1ZRQA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 6.0
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
281
Chain Sequence
b'FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGADRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 281
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zrqA00
3APTA 1TJ2A 1TIWA 3APYA 4JNYA 2FMNA 3E2SA 3IJDA 4O8AA 3ITGA 1B5TA 2FZNA 3E2QA 3FSUA 2FZMA 1V93A 1ZP3A 1TJ1A 1TJ0A 1ZRQA 1ZP4A 4JNZA 1ZPTA 3E2RA 3FSTA 2FMOA
chains in the Genus database with same CATH superfamily
4RXFA 1V3JA 3H70A 2CBIA 1J93A 4DNMA 3QFWA 3O9NA 4J3TA 3C0JA 1Q4WA 3CL7A 3F5KA 2YBVA 1QU4A 3UD6A 2CZEA 2QPSA 2WM0A 1TKKA 5J5RA 1OX5A 4IP7A 1J0JA 4O0KA 1SVDA 5GQBA 3OIHA 4UNLA 4JTUA 3LPPA 3KOYA 4NT0A 1FFQA 4U2ZA 1QPOA 1OIMA 2PWUA 2Y7GA 1PS9A 4GY0A 5AHMA 1Q6GA 3IV8A 1OD0A 2P3EA 4HKPA 2DH2A 1RLDA 5E6YA 2OGJA 2DQWA 3QEZA 4CQ9A 3W7QA 4MFEA 4DWSA 2ZCGA 1DPMA 1WAWA 3W37A 4FK9A 3V0SA 4BQ3A 3W2NA 4H19A 1LP6A 3AIWA 5IXEA 2GSEA 4OUIA 1BQCA 5I09A 3U5YA 1QUMA 2CCRA 4CQDA 3A21A 3OZPA 3GNXA 4GIAA 3TN4A 1TWWA 2NXIA 1NWSA 3LXBA 4O57A 3W1TA 1UZHA 4QX4A 1TV3A 4L4OA 4O52A 4TOQA 3D47A 3MU7A 4S1FA 4MVAA 3EEZA 5C7VA 3VOHA 1PDYA 4ZODA 4N0RA 5ENLA 3U2ZA 3SCNA 1CGYA 3EYPA 3PPGA 1E70M 5FSDC 2VL4A 4JKKA 3HU7A 4DYJA 1OC5A 4MJ2A 4EKJA 2R1MA 4H6KA 3WQVA 4DYKA 1TTPA 1CGUA 2GDVA 2QUVA 3REQA 2ZWYA 1K7EA 3CL6A 4NZ5A 2D0FA 3VZZA 3EPNA 2WVVB 1VRDA 2QNEA 3PG8A 5U7SA 1HJSA 3NQFA 2CFFA 1TJ0A 2QV4A 3M41A 4ML9A 4XO7A 3VGDA 1Z69A 1UH2A 1D8WA 3C86A 1PIGA 1BRLB 4XQ6A 3OP2A 2C18A 3NL3A 3V16A 1A5BA 2WV8A 3NUKA 1W5MA 4HHLA 3L2MA 3ABZA 3GXPA 4P8WA 2VR2A 1J0KA 3UGVA 4FO4A 3W84A 2VRQA 5CC6A 1IEXA 2L5HA 4L65A 2JF7A 2BX7A 3QGAC 1FWBC 2Y88A 1TWDA 1WYIA 1K03A 4S39A 4I7UA 4DJFD 2Y62A 3O6DA 4PSRA 1HJVA 2WMIA 4WKHA 4NXKA 2IW0A 2WMKA 1IEWA 1DJWA 3C2EA 4OWGA 4DUXA 4QJ4B 3VNZA 3VIFA 3SN4A 1YYAA 3TOPA 4ZOBA 3ITVA 2CZVA 3ZT6A 3HG3A 1L6GA 3MT1A 2G3NA 5BMXA 3AI0A 1RPXA 4ERIA 3RU8X 1W6TA 2A1YA 4NP7A 3LPOA 1TA3B 2V5CA 4HCHA 5FAJA 4K37A 4ZOAA 1T41A 3GY1A 1QXLA 3FK4A 5XIAA 2XFWA 1F61A 5F1VA 5LA1A 2RJHA 3KBWA 3GU9A 2WK2A 4NZJA 3EPMA 3M0XA 4DWDA 3ES7A 4WRHA 1Q8JA 3CQKA 2J7HA 5A2CA 3F7JA 4K39A 3AZSA 5TF0A 4QE5A 4N9EA 1XFBA 4NRSA 2OZ8A 4RDVA 2CESA 3IAPA 4YJ5A 3MQTA 4Y7EA 3ARWA 3W7JA 1OCQA 2VVNA 3IGSA 5I3JA 1XINA 4MZ1A 5A6JA 3S2NA 2WNWA 3R4IA 1EO7A 4DHGA 3QYSA 5JU6A 3OLEA 1KLYA 4V27A 1RA0A 3VAVA 4KRUA 1XXXA 1XYCA 5A8GA 5HPOA 2NQHA 1ODUA 1BXBA 3QOMA 3BZGA 3W82A 8TIMA 1C29A 4B3KA 3II1A 3NPWA 1CLXA 1F6KA 4F9DA 4S3AA 1Q4NX 2BOEX 1ZJAA 5EKYA 5EMJA 3SR7A 1K8YA 4RNIA 3O6AA 3B3DA 3UZXA 3IUHA 2IKHA 3HZ3A 5JUVA 3NQEA 2YZRA 4JY9A 3Q94A 3SRKA 2R8WA 2V3DA 2VT0A 4IXXA 5LGXA 4MJMA 4GKTA 4Z2LA 1QAPA 2XVGA 1W9XA 5E0CA 4WJXA 2YLAA 8CGTA 1G5AA 2BHZA 2PGEA 3VGBA 4GZ7A 2O7QA 3NQBA 3WUBA 4EXQA 3HM7A 1IF2A 3PFRA 4QLKA 1SPQA 5HUPA 3DCPA 1ZJHA 2YBUA 4GI6A 3M16A 2RH9A 4HTBA 1HJUA 4O53A 3TC6A 1V77A 4QEEA 3W1UA 3WH8A 2VFEA 2VRKA 3W81A 4XKYA 4ZR8A 5CC5A 2X40A 2DGAA 1IWBA 4AVFA 6REQA 1XS2A 3N29A 3COTA 3KTCA 4IFRA 3MWCA 1KV8A 5D2TA 2I56A 3VKJA 3HMJG 2ZVIA 1UOKA 2PI6A 2WCAA 3AYTA 4JQ2A 1QW8A 5GNZA 4IG2A 3HQOA 4JZ5A 1A5OC 4HN4A 1BWKA 3FA3A 1NWTA 2E8ZA 1CGWA 2XGZA 2QJIA 2NV9A 4J27A 1VBUA 1XKJA 3QRHA 3RG6A 2OYKA 2XIQA 1LT8A 1VLWA 2CLOA 2PF0A 2WJFA 4TTGA 4C6JA 3CT2A 4HZ7A 3TN6A 3WEZA 1WAUA 3ZO9A 2NQJA 4H7VA 1ICPA 4LAMA 3KVJA 1E9LA 4CGTA 3FFSA 3CO4A 4QCFA 3MSYA 4DWSC 4JIQA 3MI2A 4AU0A 4UIOA 2AGKA 4J4KA 1GW9A 4GJ1A 1QK2A 1A47A 1IR2A 1FHDA 3W2UA 2ZUUA 4N9DA 3OQEA 5FL0A 2C19A 5HR6A 2J6VA 1E6NA 4JEJA 4MHBA 8XIAA 5DO8A 4CEUC 2VR4A 3BQ6A 1XH2A 4ACZB 5T26A 4W93A 1O95A 3VKKA 1J79A 3V35A 1AG1O 3BLKA 4FR1A 2ZYFA 4R33A 3OGSA 1CLVA 3QLLA 1A53A 1BEUA 4DY1A 2VGIA 5ABGA 3C0QA 1XLHA 3EA1A 4ATWA 1KFCA 4DF1A 1VZWA 1VPXA 3MY9A 4GMEA 2HWGA 2OWXA 1UB3A 1S2TA 4WY0B 1VBRA 2OEMA 3BGAA 1H61A 1HL8A 1QBBA 1MUCA 4EPEC 2INFA 1ZJIA 3QW3A 3NZGA 3B9AA 3W25A 3UNTA 1ZAHA 4OJYA 2VWSA 3P8IA 3B0PA 3Q45A 3KBJA 5I3HA 2V9DA 4WLCA 1DJQA 2WC7A 2NX3A 1XBZA 3MJMA 2WLZA 3LM7A 1ZUAX 1AH4A 3P14A 1EDTA 4XD4A 3BJTA 3TUUA 5D4YA 1F6PA 2FB2A 3OLGA 1FH7A 5FJRA 4LV4A 1TYGA 2XFYA 4RV8A 4ZOCA 2VUNA 4QJ3B 3BL3A 4PMQA 3GHRA 5CC3A 4D6CA 1ZENA 3V18A 2J9YA 3VGHA 4H9VA 1QW7A 2V82A 1YTEA 4UUIA 1E1CA 3AS0A 5A6BA 1EYWA 2HROA 1I45A 3TJ4A 3G5EA 2J78A 4C91A 3C2FA 2ASHA 1VEMA 4F66A 4L1GA 4NYUA 3KOWA 3TMQA 4MAVA 3ARUA 1EB3A 3G0UA 5AVNA 1Q6DA 2AAAA 3ZJ8A 3QQ1A 3W87A 1OYCA 4GUHA 3U3HA 3NQVA 5BOOA 2XVKA 4Q4RA 1X6NA 2DSVA 4UQDA 5C9RA 3T6CA 2WSQA 3GS6A 2NV2A 4QS6A 1QK0A 3ISIX 1S39A 4JQ4A 3RDKA 3TTYA 2PLMA 4DELA 1MWOA 4X60A 2C1IA 3WMSA 1A3XA 2B31A 4KRZA 4WF7A 1THFD 1PCKA 5I00A 5LSMA 3QR1A 5K7JA 1Y65A 1B57A 5HANA 1Z48A 2E09A 4M8UA 4IPNB 4MG4A 1YADA 1OFEA 2XIIA 1CB2A 4RX0A 3STFA 3NQGA 3N9SA 4AZBA 4X0VA 5H91A 2WJZA 4DVOA 3U5UA 3BAJA 2WC4A 4O17A 4WKFA 4QIUA 4F0LA 3U2CA 4IUOA 3MYOA 1LWHA 1EF2A 5I3GA 1B90A 4IQEA 4L56A 1W17A 4N7QA 1WKFA 3FEQA 3HA1A 1EQPA 5IFTA 1E0VA 1VFUA 3O15A 4IIHA 1KXTA 1Q3NA 2HCVA 3H2MA 3E2RA 2GVJA 1BPLB 1W5NA 2EF9A 4LCSA 1V0MA 2H8ZA 2DQXA 1S2WA 4NZ3A 