1ZRQA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 6.0
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
281
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGADRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 5,10-methylenetetrahydrofolate reductase
total genus 98
structure length 281
sequence length 292
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zrqA00
3E2SA 1ZP3A 1B5TA 1V93A 2FZMA 3E2RA 2FMOA 1TIWA 4JNYA 3FSUA 4JNZA 2FZNA 4O8AA 3APTA 1TJ0A 3FSTA 3ITGA 3E2QA 1ZP4A 3APYA 1TJ2A 1TJ1A 1ZPTA 2FMNA 3IJDA 1ZRQA
chains in the Genus database with same CATH superfamily
3VC5A 2F8QA 1UD4A 2E6AA 1E6RA 2JALA 4HMNA 3ABSA 4J7RA 1VB9A 2YXXA 2G8ZA 1XLLA 3V36A 3VC6A 2A1YA 1FA2A 2DSVA 1PHWA 2E9MA 4NJKA 3MHGA 1FKWA 1XR2A 5AC6A 4JQ1A 1JD7A 1IF2A 1XFBA 3URNA 5K9DA 4PL1A 3HJEA 2QULA 4M19A 3GHSA 2HEJA 5AN7A 4CCCA 2ABBA 4XTIA 3VGGA 1H2JA 2TODA 3LZ5A 3LNPA 1G1YA 4DJFC 1FWEC 2D69A 4ATDA 5C55A 2XVLA 4M82A 5BU6A 2FZDA 3IK2A 1OFQA 4AHQA 1FH7A 4D9PA 4ZFCA 4NZ3A 3N2CA 1JYNA 4MYAA 2QCNA 1SZRA 1UUQA 4YWIA 2QMJA 4XWUA 1YTEA 1LBLA 5I3KA 2ACQA 2VYOA 1DTUA 3LCXA 4HKPA 4WRHA 4GXWA 1SJCA 4I6KA 5EMLA 3QSTA 2ZIDA 4BQ3A 1CXHA 4HNVA 2WWCA 3O0KA 4H2HA 4AD0A 4B5VA 4DX3A 1I4NA 1W1VA 5D9MA 1A5CA 3HN3A 1UD6A 4QP0A 1P6WA 1L6WA 1O5KA 4UOJA 2D0FA 3R6IA 3MKVA 3II1A 1H62A 1P48A 4KFOA 1ECEA 4GY0A 2VQTA 1XINA 3W27A 2ADAA 2DIEA 1YRRA 2W66A 4GYPA 2E5BA 4Z1CA 2E6FA 2OWXA 3OU8A 2EPLX 2GQ8A 3QY6A 5CPQA 1XCFA 3MSRA 3PZ9A 2D0HA 2AGTA 4MY9A 2IW0A 3PB2A 1DXIA 1XC6A 3IUDA 4BHYA 3CPUA 1NFGA 4PUWA 3T81A 3A12A 1GVQA 1RD5A 4UTLA 4ZE5A 2EPHA 3AJXA 3R2GA 3AC0A 3DFNA 6TIMA 3P93A 1W1IE 4DZAA 3HGOA 2WSKA 1O4UA 1F5ZA 4BEUA 4UMBA 4JIQA 4O50A 3T0AA 4ML4A 1BGAA 3KZSA 5BYWA 3W1XA 1TRDA 1ZAHA 3UVAA 1GVRA 1PIIA 3RXZA 1KCXA 3SB0A 1T0OA 3IGXA 4YLWA 3USBA 3H23A 1ITCA 5AHIA 3IUHA 3C4UA 4LY8A 3L12A 4TIMA 3FEMA 3ZM8A 2D0GA 3QLLA 4FK9A 4UQDA 1MVYA 4PMZA 2Z2BA 5HQEA 1A5NC 4NG3A 1QU4A 3K5XA 4ZQNA 5E0CA 3EXRA 4K6AA 4HCDA 3N6QA 3VNMA 3HPFA 1WB0A 3QF0A 2BY2A 4MKVA 4IIDA 2ZUSA 3VM7A 4AZBA 2VENA 3TJLA 5D02A 3NSXA 3ABQA 4JTQA 3NURA 4B15A 1FCUA 1KR0A 1RALA 1HKWA 3GVWA 3W6YA 1HF6A 2Y63A 1UR8A 3RLUA 4UTFA 2G41A 4GJJA 1T40A 1XDMA 1VLIA 1SFLA 2VM8A 1EOMA 2JF6A 2GVLA 4HNTA 5CPLA 1QW7A 1O66A 3NO5A 3VAVA 6XIAA 4P2VA 2WNQA 3NZGA 3EWCA 2VX5A 2ZX9A 3W7QA 1H7PA 3T2OA 4DBDA 2NUXA 1K8ZA 4MZ8A 3U4AA 1Q66A 3ICJA 4MKNA 3QGAC 1I2PA 3M0JA 4UQAA 3ISIX 1PYMA 3DKJA 2P53A 3PJXA 3KOZA 5CGTA 3CB3A 4HNCA 5AVNA 1G01A 3IJ7A 3LRLA 1KM2A 3DHUA 1R3TA 5J04A 3CAKA 1JUEA 3O3RA 4GX8A 1E1FA 5FJOA 5M17A 2EAWA 3CZKA 2J25A 1K7EA 1WBHA 3KZPA 1OIMA 2WHMA 1W37A 3S9YA 1V77A 1Q4NX 2CBVA 3T09A 1A5SA 3UNDA 2XVKA 1U5HA 2HBVA 2W91A 4XBKA 4KWOA 4IFKB 3BAXA 3F03K 4G7EB 4GRSA 4BR1A 2GJNA 1GHRA 5BCAA 1I0DA 1KCKA 2VDGA 1P0BA 1AZ2A 1RSCA 1YE4A 2VFFA 3P5ZA 4ASTA 4H6EA 1UROA 3APTA 3GXNA 4IHCA 3GE7A 2ZDSA 4UQ9A 4HZ6A 4K3ZA 5FOOA 3FHQA 4O1FA 7REQA 4DLFA 1VFMA 3TW6A 5F7UA 1AL8A 4RV3A 1L6GA 5GPRA 2E0PA 1J2BA 4HJWA 2HQAA 3WJZA 1HJWA 2X2YA 1QWGA 2OU4A 4ACYA 3DHPA 7TAAA 1WZLA 5AVHA 1JCLA 5G1MA 4JHZA 4D8LA 3V18A 4PUKA 1UH3A 4HU4A 3T44A 2EJ1A 2GDVA 3TONA 3WL1A 2RDUA 1R3WA 1R2RA 1M7OA 1H11A 1VFSA 4QGCA 1PKMA 3RYSA 1XIDA 3MJYA 3K30A 1S38A 3S5SA 3NA8A 4L61A 2NV9A 5A2AA 5A6BD 3P14A 2ZRYA 3LHUA 1MQQA 4FR6A 1SZGA 2VC6A 2XGBA 4AWTA 1D8CA 4HA1A 4WXZA 4PMDA 3LB0A 1E6XM 5F4SA 3USZA 1ALDA 4GKLA 1UWUA 4HA4A 3GVRA 3TNOA 2J77A 3MY9A 4F3HA 3O6AA 4GCXA 4IIEA 3IIVA 5CPSA 3WDIA 3R0DA 2PDXA 4ZTYA 1A47A 4ROPA 1XBYA 5CJ5A 2ISSA 3L67A 1Q3NA 1LLZA 5ABTA 3MU7A 3P81A 1H0GA 1BVNP 1SJBA 4Z2GA 5D33A 1Q85A 1E5NA 2G3NA 2PWVA 3R11A 3R8GA 2YA1A 1QT1A 2VOTA 5D2TA 1VRDA 3W1RA 4QE5A 4LUTB 1IT8A 2V3GA 4Q22A 4NX0A 3R7MA 2HS6A 1RVKA 4UR9A 1XQKA 4LALA 4DBEA 4K2SA 4Y8FA 5BNKA 4P8VA 3BH4A 4N9DA 1QXLA 3UYIA 1J0ZA 2QCHA 1DXEA 3SCNA 2ZA1A 4OOUA 3A5VA 1HO4A 4OJYA 1SU5A 3QZAA 4WOZA 1TV8A 3G24A 1K70A 2PPGA 3QFEA 3DGRA 4H7VA 1PZ3A 3PBUA 1ZJHA 3W7PA 3OVQA 3UWVA 4FO4A 4C1KA 1TX0A 1J01A 4GYFA 2ZC1A 4O53A 2CITA 2WZTA 5GJPA 3BOXA 4GQGA 3N29A 5A1AA 3N3TA 3ZT5A 3S6TA 2B7QA 1SFTA 3WUBA 1S3HA 3AS3A 1YPFA 1WE5A 1UG6A 3EPOA 3H4WA 4C7DA 2HBXA 1WP6A 2FH8A 3DERA 2VGFA 3I10A 1KFBA 2W6RA 3AIUA 5LA0A 2IQ0A 3OYZA 1B4EA 2JGQA 2B81A 3M0LA 5HQLA 3VA8A 1X97A 4C6LA 1ZJAA 2F2KA 1UH4A 1U1JA 2A0NA 3ZWSA 4GI6A 1NOFA 1K9FA 5D30A 4H8NA 2OT1A 2PTDA 1VP5A 2VZOA 1ISVA 4UFLA 1E3ZA 3QSRA 2R8WA 1OHLA 1LL6A 3DFSA 3KBMA 1NDWA 1OX4A 1ZAIA 1TV5A 1JI1A 3N73A 4LV4A 3H54A 3IJIA 5D9PA 2XG9A 3LM7A 3KLKA 3SY1A 1GZGA 4XISA 3LUTA 1I2NA 3GR4A 2OXNA 1X8CA 1KM0A 2WCSA 5JVLA 4MYXA 4PB4A 3JZUA 2PGFA 3AMCA 2V8ZA 3UESA 3EX3A 3KRBA 1Z41A 3COTA 7XIMA 4ZQPA 4ZODA 3AHYA 2XVPA 1G69A 3W7NA 4O4VA 1OABA 1US2A 3MHUA 3UBPC 1EEPA 3DGBA 1SJDA 2VFIA 2VC7A 4L4MA 4QBXA 4YL2A 2QZRA 4AWUA 4QROA 3ZWTA 3V35A 1C91A 4O0KA 4KCUA 3CB8A 2JIWA 4H01A 3VU2A 4FA3A 2DZXA 4YXGA 4S3FA 1HJQA 3T6CA 5AKQA 4PGLA 3I6EA 1VCFA 3EOSA 5CLTA 5C8BB 4LAMA 3WQ4A 2YZRA 2PUZA 2Z27A 1RY0A 3M64A 2PAJA 1YADA 3MVIA 4WY0F 2IXVA 3L68A 5CGQA 4TVCA 3KL5A 4XKYA 4WVXA 1E3XA 4RE3A 1QOXA 