1ZRQA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 6.0
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
281
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGADRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 281
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zrqA00
1ZRQA 1TJ0A 3E2RA 1ZP3A 1TJ2A 1TJ1A 2FZNA 1V93A 3E2QA 1ZP4A 3E2SA 1B5TA 4JNZA 3IJDA 3FSTA 4O8AA 1TIWA 2FMNA 2FMOA 3ITGA 4JNYA 1ZPTA 2FZMA 3FSUA 3APYA 3APTA
chains in the Genus database with same CATH superfamily
1TR1A 3W7KA 3N2CA 3BJTA 1JCXA 2WVUA 3GTHA 3TZFA 4J3ZA 3LPGA 3KWXA 3UCCA 1EOMA 4Q3MA 2FFCA 2XUCA 4GQGA 3H12A 2VCBA 2GDQA 3H4WA 2ZUSA 1ISZA 2CC0A 4N9CA 5BZAA 4Q4RA 1ZS2A 2B81A 4DF0A 3L2MA 1CI1A 4AD2A 6TAAA 1B30A 2WSQA 4D6IA 2H8ZA 3NNTA 5I24A 4LYPA 1MW2A 4PMZA 4GKLA 4UNLA 2DQWA 1V6VA 2C16A 4M0XA 4N02A 4JFWA 1R7OA 4AVNA 3GUWA 1AJ2A 2Y8KA 2CYGA 1YE4A 4B5UA 3TYDA 5DN1A 2Z6JA 4DN1A 4J28A 3TW6A 3TW7A 3E2QA 2QDGA 4KH2A 2V2HA 3OQ8A 5AZ0A 2XVNA 3KOWA 4DZHA 1XLKA 2IS7A 4KESA 2QCFA 1S2CA 4TMCA 4JQ4A 4Z2HA 1A5AA 2PRHA 4NXKA 1OCNA 3W1XA 2Z27A 1A0CA 3EB3A 4HIBA 1A5BA 4HPGA 1S2VA 3MSYA 3H2OA 3S2LA 1OZQA 1BYAA 2DJXA 5MF5A 4MMWA 4Q8NA 5JIWA 1MFUA 2Z1WA 3UWYA 4NG3A 3FGCA 3LCGA 4EAMA 3BGJA 3ZLFA 2A6NA 1XXXA 4MPKA 1G5AA 2PBGA 1R2SA 2DZPA 5A8MA 4DWSA 3M4HA 1N2VA 3VFLA 2XGBA 3K1GA 2VEGA 3GG8A 1OGBA 3KTSA 4PR4A 4PRWA 3P2VA 3H2CA 3THUA 2AL2A 1YTEA 4IX2A 1F05A 1VYSX 4EAYA 3OU8A 3BZGA 1GOWA 1GPFA 2VXNA 3WNKA 3LHZA 3N2XA 3PN8A 4MWAD 3KL5A 1UOKA 2VURA 3L4ZA 4AD5A 5C2GA 1VHNA 2A7PA 3IJ8A 2OEJA 4DO5A 1SSGA 2HBXA 3QOMA 1PX4A 4IFRA 5I5RA 2JIWA 3U3HA 2W92A 4LY8A 2WMIA 5BCAA 2GQAA 1Y5VA 4ZO8A 5ECUA 2A3HA 2BP1A 2A21A 3W1TA 5FA5A 1O60A 3JRKA 3W76A 3II1A 1FKWA 3FCPA 2HVMA 2E5CA 3IARA 2WKLA 2GK1B 4LC6A 3TDFA 1GOMA 2I16A 1WA3A 3UZWA 2HROA 5I3HA 4E4PA 2D2HA 3OZOA 3U2EA 4K36A 4YPJA 2CZEA 2GJPA 3M16A 3QEZA 3VU2A 2CLKA 3WNMA 1CGUA 3UYIA 1G9HA 2I56A 4GI6A 4NAFA 3E74A 1NDWA 4IP5A 1PIIA 4AHPA 3KL3A 2QUVA 2ADAA 5E70A 5A94A 1Z69A 4QDPA 7TAAA 1GYMA 3L66A 4R53A 1G69A 3QLLA 3HG2A 3MHFA 2PDXA 2AL1A 3GH5A 1VEPA 3MUCA 1VPYA 5AY7A 1J0KA 2AKMA 2H9AA 1KM5A 1DIDA 1NWSA 1W1B1 3GXTA 3BOFA 3E0VA 6A3HA 3AMCA 4FMVA 3U2OA 1WZAA 1CGWA 5FCZA 4QR6A 3C0LA 5AZ1A 3OP2A 1O68A 4E6MA 4K7VA 3SGZA 3PB2A 4IICA 3EKLA 1UR1A 3GG0A 3N18A 2G50A 2R1NA 1X7IA 1JPMA 5A3HA 4MY9A 1W2VA 4BF5A 1W5OA 1GKQA 4OUEA 4LUIA 1ZP4A 1ONRA 2NX9A 3KVKA 3M5ZA 4W86A 3TTEA 1TIWA 2OWXA 4C6PA 3UCDA 2EPMX 3LGDA 1TPVA 3ZXWA 3SRFA 2C1GA 4H00A 1W3TA 2HCVA 2DSZA 3GNRA 3CQ0A 2YL9A 4RNIA 1GJWA 2TODA 5H91A 3GZAA 3ZT6A 2OOFA 3DHPA 3QKZA 1NOUA 3WL1A 2Y2WA 2YW4A 2BY1A 4V2XA 2DIEA 3L4YA 5A2BA 1QUMA 2WVTA 3SN4A 5C71A 1O94A 3KLKA 3L4TA 5CCZA 3VGHA 1OT1A 2NSXA 1ZTVA 1TV4A 3GR7A 4HBKA 1EP2A 2E1WA 3W88A 3I3DA 4B5VA 1ITUA 4R7WA 2ON3A 1UW9A 2Y61A 1KM2A 3C2VA 2ZVRA 3GAKA 3KS5A 4O52A 4YCPA 1G4PA 2PGWA 2JFEX 1XG3A 2JKEA 4PTWA 2O9OA 1P0DA 1H1NA 4S3BA 3G0SA 3LXCA 1B3VA 5AOUA 3LZ3A 3W29A 4A29A 4HNNA 2PRLA 4HYVA 2WB5A 5K4ZA 1RXOB 1TELA 1UJQA 2O9RA 4POCA 2QCHA 5DANA 4O1FA 4QLLA 5LNUA 4NZ1A 3BLDA 2ZIDA 1JPKA 3S5SA 1TCDA 4D2JA 3T2QA 3MDWA 1X8FA 3ECQA 1E1EA 3KAOA 1W3LA 2CBIA 1EF3A 2ISVA 9XIMA 1MSSA 4G6CA 2CCRA 1HL8A 4IXHA 3MYOA 4YVXA 3N6HA 1C7SA 4TVDA 1OFPA 4YXGA 2HK0A 2QULA 4BS0A 1OB0A 3N34A 3W24A 4DWSB 2YJQA 2V6AA 4W84A 2VWTA 3GHRA 1HL2A 3G1SA 3K13A 4FXJA 3WDJA 1QBAA 2AL2B 1WUFA 4ML4A 3STEA 2WZMA 1TPC1 3KBNA 3VKDA 1QPNA 4CQBA 3SM0A 3MMDA 4D6GA 4IMEA 3GXIA 4P5UA 2PDYA 4JHZA 3E3HA 1ZNNA 2EJAA 3NQ8A 1R47A 1XQKA 4ZQMA 2Y1HA 1FWNA 3EWCA 3GFXA 3QV6A 1KFJA 3UCQA 1Q5MA 4IHCA 2Z4GA 4HZ6A 2YBVA 3BXWA 1KGWA 1JNDA 3DFPA 4L80A 3EOLA 4BCEA 1R9ZA 2WMIB 5HK4A 1E9ZB 3MCMA 2CW6A 3QFWA 1TWSA 1XCXA 4GD0A 3TNBA 2OO0A 4OHQA 3HQNA 2WPGA 2VZUA 2FVKA 1PCKA 4XVEA 1TJ1A 2XHYA 5A69A 4AVOA 2KX9A 4QGCA 2NT0A 2HQAA 2C14A 1XLJA 6ENLA 1NQ6A 1IT8A 1DHKA 3WYZA 1U1HA 4DBSA 3CZEA 4CN4A 1MO0A 2CBUA 3O8AA 1CXHA 5HUPA 4S3FA 3NL6A 4ICNA 3WD3A 1U2YA 1MQRA 1ZAIA 4AWUA 5ENLA 1EL3A 3DFSA 5HJXA 4GXWA 5A6SA 4NAFB 1QVBA 3PTDA 3KOYA 3DFNA 4W85A 3CT7A 3FJNA 2IPJA 4WY0A 1TWZA 4PUWA 1UPMB 4BEQA 3EGJA 2GWNA 4O54A 2OVLA 4ZOCA 4CD6A 3EDFA 2AMGA 3C2OA 1SU5A 3VD7A 1OQFA 3IK4A 1KW1A 4KEZA 3U4AA 3E0LA 2PF8A 1MRAA 2WBKA 4YTTA 4UFMA 1WAWA 4M80A 5I3FA 2BS9A 3W7MA 4MUPA 1YBQB 3EXRA 3SCRA 3MWCA 3UR2A 2E40A 1PKNA 4ATWA 2NV2A 4GI8A 3RGTA 4Z17A 2B0MA 2FFIA 1NQKA 1W8SA 3RCMA 4G7EA 4J3UA 1RZMA 2XIMA 4UC5A 3IANA 4MLJA 3DI0A 4G1KA 2VD8A 4J2PA 2Y8VA 3UQNA 4M5PA 1XLBA 1PTGA 4PC8A 3GKAA 4XSLA 1FX6A 5HMDA 2W62A 1TFVA 3ZS4A 3TLLA 1LQAA 2YA0A 3CNYA 4M19A 1Q7ZA 4PSPA 1GOQA 4TX9A 1F4HA 1BXNA 3V4BA 1JULA 3RX4A 4F0SA 1TVLA 1GW1A 3KTXA 3HPZA 1ZJAA 3NXFA 3MS8A 1JUKA 4LV4A 4HPJA 4PCPA 1XSIA 3ZFHA 4B3LA 2PGRA 3B0PA 4ZO6A 3P14A 4L9ZA 4UMAA 4Q8QA 4X2PA 2ICSA 4JIIX 1O1HA 3VKKA 4ACYA 1US3A 3NIYA 4F2UA 4WUIA 1VC4A 2INFA 4CU7A 4NNBA 1DJXA 2GDVA 4ERIA 1LOLA 2VGBA 3MSGA 3VYLA 4RNFA 1LWJA 5A1AA 4FSAA 2CLOA 2WC7A 3TK7A 1HIZA 5LA0A 5JH2A 1U5VA 2C91A 2VEMA 2CXGA 4ZA0A 2BVWA 5LGZA 2UBPC 4QBXA 1UC5A 1CENA 3ABSA 5I79A 3F4WA 1R7AA 