4HN4A

Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 103
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hn4A00
4WQ6A 4ZQOA 2KZHA 2QCMA 3F1QA 4LTSA 4LWWA 5F2MA 3CLMA 3C2OA 2PE4A 1WAUA 4AHOA 3MO7A 1LCOA 1Z41A 1JCXA 1SW7A 2PC4A 2GVLA 4X2RA 1XM3A 1H7OA 2JGYA 3IVTA 2OT0A 2BZNA 3BK0A 1KM3A 5AHMA 1FXQA 4NZFA 1F6KA 3FA5A 2QJIA 4RV8A 4JTLA 3UWYA 2R91A 3W7RA 1O4UA 1C9DA 1HG3A 3WFAA 1G69A 2WSYA 3BGJA 4AAJA 5CSRA 2VEMA 2ZRYA 4Y8FA 1Z42A 2E77A 3C52A 2TRSA 5AHIA 1JQXA 1C29A 4Z08A 1NSJA 1OK4A 2EKCA 2JKPA 1I4NA 4BWLC 5HINA 2E6FA 4NQ1A 1DOSA 2VFDA 3BW3A 4JYFA 5TQLA 3CWNA 1OF8A 2GQ9A 1DJNA 1LZOA 3S5ZA 3BLEA 3STFA 4UC5A 1FQ0A 4JTUA 3NXFA 2C1HA 2ZZ2A 1VZWA 4DELA 1PE1A 3W6YA 3LBMA 5CPMA 1W54A 5K4ZA 1R2RA 5FF2A 3L2IA 2CW6A 3DKLA 4NUWA 1OYCA 1U83A 2ATMA 5D32A 3EXTA 3W2UA 4WOZA 4MY8A 2V8ZA 1JCNA 3S1VA 1EUNA 1X1ZA 3UPWA 1Q6QA 2E5DA 1D3GA 4O10A 3A9IA 4Z1AA 1I45A 1LYXA 5LZLA 1ONRA 1WQ5A 1H63A 3EWXA 1OFAA 3EX1A 1H62A 1TTQA 1ZENA 1G4EA 4S2BA 3W2MA 4PTNA 8TIMA 3VI2A 3M1ZA 3W75A 1FCQA 1SSGA 1LBMA 4JD4A 3UZJA 3LCFA 4HIBA 1M5WA 3LTSA 4LU0A 3M6YA 2XFWA 5F2LA 4IMCA 4XTDA 2OMAA 2VFHA 4AHPA 3HGRA 1L6SA 3DENA 5C2XA 3W1LA 1BWKA 3C6CA 3E12A 2ZTKA 2V82A 3VFLA 3TSDA 1LORA 1WBJA 3NG3A 1TREA 2VKZG 3UWQA 4RKAA 2PCQA 4QIUA 5E1QA 4UTIA 4AMAA 3EWBX 4IXHA 5K9XA 4M6QA 1V7YA 2VFFA 3STGA 3PS7A 3NO5A 1GEQA 3NNTA 1H61A 3U2OA 4YCPA 4UCGA 1VCVA 3ABQA 3W7IA 3C2RA 4DO4A 4JYDA 1VGAA 2X1SA 3P62A 4UFKA 4MZ1A 2I9EA 3HBLA 2NX3A 1MXSA 2YSWA 1UBSA 4XBKA 2P0OA 4A22A 3G1XA 1I2QA 2E6AA 1FDZA 3TC6A 4YWIA 2Y7DA 1K8ZA 2R8WA 1UB3A 3R5EA 4KWVA 2TYSA 2CLEA 1SW0A 4M7TA 1R46A 1VCFA 3P82A 5FEXA 4AEOA 3TKFA 4JN6A 3LHUA 2QUVA 1OK6A 3W76A 4NX0A 2CLOA 3DFSA 5LGXA 3ZS4A 1I2NA 3NM1A 1AMKA 4XZ9A 1JRBA 2J24A 3NQ2A 4FNSA 3W7KA 3GXTA 1HTIA 4U28A 2FB3A 3ELFA 1KM0A 2DZWA 4Q33A 3W1AA 3OEXA 1EEPA 3K30A 2E5BA 3TCEA 2A4AA 5G2IA 1F73A 3PR2A 4PC8A 4N9BA 4ADSA 1I2OA 3QZEA 1W31A 1JQVA 4D2JA 4HNTA 3TJXA 3FJLA 1SQ7A 3L5MA 3EXSA 5CZSA 4A2SA 3BW4A 2HMCA 1HFBA 1PV8A 3DXIA 4B5NA 1GVRA 3G3DA 4WY0F 4S1FA 1XXXA 2A6LA 2Y7EA 4MJMA 1ME7A 1PIIA 1HUVA 3P5ZA 3MBDA 3DKJA 3GYEA 3IVSA 2WSRA 3UYCA 2NV2A 5G4WA 2Y88A 1ZAJA 1EWEA 3I68A 3NL2A 4M5PA 2G97A 3HO8A 5LKYA 3WJWA 1W5PA 1L6WA 3QYQA 2GQ8A 4PEKA 1XKYA 3PWAA 3W9ZA 3IIVA 1VYSX 3QMTA 2VENA 1BKSA 2NUWA 1DHPA 3DI0A 1LROA 4LY8A 3S1UA 3TDFA 4I7UA 2PRHA 4GC4A 4KKXA 3NOEA 3OG3A 3TC7A 3NQ7A 1U5JA 1P0KA 4Z1DA 1FY6A 1XI3A 5AYYA 3USBA 1HO4A 5AC8A 2CFFA 4WJEA 1Z48A 4WY0A 3ABRA 3WK0A 3O1NA 3GIYA 3WJSA 1AW1A 3EX3A 4GJ1A 5CZ0A 4N9EA 4WY0B 4CCCA 5DY3A 3DFPA 4IUOA 1FWSA 1TQJA 1VYPX 1XDMA 1XUUA 3W1XA 3P67A 3LV6A 1SSDA 1K8XA 1GVQA 3LHTA 1HO1A 3NQFA 2HSAA 4LVDA 4AWSA 1TTJA 3W73A 4UTUA 1YTEA 2WQPA 3HB9A 1N55A 5K9DA 3Q58A 1RQHA 2CZFA 1LOLA 3LCLA 3GKFA 3VNDA 3IIOA 1ME8A 4LOCA 4MOZA 2PRMA 2ZRZA 5DBUA 3L5AA 1EX5A 1KM4A 2AAMA 3TSBA 1WYIA 4O15A 3W7EA 1GZGA 4K37A 4MKNA 4A21A 3STEA 3LV5A 4L4LA 4UTLA 5CKSA 1ZCOA 3DFQA 4JX6A 3GDKA 1G4SA 3PUEA 4HHPA 4NU7A 3KRUA 3NQ8A 1G4PA 1KBIA 5FEWA 3LLFA 3N19B 4DPQA 4Z1BA 2ZCGA 4O54A 5D30A 3L66A 3B0VC 3IV3A 1I8JA 2TMDA 5MHBA 2B7QA 5K2ZA 4JTGA 2X1TA 2XN2A 3H54A 5U7SA 3NPXA 3LRKA 3P5YA 3MYPA 4JTHA 1KTBA 5C55A 4E0CA 4GXMA 3E9AA 3TNOA 4NX5A 3MUXA 1TV7A 2E1DA 4CNOA 1TRIA 2DP3A 2NXGA 5CPOA 3MJYA 2Z2UA 4FNTA 4KFPA 5LNWA 3DAQA 5C54A 1FWNA 1UUOA 4TMBA 1H7XA 2WNQA 1W1ZA 3L0KA 3NR0A 4NJGA 3KAOA 4JDBA 4YL2A 2OJPA 3I6RA 1X6UA 2XN0A 1OFBA 4O4VA 3QSTA 3W71A 1IXOA 1TPH1 5HWNA 1FDJA 2Y85A 4CLMA 2HS6A 4KFOA 2VFGA 2ZZ3A 2ZQ0A 2ZRUA 3EX4A 3I65A 2Y7GA 2CLIA 3EB2A 5AB3A 4XWUA 1L2UA 3EWZA 1ZHAA 2A2IA 1F5ZA 5FI8A 2F84A 1VQTA 1OFEA 2YFOA 2AQWA 1FWWA 4AF0B 4GUIA 2Z6IA 4N9DA 2UV8G 4X3ZA 2J9XA 3I7SA 3MI3A 1YDVA 1KBJA 3CU2A 3UD6A 2JGQA 5A8GA 3TMQA 3O6DA 3T7VA 4OHQA 4GWEA 3C4UA 3GR8A 4FB7A 1WA3A 1DV7A 2DORA 3B05A 2QCEA 3UQNA 1QCWA 2E09A 2DZTA 3LRLA 4IMGA 1K7EA 4JTJA 1OFDA 3G1HA 2G96A 3SGUA 4MUZA 3P8JA 1K7XA 5EY5A 1R47A 1BWLA 5DY2A 2O7SA 2J9ZA 3LCHA 1JJKA 3AJXA 2WKJA 4O12A 4RX0A 2VFEA 2ZYFA 4N9CA 3UZ5A 1LP6A 1XDLA 1RD5A 1OX5A 5G1TA 4RLIA 1FWRA 4UMCA 4OT7A 3O8AA 4K8EA 1FCBA 2E5CA 2NWSA 4ZQNA 4CCDA 3LDVA 2TPSA 2EGZA 1YADA 4N2YA 1KFEA 1GOXA 2R94A 3M5VA 1AL7A 2Q3RA 1KV5A 3GAYA 3HG4A 3LXAA 4O52A 2LLEA 2FJKA 3UWVA 1GYNA 3G18A 1KFBA 4ZQRA 3G1AA 3GLCA 2C18A 2V81A 4IX2A 5KZEA 2JKEA 5D2YA 1DORA 3HPZA 3M5YA 2FPYA 4JTSA 2V2CA 4FNQA 2H8XA 2CU0A 1QMLA 2VELA 4FXSA 3B04A 5T26A 4QSHA 1I2PA 3M5ZA 1TCDA 1RR2A 3W1NA 1WOAA 4M7SA 2WJZA 4K8HA 4QQ3A 3B06A 4UFLA 1NF7A 3INPA 2V30A 4JNMA 2V2DA 3THAA 4ML9A 4KWWA 3PM6A 5KITA 4NNAA 5DCBA 1G6CA 3W2NA 4EF8A 4UTTA 3MP3A 3FYPA 4X22A 1SFLA 3FKRA 3BARA 4IMFA 2VEKA 2QCFA 4ADTA 4FNRA 4UMAA 2A85A 4O50A 5AFDA 4E38A 4DBDA 3GDRA 1YXCA 1LOQA 2V5BA 1K8YA 3QQ1A 1L6YA 2ABAA 3L21A 4TX9A 5LNVA 1JR1A 3RU6A 3QQ0A 1H1YA 1TPDA 1IIHA 3FIGA 3G0XA 5AHFA 4FO4A 1VH7A 3PULA 2RH9A 2YYTA 3LOTA 5K4XA 5HQEA 1SPQA 2WV8A 3W72A 2FLIA 5FEPA 4IGHA 4CCEA 4Y96A 4DEFA 2E6DA 3TW6A 3LHVA 2B4GA 1W5NA 1RQEA 3IGXA 5G2HA 3SECA 1ICPA 3SJ3A 4LUIA 3R8RA 1DVJA 2EPHA 2RDWA 3FOKA 