4HN4A

Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
total genus 103
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hn4A00
3LB0A 2IQTA 4PEKA 2Z1BA 4HNVA 2RDWA 4UTKA 1OFEA 1GVFA 2C3ZA 2FFCA 3LCXA 3QMSA 4ALDA 1OYAA 2I9EA 4MLRA 2E09A 3JRKA 2C0AA 2H8XA 3DHFA 3C2OA 3NQEA 3P81A 1VHNA 4NXSA 2A6NA 4JD4A 2NXIA 3VE7A 2NWSA 4ICNA 2CLHA 3N19B 4R53A 1F5ZA 1KTNA 3WJYA 4M7SA 1KBIA 4UMAA 1GTHA 4S1FA 4K36A 4JY9A 5MHBA 1ICPA 3TAKA 5AHLA 2YDAA 5G1YA 1VCVA 2CFFA 4O53A 1Q6RA 2TRSA 1TREA 1VJIA 3HG3A 1HO4A 3BG9A 1K8ZA 1OG0A 2ZQ0A 5F2MA 3E96A 3P7YA 1TIMA 1A5BA 1XDMA 4ZVJA 3PSVA 1JVNA 3USBA 4BK9A 1I2QA 3A5FA 3VI2A 1HUVA 3NO5A 1H7NA 1YXDA 5LGXA 3V1PA 4LC8A 1VHCA 3M6YA 3KVKA 3VE9A 3IV3A 5D2TA 4GUJA 1LBLA 1PE1A 1ZAHA 1P0NA 5J5DA 3W2NA 4TX9A 4FHAA 3G1DA 4JS3A 5SWUA 3P61A 1SW0A 2GPTA 3PBVA 2V81A 4MJZA 3RLVA 5LNVA 4LT9A 3CPRA 5G2WA 1F6PA 2J9YA 4YL2A 4WUIA 1A53A 3TSMA 3ZWSA 2Y85A 3R12A 2G96A 3GR8A 3W07A 2NX3A 3QQ0A 3N9SA 1Z41A 1GVQA 1LBMA 3L5LA 1ME9A 3BW2A 1TV7A 1XFBA 4KWVA 3M43A 4M6QA 1YPFA 1JUKA 2FDSA 2CLOA 5CZJA 3L0GA 2R8WA 3IGUA 4HN4A 1ONRA 1SSDA 4X2RA 2QCFA 2NLIA 1XBVA 3NPVA 2H3BA 3HQ1A 3LBCA 1FDZA 4IWWA 3QEZA 3ZS4A 2XN1A 1P1XA 2JBMA 4FB7A 1VGAA 4W9TA 2QCGA 3TIMA 4DO5A 3TNOA 3WJSA 2X1SA 4NJKA 3FKKA 1OVDA 1KFCA 1YYAA 3E49A 3OHIA 1UUOA 2EPHA 3MJYA 3STEA 1GVOA 4JTJA 4DF0A 4JICA 3P5YA 1WA3A 3G1YA 5AYYA 3G0XA 4JEQA 1TTJA 1PIIA 4O57A 1LOSA 3S5YA 2QF7A 4E2DA 2E1DA 4LUJA 3O6YX 3C2VA 3EX2A 1VYPX 1VC4A 2QUVA 3WJXA 1KV5A 4XTDA 4X3ZA 1QR7A 3UY7A 5DY2A 1M5WA 3CQ0A 3O05A 5D32A 3R89A 1NF7A 3HG5A 5AFDA 3TQKA 3CC1A 4O18A 2GVJA 5EA9A 3G1XA 3IGXA 2VKZG 1W3IA 2GQ9A 4Q4KA 3NAVA 2ZRZA 4FX6M 4ONVA 4NX0A 2FIQA 1MZHA 3GAYA 1PCWA 5HR6A 4JN6A 3UWUA 1HO1A 2DZSA 3P8JA 1XUZA 4JYDA 1LM1A 3EXSA 1TPEA 1KFBA 2Y70A 1H51A 2C14A 3R5EA 2CW6A 3NZ1A 1D9EA 1H63A 3UWZA 3L0KA 1HL2A 1O4UA 3PUOA 5EY5A 5AYXA 1FBAA 1WYIA 3BV4A 4C1KA 3LV6A 4BF9A 3HIJA 1TCDA 3T44A 4UFJA 2V2HA 3TC7A 2NXHA 3TDFA 3NPXA 1DQWA 4FNTA 1B57A 2E6AA 3W1NA 2CZFA 2DZPA 2QJHA 3EX6A 2VFGA 3GB6A 2JKPA 3OA3A 4LVAA 5AHFA 4LUIA 3KOFA 1OF8A 3W7NA 3LLFA 4O10A 5D04C 4N9DA 4RV8A 4JTIA 1VCFA 3B0VC 1YTDA 5DCEA 3C3NA 2WKJA 2DZTA 2ZRYA 5HJLA 1X7FA 2A5HA 3QH2A 4AWUA 1WBJA 2PCQA 3JR2A 3TSBA 3M47A 1DQXA 1SUXA 1O94A 1ADOA 4UFIA 1H50A 3HPSA 4MY1A 6TIMA 3W7EA 3A23A 2VOMA 5FF7A 4JTFA 2C16A 1QOQA 4Z0SA 1YPIA 5L6UA 3IIVA 3HGOA 1Y0EA 2J88A 1KFJA 1GT8A 1OABA 2ZA2A 4AF0B 1TJPA 3GNNA 3NQGA 1GG1A 2WSYA 1NVMA 4MFDA 3SFKA 1QDSA 2ZCGA 4ZQMA 1LROA 4UTMA 3FYPA 1HTIA 2ZDRA 3UQNA 5K9XA 3FS2A 1YADA 1J5TA 3EKLA 3TFXA 3UXAA 5A8GA 3NXFA 3QPZA 5I3IA 2ZRXA 2YYTA 4IJBA 4OT7A 3P74A 1FDJA 1VCGA 5TQLA 3P67A 4NNCA 3CEUA 5HWJA 1K7XA 3QW3A 5D2YA 3CLMA 3EXRA 1LCOA 3LRLA 4AH7A 2C18A 3NQDA 3PAJA 4Y96A 3W1PA 5C54A 4FNSA 5I3GA 4OWGA 2UV8G 5IM51 3M9YA 1TB3A 4GC4A 1FCBA 3M44A 1U5JA 1ZJIA 4YXGA 4UTIA 4Y9AA 3H53A 3CT7A 1SFJA 5DLCA 4AHPA 3GKAA 3W2JA 3HGSA 3O6CA 3HF3A 3W73A 1OX4B 1TPDA 3WK0A 5KTLA 1IIHA 3KXQA 3KFTA 3LGEA 3SZ8A 3Q37A 4WOQA 2ZZ1A 4UC5A 4A21A 4JX6A 3STGA 4K39A 3MWAA 5A5WA 4TMCA 3TFCA 3ABSA 1YXYA 5DN1A 5K9DA 3S1WA 3W7IA 5LNWA 3LRMA 4Z1BA 4JTSA 1OFRA 4IGHA 1K8YA 3MP3A 5CSRA 5D33A 2QCDA 4AWSA 3PVFA 4UTTC 4A2RA 4LY8A 4ADTA 7TIMA 1VYSX 1OHLA 2EGZA 4GWEA 3THQA 3GXTA 3CHVA 1K03A 3MMTA 3A21A 1H7OA 3NDOA 4IPIA 4FXRA 1SO3A 2TYSA 1F6KA 3L21A 4LS2A 3Q2DA 4BWLC 1ZCOA 4DF2A 4O28A 5CPMA 1Q6QA 5AYZA 3QM3A 3C2RA 4FEZA 3HBLA 3GLCA 2X16A 4E38A 1DJNA 3W1XA 1MEHA 2E5BA 3LV5A 3LXAA 2DZUA 3QQ1A 1PL9A 1RD5A 3CWNA 2VELA 1T0OA 1B4KA 1H1YA 5HNRA 3AO0A 1F76A 3B05A 3BG5A 1UJPA 2J6XA 2VC6A 5KZDA 2EF9A 1L6WA 3GK0A 3RK8A 1G7VA 4A3UA 1H1ZA 1JJKA 1SW7A 5IBXA 4O8RA 4CCEA 2GUUA 1SO4A 4AHOA 2QAPA 4L4MA 1LRQA 3OBKA 4JIQA 4D2JA 1ICQA 2BTMA 1DHPA 4N4PA 2KZHA 3LHZA 3MYOA 3SW6A 4Z1AA 2BSLA 5FF0A 3KVLA 3W7LA 5EPDA 3PBUA 2LLEA 4I7WA 1VLWA 1JCXA 3DFTA 1FWWA 4JDYA 1QPNA 3W1RA 3EWXA 2OJPA 1JR1A 1XBZA 1ZFJA 4QSHA 4O13A 4Z1DA 4UIOA 4HKPA 3STCA 3EEGA 4JDBA 2FPVA 1AK5A 1TSIA 4QIUA 4M7TA 1ZENA 2QUUA 2H3DA 2ISWA 2YFOA 2OZ0A 5ABTA 1T96A 1YTKA 1W5PA 1TQXA 4M6VA 3UWVA 4KWWA 3IVTA 3SGUA 3RMJA 1KV8A 5CZTA 3RU6A 3NM3A 3G3DA 1LRNA 4JYFA 3BLIA 4UFHA 4UTJA 1FUYA 4LWWA 4O1BA 3CIWA 4J9JA 2JGYA 4RZ6A 3TAOA 2ZZ6A 3F4NA 4UMCA 2G5WA 2B7QA 4O52A 3S0CA 1W1ZA 2B7PA 1I4NA 4O0ZA 3BW3A 5AC8A 5D03A 3G8RA 3W9ZA 1SR9A 1A5CA 5I3JA 4NJGA 4N2YA 3E9AA 3PS7A 4FX8A 2Q3OA 1H5YA 3G0UA 3SECA 4YWIA 2EHHA 1X8FA 3L67A 3FEMA 4UUIA 5FF4A 1L9WA 3W84A 4KFOA 1ZHAA 3EX1A 4A29A 3TXZA 2W6RA 3I7QA 2V5BA 4IMDA 3W23A 3VNDA 1EWDA 1W5NA 3TJLA 4GUHA 4BI7A 2ZZ7A 3BVJA 5KMYA 1LZOA 3MO7A 4BI6A 3P5ZA 1SZFA 3NL3A 2NUYA 1H7RA 1N8FA 2NV1A 5KZEA 4HSNA 4X22A 1G4SA 1JQVA 3M0ZA 2QCEA 1G4TA 3MP5A 1WAUA 1J4EA 3RF9A 2WNQA 3IEBA 1H7PA 4MYAA 3THAA 4JYEA 2VENA 4A2SA 3A24A 3W7MA 4ZL1A 4MY9A 5LNRA 3MBFA 5CZ0A 1TV8A 3U2OA 3W1TA 3LM7A 3C8FA 1GYNA 5E0KA 1Z44A 3M7WA 3NZRA 1W5MA 5HUPA 2ALDA 1OFOA 3VKJA 4N02A 3SJ3A 5K2ZA 1ZNNA 3C56A 2RH9A 4HNUA 3HPXA 5LSMA 3KVJA 2WNZA 1K3UA 1TPB1 1Q45A 4PL1A 4NJIA 1SZNA 4DPPA 2ZTKA 3SR7A 1YXCA 5F1VA 2XN0A 