4HN4A

Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
268
structure length
268
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 103
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hn4A00
1X7FA 4O16A 5LNSA 1JUEA 4E38A 1W37A 3HF3A 2Y61A 4UUIA 3RLVA 3NPXA 5FEXA 6TIMA 1QFEA 2Y89A 3NQ2A 4BI5A 5AC6A 3QQ1A 2A6NA 3R2GA 5C2XA 1GVFA 3PSWA 4MKNA 5LKYA 1OYBA 1EPXA 2ZRYA 4Z1DA 1FCUA 1TREA 2FPYA 4RLIA 3L21A 4XBKA 4DPPA 1KFBA 1OX6A 1F76A 3O16A 3OHIA 4FNPA 3CEUA 4TIMA 4ZQPA 4JX4A 3P8JA 1KM3A 4RJEA 1GG1A 4NJGA 2VEIA 4IMCA 3F1QA 3C52A 1HG3A 4RV8A 4CQ8A 1YDOA 4DF0A 1JRBA 4B5NA 5AC7A 5E1QA 4X22A 4N2YA 4JTLA 5DY2A 1K7FA 4NT0A 2A1YA 5D38A 4AXKA 3UWWA 3E9AA 2Q3RA 5CZJA 1DORA 3GR8A 1LDCA 5CSRA 4U4MA 2ALDA 3A23A 4N6EA 1CW2A 3DFOA 1YPIA 4HN4A 3HG5A 2FDSA 3PSVA 3QQ0A 3OA3A 3ATYA 4JTTA 5BMWA 1A5AA 2NX1A 3HGOA 3W7IA 3NYZA 5C6MA 6ALDA 2V82A 2C6QA 3E02A 3ZS4A 2E1DA 4OGZA 1DJQA 3GNDA 5HJLA 1H5YA 4N4PA 2ZA3A 3W1LA 4JD4A 1TPC1 1VZWA 4LV9A 2Y7DA 5DN1A 3FIGA 4RCXA 3BGGA 5F2LA 2QCDB 2ZTJA 4M6QA 5HUOA 1I8JA 1WA3A 1O94A 1XC4A 3V75A 3FKRA 2AQWA 1TV8A 1V7YA 1RR2A 3S5OA 4GWEA 3N19B 4P61A 3TMQA 3GXTA 4K38A 2V5LA 4ONVA 1K3UA 3NGJA 1KFCA 1MZHA 3OVRA 3S5NA 4JTSA 1KM0A 1U83A 1F6PA 5CGQA 3B0PA 4QIUA 4HSOA 1W54A 3LCXA 2ZQ0A 4GC4A 1SZEA 1JVNA 1VCGA 3NNTA 3NQFA 1KTCA 4JS3A 2ZZ3A 3S1XA 1IXPA 3W74A 3C2OA 3MHFA 1WQ5A 3OG3A 4KFNA 1TRIA 3M47A 2ZRWA 1IGSA 1Q6LA 3THAA 1LCOA 2VOMA 4PH6A 2FQIA 1GTHA 4AHQA 1NF0A 3W70A 3FKKA 4DQWA 3G3DA 1W5OA 5AHFA 2AAMA 1W5NA 1LRNA 2OZ0A 4RXFA 5E93A 2X30A 1H7RA 4ZQOA 1GZGA 2C18A 2NUYA 1DQXA 4WY0B 3OBKA 5HMSA 4RXGA 2XN2A 4MVAA 4HNTA 4UNKA 1ML1A 2X1UA 3M0ZA 3W2NA 4OWGA 1PCWA 3QMSA 5CKSA 4H6KA 1S5TA 4BI7A 4BI6A 1D3GA 3P5YA 4EF9A 2DZUA 4WJEA 2B4GA 3A9IA 1QOQA 2YFOA 4WOZA 2H6RA 5AB3A 2X1RA 3MW7A 2Z6JA 3P84A 2CZFA 3FOKA 4LS1A 5G5IA 3TKFA 3S1VA 3L5AA 1EP1A 2QKFA 5KITA 2A7NA 2G95A 1QDSA 1X1ZA 2P1FA 3CIXA 4GNJA 1NFBA 1TMHA 2VFGA 3G1SA 3W1NA 2NX3A 4LVDA 4O15A 4OHQA 4UMBA 4LS2A 1I2NA 1RV8A 4IGHA 5EBUA 4M5PA 3S1UA 5AN7A 3W71A 1ALDA 3CQ0A 2RDWA 3GYEA 3R13A 1QWGA 3DHDA 1FWWA 5F2IA 3KRUA 1PS9A 3KFTA 4MY8A 1QAPA 3LBMA 1I2QA 1OFRA 1LYXA 3UWYA 3SJ3A 3C2FA 1GVQA 2W6RA 1WOBA 1KTBA 3P67A 2NWRA 5I3FA 1AL7A 1OFDA 2J24A 2TPSA 3MBFA 3NQ8A 2ZZ1A 3L0GA 3LCGA 4NUWA 2CZDA 2DP3A 3GDMA 3BW4A 4GUHA 3MWAA 1LRTA 1DKWA 1ICSA 1RQEA 1YXYA 3W75A 3CHVA 2GVGA 5FI8A 1H7XA 3MBDA 2CLMA 3MMTA 3SGUA 4RKAA 1O95A 5AYYA 5F4SA 5GVJA 1J5TA 4FX8A 4H3DA 1L9WA 3FYPA 4LC8A 2I1OA 4YMZA 1Q6QA 1YADA 4UTWA 1GEQA 3NXFA 1Q3NA 2C15A 1GVRA 3IVUA 3P5ZA 5I3JA 2A2IA 4IMGA 4KWVA 3INPA 3S5YA 2WNNA 3PUDA 5D04C 4FIRA 1GVOA 3ABQA 3BVJA 3NQCA 1MEIA 2G5WA 2WNZA 1SPQA 4M7TA 1TTQA 1DBTA 3LCHA 2A21A 1FCQA 2PCQA 4GUGA 1SO3A 4UTTA 1KBIA 3A22A 4OT7A 1X1OA 3EWUA 3UPBA 3HPSA 4K37A 1KFJA 5AHIA 1JCMP 5I3HA 4I7VA 3SFKA 5EKYA 3M9YA 2ZZ2A 3CWOX 1O5XA 4ZQNA 1XKYA 2V5BA 3LOTA 3Q2DA 3G1XA 4O1CA 1ICQA 4S2CA 3GDRA 3DH7A 5K9XA 1YLVA 2DZSA 3TNOA 1T99A 3NVTA 1GOXA 3CC1A 3GZ3A 1N8FA 1PE1A 3G1YA 3AJXA 3TAOA 1PV8A 1VYPX 5H91A 3ABOA 4NZJA 5K9DA 4O50A 5EMUA 1OX4A 2E77A 2YYTA 2YPIA 1W5MA 3WK3A 4AH7A 4Q32A 2WV8A 3THQA 5BMXA 4WD0A 3CB8A 2CLFA 4NQ1A 4MZYA 1BEUA 1VYRA 1KV8A 1IXQA 3QFEA 4O1BA 1DJNA 1FY6A 4JTUA 2RFGA 3EWXA 1OFEA 1IXOA 1IXNA 2O7QA 1OFAA 4J9JA 3TJXA 2CFFA 2J88A 4QJ1A 3QSRA 3T40A 4NNAA 4MLRA 3EX1A 1YYAA 2QEZA 1ZAHA 3HPZA 3PS7A 5EA9A 2V2DA 2CLOA 3HIJA 2O7SA 3TROA 3MYOA 2X1TA 2Y7EA 1HFBA 1WX0A 2B7PA 4IPJA 2J27A 5F4XA 3STCA 1YXCA 3ZFHA 3W7KA 2JKEA 3QSTA 4XWUA 3SW6A 3W7RA 1JULA 2Y63A 3C0JA 1TQJA 3T78A 1OK4A 3KOFA 1RD5A 4YCPA 2GOUA 3WJYA 2FIQA 1JCYA 3S6DA 3NAVA 4ADSA 4R53A 3MI6A 1U5JA 4WXYA 1B57A 1SW7A 2B7QA 5BNKA 4PA8A 3PBWA 1FWRA 3VNDA 2HS6A 5EYWA 2QUTA 4YLWA 2NXHA 4GXMA 2QF7A 5FESA 3BW3A 4AWUA 4JN6A 3HG2A 1LLWA 1ZNNA 3FJ6A 1G69A 4Z0SA 3O6DA 1SSDA 3SIZA 3W72A 3QEZA 7TIMA 4GUFA 2Y6ZA 4EWND 2WSRA 3W2KA 5IBXC 3MP4A 3W1UA 4Q33A 1L6YA 2BZNA 3PF3A 1TPUA 4NJKA 1TTIA 1GJPA 3PAJA 3B04A 4RK8A 1SO5A 4JTIA 1P5BA 4DBEA 4WX2A 3M5ZA 1A5BA 1AL8A 3C6CA 5D2TA 3QMRA 4JYDA 3W7HA 1GYNA 2ZA2A 4JR5A 1GQNA 1G7VA 1TSIA 4JDYA 3WJWA 2EF9A 1SFLA 4AF0A 3EXSA 1WDWA 3EWZA 4POCA 1UBSA 2Y7GA 3G0UA 1EWEA 2FPVA 3WJZA 3UNDA 3CEPA 4TU1A 3TQKA 3SGZA 4BWLC 4CCEA 1W3IA 5CZ0A 3TCEA 4HIBA 3T4CA 3VCRA 3W7CA 1Z42A 2Y62A 2YZRA 1LRQA 5AFDA 3QW3A 4R34A 3K30A 3RNDA 3VKJA 4UXDA 4X3ZA 3G24A 4A29A 3TQ0A 2DZPA 1EUAA 4DO5A 1ZAJA 4K7VA 1OFQA 5A8GA 2ZZ4A 1RZMA 3L66A 4EIVA 4ZVJA 2RDUA 4UNLA 5CPLA 1BWLA 1OF6A 3PWAA 4JTKA 4ZQCA 5G1YA 5L6UA 4XZ9A 1EUNA 2Z0IA 2CWNA 3G8EA 3Q37A 4UFLA 1FDJA 3NZ1A 1W56A 2FJKA 2IQTA 2R94A 3UZJA 4XQ6A 4PCFA 4IMEA 3HMJG 2ZRZA 3MJYA 4O19A 1PIIA 3UZ5A 3LLFA 3P74A 1G4PA 3QM3A 4HSNA 1G67A 2WOQA 4LY8A 3IRDA 2DZVA 4HNNA 1OYCA 1BTMA 4QISA 4ML9A 2QCFA 3Q94A 5FF2A 3G0XA 3N2MA 1EIXA 1QO5A 3GVGA 2FPTA 5LNWA 5G1TA 2GQAA 1MXSA 1F5ZA 3NM3A 3UWVA 5F1VA 3IIXA 3DI1A 4ZQMA 5TIMA 1DHPA 3M7WA 1R2RA 4I9AA 2V81A 4TMBA 5DXXA 2V30A 4BWLA 5CPMA 1O5KA 2PRHA 4JY8A 1S5WA 1LLZA 2NLIA 2ZZ7A 3NOEA 3RLUA 5D2XA 1SW0A 5HWJA 3WFAA 1L6SA 1KFLA 2CLHA 2YDAA 