5I23A 4B90A 3PAJA 1QI5A 1VKFA 1LRTA 3CL8A 4IP4A 3EA3A 3QGVA 4Q33A 1JXJA 4XZLX 5ECVA 3GTXA 3BMXA 1PZ1A 4Z2JA 5CKSA 4FA3A 1LLOA 5HBFA 3Q37A 3W1AA 1V0KA 1Q65A 4PBGA 1I8JA 1JZ8A 3P81A 4B92A 3OODA 1JFHA 3VIMA 2Y5SA 1EIXA 2A5HA 5CZ0A 4AIUA 4MADA 3B9NA 1TJ0A 2QPXA 4WSKA 4HU8A 1FCVA 2ZUUA 2Y8UA 4FEZA 2QV5A 3LM3A 4W7VA 3L5AA 4LYRA 3MCNA 5AC4A 3CQHA 1JGMA 1JZ7A 4AD0A 2WANA 1DJIA 5AB3A 3V3WA 1FDYA 2ANUA 1BTMA 4M1BA 1TE6A 4AG0A 1W5PA 3ICJA 4UFIA 3NTYA 1JYVA 1OFDA 5KETA 2CLFA 4UR9A 3ABXA 3PNUA 4FLRA 4PULA 3L0NA 4RE2A 4QLJA 2VZOA 4NZ3A 4H9UA 1S5WA 1PDYA 1C8QA 4R5EA 2O4QA 4H9XA 4AWTA 2X7VA 1BGAA 2DSKA 3EPNA 3EMQA 5DCEA 1KBLA 3C8FA 3PPFA 3GVVA 4UTJA 1LRQA 3W2UA 3LDVA 1PCWA 1CNVA 1QNSA 2J25A 3BPWA 1PL9A 2PTZA 3WEOA 2QCCA 4XZBA 4ADTA 3RUBL 1L6SA 1J2WA 5LNSA 5E5CA 3SCOA 4RZ4A 1U30A 2IQDA 4OQVA 5GNYA 1I6NA 1KXHA 4PMVA 3V5FA 1FWAC 1B3ZA 1O12A 4GJJA 4GZIA 4Q8WA 4Y7EA 3ISIX 3IS4A 3QC0A 1W3NA 1VIWA 4IM4A 5HQMA 3Q4DA 1Q6EA 2QVHA 1G6CA 3G3DA 4RUBA 1GQNA 4QSFA 4ILSA 4AWSA 3GNOA 1FWFC 5IRPA 4BI6A 3W1NA 4GVIA 5A6BA 1W9VA 2FZNA 1KBIA 2JEPA 3MY9A 1K1DA 1E55A 2F84A 2FVMA 2XVGA 2O0TA 2VX7A 4GUJA 1AJ0A 4LGXA 4NJGA 4S3JA 3OQEA 1IZKA 5JIPA 1KGXA 4JCLA 4O50A 4L6DA 1M7PA 1S46A 4IQLA 4KW2A 4QEEA 2VUNA 1QNOA 3DERA 4X22A 1IWAA 5HULA 3QZEA 2NXGA 5LIKX 3QGKC 3FVMA 4G7EB 4EXAA 2V5CA 2PB1A 1QHZA 4EWJA 1OGGA 4ICCX 1Z42A 2CFFA 1UKTA 2GZXA 4LRTA 4O15A 1T5AA 3V35A 3IWPA 4QS5A 2B31A 1PS9A 2A6LA 1TRDA 3NO3A 4LNCA 3BSMA 3TROA 4KFNA 3WDHA 5D9NA 3GZ3A 1J4EA 2DT3A 2B7PA 4WR3A 3E49A 4GWEA 4M1RA 4AF0B 4HGXA 2G3JA 1X96A 4MFDA 1QFEA 3N2MA 1PO9A 2DT0A 3WUBA 2QJMA 1S5TA 1A5SA 1GHSA 4U4MA 1P5BA 4FLSA 4JTAA 1RCOB 3CZ8A 2VTFA 5DX7A 1JGIA 1I2OA 4GX8A 3KVJA 3CUFA 3R79A 5CZTA 2DZBA 4AWEA 2PDCA 1QU4A 3WH5A 1VGAA 2X1RA 3LENA 2MNRA 3A9IA 3S4TA 4HZ7A 4DJDC 3ZQ9A 3PBYA 2DZUA 1RY0A 3VNLA 1EBGA 1QDSA 2VCCA 1PZ3A 4M6UA 2J74A 4JNYA 4B3KA 1W8GA 5FEPA 3RLHA 1US0A 4MGGA 3CQIA 3A4WA 3DYPA 4REQB 4A8NA 2G96A 2Z2AA 2ALRA 4BI5A 3E12A 4GIYA 2EKCA 5D05A 3M5VA 1V6UA 1B5TA 3ZT7A 2WSYA 4UTTA 2YA1A 4B5NA 4GUHA 3S6DA 3TSDA 3VOFA 4D71A 2CBVA 1J0YA 2EKGA 4QTGA 5HR6A 4HKPA 4O1CA 1UR0A 4JEJA 3EOOA 1JR1A 4DJEC 3BL3A 4GYKA 1QI4A 4H19A 3DGRA 1N7KA 3O1NA 1J18A 1OK4A 1Q63A 5AFDA 4N4QA 3VX1A 1OX4A 5TIMA 3W81A 4RNHA 3TP4A 1W9DM 3NPUA 5J04A 1Q6GA 1XV8A 4DYJA 2PDGA 4AZGA 4H9YA 3G1AA 1HJXA 5E6ZA 1XYCA 2XFRA 4LY4A 1ICQA 5G1TA 3S42A 1QR7A 4GINA 4H7ZA 4Q4PA 3WD1A 5CAKA 4ADUA 2ZC1A 4C5ZA 3FVDA 3QQ1A 1VRDA 1KV5A 3L12A 1OIMA 2VZVA 3LZ5A 1TPFA 1SM9A 1K77A 3N6JA 1V3IA 1IV8A 4L4LA 5D8WA 1QRQA 1X6LA 3THDA 2GVEA 2G3IA 1KB3A 3WD2A 4KF1A 3BLOA 1BTCA 4NT0A 4V28A 2WCAA 1FWEC 4W5ZA 1YXYA 1XFCA 4C6LA 1V3HA 3AUJA 2ZZ5A 3VVGA 2JKPA 3L4XA 1EEXA 1T7LA 1G7VA 4DBEA 2XWDA 3PTMA 3N11A 4ZVJA 3QZAA 4HMCA 1W31A 2PDWA 2XIBA 4GE8A 1Z32X 5LKYA 1LL4A 1YQ2A 3W2LA 4HN4A 3S1XA 1YKWA 2QIIA 4BA0A 3LLDA 1NF7A 3O07A 4GJ1A 2A3BA 5AC7A 4S3DA 1PJ9A 4DPQA 1UYQA 4ZQOA 4JTGA 1BF6A 5E9XA 1MNSA 1F74A 4U3CA 5CAHA 1J0IA 5T9BG 5HR7A 4W87A 1FFQA 1GZJA 1XHGA 1XD1A 2VDGA 4I8YA 1W3KA 5T9CE 5EYWA 4ZO9A 2DY3A 1I2QA 4Y9NA 3PG8A 1JPHA 1PDZA 1YNQA 3GUGA 1GZGA 1LBFA 3IAQA 1E70M 4KGLA 3RRXA 2BOGX 2XTKA 5MKGA 1ZBVA 1WX0A 1DWIM 2GJRA 4K2SA 5EY5A 4YL2A 5I03A 1H2JA 2OT0A 3PC0A 2Z2UA 2J47A 3N9KA 5L6UA 4LOCA 1XLHA 4EP8C 4JHMA 2HWGA 1D7KA 1XRFA 3W23A 1NP0A 4PMRA 4H6QA 3QR0A 2FMNA 1JUEA 3N1AA 1CECA 4WKHA 4PEEA 2E68A 3AFBA 3KM8A 3NGJA 3CUZA 2YCJA 4NNCA 5EGRA 4JNZA 4ZO7A 3TN3A 4HMNA 5D2VA 2R1LA 4PL1A 2ESCA 4NKCA 3QM3A 4XAPA 2GGIA 1F3TA 1QPOA 4RL3A 4O18A 1QPQA 2Y63A 3LI0A 2QUUA 1W1IE 1EP3A 1FWDC 3LBCA 2FGZA 3VZZA 5FSEC 1QW8A 1UHVA 2BNJA 5KZDA 4AW7A 2CZVA 3W1UA 1GWJA 4ZL1A 3G0UA 1AMKA 4UOQA 3GDKA 1Q6CA 3K8KA 5DXYA 1CLXA 2Y70A 5EPDA 3HO8A 1WDDA 1PHQA 1MEIA 5F4WA 2R1KA 1RAKA 1V6WA 3TOYA 1FXPA 1ZJHA 2XSXA 4K39A 3HQ1A 3MVTA 3ZSTA 3DFYA 4PMQA 3QQ0A 1LF1A 5AHLA 3HJZA 5I7GA 1MW3A 3CPRA 4S39A 1NOFA 2REQB 3LHUA 5BU6A 1FY6A 2YBTA 3W53A 1GONA 3EX6A 2XH7A 1V8EA 1XBYA 2G3FA 3SJNA 4ADSA 1H11A 3B0VC 1X6UA 1OCBA 2O9TA 3DOPA 2YXXA 5I3IA 4PB3A 3M0YA 4V33A 1MRQA 1EJTC 1VENA 3AS2A 3VFCA 2CWNA 3CL6A 2AKZA 2C19A 4N6FA 5FOOA 5BRQA 3MI3A 4S3GA 3HPAA 2ZC8A 1OX6A 1RPXA 2PDUA 2VVSA 5L9FA 1BYBA 2F38A 2Q6ZA 1EHAA 3U57A 3PWGA 3BUVA 2BY2A 4K6AA 4H2CA 5AHEA 4A2SA 1ALDA 4BQ5A 4DB7A 3QTGA 3GDLA 1RJQA 4C6NA 3PY2A 1KV8A 3GC4A 3T0CA 4WIWA 2HVOA 1I1XA 4QHRA 1BAGA 3T4CA 2Y88A 8CGTA 5LIWX 3VD9A 3EEGA 1C8VA 1ZRQA 3SQSA 1CGXA 1OJXA 4C6QA 3XISA 3UZJA 4EANA 2XN0A 5E09A 2HEJA 2WMJA 3TW9A 1XLDA 1XC4A 4AMCA 3IJ7A 1POJA 2WQDA 2PDQA 3AIQA 2HXUA 2CEQA 3B04A 4BR1A 3ATZA 1XLMA 2RH9A 3ABQA 2GJXA 2XVKA 4U33A 1H63A 3W25A 5KEZA 1M5WA 1NY1A 1P4CA 4GIRA 3AROA 3MP5A 1YYAA 2ATSA 2I57A 3O05A 2EG8A 3W74A 1VBJA 3W1LA 1DVJA 5CG7A 2NQ9A 2QR6A 4JS3A 1J93A 3RU6A 1S1RA 4KMQA 2VEIA 2Y0FA 2A7RA 3IIPA 4O17A 4GYPC 2QXWA 3TQVA 2QCNA 1UP0A 1T96A 1W1TA 2W67A 4GJIA 2HVNA 1V93A 4HMEA 4AXNA 3CZKA 1TV3A 2ZYFA 2C7FA 1JXKA 3T6CA 3RPMA 4PZVA 5CJMA 3HB9A 3VDHA 3GHTA 5DMLA 2ZZ6A 2EPOA 2YXOA 4KCWA 3RLUA 3QLDA 2YA2A 1A3WA 1JCLA 5C5YA 3S46A 1DIEA 4UR7A 