4MKNA 3I7SA 4WQ6A 5DBTA 1A5SA 5D09A 3NL2A 1OFPA 1P5BA 3W7JA 2QEZA 3G0SA 4Y6GA 3QMRA 4N6FA 3TE9A 1ZAJA 1AW2A 3INPA 1W56A 2A0NA 5EL1A 3W7KA 1R2TA 2P0OA 4N6EA 4K8EA 1GVSA 3LX9A 2JK2A 3PG8A 1ZY9A 4WY0A 1OX5A 4PFMA 4EOUA 4M5PA 3MUXA 3PB2A 5KSWA 3PB0A 3ZR4A 1I2OA 4OU1A 5CGQA 1O60A 3PBWA 3O6DA 1SZGA 2ZA3A 3L2IA 3KX6A 3L66A 5K9CA 1FXQA 3B8DA 1GZGA 2C13A 5K7JA 1N7KA 4IX2A 1OX6A 3M41A 1TPVA 4LV4A 3ZWTA 1AL7A 4UR8A 2FTPA 2WSRA 3DFSA 2CZEA 3GDLA 3N2MA 3QYQA 5FEZA 1OFQA 3MYPA 2E5DA 3W7CA 5AB3A 3DFQA 2A7PA 4JTUA 2YZRA 3GIYA 1W8SA 1D3HA 2VXNA 3TU9A 2Y7FA 4WD0A 4HHPA 3OVRA 5EBUA 1LOLA 1SO5A 4IX0A 4RK8A 3TW7A 4BI5A 1UCWA 1TPH1 4UCGA 4WY0B 2ATMA 3QSRA 1PCKA 1VQTA 4MUZA 3NQAA 2HS8A 3P80A 2EAWA 3LCGA 1GG0A 2ISSA 3N34A 1KTCA 2VFEA 5DBUA 2OMAA 1DL3A 1EX5A 2WO5A 1JCJA 3FJ6A 4S2CA 3TA6A 4TR9A 4O1AA 3O07A 2JGQA 3LXCA 2RKXA 4K37A 2A85A 4Y90A 2CLIA 4XBSA 1FWRA 1TTIA 4AEOA 1ICSA 4IMGA 4XTIA 1IXNA 4IUOA 4RCXA 4XWUA 1IGSA 3ZFHA 4ZQRA 4YCPA 2F84A 5AHMA 4FNQA 2Y62A 2J27A 2RHGA 5DELA 4RXGA 5E1QA 2YW3A 3W7RA 2E6FA 4LOCA 2ZFAA 4E0CA 4JNMA 2DZWA 1K8XA 2Y6ZA 2RDTA 5I3KA 3UPWA 4WJEA 1FQ0A 3YPIA 2D73A 3ELFA 2NZLA 5G2IA 1YDOA 3LCLA 3Q58A 3LHTA 2I1OA 3VCRA 1OX4A 4WX2A 3NQFA 4LVBA 3F4WA 3KRUA 3PY2A 2GQAA 5FF3A 3W87A 4R33A 4CLMA 1I8JA 1G67A 1VYRA 2QJGA 3A5VA 3PUDA 4POCA 4O1CA 1AW5A 1W3TA 3O8AA 3S1XA 4O54A 1W0MA 3ABOA 3FKRA 3QPYA 1DBTA 1WQ5A 3TC6A 5CPNA 1QNVA 2Z0IA 4NNBA 2GQ8A 3G1VA 2V5LA 4EVZA 2YW4A 3GYEA 1EUAA 1PHWA 3OEXA 3NOEA 3A9IA 1F73A 3EWYA 2CWNA 1F7BA 3BGJA 1XBXA 4QITA 1OFAA 3HJZA 4UTTA 4IOTA 3EKZA 1TMHA 4OV9A 4O50A 4NUWA 1KM6A 3IRDA 3G1AA 4JIPA 1CI1A 1DOSA 3MP4A 1H7WA 1EB3A 4XKYB 3NYZA 2CLFA 1G4PA 2VEKA 4GXMA 3EWWA 5TIMA 5F4XA 3PWAA 5I3HA 3SI9A 1DJQA 1L6SA 2ISVA 3B03A 4FIRA 4EIVA 1UB3A 1W5QA 4JGDA 3W7HA 2FPTA 3P84A 4NZFA 5DXYA 2VFIA 3N2XA 5H2ZA 4CQ9A 2I14A 2A2IA 4JR5A 3LOTA 4I7UA 1TQJA 3QZEA 5U4NA 1T8XA 3I68A 4TMBA 4PC8A 3WJZA 1JCMP 2R91A 5D05A 3LI1A 3NQMA 1OFDA 4PH6A 1AL8A 2E6DA 4O11A 3W1QA 2OT0A 3TCEA 4FXSA 5EYWA 1AG1O 2ATSA 1XDLA 1XC4A 3W22A 3NA8A 1S5VA 4ADSA 1VS1A 3OG3A 5E93A 4DBEA 2DJLA 3FFSA 2Z2UA 4MOZA 3S1UA 4B5NA 4UTHA 3DFOA 3SIZA 1D3GA 2A4AA 1QO5A 1P4CA 2RDUA 4H4IA 4AHQA 4WOZA 3KRZA 3MI3A 1JRCA 1OFBA 1XL9A 3C0JA 4MPQA 4GFSA 2HMCA 4LTSA 1YDNA 3DXIA 2ZBTA 3QJAA 3FJLA 4EF9A 1R47A 4HPXA 4RZ4A 4NQ1A 4TU1A 1KTBA 1RV8A 1GTEA 2Q8ZA 1I2PA 1EP2A 3V75A 4E2BA 2Z6JA 4HNTA 5U7SA 1KM1A 1ZAIA 3W3OA 1VR6A 2BWGA 3O15A 3AJXA 3N9RA 1AW1A 1QAPA 3ABQA 4CNPA 2FQIA 1SPQA 4JTKA 1GYLA 4GUGA 4CCCA 5AHNA 3PULA 3L65A 2R94A 1W3NA 5HQEA 2YPIA 1EP1A 2DZXA 3FIGA 3L9CA 2X30A 2B7NA 5FEWA 2PURA 1EEPA 3LCFA 1OJXA 3JS3A 3UWWA 4CNOA 4DELA 1ML1A 4Z08A 4NJHA 3W7PA 3CWOX 3GVGA 3PUEA 1BEUA 2C19A 1H62A 4XBKA 3LRKA 5BMXA 3M16A 2YGYA 2ZZ4A 1SZEA 1R46A 4DF1A 4QJ1A 2Y7GA 1OYBA 4L4LA 4M19A 5LZLA 2BLEA 5D2XA 2X1RA 4MZ8A 1IXQA 3LCHA 5K4ZA 3U8GA 1H60A 2QCLA 2J9XA 1KM5A 5AC6A 3TMQA 3B0PA 5EKYA 3OVQA 3C6CA 4YLWA 1CW2A 3W2LA 1MXSA 4Z1CA 3GX9A 2DP3A 3SY5A 1ZALA 2Y7DA 3CU2A 3LCIA 4LVFA 4KFNA 4I9AA 3L5AA 3NL5A 1PS9A 1DKWA 3OIXA 4P2VA 4U4MA 2VFHA 3NVTA 1QO2A 3CEPA 4ZMGA 3DKJA 1ME7A 1FY6A 2B7OA 3NQ7A 1FWNA 4JTHA 2WJZA 1LP6A 4MVAA 3UZJA 2B4GA 5HR7A 4P61A 1CX9A 1KLZA 2V2CA 4CQ8A 4AXKA 3LI0A 4DPQA 3BLEA 4FNUA 3U6WA 6ALDA 3M5XA 4O15A 2CLLA 3DFNA 5D30A 1XUUA 1EWEA 1B4EA 2FPYA 4Z0JA 3MBDA 1EP3A 2WQPA 3UPBA 5F2LA 5AN7A 5KITA 3CB8A 4UMBA 3W72A 1RR2A 1J2WA 3W85A 2ZZ2A 4IMEA 1S5TA 1LDCA 2A1YA 3LTSA 4N9CA 2BXVA 1TPC1 2E6YA 4JY8A 1OF6A 3DFPA 4UFLA 3BARA 2O7SA 3S5OA 1RQEA 3I65A 3I7RA 3TQVA 1H7XA 3TK7A 3TJXA 4K7VA 4BR1A 5GVJA 3EB2A 2C15A 3LDVA 2GVLA 4K7YA 1X6UA 3CM4A 8TIMA 3RLUA 3IIZA 4HSOA 4MYXA 3EX3A 3FLUA 4TO8A 1C8VA 1FWSA 4DQWA 5IBXC 3TSDA 3PBYA 3GDMA 1KM3A 4N9EA 4N4QA 1QFEA 3L68A 5CZSA 3Q94A 3BPWA 4FNPA 5AHEA 4IXXA 4NX5A 3S5NA 2V8ZA 2Y61A 3EWZA 1BKSA 1UUMA 1BTMA 1M7PA 3LTPA 5FI8A 2WNNA 3IIXA 2ZZ5A 4RJEA 3MHFA 1EA0A 3PSWA 3P62A 4ZQOA 4LVGA 1SFLA 3DI1A 4DXVA 5HMSA 3ABRA 3DZ1A 3E02A 5G2HA 4UTWC 1WDWA 1C29A 1GWJA 1V5XA 1KM0A 1KW1A 2G95A 3B4UA 2QJIA 5F4WA 2XFWA 2YYUA 1NSJA 4JTLA 5KINA 3S6DA 1O5KA 2OT1A 1Z42A 4TIMA 1XXXA 5DCDA 4PODA 1OYCA 1G4EA 1MO0A 1YDVA 2QDGA 4MJMA 5DY3A 4LRTA 5FESA 4UR7A 2CZ5A 2QKFA 2VFFA 4OQVA 4LS0A 3NEVA 4PCFA 1KFLA 3F03K 1KM2A 3W7GA 3TQ0A 3G3MA 1EUNA 4R34A 3C52A 1THFD 1DV7A 4IPJA 1KBJA 1GEQA 3NPUA 5BMWA 3T55A 2PE4A 3LERA 4RXFA 2JKAA 1EIXA 5LGZA 1DVJA 4PA8A 3UNDA 3LHYA 2AQWA 2FB3A 5BW6A 2XN2A 2O7QA 2AAMA 3O63A 1MEIA 5BNKA 5D37A 3T7VA 1TYGA 4AAJA 2Y89A 1TPUA 3LTYA 3UWQA 4R7JA 4GUIA 4Q33A 3W88A 1BWKA 5G1TA 1VLIA 1KFEA 4JX4A 3QC3A 3W1MA 2PRLA 1F74A 4GJ1A 1F05A 2CU0A 1O5XA 1VRDA 4RLIA 3KAOA 1RVGA 1W31A 1HG3A 1QPOA 1TTPA 4AB4A 3KRSA 2BX7A 2BZNA 4KKXA 1EPXA 1WBHA 4K8HA 4ML9A 2C6QA 5C55A 3NPWA 3S9YA 2X2GA 1VH7A 3ANYA 4WZHA 3GKFA 4MFEA 2FB2A 1TTQA 4LU0A 1LTDA 1UBSA 3H55A 3W2KA 4GE8A 5F1UA 2PRHA 3S8HA 2QAFA 1OK4A 1JUEA 3DBPA 3NGJA 3TW6A 1KFKA 3S5ZA 4XUGA 3R2GA 3W1LA 3C2EA 3DAQA 2YFNA 3HB9A 3WFAA 2QCCA 4UTUA 2ABAA 3DKLA 5LNUA 4YMZA 1PHQA 3UYCA 4FF7A 3QMTA 2NX9A 