1ADOA 4CCDA 4NNCA 2WQPA 2JKAA 3TAKA 1QNVA 2J9XA 1O60A 1J4EA 3L0NA 3NPWA 1A5CA 1LROA 3FJLA 4O12A 5BOOA 3S1WA 2JGQA 1W1ZA 3N73A 2HSAA 1KW1A 2BXVA 4QSHA 3WJXA 1UCWA 1H7WA 5G2HA 3CIWA 4MZ1A 1PCKA 3DXIA 3FS2A 1JCXA 5CPNA 3U6WA 4C1LA 3W85A 1EP3A 5LGXA 1XBYA 3GR7A 1THFD 4A2RA 4O52A 3BGJA 3NO5A 1F05A 1TJPA 1SQ7A 5CSSA 4YWIA 3F4NA 1ME8A 3TW7A 4TO8A 3N14A 5HR6A 3UQNA 3LV6A 2YSWA 3KX6A 1TTPA 3TFCA 1R47A 4MY1A 5K3VA 2QJGA 2QAPA 5TQLA 3JS3A 5LNUA 1H7PA 4HHPA 1NEYA 4Z1BA 3TIMA 3LLDA 4IXXA 3IIPA 1VCFA 1OVDA 2A0NA 2EKCA 4IMFA 4EF8A 4CCCA 3E12A 4W9TA 3W7PA 3C61A 3QYQA 4LTSA 1JUKA 3HOJA 5FEWA 4D2JA 5HWNA 1G4TA 2GPTA 2V2CA 3TDFA 4OV9A 5L9FA 1GT8A 2Q8LA 1DVJA 5KINA 4R33A 3TR2A 2RKXA 3WK2A 5K4XA 4ZZ9A 4JX5A 1QO2A 5FF7A 5EL1A 4UCGA 5AYZA 2NWSA 4UIOA 3NZRA 2F84A 2ZZ5A 2A7RA 4LOCA 3QMTA 4ZMGA 3HO8A 3NPUA 2DZTA 4A21A 2GQ9A 3MHGA 4FNQA 4NNBA 3W84A 5CZTA 4TX9A 5I3KA 1SZGA 3LRKA 2EGZA 4GE8A 1K8YA 4A3UA 3BG3A 3EB2A 2B7NA 1NSJA 1XL9A 3W1TA 3G18A 1LP6A 3UWUA 3T7VA 3NQDA 3TX9A 1FDZA 4LUIA 8TIMA 2E6FA 3B4UA 4O1AA 3R8RA 3E49A 1KM1A 1WXJA 3GXNA 4LVAA 5HNRA 1F7BA 3TU9A 1HUVA 2ZBTA 4H4IA 2ZTKA 3M5VA 4UFJA 1RVGA 1XUZA 1YPFA 2DU2A 3PBYA 1EB3A 3CWNA 1TV7A 4DEFA 1W31A 1T0OA 3LHVA 2VXNA 3W76A 2BX7A 3LB0A 4OQVA 3DFTA 1EX5A 4JYEA 4AVFA 5BRBA 3G8RA 2R8WA 3KXQA 3LGEA 2ZZ6A 4GFSA 3SECA 3RF9A 3QZEA 3UY8A 3CM4A 1M7PA 4O28A 2P0OA 4O11A 3G1HA 3ZWTA 5LZLA 3PUEA 4UFHA 1BKSA 2R91A 1I45A 2QCGA 3O05A 1JRCA 3W86A 1YTDA 3C56A 1QPRA 3MYPA 2YXGA 3DZ1A 3LTYA 3TSDA 3E0IA 3M41A 1OX4B 2GVJA 3CTLA 5U7SA 1WV2A 3S8HA 1CI1A 2H8XA 3PB0A 4UTLA 4K7YA 1QR7A 2ABBA 3DGRA 1FXPA 1TCDA 2NV2A 4UMCA 5F1UA 3BK0A 1KM4A 3OIXA 3BLEA 2C0AA 1TPDA 3VI2A 3TUUA 3ZR4A 1B3OA 2Y70A 4R7JA 3W3OA 3G0SA 3B8DA 5AHMA 4LW7A 5AOUA 1TB3A 3PBVA 1M5WA 3PM6A 5DCDA 1FCVA 4M19A 2GUUA 3N9RA 1IIGA 2BWGA 1OFBA 1N7KA 3TH6A 3TSBA 1D9EA 4G1KA 3O1NA 5SWUA 4JTHA 3LCFA 1CX9A 4UMAA 4EVZA 3O6CA 2ZA1A 3SI9A 3OEXA 1XDLA 3HG3A 1SR9A 3W6YA 3DENA 4BF9A 2X16A 4FEZA 1HO1A 2B0MA 4MYXA 3SZ8A 4WY0A 3TQVA 1V5XA 2AGKA 4M6VA 3T44A 1UUOA 3L9CA 5IM51 4RX0A 1RQHA 4JTGA 2FB2A 3TC6A 3EKLA 3UYCA 3L2IA 3KAOA 4E2DA 3LX9A 4O4WA 3VFLA 4U28A 3G1DA 3KHJA 3BARA 3GK0A 1IIHA 4UFKA 3BLIA 4Y96A 2C16A 3EEGA 4HNUA 1OJXA 4IX2A 2DZWA 1QCWA 5DBTA 2H3BA 4IJBA 4K8HA 2RDTA 1EP2A 3QF0A 3P82A 3I7QA 4I7UA 3WK1A 1C9DA 3IGUA 4N9CA 4XBSA 5E0KA 3NEVA 2QCHA 3N3MA 3C3NA 2PE4A 1Z44A 3WK0A 3VE7A 4KWWA 2FTPA 1TQXA 2Q8ZA 1YXDA 1KLZA 2Y7FA 3IVSA 1W3TA 1LZOA 2A85A 4RZ4A 3MO7A 4IOTA 2CLLA 4IX0A 5EPDA 5F4WA 1GYLA 3I65A 4LUJA 4LRTA 4AF0B 1OFPA 4O17A 4WXZA 3HGRA 4Z08A 2Y88A 3OVPA 1SZNA 3HB9A 3NL3A 4FNRA 1I2PA 3KVMA 2VENA 4Q4KA 1FX6A 1SU5A 3IIOA 2XN0A 3WJSA 5D32A 3QPYA 3HPXA 1LOSA 3M5XA 2JGYA 4XKYB 3TK7A 1DV7A 5D33A 2NZLA 1QOPA 1A53A 1MEWA 3PY2A 3QJAA 4OU1A 2VFHA 4JTEA 4O14A 1JUBA 3UPWA 5HR7A 1M7OA 5CZSA 3O06A 5ABTA 5H2ZA 1Q45A 3H53A 4Z1AA 1Q6OA 2VFDA 5K2ZA 2ZFAA 4MJMA 4XUGA 4O57A 2HTMA 1TYGA 4NVTA 1X6UA 1SZFA 1C29A 2WKJA 4UTIA 4OV4A 2ZCGA 2EPHA 4HPXA 2GJLA 3EX4A 1KV5A 5AYXA 3BPWA 2VEMA 5CG7A 3W07A 3UY7A 3LM7A 2ISWA 3LCIA 1TJRA 1VYSX 2QAFA 3U2OA 3IIVA 1JR1A 3LHZA 1TPB1 5D30A 1VH7A 3P81A 1Z41A 3CPRA 4ALDA 4FO4A 4IWWA 3NQGA 2ATMA 2A6LA 3W7LA 1H50A 3NR0A 4PL2A 1G4SA 2Z1BA 2OT1A 3QRHA 1P0KA 5F2MA 1AG1O 1ME9A 3C2VA 2C14A 1W5QA 3SY5A 1FQ0A 1LOQA 3PC0A 3W1XA 3TC7A 3S42A 1R30A 4A2SA 1TPVA 3DKLA 4MLJA 1PL9A 2LLEA 3GDTA 3EXTA 1F2JA 4Z0JA 3W23A 1E51A 1FXQA 1C8VA 3A21A 3MHUA 1PHWA 5LNRA 3EWYA 1ZALA 2NXGA 2OT0A 1VLIA 3TV8A 2E68A 2GVLA 1JCNA 5DCEA 1ZHAA 1TRDA 3STEA 1H61A 1VHNA 3W7MA 1HTIA 3LRMA 4QAIA 1W8SA 2R14A 3DU0A 1I4NA 3S9YA 2C19A 1UASA 3O6YX 3L5LA 3UWQA 1K7EA 4MIMA 2BLEA 5KSWA 3JRKA 1ZFJA 3IV3A 4IQLA 1Y0EA 3PG9A 3GDLA 3W7EA 3L68A 1A50A 4FNUA 3O63A 1G4EA 1B9BA 3I7RA 1B4KA 1TO3A 4K39A 1W0MA 4HT3A 2YW3A 4LC6A 4XTDA 3UXDA 5D09A 2YCEA 1WYIA 1WBHA 2A4AA 3DFSA 4JEQA 5IBXA 2OX1A 4YL2A 3STFA 3YPIA 4FHAA 2W79A 4LU0A 1VLWA 2I9EA 2JBMA 4E2BA 2VEPA 2JKPA 3A5FA 3BG9A 4FX7A 3ABSA 3SSJA 1K02A 4IPIA 1JQXA 1K03A 1VR6A 4ADTA 3LHTA 4IXHA 1UJPA 4WZHA 3R12A 1AW1A 1ZJIA 4CNOA 3DI0A 1PHQA 1T96A 4UC5A 4GUJA 1ZY9A 4FIQA 4RZ6A 4Y8FA 4UTMA 2OCZA 4WY0F 1XBXA 3P7YA 2P10A 2PC4A 3C8FA 2VKZG 3MI2A 1SSGA 1UB3A 2QDHA 4O13A 1UUMA 3GB6A 3W88A 1K8ZA 3TA6A 3H55A 3QPZA 5HWMA 2X2GA 2VEKA 2G96A 4I7WA 3DAQA 2WO5A 4AWTA 5BW6A 1I2RA 3HGJA 5C55A 3M44A 3G1AA 2G97A 2YW4A 4DXVA 4DF2A 4C1KA 5DY3A 1LM1A 1BWKA 4UFMA 4JY9A 2NUXA 3M43A 1JJKA 4S2BA 3O8AA 3A24A 4AWSA 4LVBA 3O15A 4N9EA 4WUIA 3NM1A 1HO4A 3GX9A 1FWTA 3ANYA 2EAWA 2Z6IA 4E0CA 4PEKA 4KFPA 2GQ8A 5MHBA 1PVNA 2OJPA 4K6AA 3TXVA 1XUUA 3LRLA 1H7OA 1LBFA 4KKXA 3I6RA 2C13A 3HJZA 1R2SA 1Z48A 1B4EA 1XCFA 2VC6A 3VE9A 4DO6A 4ORMA 5FF3A 5AC8A 3RMJA 2Q3OA 2V8ZA 4JYFA 3P61A 1SFJA 4P2VA 2OMAA 2YGYA 3EX6A 4JTJA 3LI1A 4FF7A 4BFAA 3LTPA 3W9ZA 2GJNA 3L67A 3LDVA 1OABA 3NQ6A 3S5ZA 3V1PA 5KTLA 3G1VA 2H8ZA 2TRSA 3W7DA 3D0CA 3TSMA 3CU2A 3N9SA 1FWSA 1OF8A 2HMCA 1KM6A 3P60A 1H7NA 4HPJA 4LWWA 2PRLA 5K9CA 2J9ZA 5T26A 4PL1A 5EY5A 2NUWA 3M6YA 4UTUA 4X9SA 1A5SA 1KLYA 2Z2UA 5DLCA 2XFWA 2TSYA 