RNHA 4LUTB 4HOZA 2X05A 3GVGA 3TN6A 3ISIX 1EWDA 4NIRA 3VMOA 4UBPC 2ISWA 3Q94A 2FMNA 4IMFA 2GJNA 4PC8A 3CZJA 4WKFA 3MHFA 3TA6A 1KGWA 3RRAA 1EEXA 2WMIA 3W1NA 4MTVA 1E9ZB 4HNVA 3A64A 4DXVA 2Q71A 3DKLA 1XGDA 4V1XA 5J5DA 4HT3A 1F3EA 1AD1A 1W1VA 3N2TA 4NUWA 5JH2A 4Q7NA 3ID7A 1TV2A 3CQ0A 2VCBA 1JF6A 3AI0A 2C7FA 1XBXA 4DF2A 1TJ1A 3KBWA 3P5YA 4F2UA 2J7EA 1H7OA 1L9WA 1TR1A 3L5LA 3R12A 3CZEA 3U2OA 1XSKA 3KTCA 2XFYA 4WDUA 3EX3A 3GXPA 3OVRA 4CNTA 4XBJA 3N11A 4RNJA 4DPQA 4MUPA 3ELFA 3M7WA 5D9MA 1C8YA 2DEPA 1HJQA 7REQB 4CNPA 2BXYA 2AL2B 1D2KA 2WZTA 2ESCA 1HKIA 1G7UA 4DBDA 2J8TA 1E1EA 3KHDA 1FCQA 3IUIA 1VD6A 4GYPA 3LS9A 3BLDA 1NDZA 2QJIA 4RXGA 4YLWA 5MKGB 4FO4A 3PHAA 3DHPA 1ZBKA 2ZVRA 1B1YA 3W83A 4IJCA 5I24A 1WKDA 3MBFA 4RCXA 2GDQA 4QJ5B 3OQEA 3TJ4A 1JYNA 1EP3A 3M07A 2BP1A 5AYXA 4CNNA 2Y7FA 3TNBA 1Q8JA 3AICA 3OIXA 4CQ8A 2QDGA 4HA3A 1ZAIA 4BI7A 5HUOA 3LTSA 1Y5WA 3LHVA 3TIMA 2QGHA 3G24A 1UR2A 4O16A 2NXGA 1BF2A 4RV8A 1V6VA 4LUYA 3JW7A 2PU1A 2EJAA 1OF6A 5EGRA 4UXDA 4ZB0A 2W67A 1RAKA 2WSQA 3SJ3A 4UTKA 4H1ZA 1M7PA 1H1NA 3UD6A 4HPXA 3P8IA 5BOEA 3ITOA 4C90A 1C90A 1EJUC 4PGLA 3MYPA 2J7FA 1T40A 1QAPA 2C15A 4EP8C 4UQCA 1OQFA 3M0MA 3VIFA 1ZSXA 2CPUA 2PD5A 2I9UA 2HROA 2JE8A 3TJLA 1GQLA 5A6LA 2RJHA 3FEMA 3SCSA 1NP0A 1Z89A 4ILSA 4YTRA 5A8NA 3I3DA 1VYRA 3KM8A 3MCNA 4Y9AA 3SN1A 4HMNA 2O9RA 1U22A 2OEJA 3QV6A 4WZHA 1CGVA 4ES4A 2WJFA 3B9OA 2Z6JA 3E5BA 5LNWA 3S9ZA 2DIKA 4GZJA 3R79A 1WDRA 3MUXA 2RFGA 4B2DA 4Q33A 3T0BA 1BGAA 2E1DA 4QIUA 2YJQA 4NX0A 1UG6A 2GJLA 3LTYA 3QYQA 4IGMA 2B7NA 3N17A 2XIBA 4H01A 3T7VA 4ZXLA 4I5RA 4M82A 3UZWA 3FKRA 5B7ZA 1W9VA 3OZOA 4KMQA 4O1BA 1CEOA 1FWAC 4HK6A 2X41A 4N6EA 2GJXB 5DANA 3QMSA 1O95A 1TUFA 