3QW4B 3IIOA 4AVFA 5F2IA 3EWBX 3RFAA 3DGRA 4ADUA 5LKYA 2P10A 3HO8A 4I7VA 3HG4A 4DEFA 3W83A 3EWUA 1B9BA 4QNEA 3BG3A 2W79A 2HS6A 3GDTA 4JTTA 2HSAA 4H3DA 1W54A 1JQXA 1TV5A 1I2RA 4O4VA 4BWLA 1W37A 4GUFA 4NNAA 1GQNA 3W1UA 1IF2A 2YSWA 3NQ8A 4OE7A 4WXZA 3G8EA 1OK6A 4CNNA 3CIXA 5F2GA 3MHUA 5J5RA 1JCNA 3FYOA 1B3OA 3B06A 4MZ1A 4S2BA 3STFA 3E0IA 3DHDA 5AHIA 1NF0A 1TJRA 4N9BA 1QWGA 1JULA 3M5VA 3NQVA 2Y63A 3NM1A 2P1FA 2YR1A 1ALDA 3PR2A 2YXGA 3G1HA 5LHEA 3W7OA 2X1UA 1O95A 4AMAA 1KLYA 3O1NA 5CKSA 3S42A 1M7OA 1I2NA 4O1DA 3WK3A 2Z6IA 2NV2A 3TH6A 3TUUA 1LORA 4ZZ9A 4GBUA 1K7FA 1LYXA 1M6JA 4BFAA 4JXCA 4QQ3A 2QDHA 5DXXA 4AWTA 1L2UA 4NT0A 3TKFA 4GRSA 5I3FA 1Q3NA 5HWNA 4YCOA 4UTLA 4QISA 1SO6A 2VFDA 3VFLA 5AOUA 3P82A 4EF8A 4UFKA 3H54A 3PM6A 1ME8A 3N3MA 1R2RA 2HTMA 1H61A 3N73A 1QCWA 1R30A 1XBYA 2NXGA 5CSSA 5HUOA 2ZRVA 5CPLA 1PV8A 2Q8LA 1FCUA 5D02A 1LBFA 5D38A 3IIPA 4O4WA 2OX1A 4ORIA 2ZTJA 1C9DA 3P8IA 3TX9A 2YX0A 5AC7A 1JRBA 2E5CA 3IGSA 4FX7A 4PTNA 2EKCA 1R2SA 4O0KA 3C2FA 1FCVA 1TO3A 3C61A 3E12A 1V7YA 2E68A 3KVMA 4KFPA 3WK2A 4CCDA 5LHFA 3G22A 1L6YA 1K02A 3HG2A 4UXDA 2ZRUA 3PG9A 2RFGA 4XZ9A 3QF0A 1TRDA 4LNYA 3G1SA 3GXNA 3GNDA 5D2VA 3MHGA 3NL6A 2DJXA 3HGRA 4WY0F 3NQ6A 3W6YA 4MIMA 5FEXA 2FLIA 5D2WA 4XQ6A 2G97A 4LRSA 3TROA 4LV9A 5G4WA 1GOXA 3DU0A 1YTEA 3WK1A 1QOPA 2PRMA 1XM3A 4IXHA 3G1FA 2QCMA 3BK0A 5G5IA 3S1VA 1WX0A 3UXDA 1JCLA 1G6CA 2CLKA 1IXOA 2OCZA 3R13A 5F4SA 1JCYA 4FIQA 3UWYA 2FJKA 5L9FA 2H6RA 2QCHA 1WOAA 4U28A 3LCWA 3GZ3A 4NJJA 4IQLA 1WXJA 3A22A 1IIGA 4Q32A 3M1ZA 1G69A 4HPJA 1FX6A 1GJPA 1NAL1 3T78A 2F7FA 2V0TA 2ABBA 3LHVA 1LOQA 1A5AA 3W75A 2TSYA 2GJNA 4LC6A 1LLZA 3GR7A 3GDRA 1SU5A 3P60A 2NUXA 3TR2A 3HMJG 2QCNA 3QFEA 1FXPA 4K6AA 5KZMA 3W74A 2QCDB 3W76A 3HPZA 4RX0A 1TPWA 4K38A 2GOUA 5C6MA 2NX1A 4UFMA 3LHUA 3QRHA 4PL2A 3MI2A 3W86A 2CLEA 2Y88A 3RNDA 1S5WA 4CQAA 1S3HA 5CPOA 4O12A 3I6RA 5C2XA 3BLFA 4A22A 5LNSA 3M5ZA 4JX5A 1I45A 1BWLA 1SW3A 3HOJA 3NQ2A 1RQHA 1E51A 2C1HA 2ZYFA 4IMCA 5BRBA 2AGKA 2ZRWA 1LLWA 2R14A 2YCEA 3UY8A 4O16A 2B0MA 3BW4A 4XKYA 4NVTA 1Z48A 1KA9F 3C4UA 3M5YA 1TPFA 5C5YA 2GVGA 4EWND 3IVUA 3GAKA 2A7RA 3LBMA 3DH7A 3CTLA 1W5OA 1WOBA 3NNTA 4JTEA 3W1AA 3MI6A 3KHJA 1G7UA 1RPXA 1QMLA 4Y8FA 2W0UA 3L0NA 3TV8A 2A7NA 1F2JA 3UD6A 3B04A 1IXPA 1X1OA 3BO9A 4QNWA 2DU2A 5K3VA 3N14A 1LRTA 4OHQA 2WPBA 5HINA 4ORMA 4ZQPA 4HIBA 1SSGA 5BOOA 1DORA 4O19A 2A6LA 3UZ5A 3NQCA 1TRIA 1Q6LA 1FCQA 3ATZA 3MW7A 4NZJA 3TMLA 3DI0A 2VEMA 2V82A 4HNNA 3IVSA 3O16A 2QR6A 1NFBA 2QUTA 4C1LA 3LLDA 5EMUA 1N55A 1AMKA 1Q6OA 2J24A 3G24A 4WXYA 3W2MA 2A21A 2ZA1A 2NUWA 5TBOA 2V9DA 1YLVA 4DBDA 4FNRA 4LS1A 4RR4A 2TMDA 3QSTA 3T4CA 3R8RA 3W7DA 1KM4A 3LHWA 1X1ZA 3PF3A 4RKAA 4UNKA 4OGZA 3DENA 3GDKA 1FWTA 4DO6A 3ATYA 4NU7A 1RZMA 1MEWA 3SSJA 4HT3A 5T26A 1RQBA 4H6KA 1PVNA 5G4EA 3W70A 2TPSA 3F1QA 3FOKA 4O14A 3K30A 4MY8A 3EXTA 4MLJA 2E77A 2Q3RA 1P0KA 4X9SA 4GNJA 1FDYA 4OBTA 2X1TA 2VEIA 4O17A 3EX4A 3OVPA 3W2UA 1T99A 2DORA 5H91A 4QAIA 3HGJA 4QM1A 3SGZA 4AF0A 1A50A 4JTGA 1QPRA 4NXKA 4G1KA 1XKYA 3NR0A 4IMFA 3B0UX 1GVRA 4UTWA 2WV8A 3T40A 1VPXA 4DO4A 1MSSA 2ZZ3A 4FO4A 2GJLA 5FEPA 3LXBA 2CLMA 5DCBA 5K4XA 3L5MA 4ZQCA 1XI3A 2J9ZA 3G18A 1JUBA 2VEPA 3WJWA 2NWRA 5FF2A 2V2DA 2H90A 4M6PA 1GPWA 1SQ7A 1XCFA 3BGGA 3PC0A 1K7EA 5CG7A 1HFBA 2Y7EA 2JKEA 5HULA 2H8ZA 4RZ5A 1WV2A 4OV4A 4LW7A 3O06A 2V30A 1U83A 1NEYA 4LVDA 2PC4A 4ZQNA 3W7QA 3W71A 1UASA 3TXVA 2WSQA 1VZWA 4UNLA 4MZYA 3FA5A 2CZDA 5HWMA 2WOQA 3GXPA 2DZVA 1QPQA 3D0CA 3NG3A
chains in the Genus database with same CATH superfamily
2Z1BA 2E8ZA 1OFEA 1GVFA 2C3ZA 3LCXA 1S3TC 5HK4A 1XG3A 2C0AA 2H8XA 3DC0A 2NWSA 3IARA 3RPDA 4R53A 3QGAC 3FYYA 4M7SA 3IJ6A 4GY0A 5AVNA 1M3UA 3UZWA 5A3HA 3TAKA 2CFFA 2FTWA 3HG3A 1HO4A 1K8ZA 1BG9A 5GQBA 1HL9A 4ZVJA 1JVNA 3USBA 4BK9A 1E9LA 3U7BA 1I2QA 5G1MA 1QNRA 4HOWA 1FWHC 1BQCA 3SO7A 5LGXA 3I10A 3RPTA 4Z1YA 3ZSSA 1S5NA 4AMCA 3WN6A 3VE9A 2PSNA 5D2TA 4GUJA 4AD0A 3VMPA 1TWZA 4S38A 1XLEA 4YVXA 5LNVA 1VFLA 2GWNA 1F6PA 2NV9A 1ISYA 4YWSA 3W37A 2Y85A 1GOIA 4DJED 1Y8BA 3WDIA 2NX3A 2DDXA 3L5LA 2NT1A 2YBUA 4P7NA 3RGTA 3BW2A 1TV7A 3HQPA 1XFBA 2J74A 4ZE5A 1R3QA 3OOQA 4UQEA 4NASA 1NWSA 4KETA 3UFYA 4HN4A 2IS7A 1L6FA 4F40A 4X2RA 3QY8A 4Y7EA 3LYEA 3VX0A 1EQCA 3OLEA 4QDPA 1P1XA 3JUGA 2VGFA 3L12A 2QCGA 1MZRA 2V6AA 2GJRA 3TNOA 4DRSA 4RDZA 1OVDA 1YYAA 2HNEA 3E49A 2EPHA 4LEQA 4DF0A 4AZ7A 6CGTA 5AYYA 3G0XA 1PIIA 4O57A 3S5YA 5FD0A 1QNSA 2PTZA 4GK8A 3O6YX 2YDRA 1BSLA 1RLDA 3EX2A 4OOUA 1VC4A 1OINA 2QUVA 4HYRA 4XTDA 5GPRA 3UY7A 1XIFA 1R3VA 1Q85A 1UIOA 1XGZA 2QJJA 1R3RA 2ISDA 1POJA 4M81A 3CC1A 2TAAA 3IGXA 1QNOA 3VM5A 4V2XA 2VCCA 1ECQA 3V5OA 1PCWA 4UZSA 4CQCA 3UWUA 4L1WA 3ZVIA 1TUFA 1LM1A 1TPEA 1XJBA 2HISA 4L80A 4Q7NA 1V3KA 4TUFA 2Y70A 1BXCA 2RGLA 4LYKA 1XINA 3NZGA 3NZ1A 3H7VA 4XD5A 1BYCA 1O4UA 5GJPA 4BEQA 4DLMA 3PUOA 1XR2A 4D6CA 1FBAA 4C1KA 1BWVA 3T44A 4RUBA 4UFJA 3S1GA 2NXHA 3TDFA 2E6AA 4P7QA 3DERA 1S1PA 2R1KA 3FDKA 1XIEA 3GB6A 3OA3A 4I90A 4FP1A 4N9DA 1YTDA 3C3NA 3FV9A 2X1IA 3GTHA 1NELA 5D9MA 3QH2A 5BRQA 4AWUA 1DIOA 1WBJA 