4NJHA 4UNLA 3TFCA 5HR7A 1W0MA 1GVOA 3ABOA 1QOPA 3CTLA 1RPXA 4UXDA 3DGRA 2FQIA 3STCA 3W2LA 1GJPA 3GNNA 4JTKA 3P81A 4UTJA 1A5BA 4A29A 3ZR4A 4ZQMA 1D9EA 2DU2A 4E2DA 3DFOA 2QJGA 1XCFA 4AHQA 3BVJA 4IXXA 3GX9A 3ANYA 3G1SA 4NNBA 4LVBA 3FS2A 3SFKA 3NQDA 4NT0A 5DCEA 1J4EA 2H6RA 1RQBA 4O16A 5HJLA 3MP4A 4JY8A 2VOMA 3CQ0A 1F76A 3CM4A 3W1QA 3W7DA 5FF4A 3PAJA 4JDYA 2DZXA 5AYZA 3MMTA 3C2FA 5DXXA 4I7VA 1F05A 1SO5A 4ORIA 1JUEA 2GOUA 3LTPA 1TTIA 5HWJA 3S8HA 1SO3A 3GXPA 3W74A 3SSJA 1LDCA 1H50A 4NJKA 2CLHA 4RXFA 3NZRA 6ALDA 3QMSA 4LS1A 1PL9A 1N8FA 1F74A 1KM2A 4RCXA 4UTTC 2G95A 3UY8A 1TQXA 4UTHA 3HF3A 4OV4A 3JS3A 3HG5A 3B4UA 4UFIA 1GVSA 4Q32A 1G7UA 1F6PA 3LTYA 4O1BA 1WX0A 5CZJA 1B9BA 3QMRA 4I9AA 2YGYA 5D33A 3B03A 4W9TA 5TIMA 3NAVA 3G0SA 3PY2A 4NXSA 1OFQA 2CLKA 1X7FA 3LCXA 5LNSA 3NQEA 5AOUA 3KHJA 4MZYA 1B4KA 2WPBA 2P1FA 2ZTJA 1FCVA 3M5XA 3HG2A 4XBSA 4ZMGA 1QNVA 3E02A 5KTLA 2Z1BA 3KXQA 2VEPA 1UCWA 3PBVA 3MHUA 3L9CA 1DQXA 4IQLA 1H1ZA 2QCGA 3LHYA 3QW3A 1GVFA 3W1RA 3JRKA 3GDTA 3M41A 3W84A 4O14A 4N6FA 2G5WA 4HPXA 2H8ZA 4S2CA 1ZFJA 3YPIA 2ZZ1A 2NX1A 3LCWA 1ZAIA 3GDLA 3E0IA 3RLVA 3QM3A 3NQMA 3RK8A 3DU0A 1FX6A 5EPDA 1Q45A 4FHAA 3BO9A 1J2WA 5L9FA 1IIGA 3HGOA 1Y0EA 1AG1O 1DJQA 5FF7A 1ME9A 2CZEA 4OWGA 2ALDA 4TR9A 2Q8LA 3PSVA 2JBMA 1GQNA 3BW2A 3IRDA 5EA9A 4CQ8A 5K9CA 4FX6M 5G5IA 3HJZA 1LBFA 3NVTA 1CI1A 1XUZA 4O1AA 4IMDA 3P74A 2ZRXA 4IWWA 5GVJA 3LI1A 3MWAA 3MHGA 4XUGA 5KZDA 5E93A 4GNJA 4EVZA 3QRHA 3S0CA 4JTEA 1YTDA 4JEQA 2A21A 5AC7A 2EF9A 2C6QA 4LRSA 3NGJA 4R53A 4O8RA 5F2IA 1N7KA 1H7WA 1YXYA 3KVKA 5LNUA 3L0NA 3W7JA 3FYOA 4M6PA 2V9DA 3G8RA 4ZVJA 1P5BA 4QAIA 3TH6A 3L67A 3A23A 2ISSA 2A7PA 5I3IA 3NPUA 2P10A 4ZL1A 3WJXA 4JR5A 3PBYA 1TV8A 1X1OA 4UMBA 3W7LA 4ORMA 2DJLA 4FNUA 1GWJA 4PFMA 2Y7FA 3O06A 4QNWA 1L9WA 4MJZA 3M0ZA 4WD0A 2DJXA 2H3DA 4JTIA 1JVNA 3PVFA 3Q94A 3KVJA 3OHIA 2ZRVA 2X1RA 4HNUA 2H90A 4R34A 1Z44A 3LXCA 1H60A 3SY5A 5HULA 1THFD 4J9JA 3MI6A 4MIMA 3VE9A 4QISA 2BLEA 4LS0A 3LCIA 4BI6A 1LBLA 3IGUA 3V75A 3DBPA 3S1WA 1QDSA 1YDNA 2J27A 3PC0A 1KFCA 1OX6A 1SZFA 5D09A 3W7NA 4PL1A 4IPIA 4O19A 3FEMA 2I1OA 1Q3NA 5C6MA 1EUAA 1WV2A 1WXJA 3ZFHA 4UNKA 2NXIA 2RKXA 2A0NA 1XBXA 4DXVA 3U6WA 1LRQA 1TYGA 5HWMA 3LLDA 5EL1A 1FUYA 1AK5A 3S5NA 1XBZA 4JY9A 3HMJG 4JICA 1H7NA 3JR2A 1GT8A 3LX9A 5LSMA 5DCDA 2C3ZA 5DLCA 3IIPA 1XFBA 3SGZA 3TROA 1TJRA 4QJ1A 4PL2A 3RF9A 1ALDA 4A3UA 1H7PA 2C0AA 3TAOA 4DF1A 2GVGA 5CG7A 2ZRWA 1PS9A 1YPIA 4O4WA 1T99A 4L4MA 2OCZA 4OQVA 3NL5A 4LC8A 1OHLA 3FKKA 5KSWA 3PBWA 1OABA 1G67A 3TU9A 1OFRA 3P7YA 2FIQA 3O07A 2QKFA 5DBTA 4FEZA 3B0PA 3RMJA 3DI1A 1DQWA 3W23A 4UFMA 5D04C 3W70A 1IXNA 2Y63A 1T0OA 4LVGA 3T4CA 2DZPA 2FPTA 3CT7A 1VHNA 5F4XA 2EHHA 4FIRA 3UY7A 1EB3A 3TQVA 4BF9A 1OX4A 2A5HA 2J88A 3C61A 2YW4A 3R12A 2YR1A 1K3UA 4OBTA 4IJBA 1J5TA 1FBAA 1LRTA 4M6VA 1OX4B 4YLWA 1D3HA 4KFNA 5G2WA 1M6JA 1W5OA 1KW1A 2VC6A 4JGDA 1A50A 4DO6A 4TO8A 1OJXA 4HKPA 4YXGA 3ZWSA 1ADOA 4QNEA 1UUMA 3TFXA 5FESA 3W7QA 3M9YA 3A21A 3QPYA 3G8EA 4LV9A 4MLRA 1W37A 2A7RA 2X1UA 3MI2A 3M43A 3F4NA 4ONVA 1XBVA 5FF3A 4XKYB 5F4WA 3G1YA 4AF0A 5E0KA 4Z1CA 2Y70A 3TJLA 3WJYA 1B3OA 3N9RA 1EWDA 1A53A 4GE8A 2C19A 4JIPA 3BLIA 5I3HA 5KINA 3LERA 2VXNA 4K7VA 3W1PA 1WDWA 3DZ1A 2DZVA 1VS1A 3DFNA 1PCWA 3PBUA 2X2GA 3M16A 2RHGA 1GTHA 2QDGA 2ZDRA 3S9YA 3GKAA 4RZ4A 5F1VA 1RV8A 2V0TA 3KVLA 5D2VA 1W3IA 2GJNA 2FB2A 3O6CA 4IOTA 1EIXA 4K7YA 1UASA 3I7QA 1FXPA 2ZFAA 2DZUA 5BOOA 2ATSA 4EOUA 3GR7A 1ZY9A 3R13A 4O0KA 3TK7A 3W7MA 1ICSA 3R89A 3TA6A 3GNDA 5K3VA 2EAWA 4K36A 3TE9A 3RNDA 5FF0A 1TRDA 1QO5A 4WOQA 4AWTA 4RR4A 1O95A 3QH2A 1T96A 1OG0A 3TR2A 1TIMA 2YW3A 1XBYA 1GYLA 1ML1A 4RJEA 4ZQPA 1XL9A 4MYXA 2I14A 2QF7A 1P0NA 4PCFA 4ALDA 5HUPA 2RFGA 1A5CA 4UR7A 4UFJA 4R33A 2CWNA 2QR6A 3C8FA 1Q6OA 4JXCA 2ISWA 3QEZA 5BMWA 3SI9A 3G1FA 5SWUA 1K7FA 3CIWA 3BG3A 4K6AA 4JX4A 1TTPA 1EA0A 1S5WA 4LVAA 3S5YA 3TAKA 2E6YA 1FWTA 3GB6A 3NQAA 1NFBA 3LRMA 2FTPA 3EX6A 4WXYA 3CWOX 3TV8A 5AHEA 1QR7A 5F2GA 3FJ6A 3PG9A 4H4IA 1MZHA 2Y6ZA 1QWGA 5LNRA 1LOSA 4FX8A 1P1XA 3CIXA 3KRZA 1YDOA 2B7OA 5I3KA 3SIZA 1YLVA 3TUUA 1HL2A 3LM7A 4OV9A 3QJAA 1TPFA 4N4QA 1GPWA 4O11A 2BSLA 1PVNA 2NWRA 3HQ1A 3CEUA 3W1UA 3W87A 1IF2A 2CZDA 1LRNA 3EKZA 3QC3A 3PUOA 1AW5A 2RDTA 4UFHA 1KFKA 1JCJA 4MYAA 4RXGA 3U8GA 2QCLA 4UTWA 5AHLA 1G4TA 1G7VA 3CPRA 2CLLA 4UTKA 4AB4A 4WXZA 2X30A 1GG0A 1KLYA 1KM6A 2D73A 2YCEA 3N14A 2WO5A 1TV5A 3MP5A 4PA8A 4BI7A 1EP1A 4DPPA 1WOBA 3NM3A 4OGZA 5H91A 5FEZA 1VYRA 2QAFA 3BG9A 2A7NA 3UXAA 3GDMA 4EWND 2Y62A 4LW7A 5F4SA 5H2ZA 1SW3A 4MZ8A 3P61A 4NNCA 2B7PA 1FCUA 1M7PA 3RLUA 2ZZ6A 5EYWA 1S5TA 4HN4A 1T8XA 4UIOA 2PURA 3E96A 4NXKA 3TQ0A 3QFEA 1O60A 1SUXA 3A5VA 4CNNA 3T55A 3VKJA 2OZ0A 1XC4A 5K7JA 5HR6A 1MEWA 2W0UA 4MY1A 1YYAA 5CZTA 5AYXA 1NVMA 1W56A 1ICQA 3HGJA 3GAKA 3C2VA 3CC1A 3ATZA 1KA9F 3HGSA 1A5SA 1KFLA 4CNPA 2J6XA 1SO6A 3S42A 3HPXA 3KOFA 1VJIA 2ABBA 3OA3A 3W7OA 5C5YA 2AGKA 1F7BA 1JULA 3D0CA 3H55A 1OFPA 1EP3A 1QPQA 2QCDA 5IBXA 2HS8A 3S1XA 4GRSA 2QEZA 4LVFA 3KX6A 3VE7A 3SR7A 1H51A 4K38A 5I3FA 3QW4B 3A22A 2QCDB 4BFAA 3HOJA 3NQGA 