4HHHA 4U31A 1GJWA 4DM1A 4WSKA 2EJAA 1CENA 3A4JA 3BMXA 1R2SA 2QCDA 1DIKA 1H7WA 4Q8QA 1RXOB 3TCSA 4CUCA 2F6XA 3B9OA 3A4AA 6A3HA 4UCGA 3PWIA 2QV5A 3SCPA 3P5ZA 4PMNA 1TJRA 3OEXA 2PDYA 4DPQA 3RX2A 3IGXA 3TZFA 3N14A 1US3A 3WDHA 4D72A 4BF5A 3A12A 4H9ZA 2ZOXA 2WJEA 1TX0A 3F5LA 5AKQA 5D33A 4Q7IA 1BGAA 3W7KA 3OVQA 2Q02A 5FACA 3GNDA 3NDYA 1Q63A 4D8LA 4JFTA 1AQMA 1FQ0A 3WLTA 4Z1DA 3FA4A 4WJ8A 1RLCL 3S5ZA 1OBAA 5HK4A 3N34A 3SUUA 1KM5A 1NFBA 4AWTA 2A3BA 3RLUA 4IQDA 5AC4A 5C9XA 2WXDM 2ZICA 4O8RA 3RMEA 1VB9A 4MPKA 4JIHA 3CC1A 1E9YB 2F2KA 2NUXA 3TNOA 3BAWA 3NQ6A 4F0MA 1P4CA 1RHCA 3O63A 4X2RA 4EF9A 3WDRA 2JALA 4OHQA 3GU2A 3NSXA 1ZRQA 1C8XA 1N82A 2ZA1A 4JTFA 3MBDA 5D2YA 4UNIA 2PDBA 2W66A 1AMKA 3UZZA 4JTQA 4W7WA 1JL8A 5TAOA 2W79A 1MFVA 3H7VA 1HG3A 9XIAA 4MNMA 3PR2A 3VOCA 3ARYA 3S1XA 4A3HA 2X16A 2YPIA 1JCMP 3LB0A 3IIXA 5EMUA 4MDPA 4S3DA 4PULA 5FEPA 5CH9A 3A3XA 4W8BA 3UR5A 4GG9A 1IIGA 2XG9A 3GC2A 3UT0A 2V5BA 3K2GA 4GX8A 2HK0A 2VGFA 4IL0A 1J2WA 1ZZMA 3GKAA 4PUJA 4NY2A 5A1AA 1XG4A 4JCMA 3VIOA 3N11A 1F3EA 3GD6A 3O6CA 3UF9A 4XZBA 1MDRA 1OQFA 3DHFA 1U1JA 1IV8A 4M7TA 4LV9A 2Q3OA 5D32A 2TMDA 1QRQA 4W4QA 3WYZA 3SB0A 3CZKA 2OPJA 4GIYA 4JX6A 3VD7A 7PTDA 5E0KA 3OGRA 1EC9A 1TV8A 3AIRA 2WSKA 1VYPX 3K46A 1FWHC 4CEXC 3HQ1A 1VBHA 4L1WA 1GPFA 3JUGA 1W1VA 3LN3A 4PMJA 4QSHA 3W4RA 3WDJA 2XM2A 2VKZG 1TFVA 1GUVA 4DF2A 3E02A 3M44A 1E0TA 3EOLA 4J1OA 1G94A 3GNRA 1KXQA 5M17A 2BSLA 2BLEA 4R85A 4KMQA 1ZBWA 4JTRA 4AY1A 3L7RA 1VEPA 5E70A 4XUGA 1JZ6A 1LQ2A 1NWRA 5DXYA 4U3AA 3SGUA 5HWNA 4AF0A 3HBLA 5REQB 2E68A 4FXRA 1E5JA 1TZZA 4LFYA 1EC7A 4E38A 4S3JA 5AC8A 2QULA 4AZHA 2DDXA 1R0MA 3P2VA 2P50A 4JDBA 2VI0A 1W1TA 3ZFHA 3GZAA 3SCQA 1Z3NA 3GE7A 1A4LA 2E67A 1OFPA 2OO0A 1HVXA 2VFGA 5CCZA 3QZAA 3LOTA 1GVFA 1XYLA 4H9MA 4HA0A 2XVNA 4MWAD 4C6OA 3GDBA 3CUZA 4ATDA 3KOFA 3MSGA 3NVTA 5XINA 1MEIA 2W62A 3VZXA 1U1UA 3A47A 4UTMA 3W74A 1FWTA 3S1GA 2J7GA 4MJ4A 3BJFA 3VNYA 1LJYA 3GVRA 2D20A 4AZ6A 1Q65A 2VC9A 2E25A 2ZRZA 4A29A 4BKNA 2NT0A 4MYAA 1K3UA 4FSAA 3TSMA 4GX9A 2ZUMA 4XISA 4J3SA 2JKPA 3LGEA 3KLLA 1BFNA 4FLRA 1V02E 3BAIA 1EP2A 1B4EA 3CK5A 4CCEA 3HGSA 1DJNA 4YXGA 4H7CA 3MI3A 2PLKA 2FDMA 3HFYA 1WX0A 1XI3A 5A6KA 4DM2A 1YBQA 3NQMA 4REQB 3E74A 3IJDA 4G1KA 4QAWA 3U6WA 2YB1A 3AC0A 1RBOB 5JH1A 2YX0A 4MWAB 4GQ0A 3TR2A 4DEFA 1VJIA 1LRQA 3LHYA 3M5YA 3LUTA 3WD0A 3KHJA 3EWUA 3A4WA 2OZ0A 5C5YA 1V6TA 3LERA 1EJXC 3GH4A 1HVQA 1HP4A 1W5OA 1HXJA 3CPUA 4Z1YA 4PTVA 4ZE5A 2IPGA 4CLMA 2G3MA 2ZBTA 2J7BA 3CBWA 2ZE3A 2WNNA 4RZ6A 2KZHA 1PUDA 2QR6A 3GHUA 2JIWA 3EKZA 1VFFA 1KM6A 1CIUA 1EJTC 1GVQA 3WNNA 2E3ZA 1PAMA 1O68A 2JGQA 4LANA 1MXDA 4Z1BA 1S5MA 2DV0A 1P6CA 4C6LA 4UB9A 3GFZA 4GRSA 3I7RA 3V0TA 3P74A 3UW6A 1W8GA 4L9YA 4ML4A 4JEQA 4H00A 3W70A 3AUJA 3W71A 2XH0A 3G3MA 3EEGA 3BOFA 3FCPA 1WB0A 1UR0A 1GOQA 3QQ0A 3R25A 4F2UA 3N2BA 3BLEA 1XM3A 1RJQA 2JQXA 3MCNA 2FVLA 3ARRA 4H6EA 3T2PA 3VNMA 2W67A 3NGFA 3RRAA 3N6QA 5JBEA 3RM9A 4QAIA 1BTMA 1VS1A 4DJED 4RL3A 4LYPA 1DHPA 1VCFA 4ZXLA 4CCZA 2F7FA 4BWLA 1V0KA 3NA8A 4MFDA 3L66A 1JYXA 4UFIA 5I78A 2CHRA 1ONEA 3PTMA 3D3FA 3GXDA 1BRLA 2WKJA 1AFSA 4XB3A 1DJHA 3LRLA 2XSBA 3VDAA 4B3ZA 3AROA 1KM2A 4M51A 1V6UA 1VPQA 5LNSA 1K7FA 2ZA2A 3QKEA 1SO3A 2Z1SA 4Y9MA 4PC8A 1POKA 1P0EA 3V1PA 1S2UA 5AYYA 2NW0A 1PO9A 4HMNA 4IX2A 4KPLA 4W84A 3TIMA 2VX6A 3HN3A 4E8GA 3S42A 2NLYA 2VVSA 3U57A 4IMEA 1JPIA 1TREA 5GVJA 4YWSA 5FIPA 1W9UA 3TN5A 5K9CA 3FV9A 4MDOA 2ZVRA 3BSGA 3N25A 1W1ZA 5EL1A 3N18A 1TJ1A 2E5DA 2FGZA 4GPNA 2B7QA 4TO8A 2MANA 3OQ8A 5CAHA 3UGRA 3VDCA 4EVZA 3TQKA 4FNPA 3SUSA 3JR2A 5D9MA 4A2RA 2CZ5A 4GLEA 4P8VA 5IHSA 2PDLA 4MB4A 3QPYA 1BYAA 2DY3A 5EPDA 4DBDA 4PL1A 3OG2A 4QSFA 1G01A 1TJPA 4CD8A 5BOEA 3EA2A 3FY1A 3UU0A 5EFFA 4ZTXA 1F4HA 2CBJA 2GQAA 5A5WA 3HPZA 3WJZA 2FZNA 2VDIA 3SCOA 3T08A 4YYFA 1BYCA 1ZGDA 1M41A 3PUEA 3MWAA 4KGLA 2PODA 1DQXA 1PL9A 3HG2A 4YIWA 1R86A 4GWEA 1VIZA 5D37A 5F4WA 5FEWA 3EDDA 2D2GA 2QXWA 3QOKA 3FGCB 3MI6A 3SECA 3K8MA 5LHFA 3FIGA 3P0WA 5EGRA 3C3NA 1XH1A 3CHDA 2V67A 2TRSA 5ABTA 1QNPA 4X63A 3SRFA 3BUVA 3O0FA 2OQLA 1UUQA 4JIPA 5LNUA 2JE8A 3TSBA 4HSOA 1FTXA 1B3OA 1W0MA 1RBAA 4K2SA 1EGMA 1KBLA 3SUWA 3NQ7A 3ABRA 3S1VA 1M53A 3DHUA 2YKKA 4IL2A 5K4XA 2PDIA 3HO8A 3S2LA 2VZSA 2YFNA 4UZUA 4CU6A 1WXJA 1TWSA 1EWEA 1LQ0A 2DIJA 1K9EA 3WL0A 1ZP3A 3GNNA 1UD5A 3GQYA 3WBAA 4A3YA 3ZIZA 3WENA 1K6WA 4FLSA 2QKFA 3BPWA 4JYDA 1V0LA 3TV8A 3DZ1A 1ODZA 2ACSA 3WELA 3BLPX 4A2SA 1JCYA 4HA3A 5A95A 2PBGA 1XDJA 2C15A 1BSIA 3MP3A 3I7SA 1XQKA 5I3KA 2FGBA 2Z1BA 3C4UA 4GVHA 2OGYA 1B3XA 2I5GA 2F6KA 1H0IA 4CQBA 3WK3A 1GKRA 4C7DA 4I6KA 3H53A 5CZKA 3FSUA 1PPIA 4LALA 3XISA 4FR6A 3OYZA 1R3WA 4BQ5A 1O60A 3UG5A 1B2YA 2QF8A 3B9DA 2OOFA 2GDQA 1SYTA 1N7KA 3TH6A 5FCZA 3P8JA 4ROPA 4K68A 3ARZA 3FYOA 1B54A 1JUBA 1XLIA 3BLIA 2XN2A 1QMLA 2VELA 2WYSA 1XLEA 4C6BA 3WF2A 2VQTA 5LIUX 2Z25A 1W54A 4E4FA 3GXTA 4AZ7A 3CZLA 1BVNP 1JUKA 4PMZA 1LRTA 1MFUA 4XZWA 3FDKA 3W26A 2AMGA 3T0BA 1V3LA 5I77A 4C6MA 2BGQA 2FZ9A 5CSSA 1R2RA 4FZIA 3RPMA 2CC0A 3WLPA 3GDLA 4IGSA 4G56A 1U2YA 1W32A 4Q33A 4WDWA 2A5HA 4JL2A 2HNEA 3URQA 4LUSB 2PA6A 