4HN4A

Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 103
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hn4A00
3NQ7A 2RDUA 4OV9A 4GUJA 3B0UX 3BARA 3LGEA 1P0NA 4LT9A 4IX2A 3PG9A 3NL3A 3KVJA 5HQEA 5D2VA 4B5NA 3KHJA 4ZQMA 2QF7A 3NZRA 4JR5A 4ZQNA 4WOZA 2Y62A 1AK5A 1JQXA 5BMWA 2R91A 2BWGA 3W2KA 5HNRA 3EWZA 1IGSA 5H2ZA 3GR7A 4JYEA 3S5OA 1B3OA 1M7PA 3QMRA 1S5TA 1G4SA 5F4WA 3W88A 2VXNA 4JYDA 4JX5A 1H63A 3T55A 2E5DA 1K8XA 4ADSA 1QO2A 1TTPA 4KFPA 2YDAA 5IBXA 3FOKA 4L4LA 1TMHA 3H55A 3P67A 3MUXA 1VYRA 3KVMA 4PEKA 2QCGA 4UFHA 3PB0A 4O1AA 3SZ8A 4GBUA 2FDSA 4UFKA 4Z08A 3S8HA 3M6YA 4BI7A 3C0JA 1MEWA 1SO5A 2CLEA 2YYTA 3ANYA 3DFQA 2QCCA 4UFLA 1XBYA 3UQNA 5EA9A 3W1QA 4RLIA 4BFAA 3T7VA 3QF0A 4CCEA 1M5WA 4FNRA 1OK4A 3FA5A 1ZALA 4HPXA 3RU6A 4Q33A 2C1HA 1SSDA 3B04A 4HNNA 4XBSA 3W7EA 5AHEA 3R89A 2CLLA 3W1MA 1TPH1 4K7YA 4RV8A 1H7RA 1X1ZA 3LTYA 3M5ZA 4OQVA 1DVJA 3G1HA 2A7NA 1YXDA 1DV7A 1R46A 3B0VC 1TYGA 3Q94A 2QKFA 2ISVA 3F4WA 1FXPA 4A22A 3NL5A 1G67A 2V82A 1H50A 3LLDA 4UTUA 3W85A 2J24A 8TIMA 4QIUA 3PVFA 1R2SA 2A2IA 4JTJA 4YXGA 1FWWA 5FF2A 2C15A 3NDOA 3W22A 1YTKA 3A5FA 1I2NA 1YDNA 1C9DA 3LHZA 4IOTA 4LU0A 4JXCA 5G2HA 3LCWA 1J4EA 1TO3A 2HS6A 3EKLA 3W7LA 4UNKA 1XI3A 2ISWA 2JKPA 3LDVA 2P10A 2QCDB 3TNOA 1V7YA 2CLOA 2QCMA 4IPJA 5K9DA 5KZEA 2KZHA 3PWAA 3CIWA 1G7UA 3UZ5A 1IIHA 4O12A 2A7PA 2ZRVA 1SFLA 4AMAA 4DF0A 3TMLA 4OE7A 1WQ5A 3KFTA 2JGYA 4JTHA 4KKXA 1W37A 1ZENA 5HINA 4M7TA 3G1FA 1K8YA 3P61A 1I45A 4WUIA 3TKFA 3W1RA 3LTPA 1DORA 3ZFHA 3DI0A 4TMBA 2PRHA 5DCDA 2V8ZA 4MY8A 4AHOA 1QNVA 1SW7A 4JNMA 4MUZA 3NQ6A 5LZLA 3PUDA 1OFAA 1A5CA 1QCWA 4O15A 5AC7A 4MIMA 5F1UA 3C3NA 3TU9A 4O53A 3STFA 2V5BA 1KFJA 1C29A 5EBUA 1ALDA 5CKSA 1QO5A 4HKPA 3MBFA 4LVGA 2C19A 3LCIA 2W79A 4MZ8A 3W9ZA 4EIVA 1V5XA 3LV6A 1RVGA 1MXSA 5DN1A 3VE7A 3DH7A 3EX3A 