1ZENA 3GXPA 2PRMA 3E96A 1EWDA 3NQMA 5D05A 2NXIA 2YX0A 2F7FA 3MI3A 3LHUA 3NQAA 3KRSA 1VHCA 1MO0A 5A5WA 3P80A 4UFIA 3KVLA 4CQ9A 3EKZA 3L65A 3NG3A 2QJIA 2QR6A 3GAYA 3KVKA 3PULA 2DORA 4ICNA 3LERA 3DFPA 4O8RA 5FEZA 3LV5A 5J5DA 5D2WA 2VFEA 3LBCA 5G2WA 2JK2A 3LXAA 4O10A 1F74A 5J5RA 1VQTA 3S0CA 1VRDA 3PVFA 2H3DA 3FLUA 2B7OA 3NA8A 2QCMA 4JICA 1LORA 4A22A 2WPBA 3P62A 1SW3A 5DXYA 4QM1A 3Q58A 1AW2A 1KM5A 1IF2A 2Y85A 3TMLA 2EHHA 2HS8A 4N4QA 5AHNA 1LBMA 1SO4A 4O18A 1FDYA 2DJXA 4NXKA 4N9DA 4UTJA 2CZEA 3TJLA 3W7GA 1MEHA 3KVJA 1S3HA 4GRSA 4L4MA 2ATSA 3F4WA 3GLCA 3N34A 4MY9A 1FCBA 4UTWC 2PURA 3ELFA 1R46A 4DELA 3G3MA 1P4CA 5LGZA 1TIMA 4N6FA 1G7UA 1K7XA 2V9DA 4N02A 2FLIA 1ICPA 2YFNA 5DCBA 4MZ8A 3H54A 3JR2A 2V2HA 4DBDA 1FWNA 1W5PA 2CU0A 1TPH1 4NX5A 2CLIA 4FNSA 1RPXA 5AHEA 2VELA 4NZFA 3FFSA 2QCDA 1WAUA 4Y90A 3STGA 2QCCA 3QC3A 1NF7A 1DL3A 4JDBA 1VGAA 4UTTC 4TR9A 1MSSA 3W2UA 3MP3A 4O54A 3EWWA 3NL2A 1JQVA 4S1FA 3CLMA 4L4LA 1M6JA 3I68A 3TXZA 5DBUA 4K36A 4Y6GA 4JX6A 4NJIA 2QCNA 3NPVA 3ABRA 4JIPA 5K7JA 1FBAA 4OE7A 1F73A 4IUOA 4AHOA 2E09A 2DZXA 4JXCA 5D03A 4AHPA 3TW6A 1TPEA 1ZAIA 1TPFA 4PTNA 5HINA 2ZRXA 3IVTA 5C5YA 4BK9A 3TFXA 2QDGA 3W1QA 4AEOA 3L0KA 1G6CA 3LHWA 3QH2A 1DOSA 3GNNA 2ZRUA 1OG0A 3W7OA 4BR1A 1TV5A 1F6KA 3GIYA 2E5CA 5I3GA 2WNQA 1WOAA 3FEMA 2QCLA 2ISVA 3W73A 1H60A 4LT9A 3NL6A 5FF4A 4GUIA 3W2LA 4O0KA 4LVFA 5LHEA 2VFFA 1XFBA 1QMLA 1GVSA 1NVMA 1QPQA 2C1HA 2YR1A 3CT7A 1XM3A 1KA9F 1YDNA 1KM2A 3EX3A 3W2JA 1EEPA 1KFKA 4NU7A 1D3HA 3MUXA 4AB4A 1VCVA 3DKJA 3HBLA 3FYOA 4O0ZA 3GDKA 3B03A 4UR8A 5D2YA 1XI3A 2E6DA 3AO0A 3M5YA 4WOQA 4AMAA 1VPXA 3MP5A 3R89A 2DJLA 3IIZA 4QQ3A 3EX2A 5D37A 1YDVA 1OHLA 5U4NA 3B06A 1SUXA 5G4EA 4LRSA 4GJ1A 1QPOA 3EWBX 4LNYA 3RU6A 5KZDA 3PUOA 1AMKA 1YTEA 2QJHA 1NAL1 3IGSA 5K4ZA 1OX5A 4TMCA 1P1XA 2UV8G 2RHGA 3UD6A 1FUYA 1TTJA 2C3ZA 4WQ6A 1Q6RA 2WSYA 5LHFA 3BV4A 4ORIA 1AK5A 2BSLA 3BG5A 2V0TA 1KTNA 2WJZA 3RK8A 1XXXA 4XTIA 3DBPA 3HGSA 4N9BA 3T55A 1GPWA 1X8FA 4O1DA 2ZDRA 5DELA 4PFMA 1H1ZA 4DF1A 1YTKA 2J9YA 1SO6A 2I14A 4LS0A 5FF0A 1GTEA 4MJZA 4QITA 2ZYFA 3W1MA 1VJIA 3FA5A 2E5DA 2NV1A 1OFOA 1OYAA 4FXSA 1LTDA 2QUUA 3DFQA 3NQVA 5LSMA 4CLMA 2NX9A 4K8EA 3PG8A 4O4VA 2VFIA 3B05A 3W22A 3M1ZA 3O07A 2ISSA 4FX6M 3L5MA 1DQWA 2J6XA 3OVQA 4AAJA 3NL5A 4FB7A 4OBTA 4M7SA 3GKAA 4QNWA 3LI0A 1AW5A 3ZWSA 5KZEA 2H90A 3W7JA 1H51A 4JNMA 3PBUA 3B0VC 5CPOA 1ZCOA 1WBJA 2E6AA 4DPQA 1RQBA 4MYAA 2WSQA 3C2EA 2KZHA 1ONRA 1JCLA 3G1FA 4MPQA 4LVGA 4ADUA 3BO9A 1R2TA 1S5VA 4IMDA 5D02A 3QW4B 4NX0A 3W1PA 3RFAA 4M6PA 4YXGA 5HQEA 3W7QA 3IEBA 3W7NA 3B0UX 5F2GA 3GAKA 4Z1CA 1EA0A 3R5EA 1H63A 1XBVA 1T8XA 2RH9A 2XN1A 1HL2A 3BW2A 2ABAA 3N2XA 1W3NA 2ZRVA 2TMDA 2CLEA 4PC8A 5FEPA 2YYUA 5HUPA 5G2IA 3TE9A 3M16A 3F03K 2CLKA 4DO4A 3ATZA 2A7PA 4HNVA 4MOZA 3P8IA 2FFCA 4ZL1A 3LXCA 5TBOA 1K8XA 4MFDA 5LNVA 4CNPA 4RZ5A 3LCLA 4FNTA 1LBLA 3W1AA 4HKPA 3G22A 4X2RA 3UXAA 2D73A 1H62A 3LCWA 3W1RA 4UTKA 4FXRA 5KMYA 4MUZA 1XBZA 3A5VA 4CQAA 4MFEA 1N55A 3LHYA 3HG4A 5HULA 4YCOA 4JIQA 1O4UA 4NJHA 3IGXA 1KBJA 1ME7A 1QPNA 3GKFA 3NQEA 4LV4A 2W0UA 1L2UA 4NJJA 4JGDA 1TPWA 3SR7A 4UTHA 4Y9AA 1J2WA 3U8GA 2FB3A 5D2VA 5AHLA 3EXRA 2E6YA 2QUVA 3PR2A 1GG0A 3W87A 1JCJA 3C4UA 3LXBA 3KRZA 2QCEA 4ZQRA 3NQ7A 1KFEA 3LTSA 2CZ5A 2E5BA 4XKYA 3HQ1A 4QNEA 1OK6A 3W2MA 5C54A 2CW6A 2BTMA 5KZMA 3BLFA 4EOUA 4PODA 1GWJA 1P0NA 3W83A 3I7SA 4KFOA 3NDOA 1VS1A 1XDMA 3DFNA 4CNNA 3DHFA 2A5HA 5G4WA 1I2OA 4O53A 4RR4A 4UR7A 3C2RA 2X1SA 4JTFA 5I3IA 3PB2A 3USBA 3UWZA 1H1YA 4NXSA 1VC4A 2TYSA 1LOLA 1L6WA 4GBUA
chains in the Genus database with same CATH superfamily
3LPPA 1X7FA 1N8WA 1WNOA 2VEFA 5I24A 4E38A 2PTZA 3RHGA 3NGFA 1A5KC 2J7EA 2Y89A 3NQ2A 4F0HA 5C2XA 3PSWA 4H9MA 1P0EA 1JPHA 3DYPA 4XB3A 4ZO9A 5LKYA 4Z1DA 1FCUA 1TREA 5JH1A 4PMQA 3I10A 5D9MA 3L21A 1ODUA 4DPPA 5AVHA 1F76A 4YJ5A 2XWDA 2HPIA 2XDFA 2D24A 4JX4A 4ZQPA 1MUWA 4JTDA 1R3VA 1RBLA 3OYZA 4J28A 1P6BA 1XWYA 3MPGA 4X22A 4N2YA 1TWZA 1FP8A 1VPYA 3VM7A 4GIRA 3N4FA 4E2VA 4WIWA 2EO7A 2WCSA 3F5KA 4KQNA 3GR8A 2DZAA 3S9IA 2PZ0A 1UD2A 5CSRA 1TX0A 1HJXA 3A23A 1CW2A 3DFOA 2IXUA 1YPIA 3HG5A 2FDSA 3W0KA 3ISIX 5XIAA 3H2FA 1BSIA 4CKQA 1A5AA 3HGOA 2BXYA 3UJ2A 1RJQA 1SFSA 5A8NA 4W93A 3A64A 3RO8A 3E02A 4OGZA 1A5MC 3URQA 5HJLA 2VC5A 1HP4A 3C2YA 2ACUA 1TWDA 1MUMA 3C3UA 3FIGA 3CO8A 4B5VA 3E0VA 2QCDB 2ZTJA 5HUOA 1O94A 1XC4A 3APTA 3V75A 1OBAA 3N2BA 1R38A 1RR2A 1KGWA 2ZVRA 3GXTA 1MRAA 2VJXA 4GIAA 4DJDC 3OVRA 5A2CA 1MZHA 3ZM8A 1U83A 3B0PA 4QIUA 3V3WA 3JUGA 3OU8A 2DVXA 2NQZA 5C70A 4DM2A 3KW3A 4GC4A 2G0WA 1SZEA 3NQFA 2GJXB 3LA4A 4JZ5A 2FZNA 3OG3A 1EGZA 4KFNA 3VGHA 3EDEA 2ZRWA 1Q6LA 1LCOA 4PH6A 5LA2A 2FQIA 1GTHA 2C91A 3I4EA 4AHQA 1WCGA 1NTHA 2ZIDA 4MNKA 2H9AB 3FKKA 1W5OA 3AHVA 4QG8A 5A69A 2X30A 4J3SA 1LG1A 1DQXA 5HMSA 4J3UA 3ZJKA 4DO7A 3M0ZA 3AYRA 5CKSA 3O3RA 2UY3A 4DBSA 1P6CA 3P5YA 2YA0A 3M0XA 2YFOA 4KESA 4JCLA 3MW7A 3TKFA 2CZFA 2MUCA 4DVOA 3S1VA 3L5AA 1IQ8A 3H4GA 5KITA 2G95A 1X1ZA 4TTGA 2PI6A 4GNJA 1G5AA 1NFBA 1TG7A 2GUYA 3FA3A 2DT1A 3HV9A 2NX3A 1GHRA 3SCTA 4OHQA 2XJ7A 1XLIA 4LS2A 