3KRZA 1IZJA 2CIPA 4IIGA 1XPGA 2ZWZA 2QJJA 5EB8A 5ABFA 3LX9A 5E0CA 3H55A 4H01A 2HPIA 2VP8A 1XLEA 3L2IA 1S3TC 1XINA 2ZX6A 4XD5A 4XIMA 2I5GA 3B97A 4KPLA 4QAIA 1TREA 5DLCA 2Y7DA 4FLOA 4W89A 1M68A 1UWSA 4F79A 1ISYA 5D2WA 2ZRUA 4FF5A 2VGFA 2WVVA 4UMBA 4FX6M 4JTTA 4EIVA 3FJ6A 4FI4A 3V5OA 1M7XA 3WJSA 2IW0A 3MKVA 2FGLA 1RCXB 1UUOA 4FNQA 3AWOA 1FQ0A 4P7RA 1H0IA 4L9XA 4FXSA 3RX2A 1ECQA 1O7AA 3W86A 2F7FA 1HO4A 4FS9A 4QROA 1A49A 3V0SA 5HNNA 1F61A 4G1NA 2F2HA 1JDDA 3OHMB 3XINA 4OE7A 3CXOA 2R1MA 3PZ9A 2NLYA 4J40A 4O0ZA 1F07A 1AJZA 3H4GA 1AQFA 5DCDA 4CVUA 1JDFA 2WLYA 3EKZA 2BODX 1AW2A 5GNXA 4PMDA 3VI2A 1L6WA 4IP7A 3FDKA 1JVNA 3KOZA 1L8NA 3VOIA 2BGQA 4FOKA 4LBRA 4D8AA 3R10A 5BMXA 3SDOA 4C1NA 2BV9A 3S6TA 1UIPA 1E1CA 3TJIA 3CHFA 4BQ4A 7REQB 1S5MA 4RDYA 2ZXQA 5D2XA 1V08A 1K9FA 1XUZA 4F9JA 1BEUA 3H7VA 5M1TA 1L2UA 4LX4A 2ISDA 2R24A 4ZOEA 3TEVA 4PBEA 2HE5A 1AUSL 2DW6A 3VNKA 4A05A 1M6JA 1UCWA 3AIRA 2EJ1A 2EPKX 1TUFA 4IIFA 3W4RA 1IXOA 4C5YA 4E3TA 5DEZA 4H04A 4C6KA 4AEFA 3BICA 1JCJA 5BXPA 3VA8A 5C7VA 4JN8A 5K9CA 1AZ1A 2YSWA 3VNMA 4MY8A 3NZ1A 3AIWA 2QCMA 2OZ3A 1QWKA 4DF1A 4CGTA 1SJDA 1TA3A 3T08A 4DYEA 3WQEA 5GJPA 4UTUA 2WQPA 3URBA 4KBXA 4TOQA 2PAJA 4D1IA 1U5HA 1ZUAX 4FP1A 3NQBA 4N7QA 4C1KA 1EO5A 5EKYA 1GPWA 3PZOA 3T44A 3GC2A 4J3SA 3U7BA 1W0MA 1MYRA 1P7TA 3B8UA 4HYWA 3VK5A 3IAPA 4O4VA 3K8MA 3QHOA 3GU2A 2VZTA 3APYA 3G77A 4I7WA 2W27A 4JTDA 3BLFA 1GTHA 4ORIA 3LERA 3WQPA 5E6YA 1XWYA 5FIPA 5D33A 2F6XA 3GYCA 3IUIA 3LSBA 1IQ8A 3W26A 3VIPA 4UQEA 1FHUA 1OEPA 1WXZA 2Z25A 2DUAA 1JIBA 3KVLA 4C6FA 2GJXB 3OBEA 3OVPA 1TB3A 2VQUA 1HP4A 3BW4A 2PODA 4GBUA 2VNCA 2Z1KA 1MW0A 5CXPA 3W28A 1D3CA 2D0HA 3IJQA 1B9BA 1BVNP 3SRHA 4UCGA 1PWLA 4K8EA 3MJMA 3UR5A 1QATA 3NDZA 2E67A 3IIOA 1XIHA 4XWUA 1Q45A 4IIEA 4W8LA 1Z89A 2AOSA 5DCBA 4IJRA 4B3ZA 5D04C 1IXQA 4C6IA 1XBZA 3AAMA 4MYXA 3OZPA 2D2JA 4W7UA 1CXEA 4DUWA 3A3HA 1R8LA 3VD5A 1BWLA 1GOIA 2ACQA 5CC7A 2FHCA 5AHMA 4KRZA 3W73A 5DY2A 2OZ8A 3D47A 1TV7A 3M0LA 5D37A 3KLLA 1IR1A 2J75A 1LUCA 4O8RA 1SO3A 3TJ4A 5D8ZA 2WBGA 1DOSA 1PWMA 1XCFA 4AAJA 5ABFB 4L1XA 3OTRA 1DORA 3UESA 1ICSA 8XIAA 1R30A 2B7OA 4L6HA 5D03A 4L4PA 4XZHA 4BQ3A 1YX1A 5A8OA 2XVPA 2P8BA 1EQCA 1Z48A 3WLJA 3NM3A 2E9LA 3PJXA 3LRLA 2WVVB 1HX0A 5CSUA 3FSTA 4BWLC 4O8AA 3TTQA 4J1OA 2PD9A 1Z9AA 1F6PA 1J6PA 2YKKA 3TYEA 1HN1A 4H9ZA 3KBMA 5BXSA 4O16A 3ARQA 4N2YA 4CD5A 1U1UA 1GQJA 1CLKA 4JKLA 4Z2LA 4QE1A 2G37A 3P0WA 1DV7A 5CH9A 4U2ZA 4IJBA 1TTQA 2CZDA 4ZSTA 3QYSA 1QTWA 4NNAA 3C2YA 1SZNA 5BOOA 3WDRA 2GQ8A 1VBUA 1Y5WA 3WFLA 3GIPA 1EZ2A 5DMNA 3WQWA 5FJUA 3UPWA 5AHFA 2D73A 4DBUA 1UH4A 2ZICA 2MANA 3VGGA 3W6MA 3NSNA 3LCFA 3AOFA 2YFNA 2FZDA 2F6KA 4NYUA 3PUEA 3MT1A 1KRMA 1OF8A 2GGJA 1XP3A 1AD4A 3W87A 4AFYA 4HJFA 2YX0A 1JI2A 4MKVA 2EBNA 4DUOA 1NIUA 3WH8A 3DFHA 1EH9A 3R94A 1B3XA 4Z2GA 3TFCA 3ZT5A 1HJVA 3TTSA 1O1ZA 4LTSA 4GH3A 2FZMA 1K4HA 2VX4A 3BG5A 1C8XA 4LVAA 1E6ZA 2QCLA 1XDLA 1ZFJA 3SCSA 3EDDA 1VFSA 2HISA 3SAZA 1AH0A 1JAEA 2ZZ1A 3VCNA 4B91A 3WMCA 1KCZA 1UWQA 2NX1A 2CU0A 2BHYA 4U3AA 5DBTA 1TWIA 5T91A 2YB1A 3PPGA 5EBUA 2ZUMA 3I3EA 3VIHA 4HB7A 1SW7A 4L61A 1NDYA 3P8IA 1CXIA 4NF7A 1FH8A 5D9MA 4PCFA 6ALDA 2WJDA 4FOUA 1IXNA 1XJBA 1P7TB 5C9UA 2YOCA 4M3PA 4C91A 2H3DA 1PSCA 3I6EA 3TQPA 6XIMA 3VTRA 1B3WA 1XRSA 5LIUX 2FHBA 3YPIA 1JRBA 3AC0A 4A6GA 4NAEA 2P0IA 1OG6A 3RU8X 1XYAA 4DJDD 3ZZ1A 3B8SA 4Y9MA 2PGFA 2E6FA 2PP0A 1DXIA 1RBAA 1DWFM 3B0YA 2DORA 1OT2A 1DJGA 4UWMA 4P2VA 1OWQA 2WXDM 3DYMA 3W37A 1ONXA 4W4QA 5BNKA 2EEXA 2VD9A 3L5LA 2NLIA 3GE7A 3ZJ7A 2GGHA 4UQDA 4RW3A 3M0MA 1NFPA 2PGEA 3RPDA 4UTFA 3P93A 5F7UA 1IEVA 2W61A 2OSYA 2BFGA 3K5XA 3EX2A 3UWZA 4JOMA 4DJED 1WYIA 1W56A 3WF2A 2HRWA 4ZE5A 2V38A 3GBEA 1VAHA 4IH3A 4JTIA 1BSIA 1SUXA 3A5VA 4GZ7A 2VFFA 3UU0A 5A8QA 1Q6DA 1XISA 3NYZA 5LA2A 4MVAA 1ITCA 2XH4A 2WMFA 3WFAA 3IUDA 3AMDA 2PEVA 1WE5A 2VT0A 1H7OA 1QAPA 1PVNA 3WX7A 1ZZMA 2Y62A 4GQRA 3SUVA 1LUCB 3NQDA 3UETA 2XSAA 6PTDA 2PWVA 4ASTA 2OEKA 4ZR8A 1XIBA 2TRSA 4DWDA 5AYIA 1XICA 3U8GA 4GGHA 2QUMA 1UMLA 1HTIA 3M0HA 2E09A 3GG7A 4JBRA 1UD5A 4M6VA 1KBBA 5FI8A 3OZMA 1V02A 3EWDA 5LNRA 2JBMA 2CLEA 1PZ0A 1W1VA 2JK2A 3BLKA 4HZMA 1G67A 5DO8A 2GVLA 2JF7A 2PCQA 3AZSA 5D30A 3TZNA 3T81A 4X61A 5HNRA 3BQ5A 1NM9A 3GU1A 1PTDA 4IPIA 3OYXA 3KWSA 3NXLA 3FX4A 4A8RA 3TCSA 3IV3A 4NXSA 3SFKA 1KRBC 3GSMA 2GDUA 3GXMA 1EC9A 3A12A 3T8QA 3QV7A 3Q58A 1F6KA 2BX7A 2Q3RA 3PZVA 1RUSA 2CBJA 2DZWA 3NQGA 2CESA 4Q4MA 2BHZA 4DBDA 1QO5A 5LZLA 2CLHA 1B3YA 1F2JA 4JEQA 5C9WA 2J66A 2QCDA 1KO0A 2WNQA 3GD6A 4GACA 3S47A 3WELA 3RCYA 3VPLA 5C9ZA 4E2OA 4MNKA 2NUWA 3OVGA 1RQEA 2PURA 2QPUA 3FY1A 4DWSC 1Z41A 1O5RA 1B9ZA 1SZEA 2E6YA 5DBUA 4TTGA 4GY0A 2CHOA 1JZ2A 2C13A 2GJLA 2D0FA 2FH6A 1FKXA 3PZMA 3ZWTA 1YNPA 3O6YX 3UERA 3TTOA 3PPCA 4A2RA 1LROA 1WV2A 7PTDA 4LB3A 3WNLA 1I2PA 3H4XA 1VZWA 2J7FA 3SSZA 3VD3A 3SUWA 4EOUA 1OFRA 1E6SM 3EX4A 4QDMA 1L2QA 3QYQA 1VFHA 5EL1A 1U1JA 4HSOA 1FCQA 1T40A 3FJ4A 4IPPA 2VEFA 1QW7A 2A3EA 5M3WA 4XSMA 3W7GA 1REQA 1EX5A 1EC7A 3VILA 3CPUA 4MSSA 3DAQA 5HOSA 1N82A 1GKPA 5E0KA 4D6JA 4XTIA 3NQMA 2VX5A 4JQ3A 2QAPA 4QNWA 4FAMA 