2PDCA 4DAIA 4RV8A 2ZUNA 1D3GA 2DEPA 1XBZA 1QRQA 1HUVA 5HQMA 3B9DA 2IQDA 2VC9A 1QW8A 1EQCA 4O1EA 4JEQA 3E0VA 4UNKA 1EF3A 5HOSA 1XYMA 1IEWA 2EPNA 4IMGA 1W5PA 1OK4A 3FIGA 5BMWA 1BWVA 3UZXA 1KBBA 2V3DA 2YDSA 3N2MA 2GDUA 3G1VA 2D3NA 4M6VA 4RNJA 1Y65A 3B8VA 1DHKA 1EUNA 3DX5A 3V75A 5AYXA 3NQAA 3Q37A 5PTDA 2XH2A 1MNZA 3NQVA 3UR5A 4BQ2A 5C9UA 1QI3A 4HBKA 3DBPA 1W17A 5JBFA 1XIGA 1RCOB 4FNQA 1J96A 4HGXA 1KFLA 4RZ5A 2XVGA 2G95A 1UJQA 4I9JA 3W7EA 1Q7ZA 3WBEA 1V93A 1YDOA 3W7CA 2C7FA 3NPXA 3M0IA 4PB5A 4B3ZA 2ESCA 2P1FA 4W9TA 3PTDA 4DN1A 3HA1A 5LGZA 3MS8A 2PDQA 4QG9A 1JZ6A 2Z1VA 2NVDA 4JFSA 1V3HA 4H9ZA 1K8XA 3NQ2A 1ZPTA 3ELFA 1UWQA 3RUBL 3RPDA 3W0KA 3OLIA 1CW2A 1MZRA 2BBFA 2WWDA 3VMNA 3W84A 2BZNA 1BRLA 4HU0A 1TMQA 5EFFA 1EBHA 2Y24A 1ONWA 1YXYA 1Y5VA 4ZB5A 2F6KA 4WHBA 4ZQOA 1Y5WA 3U0HA 5BZAA 4GGHA 4GZJA 5EMYA 1HGWA 3GBDA 3AUJA 3TC3A 1EH9A 1GT8A 4XSMA 3EKZA 3B05A 4RJEA 4A3YA 1DIEA 2VRJA 2DH3A 2E5CA 4TVUA 4HOZA 4J3VA 2JF7A 4TO8A 3UGVA 3QQ1A 5LGXA 4L9ZA 2Z26A 1U1HA 1YEYA 1G6CA 1N8WA 3OQ8A 4CQAA 3B4UA 4JTAA 1V6UA 2JKPA 1NP2A 3DC8A 3FV9A 1N7KA 1N8IA 3W1QA 4M7SA 2E9BA 1TTIA 2P10A 3NM1A 1OY0A 4N9BA 5XIMA 1E4LA 3ITGA 2F38A 2BTMA 4NZ5A 1G7UA 3OTRA 3BGJA 3REQA 1I8JA 1JDEA 2HPIA 4O1BA 3B0YA 4JIRA 1UKQA 3R79A 4PUUA 2DZBA 4I9AA 2JKEA 3SIMA 2X0YA 5AHMA 3D3AA 3R5EA 1KBLA 3I7RA 3TC6A 5HUOA 4DUWA 4DZ5A 1RUSA 1XUUA 5HMFA 5A2BA 1QK2A 2PMQA 3MHFA 2GSHA 1DWHM 1XYAA 1BRLB 3SCPA 3LQGA 2H3BA 3FAWA 3W2MA 2CLMA 2V2CA 2UY5A 4MB3A 1VBJA 3AIEA 3IV8A 3LERA 5DMNA 1F4HA 2YL5A 1XH2A 3CLMA 1ECQA 3GTHA 2EKGA 1H7RA 1UPPA 4XVEA 4ADUA 1P1XA 2QW5A 4KIRA 4KEVA 3B40A 5K9XA 2G3MA 4H9VA 4V1YA 4JGDA 1KM1A 2UBPC 4IQJA 4EK7A 3KTXA 3B8IA 4FNPA 4L5ZA 5G2IA 1XISA 3GM8A 2CETA 4H9TA 4NAFA 1R86A 3W24A 4E3VA 4EF9A 1VFUA 1DP0A 3HIJA 1THFD 5KITA 4YVVA 5I06A 3WEZA 5U7SA 2QXWA 4PTXA 1R38A 4LNCA 2BFGA 3H6OA 4J3SA 4M6QA 1NF0A 3G0SA 3N2TA 1UP3A 2EPKX 2I5QA 2GGJA 5HAOA 4L1GA 2OVLA 1DIDA 2WLYA 2V5KA 4R33A 3BAIA 3XIMA 1ZBWA 3C2OA 3WBWA 1XGDA 3REQB 3R8HA 1W3IA 4JX4A 5E09A 4FHAA 1XLCA 3G0UA 5DLCA 4EPKA 1N55A 1JQVA 4EVZA 3NQBA 1RPXA 5FEZA 3V5OA 3TEVA 1YTDA 1CX9A 1EDTA 3EOOA 1KKOA 4HMCA 1XLAA 5KTLA 4JQAA 4XTDA 3WFLA 1F2JA 3W1PA 2ZKMX 5M3WA 1M03A 5F4XA 2JE8A 3WN6A 1QWKA 3Q67A 4DWSB 2GSJA 2OZTA 2CEQA 2A21A 4OU1A 3RF9A 5AHFA 1UR0A 4QG8A 2XH7A 4O19A 1GONA 3Q45A 1KM4A 2D2HA 3QTGA 5ECUA 5ABFB 4WK9A 5DMMA 2CIPA 2PDNA 3RAOA 4X2RA 1RJPA 3WH8A 2NT0A 1BLIA 1ZZMA 4XZHA 2ZWZA 3MPGA 5JBEA 1XLHA 4A22A 1XV8A 4NAFB 3NZ1A 3KTSA 4PUNA 3PZOA 3ZR6A 3V0SA 2ZE3A 3GYCA 4MFEA 4HSOA 1C8QA 4IP5A 4XIAA 5I3FA 5DO8A 3ENLA 4C6FA 1FHVA 5GVJA 1LOLA 4FSAA 1OD8A 3TYAA 2ISFA 1EIBA 3LBMA 4HPNA 3SM0A 2O7SA 1K1DA 4BI7A 1XP3A 4C6OA 2F7FA 3IIOA 4HK6A 3BGGA 3VNIA 3WNLA 2VWSA 3GBEA 3DHDA 1BD0A 1YKWA 3NCOA 1CLXA 1OYCA 4A3HA 3LK6A 7ODCA 1FWTA 3AQUA 1SR0A 3S4TA 1HO1A 2A3HA 3WQWA 1TV2A 3F2CA 1ITXA 3UYCA 4J3XA 2OT0A 4HHLA 1I2QA 1R47A 1L8PA 1JR1A 4E0CA 3ATZA 4LCQA 2GDQA 4UB9A 2CLIA 2VRQA 3TV8A 1WXYA 2X42A 2QJJA 3MUIA 3FSTA 2NQ5A 3T4WA 1TWWA 1OYAA 4UQEA 3U2CA 1EF2A 4N7QA 1DHPA 3DH7A 1TPC1 1OK6A 5FF2A 2E28A 3LG3A 1BYCA 3TXZA 5JU6A 2AL1A 4BI6A 4W5UA 3W85A 4UMAA 3KOWA 1KTCA 1JYXA 3WSUA 3HMJG 3GR8A 4M81A 2OGJA 4DIAA 1Q2SA 1MXGA 2YPIA 4NHVA 3CNYA 3QV9A 1PKNA 2ONEA 4XG1A 3W53A 1A0DA 5G2WA 1WDSA 1AVAA 1VH7A 4URIA 1IV8A 1W32A 2C71A 3QC0A 4E8GA 1SUXA 2R91A 3GDRA 3BV7A 1YX1A 3AZTA 4ZSUA 2YFOA 3NFUA 3IJ8A 1I2RA 3RK8A 4HTBA 4DWDA 1J18A 4ATWA 2J9YA 3KUMA 4C7GA 5HBFA 3E0IA 3KVMA 2HXUA 1GG0A 4D1IA 4GIAA 2BHYA 2P5NA 5GJNA 3EWXA 3A64A 3RPTA 1MQRA 1KXHA 3VOHA 1R0MA 4F2TA 4TX8A 3PAJA 3GW3A 4CNPA 3FKRA 4HA0A 1CIUA 3ABZA 2A3EA 2LLEA 5SWUA 1F6KA 3FS2A 4KEMA 1X7FA 4UQCA 3EKGA 1CECA 1V7YA 2D22A 4QSHA 1FCVA 3VVGA 4KMQA 1CEOA 4BWLA 4V33A 3ITXA 1V3IA 4NI3A 3CGTA 3TTYA 3YPIA 2XIJA 3ARVA 3S0CA 3ZJ7A 4YHEA 3CZJA 4JDBA 3SUVA 1ITQA 4JEJA 2FIQA 4IMAA 2A7RA 1R30A 1MEIA 1OJXA 3H2OA 3N3MA 5TF0A 3RLVA 2PRHA 4MDOA 2FYMA 2VQUA 4L64A 3AWOA 4U3CA 3GXFA 3VIGA 2P0IA 3B0UX 5XIAA 3L4YA 5LNUA 2OX1A 3G3MA 4JNZA 3R43A 1IT0A 1WDPA 1XIBA 3HFTA 3FYOA 1TTPA 4Z2IA 4O18A 3LSBA 2WYSA 5E0KA 3TW9A 4HNNA 3W76A 1R6WA 2WAGA 3JR2A 1KCLA 1YNYA 3W7IA 7ENLA 3O9NA 4AY7A 3AHVA 4GZ7A 4CD8A 3LLXA 4GQBA 1ME7A 1U2YA 1I6NA 1PO9A 1M7JA 5DELA 1OZQA 4P7NA 5T9CE 2Q8LA 3SURA 4QLKA 4UTTA 2I57A 4O8AA 1J10A 2GPTA 1AA1B 4F79A 3ZLFA 4KBXA 5FEXA 1SR9A 1GUVA 2QAPA 4JTCA 3IIZA 3PBMA 2HZGA 1LJYA 1YXCA 2GL5A 2OR2A 3D6NA 1LOSA 3FOKA 4Q8VA 5BOFA 2ZA2A 4ZVJA 1X6UA 2EG6A 1VYPX 1NFPA 4EP8C 1WX0A 2VZSA 2TAAA 3PUGA 2DT3A 2EG8A 1IR1A 1E1CB 3LY0A 1ISYA 3C2VA 3LRKA 4DJDD 2PFHA 3O1NA 1S1PA 3K8KA 1W3KA 3STGA 3LX9A 1WOAA 5I3DA 5D9NA 2QKFA 1DJXA 3N4FA 4K37A 2X7VA 3NYDA 3UF9A 1F3WA 2VXNA 3UFYA 2D3LA 3RR4A 4HQVA 1XCWA 4X3ZA 1B57A 4CQBA 6ALDA 3AXKA 2CC0A 4RZ4A 3W7GA 3AROA 1U83A 1LLWA 2W63A 2GVJA 1O68A 2J4GA 2UWFA 1JPHA 4D6FA 3SCRA 3L4XA 1S46A 2HNHA 8TIMA 3OO2A 2V5CA 4RNFA 4I6VA 4I3GA 1JPMA 2X0HA 4MB4A 3TUUA 5IDIA 3BMVA 4ORIA 4JPGA 5KZEA 3CHCA 3CMFA 4BS0A 3VKAA 1CWYA 2J7BA 2WCGA 5CBIA 4IPIA 4OE7A 2DORA 4D8AA 3EB4A 3N2BA 3GK0A 4ZOEA 2VWTA 2DH2A 