1I2NA 3S1UA 3BC9A 5GNXA 3PJXA 3R13A 3RR4A 5CZKA 2Z1SA 3REQB 2G3MA 4ZFMA 1LLOA 4PSPA 3VNLA 5EB8A 2VRQA 1LYXA 1DIKA 3SJ3A 1AH0A 3C2FA 3KEHA 2W6RA 1V6UA 4ZOCA 1ZJBA 3IAQA 3NZGA 3KWSA 3P67A 1J96A 2WLYA 5I3FA 4KRUA 1OFDA 1NH6A 2TPSA 1O5RA 1HNYA 3VD9A 3ITOA 2ZZ1A 4NRRA 2DP3A 1DJYA 3GDMA 3SN4A 4GUHA 1UHVA 1F6YA 3W75A 1YXYA 3COTA 1JDEA 1JG9A 1H7XA 2XFYA 3MBDA 2CLMA 2J47A 1O95A 5AYYA 4WHBA 3F2BA 4GI9A 4H3DA 3FN9A 4UQDA 1GW9A 3V5CA 2I1OA 3EDFA 1Q6QA 2GFTA 4JKKA 1GEQA 5CH9A 2VC7A 1GOQA 3OO2A 3V0TA 3HV8A 3LS9A 5I3JA 2A3CA 1Z69A 3MSRA 3PUDA 5D04C 3SM0A 2PDQA 3TWBA 3ABQA 3BVJA 1DTNA 3STPA 1MFVA 1SPQA 3JU2A 1BKHA 1SZRA 1M9HA 1DBTA 2JEQA 1KR1A 2E9LA 1QXLA 2A21A 1SO3A 1KBIA 2VCCA 4JHZA 3WH6A 3VIJA 2ZUTA 3HPSA 4HHMA 5I3HA 2WZMA 2PGEA 3VABA 1EDQA 3CWOX 1O5XA 4WSKA 3ARPA 2GK1B 1NOFA 1P6WA 2O4MA 3VOJA 1YLVA 1ISXA 2Y4SA 3BOLA 3CC1A 1N8FA 1UQZA 4AY7A 4JQ1A 3WD1A 4O50A 5EMUA 1XLGA 1B9ZA 1QI2A 3OQEA 2YYTA 2YPIA 3FGCA 3WK3A 3HN3A 2I5QA 1BEUA 1VYRA 1A80A 5C2CA 1IXQA 1XYAA 3GFZA 5FL0A 3THCA 3UJEA 1UD6A 1IXOA 2CHNA 1B0IA 5AYIA 4HK6A 3TJXA 2J8TA 3U7VA 4Y2WA 5CLTA 1ZAHA 2RJHA 3PS7A 5FD0A 2WHJA 4J2PA 1A5LC 3GYCA 3TROA 3MYOA 1JFXA 1QATA 1JDDA 4IGMA 3M0IA 5FACA 5A2AA 1HIZA 3FAWA 3QSTA 4C6QA 1PZ2A 4J35A 3MCOA 3T78A 3VFCA 1RD5A 3QKEA 3WJYA 2FIQA 1I60A 3GG0A 3O0KA 3A3WA 1SW7A 3B97A 2OQYA 3M0KA 3P6LA 4H9TA 4F2TA 1NOUA 4JQ4A 4LUTA 5EYWA 2QUTA 3VKCA 2RJGA 3VGEA 3GXDA 3A12A 1P43A 1TZZA 3WH7A 2BGSA 3IACA 3FJ6A 4IP5A 4Z0SA 3O6DA 3SIZA 4U31A 3QEZA 4PMDA 1T7LA 3WD2A 3EBVA 2OO0A 2QPSA 1XICA 4AZ5A 4GK8A 1CCWB 3AAMA 1TTIA 3WLLA 1HP5A 2PDPA 3PAJA 2WHKA 1H0IA 1P5BA 4DBEA 3EMCA 1PX4A 1A5BA 1A5UA 3SAZA 3W7HA 1RCXB 1XS2A 4AC1X 4JR5A 7XIMA 1GQNA 3V36A 3VINA 5A6TC 1G7VA 4JDYA 4WGHA 1LQ2A 3JVAA 1SFLA 2HXUA 3EWZA 2HK1A 2QULA 2VC9A 2V5CA 3CEPA 2PWVA 2J7GA 1G0CA 3SGZA 4BWLC 3TCEA 3T4CA 3CL8A 2YZRA 3VOGA 4I9JA 4DJEA 1LRQA 1E55A 1J12A 3GU1A 3VKJA 2YCLB 4M56A 4ZENA 4A29A 3NIYA 2PU1A 1OFQA 4KF1A 4H2HA 2ZZ4A 2VGIA 3L66A 3VM5A 5FCZA 4K1WA 4FOJA 3GQYA 4BY3A 4YWSA 5CPLA 4JTKA 2V6AA 1PSCA 1RJPA 4HK5A 1EUNA 2CWNA 3G8EA 4UFLA 3GVVA 4YTQA 3CAKA 3R0UA 4B3LA 1KXHA 5I7GA 2OOFA 1YDYA 4IMEA 1IEWA 1PZ3A 2ZRZA 4O19A 2VUYA 3UZ5A 2BG5A 4R88A 3DG6A 4WDXA 3QM3A 4P5UA 3GNRA 3DIPA 1ISYA 2W63A 4MKVA 2DZVA 2BHUA 3SURA 4HNNA 3UT0A 4QISA 5FF2A 3G0XA 5LNWA 3OHMB 2QHAA 5G1TA 2GQAA 1QNRA 1KWGA 1F5ZA 1CYGA 5F1VA 2IXVA 2QVNA 1PTGA 2FHBA 3TYZA 2HQAA 3DG7A 3ARYA 2XH7A 1EBGA 1JZ5A 1O5KA 3FVMA 2I5GA 4JY8A 1BXBA 1S5WA 4S3JA 4TX8A 1CENA 3SIMA 1UJQA 3L7RA 5D2XA 3WG6A 2CLHA 2WQPA 4RPPA 3TAKA 2QT3A 1QNVA 2XTKA 1O60A 3L0NA 1PO9A 4YTRA 5ABEA 3OIHA 1W1ZA 3N73A 1IWBA 4J1OA 3WJXA 4L4OA 1UCWA 2DIEA 4M24A 3ZVHB 3QVQA 4NAFB 1FWEC 3WUEA 4C7GA 1JCXA 5CPNA 2ZUVA 1TUXA 4ZOBA 1THFD 4ACZB 4JHMA 3NO5A 1HKWA 5CSSA 2BP1A 3N04A 3F4NA 2EQDA 3AROA 1Z3NA 4TO8A 4G5DA 1R9ZA 2OVLA 3NZPA 3UQNA 5A6KA 3LV6A 1XF0A 4MY1A 3GR4A 2QJGA 2QAPA 2ZWZA 2ZWYA 1NEYA 3LLDA 5BOEA 2W27A 3WENA 3E12A 4P8VA 3QYSA 4ICCX 2Y1HA 1PTAA 3S3GA 3QYQA 5JBDA 1JUKA 3QY6A 4KS0A 2INZA 3VIHA 2GPTA 5L9FA 2Q8LA 5KINA 4R33A 3TR2A 2WMHA 4J4KA 1ZP3A 4XKMA 4YU1A 3URBA 4EANA 4PE8A 4O0QA 1RY0A 4UIOA 4UB9A 5REQA 2ZZ5A 2A7RA 4XAGA 3NPUA 6CGTA 2DZTA 1KRMA 1NWRA 2PWHA 3GNXA 4TX9A 1SZGA 3ZJ8A 4HHHA 1GZJA 1AQHA 4W84A 1WXZA 4EXQA 3UG4A 1LP6A 3T7VA 3NQDA 2A3LA 1KCZA 1JL8A 4YVVA 8TIMA 1TJ1A 1UC5A 4O1AA 3R8RA 1W3JA 4C6PA 1RUSA 4CD5A 1HUVA 2ZBTA 2IQ0A 1E0XA 4UFJA 1RVGA 3UZXA 1XUZA 2E8ZA 3LZ5A 2PZNA 4H19A 3N9KA 4OUEA 3LB0A 7REQA 1M3UA 2A3EA 1UOKA 1PYMA 5CAKA 5BRBA 4HSHA 4GFSA 3SECA 1QT1A 3UY8A 1M7PA 2P0OA 4O11A 1LQ0A 3NJ3A 3GG8A 1BKSA 4HU0A 5J04A 4X0VA 1BYDA 4MWAD 1SMDA 5D9OA 3GM8A 1YTDA 5C2GA 3C56A 1MDRA 3WF1A 1GOIA 2J79A 3ZQ9A 3MYPA 2YXGA 2IW0A 3LTYA 4IICA 3M41A 4MB5A 1OX4B 2GVJA 5U7SA 3EA2A 1KFWA 1X8CA 2H8XA 3ABZA 3BANA 3JW7A 3UVIA 3UCQA 4ERAA 5F1UA 3KZPA 4GO8A 3B0XA 4F79A 4AC7C 1TPDA 1GOWA 3WDHA 3V18A 2PDLA 4PMUA 1B3OA 4H83A 3G0SA 1V79A 2PDUA 5AOUA 1NWSA 1TB3A 3AC0A 1TA3B 1E0VA 1PYFA 1FCVA 1Q6DA 1RALA 2BWGA 2DY3A 3TH6A 3TSBA 3UW6A 1LWHA 4QDPA 1SR0A 3K1GA 5DF0A 4JTHA 4DBUA 4AD3A 5I09A 1CX9A 5AVNA 3GWQA 4EVZA 3SCRA 5IFTA 1QI5A 1XDLA 1MVYA 1HL8A 3DENA 4ZO8A 2X16A 3K46A 4IL0A 4MYXA 1BYAA 1QNQA 3MDWA 5D9NA 3TQVA 2WZEA 1UR0A 1UUOA 3L9CA 4RW5A 1H49A 2FB2A 2X40A 2GGIA 5BXSA 2YCJA 5HNUA 3ZLGA 1O12A 1BRLA 1F07A 4PN2A 4FA3A 1IIHA 5T91A 1E5NA 3R79A 3EEGA 3MU7A 1EJTC 2DZWA 1QCWA 3FXGA 3ME3A 1GKQA 3QF0A 4LANA 1A47A 4Y9PA 3IGUA 1NDVA 4HYRA 3LLXA 3NEVA 3C3NA 3HZ3A 3GG1A 2DQXA 3BURA 4JCMA 4ZCWA 1TQXA 3N2TA 3VUPA 3BXWA 3IVSA 1V4YA 1W9UA 3MO7A 4FXFA 4IX0A 5EPDA 1GYLA 4LUJA 3KS5A 1PKLA 3HGRA 1JI1A 3LNMA 2Y88A 4GCXA 1SZNA 3WBWA 3NL3A 4FNRA 4NRSA 2OQLA 4B15A 1FX6A 3IIOA 1C8QA 3QPYA 1W1YA 2KAUC 2PLMA 4W7VA 1MEWA 5IDZA 3ZVIA 3DGBA 2POTA 4JTEA 1CBGA 1M7OA 4NZCA 1CGVA 5ABTA 3LQLA 1YQ2A 3H2NA 2J7DA 2O9RA 3H70A 1Q6OA 1WZKA 4DWSA 5K2ZA 4MJMA 4S38A 4O57A 4NVTA 3RPTA 1X6UA 4F66A 4UTIA 3CMFA 2GGGA 1KD0A 2ZCGA 3BLOA 1FWHC 3PZNA 1OGGA 4Q6XA 2Y5EA 3T07A 3W6MA 5AYXA 4HOXA 4UBPC 4ML4A 4QR6A 1U1JA 