3K1GA 3FDGA 3W7IA 2V6AA 3PP7A 1QHZA 3PY2A 3MMWA 4O1CA 3WO8A 3PBVA 1D2KA 1QI0A 3FLUA 1R85A 4LUTA 2XUCA 1ZL1A 4TX8A 2ISSA 4O0QA 5IM51 3C0SA 4URIA 3UWVA 1GJPA 2HQAA 1GOOA 3W7CA 2Y85A 1DQWA 2O9TA 5KZMA 3MP4A 3QSTA 2DZSA 4GINA 2HS8A 3WJWA 3PBGA 3M07A 4NVTA 5HUOA 3LHUA 4MPQA 3ITLA 5LIYX 1FWAC 4PMXA 3LMZA 1I2PA 2EGZA 3QVQA 1RVGA 3H2OA 2YLLA 4L6DA 4YTTA 5KTLA 4BR1A 2NQ9A 3VO0A 1UW9A 2Z6IA 2W0UA 4PMDA 1B3VA 4WVXA 9CGTA 4NZ1A 2GJPA 1ADSA 1X8FA 2WANA 5DLCA 2VD9A 3OTRA 4IISA 3URBA 3WQDA 4H9UA 4C6FA 2C13A 3NXLA 3BW2A 4KCVA 2PGFA 4XAFA 5E6ZA 2Y61A 3BAXA 3L9CA 3G1YA 2WNQA 3VK5A 3ONCA 4F8XA 2Q8XA 1DXFA 4M0XA 3W1PA 4L4MA 3WD3A 3TYDA 4BI7A 3DN5A 1UR2A 5DEZA 3RUBL 1OFDA 4UTHA 3W07A 1XL9A 2Q3RA 2W61A 3E38A 1JF5A 2QPUA 1SZFA 3DDMA 5C2GA 1DJIA 1VFHA 2VNCA 3NVDA 3CB8A 1H7NA 2Y7FA 1Z7AA 1BG4A 3MCOA 1I0BA 3KLKA 3WD1A 3K4WA 4ZBCA 2FYMA 1X8CA 2QCMA 3R7MA 1GT8A 3T81A 4CKQA 1XBVA 4Y2WA 1JDDA 5HAOA 4R7WA 1WXYA 2FQIA 4QITA 1X1ZA 2YR1A 3O8AA 3S8HA 3ZSTA 4Q8NA 4PL2A 2W4XA 1V6VA 5HNRA 3EX1A 1Z6KA 4JCLA 1MYRA 2A3HA 1FBAA 3KRSA 1EGZA 3C3UA 2YYTA 4H3DA 2CW6A 2RDUA 1P6BA 2G50A 1BWLA 3WCZA 1ZY9A 3OJGA 3LRKA 3GAYA 4E5TA 1VC4A 1QT1A 1XD1A 1XLGA 2A3LA 2VEFA 3KL0A 4NJHA 3H54A 2ZXDA 4ICMA 3LRMA 3FJ4A 4GBUA 3QV6A 2AL1A 2Z1XA 5E0FA 1LM1A 5ABFA 3CPGA 5CPNA 1VF8A 1MW2A 4GIEA 4Q4PA 2O4QA 1UZDA 2ZRWA 1ZPTA 2WMFA 4K8GA 4GI4A 3W1RA 3UG3A 2WPBA 1SR9A 1DWJM 1QHOA 3E5BA 3MPGA 5KSWA 4Y8FA 3GLCA 1E4NA 4PRWA 4NAFA 2POZA 3H7UA 3TWAA 2Y8VA 4EX4A 3WFLA 2ZDSA 2G4FA 3IK2A 1UD4A 1NOWA 3W29A 1G7UA 3RN6A 2V63A 1PKMA 3S46A 3ZM8A 1KTCA 1SFLA 7REQB 2VQUA 3MANA 1AJ2A 2NVCA 3H26A 1X97A 3SM0A 1ECQA 1A5UA 4XAYA 2VHLA 1JYVA 1OT1A 3GXFA 4W5UA 4EXBA 4J28A 1O4UA 2I17A 4O8AA 4R88A 1H11A 3NNTA 2CZDA 1H7XA 4GBDA 4KRTA 3EPOA 2WPGA 3B8TA 4IPPA 4K36A 3UVAA 4AVOA 5FF7A 1VBGA 1YNQA 3R5EA 4JX5A 3EDKA 4AMAA 4AAJA 1WV2A 4GNVA 4Q3MA 1WDSA 2ISVA 2WZEA 4A8RA 1QOXA 1RK6A 2E6FA 1TX2A 2REQB 5CAKA 1UUOA 1FDJA 1CX9A 2OT1A 3NFUA 2XZ9A 2B4GA 3IIVA 3DAQA 3UERA 1WZLA 4MTVA 2GGEA 1VP5A 3BLFA 4DZHA 3BH4A 4WCJA 3UZ5A 4NJIA 4I9JA 1XP3A 1CYGA 4MY1A 1WDDA 2X1RA 1FP8A 4FNQA 1KKRA 4QE4A 4IQJA 3C2YA 4YTUA 4IX0A 2J47A 3NQDA 5KZDA 4KWOA 2PZ0A 1CGVA 1OCJA 4I8DA 3W6YA 5JQ9A 3Q4DA 5AHNA 3TOYA 3WBWA 1DXIA 2V5JA 2WNZA 4PH6A 1R7OA 2YSWA 1K4HA 4O19A 4PFMA 3T05A 3SGGA 2GQ3A 3UPBA 1RALA 3BTNA 2JBMA 1KBBA 3U9IA 4HJFA 5KZ6A 1X96A 1OFRA 1R3SA 4I8YA 4IT1A 3P81A 2NX9A 2BG5A 3MVIA 1GYNA 1V4YA 3O06A 1VCVA 3UWQA 3S1WA 3WIJA 4B4FA 4CNTA 7CGTA 1AD4A 3H4XA 3BJSA 4NNCA 1UP0A 2DZUA 4ZL1A 1WA3A 3SRDA 1FA2A 3NTYA 1M9HA 1LLOA 1GQLA 4IMFA 3T4CA 3W7RA 1TPWA 3SCVA 3UETA 2VOTA 4Q4QA 3NURA 3W7LA 4FMVA 4YCPA 4FLQA 5B7YA 4P7LA 2OELA 4OUEA 2VOMA 4P7OA 4HYRA 3W1AA 2ACUA 3LQGA 4QP0A 3AYSA 4XZNX 1PX4A 2ESCA 4QDMA 3TYUA 3L0KA 2P8BA 1XBYA 2Z26A 3T0DA 3VIMA 4F0HA 3TYAA 2XU2A 4HOWA 1AQ0A 1X38A 3WQEA 2GDUA 2Y63A 2PDKA 3GR7A 1XIDA 4IPIA 4JPGA 5FSEC 2W6RA 1VFLA 4ZO7A 2ZZ7A 3A6OA 3VDBA 4PTDA 3RLHA 4WKAA 1QNVA 2NLIA 3VNDA 2PTWA 4HPNA 1UUMA 1DP0A 1P0KA 2O9PA 3EKGA 3DECA 5E9AA 5IHRA 2FLIA 2JKAA 4IMCA 1FH9A 3GK0A 4PUUA 2DUAA 1A0DA 4ZO6A 4MAZA 2Z2UA 3T2QA 5AHFA 4S23A 1OX4B 4DB7A 1LL4A 1FWDC 3W7NA 2BVTA 4BFAA 3VMOA 4MY9A 2E6DA 1YXCA 1HTIA 3NIYA 4TV6A 4S3GA 1VQTA 1KCZA 3GYCA 3THAA 2KAUC 1HKMA 3H23A 5HNTA 1JG9A 5G4WA 4NU7A 2J6XA 4TUFA 4PYSA 2ZDRA 4PCNA 2D24A 7ODCA 5HJXA 1XLDA 1VR6A 2VXNA 2AMXA 3AZRA 4C60A 3CAKA 3AMGA 3DKLA 5LIWX 4HGXA 1UZ1A 4LSBA 5I3IA 1XFCA 5A69A 3RCMA 4OZOA 2HDJA 5KEZA 4JTLA 4EANA 3ATYA 1FKXA 2DVUA 1DV7A 2CZFA 1W3LA 1MUWA 5DMMA 1EBGA 2OOGA 2G37A 3OLDA 4U4MA 2ZUSA 3OO2A 3RPDA 4GVFA 4HA4A 2Q8LA 4M6QA 2GVGA 4YN5A 3W2KA 3RM8A 5A2BA 3AJXA 3ANUA 4PBFA 3T4WA 3BG9A 1JZ2A 3ARSA 2HVMA 1G9HA 3TTOA 3N2XA 1XSJA 2X0SA 3W27A 1E6ZA 1NIUA 5LKYA 5C70A 2XWDA 4PUEA 4HPHA 1UKTA 3NSMA 4NYYA 1FP9A 1XLKA 1OY0A 5CBIA 2ZZ4A 2DP3A 1PHQA 1W3TA 4JQ1A 1MEWA 4REQA 2OX1A 3CZEA 4HZ6A 2WZHA 2XZ7A 3TONA 1SO5A 1JD9A 1IE7C 1SW7A 3HQPA 4MWAA 4S38A 4ZVJA 3QY8A 2FVKA 4QGCA 5FOOA 3OA3A 1H7RA 5BRQA 3GG8A 4G7EB 4YWIA 3G1RA 4DJDA 4QM1A 1XLAA 1TG7A 3HURA 4W7UA 4ENLA 3GIQA 4BK9A 3E2QA 3UXKA 4PB5A 3PVFA 4LY8A 2WCSA 3ZVIA 4E0CA 2ACQA 3GDRA 1FXQA 2Y5JA 2J62A 3PTDA 3AMKA 3QH2A 3M6DA 1H62A 1XWYA 1E40A 1XIBA 4JTJA 2GJXB 2GGHA 1W9PA 4YHGA 2NUWA 3G1AA 1FX6A 2HNHA 1FKWA 4FOKA 1T40A 3KS5A 2E4TA 2E6AA 5JIWA 3I3DA 3P82A 1MW3A 1TUXA 5BRBA 1AVAA 3F2BA 3GH7A 3NOEA 3CV2A 1GG1A 3W1XA 4OBRA 3B0VC 3THDA 3N2CA 4IIDA 3WFZA 1MI3A 5D2VA 2OX4A 1EQCA 3N2TA 1TMLA 3LV5A 2ON3A 1XIHA 1GTEA 5AYZA 3ARVA 2Z1KA 4QR6A 4V1YA 3ZWSA 3T0TA 4LXFA 3EWDA 4M6PA 3UWZA 3VD3A 2YB4A 3WEMA 2EKGA 4OU1A 1EJUC 1B30A 1GOXA 1ME8A 1R38A 4A8IA 4AEFA 2C1GA 4NX5A 3VTRA 1E6XM 4R9OA 4NIRA 2PCQA 3MKVA 2X2GA 1DWGM 1DJZA 4XV0A 5ECVA 3L68A 3P60A 5BXSA 2DW6A 4AZGA 2VC7A 1EHNA 1HKVA 4CNNA 1DTUA 3TDFA 2DU2A 3V4BA 3PPCA 2PU1A 3O3RA 4QLLA 3AXHA 2WO5A 4WGHA 1LWJA 2NQLA 3V5OA 4B5VA 4HJWA 4FF5A 2WHMA 1UPMB 5FESA 2ZZ5A 3OVRA 3R6IA 3R79A 4BQ2A 1CPUA 4DO5A 4JTIA 2WWDA 1AJZA 1H7PA 1BLIA 4A4AA 1J6OA 4RPPA 3MV11 2IS7A 4JNYA 2UZ9A 3CIVA 3PHAA 4QJ1A 3T40A 4D6GA 