1ZAJA 1TRIA 2RFGA 2QAFA 4AHPA 3W86A 1O94A 3OG3A 3B4UA 1OVDA 3FKRA 5D05A 3DKLA 3BGJA 5I3GA 2Y85A 4Y96A 1L9WA 4N4QA 4NJGA 2B7PA 3K30A 2QCDA 3P62A 3RLUA 2CZ5A 4K38A 2NLIA 1DHPA 1ICPA 3LCLA 2AQWA 2E77A 3KRSA 3C4UA 2QDHA 4A3UA 1TPEA 4MLRA 3JRKA 4HSOA 4H6KA 3TQ0A 4O50A 1Y0EA 4N9CA 1MZHA 3SR7A 1OFOA 3DBPA 5D03A 1I4NA 3CEUA 3GXTA 1EEPA 5AHLA 4EF8A 4AWSA 1I2QA 2ZZ3A 4IXXA 1HO4A 1W5NA 1DQWA 3NR0A 5HMSA 4A21A 3EB2A 1Q6QA 3A24A 2X1SA 4ALDA 5E1QA 3S1XA 1OFPA 4DQWA 3UZJA 3UYCA 1TRDA 4GUFA 1VCFA 2NZLA 3GZ3A 4JDBA 2C0AA 2WQPA 4UMCA 2B7QA 1F74A 1KBJA 3L0NA 5FF7A 4QAIA 1BEUA 1TSIA 4NNBA 1NSJA 3UXDA 5D2XA 5CSRA 3KVKA 3N14A 1O95A 3M5XA 5K3VA 1EP3A 3GDKA 4CQ8A 3NPXA 2R14A 2DZXA 3NVTA 3E0IA 4DPPA 3G3DA 3M1ZA 4FHAA 3W7IA 5D2WA 3IGXA 4M19A 4M7SA 4AWTA 2YW4A 5LHFA 1F6PA 2VFDA 3O63A 5HJLA 4DBEA 1X8FA 2YXGA 3IGUA 3IIZA 3DZ1A 4IXHA 5AOUA 2FB2A 3QJAA 1XM3A 3O06A 3U2OA 4M6QA 4CLMA 1TPC1 1AL7A 1CX9A 4AHQA 3S5ZA 3UWUA 4GJ1A 3A9IA 3NQAA 4TR9A 3ABRA 5TBOA 3THQA 3HG5A 4UFJA 1IXNA 1SQ7A 2C13A 2W0UA 4S2CA 4WOQA 3UWVA 1PL9A 4GE8A 1KV8A 2TPSA 4N9BA 5HWNA 1OX4B 1L6YA 2GVGA 4IQLA 1LM1A 4Q4KA 4AAJA 3HPZA 4IUOA 3TROA 5I3FA 1J2WA 1EWEA 2CU0A 3SGZA 4O4WA 3W7DA 3MP5A 1Q6LA 3FIGA 2X2GA 4YWIA 3KRZA 2OX1A 4NXSA 3WJWA 1R47A 3BW3A 4QQ3A 3HGOA 3RLVA 2Z6IA 3GKAA 3QC3A 3G24A 4N9EA 2ZTKA 1GQNA 1FBAA 2EPHA 1LBLA 1FY6A 3EXTA 5KZDA 4UTIA 2V81A 2E5CA 3W71A 3GXNA 5K4ZA 1FCBA 1YLVA 3HB9A 4IGHA 5I3KA 4K8HA 3LTSA 4RZ4A 5G4EA 1LROA 4XZ9A 2E5BA 3TUUA 3GIYA 1VC4A 5F4XA 3M44A 2PURA 1TIMA 1RZMA 1OFQA 3M5VA 3MJYA 1WDWA 4CCDA 4HNVA 4R34A 1FWNA 3ELFA 2ZRYA 3P82A 4GUHA 3EX2A 3S9YA 4LVFA 2AAMA 1IIGA 2V2DA 3G8RA 2YSWA 3PBVA 4R53A 1YTDA 3RMJA 4HT3A 1IXQA 5E93A 2XN2A 3HO8A 2E09A 1SR9A 1X6UA 3EWWA 1H1YA 2J88A 3OHIA 1K7XA 1T8XA 4MPQA 2FTPA 4IWWA 3CWNA 3G3MA 3FJ6A 1OX4A 3ZS4A 2JGQA 3PULA 