4ZCWA 2ZUWA 1BG9A 1F74A 5H8UA 1NJJA 1YIXA 3A6OA 3Q94A 3C8FA 1K9EA 3OG3A 2OQYA 2XM2A 3R0KA 3ZMRA 4DLMA 2F9RA 4V28A 2BXYA 4MHBA 2HTMA 4RZBA 2CFFA 1PKLA 3F7JA 1TPFA 1VFHA 1E0UA 3MI3A 2NQHA 4ZEPA 5BXRA 4JAWA 1B3ZA 3B4YA 1GVEA 4W87A 1XCXA 1VRXA 3DCPA 4Z1YA 3O06A 3CHVA 3M16A 1FHLA 4F9JA 4WF7A 1PIGA 3IIPA 1UD2A 4IIGA 3UWZA 3UCCA 3PY2A 3MZNA 2HVNA 3GSMA 1TA3B 3OA3A 2YCKX 4UFKA 2VCCA 3OBAA 1O5XA 3OLGA 2VDIA 3NEHA 3PP7A 4YCPA 1GKPA 1B5TA 4JN7A 2ZZ5A 3BG9A 3A3XA 2C15A 4WD0A 1JZ3A 3WF1A 1WCGA 3I6RA 4JKLA 2J88A 1IT7A 1KRMA 1VEOA 2XIQA 4WSHA 2POZA 5K2ZA 2P8CA 2WM1A 2ZICA 3IRSA 3AHZA 5REQA 1R3YA 3T55A 2YW3A 1GTHA 3KW3A 3VCCA 3ZIZA 2WMJA 1JEZA 2FTWA 5FA5A 4DPPA 2JKAA 5A6SA 5MF5A 2EHHA 3THUA 1AMYA 3W2JA 3GTNA 5FJTA 1YDNA 5HMSA 4J5NA 1UR1A 1NOWA 1ELSA 1LT8A 3OIHA 3VE9A 4A4AA 3S2JA 3M7SA 4Y9MA 1GW1A 3MP3A 5EMJA 4LS1A 1QAPA 1MW0A 1LTDA 2VEIA 3W7OA 5ABGA 2ZUUA 2NVAA 2OCZA 3GDMA 2GWGA 1R3VA 4JKMA 3NXLA 3ZZ1A 1TCDA 2R6OA 2QYGA 3KCOA 3M46A 1OGBA 4JFUA 2NXGA 1AH4A 1TIWA 5CEWA 1F8MA 3E9AA 4OOZA 3OVPA 2FPTA 1D7FA 3ARPA 4QG6A 2V6AA 2XYLA 4M3PA 5LKYA 2WANA 4IG2A 1MMFA 1HNYA 4CNNA 2G3FA 1IEQA 4Q4SA 3VZZA 4JNYA 4HN4A 5LHFA 4KH2A 1NM9A 4NT0A 2CZFA 2EJAA 3SRKA 1I75A 4AU0A 1SMDA 1VPQA 4PMVA 2PLCA 1T96A 3PTMA 3OGVA 3KDOA 3NL3A 4O15A 3HQPA 2OJPA 3DI0A 1JVNA 4ILSA 3AWNA 1OT2A 4WZHA 4Q4QA 4UXDA 3R25A 2IKJA 3G1YA 1N2VA 3CS2A 4PEEA 4DNHA 3AYRA 3C2EA 3K8MA 2ZBTA 1K6AA 1Q8JA 3LYEA 2VMFA 3L5AA 3S46A 3UXLA 1TUFA 3VIIA 5LNRA 1UWAA 1TV4A 1BGGA 2E09A 3FDGA 3M0YA 5HJXA 2BGNE 2MNRA 3CV2A 2E6DA 4CQDA 3S6OA 2PF0A 2J7CA 3VDGA 4QRNA 3LRMA 2CLKA 5CPTA 2HCVA 3C6CA 4US5A 2FPVA 4MY8A 4E8DA 2OZ8A 1TVNA 3B9EA 3R13A 4PRWA 4X9YA 2Z00A 3ONBA 4J9JA 3T7VA 1RLDA 1UKPA 3P0WA 4JTSA 1J8VA 1V0KA 4MJMA 1WKDA 4QJ5B 5DMYA 1TVLA 4JFVA 4KETA 1OC5A 1ZP3A 2VC5A 3L7RA 5AFDA 2FFCA 3QJAA 4GVFA 4U2ZA 3GH5A 3I7SA 4LYQA 4C6PA 4AEEA 1TWZA 1PDZA 1Y7VA 4MM1A 3PAOA 1Q6QA 4PTMA 4BJHA 4RW5A 2CW6A 3TAKA 2XSXA 3VIJA 6PTDA 1JCJA 2HJPA 1V5XA 2ZXAA 2X30A 3CH9A 4Q4OA 4FZIA 3TZNA 1J4EA 3RU8X 1WDRA 4NL1A 3GXDA 4V2XA 3QV7A 3CJPA 1AUSL 3FXGA 1WZAA 4LVDA 4F2UA 1BQGA 4RE2A 2P76A 3M5XA 5LIUX 2BY3A 5A6TC 1BEUA 3WJYA 2Z4GA 4LVBA 2XJ7A 4UUIA 5A8NA 5FSDC 3V4BA 4A8LA 3AISA 3E0LA 1EDQA 1OB0A 3BSMA 2OYLA 2PDJA 2DVUA 1D3HA 3LHZA 1O5QA 4RKAA 2V3FA 4XKMA 1JZ4A 2VX7A 1JI2A 1QHPA 4NXSA 4LH8A 2GJLA 1TPUA 1PV8A 4BF9A 4LV9A 6XIMA 1LBMA 4RE0A 3QV8A 5G4HC 4A29A 3LPFA 2JGYA 3PULA 5JBDA 4L6HA 4XBJA 1JCMP 3E02A 7TIMA 3M6DA 3SUWA 3PBWA 3ZFHA 3RHGA 2PLJA 1QHZA 3NUKA 2PSNA 2W4XA 2DFAA 4CNTA 2J13A 1QNRA 3FGCA 1CB2A 2P3ZA 3P3BA 1UWSA 3POHA 3CYVA 4M6PA 4JIPA 3W25A 2PWUA 5FIPA 1VENA 3GHUA 3UPWA 1SO6A 3A4JA 3KDNA 3K4AA 3AOFA 1GOQA 1DIOA 1NOUA 2O9TA 1B4KA 5JIWA 1G5AA 4O14A 2WVVA 4W7UA 3ZOAA 4PN2A 1DJNA 3LS9A 4Q8WA 4G9PA 1A5UA 4R5EA 4Q32A 3KCJA 3TTEA 4WSJA 5CLWA 3S1WA 4D6DA 5D05A 5LXXA 4I8DA 3F5JA 1UUMA 4S3KA 1SO3A 4L1XA 1VBRA 2J7GA 1UD5A 1XSJA 2OLSA 3TWBA 5G2HA 4DAFA 4MKSA 3VIPA 5CZ0A 4LRTA 1JD9A 2AAMA 2WB5A 3M0XA 4WX2A 4RR4A 2EKCA 3INPA 4PEKA 4PULA 3S5YA 1BTCA 3LXAA 2NUWA 5LZLA 1XLMA 3LCIA 1E6NA 1PDYA 3VPLA 3LV5A 4B5UA 3WBYA 4E2BA 5G4WA 2QJGA 2BVYA 2CKSA 3BMWA 1OEPA 1H63A 5MHBA 4J4KA 1FRBA 1JDAA 4LY4A 1HQTA 2WOQA 2Y85A 2QNEA 3GAKA 1VZWA 2GK1A 4IQLA 1AH0A 2ZUVA 4XV0A 1DIKA 1KM6A 3NZPA 4ZXLA 3L21A 1AD1A 2PF8A 4WJ8A 3A4XA 1HVXA 4NZ4A 3J7HA 1WBJA 3NDOA 5HK4A 2YDQA 2Y5EA 4EACA 1ZTVA 3W87A 5HPOA 2G5WA 4D6HA 4C90A 4PE8A 3QYSA 1QUMA 3U2ZA 2Y7FA 1SQ7A 3PWGA 3WQ6A 3HZ3A 3NQ8A 1OFDA 5DCBA 5XINA 1ISZA 3RILA 2O9RA 1TJ1A 3UWQA 1GKQA 1Z44A 1SMAA 1GEQA 2WKGA 3V5CA 5KSWA 1GYLA 2FMOA 3EGJA 1WUFA 3QHMA 3DXIA 5B7YA 4ZO9A 1QNSA 1XIFA 2YFNA 3CQHA 3DFQA 1AW5A 1X1ZA 2WMGA 2XFWA 4S3GA 1UCWA 4LAOA 1HKIA 2G4FA 3WY1A 3DDMA 4EWND 4MG4A 3ZQ9A 2C91A 3W38A 1UZ1A 2FVMA 3SCUA 3QHOA 1IIGA 5F2GA 2I9UA 3RJYA 5LIYX 4GVIA 3TA9A 1KO0A 3WBXA 3LPPA 1PL9A 4W7WA 5GJMA 2QIIA 2OYKA 4KPLA 1BXBA 3BK0A 3T42A 3T0CA 3WD1A 1R3RA 3WLMA 2KZHA 4QCFA 4QLLA 6TAAA 1O1HA 3CZ8A 4LBUA 4ZFMA 2XPKA 4ACZB 3NO3A 2MUCA 4AWSA 5DBTA 1F6PA 1PCKA 2OZ3A 2W67A 1EP1A 3EXSA 5BRPA 2DY3A 4I9MA 3ITCA 3GTIA 3BLKA 1RPKA 1AQ0A 1GTEA 3GVQA 3FVMA 3AIWA 5D2VA 3SY5A 3ZLHA 3WKZA 2BOFX 1FHUA 4NJJA 1K9TA 3BJFA 3P61A 2Y1HA 3C61A 3ALFA 1BSIA 5K4ZA 2PWEA 3MB9A 4HNUA 2NX1A 2WHKA 2J27A 1E6PA 1V6WA 3CK5A 4DPQA 4PB3A 4YN5A 3KRUA 3C56A 1W91A 3VDAA 1DXFA 3ZSSA 1S2CA 4HPGA 1J0JA 1P1MA 3VNYA 4GXMA 2ZX5A 4PH6A 3N6JA 5H8MA 4MPQA 4HK7A 5F2MA 1OG0A 3IAPA 2VDHA 1TRIA 5HXMA 3WD0A 3WK1A 3UVIA 1JJKA 2FVLA 3GU9A 5HNTA 3RNDA 1B3WA 4CQ8A 3GVGA 2DT0A 4UC5A 4EPDC 3QMRA 3TJ4A 5IXEA 3IJLA 2HXTA 1KD0A 5BOEA 1QTWA 1KFKA 1P43A 2DJLA 4H3DA 3GC4A 3M6YA 1EGVA 1BTMA 1OWQA 2GJRA 2W79A 3EEGA 4MNJA 4QEEA 1SW3A 1UQZA 4PSPA 2CNCA 4B5NA 3GNOA 2BNJA 1LG2A 3RO8A 3URAA 2Q3OA 3W81A 4HMDA 3CWHA 4IGNA 4N6EA 4U2YA 1POKA 2VR4A 2YLAA 4IOTA 4MIMA 2XSAA 3HGJA 1Q13A 1JIBA 4WXYA 3AI0A 4F0KA 3O0FA 1MO0A 3CUJA 3DECA 5IHSA 2R1KA 2AL2B 2VL4A 4ERAA 1LG1A 2O4QA 4EX4A 3R94A 3QVQA 2XWDA 1JCXA 1B0IA 2YX0A 3QM3A 5D04C 3VMPA 3QR3A 3W02A 3WLSA 3PZUA 4HSNA 1GKRA 1DJZA 2WMIB 3BZJA 