3B9NA 3EA3A 1JCNA 3UJRA 2F61A 1DIOA 4V28A 3E5PA 3VILA 2BY3A 3O07A 4K8EA 3WK0A 4TMCA 4PA8A 1H50A 2PC8A 5HNNA 2J77A 3HPFA 3RU6A 3ABSA 5DRIA 2J75A 4N9BA 1OGBA 3C5QA 4I90A 3WN6A 1OC6A 2OKOA 3CYJA 3MMDA 4J3ZA 5LNWA 3DOPA 3WUGA 3OA5A 4EWND 1QR7A 3S3GA 4EACA 3DBPA 2XGBA 5FA5A 2RKXA 3POCA 1UWSA 4OV9A 3WK2A 1VFSA 3FKKA 1TPDA 3P80A 1XGDA 4KT2A 3E0FA 4AC7C 3IACA 4ZCWA 1ALDA 1DVJA 1SJDA 2FZ8A 3RX3A 4BEQA 4O4WA 4M82A 3NYZA 3CV6A 5I02A 1HF6A 1XIEA 5G2IA 3W23A 2YZ5A 3QV7A 4X3ZA 4AIOA 3OG3A 5F2MA 3UR8A 2A85A 4DYEA 1REQB 5I03A 5HR7A 2G3IA 3NL2A 3KCJA 4JD4A 1E0XA 3FGCA 4YYCA 3DESA 5A6TC 1FHUA 3CQ0A 1Z9AA 3LYEA 4DO4A 1M5WA 3GBEA 4R7JA 3UZWA 5M5DA 3LQLA 4ERAA 1B9BA 4E2VA 3BGGA 3LLFA 5C2XA 3BAKA 4GC4A 4GNKB 2HXTA 3PPHA 4KIEA 1I4NA 3T42A 3SSJA 1CGXA 1QPQA 1OFOA 4A8LA 3H21A 3QTPA 3EOSA 1F8MA 5F4SA 2EBNA 2J9XA 4Y8EA 3WLIA 2GGGA 3R8GA 2BY2A 2HJPA 3O16A 2R14A 4DBWA 1V08A 1RQEA 4MGGA 3TYCA 1W3KA 3WUEA 2NVAA 4FNTA 1FY6A 4JKMA 3VIIA 2QUNA 2ABAA 1MRQA 4ACYA 5LNRA 4C65A 4F4RA 2OSYA 1U5HA 3T8LA 4UTKA 5A8NA 1TTJA 2Z29A 3GIPA 3KEHA 5CSUA 3KUMA 4IF2A 3KRZA 5BW6A 1A5CA 4RE0A 2OWCA 1BF2A 4R5EA 4JS3A 1L6FA 5DT5A 4PUMA 4PCPA 4AZCB 1KCKA 2O55A 1J12A 4RKAA 2FZBA 1UG6A 3WMBA 2ADAA 1TVNA 3THCA 2YJQA 2F9RA 3JVAA 1KA9F 1Q66A 3CZGA 3LNPA 4A3UA 4J3VA 4PMRA 4XTIA 2GSJA 1FWFC 4HNUA 5KMYA 4GUIA 2Q09A 2HZGA 1EP3A 3WH5A 3FAWA 5CPMA 3PFMA 2OMAA 5B7ZA 4O28A 1ZBKA 2ACRA 1IYXA 3M6YA 3GWQA 2A0NA 1TB3A 2WVUA 2PWHA 2OG9A 5DCBA 3GDKA 2NVDA 3CUGA 4Q4SA 2FZMA 4XO6A 4GD0A 1E9ZB 2PWEA 4J7RA 1KFBA 3FN9A 3XIMA 4QTGA 2J25A 3ATZA 3RM4A 3CUIA 1PKNA 2A3AA 4MWAC 3E0WA 1VYSX 4K7YA 1D3HA 1ZTVA 3IEBA 5GJMA 4DJDC 5A94A 4F79A 3LGGA 4FXSA 1ZAJA 3PS7A 2RDXA 1FRBA 3IK4A 4QS5A 3B8VA 2GGIA 2C7FA 4B5SA 2GVEA 2PZNA 3M7WA 3CT7A 1L6SA 1N8IA 1ONXA 4FX7A 5CGTA 4Q22A 4IJRA 4BF7A 4LUSA 1GKPA 1WPCA 1GONA 3K8LA 1IWPA 1KBJA 3G0SA 4M5PA 3GTFA 4S3BA 5D09A 2H3DA 2VEPA 4G8TA 5FJUA 1XG3A 3M9YA 5DRCA 4R3UA 1KRCC 5IBXA 2EKCA 4LVBA 4FA3A 4L80A 2QLYA 2E7FA 1K9TA 1JCLA 1Q6FA 1TPH1 1H5YA 5JMUA 4LYQA 1XPGA 2PURA 3AXIA 5FEZA 1YE4A 3HG5A 3DC0A 4XZ9A 4ZO8A 5DN1A 1KFJA 2Z1VA 3W72A 4QLJA 3U2EA 3UVIA 5CZJA 3FKRA 4N6FA 3LXAA 3M0HA 4Z1AA 3RR4A 4J35A 1LG2A 3GVVA 3CQJA 5JIPA 2BOFX 3EMZA 3ZS4A 4JX4A 2CLPA 1I75A 2J8FA 5G2HA 1ESWA 4JTSA 5CJMA 3S83A 4O11A 2Z24A 1UWTA 1LG1A 5HJLA 3OGVA 5AZ0A 4UFHA 3LBOA 4DIAA 2B0MA 2H9AB 2XVPA 2ZRXA 3W7DA 4UQBA 3BARA 3JRKA 1LCOA 1KCXA 3BC9A 2PUZA 2Z28A 2O56A 4CCCA 1V6WA 5G1TA 4NF7A 3G6MA 1V5XA 2Y2WA 4AEOA 5JVLA 1K77A 4JR5A 4LAKA 2ZRUA 2QJJA 3P84A 4PEKA 1UASA 6XIAA 4HPXA 4OBTA 4PUKA 4MLJA 2JGYA 2CKSA 2X41A 4QDPA 3UG4A 2J24A 1GHSA 2XHYA 2PBOA 2W91A 4DJEC 4JN6A 3DG6A 4GJIA 4MB1A 2F2HA 1YX1A 1WOAA 1C8VA 1QVBA 3B8IA 4FIQA 4QG6A 2VMFA 1A80A 1RH9A 1UD2A 2OZTA 5AYBA 3GC5A 4PTWA 3PZIA 4JTGA 4UOZA 3MKKA 3B8DA 5HWMA 4CU7A 1NF7A 1RJPA 1BKHA 5H8UA 3MDWA 4Y9AA 3AHYA 2HV5A 2I9EA 3R58A 3W01A 1IZKA 4NRRA 1WKDA 2PDMA 5ABEA 4DWSD 1YRRA 3I6TA 2DVTA 3V5CA 2R1PA 3O7UA 4IP5A 3KBMA 4QDWA 1TJ2A 3WDIA 4NZ4A 4F0RA 3IJIA 3WL1A 1B9ZA 1MUMA 1EO5A 4RV3A 1PBGA 4H4IA 4TVUA 3W7PA 2CEQA 3A5VA 3WLHA 2CLHA 4GCAA 2XIBA 4WSHA 3SCUA 3B0YA 5C8BB 3OW1A 4KEZA 1MQQA 1OM0A 4GI9A 3LCGA 1O5QA 1OHLA 3ANVA 3F03K 3G77A 1XGZA 4PMVA 1ECEA 3WLQA 2Y5SA 2C91A 1NTHA 3TTQA 2XH7A 3BW3A 2NQZA 5HINA 3FXYA 3CHVA 2J88A 5F2IA 4L6HA 3TP4A 2XGIA 4WK9A 2FHBA 2VZOA 3CEUA 2GPTA 4E8CA 2XTKA 1XHGA 3MB9A 2PC4A 3VINA 4G6CA 1UP3A 1ZCCA 1DE5A 2XJ7A 1RCQA 3SW6A 4EP8C 4I6VA 4UFMA 2R6OA 3LSBA 2BFGA 1F3WA 3LSCA 1J9YA 4XSMA 3NR0A 1NP2A 1Q13A 3L4UA 2YDQA 5BMWA 1UKPA 5HBFA 4RW5A 2BGSA 2XFRA 1OFQA 2C79A 2WSYA 3WKZA 3E0IA 3B97A 4JY8A 1VFTA 3V75A 3GHSA 2CITA 4WHBA 1EIXA 1DYSA 4HMEA 1FHLA 3FVMA 3KDNA 1TPVA 5CPLA 1TPB1 4A05A 1H09A 1KGUA 2V81A 4CNOA 1UR8A 4D8AA 4QQUA 5KITA 2IKJA 2XISA 4S3EA 3UJEA 3LXCA 3RCYA 1B3ZA 1V3IA 3UCDA 2DIEA 4DO7A 4MKNA 3FS2A 5MF5A 4AHOA 4RR4A 2DVXA 3UXDA 5DBTA 3T0AA 3NM3A 1UD8A 1Q45A 4XBSA 3VX0A 2ATMA 1WO2A 4UR7A 2AQVA 3EX2A 4WD0A 5IDIA 4FS9A 1B4KA 3WLRA 1ML1A 3DFOA 4Q7BA 5EBUA 1Q7QA 4KWWA 3WF4A 4AD5A 4WOQA 3F4WA 4PMUA 1GPWA 2X1IA 4PEEA 1GZGA 2Y0FA 3NYDA 3QBUA 2ZADA 3SI9A 3LCLA 2X0HA 1IXOA 3NPVA 1GEQA 3ZQ9A 4BI5A 3BG5A 1W31A 4JYFA 4Z0JA 3SY8A 1XYZA 1PX3A 3OYXA 1GOKA 4V1XA 3U2OA 4V15A 3UXLA 3TN3A 4DBUA 1T8QA 3UG8A 3WQOA 4ONVA 1FFRA 1ISVA 4D6IA 2OVLA 1UKOA 1M7PA 1LWIA 3ES8A 1K8XA 5BRPA 3QHMA 3EAUA 2ZUNA 4H83A 3RJYA 4LU0A 3WQ8A 2VEKA 4GK8A 5IBXC 2AL2B 3A22A 3AU2A 3B8WA 1DOSA 1VYRA 1US0A 1BSLA 3B0XA 2CWXA 4JHOA 4AYSA 3I10A 4IP4A 1CW2A 1Y0EA 1XLFA 1FHVA 1XPYA 3BWWA 1CNVA 3L2IA 1BD0A 2DPEA 1T6MA 3B04A 2HXUA 1PTDA 3FHAA 3NZRA 4UXDA 1L8NA 1IGWA 1QTWA 1W1A1 5LHEA 1DE6A 5A8MA 2INZA 2WQDA 1R3VA 2UBPC 1QDSA 1UC4A 2ZWZA 2C0AA 1WUEA 1DJXA 1UKQA 3S5YA 1EHAA 3M7SA 4AQLA 3GDTA 8XIMA 4IMGA 2D23A 4EF8A 1OK6A 5T9BG 3RMJA 1H41A 1R6WA 3F2DA 4FNUA 5A8OA 3E1F1 3B40A 4YCOA 1PWMA 1SFTA 2J13A 2WW5A 3PJXA 2D2HA 1UZ4A 4PN2A 3W38A 2FB3A 1GVIA 4GGHA 2CYGA 4B9YA 4GZIA 1GZJA 4EAMA 2Z6JA 3IAQA 4B5WA 4YMZA 1DORA 4XZIA 1EFZA 4AEEA 5M1TA 3TX9A 5A3HA 5AYIA 2J4GA 2GWNA 1DWAM 3H6OA 