3LM7A 3RIKA 2ISWA 4ZTXA 3MKVA 3U2OA 1JR1A 2FZ9A 1VH7A 3VK5A 2J74A 2D2HA 3F4DA 5TD4A 4CN6A 4ALDA 3B8UA 4FO4A 3NCOA 3NQGA 2ATMA 3NR0A 1G4SA 2Z27A 4KGJA 1Q2RA 5F2MA 3C2VA 2ON3A 3TC7A 5LIUX 4A2SA 2CEQA 1TPVA 4H7VA 2BBFA 1PL9A 3AMLA 2OR2A 3GDTA 1XIDA 4L9YA 3EXTA 1RH9A 3W23A 1E51A 1YE4A 1W17A 3MA8A 1PHWA 5E09A 2WZIA 3AS1A 5LNRA 1ZALA 3N15A 3ZZ1A 4RDYA 1FHUA 1ZHAA 1TRDA 1HTIA 2WWCA 2OU4A 2D0HA 1AJ0A 1VIZA 2PWFA 3K1DA 1ITQA 3UWQA 1HF6A 2IKJA 4GOAA 3QV7A 1DE6A 4MIMA 1E0TA 5A6AA 4IQLA 3PG9A 3KL0A 3GDLA 3L68A 2Q8XA 4Y7EA 3I7RA 1PKMA 2O56A 4KBXA 2AGTA 1EF3A 5I3DA 1WBHA 5IBXA 1AVAA 3OLDA 4FHAA 2VDGA 1K6WA 2JBMA 2VEPA 4FLSA 1E40A 4NZ1A 2GGEA 1E6QM 3BG9A 4FX7A 3ABSA 1K02A 4PCNA 1DHKA 3IJQA 4IPIA 1JQXA 1FWGC 1FH9A 4I6VA 4A8NA 6PTDA 4ADTA 1EO5A 1CLXA 3WF0A 2R1KA 1KCKA 1AW1A 1VD6A 1PHQA 1TV4A 5D9PA 1R9XA 4ROQA 4UTMA 4WY0F 2P10A 2PC4A 4HNCA 2IKIA 2W5FA 4GA8A 4CU7A 3MI2A 3O7UA 4O13A 4KH2A 3TYAA 3EYPA 5HWMA 4R5EA 2G96A 4AWTA 4HA3A 1I2RA 3HGJA 1PXGA 3TP4A 3WY1A 3VOCA 4DF2A 1BWKA 4UFMA 4JY9A 4NZ5A 1E9ZB 4S2BA 1XCWA 2Y5SA 1HO4A 2ZX6A 3PPCA 2QVHA 5MHBA 1WZAA 1XUUA 3LRLA 4UOQA 1LBFA 3NFUA 1XLBA 2VR4A 1T5AA 2I17A 4ERGA 3SB0A 2VC6A 3VE9A 4CN4A 2F2KA 1WZLA 3C0QA 2MANA 5AC8A 2Q3OA 1GOKA 2V8ZA 5DFAA 3ES7A 1GPFA 4ZBCA 1OWQA 2PP0A 4IT1A 3L67A 3LDVA 1OABA 3T9PA 3CK5A 2TRSA 3W7DA 3D0CA 3T1GA 4W8LA 3MUZ1 1GVYA 3R0DA 2J9ZA 5T26A 4PL1A 5EY5A 1W1A1 2EBNA 1CXIA 4BJHA 5I06A 3M6YA 4UTUA 4X9SA 3R6IA 1KLYA 2C8NA 4OKDA 2DQWA 2J66A 1ZUAX 3GXPA 3E96A 4UZUA 3SY1A 3VAVA 3MI3A 3NQAA 4JFWA 1MO0A 2IKGA 5A5WA 4KRTA 3P80A 3KVLA 4Q8MA 3U3HA 4EKJA 3R25A 1QI0A 4JKLA 2QR6A 3OODA 4DJDD 1ISZA 2ZC1A 1J0YA 3PULA 4GYFA 4URIA 3DFPA 4XBJA 2C79A 3LV5A 1SJCA 2VFEA 4O10A 1RD6A 1VQTA 3RUBL 2GWGA 1JD9A 4R9OA 3KM8A 2R82A 1J0HA 1VJZA 3FLUA 3NA8A 4GY7A 1LORA 4JICA 4GX9A 3CHEA 1TZ7A 4GVHA 3E2VA 3N12A 3S83A 4JFTA 2Y85A 3TMLA 2F6UA 4A3RA 2FTYA 4N4QA 1WUFA 1WKYA 2BY0A 1SO4A 4TUFA 4L9XA 3MKCA 2HWGA 2Z28A 4N9DA 1EHAA 2BVWA 2F38A 4MG4A 5C7VA 1GQIA 3ELFA 4XD5A 4JNZA 4DELA 3G3MA 2YFNA 6ENLA 3JR2A 2V2HA 1O1HA 2CU0A 1FFRA 3G77A 3E6EA 3TZNA 3ICJA 1K9DA 3BMWA 3UR7A 4V27A 2HV5A 4Y90A 4LUYA 1MSSA 4KEVA 3W2UA 1EGVA 5LA1A 2OYKA 3EWWA 4RUBA 3NL2A 5JIWA 4MMWA 2XG9A 4S1FA 4WEVX 1ONWA 1M6JA 2OXNA 3AXKA 4QLKA 4K36A 2XSXA 4HYWA 3NPVA 3KWXA 3GTIA 1Q6CA 4OE7A 4IIDA 3QOKA 4WSHA 4IUOA 2E09A 1UKSA 2DZXA 4JXCA 1TPEA 2G4JA 4BK9A 5C0QA 3TFXA 2QDGA 4D9PA 3W7OA 4LEFA 1OADA 3FXYA 1LL6A 5I3GA 4KETA 1WOAA 1X38A 3W73A 3VGDA 5FF4A 1XYFA 4GUIA 3W2LA 1JGMA 1QMLA 1DIEA 3Q65A 3IANA 2C1HA 4QP0A 1KA9F 4PMNA 3W2JA 3SN1A 1KFKA 4NU7A 2WVTA 1VCVA 3GDKA 3B03A 3AO0A 3M5YA 1VPXA 2ASHA 2Q71A 3F2CA 4X61A 4EK7A 4ICMA 3HPFA 3VMNA 4Z1YA 5U4NA 3U2ZA 4LRSA 3EWDA 3EWBX 3RU6A 3PUOA 3ARTA 2PLJA 3SUVA 1NAL1 4L7ZA 4PTMA 5K4ZA 1EHNA 1Q5MA 1LT8A 4OFCA 3MVTA 1P1XA 1PDZA 1UROA 1ZRQA 1PIFA 1VFTA 1UW9A 4G56A 4YNGA 2QUMA 1AK5A 2BSLA 2OGYA 1KTNA 5GPRA 4ERIA 3PPFA 3E0WA 5DEZA 3T55A 1GPWA 1UH3A 4A05A 4DY1A 1SJDA 4PFMA 1YTKA 4ZTYA 3BWWA 3TYEA 2VUNA 2ZYFA 3MUAA 4HHLA 3W1MA 2E5DA 2NV1A 2Z4GA 4FXSA 3DFQA 4CLMA 4K8EA 4BKNA 2XSAA 4O4VA 1N8IA 2VFIA 5EFFA 4AY1A 3B05A 3T42A 3SFWA 2VD9A 3WFZA 3WLSA 1Y7VA 3L5MA 5E5CA 1DQWA 2J6XA 5LXEA 3QPEA 4M7SA 4QNWA 2DSUA 3LI0A 5H8MA 1FWCC 2H90A 5DANA 3W7JA 4DAFA 1H51A 4KIRA 3QTGA 1SJBA 4QBXA 3R0KA 1CB7B 5BWFA 1OT1A 4BQ2A 1QWKA 3G1FA 3KLLA 1V02A 1DJWA 1J6PA 4IPPA 3E74A 3BO9A 1R2TA 5EGRA 4IMDA 4RNFA 1JAKA 2HCVA 3W1PA 3RFAA 1X6NA 3C86A 3L4XA 3W7NA 2BY1A 2QS8A 2EXOA 3B0UX 5F2GA 2NQJA 1H63A 3CGTA 1T8XA 5RUBA 3BW2A 2ABAA 4JL1A 3QHNA 5FEPA 4IFKA 1IR1A 3L2LA 4DO4A 2A7PA 1W6TA 4MOZA 4QCEA 3P8IA 3EB4A 3MVIA 3LXCA 4MFDA 3PNZA 2J78A 2VOTA 3AHZA 1DJZA 1AMYA 4HNOA 4LJ3A 4N0RA 4HKPA 3E0LA 3L4YA 4XK2A 3LCWA 4AIUA 2PUZA 4DZHA 4F0KA 1EBHA 2WJEA 2WWDA 5KZ6A 2IQDA 4F4RA 4MFEA 3QV6A 3LHYA 3VX0A 3ANUA 1ECEA 4YCOA 1AD1A 1KO0A 3IPWA 2V63A 1KBJA 1ME7A 1PWLA 1HXJA 1QPNA 1M01A 3NO3A 3FSTA 1D3CA 5D2VA 4NP7A 3EXRA 4XIMA 1J93A 3PR2A 3N18A 4HTYA 3LXBA 4JOMA 1UH4A 2ZUUA 5IHRA 2CKSA 3VD7A 3BSGA 1UP3A 1XLLA 1F4HA 1TJ2A 5FSDC 1ZJAA 2CBUA 3UXKA 6REQB 5C54A 1XSIA 4EOUA 3CZKA 2BHZA 3GRIA 1I0DA 2I9UA 1PDYA 3EOEA 1GWJA 1P0NA 3S5SA 1C8XA 2NVDA 2FGBA 2A5HA 1U2YA 5CPTA 3NOYA 3WQPA 1R7OA 2X1SA 4PUDA 3VDAA 4JTFA 5FOOA 1H1YA 3EAUA 2Z00A 1E4IA 1LOLA 4GBUA 3A3HA 3D3AA 1US3A 4O16A 3VYLA 4ATLA 3QLLA 1V0KA 3FCPA 2TAAA 1JUEA 3CUZA 3TTOA 1W37A 3HF3A 5REQB 2OWWA 4UUIA 3NPXA 4GYJA 5FEXA 3W82A 3E2SA 1XLHA 2EG8A 1J0IA 4BI5A 3QQ1A 2A6NA 3R2GA 5CC3A 3HU7A 4MKNA 4IFRA 3VD3A 2FPYA 1NOWA 4QRNA 3MZNA 1S2CA 1E4NA 1ISWA 3WBYA 1KKOA 1OX6A 3O16A 2IMRA 3P8JA 3A4JA 1GG1A 2HVOA 2XFFA 3TOPA 3G2GA 4CQ8A 1YDOA 4O1EA 4DF0A 5AC7A 4LYQA 5DT5A 1HGWA 2ISDA 2XSBA 2JIEA 2AL1A 3BAYA 3APYA 4Q7BA 4NT0A 5ECVA 1V3JA 3BAIA 2A1YA 5D38A 4AXKA 4J40A 5BCAA 4IFOA 5CZJA 1KKRA 3UETA 3K8KA 1CT5A 5F7UA 2V5KA 4YPJA 1PUDA 2XVNA 4EPDC 3CZGA 4UQ9A 5A3HA 3PSVA 3QQ0A 4JTTA 4NAEB 3W7IA 1ITUA 1Q4WA 1W1TA 4GY0A 4GVGA 4HP5A 2CNCA 5C6MA 6ALDA 2V82A 2C6QA 2E1DA 1UR3M 4D8LA 1LWJA 4Y9OA 5KETA 1V6TA 2XZ7A 2WCAA 