2WMHA 5IBXC 4GI9A 3T8QA 1OX6A 5JH1A 3FCPA 1BYAA 4E4PA 5MKGB 5DBUA 2WSPA 1FWSA 2A7PA 1SW7A 2ZX7A 3WF0A 2GGIA 1SFJA 1XS2A 4UOQA 3G8RA 4X60A 1UASA 4KCTA 1LQ2A 1MQPA 1W9PA 1XGEA 1TPH1 4NKCA 3H2MA 3KWXA 3DIPA 4JR5A 3L65A 4WGXA 1RVGA 1UKTA 3MCMA 1QOPA 3QHNA 1A0CA 2DZSA 4C1NA 3N11A 3N25A 3VABA 4GI8A 1PKYA 1P7TB 4Q6JA 3WH7A 2ZUTA 1H51A 1VKFA 4WDWA 4E4FA 1XIMA 1WDQA 3NSMA 3GR7A 3CBWA 2YYUA 3FDKA 3ITTA 4N0RA 3KBSA 3H2FA 4GZEA 1X7IA 1ZSXA 3WZ0E 3BJTA 4DJFA 3WL0A 4IUOA 5AC4A 4HK5A 3DU0A 3NL2A 3TQ0A 4Q8PA 1FDYA 1CXFA 2VFGA 1TV7A 4FXRA 1S2AA 2VFEA 3IANA 4GPNA 3NQGA 1H1YA 2Z6JA 3HJZA 1B30A 5CJNA 3W29A 3EX1A 4PL2A 2Z29A 3BCJA 2QIWA 1Q7MA 1HTIA 4D8ZA 2O7QA 1LRTA 3N12A 3BGAA 2GVYA 4K38A 3PF3A 5A6JA 4L80A 3KL3A 3O7UA 1NU5A 5E1QA 1OG6A 3W2NA 4C6QA 4I5RA 4S3EA 2WSRA 4KT2A 7PTDA 1FHDA 1RLCL 2PU1A 4IQDA 3SCWA 2O56A 3GNDA 2OZ0A 4G5DA 1V6TA 1MYRA 3LHVA 3MP5A 4NU7A 4LB4A 4Z1BA 4MNMA 3FYPA 2HWGA 2C1IA 3M5VA 3W73A 3TMQA 5JH2A 5FI8A 1V51A 3HPAA 2OSYA 5G4EA 3KE0A 3NDYA 1JZ8A 1WAWA 4GMEA 4QR6A 1DORA 5D8WA 5EMUA 1PZ0A 3PS7A 4AHPA 1PX4A 5GQBA 1KFEA 3WD2A 3JVAA 2OOFA 5AZ1A 1W5NA 2XGIA 3DYPA 4WGHA 3N4AA 1G9HA 1J93A 1OVDA 3AU6A 4IGHA 4ZQRA 5H91A 1P6CA 4N4QA 1NY1A 3QW4B 1LLOA 2ALDA 3UY8A 4RL3A 1DJYA 2F2HA 4DM2A 2DV0A 2CERA 2BHUA 2FDMA 2E77A 2VZUA 3OBEA 1EZWA 3TYEA 1E6SM 3THQA 4MOZA 1W8SA 1PUDA 2NLIA 1ONRA 5E70A 4Z1DA 4J1OA 4A8RA 3LGGA 4HZ8A 4PRTA 1H61A 1OF8A 3HQOA 3PG8A 4PODA 3MCNA 4F0RA 3MMTA 4UNLA 4JCLA 3VGEA 1XIHA 5D2XA 3APGA 2Y7EA 4TX9A 1W54A 2VELA 3LN3A 2W0UA 3FJLA 2B4GA 3U8GA 5FCZA 1QFEA 4MVAA 3VIMA 3ITYA 1YTKA 2OQHA 1H7OA 3A23A 4HZ7A 1CDGA 1CGUA 1PZ2A 3EX4A 4RDYA 3E2VA 4V1XA 4W86A 5BXSA 3OB8A 1Y0EA 2NW0A 3W82A 4N9CA 4IH3A 2Z0IA 1J12A 2CZEA 2FH6A 2WZEA 2ZRVA 1GPWA 1A80A 1JGIA 2WVSA 2IS7A 3A4WA 3ZSTA 3B9OA 1HKVA 1TWSA 3EOEA 4ZB0A 3VCRA 4A8NA 2TMDA 4JN8A 4KQNA 3A3HA 2FMNA 3KRZA 1XLBA 4XUGA 2V67A 5FF7A 3DFPA 2CZVA 2V9DA 1NDVA 4ICCX 2H90A 2QVNA 2VFHA 2ZUMA 4N2YA 4Z0SA 5AHEA 1DWJM 4LRSA 3AXMA 4FI4A 4LPCA 3S1GA 5CSYA 2E4TA 3KP0A 2VX6A 5BXPA 1C8VA 4DXVA 3WO8A 3AYSA 5EBUA 5BXTA 4BCEA 1WO2A 3LXBA 4W84A 2ZXBA 3VXGA 4HPHA 2WZHA 2ATSA 3TN3A 1DBTA 2DT1A 1GHSA 4YHGA 2F6XA 2VGIA 2FQIA 3LEPA 2VJXA 4MWAD 2DZPA 3CHFA 1WPCA 3V16A 4AYSA 4L6OA 3BAWA 4TOQA 2UY4A 4O17A 1H1ZA 1V6XA 4M8UA 5CZJA 4XD5A 4X63A 2QUUA 4A2RA 1AG1O 3SCSA 4DXKA 5A8QA 1RQHA 4FX8A 4KCVA 3CL6A 3N18A 1IGWA 2TRSA 3CZGA 3EWWA 3FKKA 5CC7A 3WMCA 3BXWA 3CIVA 4GINA 4JYFA 4MB5A 1UZ4A 3HPSA 3KL0A 3N14A 3H7VA 4AMAA 1LM1A 1Q6GA 1T8QA 2OPJA 1AW1A 2D24A 5K3VA 4KS0A 1MRAA 5DFAA 4C6IA 1MXDA 4LC6A 5E9XA 3WEMA 1LF1A 1Z8AA 5AC8A 3C0QA 1IE7C 4WKAA 3I65A 2YZ5A 1R9XA 4X2PA 3VO0A 4X22A 3FVDA 3PUOA 3WH6A 1VR6A 1KB3A 5FJRA 4PUDA 4ZBCA 4C7FA 4US5D 3UA4A 3R4IA 5M5DA 3W37A 1L6SA 1JFXA 1UMYA 4AY8A 4NYUA 2A5HA 4Y2WA 3CTTA 3DG7A 3KAOA 4Q7BA 2OEJA 5FACA 5ENLA 4AWEA 4XSLA 2C1HA 4J3ZA 4ECLA 3CZLA 4LWWA 3LGDA 2GJPA 1Q65A 2CLHA 1K8YA 3FX4A 3ARWA 4XZMX 3W1NA 3BQ5A 3HURA 4ENLA 2E40A 3AMLA 3AS2A 1KWGA 3T08A 1HXJA 3K8LA 3BOLA 4CCDA 4GA8A 3W3OA 2Y5JA 4AW7A 5FJJA 1KQYA 4Y90A 4B9YA 1M1BA 2H8XA 4XK2A 2X40A 4TV6A 4NI8A 3K1GA 1W3JA 4HZMA 4QE4A 3TCSA 5IFPA 1AJ0A 1Z3NA 2E6YA 2INFA 2CLEA 1K03A 4MAZA 3CL8A 3OOQA 1GYNA 1OC7A 1IWPA 2QGHA 3MKKA 1XRTA 3U48A 3HMCA 3GTXA 1AW2A 3SQSA 1OM0A 3RRAA 1IXQA 2BS9A 3BLDA 3PFMA 3ITVA 3F4WA 2D2OA 2YW4A 5JUVA 3MYPA 3DBNA 3AU2A 2XFFA 3UG3A 4RDWA 4GVHA 3VKCA 3T07A 1B3OA 3ALGA 2VOMA 4HPXA 4WCJA 1TIMA 2ZZ3A 2YCLA 5HANA 1FWWA 1FVPA 2X1IA 3LGEA 2ZWYA 4YPJA 5M2FX 1W5MA 3FGCB 1WA3A 3FEQA 3U5UA 2G50A 3NGJA 4DUVA 3CUFA 4DBUA 3WLQA 1CB7B 3P62A 3HFYA 1HL9A 5BWFA 3NOEA 3WLHA 4S3BA 3GFZA 1Z42A 4LUSB 1XLFA 4W93A 1JL8A 1XDJA 4NP7A 2GQAA 5BMXA 1EX1A 1I1WA 3WFZA 4E6MA 1GQKA 2OWWA 3ARSA 1REQB 2ICSA 3M9YA 4CVWA 4JQ3A 5CJMA 1QOQA 1I2OA 1E9LA 1F6YA 3ZR4A 3B03A 3F4NA 2INZA 3U2OA 1GEHA 3HM7A 1KFCA 3CUIA 3BJSA 5I2UA 1HL2A 1NWRA 3W28A 2PDWA 4P61A 3SRDA 2ODOA 3ITLA 1A0EA 1DQUA 4F0LA 2OO0A 2E7FA 3HTWA 2XUCA 2DZAA 1LYXA 1GVOA 3VNZA 4GQRA 4R27A 2R14A 1MDRA 4EPEC 4UIOA 2HDJA 2YCIX 3SCTA 1Z48A 1IYXA 2OFJA 1KR1A 2JK2A 3VNKA 4M56A 1LQ0A 4FNSA 1ZAJA 1W5OA 3MC5A 4LTSA 2PGWA 2CBIA 1KGWA 3DFHA 2OGYA 1M9HA 4I9TA 1B31A 3OHMB 2PC8A 2AMGA 4LQ1A 5E5CA 4DEFA 3PBGA 3KLLA 3A5FA 3UWEA 2NQJA 2YL8A 5DY3A 3ONCA 3S1XA 1KRAC 1DQWA 3RM8A 4LBRA 1S5VA 1G4TA 4RCXA 1EA0A 5A95A 5FEWA 4FXFA 5HNNA 3UZJA 3NQ7A 3CO8A 3K4WA 4GNJA 1V3KA 4JY8A 4WDTA 3GNRA 4QDMA 1MNSA 1XRSA 4DRSA 3WF4A 3P8IA 4O16A 5KINA 3WQ5A 4GWEA 4RUBA 3SDOA 3CQ0A 2NV1A 4H00A 1ZUAX 1REQA 1W3TA 5F4WA 3AO0A 4E2DA 4D6EA 1FQ0A 1W1ZA 3GFYA 3BG3A 1EJVC 4UTMA 1M5WA 2V30A 1JUBA 2FDSA 1GNXA 3BV4A 2EG7A 3W88A 2PZ0A 4ZTXA 1XG4A 2FLIA 2WMFA 5M1TA 3L0KA 4H9UA 4IZGA 1IIHA 2OEMA 3S1VA 2QGYA 2Z28A 4POCA 1R46A 2PWGA 2WQDA 1SO5A 3CWOX 3UWWA 4UOZA 1DJHA 4INFA 5C7HA 4XX6A 1E1EA 4DJED 2FZ8A 4ZL1A 1HJUA 2J9XA 2H3DA 1SFSA 4YMZA 3IACA 5DF0A 1RJQA 1P0KA 3T1GA 1PWLA 1O95A 2W92A 3G22A 2Y88A 3HB9A 2CBUA 4PCTA 4YS1A 5JQ9A 3SFWA 3WLPA 2PDPA 3Q4DA 3WUFA 1UYQA 2OWCA 3VDHA 3QTPA 1OCQA 1FDZA 1ITUA 2QPUA 2CWXA 4UR7A 3GXTA 4QX4A 4TX6A 