4GUHA 2ZBTA 4FF7A 3N3MA 4BR1A 5D2WA 4Q4KA 4MFDA 5EBUA 3PUDA 5D05A 3O63A 5D38A 4UTMA 4OE7A 1KM1A 4GUGA 1O5XA 2YXGA 3W88A 4BK9A 3PSWA 2QAPA 4LUJA 4WX2A 4NZJA 1VRDA 3G3MA 3G1VA 2GVJA 3EWWA 1MO0A 4UTWC 4N6EA 3TW7A 1VHCA 3C2EA 3BV4A 4PH6A 4JS3A 4MVAA 3LBCA 4H3DA 2YFNA 4O13A 1IXQA 2C15A 1MSSA 1E51A 1LLWA 2QCCA 4FX7A 4ADUA 3L68A 4O53A 4YMZA 1LTDA 3OVQA 3B8DA 4I7WA 4LNYA 2QCNA 4Y6GA 3FFSA 1W5QA 1TPWA 1JUKA 3CHVA 1SU5A 1OF6A 1CX9A 4NJIA 4WUIA 2WNZA 2H3BA 3HPSA 1YTKA 3F4WA 3DH7A 3IVUA 3NQ6A 1Q6RA 3RFAA 3H53A 2QUUA 1PHQA 1W3NA 4MY9A 2PRLA 2B0MA 3LHWA 1H5YA 3MHFA 3T78A 4BI5A 4DF2A 2YZRA 3IGSA 5G1YA 1NF0A 1VC4A 2CLMA 5HNRA 4HSOA 5AN7A 2XN1A 3LCGA 3MYOA 5LGZA 2QUTA 4RZ5A 3V1PA 3N34A 5D03A 2VEIA 1PHWA 3W2JA 3DHFA 3O15A 5I3GA 3P80A 3TXZA 2YX0A 3IIXA 2X16A 3M7WA 2GUUA 3OIXA 1W5MA 2TSYA 1AL8A 1S3HA 1EP2A 2Z0IA 5LHEA 5F1UA 3LXBA 1KTCA 4ZZ9A 1KLZA 5IBXC 3EWUA 4LRTA 2BXVA 1VR6A 1KFJA 3N2XA 1W3TA 4CQ9A 4O1CA 3F03K 3W7HA 3NQCA 2Q8ZA 3C0JA 4C1KA 4HNNA 1QFEA 2NUXA 3EWYA 2R14A 5EKYA 1V5XA 2HTMA 3Q2DA 4O17A 3KRSA 1KV8A 2NLIA 3G1DA 4DQWA 3W7PA 1QPOA 3W1MA 3AO0A 3O05A 4TU1A 3UWWA 3W85A 1TPVA 3W22A 3Q37A 4FIQA 4GUFA 4LS2A 5BRBA 2Z6JA 3LHZA 3EEGA 4Y9AA 3FLUA 4O28A 1B4EA 3P60A 1TPEA 2NZLA 3GVGA 3HIJA 1YXDA 1VPXA 3C56A 3ZWTA 3NPWA 1O94A 4XQ6A 3SW6A 5U4NA 4JTTA 4OU1A 4NVTA 1I2RA 2CLFA 2WOQA 1DKWA 4HPJA 1IXPA 4TMCA 3EKLA 4EIVA 5J5DA 1BTMA 1TB3A 2C14A 2WSQA 4DF0A 3A5FA 5D02A 1TMHA 4O1DA 2C13A 1C8VA 3HG3A 3BGGA 4Z0JA 1SZEA 1IGSA 3S5OA 3PB0A 1JCYA 5BW6A 2QJHA 5D37A 3WK1A 2YDAA 2BTMA 2WNNA 3KVMA 4PODA 4GUJA 1DBTA 5HUOA 3UXDA 4RZ6A 3TQKA 1S5VA 1OYAA 3OVRA 1QPRA 4N02A 3G0UA 1QOQA 4TIMA 1TSIA 2VFIA 4Y90A 4O57A 3NA8A 2W79A 2W6RA 3MBFA 1PCKA 5D2TA 4IX0A 1AW2A 3NEVA 1DL3A 3TMLA 1R30A 1LM1A 3TSMA 2NV1A 2FPVA 2Y61A 3UWUA 5A5WA 1P4CA 3TX9A 4AXKA 3O16A 3LGEA 1ZAHA 4AWUA 4K39A 3BG5A 2JK2A 3W86A 3W07A 1SO4A 2ISVA 2OX1A 2RDUA 2A6NA 3QPZA 2E68A 1NAL1 1GG1A 3L5LA 5AHNA 1KTNA 1A5AA 2BWGA 3B0UX 4EF9A 4FNPA 3MW7A 1R2TA 1RZMA 1R2SA 1SFJA 1TPUA 1VLIA 4Z0SA 4XTIA 5DN1A 3UPBA 1ZALA 4C1LA 3UNDA 5KMYA 4P61A 4AVFA 2JKAA 4GFSA 2V2HA 3P8IA 4O18A 4U4MA 4CQAA 5D2XA 4QITA 1K02A 2YPIA 4DO5A 4UUIA 1QAPA 3R2GA 5G4EA 2C16A 1GTEA 4H6KA 5L6UA 5I3JA 4HNVA 2GPTA 5ABTA 1RVGA 1YPFA 2QDHA 3M44A 3PF3A 5DXYA 2CZ5A 4MFEA 1CW2A 3ABSA 3PB2A 3NYZA 4XKYA 4FXRA 4MPQA 3EXRA 3S6DA 3T44A 1O5KA 3WK3A 4RK8A 3W7GA 7TIMA 1VCGA 1VLWA 2Y89A 4N4PA 5LHFA 3W2KA 3WK2A 4O0ZA 1JCMP 3T40A 3IEBA 2FDSA 3N9SA 1UJPA 2ZZ5A 5TBOA 1SR9A 4G1KA 4IMEA 2ZZ4A 2GJLA 2YYUA 1K03A 2OT1A 1TPB1 5KZMA 2A1YA 2ZA1A 4LV4A 1JRCA 1NEYA 4ZQCA 1BEUA 1SZNA 4IPJA 3TXVA 4DBEA 2IQTA 4X9SA 3C3NA 3NZ1A 4POCA 1QO2A 3OVPA 1WBHA 4NJJA 4GBUA 4A2RA 3LB0A 3QSRA 5EMUA 3BLFA 3NPVA 3UWZA 5BMXA 4JIQA 2DZSA 4AH7A 5J5RA 4JX5A 3CB8A 4HSNA 3W83A 1EPXA 2QCHA 1X8FA 6TIMA 2ZA3A 3W1TA 3NQVA 3DFTA 1ZJIA 2ZA2A 1JUBA 1FDYA 4BWLA 1JCLA 1OYBA 4QM1A 3M47A 1MEHA 5CSSA 3O6YX 1ZNNA 2ZZ7A 1B57A 1TPC1 1TJPA 3LI0A 4LT9A 3ATYA 1OFOA 2NXHA 1LLZA 3DHDA 3GK0A 3EX2A 2B7NA 4P2VA 3BPWA 3THQA 3TIMA 4WZHA 4MLJA 2F7FA 3GZ3A 2J9YA 2O7QA 3SZ8A 3L65A 2Q3OA 5CPLA 3OBKA 3KFTA 1TO3A 3WJZA 4JYEA 2BX7A 3NDOA 1Q6LA 3NL3A 3QF0A 5DELA 1M7OA 3E49A 1H7RA 3A24A 4HT3A 3NL6A 4E2BA 2GQAA 3I7RA 3IIZA 1F2JA 3W7CA 2V5LA 3CEPA 3W3OA 5HMSA 5AC6A 5IM51 3PG8A 5CGQA 1OVDA 4M19A 2FFCA 2NX9A 2NUYA 3GXNA 3L0GA 4YCOA 3G22A 4UR8A 4JTFA 3P84A 1MEIA 3G24A 3N73A 1QPNA 4R7JA 4ICNA 1W8SA 3VCRA 5BNKA 1SZGA 3N2MA 5CPNA 1KM5A 4LC6A
chains in the Genus database with same CATH superfamily
3BAJA 2GLKA 3RX4A 2PDKA 3S2CA 2WXDM 2HNHA 3C2OA 3EOOA 1S39A 2OG9A 3BMXA 2NT1A 3ZVIA 3MO7A 1Z41A 1SW7A 4X2RA 4AD2A 4DJEA 3VIFA 1S46A 2JGYA 3IVTA 3OLIA 2IUZA 1GK8A 2OT0A 1FXQA 1QHPA 2HE5A 1F6KA 3FA5A 1AQMA 2QJIA 2QGHA 2R91A 1O4UA 3WLHA 1HJVA 1XFCA 1YNPA 4GO9A 1XF0A 2VEMA 4HGXA 4XB3A 1Z42A 2E77A 2TRSA 1JQXA 4L61A 3S4TA 4QAWA 3DECA 2E6FA 3MANA 1JIBA 2E8YA 2Q6ZA 3BW3A 5BU6A 1DJNA 1LZOA 4K68A 3BLEA 3WLMA 3RX2A 1FQ0A 3T08A 4JTUA 2C1HA 1JDDA 2ZZ2A 5XIMA 1VZWA 4DELA 1AD1A 3GNRA 3WD1A 1PE1A 2H9AA 5CPMA 3F7JA 2POZA 1R2RA 3WEZA 3B4YA 2Z2AA 3L2IA 2DGAA 4IFKA 1EOMA 1V3KA 2I7GA 3WDHA 4H9UA 4HZ8A 2PB1A 3WY1A 3PTQA 1OCJA 3WH5A 4PUNA 1Q6QA 2E5DA 2I5GA 4K1WA 7TAAA 1ONRA 4MKSA 4AD4A 4H8VA 3EWXA 3CZJA 3CWHA 2XSAA 1O5RA 3KTCA 2DIJA 2PF8A 4PTNA 5FKYA 1DJGA 1V6UA 3NXLA 8TIMA 3VI2A 1CXEA 1NP0A 5FCZA 4HIBA 4LU0A 5MKGB 3WMSA 1U2YA 4HU8A 1UR2A 4IMCA 3CZEA 2PTWA 1BHGA 2B31A 2HBVA 5C2XA 1ISWA 4JEJA 1FWGC 3E12A 3VFLA 1QUMA 3NG3A 1TREA 1OCNA 2VKZG 4ATWA 3KL3A 3UR5A 2PCQA 4QIUA 4Z2IA 1R6WA 4HNLA 5E70A 1C91A 4M6QA 3PNUA 3STGA 1EBGA 4GI4A 3FGCB 4WDUA 1HN1A 2ACSA 4YVPA 1VCVA 3OLGA 3V5CA 4D6FA 4MZ1A 2I9EA 3E5BA 4ICMA 3KP0A 2QJMA 4BF5A 3HBLA 2RGMA 4OOUA 1PWLA 4A22A 1I2QA 4X9YA 3BURA 3ARRA 2E6AA 4C60A 4Z17A 3CBWA 3EOEA 4DM2A 1VCFA 5FEXA 4RNFA 4AEOA 3TKFA 3WD0A 5CJNA 4JN6A 1UC5A 4H19A 2VZTA 1OK6A 3URBA 4NX0A 1VPQA 2F6XA 2XG9A 4UCFA 4PULA 3NM1A 4S3CA 1KNWA 4FNSA 1TVLA 3GXTA 2FB3A 1OZMA 2PMQA 1KM0A 4ECLA 1IT0A 3OEXA 1EEPA 4H7VA 4MUPA 5G2IA 1F73A 