1JZ5A 3P61A 1OFOA 4MOZA 3S1GA 2G3NA 5DXXA 2Z0IA 3N2OA 1M03A 4XX6A 1VH7A 4Y6GA 1IEQA 1VF8A 1ME9A 3NDYA 5CGQA 1ONEA 1UUMA 1ISWA 5M5DA 4Y9PA 3E5BA 4F4RA 3M0VA 3W22A 2ZRZA 4Q32A 1S2UA 2QIWA 4GFSA 1UR9A 3BAXA 4XKYB 2A85A 4OV4A 2Q3OA 2NQLA 1H62A 3SZ8A 4WDTA 1XLIA 3RIKA 4IMGA 3EA2A 1D3GA 3ABOA 3AXHA 3ITTA 4JFUA 4YHEA 4L1WA 5AYBA 3ARSA 6TIMA 3TR9A 1A0DA 1BHGA 1GQIA 1FRBA 3KOFA 2I9EA 3QQWA 3V1HA 2ZRYA 4Q8UA 3G18A 1FXQA 4MLRA 4XZIA 1NU5A 3A3WA 3W00A 1X1NA 4DF2A 5JU6A 1JUBA 4JR5A 1IGSA 5G4EA 3LS9A 3CIWA 1K8CA 3G6LA 2IMRA 1VR6A 3WCZA 4JYFA 1M7OA 2BSLA 2WMKA 3O2LA 1TE1A 3VXGA 2XGZA 4QG8A 1RY8A 1RCQA 1HFBA 5AC6A 1B57A 2POZA 3LCIA 4LBUA 2OYMA 4JFSA 2GJNA 3K8LA 3VM7A 1UC4A 2DZXA 2NV1A 1OF6A 1H7XA 4JGDA 3UZYA 4H7CA 2VFIA 1LJYA 3BOXA 1FFRA 2Z2BA 5AECA 5LYRA 3UR8A 2FTYA 1SVDA 5CBBA 2FKPA 3ZJ6A 4CD4A 3GXFA 3SW6A 3UGRA 4HZ8A 1WB0A 1WCGA 1VCFA 1D8CA 3WF3A 1ZHAA 4W8BA 3WSUA 5K4XA 4B5TA 1PV8A 4LXFA 2YIHA 4IXXA 4DM2A 3WEMA 1GUVA 4DVOA 3D6NA 2IKJA 5H8UA 1B54A 2R8WA 3S2NA 3U0HA 3WK1A 4MNLA 4KT2A 1G7UA 1PAMA 2KZHA 4HNCA 1KGUA 3CTLA 3S83A 4X0NA 3DG6A 1LBLA 4XAFA 1TQXA 5E9AA 1Q6QA 4PMXA 3R1ZA 2A3AA 1FHVA 5HQEA 4HOWA 1X97A 3KHJA 3TMLA 4KCVA 4RJEA 1J01A 1EDTA 3VCCA 2YW3A 3E0WA 1C90A 2A1YA 1KWKA 4IOTA 1VIZA 1Y65A 3M64A 4IMDA 4F2BA 4O1DA 1B4KA 3TN6A 3G8RA 1AMYA 5I09A 3AO0A 3PJWA 1BG9A 4ENLA 3UWVA 2OFJA 3WLRA 4W8AA 2ZFAA 4IPLA 3O9NA 3N73A 2ODOA 1SR0A 1DWGM 2J78A 2E6DA 2V69A 2CLPA 3K30A 2YCLA 3W2NA 2Z1XA 1E15A 2W3ZA 3QFEA 4Q7IA 1MEWA 2Z00A 1V0NA 4H6RA 4IG2B 5A8GA 2X16A 2YDRA 3O6DA 1EP1A 4KEUA 4ML9A 3CHCA 1ONWA 1AQ0A 3N9SA 4UMCA 4JIQA 3SGGA 1XIEA 1X6NA 2FDMA 1XDMA 4D9PA 2J27A 4HYRA 1LTDA 3LHYA 2NV9A 4KCTA 5EMUA 4E4FA 5CPLA 1JPDX 1WKFA 4CN6A 2D2OA 3SCNA 1KA9F 4LANA 1CXLA 4IPNB 3UYCA 3UY7A 3DHUA 4QRNA 1J79A 4Z1YA 4L56A 1DKWA 2PDNA 3KP1A 4C6DA 2WNWA 3WY1A 4NILA 1X7FA 5FF7A 4ACZA 2Z28A 3G24A 1TPUA 3CB8A 3W7PA 3NSMA 1X39A 4FLQA 3NQ6A 5CPQA 1AQHA 4J9JA 5C54A 1TO3A 4DLFA 3VIIA 3EWXA 1RQBA 1V6YA 2DZAA 4MHBA 2CETA 4JXCA 2YYUA 4X0VA 3REQA 3DG3A 3E02A 4GYFA 3ID7A 4UXDA 4LBSA 5SWUA 4Z0JA 1AQMA 3OOQA 1OYAA 3PNZA 4TQTA 2PF0A 3Q2DA 5JBDA 4DXVA 1G4SA 4FO4A 1J8VA 3ES7A 1PYMA 3PB0A 2YR1A 1LL7A 1W5QA 4MY1A 4UBPC 2GK1A 1XF0A 4WZHA 2BG5A 3QJAA 3QKEA 2XZ7A 3GXNA 1JL8A 1NSJA 1S5VA 2LLEA 2PU1A 3CWNA 2FH8A 2V5DA 1GYLA 4MB4A 4HK6A 3R4IA 3D46A 5JQ9A 3VE9A 2HSAA 1MUMA 3GNNA 3L4VA 4AZCA 5ABTA 3V0TA 2ZZ3A 4KIRA 3HN3A 4N6EA 3NOYA 3W1MA 1V51A 2Q71A 4KWSA 2ZXBA 1FTXA 5DELA 1QWGA 5CGTA 4TVCA 4GBDA 4BJHA 1E0XA 3SY1A 4AIOA 3USBA 3C4UA 1TSIA 3LYEA 3G6MA 3W07A 3SADA 2VC7A 1KFCA 4G56A 2DZVA 3B9DA 4O4WA 4DM1A 3W0KA 4FNUA 5BOFA 5CC3A 4PE8A 3BGAA 3NL2A 4US5D 3FEMA 3LXBA 2AAMA 3PM6A 3AYSA 3M0KA 3BJFA 4JPGA 3FHAA 1UWIA 1TPWA 2VENA 1R3RA 3HQPA 5C2CA 3GVWA 2WNNA 3ABZA 3C6CA 3LTSA 1DE6A 3BG9A 2FZBA 1ADSA 1ZLPA 5A6KA 4M81A 5AN7A 4FX8A 5CZKA 1TJ2A 4PTXA 4Q8VA 4YVVA 3HGJA 4J5NA 3W2MA 2GLKA 2GSHA 4M82A 4C60A 2BOFX 3BMVA 3KRUA 3MUXA 1H1ZA 2P8CA 1BFNA 2PE4A 7TIMA 3WUGA 2EG6A 5G2WA 4CU8A 3QOKA 3HBLA 4UR8A 4CEXC 2V2DA 1E6RA 1RSCA 1DHPA 3SEPA 4JTEA 2ONEA 4GIEA 3HPXA 4DRSA 1FDZA 4J7RA 3P3BA 1GEQA 3CL7A 1XIFA 4EVZA 2VKZG 3PANA 1XH0A 4YVPA 4UQBA 1XLLA 3SECA 3FAWA 1WZKA 3LV5A 4XQ6A 3RF9A 1EYEA 2YCEA 1YIXA 1ZJIA 3PUOA 1H09A 1BVWA 3R0KA 3M0ZA 4UCFA 2X05A 3CEUA 1OFBA 1E5JA 3QC3A 1WPCA 4ZE4A 4NYYA 1F3EA 3DHDA 4JTLA 2ASHA 2IQTA 3LHWA 5FF4A 2Q02A 3KBJA 1O6IA 2YDSA 1GW9A 1EGZA 3SCUA 1TMHA 1RVGA 4QE5A 4C7FA 3UXDA 2YCLB 2NWRA 3MSDA 2XDFA 1N8WA 2VI0A 3ITCA 5LSMA 4JYDA 4QE4A 5A6JA 2FLIA 1BWKA 3UJEA 1IR2A 5I77A 1SYTA 4PTNA 3VNYA 1SGJA 5F2GA 5FACA 3UXIA 1E4IA 4Z2IA 1BXBA 2RKXA 2NQZA 4O19A 4ZQNA 2ISFA 4WD0A 5EA9A 1QCWA 3HPFA 4LUYA 1KWGA 2IQ0A 3L4WA 3ZOAA 4JFVA 2DJLA 4KIEA 3A47A 1EFZA 3GS6A 4RXGA 2ISWA 3I3BA 3SUTA 3WH6A 4YYFA 1BG4A 2XIOA 3EXSA 5FL0A 1VLWA 4IIBA 5I6SA 4ACZB 4GNKB 1MWOA 3EB4A 3PTKA 4QX4A 1O5KA 5B80A 3KHDA 3UZ5A 3U4FA 4OFCA 2VX6A 3INPA 3CQKA 3L67A 3L0GA 4KCUA 2R6OA 4J3VA 2Y7FA 3GH7A 4NUWA 1ZP3A 1HVQA 1DXEA 3GTNA 4K37A 3VOGA 3REQB 2PU0A 4O57A 4LAKA 2YFOA 3H70A 1A47A 1RP9A 3EEZA 1K9TA 3FKKA 1WDWA 4H1ZA 4LAUA 3THQA 7XIMA 2QV4A 1TUXA 2R1PA 4YTQA 3GHUA 1KFLA 2FPYA 3IACA 3UW6A 2G97A 5T8GA 3IVSA 3DCPA 1VPXA 2OXNA 4S3AA 1GT8A 3O0FA 5A6AA 1S3HA 2J7HA 2ZDSA 3CZLA 4Q4KA 1JD7A 1EXBA 1LL6A 4HA0A 1SW0A 3VOHA 2J9YA 2VC5A 3TOPA 2J7GA 4R3UA 3I6TA 4NZ5A 1P43A 1UB3A 1SJBA 2RFGA 5HXMA 2A79A 2MUCA 1M04A 4AZCB 1K8XA 3TWBA 2DV0A 3QGAC 3W7LA 3N17A 2X2GA 2C79A 5CPNA 5J5DA 5CQ1A 2FZ9A 3APTA 3LTYA 3OGRA 3GNXA 2V3GA 3WLNA 4AZHA 1DE5A 3AS0A 3UA4A 5PTDA 4ROPA 3NSXA 2VDHA 5I07A 4GUGA 4QJ3B 3T8LA 4GCAA 4Y9AA 2YLAA 4M29A 3EX3A 1JI1A 1V79A 4LUSB 4UQCA 4M7SA 1A3HA 1P6BA 4H2HA 2FGBA 4XBSA 1A53A 2PTWA 2EPNA 2YL6A 1UMYA 1MEHA 1GG0A 4WEVX 1YBQA 4F0RA 1XPYA 1JF5A 4WKFA 1C3FA 4HHMA 1IT0A 3MV01 2W6RA 4JAWA 3AJ7A 2DSVA 1K7XA 3OBAA 1P6CA 1HF6A 1P48A 3AXKA 1HL9A 1B3OA 1FBAA 3WLTA 2OOGA 4LS1A 2VO5A 2R94A 3R13A 2E4TA 2C1IA 4WX2A 4E8CA 1EDGA 3E0IA 1C8YA 3M47A 1VCGA 2V3EA 1GORA 3TN5A 4AC7C 1SZRA 5FSDC 1EZWA 4UZSA 4O1BA 4MB1A 3GFYA 1V3KA 