3JR2A 4AVOA 4XB3A 3M47A 3TSBA 2EG6A 4IL0A 2QGYA 1O94A 4OTKA 1H50A 3H12A 2VOMA 2Z1KA 2C16A 1QOQA 3HA1A 4MNJA 4D6JA 5TF0A 1FWAC 4PTXA 5L6UA 3HGOA 3FXGA 4L56A 4PUJA 1OABA 2YL5A 2ZA2A 1S2CA 1TWIA 1XHGA 4MFDA 4S3CA 2PWEA 3WH5A 1TE1A 2V68A 5C2GA 5CG0A 2ZCGA 4H19A 1DXFA 2ZDRA 3N3TA 1YADA 3ANVA 4P8UA 3UXAA 3SCPA 2YYTA 1VCGA 1O1HA 2PB1A 3VIPA 3CEUA 5HWJA 5CC7A 4ZOEA 4AH7A 2PF8A 1OEPA 3WUFA 5I07A 3NQDA 3PAJA 3SN4A 3B0XA 3OLDA 3W1PA 5C54A 4M56A 1UOKA 4FLOA 1U5JA 1ZJIA 4P7LA 1DWGM 4RE3A 2H9AA 2VDGA 4Y9AA 3BOXA 3A4XA 3OA5A 3O6CA 3AAMA 3W73A 5C71A 1TPDA 3ZVHB 4NAFA 1IIHA 3KXQA 3LGEA 1XPGA 3MC5A 1T7LA 4RNJA 3GTXA 3STGA 3S5SA 2XSXA 3MWAA 4BF5A 3TFCA 3IPWA 2VURA 3ANUA 3GBDA 1WXYA 1ISWA 2BNJA 2IPFA 2QCDA 1NTHA 4UTTC 1Q65A 1SJDA 4GWEA 4R27A 3AIUA 3GXTA 1K03A 2DSUA 3MMTA 5CSYA 2BS9A 2QIWA 1ISXA 2ZX8A 4MAVA 2BDQA 5A69A 3KBNA 1HZYA 4OBRA 1UC4A 4PE8A 2UZ9A 4FEZA 3HBLA 2RAGA 3FK4A 4S3EA 1YBQB 2DZAA 2QDEA 3W1XA 1P6BA 1OCBA 3LV5A 4BHYA 3QQ1A 1PL9A 3KBSA 3CWNA 4DWSD 4GISA 5BOEA 2F6UA 3T1GA 1VFSA 3AO0A 3B05A 1UJPA 1V3JA 4JTQA 3RK8A 4JNZA 4L61A 4A3UA 1H1ZA 1JJKA 2VRQA 5A8QA 1SW7A 3CWHA 5FA5A 4F9DA 4AHOA 1H09A 1F3TA 1RVKA 3K5XA 4IHCA 2PS2A 2KZHA 1EFZA 4Z1AA 2WHLA 2BSLA 2OWWA 3T2OA 1ZJBA 5H8MA 1E3XA 4JDYA 1XYMA 3W1RA 4WF7A 1PAMA 1JR1A 4QSHA 1CIUA 4XX6A 3UJFA 4ROQA 2GSEA 3UWEA 2CETA 4QIUA 4M7TA 1CZ1A 2OGYA 2H3DA 2ISWA 4K8GA 5ABTA 4FZIA 2ZUSA 1W5PA 1TQXA 1MVYA 1HNYA 3T0DA 3RMJA 1KV8A 5CZTA 3MVTA 2OO6A 4UTJA 4LWWA 4A8RA 2ACUA 4A35A 1J11A 1C7TA 6TAAA 3F4NA 1Z32X 2BOGX 3CUIA 5AC8A 1P48A 4C1NA 3DGBA 1GEHA 5DMNA 4ZXOA 4QEHA 3E9AA 1RUSA 2XWEA 4EXQA 1ISZA 2ZUWA 5I23A 3L67A 1FHDA 3FEMA 5ECUA 5FF4A 1J8VA 2REQB 2PDQA 4PTDA 2P50A 4JL2A 2ZE0A 5D9OA 1GOWA 1R3SA 2A3EA 3I7QA 3E2RA 1J01A 1JYXA 1JDAA 1K6AA 1JNDA 4HVXA 3DX5A 2OLHA 4RDWA 1BLIA 2P88A 4DJDC 1J79A 3TJLA 4BI7A 1F61A 1LZOA 2VZUA 1VJSA 4BI6A 3II1A 2CNCA 1N8FA 4M3PA 1G4SA 4XBJA 4C7FA 2D2HA 1YE6A 1WAUA 4L9ZA 1U1JA 2WNQA 2OOFA 3IAPA 2VUNA 4D6DA 1BKHA 3WD1A 2PP0A 2J8TA 4WRHA 1OD0A 2VENA 3T08A 1E71M 4CVUA 4ZL1A 4MY9A 4FA3A 3W1TA 1K77A 3LM7A 1GYNA 4FOUA 1JI2A 1TV4A 4NKCA 3CTTA 3GVWA 1A5UA 1IT8A 5HUPA 5IFPA 3THDA 5K2ZA 1SZRA 2RH9A 3HPXA 4E4UA 1UR8A 1B3YA 3WBXA 4L4OA 2VGBA 3FA4A 1KQZA 1SZNA 4L65A 3ZJ6A 1TX0A 1YXCA 4H41A 2OR2A 3ERPA 3WQPA 3I7SA 3MUIA 4WQ6A 5DBTA 3ARWA 3DG3A 3NTYA 1A5SA 2ACRA 3C86A 3OZPA 2YCKX 1GOQA 3G0SA 1CBGA 3LD5A 5ABEA 3SIMA 1ZAJA 1UC5A 2F9RA 1YKWA 1WZLA 7PTDA 1GVSA 4W7WA 3BAIA 2W67A 4IFKB 1ZY9A 4WY0A 2O9OA 1XWYA 4P7OA 3WF0A 2BVDA 3ZR4A 3PBWA 1SZGA 3VKBA 4CKQA 3COTA 5K9CA 1FXQA 2C13A 2ZUMA 4AWEA 3BC9A 1BPLB 1WDQA 4GI9A 5CAHA 4UR8A 2G4JA 3GDLA 3N2MA 1T5AA 1OFQA 2E1WA 1QUMA 4B5WA 2E5DA 1XLGA 4JTUA 2Y7FA 2VGGA 3C0QA 1SO5A 4IX0A 3F4VA 5FACA 4AZGA 2ATMA 1LJYA 3BE7A 1SGJA 2YL9A 4CEXC 3LCGA 2BP1A 3AU6A 1EX5A 2WO5A 3O2LA 3FJ6A 3TA6A 4MG4A 3BMXA 4O1AA 2IKHA 1KXQA 3LXCA 3WH8A 1A5KC 1Z9AA 3L4TA 4IMGA 4C6MA 2VC5A 1O12A 1OGSA 1Q6GA 3DYOA 4RCXA 1IE7C 4XWUA 2WNWA 2WMJA 4YCPA 3E5PA 2Y62A 2J27A 1VFMA 2RHGA 4KQNA 4RXGA 2YW3A 2E6FA 4XZMX 1CXKA 1FWBC 3NO1A 1RLCL 1WZAA 2RDTA 2OSYA 2PZNA 3UPWA 3YPIA 3ITXA 3ELFA 3QTPA 2NZLA 3QBUA 3LCLA 3ZLHA 4LYRA 4F4RA 1O5QA 2WMGA 2F2KA 2I1OA 5M3WA 4B2DA 2EKGA 3VCRA 4H9TA 4WX2A 4D6EA 1JPKA 5CC3A 3NQFA 5C70A 4LVBA 3PY2A 1IGWA 2GQAA 4IIHA 3SM0A 1I8JA 3RX3A 1V6XA 1VYRA 4Q8QA 1UYQA 1JYNA 1MQPA 3A5VA 3GRIA 1RK5A 2HVOA 3S1XA 2ZUNA 2X7WA 1E5JA 3ABOA 4UWMA 1DBTA 1KO0A 1FH8A 4MNLA 2OKOA 3PHAA 4JPGA 3IUHA 5IDZA 4YS1A 2V5LA 2YW4A 1EUAA 1PHWA 2G37A 2G3NA 1E3ZA 4RDVA 4Q4PA 3BGJA 2WJEA 3HJZA 1TX2A 4XG1A 4OV9A 4O50A 4JIPA 4KEMA 4TQTA 1UP2A 3MP4A 4ZFMA 1E43A 4EK7A 1US0A 3NYZA 3WNLA 5DO8A 3SI9A 3CV2A 3AS3A 3K1DA 1AZ2A 1DJXA 3W7HA 4AD4A 2FPTA 3P84A 2VFIA 2FH8A 3LOTA 3GG1A 1EJUC 2AL2A 3AOFA 3NWRA 4EKJA 4TMBA 1KR0A 1UZ1A 1W3LA 3RYSA 5FL1A 4PH6A 1AL8A 4J7RA 2Z1VA 2HCVA 2ATSA 3CL6A 1UWQA 1DJYA 3FDGA 1TA3B 3W22A 2BBFA 1K4GA 4ADSA 5REQA 1S38A 1KD0A 3Q67A 3FFSA 3R0DA 4Z2JA 4UTHA 3DFOA 1BHGA 3WNKA 4AHQA 4KCUA 3GXFA 1S2VA 1UROA 2WKGA 3C0JA 4IP5A 4GFSA 4XD3A 1YDNA 4S39A 2GZXA 3ES7A 3FJLA 1R47A 3AMLA 2C0HA 2WM1A 4QR6A 3SRFA 4IFRA 4PBEA 3DG7A 1EP2A 1MYRA 1KM1A 1NWRA 4IIFA 2BWGA 2I7GA 4CNPA 4JTKA 2PDFA 3EMCA 3FXYA 2VM8A 2VI0A 4MB5A 3PULA 5BCAA 3N2TA 2GJXB 5HQEA 3IUIA 3WD4A 3L9CA 2B7NA 2PURA 4QTGA 2R1MA 4KGLA 1OJXA 3W29A 4DELA 4NJHA 1ZLPA 2ZC1A 5BMXA 2CBJA 3M16A 3CAVA 5I79A 4QJ1A 1OYBA 1NH6A 7ENLA 4M19A 4FAMA 3MU7A 3DDMA 5D2XA 3BAWA 1IXQA 3N2BA 4G7FA 1JPDX 1UKSA 1AD4A 1QPKA 3TMQA 1ONWA 4HOXA 3C6CA 4YLWA 4QXIA 4PMVA 3GX9A 4IIDA 3LCIA 4LVFA 4I9AA 3L5AA 3UU0A 2UY2A 1VF8A 3AIRA 1QO2A 3F2CA 4O0QA 4ZMGA 5EBAA 1ME7A 1XDJA 2B7OA 4JTHA 2BVWA 3UZJA 3KOYA 4S3GA 5A8PA 4JTDA 1A47A 1R3WA 4CQ8A 5CBBA 1QW7A 2Q8XA 4J2PA 6ALDA 4MB1A 4XAYA 2NQLA 2QVNA 1E9YB 3JU2A 1B4EA 4Z0JA 2WQPA 3V36A 5F2LA 4G1NA 5KITA 4KWSA 1Q4WA 3WD3A 3W72A 2GJPA 4BQ4A 1J2WA 2WSPA 5DRIA 4EAMA 3THCA 3E2QA 3ZLGA 2BXVA 1RBLA 4DBSA 2CHNA 3VNLA 3GM8A 3P2VA 4GD0A 3P14A 3ARSA 3TQVA 1EDQA 1UH2A 4YTRA 4BR1A 2W9MA 4M1BA 4CEUC 4HSOA 1V0LA 