4WHBA 3C0LA 3NGJA 4JYFA 1W1ZA 2A6LA 2WMFA 2HK0A 1SO3A 1QK2A 3R1ZA 2Z1BA 3UEQA 1LF1A 1E6RA 3RLGA 4UTTC 2XGIA 3NQ8A 2OEKA 1UW9A 7PTDA 5CPLA 3V75A 2YCJA 3GO2A 1WA3A 1X7IA 4OQVA 4Q6JA 4QLLA 3TW6A 1OIMA 2X8RA 4FK9A 2P0IA 3VNDA 2D2OA 4LRTA 1T41A 1Y5VA 2F7FA 3APTA 3QOMA 4JTRA 1X6UA 4HU0A 4FAMA 1XIHA 1O5KA 1EA9C 1AD4A 2JKAA 4IUOA 1KRCC 3P3BA 4K7VA 3AIUA 1LJYA 4ZOCA 1ZU8A 2A3HA 1V6UA 2DVXA 4XO6A 3CAVA 3AAMA 1S2UA 3B04A 1FKXA 1M7XA 4DZHA 2J7HA 3QHNA 1P6WA 4W89A 1W31A 1E0VA 4C6QA 3V4BA 3LV5A 1J01A 3VGBA 8XIMA 1QI3A 4DHGA 3ANYA 3S1GA 4G1KA 3PWAA 4D6DA 2VL4A 3CZLA 4CQAA 1T0OA 1G9HA 1UA7A 5G1YA 4J1OA 1DJWA 3WLOA 1W3KA 3SN0A 2FDMA 2D1ZA 1VP5A 1ZFJA 3LSBA 3WLMA 5LIXX 1LRTA 2YGYA 1YNQA 3MBDA 1NWSA 2OZ8A 1A0DA 4TX9A 4MLRA 4DWDA 4NL1A 4UMBA 3WD3A 3MI6A 1EWEA 4MF4A 4ACYA 4FXJA 4CQBA 3TR9A 1VGAA 2ZRVA 1RLCL 3NL3A 2QJGA 4ADTA 4RZ4A 5XINA 1EB3A 4JHZA 3NQBA 3KRUA 4XD6A 3RF9A 2FZ9A 5IDZA 1J4EA 1YDOA 2V5LA 3GTIA 4QG8A 4IICA 4JTHA 4LBRA 1WXYA 2ZX9A 4WJXA 3NPUA 4GXPA 3H8AA 1ITQA 3VE7A 1ZP4A 2VD9A 3NO1A 3RM8A 1SMAA 3FDKA 2WMKA 4YWIA 4EAMA 3GXIA 3WQCA 4AHQA 3NDYA 3TFXA 2VGIA 4MDOA 4J2MA 3FEQA 5CH9A 4GJIA 4L9YA 3UCCA 2Z7KA 2I9EA 4Z2HA 5M2FX 2QW5A 3IVTA 3OHMB 4GQGA 3VX0A 1YTEA 1OY0A 3KDOA 3TJXA 3WH5A 3I6TA 1GEQA 2WSPA 4MPKA 1MW0A 3QPEA 1IT8A 4YVPA 2WC4A 3WJWA 5A8OA 4TX8A 4GKTA 4Y9MA 2VP8A 3SSZA 3LBCA 2BX7A 3SADA 4US5A 3AZSA 4UCGA 3SRKA 1PVNA 4XAZA 2CWXA 3EX6A 3IGXA 3W7EA 3VNLA 4CD8A 3SRHA 3I65A 4L1XA 3A23A 3E0FA 2DH2A 4TIMA 4S3FA 4DUVA 1JDEA 3PUOA 3IVUA 3DI0A 1CNVA 3UWUA 3PJTA 1J11A 3DFHA 1YBQB 3E1F1 1GW9A 3H7UA 5I3KA 3NQ2A 4HPHA 1L6SA 4EPKA 5FIPA 4Z2GA 1KB3A 4IWWA 4KIRA 1X8CA 2QDDA 4YTSA 5FJOA 4J3SA 1XUZA 3GBEA 1YXDA 