1KLZA 3MBDA 3W1AA 3IVTA 1QOPA 2CFFA 1B9BA 1OF8A 4DELA 2FFCA 3OVRA 1GZGA 3WFAA 1OYAA 3BV4A 1F2JA 3BVJA 5AYYA 4RZ6A 1VYSX 2VEKA 1L6WA 3LI1A 3W7QA 3SFKA 1JRBA 2ZBTA 1LLWA 1F5ZA 1O5XA 1XL9A 3W70A 2GOUA 1NF0A 3W7RA 1P1XA 3NZ1A 2NUYA 2VOMA 4LVBA 4IJBA 3TR2A 2VEIA 3BG5A 2ISSA 5CPLA 3G1AA 3DAQA 1NAL1 4Y9AA 1LDCA 3OIXA 1JUBA 2NV1A 5TQLA 1Z44A 2CLMA 4IPIA 4GNJA 5HR6A 4BI5A 4XTDA 1KFLA 3EXRA 1LOSA 4JIQA 2ZZ1A 1QWGA 3G8EA 1SFJA 2F7FA 1D3HA 3BW4A 4LTSA 1PV8A 3KOFA 2PRLA 2RDTA 1W5QA 4L4MA 3PF3A 4YMZA 3UWWA 5MHBA 4R33A 1AL8A 1JCJA 3W83A 4HHPA 1S5WA 1YPIA 3EWBX 3FKKA 4RZ5A 2QJIA 5HWJA 3SGUA 3MI6A 3S5NA 3F1QA 3AJXA 4UMBA 1YDOA 3G1XA 3MHGA 4O13A 3P8JA 1VHNA 1J5TA 2BX7A 3UWZA 3ATYA 1I2OA 3GVGA 5FF0A 5FI8A 4RKAA 3W1NA 3NO5A 1B4KA 1RV8A 1JRCA 1DOSA 3C52A 2J27A 4O28A 3R12A 1ML1A 3BK0A 1KFBA 4RR4A 2VEMA 3OA3A 3W2JA 5AHMA 1MEHA 5FF3A 5AC6A 3C61A 4N6FA 5G1TA 2G96A 3EWYA 4NX5A 4O0ZA 4E38A 1JCLA 1SO3A 4O1CA 5A5WA 5L9FA 3LCFA 2H8XA 2Y7EA 1HTIA 2ZZ2A 5L6UA 4LOCA 3NL2A 3MHFA 4LVDA 4ZQCA 4O1BA 5AHNA 2J9YA 1IF2A 3HMJG 2UV8G 3UWQA 5D2YA 3ZR4A 1EX5A 4WZHA 1ZFJA 2ZTJA 4PCFA 1GG1A 1RPXA 2RH9A 1TPUA 1YPFA 3GAKA 5K9XA 4AH7A 4RXGA 1XUZA 4JY9A 4BWLC 1HL2A 2QJGA 3L65A 4WJEA 3HBLA 4FXSA 1VCGA 2NXHA 4NQ1A 3NGJA 3WK3A 2V0TA 3SW6A 1SZNA 2GQAA 4PL2A 3HQ1A 3TAOA 1EP1A 1H7XA 3KXQA 3QQ0A 1I2RA 4HPJA 5AHIA 1LORA 5FEZA 4EOUA 3HG2A 4UTJA 3CWOX 3TIMA 3F03K 3SIZA 3QMSA 2QUUA 3W7GA 2V9DA 4ML9A 1F7BA 1M6JA 3O6YX 1SO6A 3OVQA 4UTMA 2VKZG 2P1FA 1KM1A 2Y7DA 4WY0B 3W87A 4GWEA 1VLWA 2EKCA 1KBIA 1FDZA 4IMCA 2WNZA 3P80A 1VYPX 4NZFA 4RK8A 5BOOA 3W75A 2CLKA 3L5AA 1DKWA 2Z6JA 3CQ0A 2Z2UA 1G69A 3CU2A 4UCGA 4FIQA 1GWJA 2GQ9A 1A5AA 4A29A 3W1UA 1ZNNA 3GDMA 2X1UA 3LB0A 2G5WA 3LLFA 3HJZA 1W3IA 3TE9A 4NT0A 4MLJA 3W1XA 4UTWC 4ZQPA 3W7KA 3GNNA 3P74A 3PUOA 3UY7A 1SZEA 1JCMP 3TJLA 