2QCGA 2RAGA 1T99A 3VGFA 1CPUA 4LC8A 1US0A 4PTVA 1YLVA 5CBJA 5HUPA 1RQEA 2ZZ7A 4MWAC 1XXXA 2UY3A 1UA7A 4PCPA 2Q8XA 3S1UA 4AIEA 3BAKA 3MDUA 1WUEA 4XBSA 4A6GA 1WYIA 4DVOA 1R3QA 3AS0A 4CEXC 3NPUA 3LI0A 4LJ3A 4LYPA 1AD4A 4Y9OA 1TWIA 3VD5A 4CVUA 4B90A 4BF5A 3QN3A 3EWDA 2Q09A 2VZVA 3QOMA 3FJNA 3W1MA 4PMOA 2DSZA 4ONVA 4Z2KA 1QNQA 3N15A 2ZQ0A 3U7BA 2QPXA 3QH2A 4L7ZA 5FL0A 5IDZA 5I77A 1KXVA 4EPBC 1Y8BA 2CHNA 1Q6EA 2OX4A 4IJRA 3M5YA 3G6LA 3QZEA 5LNWA 3SSZA 4GFIA 3CV6A 5U4NA 4GACA 4DWSD 1OD0A 4NILA 4F66A 1Y5XA 4ZB2A 1GYMA 5H1WA 1JDFA 1AODA 5D9OA 4AXKA 5AHNA 4P8UA 3PJTA 3I68A 3R10A 4JZ5A 4JFTA 5DCEA 3OZPA 5EFDA 3HBLA 1E51A 3SZ8A 4AD4A 1NDZA 4QFUA 3M4HA 2E8ZA 1WKYA 1R7AA 3G8EA 4OZOA 1YNPA 3MANA 3SRFA 4JTLA 2ANUA 1VFOA 1ZU8A 4L9YA 3TQPA 2DQWA 4FR1A 1DQXA 4HVXA 2FGLA 2W62A 4U33A 3PTKA 5EPDA 3CM4A 4OHQA 2PEVA 4NQ1A 4O54A 4AUBA 3G1RA 3BWWA 1EQPA 1UQYA 1A50A 1L6YA 1EOKA 4Q4RA 3SY8A 3AYTA 2BODX 5TD4A 4YTRA 1RCQA 1HX0A 2G0WA 3WJXA 1EJSC 4F2BA 4CCEA 4XZWA 3DFTA 3LBOA 3TK7A 1AQHA 4CNUA 4DXXA 1K77A 4IIBA 2J78A 4QJ4B 3ORWA 5HMEA 4AZ7A 3EMQA 1U22A 3EA1A 1XM3A 2I14A 1JF5A 1NAL1 4U31A 4K68A 2PA6A 4B5XA 3IWPA 4O0QA 1PXGA 2WQPA 1XICA 5DXYA 1DEDA 3IUIA 2XIBA 2VEKA 4IP7A 2P0OA 1EYEA 3WLJA 2WNZA 3CPGA 3CASA 3V0TA 4YVPA 3EEZA 3PTQA 5HWJA 4DM1A 1ZLPA 5C6MA 1TREA 3SGUA 3KM8A 4HN8A 4B9ZA 4PTDA 1PEZA 1GG1A 7CGTA 5HWMA 1MW2A 4IGMA 2AQVA 5A5WA 4HYWA 3C52A 3BARA 4NRRA 3WLTA 5FF0A 2CCRA 1JRBA 3W2UA 5A2CA 3UY7A 3OZMA 3S5ZA 3QY8A 2BG5A 5I78A 1ZQ5A 1GK8A 4QNWA 2XHYA 3EWBX 3MO7A 5KZMA 2DUZA 1FP9A 3K4DA 3UWUA 2VGBA 3CZEA 3BG5A 3PWIA 1GGOA 3VOIA 2WVVB 4NY2A 4AC1X 2C3ZA 3WQDA 3E2QA 1TFVA 2E9LA 2WLZA 2BOGX 1IEVA 4PMUA 3MWAA 3TW7A 1NWSA 2RHGA 1BXNA 5AC5A 3KBWA 3UZYA 1V3LA 4RK8A 2WC3A 1F61A 1DL3A 1I0BA 1VJIA 4MJZA 2PDYA 3NWRA 3IVSA 5FJPA 1E9IA 4OUIA 3FJ6A 5CQ1A 4AH7A 2QDHA 4BI5A 3QKEA 3KBJA 4NF7A 1EWDA 3TYCA 1KM5A 1HVQA 3H7UA 4O11A 2FJUB 4NUWA 1F7BA 1XBVA 2ZX6A 4S3CA 3RU6A 3WJSA 4GJ1A 3CUXA 5DMLA 4AZIA 1SVDA 4ATLA 1XLJA 1AJZA 5LYRA 4PBGA 1ZNNA 3FK4A 4GNKB 3DENA 3TOPA 4KWVA 3VTRA 3WNNA 1W6TA 1M7XA 4JTGA 4LS0A 4LGXA 5C2CA 3EDKA 4GUGA 5I5RA 3UQNA 1FWRA 3QYQA 4YYCA 3N13A 4HP5A 1LOQA 1TWDA 3P0XA 3ERPA 3U3HA 2NX9A 4HMEA 1P6BA 3FXYA 1RQBA 4TQTA 3PPFA 2Z7GA 3BDKA 5C2XA 4BY3A 4UTTC 2E3ZA 4AIUA 3KOYA 4ML9A 3IGUA 1C92A 3FW6A 1E1CA 1XYCA 1DWGM 1BYDA 2XN1A 3QXBA 4PTNA 1XRVA 1W8GA 2ACRA 4EXAA 3TSBA 1J2WA 3M07A 1CLKA 3EKLA 3WNPA 2C79A 3TQKA 1JAEA 2ZA3A 1RV8A 4OWGA 5C9WA 3PG9A 3WELA 4KW2A 8A3HA 3E5PA 3MBFA 4AD1A 1EUAA 4L6DA 3N2XA 3EPMA 4PYSA 4FS9A 4GYKA 4QQ3A 3EB2A 2W3ZA 2WV8A 2FGBA 1QMLA 4B3KA 5H8PA 1AZ1A 3G6MA 3KX6A 1FWCC 3LENA 4AZCA 1CT5A 3ITOA 2REQA 3WENA 3SO7A 2Z1KA 2R1PA 4ZENA 1XH0A 4LAUA 3A22A 4H8VA 1TG7A 1FTXA 4UTHA 3RRXA 5CZKA 1JF6A 3MI2A 2XN0A 5CSRA 3N34A 3W86A 1OFPA 3PJWA 2YIHA 1JZ2A 4AZCB 1X39A 4FIRA 3MJMA 3T05A 4H7CA 4LVGA 3LSCA 1CGYA 1S2TA 2V82A 3S2NA 4M1BA 4B4FA 3L5MA 1SSDA 1UOKA 3M1ZA 1OF6A 3IPWA 8XIMA 1TR9A 3U7VA 9CGTA 3BL3A 1KWKA 4PBFA 1PSCA 1NSJA 3LTSA 3KP1A 1XX1A 4G56A 4GZIA 1J0HA 3T2PA 1XYBA 4P7LA 3L4ZA 3WQOA 4W4QA 5D03A 2HISA 3MMWA 1E72M 3LCFA 4S1FA 4WR3A 1XBXA 2FJKA 2E67A 1E0WA 4O57A 3B8DA 4LCRA 1H0IA 2A6LA 4N42A 1HW6A 3BVJA 2QJMA 2UY2A 3A4AA 3A13A 2X0SA 4C6EA 1C9DA 1C3FA 1S5NA 4JY9A 5C71A 2QPSA 1W3LA 1JZ5A 1JPDX 3OLDA 1ZBKA 3LM3A 1RCXB 4R53A 3KVLA 1ZCCA 4ALDA 3EWUA 4IJCA 2Z7KA 1BPLB 1W9UA 3WH5A 1XFCA 3UZWA 3IV3A 4EXQA 4WEVX 3ARUA 3IARA 3AXHA 3MQTA 1FH9A 3M0KA 1UR3M 2NVCA 3NG3A 3SRHA 1T41A 2G4JA 2GUBA 4MLRA 4CKQA 3F2DA 2DIKA 2RJGA 4H2CA 3WLKX 4GUIA 3SN1A 2XISA 2XDFA 3MWCA 4DBWA 1PBGA 2EPOA 5A8MA 1ODZA 1XF0A 3MT1A 3WLLA 4K7YA 5EMKA 5C9XA 5DN1A 4IISA 3UJSA 4IG2B 2OTDA 3SN4A 4CN4A 4DYKA 2I16A 4PMNA 1NEYA 3K46A 5M03A 1ONXA 2HE8A 3WQFA 2WJDA 3QR0A 3STCA 4GBDA 1EP3A 2CZDA 3SGGA 1I45A 2SFPA 2I56A 1ICQA 1ZBVA 1DJIA 1MWOA 3OVGA 4GHRA 3NOYA 4DJEC 4AF0B 1UW9A 1KV8A 4AZGA 3EWYA 4UQBA 1RK6A 4F0SA 2IKIA 4LAZA 1VBHA 2PLMA 1GW9A 2TPSA 1LRNA 2CPUA 1UC4A 3LTPA 1M41A 1B90A 2PP0A 3ZVHA 1W9VA 3VCNA 1V79A 4HCHA 3M0ZA 1F8IA 3K1DA 1GJWA 1ZS2A 3FFSA 3UCQA 4UWMA 4PUJA 4J3WA 4E2VA 1KTNA 1Z6KA 3CAVA 1W3HA 1VFTA 3IJ6A 2J79A 3AMDA 1I60A 3PZGA 4P8WA 2DZTA 1FKXA 5KMYA 3C2RA 1CZ1A 4GK8A 4L56A 3RDKA 4QDPA 4FF5A 2PTZA 1EX5A 1NELA 3GH7A 4D72A 1K7FA 1HJSA 3QC3A 4JTJA 4FEZA 3MP4A 3VI2A 4WDUA 1PCWA 1U1UA 2PDKA 2BOEX 3FA4A 1BF2A 1GOXA 2A3AA 4I90A 4RPQA 5AOUA 2Q6ZA 3CPRA 3WQCA 5I3JA 4LEQA 3MUY1 3ARRA 2V69A 1DTNA 4MGGA 4DELA 3CMJA 1YMYA 3FNDA 4MB1A 4V27A 2X2GA 1H41A 2YYTA 1S1RA 3JU2A 3U4FA 5FSEC 2Y7DA 2P50A 1RK5A 4FXJA 4C6NA 3F4DA 2R1NA 4M24A 1EEXA 1NARA 5I24A 3B0XA 4XQ6A 4PMRA 3PWAA 1UWTA 4WUIA 2CLOA 4GIYA 4BKNA 2IUZA 1ZP4A 4IJBA 5I6SA 2FZ9A 3S3GA 3I3EA 1DJWA 3OGRA 2Y6ZA 2YXOA 5GNZA 1DE6A 1ZENA 3SUUA 1QPNA 2P88A 1XD0A 3LPOA 1VFFA 3PZMA 3THCA 3WDQA 3IJQA 4BFAA 2GK1B 1F3XA 1QO2A 1MEWA 3NPVA 4IX0A 3CT7A 1E56A 1SGJA 4K1WA 3O15A 1MXSA 3BW4A 1TE1A 1X1OA 3GDLA 1TJ0A 1RAKA 3UR2A 2VZTA 3DYMA 3SCQA 4JTEA 1DOSA 1TV3A 3NM3A 2WMKA 4ZOCA 4GE8A 1EFZA 2WPGA 3CEPA 5FESA 1JNDA 4RW3A 4N4PA 4UTWA 5T26A 2OG9A 1LRQA 