1R6WA 4A05A 1UWRA 4F66A 2Z0IA 4HU4A 3HV8A 1W9BM 3OJGA 2WZEA 1REQB 3QLDA 3VNIA 3TWAA 2WCGA 1DTUA 1XINA 2C71A 2C13A 1GVYA 4JTCA 2XTKA 4IJRA 3FJ6A 3PS7A 3U4FA 1XLLA 4Q8VA 4MWAB 1TV3A 3TCEA 1OGSA 1PIGA 2J7GA 3LI0A 4EIVA 1DTNA 3I68A 1LRQA 3M0XA 5F4SA 1TVPA 4L6DA 5FEPA 3FJLA 1U1JA 3H2NA 4LY4A 1FH9A 4D72A 4L64A 4E8DA 3BK0A 1KRMA 4E8GA 4Y9OA 5I06A 4PMXA 4BWLA 1XLAA 1E6SM 4UFHA 4LYPA 4UNKA 3EKLA 2PDBA 3KVMA 1WCGA 1RK5A 2XISA 3P80A 1H4PA 3L21A 3AIWA 3RLHA 4UTUA 3LNPA 1J79A 1UKQA 5CGTA 4FIRA 1F2JA 1FWTA 1HG3A 4PFMA 1NF7A 1LDCA 3MC5A 3KTXA 3COTA 4M6UA 1BYBA 1OGGA 2E25A 1YDYA 4W5ZA 2IXVA 2DJLA 2V5CA 4QXIA 2ALDA 3V35A 1J5TA 1H41A 1I75A 1IEWA 1HQTA 4JIPA 4B9YA 1UR4A 2X2GA 4O28A 4ZTYA 3ZSTA 1TVLA 1W91A 5CG7A 2D23A 3MWAA 4D6FA 3TSBA 3TOYA 4JTGA 3CTTA 3SRFA 2Z1XA 3O3RA 1GJWA 1JQVA 1GVSA 4Y7EA 5FA5A 5CGMA 2WZMA 1FDYA 2OU4A 3SCOA 3CV6A 4DI9A 1PZ2A 1W2VA 1XFBA 4X9YA 3RFAA 4UTMA 4OOZA 5CPMA 1O1HA 4XK2A 1B3ZA 2OXNA 4H9VA 1D8WA 2CLIA 2BGNE 3L2IA 5ABFB 1UMLA 3GX9A 5BXRA 9CGTA 3SZ8A 1B30A 2YX0A 4U2ZA 4DO7A 2XJ7A 1AW5A 4RNIA 3L9CA 5EPDA 1R3TA 3SEPA 1E9IA 2NLIA 4O0KA 3DFQA 4O57A 1JPHA 2ASHA 5DBTA 1T7LA 4FXFA 2E5CA 1FY6A 1XYFA 2D20A 5L9FA 5JBDA 2E9MA 1SZEA 3ARTA 2XINA 1XLHA 3OW1A 1PEZA 3VM7A 2PI6A 4ZQCA 1K7FA 1HW6A 2BTMA 3TDFA 1N7KA 4UR8A 3VDHA 2OYLA 4LSBA 3AROA 4GZIA 3VZYA 2V5JA 2AQWA 2BG5A 3JUGA 3L5MA 1R8LA 1EJSC 2FFCA 4C91A 2WNNA 3IJLA 5EYWA 4ATDA 3WUGA 2V9DA 3MHGA 2NXHA 3ZOAA 5XIMA 3E02A 3VGEA 1WX0A 3WUEA 3IJDA 3FOKA 1E6ZA 1KGUA 1XYBA 4K8EA 1VFHA 3E2SA 1CLVA 4J3UA 3GDMA 4Q8MA 3PPGA 2V69A 1J6PA 4TMCA 4DI8A 2ZKMX 3B97A 1C9DA 2AAAA 3SBFA 3LERA 4TTGA 4WGHA 4M51A 1ME7A 2PTZA 3VIOA 1PJ9A 1D8CA 3GG0A 4A29A 3AISA 5TQLA 