4H2HA 4HJFA 1P1MA 4PR4A 2BASA 4N9BA 4ADSA 3QZEA 1JQVA 1JFHA 3FJLA 3EPNA 2ZXBA 5A3HA 3W00A 5CZSA 4AC7C 3QGKC 3BW4A 1S2CA 1HFBA 1PV8A 5I02A 2R1MA 2D1ZA 4E8DA 2QMKA 2Y7EA 3NEHA 1PIIA 1HUVA 3MBDA 3GYEA 3IVSA 1PX3A 3UYCA 2DSZA 2C7FA 5G4WA 3WEMA 3NDYA 4CCZA 3QYQA 1L6WA 2GQ8A 3VMPA 4PTXA 2DW7A 3IIVA 4AZCB 3QMTA 1VIZA 3FN9A 3ARUA 3S1UA 1EHAA 4I7UA 3XIMA 4U2ZA 3NQ7A 4DZIA 5DMYA 3WBXA 2YCKX 1HO4A 5AC8A 3TYUA 1Z48A 3ABRA 3WK0A 3S2NA 1VFLA 2OOGA 4C6EA 5DRIA 1CPUA 1V93A 1TQJA 3CPGA 1J0IA 1XDMA 5HPCA 1R0MA 2G37A 4F8XA 3LHTA 2G4FA 1IEIA 5EFFA 3H70A 2WQPA 1V3JA 1N55A 1HKVA 3W01A 3Q58A 3VDBA 1P6CA 2GSJA 2IMRA 1RQHA 3B9EA 1LOLA 2XVGA 4JTRA 1GOWA 3MWCA 3TZFA 2CBVA 2ZRZA 5DBUA 3W7EA 1WYIA 1VFMA 4O15A 3UXKA 4MKNA 3LGDA 2V67A 3SGGA 3DFQA 1Q6FA 4NU7A 1MDLA 3KRUA 1M03A 1QI3A 1OCBA 4DPQA 2ZCGA 5D30A 1UZ4A 3B0VC 1FH9A 5B80A 2VCBA 2BNJA 2NW0A 5K2ZA 3L4UA 2FDMA 1AQ0A 5C71A 3T09A 3P5YA 3VVGA 4B92A 1KTBA 3E9AA 2WW5A 4EX4A 3NWRA 4NZ1A 4NX5A 3BV7A 1SZRA 1ZQ5A 2W62A 1B54A 1EO7A 5A1AA 4CNOA 4GVGA 4KESA 4PMJA 4I5RA 5CPOA 3MJYA 2O4QA 5LNWA 1W1B1 3GTHA 4YYFA 4YL2A 2XYLA 3I6RA 1ZLPA 4B5WA 1W1A1 3KUMA 4O4VA 4NP7A 2G0WA 1PSCA 1E3XA 3LNMA 2HS6A 2ZZ3A 3U3HA 2Y7GA 2NQLA 1WNOA 3JZEA 2ZWYA 2F84A 2AQWA 2INFA 1CXHA 3SJNA 3DOPA 4C1NA 3NOYA 2X05A 3GR8A 2BP1A 4OFCA 5A95A 2IXVA 4HJWA 1WA3A 2WMFA 2QCEA 1QCWA 3H2EA 2ZXAA 4JQ4A 2EPMX 4J27A 4DBSA 2BOGX 3SUWA 4ICCX 2I5QA 3P8JA 1XG4A 1HP5A 4BEUA 1R47A 5DY2A 1TMLA 1A5OC 2HVMA 3HPFA 2FVMA 4N9CA 4ZE4A 3CHEA 3RRXA 1R3QA 1AODA 3N6HA 4NHVA 3WLRA 1FWRA 5HMFA 5A6MA 1KQZA 4RE4A 2VRKA 4OT7A 1FCBA 2NWSA 4ZQNA 3IJ7A 5EGRA 3LDVA 2EGZA 4XZHA 1KFEA 1GOXA 2J62A 1KKRA 1KV5A 4O52A 3ZT7A 1GYNA 3G18A 3LZ5A 4A3RA 2V81A 4IX2A 3UZXA 1DORA 1FA2A 2VC5A 2FPYA 3M5YA 3TYEA 2D24A 2ICSA 4JTSA 2V2CA 4P8XA 4FNQA 2H8XA 1EYWA 4HPGA 1NFPA 4MTVA 3AISA 4Z2HA 3GXMA 4QSHA 4YTRA 1NJJA 2WJZA 2J7CA 4Y9NA 4UFLA 3U7VA 1XIHA 3OP2A 2ZUUA 2V2DA 4FA3A 3PM6A 3WDRA 2KAUC 2WNWA 3KCJA 4EF8A 4UTTA 4H9MA 3FYPA 3BARA 8XIMA 3H2CA 1XSJA 1CGUA 2A3EA 4ADTA 3VNKA 3UA4A 3WQWA 1MI3A 4TVUA 1CWYA 2VCCA 3S83A 5D9MA 1LOQA 1K8YA 3QQ1A 4XUYA 1L6YA 2ABAA 3SAZA 4ZO6A 1L6FA 3L21A 4JIEA 4HTYA 3VU2A 3QQ0A 2EQDA 1E43A 9XIAA 1WDPA 1M01A 3WF1A 5HQEA 5EMMA 3W72A 3DG7A 5EMYA 3ORWA 3SECA 1VJZA 2RDWA 3CQKA 4NJHA 4O1FA 3ZXWA 3EMZA 3TFCA 4OBSA 5HR7A 4HP5A 3CTLA 4UXDA 3DGRA 1DWHM 1GJPA 1OGSA 3VK5A 3P81A 4ZQMA 1D9EA 2ZUVA 3GVVA 3DFOA 3QY7A 4D72A 4BQ2A 3G1SA 4NNBA 4LVBA 3M0VA 4LNCA 3ZT6A 4V1YA 1J4EA 2W67A 1RQBA 4HK5A 4O16A 3MP4A 3M64A 3HTWA 4AEFA 4I6KA 4TUFA 4MB1A 3W1QA 5MKGA 5FF4A 1X97A 3MMTA 5DXXA 4I7VA 4TX8A 4ES4A 1F05A 1DIDA 2ODOA 4FXFA 3UJFA 1A80A 2CESA 2E7FA 4EPBC 3TTYA 1H09A 3CL6A 4Q8QA 4ACZB 1LDCA 4DUVA 3VIJA 1GW9A 3BCJA 6ALDA 2PDMA 1PL9A 1N8FA 4RCXA 4HTBA 3N12A 2G95A 3UY8A 2WANA 4MSSA 4UTHA 3OU8A 4AVNA 3LD5A 3FGCA 2HXTA 3B4UA 3A64A 2CWXA 1G7UA 3LTYA 4JTQA 2NQZA 3CO4A 1PIFA 3WNLA 2ADAA 5D33A 1M3UA 3G0SA 3PY2A 1JZ3A 1YBQB 4DO7A 1X7FA 3LPFA 3NQEA 4C7FA 3KHJA 2WPBA 4S23A 1FCVA 1OC6A 3GVWA 3ARPA 1K6WA 2R82A 4S3DA 1BG4A 1IT8A 1PIGA 1UCWA 3MHUA 3L4VA 4I9MA 3RAOA 1F3TA 2XSXA 1IWBA 2QCGA 3AWNA 6ENLA 3LHYA 1M1BA 2OB3A 2YB4A 5GJMA 4N6FA 4S2CA 5I06A 2H8ZA 1KR1A 2Z1KA 3YPIA 1HGWA 5A6JA 1ZAIA 2XPKA 1GONA 1W32A 3VD3A 1IIGA 4W85A 4GJIA 1G01A 1S1RA 1AG1O 5FSEC 5A6KA 1ME9A 2CZEA 4OWGA 2Q8LA 1UH4A 3RPTA 4Q8PA 5EA9A 1FHVA 2WB5A 2J7DA 2YL6A 2Z2BA 4FX6M 2D0HA 4D8LA 3GYCA 1AJZA 2P3EA 2O92A 4H9YA 4LEQA 1C8XA 4IWWA 4XUGA 5KZDA 3MHGA 4D9PA 4QEEA 3MMWA 4JEQA 5AC7A 2C6QA 4R53A 4QJ3B 3L0NA 4J3UA 3CPUA 7XIMA 2V9DA 1G0CA 3B8VA 3TTEA 1EYEA 1P5BA 4QAIA 4P7RA 5CBIA 3TH6A 1GJWA 4D6GA 4AZCA 2P76A 5I3IA 4ZL1A 1PTGA 3WJXA 5LIKX 5IDIA 3W7LA 1CIUA 2DJLA 4IM4A 4FNUA 1JDFA 3P14A 4PFMA 5E9XA 1PDZA 4ZR8A 2EPNA 3PZOA 2H3DA 2E9LA 4LUTB 2OZ8A 4F0RA 2DEPA 2H90A 5CLTA 5C2CA 3IV8A 5HULA 2GGHA 1THFD 1ISYA 3L2MA 2NSXA 2BLEA 3LA4A 2YL8A 2GGIA 3BJSA 4LS0A 3TTOA 4IJRA 1ZTVA 2GUYA 3HA1A 5FA5A 1EH9A 4QG9A 2J27A 5CQ1A 2PGEA 1XCWA 4H04A 1OX6A 1EQCA 3FEMA 1TCMA 4FK9A 5C6MA 2OEKA 4UNKA 1WE5A 1F8IA 1XBXA 1LRQA 2GFTA 2JF6A 3OG2A 1XBZA 1HNYA 3W27A 1H7NA 2VGGA 1EJ7L 1GT8A 4B91A 3NSMA 4IGMA 1PKMA 4GI8A 1TJRA 2PTDA 1F8MA 1ALDA 2DVUA 2C0AA 5CPQA 4AW7A 1V8EA 5TF0A 4GX8A 1QNQA 1ZPTA 5C70A 1YPIA 4LC8A 3MV11 1CECA 3C0QA 3G77A 4B4FA 2EXOA 2QIWA 3AHTA 4UFMA 2Z1WA 2J6VA 3B8IA 4IQDA 1IXNA 3BC9A 3LU2A 5F4XA 4MWAB 3UY7A 1EB3A 3GNOA 3TQVA 1OX4A 3O2LA 1RK6A 4R7WA 1GEHA 3IUDA 3U2EA 2FYMA 4Y9OA 5G2WA 3BZGA 4TO8A 4HKPA 4MNLA 1KWKA 1TV4A 1MNZA 3W7QA 3AIBA 1UP2A 3M9YA 4A35A 3QPYA 1W37A 3KM8A 1G94A 2A7RA 2PC8A 3QZAA 1O1HA 4P7NA 4NZ4A 3G1YA 1QU4A 2Y70A 3TJLA 1VKFA 1EWDA 1A53A 4GE8A 1XG3A 3BLIA 2VXNA 1WDWA 2VP8A 1WZMA 3DZ1A 2DZVA 1VS1A 2A3HA 3O0FA 1X6NA 3BOFA 5DANA 3LEPA 2X2GA 3W38A 4WGXA 1XLKA 2TAAA 4GG9A 2F6UA 3S9YA 4IIDA 3GKAA 5F1VA 3T8QA 1RV8A 3KVLA 5I03A 1AQHA 1F4AA 3WEOA 2Z1SA 1W3IA 3H24A 1P0BA 4JFWA 1UD2A 3FK4A 5CC6A 3I7QA 5BOOA 4F40A 3R13A 3MKVA 4O0KA 3W7MA 4L9ZA 2X7VA 3HJEA 3GNDA 5K3VA 1UD3A 1J0HA 2EAWA 2OYLA 4PMDA 1VBGA 1C7TA 1QO5A 