3R0KA 3M5XA 5FJPA 1XW8A 3BW4A 4A6GA 3IPWA 1GHRA 3THUA 4GXWA 2FFCA 4QXIA 4UBPC 4U5KA 1XISA 3UJSA 1NOFA 4QROA 3UA4A 1EA0A 4KIRA 3PAOA 3AXMA 3IJ9A 2QCHA 1ITXA 3SDOA 3KX6A 3QMRA 2ZTJA 3VUPA 1D7FA 1NELA 1EJVC 1UCWA 3UJ2A 5C0QA 3TU9A 1CXIA 3TA6A 2R1LA 1EX5A 2LLEA 1W3HA 3VOGA 3H2NA 4F2BA 1EPVA 1W1IE 2QHAA 2YCIX 5AFDA 2WHKA 5LIXX 4N4QA 2PMQA 4QCEA 1NQKA 1C90A 2HMCA 2C16A 1T5AA 3G0XA 2Y1HA 3TYEA 2WKLA 4K6AA 4ZFMA 1US2A 2YCLA 1NARA 4LS0A 4C7GA 3SUVA 4LB3A 4JTHA 1Z8AA 2VZVA 3C0LA 4XKYB 3PBUA 3QGVA 4UOQA 4DI9A 1P0DA 2VRJA 4I7WA 6REQB 3EOEA 2Y6ZA 1ZBCA 1XC4A 1QASA 3WQGA 1JZ3A 3ARXA 3TYBA 1F3XA 2WOQA 3VIGA 2DJXA 4BI6A 3H2FA 5E9XA 3CAQA 3F4NA 3VIKA 5DMLA 1DBTA 4FXJA 2A79A 3R2GA 3WQPA 2Y8UA 1XRSA 1JXKA 1FXPA 1CBGA 1PWLA 3T44A 1E4MM 3SADA 1MDLA 1O66A 3TKFA 4JAWA 3N19B 1GK8A 3UR7A 3CIWA 4GJJA 4KERA 4BQ4A 3I6EA 1OFAA 1JZ4A 4AX7A 2ZX5A 3FHQA 3E3HA 2GJXA 2E6YA 3MV01 4UTTA 1E4LA 4IOTA 2WZMA 2RDTA 3SQMA 1CT5A 3GUWA 5HMSA 1T99A 3L0NA 3WLOA 5F7UA 1RCOB 2FPTA 2O9OA 4GY1A 1OCBA 1NDVA 4TR9A 4PTMA 3LY0A 3AWNA 1V6YA 4NASA 4KEUA 4GUFA 2R24A 2J74A 3R1ZA 5CKSA 4HPGA 3WQ5A 1BTCA 4IQLA 5CGQA 1QPRA 5DCDA 3O1NA 2QIIA 5GNXA 4PUWA 3D46A 1ZS2A 3ARQA 2XN1A 1TVPA 3M5VA 3K13A 4J9JA 3UESA 2NUYA 5A6BD 1CXKA 2QJNA 1IHIA 1E71M 1NDZA 4LBUA 5HWJA 5HXMA 1V0NA 5DT7A 4GZJA 2CLLA 3ZR4A 3PPFA 4YLWA 1KBIA 2VUYA 3TJXA 3WNKA 1AQHA 2GFTA 1K8ZA 3EWCA 4TX9A 1YNYA 3MHUA 4F40A 3SGZA 2PEVA 2DSKA 2BWGA 4WXZA 2NSXA 3WH6A 2G5WA 2D69A 4BF9A 3PULA 2GLKA 5CGMA 4N9CA 3ABQA 1ISXA 4WJEA 4Q8TA 4XKMA 3KOZA 4RUBA 1TQXA 1ZQ5A 4PCTA 4YHEA 1CXLA 3WLLA 2BBFA 1Q5MA 3NG3A 4KEVA 4ZOEA 1IZCA 3GM8A 1AH3A 3I4KA 3QY6A 4YS1A 2BNJA 3M0VA 3N13A 5T8GA 2FH6A 2BHUA 1ITQA 1L2QA 5K9XA 4MNJA 1XJBA 3UFYA 4YVXA 2W3ZA 1D7KA 4NUWA 2PGWA 1XUUA 1DKWA 2RUSA 3V36A 3IGUA 1FWWA 3IVUA 2PDWA 4OE7A 3WG6A 1MQRA 2VC6A 3RO8A 3WH9A 1C9WA 3MHGA 3WMLA 4MWAE 3QSRA 2ZUWA 1JNEA 1ISWA 4W85A 3W86A 1GKQA 4AHPA 4XZLX 1YXYA 4GNJA 4E2OA 2H3BA 1GYLA 4W89A 1CI1A 2R94A 5K3VA 1XCWA 4FNSA 1JPKA 1VPYA 5I24A 3BSMA 2C0HA 4IGHA 5IRPA 6CGTA 3VPLA 3YPIA 2CNCA 4MUPA 1R9XA 3RJXA 4CN1A 4TVDA 4HNVA 5BXPA 4Y9OA 3N1AA 3DFYA 1LOQA 3VGEA 2YBTA 3AIEA 4JQ3A 1G67A 2VFFA 4RNJA 3CUXA 2PWGA 3WQ6A 2DZBA 2PRLA 2TYSA 4IXHA 1HN1A 1RD6A 3ALGA 3TROA 1XC6A 4H01A 2PGRA 1TE6A 3CXOA 4ORMA 1KNWA 3NJ3A 3SY1A 3LZ5A 5I23A 2NV1A 4XD3A 4LVGA 3WF1A 1LBFA 4PE8A 4HU3A 1UD6A 4F0KA 3EWZA 1MXSA 4H8UA 4O14A 1F07A 4HU0A 2INEA 4UTWA 2ALRA 1UBSA 2P10A 3CQIA 1HNYA 3INPA 1UR1A 2PFHA 4HK7A 3VOIA 1GQIA 4FOUA 4R7OA 3U4AA 2YA2A 1NVMA 1VRXA 3RNDA 5TNVA 1TV2A 1A50A 1EX1A 2F38A 4I5UA 1WDRA 4XTDA 1VHNA 3G1VA 3W9ZA 3ANYA 3DFQA 3N4EA 3M0MA 3IIOA 2H8XA 4K38A 4GHRA 3CASA 5FJOA 4Y96A 1HO4A 2ZZ3A 1K9DA 1YNPA 1MW1A 1GVRA 3HTWA 3M46A 4ZO9A 2PPGA 4LC6A 1YDVA 1JGMA 2E28A 3G1HA 2HE5A 1QW9A 4GVIA 1K9FA 1FUYA 3HQNA 1Y7VA 2NXHA 1H49A 4AIEA 1VAHA 4B2DA 4HU8A 1SM9A 4YNGA 4HD5A 4LUYA 3RFAA 3ZVHB 3CU2A 4GFSA 1VEOA 3WBYA 4M56A 1LF1A 1FWCC 4LWWA 3W7HA 3VIHA 2NWRA 4JTEA 3UQNA 1XF0A 3S5SA 1O12A 1S5NA 1S46A 1TTQA 4Z2IA 4NG3A 3W1LA 1TSIA 1NQ6A 4Z2HA 1QI3A 2FDSA 5LNVA 1PB0A 4LEQA 2GVLA 3LZ3A 1Q7ZA 3GFYA 3TLLA 4AMCA 4G7FA 1ZLPA 1JZ7A 4GH1A 4I3GA 1UIOA 1YPIA 1MNZA 5C7HA 1PIFA 1XLMA 3PTQA 3MVTA 4JN8A 2AAMA 4PMOA 2G96A 4PR4A 5HATA 4XG1A 4HCDA 3N04A 2R1NA 3L12A 3GC4A 3KFTA 1B1YA 1UH4A 3ICJA 1R7AA 3ZR6A 3GZ3A 2H6RA 3ZOAA 2V68A 2GSHA 1TWZA 1EDGA 1UOZA 3NCOA 4XIMA 2ICSA 3LI1A 4PTXA 1AZ2A 4OIFA 3RR1A 3D6NA 2J7FA 1JZ5A 3VGFA 6ENLA 1JYWA 3QR3A 3E2VA 2BOGX 1EYEA 1C8QA 3QYQA 4AXNA 3VD5A 2A21A 2FFIA 2RJGA 2ZX8A 3VDHA 1A0CA 2J8GA 2XPKA 4US5A 3LNMA 4MNLA 3W00A 2XH4A 4Z2GA 1TV7A 1Y8BA 4OVXA 4UTTC 4IJCA 3SEPA 3MSRA 5LA2A 1UIPA 4WSJA 4PBGA 4IMAA 3PZOA 1OVDA 3H8AA 1JGIA 1W1PA 3LBCA 5D30A 3VC5A 4Q7NA 3MMUA 1KM1A 3ITTA 3AYVA 4PRTA 4C1NB 4RZ4A 5FJTA 1GCYA 4HSHA 1TMHA 3UXIA 3SIZA 1EZ2A 1J0ZA 2FZDA 2X1TA 2VGBA 5G4EA 1M68A 1J10A 1I2OA 3PNZA 1ZFJA 4C5YA 2ZX6A 4E2DA 4GO9A 1SFSA 3LK6A 3LLDA 4ZE4A 3AHXA 3PBMA 3WEOA 3EXRA 2QGHA 2CLMA 2Z2BA 6TIMA 2TAAA 1AK5A 9XIMA 2VDGA 3W76A 1UMLA 4WY0F 2QEZA 4ZQRA 2IKGA 2OJPA 3WF3A 2HPIA 4HT3A 5F2LA 1PV8A 3LHTA 4H04A 4JBRA 3TAOA 2OTDA 4ORIA 3SO7A 3RF9A 3O6YX 3WLMA 1MZRA 2PD5A 5A6AA 1R3YA 4S2CA 4K1WA 3NDOA 1VFMA 1XBXA 1KO0A 2OT0A 4TU1A 3BURA 4R9XA 5FF4A 5HQEA 3MJYA 3LCIA 5HA7A 5FKYA 2GJRA 2EG6A 4C6EA 2D3LA 3N15A 4GQRA 1M7XA 2IPJA 4I9MA 3CHEA 1L9WA 4NJGA 3DFHA 2IQTA 2PTDA 4EK7A 1OYBA 2VFHA 2QJMA 3CL8A 2ZC1A 1Q2SA 1O5RA 1TRDA 3K4DA 1W3JA 3E0VA 4AF0B 1EA9C 1KW1A 3QF0A 4O18A 2FKPA 3QN3A 2TODA 2FTPA 1I1WA 1S5VA 2QAPA 4IPLA 5KINA 3MUY1 4KKXA 1GEHA 4Z2KA 4M29A 1PIIA 4U2YA 4FLOA 1XCFA 2HEJA 3M43A 2ODOA 1EDQA 2GUUA 2NX1A 5BU9A 4OKDA 3KHDA 1LUCB 3JU2A 3TQ0A 1EKOA 4AX6A 4AZIA 1QWKA 3R8HA 1HO1A 4RDWA 4B5UA 5K4ZA 5E09A 6XIMA 5D8WA 1VKFA 1VIWA 1KFLA 3WJSA 4QISA 1OC7A 1Q6RA 4PGLA 3GTHA 1OCNA 2QYGA 2DZVA 2QVHA 3W7OA 4F48A 4OT7A 5CLTA 8A3HA 3CUJA 2UY2A 1TPFA 3TWBA 4DI8A 2Y5EA 3KTSA 3SCRA 1TV5A 3P93A 3GB6A 4NAEB 3SQSA 2PE4A 4XZMX 3GG7A 4ZSUA 1W8SA 4S3CA 5CQ1A 1LLWA 4BZYA 4PFHA 4PRRA 3E96A 1W1YA 4UTWC 1YBQB 3NZ1A 