4MFDA 2BGSA 4RXFA 4CKQA 1LLZA 4BS0A 4HHHA 2F61A 1TCDA 3ABQA 3MQTA 1VFLA 4Q8TA 5D2VA 5FEWA 2OCZA 2NV1A 5C54A 3SAZA 3IIVA 4RZ5A 1G5AA 3TR2A 1HJUA 4K68A 2XIQA 4F8XA 4PR4A 3MVTA 1XC4A 1XYAA 4UFMA 5TD4A 1MUMA 2XSBA 5M17A 4V2XA 1I2RA 1UPMB 2RJGA 2J62A 1SO5A 3BLOA 3MCOA 4LV4A 1OK4A 1Q6RA 4C7GA 5T26A 2P53A 1AW1A 4L1WA 1OC7A 5I5RA 4F48A 1XF0A 2R1KA 4NT0A 5FSEC 1Q7ZA 3C0JA 2B7PA 2D0GA 4LVGA 4XKYA 3CL6A 1BWVA 1TQXA 3WDQA 2FTPA 5E09A 4JTFA 1JZ5A 3WLTA 1CLXA 4A8RA 3INPA 1WV2A 4J9JA 4DB7A 2FZDA 4Y96A 2E0PA 3CWOX 4BQ5A 2XHYA 1A4LA 1XI3A 3VCCA 2HNEA 3M44A 2FPVA 1Q2SA 3SY1A 1LRNA 5AYBA 5KTLA 1BSLA 2WBKA 3CQKA 4HNNA 4AZGA 1AQFA 1ZUAX 4DJDA 4WY0A 1E6NA 1RVKA 1QMLA 4XZ9A 4L7ZA 3AOFA 1TIWA 3AYSA 3SO7A 4XTIA 3M0IA 4DLFA 2GVYA 1BYCA 4YPJA 1KFBA 2QVHA 4L9XA 1JUBA 3S4TA 2YFOA 3PNZA 3W84A 2GSHA 1KFWA 4KPLA 3A9BA 2HV5A 1BF6A 3V1PA 2DZXA 2H9AA 2A3EA 1F74A 3EOLA 4GC4A 4WSKA 4TVUA 1KWKA 2VXNA 3CS2A 2YDQA 5KZ6A 1KM1A 3RMJA 5BRPA 4DM2A 3QHMA 1QI2A 1NOFA 1R87A 3CV7A 3TC3A 1XIJA 3QZEA 5HWMA 3TX9A 3SGZA 2IKIA 1OX6A 2E68A 4O1AA 1E9YB 3VD4A 3M6DA 1FWDC 4FX6M 4XQ6A 2GGHA 1FX6A 4ZQMA 1RY0A 4TVCA 4MKNA 1UR8A 3OA5A 4M5PA 2JGQA 1IWAA 4LAZA 1IF2A 3SSJA 3RPMA 5LHFA 1C7TA 3SIMA 1VFFA 5CPSA 3DC8A 1XH0A 5K4ZA 2A6NA 4JQ2A 1P4CA 2LLEA 3R0DA 4MIMA 4I90A 4CN1A 2F9RA 2FLIA 2CLPA 5A8MA 3NO3A 1N82A 4WD0A 3R8HA 4KBXA 1GCYA 3C5QA 5EKYA 3MSRA 1B0IA 2ISVA 5JUVA 3WZ0E 5CC7A 5FF0A 2OQYA 2XN1A 1XR2A 2YB1A 3WNKA 2HBVA 4QR6A 4DIAA 1CENA 4U2YA 4IL2A 4NASA 2X1RA 5ABTA 4BF5A 1O6IA 1YIXA 1KBBA 3OLDA 3W7DA 1OG6A 3GDTA 4GH1A 2Q8LA 4DNHA 1FFRA 1E1CA 3SECA 5J8LA 3T4WA 2PDKA 1EJ7L 4CLMA 1F61A 5C7VA 1T96A 2CXGA 1K7EA 4UTFA 1FWBC 1P7TB 4NRRA 3NQAA 2CLOA 