4TO8A 1FWSA 2OTDA 1B1YA 2YB4A 1C3FA 3PTMA 5CCZA 3E0WA 1CGWA 3LGDA 1IWPA 1DIEA 3BPWA 1IWBA 5AHEA 3ZJKA 2V8ZA 1U1HA 3ARPA 4PFHA 2WLZA 1LUCA 5FI8A 2VQTA 3IIXA 1DJGA 1E9ZB 1EXBA 2ZZ5A 2GFTA 1NFGA 4LF1A 1IT7A 4GQ0A 1SFLA 1GVIA 3ITYA 3DZ1A 4CU8A 1EXPA 1C29A 1UA3A 2DT0A 3CK5A 3TZFA 5F4WA 1W9PA 2QJIA 3KBVA 4NHVA 5KINA 1UZ4A 4MAZA 2AMXA 2OT1A 1PB0A 4TIMA 1KXTA 2F38A 1OYCA 4JNYA 4C6EA 2QDGA 5DY3A 3V7PA 3WFLA 5FESA 4UR7A 2CZ5A 2OWXA 3QN3A 1DIKA 1RPKA 1AA1B 4W88A 4PCFA 4XD4A 4YJ5A 3N15A 3W7GA 3G3MA 1VEMA 3CXOA 4R34A 2VX7A 1THFD 3BCFA 1PBGA 1HXJA 1RCXB 1KBJA 3QOKA 5I5RA 3N2OA 5BMWA 4AD2A 3LERA 1W1A1 4KRUA 2A3HA 1J2BA 4E8GA 4NIRA 3M64A 4HU4A 4C91A 8A3HA 1W1VA 3UNDA 3S2CA 3W53A 3VNYA 4HNLA 2FB3A 4AZCA 5BW6A 4OIFA 3KOXA 1WAWA 3PTKA 8CGTA 4CD5A 1OG6A 1TYGA 1WDRA 4NRSA 3IACA 4GQQA 3M46A 2XJ7A 5G1TA 1VLIA 5E0CA 1EL3A 3M0YA 4LPCA 4JX4A 4GX8A 2GGJA 5FJRA 1F74A 1B30A 2C79A 4AG0A 3ARUA 4HP5A 1IYXA 3CQKA 5BYWA 2FMOA 3CV7A 3KAOA 3SY1A 3NGFA 1HG3A 4PMQA 4E2OA 1TTPA 4AB4A 1TKKA 2BZNA 1R5YA 1EPXA 2NQZA 4ML9A 1BGAA 2A3LA 5C55A 3S9YA 5KEZA 3VGBA 3H7UA 2Y2WA 4MFEA 1XD1A 1E1FA 1XYFA 2PDHA 1LLOA 1LTDA 3E74A 1OADA 4ZFCA 3VD4A 4MNKA 1NIUA 3HB9A 2QCCA 3UYCA 3RCYA 3QMTA 3QW4B 4AVFA 4RNHA 3RCNA 3RFAA 5REQB 1X96A 2P10A 3KW3A 4I7VA 2NSXA 3ZR5A 2PLCA 3U48A 2HSAA 1W54A 1EJTC 3PANA 3S2MA 3OTRA 4LB3A 2QW5A 4V33A 3DFHA 4PCNA 4W5UA 1OK6A 4LNCA 3UG5A 3AU2A 4JN7A 3B06A 2Y5EA 3E0IA 5AHIA 1NF0A 3R1ZA 1X97A 5I78A 2XM1A 3IRSA 4MWAD 3G1HA 2IQDA 2WZTA 1O95A 3O1NA 3GDBA 3S42A 1M7OA 1I2NA 1JF5A 1GQLA 2NV2A 4GXPA 3TUUA 2PDNA 4F0KA 2PWDA 1K7FA 3O9NA 3JW7A 4JXCA 3UZYA 5F7UA 5IFTA 1IR1A 3WQOA 3ZT6A 1G01A 2QJMA 1UZHA 4HD5A 2E7FA 4IJCA 5I3FA 1AQHA 3CMFA 2QXWA 3P82A 1ME8A 2PCEA 3BCDA 4ZSTA 1R2RA 1CB2A 1QCWA 1R30A 2NXGA 5CSSA 2ZRVA 3IJ8A 2Q8LA 1KFWA 2C8NA 1Z6KA 4BQ5A 3V1HA 5D02A 1ZBCA 1KCXA 2PC8A 2OX1A 1QNQA 1R6WA 2C1IA 3OU8A 3KBJA 3SCOA 3WF3A 3TX9A 2YX0A 4C6KA 1HVQA 2WVTA 1KBBA 4AZHA 2DVXA 4D9PA 1R2SA 3UA3A 4O0KA 2C91A 3MKVA 2CPUA 3WK2A 4CCDA 2JF6A 1TE6A 2ZRUA 5FJJA 3PG9A 4XZ9A 3QF0A 3G1SA 2ZUVA 3S83A 4I5RA 4CGTA 4DIAA 4JHMA 1GGOA 3HGRA 3NQ6A 3A13A 1DYSA 5D8WA 3OHMB 2FLIA 5D2WA 4XQ6A 2G97A 1RK6A 1TFVA 2VRKA 4ICMA 3DU0A 4Y9PA 3GFXA 1Q2RA 1GW9A 4HZ7A 4IXHA 3TN6A 2QCMA 1XH1A 3BK0A 4I6KA 3DIPA 4JQ4A 4AD1A 2C7FA 4RV3A 1WX0A 3UXDA 3AHZA 4QX4A 1JCLA 4FIQA 2OU4A 2FZ8A 3BJSA 3RIKA 3A22A 4PSRA 4PTWA 1IIGA 1G69A 1GJPA 1NAL1 3FCPA 5FL0A 2ZXDA 3WELA 4LC6A 4EAYA 3OGRA 1SU5A 3P60A 3BMVA 3TR2A 2HJPA 3HM7A 4K2SA 2QCNA 3QFEA 1NQKA 1FXPA 3PWIA 3W76A 3M7SA 3SQLA 2AQVA 4K38A 2NX1A 4UFMA 3LHUA 4PL2A 4DN1A 3GTIA 4CQAA 1S3HA 2VP8A 2HQAA 1VFOA 2EO7A 4FLSA 3BLFA 2I5IA 1J9YA 2XIJA 5H1WA 1P0DA 3KLKA 2C1HA 3SUSA 1FP9A 4OBSA 1M9HA 4H9VA 1N82A 3V3WA 1KA9F 3C4UA 3IJLA 2GVGA 3MSDA 2H9AB 3VOHA 1EJ7L 4R9OA 2A7RA 3L4ZA 3DH7A 3GIPA 1AFSA 1W5OA 3RR4A 4LANA 2DIEA 4DY1A 4W87A 1QMLA 3WQ4A 3FJNA 2WW5A 1MW3A 3AZSA 5HPOA 3FX4A 4UBPC 4AZCB 1AH4A 1EDTA 5AVHA 2WBGA 5HANA 3MPGA 4LCRA 2HVNA 1LRTA 3CGTA 4OHQA 5CJNA 2RGMA 5KZ6A 4BJHA 4LUTB 3H7RA 1VEOA 5DMMA 2WMHA 3UZ5A 3F5LA 4M80A 1XIHA 4OECA 3TMLA 3DI0A 1QATA 2DGAA 1SJCA 4U3AA 3O16A 2HRWA 2QQ6A 1IEQA 2C71A 2W92A 3VOJA 4C1LA 1EJVC 5EMUA 1Q6OA 2X0YA 3P93A 1JIBA 2GSJA 2NUWA 4RR4A 3DCPA 2TMDA 4JEJA 1ZZMA 4L64A 3W7DA 1KM4A 3UXLA 2DH2A 3LHWA 4OGZA 4KPLA 1PTAA 3E2SA 4QE5A 3U2CA 2ALRA 3V35A 3U3HA 3VGFA 1MEWA 3VZZA 5M5DA 1FHUA 4H6KA 2XH0A 2VT0A 3F1QA 4O14A 1BG4A 3BCJA 1XIGA 4LUSB 2CBIA 2EPLX 2Q3RA 4X9SA 1FDYA 4OBTA 2X1TA 3GWQA 5HDRA 3OVPA 4QAIA 1KRMA 4QM1A 4AF0A 4JTGA 3BSGA 1QPRA 1Q6DA 3WUBA 1Z3NA 3CO4A 2HBVA 3CH9A 5A6SA 3N4FA 2WV8A 4PUKA 1XPYA 1E6SM 4GI6A 4FO4A 4QE1A 5AKQA 1BVNP 2CLMA 3N9KA 2D22A 4XKMA 1LQAA 1XS2A 1PYFA 5LIUX 3HURA 1I75A 1FP8A 1GPWA 3PZ9A 3PZQA 1XCFA 3BGGA 1ENUA 3MMUA 2EEXA 2V5CA 4WSHA 1DWIM 4MWAC 1PX3A 4CD4A 3D3AA 2H8ZA 4RZ5A 3LMYA 4XSMA 4LW7A 1UKPA 4LSBA 1U83A 3H4WA 4PRWA 3CASA 1NEYA 1RJPA 1FWDC 1UG6A 4GJJA 2PC4A 4CNTA 3W71A 5M17A 1G0CA 1UASA 4PRRA 3FA5A 2OSWA 5HMDA 2W63A 2CZDA 1H1NA 2Z2AA 1V79A 4G7EB 3AFBA 1EJSC 3GIQA 4DJEA 2DZVA 2XU2A 3A47A 1TVNA 1F6YA 3WLSA 3CL8A 3AWOA 4LALA 3FAWA 4HNVA 3H2OA 4ALDA 3MUZ1 1I1XA 4ZA0A 3G5EA 4CU7A 4LJ3A 2HE5A 3NQEA 3B8IA 2A6NA 4JD4A 3BJTA 3HV9A 4ICNA 2CLHA 4FK9A 2ODOA 1GTHA 1ICPA 3SQMA 1D7FA 1Q6RA 2GLKA 1UQYA 1TREA 1VJIA 5C8BB 2YA0A 3BG9A 1OG0A 1WKEA 1XDMA 3PSVA 3HPFA 3VI2A 1ZP4A 1XX1A 1H7NA 2WC7A 4E3TA 1BYDA 1YXDA 4LC8A 4UOQA 1VHCA 1U5VA 1E15A 4FPSA 4PCTA 1JG9A 3NDYA 3MTWA 2O9PA 5EFDA 4HGXA 1MMFA 3D3FA 3G1DA 3GR4A 4JFSA 3VNJA 3CZLA 3P61A 4HU0A 1SW0A 2GPTA 4MJZA 2V81A 5LIYX 4KRTA 1HQTA 4YL2A 3WLMA 2YBVA 4HNOA 1A53A 3ZWSA 5GNXA 2G96A 2ASHA 2BFGA 3CMGA 3N9SA 3V0SA 4DZAA 4KWVA 3WX7A 2I9UA 3VCNA 5BU6A 4M6QA 1E4IA 1UJQA 4K1GA 1YPFA 1JUKA 1CXIA 2FDSA 2GUBA 3L0GA 2GYIA 3PZOA 1UPMB 4HK7A 3IGUA 3VIHA 1WPCA 2E40A 1UR9A 1Q7ZA 1R87A 4CD6A 4FB7A 1JDDA 4W9TA 1V03A 3RO8A 4DO5A 2Y5SA 3WJSA 1HGWA 2J75A 2X1SA 3FKKA 1KFCA 3SCWA 2WKLA 1GVOA 3MSRA 4JTJA 4WKHA 4H9MA 2Y24A 4HZ6A 4E2DA 1LQ0A 2E1DA 2Z28A 4LUJA 1IQ8A 2W91A 