3PULA 1XD0A 2D3LA 1LCOA 3EWYA 1Z8AA 4WCJA 3MBFA 4GO8A 2PC4A 1CLVA 3H24A 3O6CA 4JTHA 5G4WA 3RITA 3LHVA 1R85A 2AQWA 2YCKX 1JDCA 2W63A 3U5UA 2ZADA 4NU7A 3S2CA 3THAA 1OD8A 2E77A 1E0UA 4TR9A 1O5XA 4UTTC 2BZNA 4TVUA 3ZR4A 2GL5A 5CBJA 3KTCA 1E6PA 4R7OA 1CTNA 4UFHA 3B9OA 3L4UA 2WVSA 1ZL1A 4RPPA 2FHFA 8XIMA 3BW2A 3AZRA 3GR4A 2BVTA 4ORMA 1ODZA 4ZTYA 2V5JA 3PHAA 1OABA 4MKSA 4HK5A 3UWEA 4K7YA 2ACUA 4C6JA 1B31A 1UR8A 3GTFA 4B5WA 2ZUNA 3QBUA 1AFSA 1OD0A 3T55A 4DX3A 1K8ZA 1G4TA 3QY8A 3UA3A 3JUGA 2ZE0A 1A5CA 1MFVA 2AGKA 7A3HA 4C7GA 3WNPA 2NVCA 1NAL1 1TTIA 3CWHA 1ISVA 3DZ1A 2X1TA 4GISA 1EBHA 3ITXA 2HK1A 3L0KA 3M9YA 2RJHA 4XD6A 3IVUA 4GQBA 4Z1CA 3IV8A 5CZSA 3W7NA 4OTKA 5BOEA 1C7TA 4RE4A 5D4YA 3R43A 1R9YA 4DI8A 3CLWA 2PWUA 1ADOA 3E5PA 3IUHA 4GKTA 3NPWA 1WZMA 2I14A 2QVNA 3MMTA 4L6OA 1R38A 3CO8A 1GOKA 4M24A 3QN3A 3G1RA 1W1YA 1IGWA 1T41A 1G01A 3AHZA 3B8IA 1VFUA 2NUXA 1I0BA 2VDIA 3URQA 4WOQA 1ADDA 1W1A1 1JCMP 4LVBA 4PUEA 1NH6A 2PUZA 2J77A 3DU0A 1F9CA 4A3YA 1K4GA 1DJZA 2Y5EA 5F1UA 4NX5A 1TPDA 4R9OA 2NQJA 2VOMA 3JW7A 1TTPA 5IBXA 4XIAA 4O11A 3KE0A 4JDYA 4E2BA 3TR2A 1VBGA 3POHA 1KXQA 1VHCA 4DWSD 1V7AA 4FR1A 4CCEA 1T6MA 2W91A 2RDUA 1Z7AA 4XZWA 4AZ6A 5FF3A 2FZ8A 3VINA 3VUPA 2O92A 3BVJA 3LQLA 1MVYA 3TQKA 5C6MA 3MI2A 1NEYA 1OK6A 5CZJA 1DQUA 1OG0A 1DPMA 2PDPA 4UQAA 4W5UA 1OC5A 5I78A 4IMAA 3L68A 1MZHA 1A5UA 4HNLA 3S6OA 1Q8AA 1JYWA 3VKAA 3NQ7A 2J9XA 3URNA 2D69A 3VABA 2D1ZA 2OQYA 5D02A 4GI9A 1EJWC 4HHPA 1UR4A 1FWTA 2I9UA 3KZPA 1YEYA 3VOCA 2V81A 1WQ5A 2TPSA 3R11A 3TYCA 1KTCA 2GSEA 1YDNA 1FH9A 1WKEA 4EPBC 1UWTA 4D1JA 3QVQA 3LUTA 3OHIA 1NWUA 1Q85A 3LA4A 1YTDA 2YPIA 3QW4B 3OIXA 4NRRA 3PZIA 3W75A 5IDIA 2WKGA 2WCGA 1UPPA 1GNXA 3QPZA 3FNDA 1ZB5A 4OECA 4GO9A 3VDCA 4AIBA 2XPKA 3NO1A 1QBBA 3KRSA 3TA9A 4L64A 4Z0SA 5ABEA 1IT7A 1FCUA 5KMYA 3TC3A 5HATA 3RXZA 2A7NA 1KFBA 3GVRA 1GQKA 5J5RA 1CXKA 3BLEA 2YDAA 4BY3A 1YW1A 1WDSA 1HGWA 4LUTB 3UPMA 4H3DA 4O53A 3C3NA 3PTQA 3IJ6A 4AF0A 1V3MA 3FEQA 1RLDA 3BCDA 3B8WA 2WNZA 1YXDA 3PUGA 3M6YA 3NGFA 3M46A 4HOZA 1PKLA 1J2BA 4MWAE 3LMYA 3IGSA 1B90A 4HU0A 2WSRA 1CWYA 1XX1A 4MJMA 3B03A 2OWCA 4IGNA 2IXVA 3AIBA 2WHLA 2PD5A 2OX1A 1GGOA 4WY0F 3TV8A 3GH4A 1DJWA 3PF3A 2QGHA 2ZUVA 1ZJBA 2IPWA 3LLFA 2WYSA 4I90A 1PX8A 1FCBA 1LOSA 3NCOA 4ZBCA 1YPXA 4TV6A 1QK0A 2WCSA 4MJ2A 3ARPA 2Y89A 4I7UA 4REQA 2ZBTA 3AHVA 5GPRA 4AVFA 5FEZA 1NWTA 1EHNA 3VNIA 2WC4A 2HZGA 3VOJA 3BCJA 1UUQA 3GHSA 4PYSA 1EC8A 4K1GA 1XYMA 3BLIA 1H41A 4NI8A 1OIFA 1F76A 4DO7A 2J4GA 3B3DA 3R7MA 1QMLA 4RLIA 3JZEA 4MM1A 2ZZ4A 3F7JA 3MW7A 2C0HA 4JTKA 4AD1A 3P82A 1I2NA 3VIKA 3CZJA 8A3HA 3GK0A 4AUBA 2G4JA 3RO8A 2IKIA 3AIVA 5IHRA 5I3DA 3BTNA 4AEOA 2QKFA 4EE9A 3T9PA 1GVRA 3P7YA 4LSBA 3O06A 4F40A 3QV9A 2NT1A 2XJ7A 2HDJA 5BYWA 3GU9A 4PA8A 4C6EA 3EDJA 1NDVA 1UD3A 4TX6A 4H9MA 3QR3A 1VJSA 3WQ6A 4W88A 2PZ0A 4LCSA 4AXKA 1OYBA 1UKQA 3KDNA 3RM8A 1OVDA 1Q13A 3ENLA 5HUOA 4K3ZA 3D5HA 1KM1A 4MFEA 3G1DA 5D38A 2X0YA 3UBPC 5FJOA 1ZGDA 2OSWA 4JN6A 1NF0A 4M56A 1Y8BA 5KITA 1BQGA 1IWBA 1TR9A 3MA8A 1AD1A 2DU2A 3MDUA 4CNTA 3E2RA 1R46A 3EBVA 6REQA 2J7BA 4PCSA 2BOEX 3CASA 3DBPA 2X7WA 2DQXA 3I7QA 1W3IA 3ANUA 3AALA 3STPA 1NFGA 3S3GA 4A3RA 4DHGA 4JIEA 3DHFA 1WNOA 4ZTXA 2W5FA 2P5NA 3CHEA 4XAYA 3STFA 1GG1A 3TE9A 3E1F1 3LGEA 3C0QA 3EWBX 3TAKA 1R3QA 1BVZA 4LRSA 4H9TA 3P62A 2Y4SA 3OEXA 3GB6A 3SUUA 3FK4A 5I02A 3NWRA 4OT7A 2Y6ZA 1XIDA 9RUBA 4MDPA 2OG9A 1E51A 2PCEA 3VNZA 4UB9A 4OZOA 1EJVC 5BRPA 3QSRA 3HURA 3WK3A 3APGA 3ZR6A 2GFTA 3V36A 2PPGA 2XINA 2BDQA 3DUGA 5C7HA 5IFTA 2QMKA 3PWIA 4MYAA 4P61A 1K9DA 3E9AA 3MVIA 1Y0EA 2JEQA 3FAXA 3S8HA 4BKNA 1SO5A 3ARZA 3V7PA 1QPKA 2JGQA 3CLMA 3TC7A 5LA1A 3R0UA 3SBFA 8TIMA 1F7BA 4JNMA 2EQDA 2QDEA 2V67A 1JCTA 4MAZA 1UBPC 5HMSA 1EB3A 5AYZA 1XQLA 4LS0A 3OVQA 3W6LA 3W3OA 1SW3A 1UG6A 3N25A 1X1OA 2G95A 1PYFA 5D32A 3BARA 1UBSA 4QJ4B 4KQNA 3FA3A 4IQDA 3SSJA 1ITQA 3GXPA 3NO5A 3FSUA 1XYFA 3WLMA 3SO7A 5G4HC 4AD3A 4LC8A 1JDAA 1U5JA 5FD0A 3LM7A 2O4MA 3A4JA 3BMWA 3NM1A 3AXMA 4S3KA 3LBMA 1ZQ5A 1XYZA 2WW5A 3GY1A 5I00A 1H60A 2EXOA 3NJ3A 3LNMA 2OGJA 3KCLA 1N8FA 2OZ0A 3RO6A 2X41A 2CHNA 4O0QA 2OB3A 4MTVA 2QPSA 3TSMA 1ISXA 4F9DA 1ZBWA 1PXGA 1K7FA 2CWXA 3U5YA 4X3ZA 5T26A 2O7QA 1HT6A 3BCFA 3ME3A 3SCTA 4AZIA 4TIMA 1GOXA 1HKWA 4EPKA 3CIXA 1IIHA 1TJRA 4PB4A 1FHDA 3MUAA 3BJSA 3CS2A 1MQPA 3AISA 4I7VA 4AD4A 1K8YA 1TV8A 1BRLB 3ITGA 2GYIA 3HM7A 2DSWA 3C2EA 2TSYA 4M7TA 3R5EA 2R82A 1FWJC 2FB2A 1YDVA 3BOLA 3TUUA 2REQA 2H3BA 4PUNA 4NZFA 2Y24A 4GHRA 4YCOA 1OM0A 3WD4A 4CN1A 1LYXA 3B8DA 4AIEA 5F1VA 5FESA 5AYXA 3I10A 3LY0A 1UR2A 2YYTA 1KKOA 2BLEA 1Q8JA 1ZAHA 4HN8A 3LU2A 1O66A 2AQVA 2OQHA 5FEXA 4UFKA 5B7YA 3F5LA 4GI4A 5CLTA 3QHNA 1XLGA 1EJUC 1TV5A 2BVDA 4UUIA 4QM1A 1SMAA 4QNEA 1E6NA 4B16A 2IKHA 4HCHA 1UD8A 4V15A 4PEKA 5C2XA 1KQZA 3W83A 4Z42C 4B4FA 1Y7VA 4UOJA 3DDMA 3WLIA 3VDBA 2WZIA 1S2AA 3LCHA 1H1YA 3LCXA 3PWAA 2VMFA 3O6AA 1OFQA 1YADA 3QR1A 3FYPA 4KWOA 1XKJA 5FJRA 3WDPP 3GVGA 3PS7A 3O7UA 3R89A 4I8DA 1UP3A 3URAA 4AX6A 2E25A 3LK6A 2ZTKA 2RGLA 6REQB 4AZ7A 3ZJKA 1V03A 2PP1A 3FHQA 3CUXA 1QI2A 2ZA3A 4MIMA 3E38A 3MUZ1 