1XRFA 4YWSA 2DW6A 4CQCA 3QH2A 1DPMA 3TR2A 5BZAA 1WAWA 3B9AA 3F5LA 2YW3A 3ZO9A 2J79A 4EAMA 5JBEA 1UWSA 4MWAD 4MYXA 1ZL1A 3WUGA 4EANA 2PWDA 1A5CA 3T42A 4WDTA 4J28A 2QR6A 5EMLA 3QEZA 5BMWA 3S6TA 3BAWA 5FD0A 3W29A 3KDNA 3VKCA 3QV8A 1TTPA 3S5YA 1YE4A 1BYCA 1HKMA 3LMYA 1J79A 2VUYA 4J40A 4C6PA 1RP9A 1NFBA 3VTRA 3SUVA 3BCDA 3EX6A 3WQ8A 3CS2A 4WXYA 3K4AA 1QR7A 3DYMA 5AHEA 3FJ6A 4AD3A 1NQ6A 2JQXA 3LNPA 2B7OA 4CQBA 2WHLA 3TUUA 5IOBA 1HL2A 3LM7A 3WQ5A 1XGDA 3ABZA 1TPFA 2QVHA 2O55A 2VZSA 2GWNA 1BKHA 1B0IA 2NWRA 3W1UA 3VAVA 2AMGA 1IF2A 1GZ1A 4W5ZA 4C5YA 4Z2KA 4JTDA 1JCJA 3GQYA 3U8GA 5AHLA 4NAEB 1US3A 1G7VA 4QQUA 2Z4GA 3CPRA 5IHSA 4Y8EA 3WLLA 1ONEA 2XVLA 1KM6A 3NDZA 5JBFA 2AMXA 4JNZA 1TV5A 4WKHA 2CEQA 3FSUA 4GFIA 1SJBA 1WOBA 1OC7A 4G5DA 3RITA 5FEZA 4E2VA 2QAFA 3FXGA 3KBJA 4EWND 5H2ZA 1IEWA 4NNCA 1M7PA 3K5XA 4XKMA 1JAKA 3RLUA 3BCFA 3TQ0A 2CHNA 1O60A 3I6TA 4GZIA 4CNUA 3O3RA 3BAXA 3DHUA 3T55A 5K7JA 2W0UA 4UOQA 1A5NC 1YYAA 5CZTA 5AYXA 5CSYA 3QY8A 1ICQA 3C2VA 1W9BM 3H8AA 1KA9F 3HGSA 5H8PA 3BWWA 4ACZA 1KFLA 4CNPA 2PWVA 4NI8A 3QTPA 4HOXA 4L4OA 1XDJA 3PZMA 4CN4A 5C5YA 4XAFA 1E6ZA 4QEHA 1OFPA 2GDVA 3WLOA 5IDZA 5GNYA 3IK4A 2HS8A 1KXTA 3OZMA 4W7VA 5BXRA 1NARA 2QEZA 3VE7A 1RHCA 3W6LA 4AUBA 5CCZA 2QCDB 1YBQA 3HOJA 3WMLA 4C6BA 2WBKA 4BR1A 5AYBA 1L2QA 4MFDA 2GJXA 1FHDA 3O63A 1Z6KA 4MGGA 3AMKA 2UWFA 4OE7A 1KM1A 3L12A 3OHMB 1B1YA 3W88A 2GYIA 5A6AA 2WVVB 1XIIA 3JU2A 4XAYA 3GVRA 5A8NA 4H3DA 4JBRA 3BDKA 2QCCA 3O9NA 4GXWA 1UD8A 4ADUA 4WK9A 4ZOCA 1LTDA 3PPCA 3PJUA 3MMDA 1W5QA 1TPWA 4BF7A 2PAJA 3N4EA 1S5NA 2X7WA 2P0IA 2WNZA 4B3KA 5B7YA 2H3BA 4F0HA 1NQKA 1GUVA 3NQ6A 3B9DA 1Q6RA 3WELA 2PLMA 3UP8A 3FY1A 4US6A 2B0MA 4H9XA 3KCOA 4U10A 6REQB 3WLTA 5HNRA 1WKDA 1I60A 3B9NA 3LCGA 3MYOA 3O6AA 1ZJHA 1Z7AA 3WDJA 3W2JA 3DHFA 3APTA 1XLIA 5I3GA 2VQTA 3P80A 4DUOA 5AC5A 1QNSA 2AGTA 3OIXA 2TSYA 3ITLA 1S3HA 2Z0IA 3L4WA 2AL1A 3PP7A 4J2PA 4ZZ9A 3EWUA 1W3TA 4CQ9A 3R8GA 2A3BA 1ZBWA 5LYRA 2RUSA 2Q8ZA 2IKJA 3C0JA 4C1KA 3CUFA 2AQOA 4HNNA 4LUTA 3AC0A 1UP0A 2R14A 1V5XA 1UWIA 3TNBA 3WYZA 2OVLA 2NLIA 3G1DA 4S3BA 3W1MA 1TPVA 2FGZA 3CMGA 3Q37A 1IR1A 3LHZA 1EDQA 4L9YA 3FLUA 1DE6A 1OC5A 1B4EA 3PBGA 1SVDA 4GGBA 1B3VA 3UESA 3N2OA 4JTTA 3IJ8A 1JDEA 2ZUMA 4XD4A 2VRQA 4HPJA 2ZX7A 4HA0A 4L56A 3G6LA 2C14A 1R8LA 5A6TC 4P8UA 2OQHA 1C8QA 4H2CA 2WSPA 3FXYA 3S5OA 2OPJA 1LUCB 1N8IA 4S3FA 4UB9A 5CBBA 3PB0A 5BW6A 1TWWA 2QJHA 2B81A 4OVXA 4M1BA 1E6SM 3KVMA 3BL3A 4GUJA 3UXDA 2FVLA 2WBGA 3TQKA 1BPLB 3WUBA 1OYAA 3CV7A 3AUOA 5I09A 4Y90A 3WQVA 4O57A 4IICA 4AD1A 3MBFA 4U3CA 5I5RA 5D2TA 1LL4A 1JYWA 1AW2A 2FZMA 2BY2A 4H6QA 4KCTA 3S6OA 3P6LA 2EPKX 2FPVA 4DI8A 2XZ7A 3F4CA 4DY1A 5A6BD 1NDVA 5JXQA 3O16A 5TNVA 3LGEA 2ESCA 1QI4A 8XIAA 1QXLA 3BG5A 3W86A 3TJIA 3F4DA 2OX1A 4MWAA 2A6NA 3UT0A 1XIFA 3E0FA 1NAL1 3L5LA 4EXBA 3WBEA 3B0UX 4EF9A 4NF7A 4BY3A 2YA2A 1VLIA 2J47A 1XLEA 2PDWA 2PI6A 1YX1A 2XFYA 4P61A 5AECA 1RUSA 3FDKA 1GKPA 4CQAA 5D2XA 4QITA 2CXGA 3UW6A 5C9WA 4UUIA 2ZX8A 3R2GA 2C16A 3ZVHA 4JCMA 1EQPA 2ISDA 2MANA 5L6UA 3D46A 1XICA 2GPTA 1FWJC 1RVGA 2VX7A 3F2CA 2YCLA 3MVIA 2CZ5A 4MFEA 1MMFA 1HZYA 3ABSA 3RG6A 3S6DA 4DYKA 1O5KA 3VM5A 3WK3A 4RK8A 5LHFA 1DXIA 1VCGA 4FLQA 4N4PA 1QW8A 4YTQA 1P7TA 1UBPC 3W2KA 1TWIA 1CGXA 1E0VA 1AH0A 3SN1A 1JCMP 3IEBA 2FDSA 3N9SA 4JKMA 1OD0A 2ZZ5A 2BVDA 4GLEA 4W8LA 3NCOA 2OT1A 4LAKA 3QHNA 1JRCA 1NEYA 3TA9A 3M0HA 4IPJA 5DQPA 3TXVA 3DGBA 2V5CA 2YLAA 3C3NA 3NZ1A 1QO2A 3MSRA 2W4XA 4FLRA 1ZSXA 4NJJA 3LB0A 3BLFA 4AH7A 4Q4QA 2VJXA 4I90A 2QCHA 2ZA3A 3W1TA 3NQVA 3DFTA 1ZJIA 9CGTA 4WSHA 1J93A 1JUBA 3OZOA 4BQ3A 3M47A 4XD6A 2I9UA 3E0WA 3R0UA 1MEHA 1HL8A 1B3WA 3O6YX 1B57A 1TPC1 2I16A 4WDWA 4LT9A 3TYBA 3DHDA 1QWKA 4HHLA 2O9PA 4G1NA 2F7FA 1E55A 3SZ8A 1BXCA 2A79A 4AIEA 4NZ5A 3WJZA 4JYEA 5ABFB 3GD6A 2WZEA 5DELA 3EB4A 1H7RA 3A24A 1IV8A 1I1WA 4QCEA 1IR2A 3CK5A 4Q8OA 2V5LA 4Z2GA 4AG0A 4CVUA 5HMDA 4M19A 2WZIA 4NG3A 4F0KA 1E9LA 3EMCA 4UR8A 4JTFA 1MEIA 3G24A 4BQ5A 4DBUA 3RCNA 4ZOBA 3SN0A 2DZBA 3WH9A 4M51A 3MB9A 4HPHA 4WQ6A 4PMQA 1P6BA 3IS4A 3S2MA 4LBUA 3CLMA 2WVSA 4B3LA 2VVSA 4AHOA 4QE5A 4H00A 2VR4A 3ZQ9A 2BZNA 3BK0A 1KM3A 4AX6A 4JTLA 3UWYA 1V0MA 4IL2A 1ZGDA 1HG3A 2PWFA 3WFAA 2WSYA 4AAJA 5CSRA 1B90A 1TG7A 1MW0A 1ZU8A 1RPKA 2EG7A 1NSJA 1US2A 3LSBA 4BWLC 3USZA 3QYSA 5HINA 3ZIZA 2VFDA 4LYQA 4JYFA 5TQLA 5CAKA 3CWNA 3EAUA 2IS7A 3S5ZA 1FKWA 4MDOA 2R1LA 2HDJA 2YXOA 3I3BA 5BXSA 1MYRA 5KZ6A 1S3TC 1W54A 5K4ZA 4H1ZA 2VI0A 2J77A 3OLDA 5FF2A 4FXJA 4GYPC 1W9VA 4H01A 3DKLA 1W1TA 4NUWA 1OYCA 1U83A 1XLLA 2PGRA 3N15A 5D32A 2PLJA 4MY8A 3R7MA 1R3TA 4DZAA 3S9ZA 1EUNA 2WMHA 3MCOA 4CNSA 1D3GA 2FMNA 4HZ6A 3S5SA 3K1GA 3SRFA 5LZLA 1DWAM 2C1GA 9XIMA 1OFAA 4FOUA 1V02E 2Q02A 3N11A 3PFMA 1H62A 1ZENA 4AD5A 2OYMA 2VX4A 3M1ZA 3W75A 1FCQA 1JZ7A 5CC5A 3Q65A 3UZJA 4YTUA 3G2GA 3LTSA 4XO6A 2XFWA 3QR0A 1E6QM 1V3LA 1PO9A 3W1LA 4GY0A 2V82A 2AKZA 4UBPC 1NU5A 3AXIA 1ZRQA 3R10A 5ABHA 3R0DA 4QLKA 2NQJA 2FHCA 4I8DA 3NNTA 2ZXQA 5FSDC 4YCPA 4I8YA 4FOKA 3FAWA 1GPFA 3SB0A 3W7IA 1JF6A 4JTCA 4DO4A 1E4MM 2DDXA 3BANA 4IIFA 2PDYA 