4GYPC 5DT5A 4NXKA 2EQDA 2W27A 3AXXA 3O6YX 5KZDA 4CD7A 1K9DA 3HG5A 2I1OA 5CSSA 5K4XA 4D6JA 4I7VA 3VKDA 4HCLA 2Z1WA 2V5LA 2XSBA 5F1UA 5I7GA 1AFSA 1EA9C 4ZQCA 1TPVA 2BXVA 4GOAA 1S2VA 4FAMA 5A3HA 3MA8A 3QPEA 2CLPA 4OV4A 4U10A 5E6ZA 3OQEA 4OKDA 5CPMA 3RCMA 4GABA 1K8CA 1UJPA 3KRSA 2GGHA 3VOGA 2ZE0A 1H4PA 1B1YA 2OO6A 4DO7A 2PZNA 2NWSA 4IPPA 4ZXOA 1FFRA 1NWTA 2PP3A 4WJEA 2FTPA 4AEOA 3GQYA 1CGXA 5TAOA 5LXEA 2PGRA 2Y8KA 1RA5A 1GCYA 4CUCA 2X1TA 4W5ZA 2AQWA 4Q33A 3CU2A 3MV11 2I7GA 4FNRA 4J28A 2NQZA 3EDFA 3E5BA 3LXCA 3TMLA 3UW6A 1QVBA 2J6XA 2QHAA 4OT7A 1FXQA 5FAGA 4MADA 2FHBA 4LEFA 1XLIA 3PZQA 4UTKA 3VGBA 1XH1A 3ZJKA 2VI0A 1EIXA 4U4MA 3G3DA 1HKMA 3GKAA 1Z32X 2WJFA 5AHLA 3NEVA 3TYUA 4PCSA 1XIEA 1NWUA 5F2LA 1UKOA 3D3FA 4DBSA 4Z2JA 5J8LA 4C1LA 3VK5A 1KA9F 3I3DA 2BY1A 3KOXA 1ME9A 3M7WA 4GO8A 3TR2A 3RN6A 3VD4A 3CQIA 3W7RA 1OFRA 2EF9A 3ME3A 4HB7A 3GIQA 2QJIA 2X09A 1WXZA 3FSUA 1QI5A 1E15A 2H9AB 3N17A 3PZIA 3GG0A 1MUMA 1QR7A 3GHTA 1ADOA 1V7AA 4ZGYA 3TJIA 4RZ6A 3GNPA 4B91A 4HNOA 2NWRA 4LSBA 4F48A 3TTQA 2AAAA 3MW7A 4B5WA 3SQLA 3EBVA 3GIPA 1R9ZA 4QS5A 3UT0A 2Q71A 2Q3RA 4R3UA 2I5GA 1ODUA 3GDBA 3L9CA 7A3HA 3H12A 2ZRZA 4HHMA 5AC7A 3E74A 3W74A 4JTKA 1TMLA 4IMEA 4GQ0A 3WK0A 3TDFA 4LAKA 4S23A 3DKLA 2EEXA 3EYPA 3D47A 4ZMGA 5LHEA 3G1FA 4AHOA 2IPJA 1V8EA 4H19A 1JZ7A 3DFYA 1UKSA 4MWAE 3Q58A 4MFDA 3WX7A 1P0DA 1UPMB 3W71A 2QUNA 2NZLA 2YOCA 3E1F1 1ISXA 1JYWA 1XKJA 3OZYA 1V3MA 5G5IA 5DT7A 2QJNA 5AECA 4NZ1A 4K8GA 4LYRA 4JFWA 4S38A 4QEHA 4BA0A 3OP2A 1LZOA 4X61A 4WY0A 3TC7A 2NLYA 1YDYA 1ZJIA 3ARZA 1JCYA 1P4CA 1F05A 1KKRA 3Q65A 3GUGA 3UJ2A 3EOUA 1Q45A 1JXKA 2QMKA 1V6VA 1IWBA 1F3EA 3WLOA 1VIZA 3WG6A 4JTHA 1OFOA 2X16A 3LOTA 2C18A 2Z2UA 3G1XA 1LP6A 4KGJA 3H7RA 3MDWA 4Q7IA 1TELA 1UD3A 2P3EA 4DQWA 1EZ2A 5A69A 2R9RA 4FLRA 4I5UA 2OMAA 4JTIA 3M43A 1XD1A 1V02E 4IPJA 3SBFA 1KQZA 4NAEB 2J66A 2QS8A 4RDZA 1U5VA 5JXQA 3UETA 4G7FA 3QEZA 4PSRA 3VD7A 4OQVA 4J40A 2NSOA 1C8YA 1IQ8A 4H83A 3URBA 2HV5A 3O6CA 4DO6A 4K1GA 3LA4A 1HJVA 1X1NA 3O6DA 1Q6FA 3RMEA 5C7VA 3T8LA 4HIBA 5L6UA 1XPYA 1XYZA 4Q7NA 1QNOA 2NXIA 3SEPA 3E2SA 3GNNA 5HMDA 3ZYZA 1JDCA 5EGRA 1E4MM 1MFVA 1E5JA 1JDDA 5HJLA 2X1UA 4KFNA 3UD6A 4GKTA 1GOMA 1XL9A 3EX2A 3W1TA 3UG5A 4FOKA 3W7JA 1PJ9A 4US6A 3S9IA 1X8FA 2WSQA 5EL1A 3W07A 1JRCA 1RZMA 5DRCA 2VR5A 2ZDRA 2ISWA 1XDLA 1F4AA 1MUWA 3WK2A 3GVVA 3BCDA 5E6YA 2WBGA 1HIZA 3NQDA 4LUYA 3QQ0A 3L4UA 4L4LA 3TLQA 1W31A 2GSEA 1GJUA 3G77A 3N19B 2O92A 3F1QA 4JTFA 2DUXA 1B3XA 1D7KA 4AD3A 1UB3A 4AG0A 3H2EA 3H53A 3SAZA 4AB4A 4FALA 1A3WA 2GUYA 4XO7A 1E55A 2E5DA 4FF7A 4DF2A 3PHAA 3TP4A 4AY1A 3AHXA 3HG3A 3GO2A 1KGUA 3DZ1A 2W9MA 4DZIA 4GISA 3MBDA 4GQQA 3CMGA 3AMGA 3XISA 3KS5A 3DG3A 4NAEA 1L9WA 2FPYA 2W5FA 4NIRA 4TXEA 1ZJBA 2A3BA 4LNYA 1WZKA 5I00A 4OVXA 3GZAA 3V3WA 2DQXA 3CUGA 1NH6A 1VF8A 2ABAA 1UR9A 2FVKA 3DFOA 4ZR8A 3O16A 4PR4A 2RDWA 1AL7A 4I7WA 4J27A 5FEPA 1TTQA 3ABOA 2IKHA 3VE7A 4ZZ9A 4TTUA 5EU9A 5D38A 2VEGA 5CBBA 4H6RA 3GRIA 1QASA 1WKEA 3NNTA 2ZRUA 1UC5A 4N02A 1PWMA 2L5HA 2WZIA 5TNVA 2PRMA 2X7WA 4FMVA 1Q2RA 3PR2A 3AHTA 5I02A 2WXDM 3PPCA 2JQXA 4GD0A 1PHQA 4M1RA 3BPWA 2FZNA 2PD9A 3OVRA 1TZZA 3LNMA 5G1YA 1E9ZB 3WD4A 3G1HA 2XU2A 1UWRA 2Y0FA 2Y61A 3LCGA 1TJRA 1BFNA 3W26A 4QQUA 4KWSA 4XD6A 1Q6OA 3E2RA 3PB0A 1DWFM 1FDJA 1Z69A 1FXPA 4K7VA 1K3UA 3C5QA 3DI1A 1B9BA 4GG9A 4LF2A 1GVIA 4Y9PA 3E0WA 2ZZ6A 4R9OA 1ZFJA 2PI6A 3VD3A 4J3TA 3UPMA 4JHOA 2IKGA 2PTYA 3BLOA 4RNHA 2BWGA 2J7EA 3CO4A 2C0HA 1IXNA 1L2UA 3GS6A 1A3HA 4TVDA 1YBQA 1KCZA 1F9CA 1OSEA 1XIJA 2YCJA 1FX6A 3OZOA 2R1LA 3WIJA 4MWAA 2DDXA 2V5JA 4HTYA 1EJXC 1V0LA 2I17A 1DE5A 4PUEA 4Z0JA 4U28A 2WHJA 1VAHA 5TIMA 3NQEA 5D32A 2WO5A 2J62A 4LU0A 2NT1A 4IX2A 1IHIA 4N6FA 1XSIA 2PE4A 3H4XA 4DI8A 4JTTA 4YTSA 4PZVA 1BF6A 3A9IA 2RGLA 1SPQA 1TVPA 4DWSC 3R0UA 4TUFA 2BDQA 2XIOA 3W1AA 1K4HA 3VIOA 3UG4A 3L0NA 1W3NA 1J0KA 2FTYA 1EXPA 3NIYA 3F2BA 4GIEA 1WNOA 3B8WA 3WJWA 1DJGA 2CXGA 3KWSA 1OZMA 3G18A 1CI1A 2VTFA 1E70M 3TN4A 1CYGA 5I79A 1RD6A 3SADA 4KFPA 4F40A 3W00A 4XZLX 3BLLA 1XGZA 1P5BA 1T7LA 4MAVA 3W7LA 4KGLA 1GJPA 3GG7A 4LS2A 1E0XA 4AX7A 1W2VA 4HYVA 3QZ6A 4E3TA 1G7VA 1ZHAA 2WW5A 1LDCA 4BZYA 4ERIA 1X6NA 4R7OA 1LCOA 2CESA 4P7RA 5HJYA 3OLEA 5IHRA 4JTUA 3TZFA 2AGKA 4IM4A 1VBGA 4J35A 3MUAA 3H26A 1PS9A 1VYSX 3HGSA 1OFBA 4AIBA 2A4AA 4XZBA 5D8ZA 4REQB 3CV7A 3VIFA 3MYOA 1IEXA 4NNCA 4LYKA 1H3GA 2UZ9A 1JPIA 4WDXA 1YPXA 5CKSA 2CYGA 1VC4A 1EWEA 2HSAA 1J0YA 2J7DA 3T4CA 4RX0A 3CL7A 1FWFC 3WNKA 1A5OC 4H1ZA 3LHYA 3CHDA 2V81A 5CC5A 3TTOA 1XLDA 2VEPA 2DIJA 5I3IA 4C91A 1XWYA 3TIMA 2IPWA 5F2IA 1J6PA 2WK2A 1EJ7L 3AZRA 3PC0A 1QBBA 3PPGA 3UJEA 4Z2LA 3DHFA 1QNPA 1UH2A 1OX4B 1FBAA 3IGHX 2OLHA 4YTQA 3V1PA 1GZ1A 3IGSA 4GCAA 1O1ZA 1QATA 1TX2A 1HFBA 2VVNA 2ZRXA 3IK4A 3LU2A 4XO6A 3C3NA 3UWYA 1KGXA 3UJRA 2C14A 2DT2A 5JIPA 3GIYA 1TPB1 1HN1A 3SSJA 4UZUA 3C0LA 5LA1A 3UR8A 4Q8OA 1XHGA 2NUYA 3C3UA 4DUXA 4Q6XA 3HG2A 4WY0B 3LV6A 3WMSA 2R24A 1ADDA 1S2WA 1GQNA 5FKYA 3N6HA 1CBGA 1T5AA 3IEBA 4K39A 4LF1A 4TV5A 1EC8A 1M3UA 1LL4A 2BGSA 3C86A 1S5MA 4AEFA 1A4MA 1CTNA 4E2OA 1XIIA 1YHTA 2GJXA 2CHRA 2QCMA 