5G2WA 3UWYA 3KRUA 4TO8A 4I7VA 5FF4A 5C5YA 3TV8A 3WJSA 3BG3A 4FIRA 2DORA 4BI6A 3N9RA 4FNTA 4TU1A 3DFSA 3E12A 2TRSA 4FO4A 4ADTA 1PVNA 1VLIA 5K2ZA 2OCZA 2Y7GA 4RXFA 2VFGA 1O4UA 2NX3A 1SO4A 1CI1A 4AXKA 5C55A 1T0OA 2H90A 4O19A 5KINA 4LV9A 4GC4A 2ZFAA 1OHLA 4O54A 4PFMA 5F4SA 1S3HA 4O4VA 3DFOA 2A5HA 4H4IA 4QNEA 1XKYA 4JY8A 1DJNA 2AGKA 1TQXA 4LUJA 4ZZ9A 2EAWA 2CZEA 4KFOA 5D09A 3N2XA 1HG3A 1EIXA 5DXXA 4O16A 3PBWA 5FESA 4Z1CA 3PBYA 3W2MA 3BLIA 6TIMA 4WY0A 3O16A 3LOTA 2DZWA 5D04C 2VFIA 1XBZA 3UD6A 1GVQA 4Y6GA 1W54A 3BPWA 5C2XA 1UUOA 4Z0JA 3C6CA 4UUIA 3NOEA 3TSBA 3S5YA 1ADOA 1XBXA 4GFSA 3LCGA 4JIPA 3TXVA 4NJKA 2CLIA 3TQVA 3FYOA 3C2RA 2Y88A 1Q6OA 2ZZ6A 2A1YA 1K03A 4U4MA 4BWLA 4KFNA 1Z48A 3HG3A 4I7WA 4JX4A 1D9EA 5AB3A 4KWVA 5J5RA 3B05A 2XN0A 1KM5A 1RQEA 3WK2A 4NJHA 5DBUA 2VFEA 1A50A 1TTJA 2GJLA 1ME9A 3QW4B 1WAUA 3L5MA 1QPNA 1LCOA 1TQJA 2QCHA 5LHEA 1EWDA 4POCA 1KTNA 1WXJA 3VCRA 1IXPA 1PCWA 2E6DA 3LCHA 4PA8A 2A6NA 2DZPA 5K4XA 3LHTA 1DQXA 3DHDA 4H3DA 3GYEA 4X2RA 2GVLA 3L9CA 2NXGA 5HUOA 3W7CA 4QISA 3EX1A 1W31A 4R7JA 3P8IA 1L6SA 1C8VA 3H54A 3SI9A 1W3TA 1VR6A 3HGRA 2V2HA 1H62A 3LM7A 1JUKA 2GJNA 3QPYA 4LW7A 2W6RA 1K7EA 4HNTA 5AC8A 1MSSA 4LV4A 4UTTC 4G1KA 2ZRXA 3OVPA 3TA6A 5U7SA 1K3UA 1QPRA 4TMCA 2PCQA 4OU1A 2YYUA 4C1LA 4KWWA 3P81A 1H61A 4P61A 3B06A 2B4GA 4RX0A 3HIJA 5KSWA 2WPBA 5I3HA 3O15A 3Q37A 3G0SA 1R2TA 3IRDA 3UXAA 2Y89A 5J5DA 1LOLA 1T99A 5H91A 1UCWA 2TSYA 4UTWA 2O7QA 2R8WA 1LRNA 3LRKA 3L0KA 1FCUA 4AB4A 3L67A 4DXVA 1B57A 2J9ZA 4K6AA 4M5PA 1HO1A 5C54A 3JS3A 3Q58A 4FNUA 4JTEA 1G4PA 3UPWA 1OFBA 3CHVA 1R2RA 2ZZ4A 4NJJA 1TV7A 2Y63A 4JICA 2FPVA 1ZHAA 3DGRA 2EGZA 2BZNA 5A8GA 3G1DA 3G22A 3H53A 5GVJA 3B03A 2JKAA 2JBMA 2VC6A 3O07A 4IMEA 3STEA 4UNLA 1OX6A 3DFPA 4MFDA 1LRQA 2OT0A 2DZVA 4LNYA 3QEZA 2XN1A 4NJIA 3DU0A 4YL2A 3NG3A 3OBKA 