2W92A 3ITCA 2IQDA 4JFVA 3G1XA 1LL7A 4U2YA 2CETA 4YWIA 3QV6A 1RSCA 3R5EA 2TYSA 4M7TA 4LB4A 1KO0A 1XH1A 5HAOA 5LA0A 3N18A 4JCLA 2DSWA 3HV9A 5A6LA 1K9DA 1XLBA 1XLGA 3WSUA 4B5TA 3GU2A 1ODZA 3MKCA 1MW1A 1OBAA 5LGXA 3ZS4A 1I2NA 1AMKA 4XZ9A 1AJ0A 2PTXA 4U28A 3C5QA 3ELFA 3VD7A 3W1AA 2QHAA 5A6BA 3EKGA 3K30A 3B8UA 3WUEA 3BSGA 4WJXA 2A4AA 2F9RA 3PR2A 5IRPA 3VYLA 2Y8UA 1K8CA 4WLCA 1YRRA 3K1DA 1QT1A 1AA1B 1E40A 3UJ2A 5FJUA 3ZR5A 3TJXA 2QGYA 5A2AA 3UXLA 2BVWA 1SQ7A 3M07A 3EXSA 1HKKA 1JZ5A 3UCDA 3RGTA 2HMCA 1GVRA 2A6LA 1ECQA 2ZXDA 3DKJA 4ZO9A 1UG6A 1Y65A 3RJYA 2FHFA 2NV2A 2Y88A 3I68A 3FA4A 4M5PA 3HO8A 2PTYA 3WJWA 4YPJA 2OO6A 1XKYA 3PWAA 3UVIA 4CD6A 5C9RA 2VENA 2E25A 1BKSA 1ISVA 2NUWA 1ZS2A 1DHPA 2YOCA 3H7UA 1TJ0A 4KKXA 3OG3A 4E4PA 1HF6A 1P0KA 2D2OA 1IT7A 1LUCA 2KX9A 4LYRA 2XH4A 3USBA 1GOQA 4WJEA 3V3WA 4WY0A 2C79A 1WO2A 5M5DA 5AKQA 2ACQA 1HJSA 4GJ1A 5CZ0A 4GIAA 4IUOA 1VYPX 3ZSTA 3W1XA 1DP0A 3AWOA 3P67A 2PLCA 3EA3A 4H7ZA 1WZKA 1K8XA 3GTNA 1V79A 1HO1A 2HSAA 4BHYA 3R58A 2BV9A 6PTDA 2QV4A 3PPFA 4CNTA 1TTJA 1CXIA 3W73A 4UTUA 1YTEA 3QV7A 2JE8A 4PMRA 3AS0A 4A8NA 2CZFA 2Z28A 5BCAA 3LCLA 3GKFA 4KCUA 3KOZA 3IIOA 4X2PA 1VB9A 3OBEA 4PCTA 2GZXA 8RUCA 1KM4A 5EB8A 3TSBA 1R7AA 1CYGA 1DXFA 5J04A 4XAZA 3LV5A 4L4LA 1KRMA 1ZCOA 4AZBA 4JX6A 2WJDA 3PUEA 4HHPA 1SMAA 1G4PA 1KBIA 5FEWA 3G6MA 1K6AA 3N19B 4R9XA 2OWWA 2R1NA 2MNRA 4IIGA 4AZIA 2PDLA 2WLYA 2YLLA 1EGZA 4M82A 1EFZA 2XH0A 1V3IA 3IAQA 3VKDA 2B7QA 1H5VA 1LQ2A 4E3VA 4MMWA 2P8BA 3TNOA 4HYVA 4AYSA 2WM1A 1TV7A 1DXEA 1VJSA 3VIMA 4HNCA 3AZRA 3AHXA 4FNTA 5I6SA 4KFPA 1TFVA 1FWNA 6XIMA 4HK7A 1H7XA 2G3FA 1XIJA 5DO8A 4AZGA 1J6OA 4UZUA 3KAOA 1J5SA 5GNXA 1E9YB 1Y8BA 1V0LA 4QG8A 2FGBA 5T8GA 1W1VA 2BGQA 1O1ZA 2FZDA 3SQSA 2X40A 1Q6DA 3OBAA 4IP7A 2ZRUA 4KMQA 3I65A 3QZ6A 4QGCA 3EB2A 3UJRA 1UH2A 3WX7A 4XWUA 3EWZA 1ZHAA 2A2IA 1TUFA 3H4WA 7A3HA 1FWWA 4PMNA 2VX6A 4N9DA 2Z26A 3I7SA 3ZOAA 2E9MA 4HMCA 3UD6A 4L7ZA 5A8GA 4GWEA 3C4UA 3WZ0E 2NSOA 1W8GA 1UWRA 1V02A 3UQNA 1XGEA 3H7RA 2E09A 3LRLA 5C9ZA 4ERGA 4QRNA 5CXPA 1ZP4A 2F61A 1RBLA 2OFJA 5EY5A 5FOOA 4GYPA 3EMQA 2J9ZA 1V7AA 4FAMA 3UZ5A 1ITXA 3E2QA 1LP6A 1XDLA 2QNEA 3MU7A 1OX5A 4RLIA 4MJ4A 1Q13A 3VOGA 1DTUA 1B5TA 1E4LA 1AUSL 3M5VA 1KXVA 1CB2A 1AL7A 1BF6A 3LXAA 3P2VA 1A4LA 1WZLA 3WL1A 1V0NA 3HPZA 1JPIA 3VX0A 1Q85A 2XIMA 4ROPA 1I2PA 1TCDA 4H8NA 1RR2A 3RM8A 2V30A 4JNMA 3THAA 3W6MA 5KITA 2DVTA 3OLEA 3LS9A 4V1XA 1Z9AA 1SFLA 3TOPA 4IMFA 3AOFA 1XIEA 4O50A 5AFDA 1J10A 1E5JA 5FAGA 2XISA 3GDRA 5FJOA 1VFUA 2BS9A 4NSBA 4LAZA 5HMEA 5CC3A 5FJRA 3M0MA 5LNVA 3ARTA 3GXDA 3KRBA 1TPDA 5CBJA 1IIHA 2R9RA 3FIGA 1A3WA 4MJ2A 3QY6A 4FO4A 3CJPA 1SMDA 3LOTA 1Q8JA 5K4XA 1SPQA 2WV8A 3GIQA 2AL2A 1GQIA 4GI6A 3NO3A 3V1HA 4DEFA 1RQEA 3IGXA 1ICPA 2PF0A 3CUXA 1K9EA 3R8RA 4QE4A 2EPHA 1JPMA 1OCQA 3MSYA 4TOQA 1W0MA 3OYXA 2GL5A 1QOPA 5DMNA 1RPXA 2Y24A 4XZIA 3MKKA 4JTKA 1SGJA 4UTJA 2DU2A 4E2DA 3PBMA 3K8KA 4PE8A 4AISA 4DIAA 4G56A 3ANYA 3SFKA 3JUGA 4JIIX 5DCEA 2W27A 2GGGA 2PZ0A 3FHAA 4ZB0A 4C7GA 6XIAA 2QLYA 3CM4A 2ZX6A 3QGVA 1Q4NX 3EDKA 3OO2A 3PAJA 1MZRA 3RXZA 3MPGA 2VZUA 3LTPA 4OJYA 1E9ZB 1XYLA 1EC9A 5HWJA 1S1PA 4ROQA 3SSJA 1N82A 3R25A 4ZBCA 1SJAA 1EOKA 3NZRA 4LS1A 4AX7A 2Z24A 3MZ2A 4B3ZA 1PX4A 1NM9A 2REQA 1TQXA 4W86A 4OV4A 4HNOA 3JS3A 3WQ6A 3HG5A 4UFIA 1XIGA 1U1HA 4U33A 1WX0A 1RCOB 4KIEA 5CPTA 1S2WA 2YGYA 3KTXA 4QP0A 3LMZA 4XK2A 3WBAA 3MO4A 3ZJ6A 5HK4A 2XH7A 2CPUA 4NXSA 1KRBC 3OTRA 2OZ3A 3FSTA 3DYOA 1RCQA 2DT1A 4GINA 4MZYA 1B4KA 2E67A 2ZTJA 3M5XA 1EL3A 3OGSA 4I6VA 4HD5A 1QNVA 5KTLA 3CIVA 4W8BA 1A0EA 3WLQA 3L9CA 3GS6A 1CGTA 1R87A 3QW3A 1CDGA 1GVFA 3W1RA 2ZUNA 4I3GA 3GDTA 2W5FA 4D1JA 2NQ5A 4O14A 2Y5EA 2VCAA 2G5WA 1UKTA 2ZZ1A 3LCWA 3QM3A 3NQMA 3DU0A 3AHYA 1OIFA 3AS2A 3CAKA 3FV9A 4DAIA 1DJQA 1UIPA 1XX1A 4L6DA 5FF7A 3B0XA 2ALDA 3HPAA 3ZJ7A 3PSVA 2GDQA 3BW2A 5XINA 3VNJA 4X60A 2VQUA 3AMCA 3HJZA 3PZUA 4QJ5B 5A2BA 3NVTA 2VMFA 1CI1A 2BY0A 1KGXA 1XUZA 3ONCA 3KTSA 4M80A 2WYSA 2ZRXA 5G4HC 1QNPA 3LI1A 4B5XA 4OKDA 3S0CA 1YTDA 2VC9A 5LXEA 4LRSA 3NGJA 1HIZA 4O8RA 1PAMA 1JF5A 3A3XA 5T9CE 3W7JA 1XLFA 1DJXA 2V3FA 3GNXA 3MZNA 1WXYA 4J35A 2PD9A 3GTIA 1UJQA 1O68A 1TELA 2P5NA 3DC0A 2ISSA 2R1KA 2A7PA 3NPUA 2V3EA 3VIOA 3VKBA 4JR5A 1RAKA 1TV8A 3ONBA 3CZLA 4IT1A 4Z42C 1UW9A 3O06A 4HOWA 1L9WA 2EG8A 3UXIA 1JVNA 3PVFA 4LB3A 1XRSA 4GBDA 1T7LA 4ZENA 4C6LA 4YU1A 3LENA 2PGWA 1R85A 3EDJA 3MI6A 4MIMA 2GK1B 4Q6XA 1PXGA 3LCIA 4BI6A 1GVYA 3IGUA 3V75A 3DBPA 3S1WA 1YDNA 5REQA 3UVAA 4DBWA 4F3HA 3PC0A 1KFCA 3W7NA 3BMVA 4O19A 2I1OA 1R3YA 1Q3NA 1CXLA 2WZTA 1EUAA 4ZTXA 4QS5A 3L4YA 2A0NA 3LLXA 1EHNA 2HJPA 3WNKA 1QI0A 4DJFD 4H8UA 1GQKA 1US0A 2J13A 4B9ZA 4TV5A 1AK5A 1C93A 2QT3A 4JIHA 2ZDSA 3IIPA 4OOZA 4W4QA 3QN3A 1GJUA 3KOXA 1UKOA 1H7PA 4C6KA 1ZJBA 4XZLX 4Y7EA 2PS2A 3EB3A 2GVGA 4DF1A 4IIBA 2WMJA 4F2UA 2CNCA 3EDFA 3VGEA 1IGWA 1CNVA 2OWXA 1TWDA 2FIQA 4XZBA 4DLMA 4FEZA 5HJYA 3RMJA 3PK7A 2F38A 1WB0A 1F9CA 4L1GA 3OQ8A 3A4XA 5JUVA 2QPSA 1WDSA 4Q8MA 4H41A 3R43A 1PZ1A 2EO7A 2FPTA 3CT7A 1J96A 1VHNA 2HBXA 3GUWA 3ITTA 2A5HA 3C61A 1PKLA 