1H7NA 1SFSA 3TYZA 2VRKA 8RUCA 4C6CA 1OC6A 4FZIA 4I5XA 4RCXA 3N4EA 4HT3A 3M7SA 4CNUA 1ZU8A 4I6KA 5BXRA 4GFIA 3HGSA 5I3KA 1UZ4A 4Z2KA 4C6OA 1LLWA 2J7CA 3WG6A 2YBUA 2P3EA 4HP5A 3V18A 1JRCA 1F3WA 4HNTA 3W7RA 5AC8A 5C55A 1YE6A 2RJGA 2X30A 1XFBA 4TX8A 4XAGA 1VB9A 4Q7BA 1Q3NA 1L6YA 5M17A 4MWAB 4JTCA 1A5LC 1E4LA 2P53A 4BZYA 3SN1A 4HA1A 1AA1B 1LG2A 3C0JA 5CJNA 1EJSC 1DTNA 2PZNA 2RDWA 4O14A 3T0AA 3VIOA 3ZVHB 2PBOA 1EUAA 3UJSA 5KZ6A 1EYWA 1ZCOA 1E3XA 1KLYA 3EMCA 1V7YA 4HTYA 1IEIA 5HJYA 3AU2A 1XIMA 3TYAA 4D6DA 4JHOA 5K9XA 3S2JA 1A5MC 3V0UA 1Y5XA 1JEZA 3WF0A 3TCEA 2ABAA 1QNPA 1UD4A 3A5FA 3KP0A 1RA0A 1CGYA 4PFMA 3MHUA 2P76A 3UR7A 3WJYA 4MNJA 1SQ7A 1FWGC 3B05A 3DKJA 3UNTA 3W7EA 3PUDA 1V4YA 3CQJA 1E4NA 3TYBA 4ALDA 4B5SA 4KEMA 3BAYA 3LTPA 3W72A 4JL2A 3VMOA 3DC0A 4Z1AA 3N13A 5AHIA 4C65A 5CC6A 1NELA 3PVFA 4ZQRA 5A6BD 3ZR5A 3T2PA 1CB2A 4PCTA 3N9RA 4R34A 1OBAA 2PP3A 3MQTA 2INZA 1PX3A 3A4AA 2IUZA 4HA3A 3MYPA 3HZ3A 5EFFA 3G3MA 4IUOA 4BK9A 5CGMA 3BDKA 1XC6A 1EOKA 4WKAA 3MV11 3I4EA 1E0VA 1GZ1A 4KWVA 3KL0A 1OGSA 4L65A 4O1EA 4QQ3A 2QUNA 3H54A 4HOXA 3OLGA 5G2HA 4UOZA 1FUYA 3CBWA 2PLCA 2PDBA 4CNOA 1ECEA 2NW0A 2YZ5A 3RAOA 4AHQA 3EMZA 1ZBCA 2Q8XA 3DGBA 1HO1A 4AMAA 5LGXA 4OIFA 2GVJA 7REQA 1DQWA 3FXGA 3A13A 3NPVA 3VKBA 3CU2A 1UZDA 4RXFA 3UEQA 3VGBA 5HMEA 4ATDA 4YS1A 3M0IA 1J9YA 3T0DA 1KFWA 4QP0A 2UY5A 3DH7A 3T78A 3MZNA 3U7VA 2NQHA 2AAAA 2F8QA 3PBMA 5CSSA 4OJYA 1EDQA 4I9MA 3OW1A 1UA3A 3ES8A 1VEMA 4FB7A 2OJPA 3UJ2A 2HJPA 4TV5A 1LORA 2CLIA 4UTWC 3BE7A 7CGTA 1LWIA 4WQ6A 3S0CA 3NUKA 1FWRA 1JZ4A 1IXPA 3QMTA 4Y8EA 2J9ZA 1V77A 3RRAA 3WD0A 3N2TA 4E0CA 4KERA 1LP6A 2G5WA 1F5ZA 2OWWA 3PR2A 4JX5A 4B9ZA 1PE1A 4J35A 4WRHA 4MG4A 3NEVA 3ALFA 2XYLA 5KZMA 4LEFA 1GOOA 4FPSA 4V1XA 3S9YA 3B40A 3HG5A 3WQ8A 3IGUA 3VMNA 2OO6A 3B9AA 1XIGA 3PAOA 4ZXOA 3IJLA 2GUBA 1GVIA 3W7OA 4TUFA 3NURA 4HNUA 1RHCA 4NHVA 4NQ1A 2XN1A 3NQFA 4HU4A 1UH3A 3BGGA 5A95A 2WSPA 1RBLA 3N3TA 1WDPA 4GK8A 3SURA 3PG9A 2ZKMX 3C5QA 4UFLA 1JG9A 4Y2WA 1YPFA 3BZJA 2XH2A 2CLMA 3WMBA 1HP5A 3CEPA 1WZLA 1M7JA 5U7SA 1KLZA 3EDEA 4HNOA 1XLFA 4LQ1A 2YCIX 1LT7A 5C9RA 1UH2A 4A22A 1Q6LA 2JALA 3P80A 1W37A 1DBTA 4ZB2A 1R2RA 3USZA 4HSNA 4F0LA 4FOJA 4JIHA 3LCWA 4F0KA 1D9EA 2NVDA 1EWEA 2UY3A 4O0KA 2EPLX 4KS0A 1W9BM 3NG3A 4LWWA 1JFXA 1QPRA 2WKJA 1UQYA 1R86A 3OIHA 5CSRA 3K1DA 3DFQA 3ZJ8A 4CD8A 2WSKA 4UNIA 3NQEA 1DEDA 3M5YA 3FGCB 4GUIA 4DUVA 1F4AA 1SO6A 2HV5A 5JMUA 3QHMA 4O12A 4FNPA 1M1BA 3L9CA 5HQLA 2OLSA 1G0CA 5IFPA 4F66A 3STGA 1RLCL 2J8TA 3N2BA 3VIJA 3GFZA 5D9OA 2NZLA 3CM4A 3NQCA 2OT1A 2VVNA 1GKRA 1G1YA 2DW7A 2OGYA 4PRRA 4A35A 1D8WA 2ZUTA 4LNYA 3SR7A 2PTXA 5A6MA 2HE8A 5E0FA 4EPDC 4N9EA 3A22A 3WUEA 3DECA 4GY7A 4Q7NA 2BXZA 1Q7MA 3AU6A 2C15A 1UIOA 3UD6A 2QZRA 4EKJA 5DY3A 4IGMA 4DO4A 1D2KA 2NWSA 1XDJA 1EKOA 2J8FA 4CVWA 4UQ9A 3THCA 2DZTA 4F0HA 2HS6A 4NI3A 4XZNX 1Q4WA 3UG8A 3M7WA 3OGSA 1ME8A 3DI1A 4RZ6A 4G7FA 2HPMA 4XUGA 4G5DA 2KAUC 3BW3A 1QNRA 2J7DA 1NFBA 1D7FA 2GVYA 2ZX7A 3OLDA 3LRKA 3PBVA 4EF8A 4LF2A 1H3GA 1HXJA 5JBFA 1W3HA 3WLSA 3NVDA 4WK9A 2FYMA 4PUJA 2Q09A 4B5XA 1LT8A 3GC5A 4GZJA 4GMEA 1DYSA 4PMOA 4J3TA 1QT1A 1XSKA 3PBGA 1WKYA 4WGHA 2H9AB 1VCVA 3UP8A 4H7VA 3UWUA 2PWDA 2EG7A 1XGDA 3M6DA 1SFJA 2BASA 4IF2A 1P6WA 5FAJA 3B8VA 4JTUA 3B0XA 4NSBA 3H7RA 2Z1BA 2G0WA 2FMOA 4E8GA 3BLLA 1CX9A 1D3HA 5GJMA 3UG4A 2NSOA 4LVFA 3VM5A 4O10A 3LEPA 3W1PA 4JTFA 4EWND 1RA5A 1EPVA 1R3TA 3BO9A 3BAWA 5GNZA 3UGVA 3TLQA 3VIGA 1E9LA 4YTSA 1KBJA 2QMJA 2PSNA 2XN2A 3GAYA 3WDIA 1IEXA 4J3XA 4U31A 4GLEA 1XBVA 3AIEA 1WBJA 3M1ZA 3KVMA 5CPTA 1QXLA 2VUYA 1GK8A 2OZTA 4URIA 2EPHA 3XIMA 2RHGA 4GY1A 4IQEA 4YYCA 1QI3A 3MKKA 2CLLA 3HGOA 2ISSA 3QSTA 2OR2A 2X0HA 1KTNA 3RG6A 2ZA1A 1FWSA 2WJZA 3GR8A 2JE8A 4L7ZA 4PUDA 1TTJA 3NZQA 3P5YA 3L7RA 3VZXA 3PJUA 3H2MA 1SJAA 3KCJA 3RK8A 1R6WA 1E72M 1K7EA 3ERPA 1ME7A 4JD4A 5JH1A 3GVQA 2Q01A 4NJHA 2V68A 2QNEA 2WC3A 4FIQA 4WVXA 5U4NA 4IPJA 5KZEA 4L1GA 1KM0A 4PFHA 4IIDA 3KXQA 2R91A 5E1QA 3MANA 4B4HA 1VFMA 3SUSA 3VGFA 1FVPA 1O95A 1HVXA 3HV9A 5G2IA 1X98A 2FPTA 4ERAA 2JQXA 4LAOA 1TPEA 3W01A 4CEUC 4HPXA 2B7QA 3WZ0E 4ZZ9A 3HMCA 1E0WA 1HNYA 5HWJA 2I17A 5ABHA 4P7LA 3UWWA 2H6RA 3Q94A 3WQFA 1UKOA 2WZTA 4GPNA 1XS2A 3R25A 3TH6A 3MJYA 3B06A 3N12A 3HOJA 4P8XA 4HSHA 4HA4A 3MP4A 3ANVA 4KWWA 3OLIA 3AMLA 5A2CA 4A3HA 3ZYZA 1BWVA 4A21A 4HCDA 1NARA 4D6FA 2VQTA 1LWHA 5JUVA 2OSXA 1XRVA 4BFAA 2VM8A 4GA8A 2VOTA 1PEZA 1PBGA 4DYKA 3ZVIA 3ITOA 3GNDA 4JKMA 3PP7A 2INEA 9XIAA 3WEZA 4Q4OA 1KTBA 1XI3A 3EXTA 3EPMA 1R2TA 3G1YA 3V75A 4JY9A 3WKZA 3T42A 2WAGA 3JZUA 2DIJA 3N3MA 1DWAM 4M51A 2X8RA 3SY5A 3KS6A 2X1IA 2WZHA 2BHUA 4KKXA 2X2YA 4GX9A 1TX2A 2DUZA 1PUDA 1WOBA 3GDTA 3J7HA 2DT2A 1H5YA 1PHWA 1XM3A 5I06A 4LW7A 4FHAA 3NZGA 3KOXA 2C8NA 3C2FA 1HW6A 3FJLA 3PZUA 4X60A 4LH8A 4AQLA 3ATYA 3S5OA 5FL1A 4I9AA 3W7IA 2WZEA 2E7FA 4EPEC 3CMGA 5XIMA 4AC1X 4E8DA 1C9WA 2GUUA 2PFHA 1WDRA 1EEPA 4Y9OA 1DIKA 1QHOA 5LNVA 2PMQA 5HNTA 4PSRA 2VFGA 3D0CA 3GYEA 1B4EA 1R3YA 3UJRA 2VR5A 1TKKA 1XUUA 2OYLA 1OZMA 3NYDA 1VBRA 3T09A 1TX0A 2FDSA 3OPSA 3RDKA 2EO7A 1N55A 1FWHC 2AMXA 4RDZA 