2ZA3A 4BQ4A 1VBGA 4JD4A 1C9WA 1VZWA 2E8YA 1JI2A 1V0NA 4RCXA 3BGGA 3GDBA 1I8JA 1WA3A 2CXGA 1TV8A 1V7YA 4ZB5A 2OODA 1W9VA 2Z2AA 3N19B 4XAFA 1XLMA 1OM0A 4HSOA 4W8AA 3BZGA 1W54A 1VFFA 4F8XA 1VCGA 2DIJA 4B3ZA 4XO7A 2GWNA 1V7AA 4W7WA 1TRIA 4NHVA 3VKDA 4TVDA 1K4HA 1NF0A 3W70A 3CUHA 2CKRA 3VU2A 1LRNA 4RXFA 2J4GA 5XINA 4MWAB 4QJ3B 3DUGA 3W38A 2NUYA 4RXGA 3RM8A 1OC6A 4OWGA 1PCWA 4P8WA 3M07A 1S5TA 4BI7A 1MQQA 1QNPA 1YPXA 2VGBA 5A6SA 5A8OA 2PD9A 4MAVA 1BRLB 4B5TA 4WJEA 4GJJA 2J7CA 6XIMA 2WVVA 4IIHA 2Z6JA 2E67A 4IJRA 1WXYA 2P76A 2NVAA 3GC2A 2C1GA 4RL3A 3L4WA 4UOJA 2P1FA 3FVDA 1TMHA 2AAAA 2Q01A 1UPPA 3S2LA 4LVDA 4O15A 1L8PA 4UMBA 1F8MA 4IGHA 5EBUA 4M5PA 3W71A 3LN3A 1ALDA 3CZLA 2Z1VA 3DHDA 4K8GA 3ARQA 5F2IA 4HZ7A 2EJAA 3KFTA 3OOQA 4Q4PA 1QAPA 3LBMA 1R3QA 3UWYA 1LQAA 1EFZA 3PZVA 1B90A 2YL9A 4ZXLA 5E70A 3WQFA 2EPLX 1B30A 1W3LA 3SSZA 2J8GA 3A4XA 4OOZA 1DYSA 2G4FA 3SCNA 3NSXA 1UWQA 1E5JA 3EDDA 3GG7A 2F61A 5LIXX 3MWAA 1ICSA 4GG9A 2E3ZA 4WLCA 3CHVA 2GVGA 5AC5A 3IK4A 5FI8A 3WYZA 3M64A 3WF4A 4PMZA 3SGUA 3VIOA 5F4SA 4GIEA 5GVJA 4H41A 2GDQA 1L9WA 2WNWA 3I6EA 4RW3A 4IQJA 5DT7A 3NXFA 1Q3NA 3IVUA 2A2IA 4H9YA 3AIEA 4IMGA 3S5YA 1KCLA 1XG4A 2WNNA 3U5YA 2Z1WA 3POCA 1L6GA 1SVDA 1X39A 3AIWA 3CTTA 3NQBA 1MEIA 3TTSA 3GHTA 1E43A 2XH2A 1EJXC 2WHLA 2FMOA 2WBKA 3PTKA 4LUSA 1UR8A 4UTTA 4K1GA 3VZZA 4OECA 1X1OA 3EWUA 1XKJA 1OD0A 5HPOA 5AHIA 1DXFA 1JCMP 4CQBA 1MXDA 1RA0A 5EKYA 3LNPA 1R87A 3M9YA 2ZZ2A 4RDZA 3SDOA 5JVLA 3Q2DA 3TN3A 1ICQA 3EWCA 3UNTA 1JNDA 5I6SA 1RPKA 1QUMA 2DZSA 4E8GA 1GOXA 3AJXA 2J7HA 2F8QA 3W53A 3CS2A 3ORWA 4B5WA 3VCNA 1W5MA 4E3VA 4Z2GA 2A3BA 2VDHA 3THQA 3LYEA 1A5NC 1RK5A 1U22A 1KV8A 1NP0A 5TAOA 3KTXA 3WNMA 1XRSA 2BVDA 1JYWA 2RFGA 3THDA 8RUCA 1IXNA 4H01A 1OFAA 4OOUA 3H7UA 1J11A 2OOGA 5BROA 3T40A 4NNAA 3AJ7A 3EX1A 1YYAA 3DESA 3HIJA 3LQGA 2G37A 1VEOA 2X1TA 4EXAA 1HFBA 2C7FA 2WZTA 3ZFHA 3R94A 3W7KA 4XWUA 1UR1A 3SW6A 1JULA 3C0JA 3KRBA 2NQHA 3N17A 2XVLA 1TQJA 1OK4A 3KOFA 2NQLA 4YTSA 4L1WA 4R53A 4PMRA 4ZOAA 2GLKA 3R1ZA 4NI8A 4WXYA 3WUGA 3CIVA 5BNKA 2XFRA 2WHMA 3PBWA 2Y0FA 2QZRA 3VNDA 1D7KA 4YLWA 2FGZA 3CL6A 3OLIA 3BW3A 4AWUA 3VDHA 1AODA 2OZ3A 3MMDA 9RUBA 1LLWA 1OB0A 1QOXA 3ARZA 3TTEA 3W72A 3TONA 4M0XA 5A2BA 4IQEA 2PD5A 3A47A 2WSRA 1RA5A 1X6LA 3WNKA 1FP9A 3W1UA 4Q33A 1HKIA 4CD6A 1NY1A 4B4FA 1BXCA 4GACA 2BODX 2CPUA 3R43A 4IIFA 2PTYA 1FKWA 4AFYA 3B04A 1E0WA 1XIHA 4NYYA 1AFSA 4HU4A 1ZCCA 5CQ1A 1AL8A 3C6CA 1MNZA 5D2TA 3WMLA 2NVCA 2VRKA 3GE7A 1WDQA 4FF5A 2PTDA 1FWFC 2VYOA 1TKKA 4AF0A 3P0WA 2Y7GA 3G0UA 2ANUA 2E28A 1V6YA 1GUVA 3UNDA 4LGXA 2VCBA 4TU1A 3TQKA 3T2OA 3MO4A 1W3IA 4HIBA 2OGJA 2Y62A 3CH9A 3PTDA 1C8YA 3K30A 3RNDA 1MDLA 3AMKA 4X3ZA 4GLEA 2DZPA 4K7VA 4R9XA 4GO9A 4EIVA 5E0CA 4ZVJA 3DBNA 3QV9A 3TVAA 2RDUA 4B4HA 1VRXA 1U1HA 3AI0A 2D0GA 2UWFA 3FW6A 2Z0IA 2Z26A 3NZ1A 4C6KA 1TVLA 4QEHA 1W56A 2FJKA 2I7GA 2IQTA 3UZJA 4MSSA 4A4AA 2PDKA 4XQ6A 3GNOA 3MJYA 4WSJA 3D5HA 3P3BA 1PIIA 3LLFA 1G4PA 1G67A 3BCDA 1DQUA 1DWHM 4AISA 3CYJA 3IRDA 3B0YA 1BTMA 4LF1A 2ZICA 4ML9A 1EKOA 3N2MA 2FPTA 2VM8A 5E0FA 2PMQA 2PPGA 4AZ6A 3UJFA 1OEPA 1R2RA 2V81A 2J7FA 3PFRA 4TMBA 3S6OA 1ADDA 3AXMA 1V6XA 2V30A 3RPMA 1Q6GA 1QBBA 1UKPA 1LLZA 2ZXDA 2ZZ7A 3UF9A 3RLUA 3WFAA 1NELA 3HQNA 1J2BA 2YDAA 1BQCA 4AD2A 4CCDA 3K2GA 1YMYA 2E9MA 4F2UA 1ZP4A 1LROA 3FJLA 5BOOA 4UQCA 3WD0A 3B9AA 2G3IA 1KW1A 5G2HA 3BJFA 4M80A 1AUSL 4WDUA 4MZ1A 3FS2A 2D3NA 3W85A 5LGXA 1XBYA 3GR7A 3FA4A 1QK0A 3KDNA 3PZOA 1NQ6A 3SCUA 4A2RA 3BGJA 1TJPA 1SQ7A 1FHDA 4BQ3A 1UYQA 3QR3A 3TW9A 3WLHA 3PBMA 5HR6A 3UCDA 4GZIA 1ZZMA 3TFCA 4CU6A 1KBLA 1R47A 3H23A 3HMCA 5K3VA 5TQLA 1Q6FA 2ZE3A 5LNUA 2ZX5A 4B5UA 4LQ1A 4Z1BA 1XH2A 2YCKX 3ITVA 5DMYA 4IXXA 1VCFA 2A0NA 2EKCA 4CCCA 4DI8A 4W9TA 3RLGA 3CQKA 3W7PA 3C61A 5B80A 3HOJA 5FEWA 4IG2A 4MDPA 1G4TA 1TWIA 2X42A 3TDFA 3SCVA 3N4EA 2F2HA 3WK2A 2GDUA 4FI4A 3KBSA 4PTVA 5FJOA 3SEPA 1QHOA 4JX5A 4IL2A 5EL1A 4UCGA 5AYZA 4PTWA 3NZRA 3GXMA 2F84A 1FRBA 2WB5A 1K4GA 3HO8A 1QK2A 4A21A 4M1RA 2DSZA 4FNQA 5FAGA 1UD5A 1KGUA 1UWAA 4MB4A 1X1NA 5CZTA 3MC5A 3N6QA 2FH6A 1C90A 4GE8A 5DMNA 3EB2A 4F0LA 4I9MA 3BJTA 3KUMA 4YIWA 1JPDX 1NSJA 4DLMA 3W1TA 4ZR8A 4BF5A 4ZXOA 3RJYA 3TX9A 4V1YA 2E6FA 4TVCA 4GY1A 3B4UA 1KM1A 4XUYA 5GJMA 4KMQA 5FJUA 1IGWA 3VOFA 1F7BA 5HNRA 1EGMA 1S5NA 1EB3A 3CWNA 4DEFA 2YB1A 3T8LA 2G3JA 3WDQA 3N13A 1T0OA 2PWUA 1FWDC 3BTNA 4KCWA 3AU6A 4M6UA 1NM9A 4HPHA 3BGAA 3DFTA 2QNEA 4AVFA 2OWCA 4JN8A 3LGEA 4MWAC 3RF9A 3DN5A 4LAUA 3G1HA 3AZRA 3ZWTA 2WXDM 4UFHA 4UZSA 3FHQA 4P8XA 2R91A 1I45A 2PF0A 3C0SA 3O05A 1JRCA 1ODZA 1WB0A 3EEZA 3V0UA 4H9VA 4ZE5A 1IEIA 1Z89A 3TSDA 1TZ9A 4YVPA 4K68A 1H1NA 3CUJA 1BAGA 3PB0A 2HZGA 3WDIA 3MMUA 4N7QA 4R7OA 3DGRA 1FXPA 3VNMA 1TCDA 2QW5A 2V3GA 1REQA 4UCFA 3BK0A 2C0AA 1M04A 3IWPA 1EXBA 3NZQA 1GOOA 1Y8BA 5I5RA 2Y70A 4R7JA 1J79A 3GW3A 1J0ZA 2FHCA 2WC7A 4ASTA 2PP1A 1M5WA 3GH4A 3PM6A 3N9RA 2VR2A 1N7KA 8CGTA 1JZ3A 1UP0A 1GJWA 5M3WA 4KWUA 4LB4A 3FAXA 1XSJA 3O6CA 2ZA1A 2BOGX 3T0TA 4WVXA 3TYDA 2PDIA 4FEZA 2B0MA 1EYWA 4WY0A 1LG2A 3RXZA 4ZSUA 4RX0A 2D69A 1OIMA 2PBOA 3GNPA 