3PFRA 3EMZA 3G1DA 3F5KA 1K02A 3MSYA 3PSVA 1ZY9A 4NYYA 1CNVA 4BF7A 4R85A 5ABEA 3WLIA 3RM9A 2QUTA 2Y4SA 4FX7A 4HHHA 4EANA 3VOJA 5LIWX 3W70A 2BXZA 1M6JA 3NO1A 3UNTA 1UBPC 2C1GA 4BQ5A 2V63A 3AIBA 1VFLA 2RFGA 1E43A 3W23A 1RBAA 2X1RA 3M44A 4UNIA 1QPQA 2WKLA 3W75A 3RFAA 2BB0A 3E3HA 4ADSA 4AC7C 4O1DA 3C2FA 3CC1A 1YNQA 3FA3A 1C8XA 3ES8A 1VJZA 4EIVA 3B8UA 2OOGA 4X9SA 4GYJA 3GX9A 4HD5A 1IEIA 1Z7AA 3RG6A 2ZTJA 3TN6A 4IPNB 1Q8AA 5BROA 2B7NA 5C70A 5DXXA 4UCGA 5DRIA 5AYBA 3QLDA 2CLLA 2Y62A 4JIIX 2VD9A 9XIMA 2CZ5A 3NXFA 3VKJA 1QPRA 3VX0A 3SIZA 1W1TA 2QCCA 1KLZA 3OBKA 2VO5A 3C2YA 1B54A 1EJUC 3D46A 1L8NA 1EL3A 3WK3A 2C8NA 4KIEA 2O0TA 2PDLA 2GVGA 2QDEA 4GC4A 1NIUA 2A85A 1E9YB 1V02A 2FKPA 6REQB 4U3AA 5D2YA 4D1JA 1AH3A 1QO5A 3WLNA 3C0JA 3TX9A 2WBKA 5FF4A 4L65A 3T9PA 1XW8A 1MI3A 2WM0A 4MPKA 3QRHA 4NASA 5C9RA 1JQXA 4GO9A 1XLEA 1TJ2A 3W9ZA 1IXPA 4RLIA 4AYGA 3LHTA 3WH9A 2PODA 3TWAA 4GI4A 3H4GA 4UTIA 2JEPA 1VEMA 3RM4A 1A49A 2HRWA 2J7FA 4S3AA 3UEQA 3BW3A 4U5KA 3IJDA 2HPMA 4MJ4A 4MSSA 2WPBA 1Q63A 3THAA 3TCEA 1CGWA 1JG9A 4KWUA 3EDJA 1C7SA 4LBSA 4Z17A 4Q8MA 3VKKA 2RGMA 3KTCA 4WKFA 1KRCC 2QUVA 4EOUA 2E1DA 4QTGA 2VEMA 3TLLA 5K7JA 2ATMA 1DV7A 3VD9A 4DZHA 4R88A 1SM9A 5E9AA 1QK0A 1MW1A 4IT1A 1H60A 1OC6A 3A9BA 1G4SA 3TJXA 1Q5MA 3HPZA 1LROA 2A7NA 1GOOA 2ZXDA 1TUXA 1CXLA 4C6KA 4GFSA 4PFHA 5EY5A 4IXXA 6REQA 3WQPA 2NSXA 3DC0A 2YL9A 4PBEA 4ERGA 4P8XA 3ATYA 2VP8A 1UIOA 2BMBA 3EA3A 4JIEA 4PCNA 1IZCA 4ZE4A 3CV1A 3PN8A 4JOMA 4CD6A 3DESA 3P60A 2DSUA 3P7YA 4J2MA 3GC5A 1H5VA 4S3JA 1KFWA 2DU2A 5LA2A 2QT3A 3WYZA 4WQ6A 1WOBA 1E0TA 5J5RA 2REQB 5FF3A 5CZTA 2XIMA 2ZOXA 2RDXA 2WVTA 2AOSA 2PBGA 4Y6GA 1E6QM 2H9AA 2GVEA 1QI2A 3W7DA 4H6KA 4MNKA 2CBJA 2DSKA 3VZYA 1JYVA 2QVHA 1V4YA 4NNBA 4TMBA 4P5UA 4Q8NA 3CIWA 5GNXA 1AQMA 3RJXA 3B3DA 4KERA 1YXDA 4K36A 3BLPX 3GU2A 4CN6A 4MNLA 2PCQA 5BW6A 4AISA 3ANVA 4S3DA 4DYJA 4MDPA 3NQ6A 2J75A 5DQPA 1VBUA 3CUZA 3UJFA 3CXOA 5CSUA 2Z25A 3KBNA 2QCLA 5K9CA 4R7WA 4AD2A 4S2BA 3V0UA 1GZJA 1O94A 2FHCA 4A35A 2PLKA 2ZZ1A 3ID7A 4CCZA 3KS6A 1MEHA 3W7KA 1BSLA 4MF4A 3AXIA 3JUGA 2X1SA 4YYFA 3NL5A 2GWNA 2VX4A 3LCWA 2YB4A 3W1LA 1O6IA 3OJGA 1TPEA 2VHLA 1EBGA 3L23A 5CZSA 1MFUA 3QY7A 3STPA 4QLJA 3VDBA 2HS8A 4MZYA 3L2IA 1BKSA 3UCDA 4G8TA 2B7PA 3TOYA 1AJ2A 1J6OA 5CGMA 5EMMA 2D1ZA 3LDVA 3G5EA 1J9YA 1NF7A 5DCDA 1OCJA 3WMLA 2QR6A 3I7QA 4H41A 1NFBA 1OX5A 1EB3A 2D73A 4IP4A 5GNYA 1YYAA 3DEQA 2XIIA 2V5BA 1WV2A 2HROA 1NDYA 1QDSA 1BG4A 2WMIA 4C6MA 1B3YA 3LLDA 3MV01 2VUNA 2FZMA 3L4VA 3HV9A 3OW1A 5EB8A 3S8HA 2OODA 4HPJA 2PP1A 3XINA 3PSWA 2Z24A 1N8FA 4LCSA 5HNRA 4EKJA 2J8FA 3LI1A 3NQMA 3TN5A 4JKKA 4MTVA 4HHPA 4G7EA 3P6LA 4IFRA 4JL1A 4ZA0A 1X96A 1ZBCA 3DAQA 1KLYA 4PA8A 3PBYA 3A47A 5F1VA 5IM51 3AZSA 1Z89A 2OKOA 3VINA 2VGGA 2ZVRA 3RO6A 3ZT6A 5AYZA 3A24A 2J8GA 1AQFA 3ZVIA 3GG1A 2V2HA 4WIWA 3WQVA 3BICA 5IBXA 4J3UA 4PC8A 1SJAA 3NPWA 4W8LA 5EKYA 1BXCA 3P84A 1E40A 1J5SA 5BRQA 5EA9A 1F07A 2WJEA 4CNOA 1JCNA 1L6FA 4XB3A 4B16A 1OT1A 5D4YA 4IMCA 1S2UA 4R34A 4IXHA 2I9EA 4H04A 2Z1XA 1GPFA 4Y9NA 4LT9A 4N9EA 1UWIA 4TTGA 1M65A 1PAMA 2GLKA 4AQLA 3CUHA 1G67A 1XQLA 3V7PA 3GW0A 3ARXA 1ESWA 4D6IA 5FJIA 4IPLA 3VNDA 4OGZA 4GIRA 2YA2A 1QNVA 2YSWA 3GFXA 4CLMA 4P7QA 4ES4A 1JCTA 2GFTA 4Z1AA 4AVFA 2QDDA 2VNCA 4YVXA 3L5LA 1UHVA 1E0VA 3HG4A 3SCVA 5D09A 1EGMA 4F0MA 1KFJA 2HNEA 2J7HA 3B9NA 4E5TA 2QV4A 2C13A 2DVXA 4OBRA 3GC2A 3PNZA 3MTWA 3ES7A 1TE6A 2NX3A 3L0GA 5G1TA 3MCOA 4FLSA 3D0CA 1PIFA 4XAGA 3HGRA 4NZJA 1JGMA 4O28A 3T78A 4LW7A 3C0SA 2DZWA 1NVMA 4JICA 1JUKA 4NJGA 3ANUA 3OODA 1F73A 1FWHC 4HJFA 3JRKA 3QQWA 2VFDA 5A6BA 4FP1A 2CHOA 5LNVA 4O13A 1JXJA 1A3XA 4AD5A 1O7AA 3B8TA 4OIFA 2WC4A 1W9DM 3G2GA 3TSDA 3WCZA 4UTUA 2VKZG 4CU6A 3LMZA 3N9KA 1M01A 2YA0A 3BOFA 3JS3A 1I1XA 2IPFA 1EXBA 1XYFA 3CH0A 1WAUA 1H09A 3UA3A 5HA7A 2ZRWA 7REQB 3W01A 4ZO6A 4ZO7A 2YBVA 4HT3A 3S2MA 1D9EA 2ZX8A 4AZ6A 3L66A 4GBUA 1LT7A 4CGTA 1OGGA 3GNXA 4IUGA 3E49A 4PTWA 5HULA 1XLKA 1R9YA 3PNUA 3WNMA 4RXFA 4NSBA 3SUSA 3L2MA 1ENUA 3WMBA 5AYIA 2YR1A 4YWSA 4LOCA 1OBAA 5E0FA 4JNMA 3U2EA 3THDA 2E68A 1XI3A 1KBJA 1TO3A 4JQ2A 2XFRA 4UTJA 5TBOA 4RE4A 1ISWA 1A5AA 1ZGDA 4Z08A 4FOJA 4Z42C 1W1PA 4H4IA 3LZ3A 4GH3A 4JL2A 1L0PA 1M53A 4K8EA 2C19A 1IZJA 1FOBA 1J79A 2B0MA 1FH8A 3NR0A 3TE9A 3CYJA 2OB3A 3GU1A 3S9ZA 1RA0A 3RMJA 1UBSA 1E4NA 3NDZA 4EE9A 5AY7A 1MDLA 4C6DA 3TAOA 1YDVA 4LUJA 2OEKA 1G4PA 4Q3MA 1E4IA 1K7XA 5C0QA 2EO7A 2JEQA 4X0VA 2PRLA 1U5JA 3BLFA 1KV5A 2DW6A 2BSLA 1DWIM 4ROQA 2HVMA 3APYA 1M68A 1A5KC 4DB7A 1ZRQA 1V0NA 5DY2A 3VNJA 1TQJA 3UXKA 4Q4KA 1H7XA 4AFYA 1CGVA 2B7OA 1WDDA 3NAVA 3N04A 3GDKA 1W1B1 5HR6A 5AZ0A 2AMXA 3RCNA 3KFTA 4I8YA 1WKFA 4IIFA 1U33A 1VGAA 1RHCA 1J11A 2PDGA 2FZBA 4WJXA 5TQLA 1FP8A 1W56A 5FAJA 4EWJA 4W8BA 2OKTA 2ZFAA 2WSYA 3L4WA 3QR1A 3U5YA 4F4RA 1RH9A 5I07A 2HE5A 1R8LA 2PWDA 3MO4A 4ZO8A 1D8WA 3LLFA 5A8OA 2A2IA 2X8RA 4KRUA 2Y89A 4QAWA 3N2OA 1TCMA 3CT2A 3PZTA 3S5NA 1UIPA 3SN0A 3SQMA 4XIMA 3VIKA 1X6LA 1VJSA 8CGTA 1CXIA 4E8CA 2PB1A 4GJIA 2OELA 1HP5A 2H6RA 5I03A 3B97A 3FA5A 3PM6A 3JW7A 1C93A 1OFAA 4ADTA 2J47A 2QV5A 4DJFD 4DJEA 4GY1A 