3VUSA 5FEWA 3EZ4A 4H6KA 3TWAA 2PI6A 4FXRA 4YWSA 1ESWA 4RV8A 3SCQA 4WY0B 1XIIA 1M3UA 5CPSA 2ZA2A 4ZXLA 3ONCA 5DRIA 3AUOA 3DEQA 2GQ9A 2OKTA 1RJPA 3QRHA 4RK8A 4ZODA 1ML1A 1C9DA 4KEVA 2X40A 1YRRA 2G3MA 3QY6A 3CT2A 4LALA 4XD3A 1DL3A 5EBAA 3IPWA 4CQCA 4DO6A 1VS1A 2J7EA 1R9XA 4WF7A 2JF6A 4QFUA 1CGTA 1T0OA 4EF9A 5REQA 3SQMA 1GVFA 3T1GA 4RR4A 1X1ZA 4WJXA 1NTHA 3EA1A 1V5XA 2BBFA 2O56A 1CBGA 3WLQA 3UG3A 5HMFA 3HG3A 4XVDA 2GOKA 2HNEA 1AW1A 1P0KA 3RILA 4XO6A 1S5NA 3C3UA 3LMZA 2BY0A 1XGZA 1U22A 2QDHA 3T7VA 4HHHA 3WH7A 4HQVA 2YL5A 1W1PA 2FTPA 4JQ1A 3P6LA 3H7UA 4ZEPA 4HPHA 2QW5A 1F8MA 4J3WA 1KFEA 2PDMA 5CPMA 2WWCA 4JZ5A 3F4CA 3V5CA 1THFD 3PFMA 5TQLA 4XISA 1E9YB 3LPFA 4EK7A 3LGGA 4JN7A 1EPXA 3R58A 3M0JA 4XKYA 5HANA 4UTWA 3GKFA 1H51A 3G8EA 1J6OA 3C61A 4MB3A 5BW6A 3BURA 4A3QA 2VL4A 4DNHA 3H53A 3LCLA 4IX0A 4N9DA 4JTQA 2QLYA 1AVAA 1MI3A 5B7ZA 5DFAA 2ZXDA 4XTDA 4JX6A 3H2FA 5KINA 1LG1A 4GC4A 3W2JA 3LBOA 4K1WA 3DFTA 5K2ZA 1DJYA 2V5KA 2X1UA 4ZMGA 3VIFA 3RMEA 1HKJA 1H7PA 2XH0A 3MI6A 4PRTA 5K3VA 1OYCA 4XAZA 1NWRA 2OYKA 3CGTA 1HKVA 3SGUA 2FVLA 4ECLA 4W9TA 5TD4A 3IIZA 1H7WA 1IZCA 4H8HA 4PTDA 1WAUA 1EIBA 1FWWA 1HUVA 1EA0A 3EWUA 4ZFMA 5C70A 2DT1A 3N15A 1DQXA 3AYRA 3JR2A 3M07A 2GOUA 2ZRWA 3IJIA 1R87A 4MJZA 3CUHA 4YTRA 3ELFA 4OBRA 4QSHA 1WXJA 3LQGA 3MMWA 4PGLA 3Q67A 1FDJA 2J62A 2OKOA 2BXYA 1VLIA 3ZLHA 4CNNA 1C29A 2FPVA 1SR9A 3BG3A 3CB3A 4PMJA 1KR0A 3MO4A 3ZSSA 1MMFA 1MXDA 1Z3NA 5BMWA 1XCWA 3KEHA 4GQQA 3T4WA 4QLKA 1S39A 3N04A 3WNOA 3HFTA 2RDTA 4OGZA 2TYSA 1YMYA 1FH7A 2ZE3A 3CUGA 1I75A 3LN3A 1UWAA 2DEPA 1MDRA 3IJ9A 2G4FA 1RJRA 3WBEA 4OOUA 4OKDA 1MUWA 3OG2A 4ATLA 1ELSA 4N0RA 1J5SA 1Q6FA 3HIJA 1LQ2A 4HNVA 5FF2A 1TMLA 4DI9A 2Z1VA 3OZYA 1JCNA 4S3EA 1UASA 3P60A 4ZOAA 1EGVA 3OA3A 3OB8A 3TMQA 4PB5A 2R14A 4YN5A 4HVXA 1FHLA 2F6UA 3BANA 1DIOA 2XM2A 4AB4A 3FW6A 1ZBKA 4PCNA 1HKIA 2PLKA 3QH2A 4X63A 5D09A 1W54A 2VGIA 1TJPA 3BH4A 3TA6A 1CEOA 4V1YA 3IK2A 1IE7C 2FTWA 4EXBA 4ZQCA 3WNNA 3F2CA 4E5TA 2CZFA 2I7GA 4BQ2A 1SFLA 4Z08A 3G1HA 4D8LA 3DKLA 1RR2A 3S2MA 1FP8A 1G94A 3LXAA 3SIMA 1DP0A 1V6XA 2DSUA 3NQ2A 4RDVA 4JIRA 4Y90A 1BPLB 3NDOA 4IG2A 4PODA 3NR0A 3AS3A 1H5VA 3FDGA 4H83A 4AH7A 2Z1SA 3TIMA 2H90A 3M5XA 4H9VA 4PTVA 4CQAA 1MXSA 3VKJA 3MWAA 4IIHA 5JBEA 3P74A 4CCDA 4KRTA 1W5NA 4FNRA 1EO7A 2V5BA 4EX4A 4S38A 2G8ZA 1QOXA 3TXVA 2CERA 3W71A 1E40A 3EWZA 1VBHA 3GDMA 1JPIA 1KKRA 3TFXA 2VHLA 4LB4A 4GZEA 1XR2A 3U2ZA 3MC5A 4INFA 3I65A 3OBKA 3TX9A 4L4MA 3G5EA 3H21A 1JDEA 3QTPA 4KFOA 3CHVA 3JS3A 1GJUA 3NEHA 5CBIA 1LDCA 5EFDA 3WJWA 3PBUA 3FIGA 1YPIA 1KBKA 4DZAA 1HKMA 5REQB 3U2CA 1A0EA 4J4KA 3EWWA 4WHBA 3PBWA 2RGMA 2DVUA 4AHOA 2YZRA 1KFKA 4J27A 4MJ4A 4RX0A 3H8AA 3DC8A 3KBSA 4LYQA 3ZMRA 5IM51 4NJIA 1TQJA 2VC9A 1T99A 1XSJA 2TAAA 1XH1A 4XZMX 7ODCA 3U6WA 4O28A 2QDDA 3CIVA 2QJHA 2NXHA 3AXIA 1GHRA 3FXYA 4RPQA 3PJTA 4K68A 1EUNA 5LXEA 3H23A 3WQGA 1K6AA 3KBWA 4F0MA 3A6OA 1LM1A 3UVAA 2VGGA 1TWDA 3FS2A 1RK6A 3IRSA 3UFYA 1QO2A 1HGYA 3MU7A 3AJXA 2W4XA 1I1WA 4UTHA 3K4WA 4UIOA 3RN6A 2ZX5A 4MKNA 4S1FA 2D24A 1YDOA 1M41A 1B1YA 1L6GA 4GXMA 4H41A 3AHXA 4UTLA 1UD2A 1L9WA 2OX4A 2BTMA 3GDBA 3GX9A 3WF1A 5CSYA 2SFPA 4F8XA 3PSVA 3WLHA 1XL9A 2WHMA 4EACA 1QHPA 2C0AA 1JJKA 2OU4A 4K38A 3S5YA 3TJLA 2D3NA 3HFYA 3LRMA 1RALA 1H0GA 4BHYA 1W3JA 3UT0A 4QG6A 4LAZA 2BGNE 2VFDA 2VZSA 2UWFA 3CUJA 2XSBA 4LVDA 4DNMA 3B4UA 1TZ9A 2BVYA 5HJLA 1POKA 4XBJA 4FALA 4J2MA 3MCOA 3BLPX 3WQDA 1NJJA 3WDQA 1KNWA 4WDXA 1IIGA 4JYEA 3WLPA 3W7CA 3KCOA 4ZSUA 3UXLA 3WLLA 5I3GA 3AZTA 2YGYA 1Q66A 5M03A 4KGJA 2C3ZA 4CD7A 5BWAA 3S1UA 5J8LA 5KSWA 1CCWB 1QOPA 2POTA 4LYKA 4HU3A 1VPQA 3UZXA 3KX6A 4N9BA 3NQVA 3WLKX 2A3CA 3P84A 3ZIZA 3ZWSA 1OX4B 4NASA 4RKAA 2WHKA 2A4AA 2V2CA 3A4XA 2Y5JA 4B2DA 2YL8A 4FNTA 2PLMA 4GABA 4Y96A 1ENUA 1KD0A 5EMLA 4I9JA 4F3HA 2GQ3A 1F6YA 3VAVA 1W2PA 1UWRA 3GO2A 1XRTA 1KCKA 3R0DA 1QASA 4S23A 3S9ZA 1XLCA 2J24A 1T8XA 3CUIA 2PWHA 3O16A 3T2OA 3ZM8A 3EAUA 4IFKA 5E93A 1CW2A 3U9IA 4FIRA 4U10A 3W7QA 1F8IA 3HV8A 3S5ZA 2PWEA 4DJFC 4Q8PA 3PK7A 1OADA 1JZ6A 2X1SA 1AG1O 4GH1A 5DMYA 1WO2A 5DQPA 3S5NA 2QT3A 3K2GA 3W38A 1RH9A 3MHGA 4JL1A 3SN0A 1BLIA 2WO5A 5K7JA 5TBOA 1OFAA 3RCNA 2CNCA 2J79A 4DELA 4YLWA 5EU9A 3I68A 2XWEA 1MUCA 2EF9A 2FQIA 3KW3A 2ZRXA 2E5DA 3R8GA 4PTMA 2VEPA 1FA2A 3VO0A 3WQCA 1KRCC 1XYLA 3T0TA 3MSRA 5BROA 2ZX8A 2Z7GA 3BK0A 3QY7A 2PDFA 2PDHA 3T07A 4E2DA 1DJNA 4Q8MA 4QS6A 4AZBA 4JY8A 3SCPA 5DMMA 3ONBA 3CYJA 2PTDA 1ZPTA 2J13A 5HPCA 1I45A 1S2WA 2W0UA 3MTWA 2XIIA 1QNVA 1BSLA 1H7RA 1YHTA 1ITXA 3IGHX 5CEWA 3NFUA 3SJ3A 1VRXA 2AQOA 4QG9A 2E0PA 2Q8ZA 4S2CA 2WJFA 4PUUA 3E0FA 4R88A 2Z24A 3O0KA 4FK9A 5AVNA 2J8GA 1ICPA 3N14A 3OYZA 3G0XA 1H61A 4CKQA 5IBXC 3DESA 1K9EA 1U83A 4DZ5A 1E3ZA 3VD4A 1UZHA 5DRCA 3RR1A 4HMDA 4X9SA 3IIXA 4O13A 5MKGB 2F9RA 3GWQA 4LT9A 1BXCA 1GTEA 2VC6A 2W66A 2Q8LA 1TCMA 3SCWA 3COTA 5H6HA 4Q8OA 2JKAA 4LU0A 5G5IA 4JDBA 3EOUA 3CV1A 4OV9A 1SFTA 4DAFA 3BSGA 3CV6A 2XM1A 1GCYA 5LXXA 4P7OA 4PUMA 1A5OC 4D6HA 3E6EA 3ARWA 5LHEA 3T05A 5FKYA 3CWOX 5HAOA 3TNOA 1AZ2A 2A0NA 3EDKA 4UFJA 1ZENA 5HWMA 4KWUA 2QEZA 2V9DA 1V3JA 