1GZGA 3W7PA 2JFEX 2Y88A 4AF0B 3NEVA 1J18A 5LIKX 1OCNA 3TUUA 1GG1A 3SUWA 1PDZA 5BXTA 1SFTA 3BLPX 4V1YA 4GFSA 5FCZA 4O0ZA 1E5NA 3VMNA 5XIAA 4F3HA 1M3UA 3DIPA 5JBFA 3GR4A 1XLGA 5LKYA 4Y9NA 3GTHA 3K1DA 5A8GA 1H11A 1EYWA 1SUXA 1TPFA 5D9OA 1BKHA 1IWBA 3T81A 4PH6A 1MNSA 1NQ6A 4MHBA 2ANUA 1NDYA 1QJWA 2VZVA 6ALDA 5EMJA 2OPJA 3QH2A 2PGEA 5FEXA 1UP2A 2V3GA 3L4ZA 4N4PA 1SJAA 4KS0A 1XFCA 4DPPA 4E2OA 3TJIA 1IWPA 2XM1A 2A1YA 4IUGA 4BI6A 4JOMA 3S6OA 3GKAA 1U5VA 3LNMA 1GZ1A 5EFDA 3VA8A 5EMUA 5DFAA 5IFTA 4TXEA 4Y8EA 1RQBA 4JPGA 3T0DA 1F3TA 1AFSA 1UWUA 1XPYA 4MY8A 1C8VA 1XYLA 3KRSA 4I6KA 4WDWA 1QNPA 3TAOA 3ECQA 2PDPA 5I78A 1FUYA 4C1KA 2VM8A 1OJXA 4M8UA 1XDJA 1WBHA 4H9ZA 3F5KA 4NJHA 1C9WA 5CPNA 1E1FA 2ZUMA 2EG6A 2EF9A 4IP4A 3XINA 4TTUA 1BVNP 3C56A 4O4VA 6REQB 4LVBA 5AYYA 3NPXA 4ONVA 1Z69A 1KCZA 4WJ8A 3DZ1A 2ZIDA 3M0YA 2XIIA 1AQMA 1UQYA 4ACZA 2J9ZA 2HVOA 5LXEA 2YL9A 2QV5A 4UOZA 1OM0A 7CGTA 1QPRA 2PWVA 4B5XA 1JYVA 4JIRA 2DT2A 3TH6A 1TE1A 1EO5A 4JFWA 2JALA 1OFEA 4LTSA 4S23A 1TWDA 5F2GA 1I2OA 1D3CA 1W5PA 2TODA 1ZQ5A 4MGGA 2GJRA 2Y89A 2RGMA 4JHMA 3W23A 4AISA 1Z3NA 4P7RA 3M0LA 5G2IA 5E0CA 5FAGA 3RCMA 1DJQA 4CU8A 2GGJA 2E5DA 4PUEA 3UZJA 3LX9A 3PG9A 2YL8A 4J3XA 4QAWA 1HKWA 1K70A 4XD5A 1HL9A 3ZR5A 2HISA 4F9JA 3GZAA 1AVAA 3BAIA 1SZFA 1ODZA 4R34A 3WLLA 1R47A 1OABA 4BK9A 1KKOA 3HQOA 3EXSA 3GIPA 4FI4A 5EU9A 5CKSA 2OYKA 2C1GA 3DBNA 1DQXA 3VOHA 1V0MA 3P67A 3IAQA 1QPKA 1GW1A 3LSCA 1XUUA 6TIMA 4QRNA 4ZO8A 1CXEA 3UJEA 3LU2A 4XG1A 4QSHA 3CXOA 3HGOA 3U7BA 5C0QA 1QHPA 3NQGA 3GNDA 3MP4A 4UTWA 3G6LA 4AVNA 3R6IA 4O54A 1JJKA 2VWSA 3F4CA 4AD2A 4HYVA 5G1TA 4XTDA 1H61A 3RO8A 2I7GA 3CH9A 1POKA 1XS2A 3O05A 4KESA 2HVNA 1UWAA 3QGVA 4R33A 