2J75A 1NDWA 4NYUA 3UYCA 2BXZA 3AIVA 2OLHA 3VD5A 2WK2A 3G1DA 3BARA 3GIQA 3QHOA 3GK0A 3VNZA 2PEVA 4UFKA 4BZYA 2W91A 3FNDA 4HNUA 1GQJA 5C9UA 4WK9A 2RDTA 1JPKA 2QGYA 2AL2B 3I7QA 1C9DA 2GJRA 4XBSA 5E0KA 1E4LA 4DRSA 1BQGA 3PANA 1KXTA 4EE9A 3P2VA 3VE7A 4KWWA 1YXDA 1KLZA 2X2YA 4DB7A 2A85A 3WQWA 3T2PA 1UBPC 1E1CA 4RZ4A 2QJJA 3H7VA 3PZ9A 4XISA 1QW8A 4GHRA 5F4WA 1RCQA 3NTYA 3AUJA 1R8LA 1Y5XA 3WNNA 1LT7A 1Z6KA 2AKMA 4Z08A 3VGFA 3ITTA 4Z2KA 1RBOB 3ITGA 1T41A 1K9TA 2XN0A 5D32A 4TXEA 1ZJHA 3M5XA 2JGYA 3TK7A 1RXOB 3U0HA 4C1NB 1QOPA 1A53A 2PC8A 2OZ8A 3QJAA 4OU1A 2ZUNA 4MJ4A 1JUBA 5HR7A 5H2ZA 4EWJA 3WQ4A 1V93A 1ZLPA 2VFDA 2Z7GA 1BG4A 3PHAA 2NT1A 3HM7A 4ZFCA 3TLQA 1TYGA 2BOEX 4OBSA 2WSPA 4OV4A 1Q7ZA 2EPHA 2CHRA 3WLMA 4H8NA 3GFXA 4HPXA 4JL2A 2GJLA 3EX4A 3MSGA 2J7BA 4A3QA 3N29A 3APGA 1M68A 2VEMA 3BAWA 4X63A 1K1DA 3FV9A 4MPKA 1Q8AA 3IIVA 3LHZA 3SUTA 4G1NA 1Z41A 4JAWA 1EZ2A 2ODOA 1XLFA 3KL3A 1H50A 2QJNA 4PL2A 2Z1BA 2Z29A 2DDXA 2KX9A 1P0KA 3ITCA 3MWCA 3SY5A 3QR0A 4QLLA 4HPNA 3G6LA 4MLJA 4NZ4A 4U33A 4XD3A 2EPKX 3BLKA 2HVMA 1F3EA 1ZL1A 3MHUA 3PN8A 1XYBA 5H8PA 1J5SA 2OT0A 3AZTA 4E8DA 2GVLA 1H61A 2WSKA 3SUSA 5HOSA 3LRMA 1B2YA 3DU0A 3GH5A 3L5LA 1XIBA 4HGXA 4HB7A 3JRKA 1XIEA 4NASA 4PCPA 1CECA 4XD6A 2VX4A 3W7EA 1A50A 4FNUA 4GZEA 1B4KA 4HMCA 4LC6A 3E5PA 4LXFA 3T4WA 4LAKA 4JEQA 3STFA 3R11A 3TLLA 2W79A 3JZUA 1OIFA 3EOSA 3RM4A 4E2BA 2J77A 1W2VA 2JKPA 3A5FA 3RM9A 1RK6A 3EOUA 3ZO9A 3FHAA 2TODA 5A6BA 3WEOA 1K03A 1VR6A 3DEQA 3LHTA 2G3FA 2EPOA 1KQZA 1ZJIA 1XIFA 1T96A 4IPLA 4FIQA 1QVBA 1R9YA 1C93A 1J18A 1XBXA 3T0CA 4GBDA 3C8FA 2JE8A 1NP2A 4J5NA 2XIOA 4DYEA 1SSGA 1W9DM 1UB3A 2QDHA 4NILA 1UUMA 1R85A 4WKAA 3GU2A 3TTQA 3QPZA 4PUJA 4IHCA 1KR0A 3BAKA 4I7WA 3UYIA 1ONEA 1XLDA 4H6RA 4H04A 1UR9A 3G1AA 4AVOA 2G97A 4AU0A 3CUGA 5DY3A 1LM1A 4AZHA 1HKKA 3VMPA 1WE5A 1JJKA 3PWGA 2BVYA 3U7BA 4N9EA 4JKMA 4WUIA 3VNYA 5I03A 1YIXA 4XSLA 2Z6IA 3MCNA 1KQYA 4IP7A 1PVNA 4K6AA 5LIKX 2ZADA 4AD0A 3Q67A 3HJZA 1YNPA 4DO6A 4ORMA 3B9OA 9XIAA 4E8CA 3AXHA 2VGFA 1W9PA 3S4TA 3OJGA 4JYFA 4Q8WA 3P61A 2PDCA 2OMAA 5G4HC 4H00A 5BXRA 2X09A 3EX6A 3LI1A 1CXFA 3NUKA 1EOMA 3WN6A 3NQ6A 5KTLA 3G1VA 2H8ZA 3VGBA 4GH3A 3TSMA 5EMJA 1IR2A 2ADAA 3CV7A 4S3KA 4QS6A 1OF8A 5CEWA 2HMCA 1KM6A 1EJVC 1H7NA 3P60A 4LWWA 4UOZA 2VQUA 3MTWA 3OPSA 2NUWA 4A8IA 1RAKA 3CB3A 2HNHA 5I23A 3WEZA 4C6BA 4KEMA 5DLCA 2TSYA 1ZENA 2NXIA 1A49A 3KDOA 3FY1A 3KLKA 1O6IA 4S3CA 1VHCA 3UG5A 4UFIA 4CQ9A 3R8GA 3NG3A 2PTXA 2WM1A 2AQVA 4XZIA 4EX4A 3GTXA 4J3WA 1EQPA 5FEZA 2Q6ZA 1L0PA 5J5DA 5D2WA 3LBCA 3NDYA 4HJWA 1Q13A 5J5RA 1XH0A 3WLKX 3PVFA 5ENLA 1HGYA 5ABHA 4PEEA 2Q09A 2WPBA 3P62A 1SW3A 5CJNA 4QM1A 1AW2A 1POJA 1VFOA 3RRXA 1IF2A 1OGSA 1RP9A 2HS8A 2GYIA 4L4PA 4LUSB 4DWDA 4O18A 3K4DA 2ZE0A 1O5QA 1NQKA 1UOZA 3GY1A 4R27A 1MEHA 3KVJA 3GLCA 4UTWC 3H2EA 2POZA 3FJ4A 1G7UA 3OBEA 2WLZA 3CQJA 2FH8A 2Q02A 3S6TA 1DXIA 4JIIX 4P7QA 4MZ8A 1B3VA 3H54A 3F4CA 1W5PA 2ICSA 2XISA 3KCOA 1R7AA 2GVYA 1YBQA 3BL3A 4MHBA 2QCDA 1WAUA 3RAOA 3VC6A 3IJ7A 3QC3A 4JDBA 1NF7A 2V69A 1VGAA 2P50A 5BWAA 3MKKA 3RX4A 4BEUA 3I68A 3OLEA 2BFGA 4S3FA 5DBUA 4PCTA 1RY8A 5H8UA 3OLGA 4NJIA 4ATWA 1E9YB 1EJUC 4JIPA 5I77A 4LAOA 1JPIA 2G41A 6XIAA 3TW6A 1ZAIA 1TPFA 4PTNA 5HINA 2GJXA 1RHCA 4KGLA 1J01A 1TWSA 1V8EA 1BSLA 1G6CA 1TX2A 5H1WA 1OG0A 3ZXWA 1TV5A 3GIYA 2H9AA 2VCAA 4WJXA 3S46A 2CZVA 3DOPA 1XLCA 3VXGA 3RN6A 1QPQA 2YR1A 3CT7A 4QAWA 1M41A 1EEPA 3WQ6A 1ZPTA 2AQOA 1KC7A 3EZ4A 1F4AA 3LU2A 3HBLA 3M4HA 3EMQA 2PU0A 1U30A 3PPHA 1J6OA 4Q4RA 1XI3A 4WOQA 3MP5A 3R89A 3EX2A 4H8HA 2UZ9A 3L2MA 5FJRA 1OHLA 2YBUA 1H4PA 1TV3A 4IQDA 4U5KA 4HPGA 5JBEA 3ITXA 1LL4A 5E9XA 2WW5A 1OZMA 2FDMA 2QGHA 1PJ9A 4OVXA 1NDYA 2OKTA 5KZDA 1AMKA 4Z2HA 1MZRA 4NKCA 1XV8A 3IGSA 3V1HA 4DHGA 4TMCA 2NSOA 2UV8G 4DYKA 1DEDA 3REQA 3FJNA 3UD6A 3WELA 4OUIA 1TTJA 4QG9A 5LHFA 3BV4A 3SN0A 3BG5A 2V0TA 2X0SA 1XIGA 1P1MA 5A6MA 3RK8A 1XXXA 4AIBA 1GQKA 3PZIA 3VNIA 3EA1A 1C92A 1UD3A 5C9WA 3HA1A 2OZTA 2XGIA 1H1ZA 3BSHA 3VIIA 3M0VA 4DUVA 2J9YA 5FF0A 1GTEA 1XISA 3FA5A 1OFOA 1OYAA 1U5VA 1H5VA 1LTDA 3NQVA 1XYCA 4FLQA 4GQGA 4U10A 3W22A 3M1ZA 3NEHA 2ISSA 1Q6EA 3FDGA 1IT0A 3OVQA 4AAJA 1V0LA 3GKAA 1MUCA 4ENLA 5KZEA 3W29A 3PBUA 4Q8UA 3WQ8A 3PZQA 4MYAA 2WSQA 1CB2A 2GOKA 3C2EA 3T2QA 4MPQA 4LVGA 1S5VA 2A79A 3PAOA 1YNQA 4NX0A 4M6PA 4YXGA 5HQEA 1QTWA 3W7QA 4UNIA 2WMFA 3IEBA 3VPLA 1Q63A 4MUPA 2V3EA 4LH8A 4DJED 1XCXA 3RJXA 2AMXA 2P53A 1QI4A 3URNA 5LXXA 2ZRVA 4US5A 4PC8A 2YYUA 1KRBC 1ZBVA 3TTYA 3F03K 2CLKA 2ISFA 2CHOA 2GK1A 5FL1A 4OIFA 4ZL1A 3BOXA 4WGXA 3WBXA 4W87A 5LNVA 3NYDA 4CNPA 4RZ5A 4C6EA 4H9XA 1DIDA 4PB3A 2VZUA 4ZODA 4F0SA 1CNVA 3G22A 4X2RA 4DJFD 2D73A 5KMYA 4UTKA 4FXRA 4EACA 4MUZA 1QW7A 1XBZA 4GX8A 1XLKA 4CQAA 2GZXA 2JF7A 1AH4A 1JF5A 4P7LA 2WC4A 4FSAA 3IGXA 3U48A 1ZBKA 3GKFA 4LV4A 1TPWA 5ABGA 2PDMA 3SR7A 3LK6A 4QS5A 2YXXA 4ZA0A 3UPMA 3WDRA 4BHYA 3KTSA 3W87A 3ARXA 3ENLA 3KRZA 4ZB2A 4U2YA 4PFHA 4XAYA 4XKYA 4DUXA 4XVDA 3MUCA 3VNJA 3WBAA 1A3WA 3DCPA 1DPMA 4GPNA 4KCTA 5B7ZA 3SADA 3N25A 4BS0A 3AXXA 3BLFA 3VMOA 2D22A 4PODA 3CV1A 4U2ZA 1C91A 