4UTIA 1DWJM 4XD4A 1E73M 3H22A 1R3WA 4C1LA 1FOBA 4S3CA 3BAKA 1MNZA 1OX5A 2XVLA 1SMDA 3ARTA 1M01A 1RV8A 3K46A 1E0TA 3W7HA 4OBTA 4GRSA 2ZWYA 4WDWA 4H4IA 4WLCA 4H8VA 1EJXC 5D2YA 1A50A 1A4MA 3WBWA 4K8HA 1TRIA 2DVXA 3A23A 2C6QA 1AK5A 1O5QA 3DENA 4FNSA 4OWGA 3PZGA 3ABRA 3EKGA 5A8NA 5HNUA 3BC9A 3A3XA 4HHLA 4MPQA 4KRUA 3W1QA 4NIRA 1JNEA 4GNVA 1R3VA 1UR3M 2E1DA 4LUSA 2GVGA 4M6QA 3DXIA 2VJXA 1W1ZA 2XFFA 3VNJA 3IEBA 3BV7A 1BYDA 1YTKA 3DIPA 2QQ6A 2QHAA 3KBVA 1JQXA 5A6LA 1KM3A 1RK5A 3ORWA 1CPUA 5BU9A 4NZCA 3CYVA 3BAJA 1Q4NX 2CHRA 1IYXA 1JCYA 3H2EA 2OTDA 5LIYX 3SY8A 4DJDA 4XV0A 3NL5A 4AZ5A 4R27A 1C92A 3GBDA 4CU6A 5AVHA 5C8BB 2YXGA 4B9YA 5HINA 5HPOA 2UZ9A 4HTBA 3VZYA 2P0OA 4C90A 3TC6A 2ZVIA 3CMJA 3MKCA 2XG9A 3R8HA 2ZTJA 4NL1A 1SZGA 2P1FA 2DIKA 2FIQA 4O1AA 2PWFA 1I60A 3RM4A 1DXFA 1HG3A 3HU7A 4LS2A 3AYTA 4Q6XA 3HQOA 4LEQA 1P1MA 3F4VA 1QK2A 2PDKA 4IFKB 1VJZA 4DJEA 2D2GA 3SB0A 3G1VA 1J96A 2Z6IA 3TYUA 3CTTA 3WQVA 5EMMA 4DEFA 1KM6A 3F03K 4GOAA 4PMUA 5LNWA 1MXGA 1Q7QA 1K03A 3TQ0A 3Q65A 1T8QA 4Q22A 4IQJA 3LPPA 4B2DD 4FX7A 2OEMA 3EOSA 3N19B 4BF7A 3VGEA 3AHYA 1PKYA 1B2YA 3HGRA 4NRSA 1PPIA 4I6VA 1TYGA 1GJPA 3HTWA 2DPEA 2FB3A 5JVLA 2QAFA 3E2VA 1VP5A 3M43A 1PTAA 2F61A 1V0LA 3C2RA 4YWIA 2CZ5A 4JTSA 3A9BA 5IHSA 3H2NA 4EXQA 1J5TA 4I3GA 5FJPA 3NAVA 4DPPA 1SZFA 3UXKA 4IZGA 3VC6A 4GVFA 1J0HA 5HDRA 6XIAA 3MBDA 3KRBA 5A8PA 1W9UA 2XGIA 5DF0A 3NZPA 1A5NC 4YHGA 1I0DA 3WLOA 3N6QA 2IXUA 2EAWA 1G4EA 2P10A 4QQUA 3IJDA 1CXFA 3CC1A 4GG9A 2ABBA 3POCA 1CZ1A 1V0MA 4L4OA 1FP9A 2QF8A 4JKKA 4RE3A 4IGSA 3AXXA 4PMYA 3CAVA 3TKFA 3TAOA 4YJ5A 1FWIC 4D6EA 4X2RA 4FXFA 3W02A 1V6TA 3L2LA 3AIUA 2E8YA 1CDGA 2PDIA 3U48A 1CIUA 3PZNA 2ZCGA 4RE0A 2OCZA 4DIAA 3UF9A 3S9IA 3RMJA 5BRBA 2CKRA 4QCFA 4WDUA 1TPB1 1JF6A 1TMQA 2QYGA 1YXCA 5CJ5A 3WBYA 1WXYA 3D3AA 4M8UA 2E6AA 1Z6KA 1VD6A 3G2GA 4UNKA 4H8UA 5AKQA 2EHHA 1J11A 3P8JA 4LCRA 3L21A 4OBSA 3NZRA 3C86A 2DP3A 2UY4A 1W91A 3W6YA 3VDAA 2ZRVA 1W6TA 1BD0A 2D22A 1OSEA 3AQUA 5G1YA 4MWAC 3B0UX 3QPEA 3TTYA 1JYNA 1E6QM 2V5LA 2WJEA 4DXXA 4U28A 4CNSA 1F3XA 3IIVA 5C0QA 4BI7A 4IWWA 4IMFA 4KFPA 2JIEA 1WKDA 4MF4A 5CLWA 2D0GA 4WJ8A 4UTKA 2VEKA 5JXQA 2PA6A 2OELA 1OINA 3SQLA 4CNPA 1W9PA 4P7NA 3WO8A 1VEOA 3H2AA 2Z7KA 4C1NB 4AEEA 1E1CB 1KM4A 5TF0A 1V02E 4N42A 1A5KC 2Y85A 4L5ZA 1E43A 3SCVA 3UG5A 2UY2A 2BMBA 4CQ8A 1E56A 2UV8G 2FJUB 4A8LA 1DJQA 1YLVA 3VMPA 4ZOBA 3CMFA 3CH0A 5ABGA 2YB4A 2CITA 3C8NA 2I1OA 4MB5A 3QMRA 1EA9C 3LB0A 1QI0A 3CV2A 4P8UA 3FYOA 3GW0A 3AWNA 2ZZ2A 3CV7A 1UJPA 1E6XM 3LPOA 3AI0A 2BGSA 1PKMA 4AISA 4B15A 2DVTA 1B0IA 3EOEA 3LSCA 1TA3B 4JIPA 4PL2A 1XW8A 3F4NA 1WP6A 3P5ZA 3TJXA 2C1HA 1M65A 3IGXA 5XINA 3F4DA 4QEHA 2GSJA 2TMDA 3SFWA 4MZ1A 2X09A 3FYYA 4LUTA 2C71A 2QCGA 4P7QA 4MUZA 5I3JA 1RPKA 2YLLA 2XFWA 2FJKA 4Q4QA 4H8NA 4XG1A 1XBXA 4LFYA 4ZENA 5BXTA 2PRMA 4PN2A 4CCZA 3BAIA 2PLJA 4MZYA 2WPBA 3W2KA 3WL0A 1GVYA 2VR4A 3RX3A 5A6TC 1K6WA 3PZQA 2WWDA 3WFZA 1QNQA 1KC7A 1IWPA 4M6PA 1TPH1 2OLHA 2D20A 4W7WA 1TVNA 4JQ2A 3MP3A 2DGAA 2QJNA 3WK0A 3RM9A 3CAKA 2R9RA 4LF1A 4OOZA 2CPUA 1ZAJA 7ENLA 2Y7EA 4AYGA 4DQWA 4ONVA 4GGBA 4MZ8A 2G41A 2HS8A 4Q6JA 4GIAA 1HJSA 5D9PA 1PZ2A 1SO4A 2PTYA 1VYPX 1JAKA 3FA4A 2BWGA 2AGTA 1QOQA 1BF2A 4WXYA 3QZ6A 4TO8A 3EX1A 2OQLA 1CYGA 4HCLA 4DJFA 1BGGA 1L8PA 3I7SA 3O3RA 4ZGYA 4YIWA 4WSJA 3HMJG 4WJEA 2ALDA 4LV9A 2QGYA 4I5RA 2IPFA 5LIXX 3DBNA 3DG7A 3VCRA 4E3VA 2XIQA 3OVRA 3NPXA 1SJCA 2IKGA 3ARRA 1DJHA 2ZZ7A 3JVAA 3WENA 4KETA 5A2AA 2OODA 1GVSA 1HQTA 4AYSA 5F2IA 5KTLA 4TTUA 1WBHA 1PIFA 3GRIA 2GGGA 5XIAA 2XU2A 4GQ0A 2CXEA 2DDXA 4IL0A 3LG3A 4YTUA 3NQAA 4YMZA 3WQ4A 1I9CB 3F2DA 1YDYA 4QAWA 1EJRC 4D72A 3GDRA 1UOZA 1RD5A 3QPYA 4PH6A 4E38A 4CUCA 5GQBA 4GNJA 2NQ5A 5DT5A 3NOEA 2HNHA 3HF3A 3MMUA 5IOBA 1J0JA 4GYPA 4AY8A 5H8MA 4U5KA 2O9PA 1IEWA 3GQYA 5GJNA 3WQ5A 3UNDA 1P0BA 4I9TA 4ZFCA 2GUYA 3ZLGA 4UZUA 1OFEA 1MDLA 4WXZA 3MUIA 2Z29A 1WDQA 3RR4A 3MUY1 4QJ5B 4WOZA 2GWGA 1O4UA 1UKPA 3FOKA 5IDZA 2WMHA 3QV8A 3I4KA 4DXKA 1XG4A 4P8VA 1AL8A 2PWGA 3STCA 1LZOA 3E2SA 1R5YA 3GNPA 3P0XA 2A3LA 2L5HA 4LUJA 4OVXA 3M44A 3L65A 1BQCA 1ZSXA 3L23A 2HTMA 1VFOA 5GVJA 1VFFA 3FFSA 3GM8A 2PS2A 1W32A 3SRKA 4BEUA 4YNGA 4G2DA 4A4AA 5DT7A 2V8ZA 3WN6A 4X9YA 4YU1A 1TVPA 1UP2A 2V82A 3AYVA 4MNMA 2NUYA 5K9DA 4V27A 4US6A 4QIUA 3A24A 5FJIA 4RZBA 1UD6A 5G1MA 1OHLA 1UWUA 3KZSA 3VNDA 2NX3A 3LOTA 1W5MA 3MPGA 9CGTA 1JYXA 4R33A 3VC5A 4IMCA 1J0ZA 4XZ9A 3FV9A 3ARUA 5CPOA 1MQQA 1A3XA 1BKSA 3HA1A 3IRDA 1XYBA 3DN5A 4D6CA 1FWCC 3NVTA 5AYYA 4NY2A 4WGXA 1I2RA 1TIMA 2ZUWA 3DFOA 3QW3A 4XKMA 4NZ4A 2B4GA 1DWHM 4IT1A 5EMJA 2XFYA 4CLMA 1OC7A 2E3ZA 3UZZA 4FF7A 3GXDA 1RBOB 3ITVA 1VQTA 3QMSA 2WLZA 2ACSA 5EMKA 3RJXA 3TVAA 1TWWA 1VJIA 1JD9A 1XKYA 5AC5A 1OCQA 1RP8A 4NX0A 1Q2SA 1VFTA 3S1VA 3MO7A 5H8PA 3TONA 4JQAA 2HMCA 3EB2A 2BY3A 1US2A 2E8ZA 3B8TA 3C56A 1MZRA 3VKCA 3A21A 3UY8A 4WSHA 3N4AA 1GQLA 1M53A 1N8IA 4ES4A 3BV4A 1HKKA 2I5QA 1ZALA 1NVMA 4PBFA 4ICMA 3JU2A 1DTUA 2RUSA 2WOQA 3UPBA 5MHBA 4DBWA 4F48A 3I6RA 5FJJA 4U5IA 3W7DA 4AY7A 2VELA 1K70A 4H6EA 2VYOA 1P0NA 2H8XA 4N4PA 4NAEB 3R8RA 3CHDA 3DYOA 3VDGA