3A24A 3I4EA 2YL5A 1J4EA 3T78A 3M4HA 3IJLA 1AD1A 5BU6A 4KQNA 1QNQA 3IGHX 3GBDA 3O0KA 4C6CA 1E6PA 3QFEA 1NSJA 3N9RA 3MDUA 5JXQA 4RDZA 5HPCA 5GPRA 3NO1A 1SO6A 3M0JA 2WBGA 3MZNA 3RIKA 4QE1A 2X7VA 1IT8A 1SFJA 5TIMA 3GSMA 1G0CA 4Q8PA 3T07A 4AG0A 4DZIA 4P5UA 2P53A 4GCXA 5TBOA 2ZIDA 1TE1A 4DAIA 2DJLA 3H2EA 2QQ6A 4A21A 4B92A 1JIBA 1FCVA 2QCLA 3VNJA 3L23A 3V5FA 1I2RA 2TPSA 2DW7A 4B5NA 3QV8A 1HJQA 4AY7A 1BYDA 1GVYA 1D9EA 2BTMA 4Q4KA 3FSTA 3AALA 4HNCA 4CNPA 5A6LA 4CQCA 1DWHM 1RJRA 4P8XA 3IJQA 3GRIA 4I5XA 3WF0A 1EUNA 2WVVA 1IEQA 1X7IA 1TR1A 5DY3A 4YVVA 2YYUA 2Y8KA 3FAXA 2OZ3A 3QPZA 3BCDA 4L1XA 3IVTA 5DY2A 4GABA 5F2GA 4RE2A 5EU9A 5BYWA 4DX3A 3WLSA 4QBXA 2GJLA 4GXMA 3ITGA 2PP3A 2OU4A 2XFFA 4HIBA 1QNSA 4OOZA 1R3QA 4TV5A 3W7MA 1YTKA 1Q6OA 4J2PA 4IUGA 2PDGA 3QXBA 3EOUA 2QDDA 1JEZA 4WIWA 4RE3A 3FNDA 4NI3A 4R27A 3KBNA 3BMVA 2O9RA 4UQCA 1V93A 2VFIA 3SAZA 2Y7EA 2QCEA 3DHPA 3PJUA 5KZEA 3MSDA 4JXCA 4HQVA 3BQ5A 4B15A 2XYLA 1ZNNA 1UA3A 3KBVA 3GW0A 3CTTA 1CZ1A 4INFA 2UY3A 4AWEA 2PP0A 1UD3A 4N02A 3BG3A 3DENA 2XIOA 1XX1A 1Y5WA 3KAOA 1TMQA 2KX9A 1CDGA 4AUBA 3C2RA 1TA3A 2DZTA 4N42A 4PCSA 1J18A 1P7TB 1RK5A 3TAKA 5CJ5A 4D1IA 1RPKA 3M0ZA 2HISA 5H1WA 1A5LC 3IRSA 2AL2A 2PDCA 1ZALA 1Z32X 3CWNA 1KQYA 4LJ3A 1UHVA 4DJFA 1FDYA 2A7RA 1L2UA 2X0YA 5CBJA 4UQ9A 2P0IA 4F2TA 3UJFA 1EZWA 2GK1B 3G2GA 3G1DA 1YDOA 3R11A 5XIMA 1L6YA 1SU5A 1EJWC 2WKGA 5LXXA 4HU4A 5FF0A 2A2IA 3VFLA 3ARTA 2X42A 3SRHA 4E4PA 3KXQA 1X7FA 3KWXA 3EMQA 1VCGA 4GUGA 5HMEA 5M3WA 3GVWA 3P62A 3WLKX 1M3UA 3R89A 1H60A 1E4IA 5AYXA 5I6SA 4H6QA 1HP5A 2FMOA 3PB2A 2BY0A 1KWGA 1IQ8A 1FWRA 2DUXA 4AIUA 4XD5A 2CXEA 3PANA 2ZUVA 5IDZA 2Z7GA 2QGYA 3EZ4A 5BCAA 3BZJA 3LMYA 1MO0A 1R3TA 4W9TA 7TIMA 1PCWA 4BA0A 2VC5A 3EB4A 1JYNA 2Q01A 5HOSA 5D02A 4JIEA 1DTNA 3QTGA 4LVDA 1TIMA 3WNMA 1SZNA 3MO7A 5DANA 4DPPA 1ICSA 3STGA 4X2PA 3GVQA 4X9SA 4S3KA 5CZ0A 3WBEA 3LCHA 4GYPA 2WJDA 4MZ8A 1UMYA 5EA9A 1I9CB 3AXXA 5FJIA 3JS3A 2MUCA 1PEZA 1EWDA 3LTPA 2RHGA 1CB7B 4JTTA 3VDGA 3UY8A 1ZCOA 1SZEA 3OODA 4PODA 2OSXA 1LL6A 2Y24A 4FX6M 1EXBA 3N3MA 6TAAA 1NM9A 2GYIA 2PWFA 3NSNA 3TYZA 1JULA 3KM8A 2OLHA 5C71A 4DXKA 2CPUA 3F2CA 1EOKA 1V3MA 4BS0A 1WQ5A 2W9MA 3W1NA 1JQXA 2EPHA 1GWJA 5CG0A 1TPUA 1L8PA 2ZTKA 2OCZA 4X61A 4MSSA 1Q6CA 2AQOA 2CLFA 4HP5A 2OLSA 3DFTA 5DMNA 4MMWA 5EMLA 4I7VA 3TR9A 3OIXA 1MMFA 1DIEA 1HKWA 1Q8AA 1EH9A 3L2LA 1XCXA 1UPPA 5FF3A 2OKTA 1N8FA 3VXGA 4CU8A 3AIBA 1UKSA 1PE1A 1E6SM 4LAOA 2W63A 5BWAA 1HUVA 3GXNA 3BMWA 4JQAA 4YVPA 2VENA 1I60A 2V30A 1H4PA 4XUYA 5H8MA 4HOXA 1U83A 2CLKA 2QS8A 3HF3A 2P76A 2YL9A 1QOQA 4EAYA 1QPNA 4ZMGA 2FTYA 3AO0A 3PZUA 2G4JA 2J7CA 1E15A 3CB3A 3GXIA 3KW3A 5CPSA 4ADSA 1DQUA 1OABA 4GY7A 1YMYA 3DG7A 3BXWA 1R87A 4L6OA 4FEZA 4EIVA 4YTSA 5IFPA 1RY0A 3HOJA 2DT2A 3VNKA 4AD2A 3FEMA 5U4NA 1JR1A 3VE9A 1V03A 1H1NA 4O1FA 1NWUA 1VFOA 5RUBA 1OB0A 3FA5A 1A49A 1KB3A 1HJXA 3EXTA 2VZTA 4QFUA 3RK8A 1PVNA 1BXNA 3SY5A 1QATA 3T2OA 4Z08A 2WHLA 4ZXOA 2H90A 4CQ8A 1CXEA 1WBHA 2VX4A 1ISZA 3TQPA 4IICA 4ACZA 1JI1A 3B4YA 3WQ4A 3VNLA 1QWGA 4DNHA 2CWNA 2HPMA 1IIHA 3CWOX 4IM4A 2O4MA 4JTDA 5AC7A 4LUTB 2Z2AA 3GH5A 3BE7A 5AZ1A 1M65A 4GVGA 1W9BM 4OECA 3NO5A 2J27A 4W88A 5ABHA 4WY0A 4W8LA 1ICQA 4IGNA 1JPDX 4ZB0A 2DZPA 2B7OA 2Q6ZA 3GYEA 4FB7A 3STPA 4GYKA 4Z2JA 3BLLA 3IWPA 4M3PA 2BHYA 1FOBA 3IVSA 2OR2A 3TW7A 4JFSA 3GNOA 4LPCA 1WZMA 1G6CA 4MF4A 3R0UA 3W73A 5EMYA 5E93A 1V6XA 2IQDA 3VVGA 3UPMA 1R30A 1N2VA 1EUAA 3TTSA 2CXGA 2AKMA 2XSXA 2FHFA 4RCXA 4TMBA 2PS2A 4NILA 2JF6A 3MC5A 4IIBA 4GQGA 5LA0A 3OHIA 4GO8A 3GU1A 2PDXA 3IUDA 3LCWA 3UYCA 4QG9A 3PUGA 1X1OA 1JVNA 2YL8A 3IARA 3S9YA 3HFTA 1O6IA 3K8KA 1XKYA 1Z44A 3A64A 5AHIA 1JFXA 3TW9A 4A3QA 5A8PA 4KWVA 3ZXWA 1AA1B 1NP0A 1QI5A 6PTDA 4WEVX 4H9XA 4MB5A 2PLCA 3EWBX 3W6MA 4FI4A 1C93A 3MHFA 3EMCA 2G8ZA 3MYPA 4C6DA 4LRSA 3VCCA 2QMKA 5I79A 3B0UX 4OQVA 5D9NA 2BVWA 3AU6A 1KLZA 4WZHA 3ZWTA 2PSNA 3BV4A 1S3TC 2ISDA 1MVYA 2G0WA 4KW2A 3VGGA 1E72M 1F7BA 3P61A 4KETA 1VLIA 2C71A 1E55A 3QQWA 4DJFC 3M0LA 4Q8VA 3I68A 6ALDA 1SUXA 3MTWA 3DG3A 5D38A 1JQVA 2XM1A 1B5TA 4DUWA 4ASTA 1SR0A 3HMCA 4EPDC 4UFLA 4H1ZA 3BAYA 3LCFA 1QHPA 3W2MA 2XH2A 4W86A 4JNZA 2EXOA 1OT2A 1Q6LA 4H8HA 1Z41A 4DUVA 4GA8A 2VR5A 3IIPA 4JKLA 3CH0A 1LOSA 2DFAA 2PLJA 1Q6QA 1P1MA 2ZKMX 3NL6A 3LU2A 4F3HA 1RP9A 5ABFB 2GOKA 4B3LA 4P61A 3L4VA 3ERPA 3ME3A 5DX7A 1M6JA 3R13A 5IOBA 2J79A 2YW4A 3CS2A 5FL1A 3ZYZA 5D2XA 3Q37A 1J0IA 4WOZA 1K7XA 1Y5XA 3RLVA 2Y7DA 3TZNA 1Q85A 3TC3A 3TFCA 3IANA 1JCXA 4NAFB 1LDCA 1YXDA 3MMTA 2ABBA 4PB3A 5D9OA 1K70A 2Y4SA 2I1OA 5MKGB 4IMDA 3LTYA 1HX0A 1NF0A 2PAJA 2EQDA 3PJWA 4GYPC 4MY8A 3DFNA 3CM4A 1RA5A 1TQJA 5H6HA 4A3RA 4GYJA 2Y70A 4R34A 3L21A 1SSDA 3LPFA 1V3KA 3QC0A 4KGJA 1U22A 2QF7A 1HL2A 3F4CA 1YW1A 3M0KA 1KV5A 4F9JA 3SFKA 1AW5A 3IS4A 1YHTA 4C5ZA 1S5TA 3ZVHA 4X9YA 5D9PA 2I14A 4HHPA 2YCEA 4V33A 2ALDA 5BROA 3UCCA 4ICNA 3BICA 4M6UA 1I0DA 3H2AA 1IXNA 1TIWA 3WZ0E 1B3YA 1EJSC 3WDPP 2P1FA 2HBVA 2ZUTA 4NZFA 3S4TA 3SCWA 1J5TA 4QQ3A 1EEXA 2ZZ6A 1EGVA 3C61A 3KZSA 4L4PA 2WM1A 4XSLA 5J04A 2PF8A 1RV8A 2ANUA 2XN0A 2TSYA 3G24A 3N6HA 4CNUA 2R1KA 