3LERA 1XXXA 1VRDA 5KMYA 1G4TA 1FCQA 4OBTA 4O8RA 1OK6A 2DJXA 3MP3A 1G6CA 4IMFA 1PS9A 4HNUA 3R13A 3NPUA 4UR7A 5LKYA 1VJIA 1XDMA 2ZRZA 2NX9A 2DJLA 1UJPA 3IIXA 5HWMA 1H7WA 4JYFA 3ZWSA 2ZZ7A 3TDFA 5EL1A 3V1PA 2X30A 3MYPA 4C1KA 4ORIA 4MY1A 1W3NA 2DP3A 4X22A 2C6QA 1N55A 1W0MA 1EPXA 1TTIA 5EY5A 3L66A 1GVOA 2CLFA 3TMQA 4X9SA 1QPOA 4XWUA 3W7NA 4DEFA 2X16A 3GKFA 3CB8A 1XUUA 3L0GA 3TH6A 3IEBA 6ALDA 3NQFA 3NQGA 3ATZA 1ME8A 4XQ6A 4NNCA 3LHUA 1W5PA 3NQVA 3W2UA 3O8AA 3ABQA 3EWXA 3I68A 1KFKA 5F2MA 2H3BA 3DXIA 1VH7A 4LUIA 2OZ0A 3NQDA 4YLWA 5CG7A 1UASA 4WY0F 3NQ8A 3OEXA 1OABA 1W8SA 4OV4A 3O05A 3MYOA 5KITA 3P5YA 4ZQOA 1OFDA 3NQCA 1JUEA 1AG1O 1FDYA 4QM1A 4E2DA 3DFTA 1WA3A 2WNNA 1KM0A 3W07A 1VHCA 5DY3A 3C2VA 3CM4A 5DCBA 4NZJA 4MOZA 3O6DA 4S2BA 4OWGA 1HUVA 1LRTA 1TJPA 1SZGA 2CW6A 1JR1A 1M7OA 4XKYB 1YYAA 3LI0A 4LRTA 1WV2A 3S6DA 4YCPA 1Q45A 3USBA 2V2CA 4DO5A 1ICSA 3DI1A 5G2IA 3TSMA 4OGZA 3W23A 2A21A 2QUVA 1WOAA 1GYNA 4UTTA 3W7HA 1RR2A 3NEVA 2YCEA 3LV5A 4ZVJA 2YPIA 3EEGA 2Q8LA 5EPDA 3SSJA 1GVFA 1LTDA 1SU5A 1FWTA 3CEPA 1H7NA 4IX0A 2I1OA 4U28A 4GUGA 1FX6A 3RFAA 2P0OA 4AF0B 2OMAA 2WSYA 2A7RA 2YFOA 1ME7A 3GDTA 1O5KA 1ZAHA 1YXCA 3G1SA 1P0KA 4Z1AA 1XCFA 5K9CA 3EWUA 2NUXA 1THFD 1GOXA 4NU7A 4N02A 2E6YA 4X3ZA 4Y90A 3U6WA 3MP4A 3MHUA 1OYCA 1LOQA 2ZA1A 4FNSA 3NAVA 3LRMA 1T96A 4UFIA 4CQ9A 3TW6A 4ZMGA 2H6RA 4FX7A 4HN4A 1A53A 1H5YA 3NPVA 2Q3OA 3M41A 1ZAIA 4OHQA 4QJ1A 1GVSA 2YW3A 4BF9A 5G5IA 4K39A 2ZDRA 1H60A 4Q32A 3IVSA 3NM1A 4ICNA 5AFDA 4DO4A 1GPWA 3HG4A 4FB7A 5LNSA 4W9TA 3NL6A 2H8ZA 4XKYA 1AW5A 4LS1A 5K7JA 3I7RA 1W5MA 3BLEA 1TPDA 3RK8A 1JJKA 2WV8A 3S1VA 3M43A 4K7VA 2PE4A 3G18A 3N2MA 3VE9A 2VENA 1L2UA 1OJXA 3GLCA 3L21A 2C18A 3W7MA 3O6CA 3M16A 1YXYA 1KM2A 3IIVA 2A0NA 4Z1DA 1GYLA 3QQ1A 3TFXA 3S42A 4AF0A 4S1FA 3N9SA 2GPTA 1PCKA 2E6FA 5LNRA 3W2LA 3HGJA 