1KV5A 3WJXA 4X3ZA 5M03A 3CQ0A 3QV9A 1D2KA 1YPXA 1NF7A 3HG5A 3R89A 3TQKA 1C91A 3G1XA 2VKZG 3ARXA 1FWIC 2ZRZA 3HU7A 1X8CA 3QLDA 4FX6M 4G2DA 1JGIA 4XISA 5DMLA 2WK2A 4DWSC 4BA0A 3GH7A 2DZSA 1XUZA 4H9XA 5ABFB 1EOMA 2G0WA 1PTGA 3VIKA 1KFBA 4BKNA 3OLGA 2GGIA 1OY0A 3R5EA 3H21A 1D9EA 1H63A 3UWZA 3L0KA 2ZXQA 2Y8VA 1HL2A 1SVDA 1LL7A 5EY5A 1WYIA 3BV4A 3H2MA 1EF2A 2C1GA 5CLWA 3TC7A 3GTNA 3NPXA 1YNQA 4GQBA 3UBPC 3T0AA 2CZFA 3EX6A 4B3LA 1K9DA 3UG4A 5AHFA 5D04C 1RJRA 3NO3A 1KRBC 3MDWA 1VCFA 4QJ5B 3B0VC 4AZ6A 5H8UA 1AJ0A 4JKMA 2QUMA 5HJLA 2BHZA 4B5XA 3T42A 2A5HA 1HJQA 2PCQA 1UOZA 4IIEA 4EP8C 1JYWA 1JD7A 2PZ0A 4UFIA 3HPSA 4GY7A 4MY1A 5BU9A 2R1LA 3A23A 1JZ5A 4JTFA 1W3HA 2FH6A 5BXRA 1PWLA 4CU6A 1ESWA 3IIVA 4DWDA 2NQ9A 1Y0EA 3WNPA 4W84A 3TCSA 4AF0B 3KDNA 2WSYA 3AMDA 4MWAE 1MFVA 3EBVA 3D5HA 2DUXA 4GH3A 5A8GA 3NXFA 3QPZA 2DQWA 4DYEA 2ZRXA 5I3IA 4IJBA 3L4VA 1K8CA 1FDJA 1I60A 1KGXA 3UERA 3RMEA 3UPMA 3T07A 2IPGA 3EOOA 1GNXA 1EC7A 3AIWA 3LRLA 4YPJA 5CXPA 3CHCA 3F4DA 2C18A 1Q7QA 5A1AA 4FNSA 2ZKMX 2GUYA 2UV8G 5IM51 3N29A 3M9YA 4GC4A 4UTIA 3TP4A 1SFJA 4PZVA 4YIWA 3GKAA 3W2JA 4MKVA 3BLOA 3K46A 2EG8A 1V08A 3WK0A 3CT2A 1CTNA 1UKOA 4JIIX 4MB4A 4DJFA 3SZ8A 4JKLA 3I3BA 4IGMA 4K39A 2GK1A 4DUXA 4QE4A 1XLFA 4AIUA 5A5WA 1JAEA 3ABSA 4MDOA 4Z2LA 3G2GA 3MANA 1TMLA 4DNMA 3S1WA 4ERAA 3W7IA 3LRMA 3LM3A 1PZ0A 2G3FA 5I24A 4LY4A 2Z1XA 1UKQA 3XIMA 1YX1A 3N6HA 3CS2A 4A2RA 4E5TA 1VYSX 2EGZA 1YE4A 2Q09A 3PZNA 1H7OA 4F8XA 4OVXA 1TR1A 1SO3A 5I09A 2TYSA 3Q2DA 4BWLC 5TAOA 4IZGA 1U2YA 3AUJA 3CHFA 4O28A 4DF2A 3P0WA 4MPKA 1Q6QA 3QM3A 2Z4GA 3GLCA 4IM4A 4E38A 1MEHA 2E5BA 3LXAA 4XO7A 4XZHA 1E1CA 4D1JA 1E56A 3M07A 2BMBA 3AYRA 1H1YA 5HNRA 4HU8A 3MJMA 1F76A 3LPFA 1MFUA 4ENLA 3ENLA 1U30A 3PBGA 3UG3A 2XG9A 3GK0A 1G7VA 2NT0A 2GUUA 1LWIA 3OBKA 4JIQA 1T40A 2BTMA 3KTSA 4GVFA 4N4PA 5HQMA 3W7LA 4I8DA 5EPDA 2X42A 1CECA 3PBUA 4PB3A 4ACZB 1JDEA 3W81A 4IICA 4U2YA 4I7WA 1VLWA 2J6VA 2HK1A 3EWXA 3T0TA 1XBZA 4QFUA 4Z1DA 4O13A 3AISA 4HKPA 3LS9A 5BROA 2FPVA 2WQDA 2OYMA 3SRDA 1KRAC 3QHNA 3RCMA 2Y0FA 2QUUA 2OZ0A 4QAWA 1W8GA 1XC6A 4KWWA 2GVYA 1LRNA 4JYFA 3BLIA 1E9IA 3CIWA 2W61A 5HMFA 3WLRA 2JGYA 4WLCA 1KBKA 1AJ2A 2EG7A 4E4PA 4JTAA 4O52A 2X0SA 1W1ZA 5LXEA 1SR9A 1W6TA 2FGBA 5HQLA 4DM1A 4IIBA 2ZUUA 3PS7A 2Q3OA 5JUVA 4C6BA 2VX6A 4ATLA 3BWWA 4YWIA 2IW0A 1L9WA 2XM2A 3W84A 4KFOA 1FHVA 2IKJA 4CD8A 1DIDA 4PBFA 4TTUA 4NL1A 4C60A 2QNEA 3MSYA 4IMDA 1PUDA 1EWDA 4L9XA 1W5NA 1QXLA 1C9WA 3XISA 1HJXA 2GDVA 2P5NA 5KZEA 2V5DA 2ON3A 4ZO6A 5C9WA 1HJUA 2BY2A 1J4EA 4Y9OA 1M7XA 3IEBA 1DE6A 1VAHA 2O9TA 3CIVA 2NLYA 3THAA 2WWDA 3WBEA 5A8NA 1V0NA 3KTCA 1K9TA 4GZIA 3R11A 1TV8A 2QV4A 3C5QA 1NU5A 3VK5A 2J25A 3C8FA 1V7AA 4HCLA 2PD5A 2OSXA 4YYFA 4B4HA 1JZ3A 1OFOA 5JXQA 1ADDA 1OZQA 4N02A 3SJ3A 1SJAA 4S3KA 1YBQA 1UUQA 1B3WA 1C93A 1CT5A 4PR4A 1K3UA 1V3HA 1M7JA 1DXIA 4NJIA 3BANA 2ZTKA 3BMWA 3S47A 4GZ7A 4MKNA 4R9XA 1J0HA 1TCMA 4A8NA 1CYGA 1OFPA 5ABGA 2JALA 3W7JA 2QEZA 1XSIA 4N6FA 3TE9A 1MUWA 2WHJA 1SM9A 3INPA 1W56A 1QI4A 3T0CA 4N6EA 3QV7A 3LX9A 5D9PA 2JK2A 3FA3A 2OEKA 2UY5A 3TYCA 1MRAA 4PFMA 3KOWA 4HMCA 4DAIA 3MUCA 3GXMA 3PB0A 3SJNA 2FKPA 1KXHA 1DWHM 4OU1A 1AODA 2FYMA 1OC5A 2ZA3A 3KX6A 3L66A 1TJ0A 4ZB0A 4R85A 3B8DA 3WEOA 1A5LC 1VRXA 4GI8A 4RE4A 4OOZA 3DUGA 3PK7A 1AL7A 2XGBA 4IQDA 2XVGA 2CZEA 5I6SA 2POTA 4MJ2A 4XZWA 5CC5A 5AB3A 3GTFA 3DFQA 4EPEC 4ZE4A 3GIYA 2VXNA 1LOLA 1PKMA 4BI5A 1TPH1 3QSRA 5CLTA 1VQTA 3FNDA 3NQAA 4ACYA 3P80A 3GZAA 1GG0A 2ISSA 3N34A 3T6CA 1DL3A 2VGIA 3F4CA 1JCJA 4S2CA 3GVQA 4B4FA 2Z1SA 4XAZA 4K37A 1JF6A 3BAXA 4XBSA 2PDBA 1TTIA 5HPCA 2W27A 4IUOA 3N2CA 1EYEA 3MKKA 3EOEA 3KOZA 3ZFHA 4U31A 3M0VA 3CNYA 1NY1A 1E1EA 5CGMA 1H49A 5E1QA 1HKKA 2QLYA 2XIOA 4E0CA 4JNMA 2VC7A 4B92A 4PCPA 2V63A 3S2JA 5I3KA 1XRTA 3LPOA 1FQ0A 2IQ0A 5G2IA 1YDOA 3Q58A 3T2QA 4IG2A 4OJYA 3KRUA 3D47A 2PWUA 4D8AA 3OO2A 1S5MA 2D69A 3UT0A 1G67A 3TYUA 4F48A 3QPEA 2F6XA 3MA8A 4BQ2A 4HJFA 1A3HA 1CGXA 1SYTA 2XGZA 2Z25A 3KBWA 3VM7A 2PWVA 4Y8EA 2PMQA 3W6MA 1JZ4A 1W0MA 4QHRA 3FKRA 4RNIA 4KH2A 4ZB2A 1WQ5A 5CPNA 3QKZA 2AMGA 1XSKA 1BXBA 4EVZA 5E5CA 4NSBA 1GK8A 3VDCA 4F79A 3NOEA 3EWYA 3RAOA 5LYRA 4QITA 1OFAA 3TVAA 3EKZA 1TMHA 3IRDA 4FOKA 3G1AA 3KWSA 1M68A 1CI1A 1DOSA 3AXIA 4PB4A 4HYVA 1EB3A 2DW7A 1G4PA 2VEKA 4GXMA 2UY4A 1E1CB 2CIPA 3ARZA 1DJQA 3DOPA 2ISVA 3ALGA 3LENA 3AHYA 1FH7A 4EIVA 1UB3A 3H6OA 4D8LA 4PUUA 2V67A 1W17A 3N2XA 1BRLB 1Q7MA 1F4HA 4I7UA 2X40A 4BCEA 3E0LA 4ZODA 4PC8A 2E6DA 4O11A 1DPMA 4IGNA 1A49A 1QBAA 1AG1O 5I77A 5KETA 3A12A 3NCOA 3NA8A 4ACZA 3LA4A 4WDTA 3OG3A 3QQWA 5E93A 3AUOA 3BAKA 4B5NA 4H7CA 4LAZA 1AD1A 2RUSA 2RDUA 4WOZA 1OGBA 1XL9A 4TOQA 4AD5A 1IV8A 2HMCA 3QHOA 3M6DA 1JEZA 3DXIA 1VP5A 3QJAA 4EF9A 4AX7A 4HPXA 1LF1A 4NQ1A 4TU1A 3CPUA 5C9ZA 1RV8A 1GTEA 4JIHA 2Q8ZA 4A6GA 1I2PA 2OZ8A 3GVVA 4HNTA 1BFNA 2DH3A 5U7SA 1HVXA 1NQ6A 1HW6A 3W3OA 3VILA 2B81A 1AW1A 1CXLA 1US3A 1RJQA 2CXEA 3REQB 2BVTA 1V51A 4WKFA 4CCCA 3O6AA 2XWDA 4G9PA 4FR1A 3L65A 1E6NA 2OYLA 1W3NA 2QUNA 2VVNA 2WVVA 3N17A 4HCHA 2DZXA 3NDZA 2X0HA 3C8NA 6REQB 3SB0A 