4UNKA 4ZB5A 1YEYA 4JNMA 1SZGA 1MSSA 2BV9A 1KR1A 2HSAA 4W8AA 3SCTA 2NT1A 4GKLA 2PWDA 1ZU8A 2VO5A 2OYMA 3CIXA 4E4UA 2CERA 5EMKA 2FIQA 4E8DA 1MEHA 3N2MA 2C1HA 1FWSA 2PD9A 2HTMA 4D71A 8RUCA 4LB4A 3U7VA 4RJEA 3A23A 4Y90A 4RDYA 3I65A 4QEHA 4Q4MA 3HPSA 5FEXA 1MZHA 4AW7A 1IXPA 3KVLA 2V3EA 3VNIA 4A8NA 1M1BA 3ITCA 3TC7A 1O5KA 3WY1A 1X6UA 2DZXA 2BASA 1OG6A 1SO4A 3ITYA 3VCNA 5A6SA 3DBNA 3WQCA 3PAJA 3UCQA 1E51A 3D3AA 3BCJA 4NL1A 4RNFA 2NZLA 1W5QA 2XINA 3O05A 3KOXA 2EAWA 4C1NA 4RZBA 2WHJA 4NKCA 1UR3M 1XDMA 3H55A 4DLFA 4MZYA 3KZPA 2WMJA 4CQAA 3GIYA 1PTGA 4AD0A 4GOAA 4O10A 3P3BA 3L5MA 5SWUA 2XWEA 4ZFCA 5HQMA 4HZ8A 3NZPA 4C7FA 4B5TA 4GXPA 1XIFA 1AH0A 3GKFA 3ZT5A 3MKCA 4EOUA 5FI8A 3HGOA 2HRWA 4P2VA 4ZQCA 3GTIA 2QCCA 3STEA 9RUBA 3LEPA 3T1GA 5C9WA 4L64A 3DFPA 4GE8A 1V7YA 4EXAA 3KP0A 3DUGA 4CD6A 1ONWA 4KH2A 1QJWA 2VEMA 4LUIA 4JYEA 4UMBA 4ROQA 2JKEA 3AS2A 1R47A 1QNOA 1DHKA 2D73A 3VM7A 5C9UA 3ECQA 5REQA 4LT9A 1JDCA 1OFBA 2X8RA 3VU2A 3MUAA 3WJXA 4M24A 3VOJA 2YW3A 4J2MA 3D5HA 4UCFA 1TTIA 4RE4A 3ABXA 5DXXA 2Q71A 1ADOA 1SZRA 5CEWA 1K02A 2FGLA 1EP1A 5CSYA 1NDWA 4B5XA 1EOMA 3ITOA 5TD4A 3OPSA 4LAUA 2WWCA 1C7SA 4AD3A 3CPRA 3CH9A 2HVOA 2FPVA 3OVGA 2I5QA 1BWVA 2G41A 4U5IA 4LCQA 1RCXB 2QCNA 3AFBA 4HN8A 4WGXA 5AY7A 4MB3A 4DO6A 1WUFA 4AY8A 4DBEA 1OADA 2EG8A 4Q32A 1NFPA 4JHMA 1LUCA 3U0HA 1S2AA 4C6IA 3UEQA 3OBAA 3TSDA 4IIEA 2BVDA 3TA9A 4ZTYA 4ECLA 4B4HA 5CC7A 3IV3A 3ONBA 2V2CA 2YOCA 1JRCA 5BZAA 3FYPA 1NEYA 3OZMA 1IXQA 4KCUA 1E56A 1E73M 3PC0A 2VZUA 2HK1A 2YXGA 5EBAA 4DJDD 2OLAA 2ONEA 2ZFAA 4HNOA 1F5ZA 3LD5A 1A5MC 3NZQA 1DWFM 4Z0SA 3VIPA 3VKCA 1FVPA 5M03A 3PG9A 1RD5A 3CMGA 4MOZA 1KXVA 1XYFA 3B8UA 3PTKA 3IJ8A 4MKSA 1T96A 1IT0A 3U4FA 4ICCX 1J6PA 2X2YA 4NAEA 1TVLA 1J11A 3I6RA 3NXFA 3DFSA 2QPXA 2EPMX 4LUJA 5HULA 4P7QA 4GYFA 2VTFA 2WC3A 1TZ7A 4O1EA 3M0YA 3OZOA 1KXHA 2WVSA 4H8VA 3P67A 3N73A 1JAEA 3C8NA 1PJ9A 1WDPA 3OBEA 1GOIA 1YTDA 1RQBA 2ZXQA 3DXIA 4HOZA 1E1EA 1GVEA 2B81A 1HGYA 1W2PA 5HNUA 3OOQA 1XIGA 1FCBA 3BDKA 3W24A 3DERA 3L5AA 4L9ZA 1IR1A 3D0CA 1SW0A 3JZUA 3WLNA 3TFXA 3QGKC 1I6NA 4JGDA 4O1AA 3EOOA 4JOMA 3B06A 1H5VA 3LI0A 2QUMA 3ID7A 5C55A 2P88A 4DXXA 3AHTA 1GNXA 1SMAA 3UPWA 2WZTA 2YL6A 2P8CA 4IFKB 3VM5A 3M1ZA 4WR3A 1V51A 4W5ZA 4IJBA 1BF6A 3S2MA 1CCWB 2R82A 4XAPA 3TVAA 1UBPC 1JF6A 2VURA 1O5XA 1RBLA 3WQFA 4KWUA 5FJJA 3G6LA 3EB3A 4MIMA 5K2ZA 2IUZA 1OGGA 2V3GA 3EX6A 2X7WA 1KM3A 4DLMA 4UFKA 1GG0A 1CXHA 3B03A 1P6WA 1BGGA 4TTUA 3WH7A 2QJGA 3QM3A 5AC6A 1JPMA 4RK8A 3FXGA 1K1DA 1P48A 3A9IA 4LNCA 3QMSA 3N17A 2X1SA 2QCFA 3VKDA 1RVKA 2D3NA 3N2OA 2QZRA 4M19A 2PDNA 1R5YA 4BY3A 2E0PA 3N9KA 1TO3A 4KFNA 2V3FA 1ELSA 2V5DA 3CTLA 4GQQA 1ME7A 3VABA 1CGTA 1M04A 3B8SA 2CBVA 1PKLA 1F4AA 2ATSA 3F4DA 2XIJA 3TE9A 1S5WA 3L0GA 1IT7A 3N6JA 2FHCA 1YIXA 2YCKX 4PMYA 5EMMA 3TJIA 4Y6GA 3E9AA 5M2FX 4HMDA 1SGJA 4N6EA 3PZVA 4DJEA 1E5NA 4LS1A 4Q8UA 2WLYA 3GTXA 5EYWA 5G4HC 2ISWA 2IXUA 2A6LA 1ZAIA 3ENLA 4AD1A 3BOXA 3S2CA 3SIMA 1JDFA 3UXAA 5C54A 4NI8A 1J8VA 3HG4A 2RAGA 2WBKA 4TQTA 4MKVA 3AYRA 5KETA 1EXPA 3MCMA 1QBAA 3QW4B 1EL3A 3PB0A 4B16A 3KVKA 1A3WA 1P7TA 3OVPA 1UQZA 1H1ZA 2C6QA 3TXZA 1GVSA 3UA3A 4U10A 3ARPA 3A4XA 1XLLA 1O1HA 4OV4A 4AZ5A 4PSPA 2Q8ZA 2D2JA 2POTA 2GUBA 1ITUA 3W88A 2GK1A 3USZA 2E9LA 2VYOA 3KVMA 4CN6A 2XIMA 1I2NA 3C6CA 1XYAA 1W37A 3QKZA 1LQAA 3LENA 1XLBA 1QI4A 4IIFA 5CPOA 4J3UA 1K4GA 1G7VA 1R3RA 3DH7A 4NJKA 3LPGA 3W6LA 2RGMA 1UH3A 4RZ5A 4KCTA 2BB0A 1W2VA 3FW6A 3IUIA 3AUOA 1HKKA 4LYRA 1LORA 2BS9A 3S6DA 1BVZA 3S47A 2OEJA 2PTXA 3DGRA 3M47A 5DQPA 1Q6EA 3I7QA 3L5LA 2I7GA 1F9CA 3F1QA 3BSHA 3W2LA 1XYBA 1OINA 1BHGA 2E1DA 1KCLA 2RDWA 3AIUA 4CCDA 3HIJA 2QT3A 1E43A 1KFWA 5CZTA 3H12A 3STCA 3KL3A 4GGBA 1ZJBA 2AQWA 1BXCA 3C52A 1XRTA 3T8QA 2PP1A 3PZQA 4Q4OA 2EPOA 1HT6A 4N2YA 2A7NA 3BGJA 5BXTA 4CVWA 3CHCA 3P0XA 1H51A 5DFAA 3G1SA 2OO6A 4BHYA 4US6A 1E3XA 3IJ6A 5F1UA 1WKEA 3GR4A 4D2JA 3DU0A 3V7PA 3VIJA 1H7OA 4EWJA 3FJ6A 2FH8A 3M64A 1DEDA 3AJ7A 1JUEA 3MS8A 2UV8G 2GVYA 2XSAA 3PSWA 4ATLA 1ZSXA 4K7VA 4AYGA 1YPFA 3FX4A 3VD4A 1XV8A 5B80A 3AXKA 2W92A 4AB4A 4LF1A 1T7LA 3NPXA 4C6QA 3AHVA 3GG1A 3QC3A 4PB4A 4LVFA 1HKJA 4CD5A 2OEKA 4Y9PA 4Q8OA 3BLDA 1UWAA 3KE0A 3NDZA 1KR0A 1BQGA 3H24A 1JFHA 3PZ9A 4ALDA 2W27A 1QCWA 4AWUA 1RQHA 3L67A 1M01A 4RXGA 2C8NA 3GR8A 1SQ7A 4LOCA 2DIKA 2WB5A 3FYYA 2GUYA 4RW3A 2X09A 1JDEA 3JZEA 3S0CA 1OWQA 3GHTA 3P6LA 3HJEA 4JTKA 3W3OA 1VJSA 1R2TA 2QCGA 2QMJA 3CEPA 3CGTA 4O1BA 4ZQMA 4D6EA 3CAVA 3ZJ7A 4UTJA 3B4UA 5C9ZA 3A5FA 5BXRA 4NNBA 3T0CA 4ZQNA 2WSPA 3W02A 3CZJA 3V1HA 4O1DA 4E3TA 1ZP4A 3G3DA 4LAZA 3PZNA 2VJXA 3N12A 3N4AA 2AOSA 4NHVA 3NL5A 4B91A 3AICA 1AODA 4WX2A 4JFUA 3KRUA 4DBSA 4ZA0A 1W9VA 5D8ZA 3HB9A 3WD2A 3E49A 4E6MA 4LTSA 1KRMA 1H2JA 3OB8A 4FP1A 3RITA 3BOLA 4I9TA 3W85A 1TR9A 2YIHA 1LZOA 1UC5A 1F3TA 4A35A 2DT3A 3EKLA 2CU0A 4K1GA 4AD4A 4D1JA 3K5XA 1JZ8A 1HW6A 4S3FA 3AAMA 4P7NA 5AOUA 1S1RA 4O16A 3EX4A 2B7PA 4PCFA 2YXXA 2I9UA 4M7SA 4J3WA 3U8GA 1X98A 3WDQA 2F8QA 1YDNA 5LXEA 1A5KC 2JK2A 4MM1A 2X05A 1WZAA 3HGRA 4HYVA 3PWGA 4WUIA 3K1DA 1SJAA 3LA4A 2VX7A 2FTWA 1FCUA 2ZXBA 3APTA 