5I0DA 4UQBA 2VEPA 4FNRA 4UC5A 4IFKB 4MWAC 4PUJA 3DENA 1JL8A 4J35A 4JQ3A 4RDVA 4JBRA 2EJ1A 1BYAA 3QY8A 2HBXA 2WC7A 1NDVA 2FVLA 2WSYA 3G0XA 3VUSA 3VGDA 5BXPA 1QNRA 4L9ZA 1TR9A 3OBAA 2QCCA 3MZNA 1UZDA 3BLEA 4GIAA 4RE4A 2WMHA 4AZCB 4OUIA 3TV8A 2CYGA 3RK8A 3VO0A 5AN7A 3SCWA 2W63A 4LVAA 1ZL1A 4UQDA 3RUBL 5K9CA 3MV01 3BURA 4WJEA 4KWWA 4MUZA 1M9HA 3ERPA 3HFTA 3HIJA 1ITUA 3B0UX 2CBVA 3AU6A 1PIFA 5BWFA 2X0SA 4PCSA 4XIAA 5I77A 4GY0A 4UOQA 1NELA 3BG3A 2OO6A 2PE4A 4E4PA 4DWSA 3CMFA 5HJLA 3S5OA 5DMNA 2PSNA 2PRHA 2CU0A 4JQ4A 1D3GA 1IEIA 1BAGA 3GK0A 1H49A 2ZRYA 3A4JA 1VEOA 1XYZA 3UR5A 1QHZA 1PX4A 4L4PA 3ANVA 1R2SA 4U5IA 2V5DA 5DY3A 3BMVA 4NKCA 4EWND 5HQMA 2DIJA 4B5WA 2PS2A 4YJ5A 5EMLA 1TSIA 3H2OA 5E1QA 3UG3A 2C1HA 3R7MA 3KOFA 3I7RA 4LBUA 3F2CA 2J4GA 1UWQA 1FCVA 3ZJKA 3WNMA 1UKSA 1CT5A 1TWSA 1ZPTA 3PNUA 1JNDA 4MJMA 3MUCA 1TFVA 4EPDC 1W5NA 4A2RA 2XU2A 3W1XA 4CQDA 1Z9AA 4AWTA 1R7AA 4GZ7A 3O2LA 3VIKA 4YIWA 2WM0A 4QDMA 3UA4A 3UZYA 4ZR8A 2HNHA 4FLOA 3NXLA 3SFWA 5D9NA 5BYWA 1R3VA 5GVJA 1MXGA 5A3HA 3BCDA 2VGGA 5A6JA 3LGGA 4IMEA 1XGEA 3EOEA 4QJ1A 1RY8A 4AW7A 3EDJA 3BE7A 1WAWA 1V02A 3DGRA 4YHEA 1TZ9A 4ALDA 4MYAA 2VZSA 4TVDA 3U5UA 2D22A 3AALA 2YCIX 3D3AA 1XW8A 1VJIA 1HL2A 3HPXA 3NGFA 3IV3A 1R5YA 1HNYA 1W8GA 4GPNA 3WD2A 3GHSA 5I3JA 4NILA 3EB4A 4GC3A 3STFA 3NZRA 2EPKX 1LG1A 2ON3A 2QIIA 3WLJA 3UR2A 4M1BA 3ZYZA 4C5YA 2FZMA 2I5GA 4NI8A 1YE6A 2WVVB 2QF8A 1UD5A 3T9PA 3C2VA 4AZHA 1JPMA 5AFDA 5C9WA 2YLLA 3ICJA 1OIFA 1HO4A 3HGJA 2UY5A 2AKZA 1KTBA 3FCPA 3QY6A 3MT1A 3W6MA 2VUNA 4C65A 1Q45A 5LIUX 2E77A 2X1UA 4LCRA 4EX4A 3DDMA 1HP5A 2VD8A 3BAKA 3PAOA 5A2BA 4LF1A 4A4AA 1JDCA 4M6PA 4GISA 2PF8A 3RX4A 1XBVA 4LF2A 4Q8PA 1F9CA 1TG7A 