3VGEA 3JS3A 4JQ3A 5GNYA 3HQNA 3WDQA 4Z08A 5RUBA 3GVGA 4DUOA 3S6TA 3NUKA 2C19A 1H62A 3PZVA 2NQJA 2YGYA 2ZZ4A 4X61A 4DF1A 5HOSA 2Y7GA 2PDXA 4L4LA 1Q6FA 1B3VA 1R0MA 5HAOA 2VX4A 1RCQA 5K4ZA 2QCLA 4H1ZA 4E6MA 4MJ4A 3PN8A 2J9XA 4WGHA 1MDLA 3B0PA 5EKYA 3VD5A 4B5SA 1CW2A 3M0HA 4Z1CA 3CU2A 4KFNA 1DKWA 1R3YA 1DJHA 3I6TA 4U4MA 4LCQA 5HNTA 2XYLA 4F2TA 1LL4A 2PDIA 3DKJA 2HE8A 2XH7A 4A05A 1GPFA 1LP6A 1S2WA 1E0XA 1HP4A 3NOYA 3WF1A 1CX9A 4NF7A 3O0KA 3U2EA 4DPQA 3GXDA 2XSBA 5D30A 2DY3A 4XIMA 3S46A 2NVAA 4Z2KA 1PPIA 4WSKA 1XISA 3CUXA 3CB8A 4UMBA 1NOWA 4PULA 1PDYA 3UW6A 3W85A 2ZZ2A 3L2MA 2OFJA 1S5TA 4IMEA 2A1YA 1A0EA 3OQEA 2WZMA 1TPC1 3BLLA 3L4UA 1OF6A 1WDDA 4UFLA 3VKAA 4LUYA 3H2FA 1QHZA 2NQ5A 2O7SA 3I65A 1JCTA 3I7RA 3CYVA 4FSAA 2QF8A 4C6DA 4W8LA 4H8HA 5GVJA 4XAFA 1X6UA 4L4PA 4PCSA 3TR9A 1UR2A 4MYXA 3EX3A 3FLUA 4XAGA 3BTNA 4DQWA 5IBXC 3AJ7A 1XRSA 1WXZA 3ME3A 2OELA 2V3DA 1KM3A 3KL3A 3FJ4A 3SCSA 4N4QA 3TQPA 1BXNA 4IXXA 4V27A 3TNBA 3QGVA 2Y61A 3U5YA 3R8GA 2XSAA 1BKSA 4XSLA 2E9MA 4RJEA 4C7GA 4LVGA 5I0DA 4EXAA 4DXVA 3WL1A 5HMSA 1TJ1A 2CWXA 4UTWC 1B3XA 1BAGA 3QLLA 4X0VA 4INFA 1EPVA 3WKZA 1BYBA 1E6ZA 1ONXA 4KEZA 1KW1A 1O6IA 5AC4A 5BRPA 2YYUA 4JTLA 1U5HA 4QLLA 4Q8VA 3S6DA 2BG5A 1DHKA 4C6NA 1XXXA 4W85A 5DCDA 1TZ7A 4D6GA 3LN3A 2Z27A 2WC3A 7CGTA 4DNHA 5B7YA 2EBNA 4LS0A 3NEVA 1TJ2A 1KM2A 2X09A 1E6RA 2J62A 2FHCA 1IEXA 4C6OA 1DV7A 4IPJA 4UOJA 2VZTA 2CYGA 4YTQA 3OPSA 3OYXA 4L7ZA 1EIXA 3CZGA 1DVJA 4GKTA 4HCDA 1HX0A 1V4YA 4QG6A 2YCLB 1N8IA 1HKIA 4LBSA 5HNUA 1MW1A 2O7QA 1UWAA 2AAMA 3AQUA 4IT1A 5BNKA 1UR4A 3T7VA 3LTYA 1TPUA 2VDHA 4F0MA 1PZ1A 1XLKA 4R7JA 4GUIA 1ODZA 1BWKA 4IH3A 1Y65A 3ZM8A 3TC3A 3I3DA 4NP7A 3TN5A 3CHEA 3QC3A 3RO6A 3W1MA 2G50A 3JZEA 3WDPP 4NYUA 4AIEA 1VRDA 4RLIA 1RVGA 4UCFA 2DT3A 4ZOCA 1MUMA 2BX7A 4KKXA 2HPMA 2V5JA 4CQBA 3EMZA 1GUVA 2A3BA 3VKKA 2X2GA 5LIXX 4WZHA 1K6WA 3QV6A 3GVRA 4LU0A 4FOJA 4KEUA 4C6QA 2PRHA 4QG8A 1JUEA 3DBPA 2L5HA 1KFKA 3B9NA 3C2EA 4U10A 3DAQA 3GH4A 2YFNA 1H41A 3NZPA 1VFFA 2VCAA 2WMIB 5LA1A 5LNUA 3CZ8A 2HBXA 4QS6A 1VPYA 1HKWA 4H01A 5F2IA 3ARVA 1POKA 3DGRA 4KW2A 1XLJA 3NSMA 4KESA 1QJWA 2QT3A 3HO8A 2OLSA 3GG8A 3W83A 3V5FA 3BG3A 2W79A 4JTTA 2YLAA 4O4VA 4BWLA 4GUFA 1IF2A 3T8QA 1XLHA 1KCLA 3R25A 9XIAA 2HK0A 1RD6A 2E3ZA 3DHDA 1TJRA 1QWGA 2Y63A 1GVYA 2HXTA 2D0GA 3KL0A 2I57A 3CZKA 5LHEA 3U57A 1VB9A 1XFCA 2X1UA 1KLYA 2W62A 1WNOA 4RPQA 3O0FA 3WK3A 3WUEA 1PJ9A 2VZOA 3PPFA 1VBUA 1W1B1 5LIKX 4ZZ9A 5B80A 1PDZA 1V0KA 3EA1A 4NZ3A 4QQ3A 2KX9A 3HZ3A 1L2UA 4S3JA 4NT0A 1ZBWA 3S4TA 5LIWX 4XZNX 1YMYA 4YCOA 4QISA 3VFLA 2WANA 2BOFX 4D8ZA 3B97A 3H54A 1N2VA 5CBJA 2GDUA 1HKMA 4KCWA 1C7SA 5MKGA 4QJ4B 4P8XA 3E0FA 3AWNA 3KBMA 5CGTA 5CPLA 1DWAM 1NFPA 1BVWA 1KKOA 1LBFA 4LYQA 5D38A 2J7FA 2CERA 1PIFA 2ZTJA 4H83A 5T8GA 1JRBA 4GHRA 4FX7A 4PTNA 1UWSA 3C2FA 1EHNA 1WUFA 4PN2A 2ZX7A 3H70A 3RITA 1TO3A 2E68A 3KVMA 4KFPA 1L6YA 1QWKA 4G8TA 3VUSA 1TRDA 4LNYA 3U4FA 3GXNA 1L6GA 3GNDA 3EKGA 4KWOA 1YNYA 2WAGA 3B9AA 3W6YA 4KCVA 1RAKA 1G9HA 2D3NA 4HTYA 4HJWA 4JQ1A 3WK1A 1QOPA 4FI4A 3WBYA 5JMUA 2PRMA 3IJIA 3S6OA 2OZTA 5TNVA 2Z00A 1W3KA 2OVLA 3SRKA 1SR0A 2J79A 3VMOA 5G5IA 3S1VA 4W8AA 1XSJA 1JZ7A 1OT1A 2CLKA 3UWYA 1OCQA 4G6CA 2FJKA 4M24A 4FMVA 2QCHA 2XZ7A 3HTWA 1M1BA 4NJJA 4IQLA 1WXJA 4Q7IA 4CCZA 4YTUA 3T78A 3LHVA 1LOQA 2WXDM 1XLAA 3RJXA 1EYWA 3SCNA 3FY1A 3W75A 1QHPA 6A3HA 1Q6EA 4DUVA 3RM9A 3PBMA 4J3WA 2O55A 3HMJG 1I9CB 3VC5A 1RALA 2PTDA 4JCLA 3WH9A 1FVPA 4Z2IA 1PSCA 2FZ9A 5KZMA 3EWCA 1I0BA 2XFRA 3CBWA 1TUXA 2GOUA 3T0BA 2D2JA 4Y9MA 1CENA 1JXJA 3EDDA 3DBNA 4YN5A 1KBLA 4O12A 1VBJA 4PTMA 4A22A 3GNRA 4JX5A 4WJXA 1ZGDA 3HOJA 1RQHA 1E51A 2ZYFA 1VIWA 3E2VA 4B15A 2HNHA 5FJUA 2AGKA 2ZRWA 4Q6XA 1LLWA 2R14A 3WO8A 4O16A 4DWSB 1WB0A 3BW4A 1Z48A 4G56A 1P7TB 5C5YA 4GMEA 3H4GA 5CC6A 4EWND 4GG9A 3BSHA 1JL8A 1HKJA 3M4HA 5A94A 3LBMA 2Y5JA 2V5KA 3CTLA 1WOBA 2J13A 4Y8FA 1TMQA 2W0UA 3PNZA 3UD6A 3B04A 2YDSA 3CUGA 1UZDA 1IXPA 1X1OA 1W9DM 4Z2HA 2UWFA 5A6TC 3FVDA 3EEZA 3RR1A 3OVGA 4B5VA 4C1NB 4OZOA 1AQMA 1GCYA 5JH1A 1SSGA 5BOOA 3Q65A 3EPOA 1Q6LA 3ATZA 3MW7A 2VQUA 2V82A 1PZ2A 4PMZA 5IOBA 1XLBA 2CC0A 3R10A 3VZYA 2BODX 3VIGA 3RJYA 2RJGA 5A6BA 4A4AA 3CLWA 1AMKA 3BLDA 5E9XA 2ZE3A 2AKZA 5C7VA 3ZLFA 3BZGA 1VJZA 1YLVA 3VU2A 2G3JA 3ITGA 4HPHA 2QPXA 3UETA 5A6MA 3R8RA 3VA8A 2D0FA 4UNKA 2NVDA 3DENA 4G5DA 1FWTA 3ATYA 1R8LA 4CQDA 1RZMA 4Q8NA 3SSJA 4HT3A 1R9ZA 2VR4A 1XG4A 3CL7A 7REQB 2TPSA 4CD7A 1L2QA 1V6TA 4I6VA 1GKPA 4DJEC 4MY8A 3Q45A 4ZTYA 2VEIA 4C6JA 2CESA 3HFTA 3W2UA 5D4YA 1A0DA 2YA1A 1HP5A 4AFYA 3UR5A 4WCJA 1D7KA 3OBAA 4IMFA 3VC6A 4LYPA 1QTWA 1VPXA 1MSSA 3GG0A 2ZZ3A 4IFOA 2GJLA 1NM9A 3R4IA 5FF2A 2V2DA 2GVEA 4M6PA 3TN3A 1SQ7A 3PC0A 2YOCA 1SFSA 2Y7EA 1VPQA 4C5ZA 1WV2A 1B9ZA 1R7AA 2V30A 2YIHA 3ZR6A 2MUCA 3TN4A 2DEPA 4LVDA 4ZQNA 3W7QA 1X39A 4AIOA 3ZVHA 1GVEA 3AIQA 4UNLA 1GYMA 3WNNA 4S3BA 2AL2B 5JBEA 4DJDA 2FZNA 2W66A 3ALFA 1XYBA 2WOQA 3UP8A 1UD8A 3GQYA 4AQLA 2QZRA 3BOLA 4PEKA 4DO7A 3SQSA 4UTKA 2RDWA 2FFCA 1OYAA 2I9EA 1X38A 3L7RA 4MLRA 2E09A 3WD0A 3CQIA 2J78A 3JRKA 3PUGA 3Q4DA 