3G18A 2VM8A 5I06A 1UR9A 4TIMA 2DEPA 3QR0A 2IQ0A 1A5AA 4FPSA 3QY7A 4H41A 1QOPA 2WVTA 1GOWA 1RUSA 1OYAA 1W56A 2J9ZA 3LCXA 2OQHA 2ZQ0A 3VX1A 4AIBA 2R9RA 1DL3A 3PUOA 4E3VA 3W0KA 3A13A 1AW1A 4M81A 5E5CA 1H0GA 2YFOA 1C7TA 1PYFA 4BWLC 3H4GA 4L7ZA 3FVDA 2PU0A 3AMCA 2NSOA 1JXJA 2O7SA 3XINA 1OGSA 4O13A 3VUSA 2E77A 1O1ZA 1R46A 1QO5A 5HDRA 3QZ6A 2CBUA 3FJNA 3CV1A 4ZB2A 1W91A 4JTCA 3QPEA 1NFGA 4O4VA 4FNRA 2GQ9A 1G4TA 1KWKA 4UMAA 3MUZ1 4XVDA 2JIEA 2HVNA 4ZQOA 2WQPA 5J8LA 4B90A 1H63A 1Z89A 1NH6A 3GTNA 3JW7A 1GQKA 1X6LA 3WK1A 4IFOA 4KEMA 1QPKA 1VHCA 2PDQA 3UWYA 4H6RA 4MADA 3RAOA 1VD6A 2J8TA 1XSKA 4HPJA 3W7GA 4G5DA 2BXZA 1PXGA 3WQWA 1W1B1 3BV7A 1OZQA 4HMCA 4AXKA 1VGAA 1E9IA 3B05A 3KS6A 2C14A 2RGLA 1WXZA 3G1FA 4QHRA 1WBJA 3CNYA 1GQNA 1HIZA 5BWFA 3EWYA 3RYSA 4IHCA 4NJJA 1K8CA 1ME9A 2UY4A 1J2BA 1LLZA 4D8ZA 2V8ZA 1TCDA 2IMRA 2DSZA 1TELA 3M0IA 4L9XA 1G1YA 4H7ZA 4LQ1A 1X1NA 4HA1A 2DUZA 4MLRA 4QRNA 2OODA 1F76A 3TLQA 2PDJA 3PZTA 1P5BA 3RCNA 2O92A 4OBSA 5CBBA 2BGNE 3SURA 2E8YA 4GC3A 3W53A 4HSNA 1G69A 2ZX9A 4Q8WA 1KTNA 1PX8A 2IKIA 3VKBA 2GL5A 1EPXA 5I2UA 5FF2A 1B0IA 1OIFA 3VCRA 1XQLA 3S6TA 1L6WA 1TPEA 3GDMA 3HV8A 4JL1A 1UWUA 1OD8A 1UWIA 2E40A 2WMGA 4BJHA 1JPHA 1PZ3A 3RRXA 4HNLA 2QUTA 3DI0A 3ZR5A 3WNPA 3UYIA 3ZLHA 7REQA 3EB2A 3RGTA 5K9DA 3MUCA 3UWEA 4ZZ9A 4DWSB 3IIZA 4IH3A 5A8QA 1OZMA 2OQYA 3OLIA 1J01A 2ZRVA 3BANA 5MKGA 5AN7A 3PN8A 2FPYA 4ES4A 5CXPA 1A4MA 1N8WA 4DN1A 4LS2A 4UFJA 4IZGA 2FJKA 2QAFA 1M7OA 4O54A 1LOLA 1AUSL 1KC7A 3VA8A 5T91A 1BAGA 2W5FA 3AZTA 4LH8A 2ZA3A 4XD6A 3Q2DA 2BVYA 1V8EA 2O0TA 3CHFA 1KM0A 3MW7A 3OHMB 4UTFA 1OK4A 2Z1WA 5I0DA 4HVXA 4DQWA 2NQ5A 1GOMA 2REQA 1L0PA 3TXVA 5AC5A 3SN0A 2DSUA 2VGGA 3REQB 1JDAA 4QG8A 1A0EA 3EDFA 3EBVA 4AHQA 3CMJA 1LL7A 4JDYA 1NY1A 4OTKA 4XZHA 4D6FA 3DGBA 4LC8A 2JFEX 4G9PA 3CV7A 1DWIM 3VE7A 1I2QA 3RXZA 4TX6A 3WMCA 3PJTA 4RLIA 4G2DA 3OZYA 2WAGA 3W75A 2CLIA 4HCLA 1FWNA 3WLJA 3Q67A 1OSEA 3AS3A 1OEPA 3UWUA 3R10A 1W9DM 4DZAA 3KL5A 4HHMA 2BP1A 4FXFA 1KGWA 1GW1A 2G95A 2V5KA 1V3HA 1F05A 1U5VA 5D05A 1FWJC 4M6VA 2G3JA 4XAZA 4QJ5B 3UNDA 4ZSTA 2PB1A 4HYWA 4W87A 1FH8A 3AHZA 4OGZA 2WMIB 4LEFA 2OFJA 3A9BA 1MNSA 1UROA 4OOUA 1PDZA 3FOKA 2D2OA 4BEUA 3R0DA 1S3HA 1UYQA 5I07A 4DRSA 1XICA 3TQVA 4M1BA 1G4PA 1H3GA 1QI2A 1A3HA 1BYBA 1RAKA 2V5LA 2A3EA 2QJHA 1ZBVA 4S2BA 4EE9A 5A6MA 3E6EA 3NEVA 4I5RA 4UQEA 3E12A 1P1XA 1PKYA 3RILA 3MO4A 3NQ2A 3LX9A 5LGZA 1UA7A 2CHOA 4YL2A 1PZ1A 5D04C 3PK7A 1WOBA 1WZKA 4H9YA 1LBMA 1XDLA 4QNEA 3Q65A 4C6KA 4AFYA 4GQBA 5DELA 2VWTA 4POCA 1CTNA 2CKRA 4JFVA 3CQHA 4L61A 4D6HA 3L4XA 1WE5A 4WQ6A 1OJXA 3H22A 2VCAA 1S2CA 3VKAA 2VFDA 4MJZA 4O12A 3GG0A 1JJKA 5AHEA 5AHLA 1C3FA 3NPUA 5CSRA 5F4XA 5JH2A 4HZMA 3SUTA 2QDEA 2J7DA 3VD9A 1PZ0A 4M80A 4F0SA 1F73A 2PTZA 3S2JA 3R43A 4AC1X 3AMLA 1KRAC 3U7BA 5HMDA 3V0UA 2OWWA 3PM6A 3CUFA 3LM3A 1XH0A 4D6DA 3EX3A 1H1YA 3AISA 1GZ1A 3PBWA 2VEGA 2BODX 1PSCA 1LTDA 2PDHA 2JEPA 1OX4A 2A7PA 4MYXA 3OBKA 3MUXA 3S6OA 3MA8A 2BDQA 1WP6A 1BG9A 5DF0A 3ELFA 1GYMA 4XVEA 5EB8A 4AH7A 3O2LA 1XIJA 3KP1A 2ZZ2A 1W5PA 3DIPA 1P0BA 1DIDA 3R12A 2DZWA 3P7YA 2VD8A 2E5BA 1VH7A 4O50A 4XIAA 4XAGA 1Q2RA 3KCLA 1O7AA 2QIWA 1FWEC 3GAKA 3AOFA 4GH3A 1ONRA 4UR9A 4I9AA 4GACA 1EJ7L 1IEIA 2CIPA 2IPWA 5HJYA 4NXSA 4TXEA 1A5NC 3CJPA 5EFDA 3PF3A 4WDUA 3DI1A 1HZYA 1D3CA 4JHZA 1XD0A 3L4WA 2QVNA 1ENUA 2HE8A 4K8HA 3BVJA 2AGTA 1S2VA 1F74A 3ZSSA 4NQ1A 3VC6A 3CWHA 3LG3A 1RP8A 3UZYA 1UQYA 3NM1A 4UWMA 5L9FA 1CXFA 2P3ZA 2OXNA 4YU1A 2A4AA 3NOYA 1IGSA 5DBUA 4Z42C 1TRIA 1W3IA 1KKOA 3PNUA 3LHVA 4FALA 3LDVA 4LBRA 1GJUA 1XRFA 1JD7A 4KWSA 1DJGA 3SFWA 3UP8A 5G2WA 2QUUA 3WD4A 4LNYA 2D0GA 1AL8A 3QZEA 2DT0A 3VOFA 3CLMA 4XX6A 2V69A 1HGWA 2PDUA 3SJ3A 3A3WA 4CN4A 5H8PA 3DHDA 3PSVA 1NDYA 3A3HA 3GX9A 4PZVA 3S5OA 5EY5A 1LT7A 3DX5A 2C3ZA 1PZ2A 1TWIA 1I8JA 4LF2A 2A6NA 3ABOA 4IIGA 4PBEA 3W22A 1OG0A 2ISFA 1J0YA 2YCLB 1MW0A 3N3TA 3MBFA 2DSWA 4PUDA 4E2BA 1LYXA 1VJZA 4OFCA 3IJ7A 4IG2B 4LCRA 4NZCA 1CWYA 1U33A 3H7RA 1R9ZA 5LZLA 1POJA 3GO2A 3RO6A 4G7EA 3E0LA 1T0OA 1HL9A 1JI2A 1SMDA 4C1LA 1BKSA 1N55A 3W83A 1IZJA 1XIMA 4WDTA 1TV4A 4L4LA 5LYRA 2NWSA 3EWWA 3LHWA 4MUZA 3PBYA 5TQLA 1JAKA 1XLJA 1E3ZA 1Y5VA 1AZ1A 2YA1A 3G8EA 1RR2A 5D03A 3TNBA 3BO9A 4XK2A 3MP5A 3NQ8A 3ALFA 2PRMA 1UWRA 2GGJA 1TZ9A 3VZYA 4PUNA 4RNHA 4KESA 4KFOA 1WCGA 3T09A 1JCTA 5CZSA 2EPKX 4LYKA 2ZX7A 3T7VA 1YDYA 7ENLA 4X0NA 3ZLGA 1EIBA 3GUGA 3RPTA 3T9PA 2G97A 1YE6A 3EGJA 1DJYA 3S1UA 4IFKA 4KCWA 3THQA 3SCSA 1CLKA 4Z1CA 5DMYA 3UY7A 4CNSA 3LGDA 2FVMA 4ZENA 3KCOA 3EXSA 4U33A 3NGJA 1HFBA 5H2ZA 3L4YA 4J5NA 3DYMA 5CPTA 2FJUB 1KFEA 4UTIA 2ZC8A 1FCQA 2A3CA 4CD4A 1KM4A 2IXVA 4ADUA 3NO3A 4JIIX 1ZB5A 3VI2A 2DORA 4LW7A 3VFCA 2GZXA 3NQAA 3VMPA 5JBFA 1T8XA 2OSWA 1WKYA 3TEVA 1S38A 4A22A 1E6RA 4Q6XA 3L65A 1SJCA 1XYMA 1VBJA 3UZJA 4KS0A 2DT1A 2VCCA 1GGOA 5HQLA 3G22A 2EO7A 3CAWA 2ZE0A 2DH3A 3LTSA 2VEIA 1ZHAA 1SW3A 1E1CB 2D0HA 7TAAA 4CD7A 2YXOA 3KWSA 4UR8A 4NX0A 4HNNA 4HK6A 2WMHA 3IRDA 3T55A 2J66A 1EEPA 4H9TA 3APGA 1GVOA 1AL7A 1XLCA 3U48A 1B3WA 4P8UA 2CLEA 1C92A 4LX4A 3WNLA 3AS1A 4D6JA 4C90A 3W28A 2E1WA