4EACA 3R12A 1E1FA 1OADA 1K3UA 1T40A 4OBTA 4L9XA 4IJBA 1J5TA 1I9CB 4M6VA 4YLWA 5JBDA 3VUPA 1YNYA 4JQAA 4KFNA 3AIVA 2VC6A 3IPWA 1A50A 2VL4A 4DO6A 2E40A 3RUBL 3GO2A 4J3VA 2O56A 2J7BA 3VMOA 4PZVA 5BROA 2VURA 3U5UA 4HMEA 2ZUTA 3A21A 1QI2A 4DX3A 4MLRA 3MI2A 1ITCA 3M43A 1ZCCA 3F4NA 4KQNA 3WLSA 1JI2A 5FF3A 4XKYB 3BH4A 3OZYA 3BQ5A 5KINA 2C19A 5I3HA 3G5EA 4HBKA 3LERA 2V38A 4K7VA 3VD9A 1UD4A 1JZ4A 3BLLA 4Q8UA 3KS6A 1LWIA 3M16A 4QJ4B 2I57A 2RHGA 1GTHA 5JH1A 2MUCA 2A3LA 1W3KA 4RZ4A 3QGAC 2OSXA 1Q4WA 2WJEA 2GJNA 2FB2A 5DMMA 1R3WA 4K7YA 1EGMA 3U4AA 1FXPA 1E0TA 2DZUA 4IFOA 2HV5A 3M0JA 2ATSA 4ZSTA 4E5TA 1ESWA 5DT5A 3GWQA 1ICSA 1YIXA 3TA6A 1EC7A 2WSKA 2V3GA 3C0LA 3A4AA 4FF5A 3TE9A 4ZB2A 2GSHA 1EJRC 3RNDA 3QOMA 5FF0A 1UR4A 1O95A 4J4KA 4PTVA 2W91A 1A3XA 1XCXA 5IHRA 3NZQA 1MW3A 4ZQPA 1M53A 3CHCA 4AZ5A 2I14A 3S47A 1UZ1A 3TP4A 2OYKA 2HK1A 1P0NA 2QF7A 4M6UA 4ALDA 3UBPC 2RFGA 3GHUA 4UR7A 4V2XA 3AHVA 2CWNA 4JXCA 3UFYA 1CB7B 4IZGA 1OT1A 3BG3A 4LALA 3S2LA 1EGVA 4JX4A 3B9OA 2PDQA 2WWDA 4IJCA 3GB6A 4ATDA 3NQAA 1J12A 4DLFA 5DMLA 2L5HA 5DF0A 1FHUA 3SCQA 1ODUA 4AZ6A 4FOJA 4H4IA 2OQYA 2Y6ZA 4HA4A 2Q8XA 3MUAA 3WQGA 7ODCA 4FX8A 1P1XA 3VNZA 3KRZA 4NL1A 3WLNA 3H26A 4GC3A 4O1EA 2BDQA 4I9JA 4X0NA 2QPXA 4FR6A 4M24A 2PSNA 4O11A 4HCDA 4XZNX 1A5LC 2GJPA 1QNRA 3U7BA 2XZ9A 3W87A 2FVKA 3TONA 2CZDA 4XIAA 1S2UA 3BUVA 1KXQA 5C9XA 4GISA 3IRSA 2QVNA 1RD6A 4RNJA 1MFUA 2CLLA 4LUSA 1A5KC 1GG0A 2D73A 4M8UA 3N14A 1XLMA 3CQJA 7REQB 3LPPA 4C6MA 5GJPA 5JVLA 3PAOA 1BVNP 4DPPA 4OGZA 1OINA 3H2OA 3KOYA 2GWGA 1VYRA 3UXAA 2A7NA 2ZIDA 3FVDA 2Y62A 5F4SA 2B7PA 1FCUA 1W1YA 2J8FA 1S5TA 4HN4A 3IK2A 4GVHA 1T8XA 4G7EB 5E09A 2CYGA 2PTZA 4NXKA 4K1GA 3KCLA 5J8LA 3SSZA 1XIBA 2FHBA 1VBRA 4GHRA 2E28A 1W56A 3TWBA 1UWAA 3HGJA 2YJQA 3KLKA 2HQAA 1QHZA 1HP4A 4CD8A 2PBOA 2J6XA 1XJBA 2WMIA 3KOFA 4F2TA 3W26A 1IZJA 2GSEA 2I17A 1JULA 1X1NA 4NRRA 3VGDA 3H4GA 2VZOA 3H55A 4B5SA 1EP3A 2BXZA 5IBXA 3K2GA 3ZLFA 1H51A 4K8GA 4ILSA 4UQDA 2P3ZA 4US5D 4BFAA 3W82A 3N3MA 4TVDA 3TN4A 4C6FA 3IJ9A 1HGYA 5D38A 4GD0A 4J3ZA 1VEOA 1DJWA 4H6EA 4C6DA 1BTCA 3TZNA 3AALA 3AS1A 2DSKA 1D2KA 1JEZA 2GQ3A 5A8MA 1X38A 4S3AA 4NZJA 1VRDA 1RBOB 4UTWC 1TE6A 4N6EA 3TW7A 4U5IA 3KBSA 4PH6A 3AU2A 4S39A 2YFNA 3QLLA 4ZEPA 1MSSA 2GGJA 1E51A 2ZOXA 4MPKA 1CENA 3UZWA 2DIKA 3A3WA 2QMJA 2VRJA 4FX7A 4DJFA 4QROA 3L68A 1UYQA 3UPMA 1XRTA 5EMKA 2QCNA 4Y6GA 4DI9A 3C0SA 3FFSA 4S3KA 4PUDA 1EBHA 3ENLA 3CHVA 5LA2A 2QZRA 1NWUA 2EPOA 4IG2B 4WUIA 3HPSA 5LIXX 3DH7A 4LCRA 5HPOA 3RFAA 2WPGA 4Q4MA 1K70A 3RPMA 1UC4A 1W3NA 4MY9A 2PRLA 3LHWA 4BI5A 3T78A 3L4XA 2YZRA 3IGSA 5G1YA 3VA8A 1V03A 1VC4A 3B97A 3SCOA 5AN7A 4OUEA 1O12A 3VZYA 4DWSC 4RZ5A 5GPRA 1QW7A 3G1RA 5D03A 3AJ7A 2Z7GA 1HKIA 3IIXA 1H0IA 4WEVX 1W5MA 3HZ3A 4PYSA 1AL8A 1ZJAA 1EP2A 1PPIA 5LHEA 5F1UA 2BXVA 3R11A 1KFJA 3N2XA 4H9TA 3W7HA 3NQCA 2E4TA 3EWYA 5EKYA 3NZGA 3K13A 2HTMA 4HOZA 4DQWA 1QPOA 4MDPA 3MDWA 4TTUA 3O05A 3UWWA 2GK1A 4GUFA 5KEZA 3MUIA 4NIRA 3R94A 4Y9AA 1S5MA 5I78A 4ERAA 3UR7A 2ZUSA 3BSHA 1GQLA 2Y8KA 4ZODA 3WH8A 3FEQA 3HIJA 4Q7NA 1YXDA 1VPXA 4DAFA 3ZWTA 3NPWA 4YYCA 4XQ6A 3SW6A 3WD3A 4HN8A 4OU1A 3WLPA 1W3JA 3VC5A 1Z8AA 1IXPA 4EIVA 1TB3A 2WSQA 4DF0A 4W5UA 1HT6A 4N42A 2UY2A 1B3YA 1LWJA 3FHQA 4G9PA 1DJZA 2C13A 1C8VA 3IJLA 5CH9A 1X7IA 3DBNA 1SZEA 1UQYA 1E72M 2Q09A 5HJXA 4XAPA 1JCYA 5D37A 3ZM8A 1PB0A 1MNSA 1QATA 2YDAA 3WK1A 2WNNA 5HUOA 2QQ6A 3AHZA 4HHMA 4GH3A 4RZ6A 1OD8A 1E5NA 2XIOA 4GJJA 1QPRA 3VOHA 2E9BA 4N02A 2PDNA 4LEFA 3N1AA 4LAOA 3FDGA 3VD5A 2J8GA 2CERA 2W6RA 4CD5A 3C86A 3SCPA 4XZWA 3NEVA 1DL3A 3TMLA 1R30A 1LM1A 2YBTA 3DN5A 3M46A 3UWUA 3AROA 1VFHA 1P4CA 3TX9A 1BFNA 4K39A 1SO4A 4OIFA 2ISVA 4JAWA 3QPZA 3NO1A 2HVNA 3BJFA 3ZR6A 3UCCA 4YTTA 2OWCA 2XGZA 3T2QA 1GHSA 4JHZA 5CAHA 1KTNA 4B4HA 4FNPA 1DTNA 3TN5A 2PDJA 2BVYA 4ZO8A 3U4FA 2TODA 1R2SA 1SFJA 1NWRA 1SYTA 4JKKA 4NI3A 1UWUA 3RN6A 3GZAA 3F5JA 5JU6A 4C1LA 1DWJM 3UNDA 3CHDA 3LPGA 4AVFA 1K02A 2YPIA 1QAPA 3N2TA 4XISA 3CUIA 3UERA 1GTEA 3EEZA 4H6KA 1NDZA 5ABTA 4KW2A 4UOJA 3E2SA 3KL5A 3BZJA 3PZNA 3PB2A 3NYZA 4XKYA 4FXRA 4MPQA 3T44A 4L64A 1YNQA 3CZGA 2Y89A 3T1GA 3WDQA 4FSAA 3DESA 4NAFB 4D6DA 1FWAC 3OYZA 3QTGA 1VAHA 1EF2A 1NWTA 3SCRA 4LPCA 4RZBA 3CAVA 2YYUA 1TPB1 3ITVA 5T91A 3MA8A 1VBUA 4ZQCA 4IPPA 3QQWA 4HYWA 1DEDA 3OVPA 4B90A 1JYXA 1WBHA 4GBUA 3S1GA 5EMUA 3B40A 4I5XA 3NPVA 5BMXA 2DZSA 3GG7A 4HSNA 3W83A 1EPXA 4EPDC 2NVDA 3U2CA 1JCLA 4QM1A 1H0GA 2WQDA 1PZ3A 3PJWA 5CSSA 1R3RA 3I4KA 1DIEA 3QHMA 2ZZ7A 4DJDC 3DCPA 3ATYA 3N29A 4RE0A 3GW3A 3BPWA 4RNHA 3MMUA 4ZFCA 3H23A 2DSUA 4XD3A 2J78A 2YIHA 2J9YA 3V7PA 3L65A 2Q3OA 1B3XA 3T81A 3FCPA 3KFTA 1XSIA 1DHKA 3NDOA 1ITQA 1Q6LA 3NL3A 2VR5A 1XW8A 4JNYA 1M7OA 3NL6A 3W37A 4CD7A 2W9MA 3VGBA 5FJJA 2DPEA 3W3OA 1JGIA 1P0DA 3SCWA 5IM51 1E1CB 3GH4A 3PZTA 1OVDA 2BGSA 2ALRA 2NX9A 2NUYA 4B9YA 4ACYA 4L65A 3KOWA 3M0LA 4R7JA 3N2MA 5E9AA 4Q7BA 5CPNA 4US5A 1KM5A 1C7SA 4LC6A 2KZHA 3F1QA 4M56A 4LWWA 4HSHA 5F2MA 2VGIA 3KL0A 4J1OA 4ATLA 1WAUA 1D7KA 4D6EA 1X6LA 3KEHA 3UU0A 1LCOA 3POHA 2PC4A 2PEVA 2O9TA 1MUWA 1R9XA 3VPLA 