4YTTA 3RX2A 2Z6IA 2C1IA 4S3KA 2WVTA 3VIJA 1E71M 1GPFA 4GBDA 4FALA 4WDXA 1RPXA 3EDFA 5EMMA 1ITXA 1R9YA 1E6QM 3L0KA 4GVFA 1P0NA 3W24A 1SR0A 4XAPA 1WDWA 2WVSA 4X60A 2NQJA 3A6OA 3ARWA 5AB3A 1UROA 2INEA 3N34A 3TXVA 3LOTA 1OD8A 3BQ5A 3MANA 1LOLA 1E73M 1JPDX 1DJIA 5IM51 3OBKA 1VRXA 3DG6A 1LQAA 4X0NA 3L0NA 1VPYA 5CLWA 1GVOA 2WQPA 4D8AA 1BFNA 2CLHA 1E0UA 1GWJA 1R30A 3H4WA 4UMAA 1KM6A 3P0XA 1LWIA 3CNYA 4OKDA 2WKGA 1OG0A 5A6BA 4EKJA 4R9OA 1TJPA 1KFJA 1XRTA 3S5YA 2J74A 2Z00A 3EEZA 2UWFA 3ZR6A 3AXIA 3PZMA 1KLYA 3U3HA 2DZTA 1FVPA 4HB7A 4CNUA 2JKEA 4NJKA 1LL6A 3C2OA 1V51A 3KBMA 4WXYA 1WOBA 2Q3OA 5BU6A 3HMJG 2JIWA 3DAQA 2VKZG 4HTBA 3VNJA 2XH0A 4GIEA 1KXQA 5LA2A 2CLEA 3TQVA 1Z7AA 3WK3A 4B2DD 4RE3A 4JN7A 5HULA 3ABRA 4E2VA 3FYYA 4C1NB 1HUVA 3CUXA 2QAPA 4RE2A 5F2MA 1XBZA 2EKGA 3P74A 3OLGA 2PZNA 2REQB 3VD5A 2WJDA 2FZ8A 3W1AA 2VURA 3LHUA 2P10A 3G1FA 1E4LA 2Y61A 5B80A 2XFRA 4MNJA 3WUFA 5F1UA 5C9UA 1WXJA 2WZIA 4P8XA 4WCJA 2A21A 1U33A 3T05A 2VGFA 4IG2A 4LS0A 2ZBTA 2VC9A 4KCTA 5CC6A 2NUXA 1CCWB 3AC0A 1AW2A 1WP6A 3UETA 4CD4A 4ZENA 2FPYA 3PFRA 1FA2A 4PUUA 2BVWA 4JTIA 3VKKA 3DHFA 4MADA 3QJAA 4PFHA 3AO0A 2GGEA 5I2UA 1X6LA 1HKMA 1GOWA 3UGVA 7XIMA 4YMZA 4NNCA 5T8GA 3CV2A 3CO8A 2VDGA 2OJPA 3VDAA 1UCWA 2DSWA 3F4WA 3AFBA 5M1TA 2Y0FA 3M0KA 4Z1YA 2CIPA 2RDWA 1G67A 1XLDA 3S5ZA 3APGA 3MHUA 2XGZA 1QATA 2DGAA 2VZUA 4I7WA 4UB9A 3REQA 4LVFA 4ORMA 4IGHA 4PUMA 1UB3A 1WUFA 2ACSA 3V5OA 3MA8A 4QP0A 2HS6A 3KWXA 4TUFA 4Q22A 1B3VA 5HR7A 2DT3A 3TN5A 1LYXA 6XIAA 4R7WA 5PTDA 2YBVA 3AZRA 3THDA 4CQ9A 5RUBA 4AIOA 3QKZA 4GQRA 2E9BA 5AVNA 1EL3A 1Q6OA 4Z2KA 4JL1A 1S1RA 3IS4A 1LUCA 3P0WA 4QJ4B 3CBWA 2Q8XA 3UPBA 2FVMA 1K8CA 1D7FA 5JMUA 3STEA 3WELA