2NQ5A 2PFHA 3W83A 1Q65A 3I7SA 4KFOA 4L1GA 2B31A 3DFNA 2R1NA 2Y8KA 5G4WA 1I2OA 1ADSA 4O53A 3MCMA 4XZLX 4UR7A 5JMUA 3C2RA 1M1BA 1V51A 3USBA 5EMKA 4DJFA 1XLJA 8XIMA 1L6WA 2EG6A 2BV9A 4W85A 4LX4A 4DNMA 5LNSA 3RLVA 6TIMA 2R1MA 2QYGA 3CUXA 3A13A 5GJPA 2UBPC 1GVFA 4KEZA 4KWOA 1OYBA 2IS7A 1EO7A 3BE7A 3VIMA 4KPLA 3H21A 2CC0A 2QMKA 1CXHA 1S2AA 1KFBA 1R3RA 3OHIA 4XO6A 4FNPA 3CEUA 1P0DA 4IMAA 4REQB 3ES8A 1ZS2A 4RJEA 3KP1A 1KRCC 3TZFA 4IMCA 3C52A 4RV8A 3R7MA 1JRBA 3RPDA 3CH0A 3DYOA 1K7FA 4UQAA 4Z2IA 1SMAA 3E9AA 2Q3RA 1IT8A 4WJ8A 3OGVA 2CLPA 1LDCA 4L56A 1OCBA 4N6EA 2PS2A 1DWIM 4HN4A 4J7RA 3CQIA 2QLYA 5BMWA 2NX1A 1TWWA 4A3YA 3C5QA 1JFHA 3DYMA 3NYZA 1ONXA 3BAJA 2W67A 1WZMA 3ZS4A 4XD4A 1DJQA 2YCLA 4IJCA 3GNDA 4DZAA 3IS4A 4Q8VA 3KL5A 3KOZA 4X0NA 4PTDA 2WMIA 5HMFA 4LV9A 2Y7DA 1GKRA 1E1FA 1F61A 5EMYA 3A3XA 5JUVA 5FKYA 5LYRA 2AQWA 3GC4A 3S5OA 2IKHA 4GWEA 3TMQA 4K38A 3GVWA 2QQ6A 3NGJA 3S5NA 3AIUA 4QE4A 1KM0A 4PR4A 1F6PA 5CGQA 1QJWA 4AD5A 4JS3A 1JVNA 3NNTA 3BUVA 2ZZ3A 3AALA 4K3ZA 1IXPA 3W74A 2WAGA 4G8TA 4JEJA 1WQ5A 4AY8A 2O4QA 4JTAA 3PZTA 2JF6A 2VNCA 2PSNA 1IGSA 3THAA 2VOMA 4D6EA 1VENA 1W91A 4KW2A 3LPFA 4DQWA 3CLWA 3H4XA 5AHFA 2AAMA 1W5NA 4B91A 5HMEA 3TYCA 2P0IA 1H7RA 4ZQOA 2C18A 5HBFA 4WY0B 3OBKA 2UY4A 4GXPA 1W1B1 2Z1XA 3MMWA 5LIYX 1IT7A 4MVAA 3W2NA 1ML1A 2X1UA 4L5ZA 3F2DA 4HN8A 5BOFA 3VIGA 4H6KA 4BI6A 1D3GA 1E6RA 3KCJA 3OG2A 4ZSTA 3UXIA 4J3ZA 3A9IA 1QOQA 3KBWA 2H6RA 4PBEA 4WOZA 3ZVHA 3P84A 3TCSA 2PDJA 4JIEA 1DTUA 2VI0A 4NAFA 4C6DA 5ABFB 1EP1A 2FKPA 3T0AA 1QDSA 3CIXA 4FLRA 2X41A 2R6OA 2VFGA 3G1SA 4ACZA 4CNUA 3W1NA 4F3HA 4MJ2A 3WZ0E 4UQBA 4PUUA 1RV8A 2W4XA 5AN7A 5HANA 2RDWA 1QWGA 2XGBA 1FWWA 3F7JA 1XG3A 3KZSA 3QGVA 2D23A 1AQMA 1E1CB 1E1EA 4PMXA 3LZ3A 4LAZA 2PLKA 3IJIA 4YYCA 3LGDA 5T9CE 1OC7A 1AQ0A 4L61A 1OINA 2J24A 2OFJA 3LM3A 1SFTA 2WPGA 4I5XA 2CZDA 2QUNA 1HN1A 3GUGA 4LF2A 2GUBA 1DKWA 4A8LA 4I3GA 4AW7A 1QNSA 3WLQA 7TAAA 1B3YA 1J5TA 1ZBWA 5FJIA 4LC8A 3UJSA 4HZ8A 4MM1A 4FOKA 2C15A 3S9ZA 1GVRA 9XIMA 4D8ZA 1BXNA 3INPA 1IEVA 3TEVA 3AYVA 3AIBA 4WR3A 4FR6A 2RAGA 3NQCA 4AD1A 5FJJA 4EPKA 4M7TA 3LCHA 2PCQA 4GUGA 4FLOA 4C6OA 1F3TA 4FMVA 2YOCA 3UPBA 1W3HA 3WQOA 2P88A 3PUGA 1OSEA 4D1JA 4JFVA 1TR1A 3NURA 4ZQNA 1XKYA 4HZ6A 4D1IA 3CHFA 2V5BA 3LOTA 4M82A 1UIOA 3G1XA 4O1CA 4S2CA 3MT1A 4DWSD 3CJPA 1NJJA 3DH7A 5K9XA 4MB1A 1HJVA 1HVQA 3GZ3A 3G1YA 1JEZA 3TAOA 2CWXA 3ARSA 5H91A 1AQFA 3ABOA 4NZJA 3ZYZA 2EKGA 1OX4A 2E77A 3RRAA 2WV8A 4WD0A 2EPMX 4MZYA 1VBHA 1VFUA 4EPBC 3QFEA 4S23A 1DJNA 4JTUA 1VBRA 2I57A 3I3BA 4J9JA 4V33A 2CFFA 2J88A 4QJ1A 4P8UA 4AMCA 4Q3MA 3EPNA 3CBWA 3E2QA 1X98A 4MLRA 5IFPA 3HPZA 1TA3A 1JAEA 2V2DA 4YHEA 1XC6A 2ALRA 3QOMA 4QE1A 4AX6A 2B7PA 5M5DA 2J27A 3STCA 1YXCA 5JBFA 1HQTA 2JKEA 4GYKA 2HXTA 3UG8A 1D8WA 3DC0A 4YCPA 3NAVA 1JPMA 4ADSA 2D3LA 2JALA 1UMLA 2B7QA 1KCXA 3AYTA 1T40A 2J25A 4HU3A 1FWRA 2FGLA 2HS6A 4HA0A 1UWSA 2YDRA 2OTDA 2QF7A 2RGLA 1O7AA 1VFMA 4NZ3A 4JN6A 2XYLA 1ZNNA 1G69A 1SSDA 4GUFA 3S2NA 3UEQA 5M2FX 3PZGA 2Y6ZA 1HJQA 4EWND 2R1PA 3P93A 3W2KA 3EKGA 1D8CA 4QQUA 2Z2BA 1UG6A 2BZNA 4JFUA 1OG6A 1TPUA 1GJPA 1RLCL 1MW3A 3PNUA 1SO5A 1N82A 4JTIA 1O68A 4GGHA 3GTFA 2PTWA 1ENUA 3C8NA 3T8QA 3ID7A 5A95A 4JYDA 2J6VA 2ZA2A 2XM1A 3AISA 1XIJA 4QE5A 4QSFA 4Q22A 2CITA 1TSIA 3E2RA 4A3HA 3WL1A 3H12A 4BEQA 4FXJA 3IUDA 3WF2A 5C8BB 2Y8VA 5HK4A 4POCA 2DT0A 1EIBA 3M6DA 1EWEA 2FPVA 4LCQA 6TAAA 3VCRA 3NXLA 1Z42A 3LPGA 7CGTA 2XH0A 4R3UA 1TMQA 5AFDA 4R34A 3N2OA 3DFYA 4UXDA 4GYPC 3ARUA 2GL5A 3G24A 2VR5A 4NI3A 2PDNA 3TQ0A 1EUAA 1IHIA 5A8GA 3R10A 4FZIA 3S47A 1E56A 2E9BA 3PWAA 4ZQCA 4GISA 1BPLB 5G1YA 5CPQA 4XZ9A 4F2BA 4V1XA 1EC8A 1DP0A 1V77A 1TIWA 5E6YA 2ZUMA 1JIBA 3E0FA 4CUCA 1RCOB 3GIPA 4UQEA 3B9EA 4FAMA 4HCLA 2INFA 3H6OA 5CSYA 2REQA 4PMVA 1S2VA 3WLTA 1OYCA 5DO8A 2CERA 2QCFA 3OB8A 3Q94A 2W66A 2D1ZA 4BCEA 2PB1A 1MXSA 3NM3A 3UWVA 1VKFA 2PODA 1CEOA 2D20A 1PTDA 4ZQMA 5TIMA 1GK8A 3M7WA 4I9AA 2DUZA 2WC3A 5D8WA 4AXNA 3MUIA 5AY7A 4MB3A 5DXXA 3WUFA 5CPMA 2NLIA 2WKLA 2XGZA 4GZ7A 1Z32X 3PWIA 2JKAA 3T81A 2J9XA 4QTGA 1J4EA 1A5CA 4AEFA 4O12A 1HW6A 2JGQA 2HSAA 4QSHA 1FH8A 4LYRA 1H7WA 2OX4A 1E3XA 2WJFA 3UA4A 4C1LA 1EP3A 4WKHA 1GGOA 1S39A 1GVIA 4YWIA 3PZUA 4L64A 3XIMA 1ME8A 1NDZA 4FOUA 2VQTA 4W5UA 1KBKA 3KX6A 1TTPA 1QHPA 4B5SA 3SCQA 1YBQB 1E4MM 3JS3A 1US2A 3V35A 1H7PA 2OLAA 4HHPA 1POKA 4L1XA 2HE5A 1OVDA 4RNIA 5JXQA 1QHZA 5GNYA 3UA3A 2DT2A 3D47A 4J27A 4TV5A 3DERA 4D2JA 5HWNA 4U5IA 3AMCA 1WDRA 3QKZA 3AS3A 4OV9A 4AZCA 3CYVA 2VVNA 1GT8A 1DVJA 3KBVA 3WF3A 3WMCA 2C71A 3H4WA 4G7EA 4R7WA 5CGMA 3G5EA 1WKEA 1HL9A 1FHLA 4ZMGA 2HPMA 3K8LA 3TN4A 5BRPA 2GQ9A 1CGWA 6A3HA 2IPGA 3MHGA 2YL8A 5I78A 2BY3A 1R3TA 4JN7A 2VGGA 3W84A 5I3KA 4WF7A 4IIGA 4GQBA 3K5XA 2EGZA 1K8YA 3BG3A 2B7NA 2DW6A 3OA5A 1EJSC 1P7TA 1XL9A 2J8FA 3G18A 5D8ZA 1YE6A 3UWUA 3QR1A 2C0HA 1BWVA 4C60A 1FDZA 2AOSA 1S38A 1WXJA 3GXNA 4LVAA 3WDJA 4H4IA 1PAMA 3DDMA 4I5UA 2WBGA 2PAJA 2I16A 3PBYA 3W28A 1E71M 2O0TA 3LHVA 4GCAA 2BX7A 3PZMA 1TMLA 1KRAC 4OQVA 2VP8A 2PWGA 1EX5A 1GJUA 3KXQA 4G7FA 1PX3A 4LALA 3CM4A 5M17A 3WQVA