4LXFA 5ECVA 4RV8A 3T2OA 2OGYA 4A8LA 1C9DA 1OIMA 4QTGA 1PEZA 3L23A 2ZRYA 4KCVA 3C52A 3AMDA 7REQA 1C29A 3WQPA 4I5UA 2OSYA 3WQCA 3FVMA 3ZLHA 1DOSA 4ZGYA 1C3FA 1KR0A 1OF8A 2GQ9A 2HE8A 3DDMA 1H41A 3E3HA 2XFFA 4NYYA 3NXFA 2D3NA 4G7EA 3LBMA 3LZ3A 3VIHA 3VNLA 1AJ2A 3VUSA 2BOEX 1AMYA 2CW6A 1UPPA 3LPOA 2GVEA 3EXTA 4UTFA 4WOZA 1HJUA 1A3HA 2V8ZA 1JCNA 4IFKB 1JZ2A 1X1ZA 3UPWA 1HKWA 2OLHA 4ZXOA 1J18A 3E2RA 2E0PA 3A9IA 1LYXA 4IL0A 2VEFA 2Y8VA 1H63A 3C3UA 3E0LA 4NRSA 4S2BA 3W2MA 2CC0A 4NY2A 4M1RA 4JFSA 2Z1VA 1XLCA 1PBGA 3CGTA 4WKFA 1SSGA 1LBMA 4JD4A 1M5WA 2PP0A 1SJDA 4XTDA 3QR3A 4AHPA 1O66A 4S3JA 2VGBA 4PUJA 3HGRA 4FMVA 1W1PA 4O0QA 2BHYA 4DJEC 3MDUA 1EJTC 2UZ9A 3CQHA 1XIMA 2G50A 5JMUA 1DWIM 2V3DA 3VMNA 1MQQA 3WD4A 1PTDA 5E1QA 3BAIA 3J7HA 2VFFA 3CL8A 2FMOA 1OGGA 3NO5A 5JQ9A 3CXOA 4CKQA 4UCGA 3GC2A 3I10A 4N0RA 4YJ5A 5M1TA 1VGAA 2X1SA 4IGSA 3W0KA 4UFKA 4CUCA 3WBWA 2OLAA 2YSWA 2XVKA 3V36A 5CEWA 4IG2A 5I77A 2R8WA 3EPMA 4YN5A 2XGBA 4KWVA 3N6JA 5CGTA 1UH3A 1GKQA 1OZQA 1ISXA 3P82A 2AQVA 1W9DM 2VT0A 4B5VA 2CLOA 2D0GA 3VCCA 3OOQA 1BD0A 2GUBA 2J24A 3NQ2A 3CUGA 3EDDA 1HTIA 3P0XA 4Q33A 1BSLA 3UF9A 4DXXA 1EJSC 3ARWA 2ONEA 5FACA 1Y5XA 3CH0A 4AIUA 1SFSA 3AIEA 4DYEA 3EPOA 3VOFA 1I2OA 4HNTA 1ENUA 4A2SA 4CU7A 4IQEA 3ECQA 3DXIA 2BVTA 3G3DA 4H9VA 4WY0F 1XXXA 4MJMA 2WVUA 4PMYA 3P5ZA 4AY7A 4C90A 2ZVIA 1WP6A 2V6AA 3H2AA 1BGAA 5GJNA 1ZAJA 1V77A 2OQLA 2G97A 3RCYA 2PDXA 5LKYA 5BYWA 1RJQA 4C91A 1RP8A 4GZ7A 4GA8A 3MT1A 1CCWB 4PEKA 3SN4A 3C8NA 3SQLA 3WQEA 1L0PA 1VYSX 4IQJA 1HL9A 4YIWA 3RRAA 2V5JA 3MC5A 3WUFA 3W02A 5I7GA 3UEQA 3DI0A 1LROA 4LY8A 3TDFA 4GC4A 1P43A 4DXKA 1FY6A 1XI3A 2JEPA 1H49A 3WF4A 4UNIA 4WVXA 3GIYA 2XU2A 4ZCWA 3EX3A 5CLWA 5ABGA 4CCCA 4CU8A 4AC1X 3DFPA 4RDWA 3WKZA 1FWSA 3HQNA 1W2PA 1PDYA 4LSBA 5D9OA 2WMKA 3LV6A 1GVQA 2R1PA 4DZ5A 4KCWA 3NQFA 3TYCA 4LVDA 1WCGA 1U1UA 4R88A 2YDRA 4CEUC 2IPFA 3A47A 3HB9A 1K4HA 3TVAA 4E8GA 3E0VA 4GIEA 4ASTA 1MW2A 3VNDA 5AZ0A 5A69A 3Q67A 1ME8A 1BRLB 4LQ1A 4LOCA 3BQ6A 3CAQA 3SCUA 1EX5A 2AAMA 4C65A 1GZGA 4K37A 3I3DA 3WD2A 3NTYA 4A21A 3BXWA 5CKSA 4RE3A 2XWEA 4NILA 2ZUWA 2OU4A 4FLOA 3LLFA 4Z1BA 3CYVA 3GHRA 4O54A 1XYCA 4PUEA 2JIWA 1ADSA 5MHBA 4TVCA 2X1TA 2XN2A 5U7SA 2WHKA 3NPXA 3MYPA 4ZE5A 5C55A 1PKNA 3GH5A 4GXMA 2J7HA 3RDKA 3H6OA 1XH0A 2DP3A 2CZVA 1V6VA 3D5HA 1JI1A 5C54A 2DSVA 1CZ1A 3VDAA 1K77A 1XYBA 1UR8A 2WNQA 4GNKB 3L0KA 3NR0A 4Q4SA 2YXXA 1SM9A 1CTNA 3N4AA 1X6UA 1GGOA 2XN0A 3DUGA 3S3GA 2J4GA 3QSTA 3W71A 4DN1A 1TPH1 1PZ0A 5HWNA 1FDJA 2Y85A 2IPWA 4KFOA 2ZQ0A 3EX4A 2J7GA 4KEZA 1ZBKA 2A3AA 5AB3A 4Q4OA 1WUFA 3PPHA 1VQTA 2ZX5A 4GUIA 2UV8G 4X3ZA 3MI3A 3PZGA 1YDVA 1KBJA 3PZ9A 4HQVA 5KETA 1Q7QA 3CU2A 4PUWA 3WDIA 2JGQA 4E3TA 4Q7IA 3O6DA 3T7VA 2D0FA 4FB7A 4QS6A 4AFYA 2DORA 3B05A 4C1NB 4DRSA 1JZ6A 4L5ZA 5I0DA 4W88A 4IH3A 5H8UA 2PDFA 2BY1A 4GMEA 5JIWA 1V6TA 1OFDA 1VBJA 3SGUA 1BWLA 2O7SA 1N2VA 3AJXA 1OT2A 4OECA 4RX0A 2VFEA 4WJ8A 1PYFA 4CGTA 1AZ1A 1RD5A 5G1TA 3VOCA 1D3CA 1XISA 2YBVA 2NLYA 3O8AA 3HFYA 3WMBA 2E5CA 2EG6A 2BHZA 3GC5A 4CCDA 4JOMA 3A4WA 4AD0A 1YE6A 4N2YA 5HQMA 1U22A 2R94A 4JFUA 1GOMA 1YDYA 3HQOA 3HG4A 2LLEA 3UWVA 4ZQRA 1XHGA 2C18A 5KZEA 5D2YA 5MF5A 4REQB 1XYAA 1LQ0A 4QLLA 5BU9A 3K8MA 2CU0A 4FXSA 3B04A 4EP8C 4D71A 1XWYA 3M5ZA 4HU4A 3W1NA 1WOAA 4M7SA 3ICJA 4N7QA 2OKOA 2NVCA 4QQ3A 5DRCA 3B06A 5IFTA 3INPA 4MWAE 3BOXA 1YPXA 4TX6A 4XD5A 1G6CA 3W2NA 3FNDA 4X22A 3UZZA 3FKRA 4LJ3A 1MXGA 2NT0A 4MHBA 2VEKA 4OBRA 5CPSA 1XC6A 4UMAA 2A85A 3VGHA 5IFPA 5E6YA 4E4FA 4JTAA 3I4EA 4LGXA 4E38A 4DBDA 4GCXA 3ZYZA 2PODA 1JR1A 2G41A 3RU6A 3R4IA 1H1YA 3SCVA 3G0XA 2OKTA 2YZ5A 3RJXA 1V6YA 1G1YA 4G2DA 5C7VA 1VH7A 1AH4A 5TAOA 1JD9A 3NZPA 8CGTA 4D8ZA 2FLIA 5FEPA 4IGHA 3QVQA 2E6DA 2B4GA 4GX9A 4DVOA 3AXXA 1W5NA 4IHCA 3SJ3A 1DVJA 1JPDX 3FOKA 1J0YA 2OODA 1GVOA 3ABOA 3FAXA 2FQIA 3GNNA 1A5BA 4A29A 4LF1A 4P8VA 2WZHA 4B16A 4RNIA 4CN1A 4A4AA 3W81A 2VC7A 2XHYA 3RO6A 3PWGA 2NV9A 2H6RA 3T2PA 2UY5A 1LWHA 5HJLA 3A13A 3ZJ8A 1H4PA 2VOMA 4Q6JA 4LH8A 1M9HA 1NH6A 3W7DA 4ZXLA 1P0EA 1EPVA 2CKSA 4CEXC 3NQBA 4MM1A 1SO5A 2CHRA 1HVXA 1MQRA 3CV2A 2QYGA 3S8HA 1RXOB 3GXPA 2WM0A 4NJKA 1Q2RA 4RXFA 3QMSA 1F74A 4KEUA 4UTTC 3TYAA 3ABXA 3HF3A 2XIJA 3FJ4A 2VOTA 3S46A 1FWFC 3GBDA 4MKVA 1GVSA 4Q32A 4O1BA 2DH3A 1CGYA 1EJXC 3N25A 1JG9A 1B9BA 4I9AA 1L8NA 3B03A 4W9TA 5TIMA 1CT5A 3NAVA 5BOEA 3SEPA 1OFQA 2CLKA 1QBBA 3V5OA 3LCXA 4IISA 2FKPA 3FYYA 3A12A 4NASA 4XBSA 3AXHA 1B31A 4ZMGA 1CGWA 1XKJA 4H6RA 3T0TA 4GQQA 3GTFA 2WAGA 3FA3A 3WQDA 3NSNA 4IQLA 4A3YA 4RUBA 4CVWA 2WKGA 3M4HA 1R38A 3GHTA 2OGJA 3GDLA 3E0IA 3RLVA 2PWUA 3IUHA 3Q4DA 1FX6A 5EPDA 2C71A 1Q45A 1MUMA 4FHAA 3BO9A 1J2WA 1Y0EA 4TR9A 4CQ8A 1Z69A 1EF3A 5G5IA 1LBFA 3CH9A 4L80A 4IMDA 1IYXA 3P74A 4OTKA 2Z25A 4EVZA 3QRHA 2QJJA 1ELSA 6A3HA 2EF9A 2VYOA 3U48A 1N7KA 1H7WA 1JDCA 2P53A 2ZC1A 4M6PA 2WHMA 1WPCA 3G8RA 2FFIA 5EU9A 3P3BA 3L67A 4PB3A 2JF7A 1MVYA 4JKLA 3TLLA 3H2FA 3PBYA 4U3AA 1E3ZA 1V3HA 1X1OA 3RIKA 1BF2A 4ORMA 4FS9A 3KBWA 4WSJA 1C9WA 4QNWA 4AVOA 4MJZA 3M0ZA 4WD0A 2DJXA 4JTIA 2ZRVA 4HNUA 4MG4A 1TUXA 1WDRA