3DHFA 3C2OA 1AJZA 2NXIA 3C0LA 5A6JA 1EBHA 4Q6JA 3TZNA 1E70M 3C2YA 1F5ZA 1KTNA 4HU3A 3OYZA 1GOOA 2I16A 1KBIA 3VKCA 4HNCA 1GKQA 2DVTA 4K36A 4JY9A 3EB3A 1MW2A 1J6OA 4O53A 1DJWA 2Y4SA 3KP0A 2TRSA 2YA2A 2ZQ0A 1LT7A 3E96A 3P7YA 4I5UA 4DB7A 4LEFA 2X7VA 2XHYA 1M03A 3A5FA 3NO5A 3H2EA 9RUBA 1ZPTA 1KGUA 2WM0A 2YB1A 2E28A 3M6YA 4F0SA 3BL3A 3CV1A 1LBLA 1TV3A 5J5DA 2ICSA 4ZEPA 4JS3A 1XIBA 5EMMA 1HL8A 3KE0A 4WUIA 4XIAA 2Q01A 1MQRA 3TSMA 4L6DA 3R12A 3N4AA 2OWCA 1Z41A 1GVQA 1V02A 1ME9A 1NDVA 1C92A 2D23A 1W32A 1XQKA 4C5YA 1BQGA 2PLJA 1FHLA 4RDYA 1TELA 2CLOA 2HV5A 2BXYA 2ZXBA 3VPLA 3SN1A 3FSTA 1PYMA 2PD9A 4KERA 2BXZA 3ABZA 4QJ3B 2QCFA 1XBVA 5AZ1A 3NPVA 3RLHA 2WMIA 2XVNA 1ITUA 4ES4A 4C6LA 3LBCA 3NSNA 4UQAA 3VX1A 3ZS4A 4XVEA 2JBMA 1VGAA 3HJEA 1WDPA 3WDRA 4ERGA 3VIFA 3TIMA 3IANA 3WH7A 4NJKA 1JAKA 4ZOBA 3OHIA 3UVAA 3MJYA 3AIEA 4KS0A 3R6IA 1IT0A 3N6QA 1SJBA 2OQHA 3P5YA 1WA3A 3G1YA 4JEQA 2PDJA 2WVVB 1LOSA 4AC1X 2QF7A 4LUTA 3CJPA 2GL5A 4GO9A 3E6EA 4PGLA 1T41A 3C2VA 1VYPX 4NZ5A 1UPPA 1QR7A 1M5WA 1GJWA 3PP7A 3O05A 5D32A 1B31A 2YZ5A 3CUFA 3GG7A 4O18A 4GVHA 4Q4KA 4UOZA 5J04A 4ONVA 1V3MA 4NX0A 1MZHA 3GAYA 4B9ZA 6XIAA 5HR6A 2FJUB 3MCMA 4JN6A 3GY1A 4Y2WA 1HO1A 3P8JA 1E40A 1UHVA 1UR0A 3UZXA 1ZS2A 4P7RA 4KRZA 1NDZA 1BYAA 2O56A 1H51A 2C14A 2CW6A 1XIIA 3ZQ9A 2PTYA 3USZA 1E55A 3R0UA 3VNKA 5AYXA 4JOMA 4TXEA 3E1F1 3HIJA 1TCDA 3GU1A 5AECA 1KQYA 3DG6A 2V2HA 2PDKA 2DT1A 1VENA 1B57A 2DZPA 3HV8A 3QVQA 2QJHA 2VOTA 3U2ZA 4I9TA 4LVAA 4LUSA 3IUDA 3KOFA 4LUIA 4O10A 1Y5VA 3WQVA 3I4EA 5DCEA 1ZJAA 1W9UA 1VFHA 1FTXA 2CEQA 2QVHA 1X7FA 3GBEA 1UR3M 3SN0A 6TIMA 3W7EA 1OBAA 4XZBA 1PKLA 4Z0SA 2ZADA 2J88A 1GT8A 3SBFA 4Z42C 4J1OA 4H2CA 5AY7A 3I4KA 2PP3A 3AXXA 3GNNA 3NQGA 3CB3A 3SAZA 1F4AA 2F6KA 3SFKA 4FF5A 4WK9A 3KEHA 3ITLA 1QDSA 4Q22A 1EBGA 1MRQA 3FYPA 1HTIA 3TFXA 1BD0A 3PZUA 3P74A 3PAOA 1OIFA 3KTXA 5TQLA 1B2YA 5D2YA 4IP4A 3CLMA 3EXRA 4WR3A 1LCOA 3KL5A 2FVLA 2D1ZA 3VNZA 1ZBVA 1Q66A 1KWKA 5HNNA 3QYSA 4W89A 3CT7A 3RUBL 2DVUA 3HGSA 3QOMA 1E0UA 3KZPA 3HF3A 1OX4B 2EPOA 4YYCA 1MNZA 1P0BA 3FEQA 5KTLA 3E3HA 2OOGA 3ECQA 1ADSA 3TTEA 3Q37A 4WOQA 4Q7BA 4A21A 4JX6A 3WBAA 4AVNA 2DZBA 1A3XA 5K9DA 2XIQA 2XH4A 4JTSA 4HN8A 4LXFA 1K8YA 3MP3A 1W3JA 5D33A 4AWSA 3PVFA 1EA9C 4LY8A 4ADTA 2QIIA 4H7ZA 4ZGYA 2CITA 4LAOA 3KHDA 3THQA 3FHAA 4NRRA 3H2AA 4ZOAA 3CHVA 3A21A 2YJQA 1F6KA 3AC0A 5CPMA 5C2CA 4CNUA 3C2RA 2X16A 1DJNA 4DYKA 3UR2A 4O8AA 2DZUA 2OO0A 4ZO7A 3GUWA 1HKVA 2ZICA 1RD5A 4HK6A 1KCKA 1T0OA 4Q4MA 1F8IA 3LEPA 3BG5A 1C90A 4JQAA 5KZDA 2EF9A 3G77A 4QP0A 1DWJM 2Z7KA 4O8RA 2NQHA 4FR6A 3ARYA 1LRQA 5G4HC 2FTYA 4JHZA 1MI3A 2BY1A 3LHZA 2WC4A 3SCRA 3B8VA 3WLIA 3B9DA 2PLKA 3ITTA 4U3CA 3DFTA 3BURA 2OJPA 1CWYA 1ZFJA 1QI2A 4QBXA 4UIOA 3M0LA 1AK5A 4QEEA 2X41A 1JI1A 2W5FA 2WMKA 2YFOA 4M6VA 5AC5A 3SGUA 4ROPA 3RU6A 4PMNA 2CBVA 1FUYA 4O1BA 5MKGB 3TWBA 3SUUA 4XV0A 4LAKA 4J9JA 5HBFA 2G5WA 2B7QA 1XW8A 2B7PA 3WIJA 4O0ZA 3WF2A 3BW3A 3PWGA 1A5OC 3W9ZA 3PFRA 1A5CA 3WG6A 5I3JA 2P0IA 4NJGA 1ONEA 3IK4A 1XIJA 4FX8A 1XD0A 1H5YA 2EHHA 1CXEA 4UUIA 5BZAA 1ZU8A 1OZMA 3EX1A 4A29A 2W6RA 2ZUTA 2BHYA 3W6LA 1E0VA 3WNMA 3W23A 4AY7A 3WF4A 4GUHA 1R7OA 3BVJA 2VZSA 3MO7A 4Q4OA 2VWTA 5GJMA 4TV6A 1MW0A 2NUYA 1H7RA 4B3KA 4HSNA 1JQVA 2V3EA 3LBOA 3M0ZA 4F0RA 1G4TA 4X63A 3MP5A 1UR1A 3RF9A 2XVKA 3AZRA 1H7PA 1A4LA 2RJHA 5I2UA 5IHSA 4A2SA 3ZSTA 4P5UA 3A24A 4ERIA 3W7MA 5LNRA 2PP1A 4E3VA 4QG9A 5CZ0A 3U2OA 1U33A 1BSIA 3QZAA 3UNTA 2J8GA 5A2AA 4LF2A 1AQ0A 1Z44A 3M7WA 3NZRA 3CMJA 3UCCA 3WQEA 5FOOA 3JZUA 4JFUA 1ZBKA 2ZX5A 3VKJA 3QR1A 3C56A 4HNUA 1EO7A 1VKFA 4PUEA 4B16A 5LSMA 3KVJA 3H22A 5A6BD 2WZIA 2WNZA 5E9AA 1BRLA 4GQRA 4H8UA 3PJWA 3ICJA 4MKSA 3SR7A 7TAAA 1W1IE 2XN0A 2Z26A 4W8BA 2AQOA 2W4XA 5D09A 2ZVIA 4DXKA 1FFQA 3SEPA 4Y6GA 3QMRA 1AW2A 1JFHA 3WD2A 2A0NA 3W7KA 1R2TA 2P0OA 2VD9A 4L1XA 1VFTA 4K8EA 4DYJA 3FAXA 2OKTA 3PG8A 1F9CA 2VNCA 1OX5A 2DW6A 4CUCA 4M5PA 3VOIA 3LG3A 3W27A 1TG7A 3ES8A 3C0SA 2VX5A 2OLAA 1O60A 1FKWA 3L2IA 4US6A 2QPSA 1JDFA 1E6PA 2I17A 5ENLA 4HB7A 4AISA 1N7KA 3BOFA 4IX2A 4LV4A 4ZBCA 1TWDA 3OJGA 3ZWTA 3OZMA 2B31A 1EO5A 2WSRA 3DFSA 4FS9A 4EPKA 3SCTA 5FEZA 1I0DA 4ILSA 2JIEA 3MYPA 4DJFC 4UZUA 3U0HA 2ZIDA 1V6YA 2YZRA 1D3HA 3TU9A 4HHPA 4J3TA 5EBUA 6REQA 2REQA 4JHOA 4D6FA 3VDHA 4UCGA 5FJPA 5I3DA 4MUZA 2BASA 2EAWA 3M0IA 1KTCA 2VFEA 3VD9A 2OMAA 2VWSA 1RXOB 3I6EA 1QRQA 4C65A 1IWAA 3O07A 2JGQA 2A85A 1FWRA 2VHLA 4S23A 4AEOA 4HSHA 1WCGA 1IGSA 4ZQRA 1RY0A 1TZZA 2F84A 5AHMA 4FNQA 1CXFA 3QXBA 1KCZA 3W7RA 2ZFAA 3BV7A 1S2UA 2GSHA 3JVAA 2R1NA 1CGYA 3A64A 3RXZA 2EPKX 3WQFA 3B8UA 2IXVA 3LHTA 3SUTA 2VEGA 4IGSA 1OX4A 1PX8A 1F3WA 3F4WA 2SFPA 3GHRA 5FF3A 4IQEA 8XIAA 4R33A 4GBDA 5FAGA 2WBKA 2QJGA 2VRJA 5AYBA 3XINA 2WYSA 3W01A 4XVDA 4POCA 1AW5A 3LU2A 1W3TA 3O8AA 2PDGA 4O54A 3WL0A 4HPGA 2ACSA 3QPYA 1RP8A 1YHTA 1L8PA 3HFYA 5CPSA 4NNBA 2GQ8A 2EXOA 1YNPA 2GDQA 2VMFA 1F73A 2CCRA 4UTTA 4IOTA 2R24A 4AXNA 2DFAA 2YXOA 1H7WA 2G3IA 3MV11 2GGHA 3KRBA 2D0HA 4BZYA 2IKIA 3L2LA 2CKSA 3NJ3A 2PF0A 3CUHA 4US5A 4E2VA 2OYKA 2DQXA 3LZ5A 1EX1A 4JGDA <