3UZZA 3V5FA 3W2KA 2GOKA 4OUEA 4CQCA 3VZXA 1PZ1A 5D37A 1LWHA 3VOCA 1NTHA 2B31A 1R87A 2NQ9A 4ACZA 4B4HA 1TJPA 2OSXA 4M6UA 3SJ3A 4E4UA 3CIXA 4P7OA 1EYWA 3S6DA 1VD6A 3R1ZA 4XZIA 1LWJA 1GORA 2PBOA 5IRPA 2CU0A 2GYIA 2GZXA 1JNEA 2H8ZA 1HG3A 4FIQA 3W22A 2X05A 1A5LC 1VYRA 2VURA 3N9SA 1PTAA 4IFKA 3BANA 3UU0A 1LUCB 4DUOA 3ZS4A 3W72A 1PB0A 3RLHA 3MSDA 3RCYA 1PVNA 5KETA 1V08A 5CPNA 3S47A 4DJDA 4LB3A 1QI4A 4QAIA 3TYZA 1FWJC 1PYFA 1X98A 3E6EA 4I7UA 3TR9A 2TSYA 2G97A 4AVOA 2WZMA 4YTUA 4A21A 2ON3A 4PMJA 4ZQMA 2G3JA 4I5XA 5CC6A 3BSGA 1H7WA 4L9XA 3LCHA 1Q6RA 3EWZA 2QCDB 4QSFA 2W61A 3IVUA 5EBAA 2VEFA 1GVFA 3PUEA 3T0BA 1PTGA 1GOIA 3SJNA 2AKMA 2GOUA 2PWHA 3SW6A 3PK7A 3CAWA 3D5HA 1SSGA 1ADSA 1H7NA 3I3BA 2GQ9A 3E38A 2FFIA 2NV2A 4PMXA 1IZKA 4JTDA 3BSHA 4W85A 3WF2A 3QPZA 2DJXA 4JX6A 3T0DA 2YCEA 4O10A 1ICSA 2YBUA 3AUOA 1KRBC 1KC7A 3CTLA 6ENLA 3LQLA 4IGSA 1TKKA 1WXJA 1VIWA 3NGFA 2KAUC 4ICMA 3ARQA 3BAJA 3P5YA 2PGEA 3BCFA 3LTYA 3VDCA 3FAXA 3I6TA 1KTBA 3VGDA 1QI0A 2ACSA 3LHWA 3HOJA 2DPEA 5A6LA 5I0DA 1BVZA 2Y8UA 3VYLA 1UR2A 1LUCA 4JQ4A 1XRFA 3SGZA 1YQ2A 3WNOA 1BKHA 3IS4A 3OHIA 1OADA 1CGTA 4M0XA 4YJ5A 1PE1A 4J2PA 4ZOAA 1W1YA 2XH0A 2DUAA 5E93A 3WQGA 3PZVA 4H6QA 1GVYA 4YU1A 2OLAA 4QIUA 3ZJ6A 3M0MA 1R3SA 5T91A 3GG8A 8RUCA 1RR2A 2PU0A 1V6YA 1LBFA 2VRKA 1EC7A 3WUGA 4JS3A 3VIHA 3TROA 2ZZ4A 3NTYA 4AF0A 2XZ9A 4LANA 5HWNA 1JAKA 4GH1A 1JULA 3WEOA 4A2SA 2QCDA 2RUSA 4BK9A 2CLFA 2O4MA 1IWAA 5BWAA 1S5TA 2J74A 1XKYA 5LNSA 3WDPP 3HO8A 2YDRA 2GQ3A 1XPGA 3S2LA 4A3QA 3MZ2A 2O55A 5H2ZA 4EAYA 3U6WA 1V0MA 3G1SA 4NNAA 3RIKA 3LMYA 3MMUA 1SYTA 5HINA 1OCBA 3T2QA 4C1NB 3RX3A 2Y2WA 6A3HA 2HVOA 3RITA 2IMRA 3EDEA 4MMWA 4H9XA 3ECQA 1HJXA 4HU8A 4WOQA 3VMOA 3BURA 3UR7A 3H2CA 3AYVA 1O5RA 4RPPA 3TYBA 2OQLA 5L9FA 4S39A 3F4VA 4NX5A 1RP8A 2NQLA 4KRTA 1M04A 4QJ3B 3AMKA 3HQ1A 5A8PA 3CHEA 4FNUA 2E8YA 3M41A 4KESA 1OFEA 5T8GA 3UZ5A 1YBQB 1B3VA 2A3LA 2QDGA 4GXPA 3H21A 2PURA 4FNTA 4OBTA 1UP2A 4B3LA 4GUJA 3ZVHB 3R12A 3UXAA 4M80A 5ECVA 3RX4A 4C5ZA 3KHJA 3CQJA 3ZR5A 3EOLA 4ICNA 4YNGA 4PMYA 4DWSA 2BHZA 2D2GA 2WKJA 1C7TA 1RBOB 1K4GA 1XSKA 3FHAA 4KCWA 3FJ4A 4FB7A 3MI6A 2WJZA 1T6MA 2CKRA 2D23A 3GAYA 2DVTA 2Y5SA 2VR2A 3ANYA 3PJUA 3GY1A 4DF1A 2NXHA 5FJUA 3H2AA 3N4EA 1JFHA 3IVTA 4HU3A 1VPXA 2ZC8A 3AS1A 3BTNA 4QITA 4Q4PA 4CN1A 1CENA 2Z1SA 1ONEA 1H50A 4RNIA 4KEUA 3W7MA 2V38A 2QUMA 1T8XA 1O12A 4DF0A 4JCMA 3UERA 4Y7EA 4MWAB 1GOWA 3TH6A 4PFMA 4QM1A 4W7VA 1L2QA 4FPSA 4XZ9A 3BC9A 1FUYA 1QPKA 3R89A 3G1AA 2F84A 3FN9A 4PCFA 4YIWA 2BGQA 2FHFA 2YLLA 1TQXA 3B9AA 5ABFA 4X0NA 1GQIA 3W6MA 1QHOA 3T0TA 4BQ4A 2FB2A 4C5YA 3WUEA 2XINA 1POJA 1DWAM 2PDMA 1UUOA 3E0FA 4B5TA 9XIAA 3UXIA 4XAPA 4YTTA 3VNLA 4CQ9A 1P0EA 1LWIA 4DNMA 4XD3A 4OV9A 1FY6A 1Q4WA 1W1A1 4IIHA 4UZSA 3F5LA 4YCOA 4OFCA 5DEZA 2D20A 5FD0A 1VHNA 2O9OA 1MW3A 4DO4A 2C6QA 4Q8TA 3H24A 3QOKA 3A3WA 4OECA 3VM5A 3EB3A 3NSNA 5REQB 2QEZA 2BVTA 2XWEA 1FWBC 4WLCA 4FOUA 3F4CA 3SR7A 4R7JA 3VX1A 1JPKA 3OG2A 5BOOA 1XC4A 3IIXA 4O52A 3RLGA 4AIOA 1E71M 2QQ6A 5C5YA 3ARYA 3IAQA 4IWWA 1FWIC 4NZFA 2XFYA 4Q8UA 3TFXA 3HF3A 5LIKX 2FB3A 3B8SA 3OEXA 3OA5A 2E1WA 4MZ1A 1TPDA 1EO7A 4HOXA 4D71A 4KRZA 4XZNX 1UP0A 3HQNA 4BWLC 2ZVIA 4TU1A 2A79A 1VHCA 1OYBA 1EKOA 3HPXA 2PS2A 5A6MA 4JYEA 4C6JA 4LVFA 2XN2A 2QF7A 3B04A 2A3CA 1MSSA 5EYWA 4Q8QA 3W1UA 2XM1A 4D6CA 1US3A 3WFAA 1TZ9A 3DOPA 4O0ZA 1EJRC 4W8AA 1X38A 3MSGA 4D6GA 4FXSA 4G1NA 3BLIA 1VQTA 4O12A 3EDDA 2JFEX 3GXMA 3NZRA 4HNLA 4IICA 4JX5A 4A8IA 1N82A 2POTA 4AX6A 2GUUA 4JTRA 3UPBA 1CXKA 3BO9A 2AKZA 3KEHA 2OSWA 2PD5A 4O1AA 1EPXA 3W6LA 2P8BA 3BUVA 1OGSA 3H8AA 2DW7A 3NQCA 1AMKA 1B9ZA 3NYZA 4AXNA 1PPIA 2JIEA 1I9CB 2J6VA 1HZYA 1RJRA 4GUHA 2ASHA 3VILA 2QLYA 3HU7A 2A6NA 1EPVA 4W88A 3EPNA 4ORMA 4A05A 4XAZA 2Y7GA 5CPOA 3AIRA 3RR1A 1E6ZA 4MY1A 2XH4A 3VUSA 2WNWA 5KZ6A 3EAUA 4DO5A 4C6BA 1KXTA 4Z2HA 5CG7A 3QKZA 5I23A 1EHAA 4CU7A 4JXCA 3OGSA 4CNSA 1HKJA 1QBAA 4K8HA 4GUFA 3MUCA 4A3UA 2YKKA 3QV6A 4CEUC 1YPIA 3VKBA 1XJBA 4KEZA 2D2JA 4Y8EA 1Q6DA 1UMLA 4IFOA 4FX6M 1HKKA 3GXIA 2C16A 4C60A 1U30A 1GOKA 2ALRA 2ISVA 3BAYA 3E12A 1ZB5A 3S5OA 3URQA 5I3HA 2PDIA 4H8HA 5HPCA 1CXEA 3C8NA 3GKFA 3R58A 3BMXA 2AQOA 3KXQA 4UFJA 4QNEA 3NL6A 3QPYA 1KBIA 1G4EA 4V15A 3ZLGA 5HNUA 5A6AA 4L4OA 1RY8A 1FFQA 1TR1A 1M7PA 3AIQA 3K13A 1FWGC 4HSHA 4G6CA 3LPGA 1SO4A 3PPHA 2YBTA 4NJHA 3EZ4A 1OCNA 4GVGA 3B06A 3S83A 3TNBA 2PCEA 4L1WA 2BVWA 3W7HA 3AFBA 4EF8A 3WQ8A 4MLJA 2ZCGA 3IRDA 3PBVA 3DYOA 2G37A 3QGKC 1DYSA 1MZHA 2ISDA 3W4RA 1BHGA 2CWNA 3H70A 1R2TA 4AVNA 4L4PA 1J0IA 5HR7A 4QE1A 5H6HA 3M0VA 3ABRA 2G96A 1W2PA 3LCLA 4H7ZA 2R1MA 1C9WA 2I5IA 4JDYA 1K6WA 2FGZA 1TZ7A 3AICA 2Z6IA 3FY1A 3GHRA 1SZNA 5HDRA 2V3EA 1RP9A 1TMHA 1EO5A 1EC9A 4C6CA 3ARTA 3KBVA 4Y9AA 4GX9A 1ICPA 2R82A 3VGHA 1BYBA 3KHDA 2WNNA 1H49A 1BQCA 3IJ9A 2UV8G 3WBAA 3LBCA 4ZOBA 2Y8VA 1H1NA 4XVDA 4CD4A 3QMTA 1PX3A 1FCQA 3AAMA 3N9RA 1F3TA 2PDUA 2YCLB 4UBPC 3TTSA 3G0XA 1MUCA 1NQ6A 3CLWA 1HGYA 1BAGA 2JBMA 3O8AA 3GH4A 1XG3A 3EA2A 3OIXA 1R2SA 4QHRA 2MANA 1B2YA 4BEQA 4H9MA 1S3TC 3SFKA 3MUXA 1EP2A 1A53A 4UFMA 4KKXA 2XTKA 4HA3A 3TQVA 1LQAA 1DPMA 3POCA