3MW7A 2X1RA 3FFSA 3EXSA 1XBVA 4RJEA 3PM6A 2VFFA 3E9AA 2QCNA 3M0ZA 5KZMA 1GVRA 1Q3NA 1LZOA 2ZYFA 3E02A 5U4NA 2Q8ZA 1VPXA 1B4EA 2CZFA 3KAOA 1JCXA 5D37A 1U83A 2C14A 3EX4A 5AN7A 3RNDA 5DELA 1H7OA 1SUXA 3L68A 5AHFA 1WBHA 5E0KA 1RD5A 5G1YA 5G4WA 3QSTA 4PTNA 3INPA 4ZL1A 3S0CA 2HMCA 5AYXA 3G1VA 1P4CA 3BW2A 2ZA3A 4Z1BA 4O18A 3IIPA 3W1LA 1YDVA 3PAJA 4OT7A 5EKYA 3P60A 3MWAA 1XC4A 4CCCA 2ABBA 3VNDA 1QPQA 5F2GA 1NF7A 3AO0A 4I7UA 4N4PA 3UNDA 1OX5A 5TIMA 5BRBA 2B0MA 3QSRA 5LNUA 1HFBA 4O10A 5CPNA 2FB3A 1TV8A 1NEYA 2Y6ZA 3FJLA 1N8FA 3C2EA 3A23A 1Q6RA 4FEZA 1KW1A 3WK0A 4YCOA 4ADUA 1PIIA 4BR1A 4J9JA 4RCXA 3W7JA 4XUGA 1VCVA 4LRSA 1PE1A 3O1NA 4N6EA 3TAKA 5IM51 1LLZA 3MI3A 2RDWA 3A21A 4FX8A 2NUWA 3T78A 3TX9A 4GRSA 4MJZA 4ONVA 1GT8A 2BXVA 3HPXA 3PUEA 1TB3A 3W2NA 3QZEA 5EMUA 1TTQA 2X1TA 4LVAA 2FLIA 2I14A 2YR1A 3R2GA 3NNTA 1NVMA 3C56A 1VGAA 2HS8A 3HGSA 3TK7A 3G0UA 1G7VA 3DKJA 1ICQA 3FLUA 3QPZA 1H7PA 2IQTA 1FWRA 1VS1A 2PRMA 3GB6A 3GX9A 4MYAA 1U5JA 4A2SA 3BO9A 4UTLA 2ZQ0A 2J9XA 1XFBA 4O57A 1VQTA 3TXZA 1N7KA 3GDRA 2OT1A 4MZYA 3NQMA 3UPBA 3MMTA 5LNWA 1YTEA 4E2BA 3TC6A 1P5BA 2QJHA 4ZQRA 3TQKA 1ONRA 4K37A 1OFEA 2A85A 2NX1A 4AEOA 3W7PA 1QR7A 2PC4A 2JK2A 4CQAA 3TC7A 3FS2A 3GAYA 3C2OA 5I3JA 2B7OA 1KM3A 4LWWA 1F76A 1KM4A 1PHQA 2HSAA 2NWSA 3N73A 4K8EA 3A22A 3SJ3A 3T4CA 1OYBA 1QDSA 4FNQA 4FF7A 4PL1A 4MY9A 5D2TA 1QAPA 1X1OA 4JTGA 1AMKA 4UC5A 5LGZA 3BG9A 2QDGA 3GK0A 3KX6A 2QCEA 1YADA 3PY2A 3SY5A 3W7OA 3N19B 3LBCA 2BTMA 3PBUA 4JD4A 3EKZA 3WK1A 1ZY9A 4NX0A 3B0PA 2GVJA 4HIBA 2V30A 2ABAA 4FXRA 5BMXA 4CNPA 2VELA 2BLEA 3C2FA 4LY8A 2ZA2A 5DBTA 2RHGA 4FX6M 3I6RA 4EF9A 2NV2A 3R8RA 1TPWA 4LS2A 3LRLA 3L2IA 3LX9A 2ALDA 1Z42A 4JEQA 1GG0A 4PODA 3HF3A 5D38A 2OJPA 3F4NA 5LSMA 4NUWA 2GUUA 3N34A 3VI2A 4K36A 1Z41A 4JTTA 5CZJA 1UUMA 5EYWA 3NM3A 1KV5A 3CC1A 1K02A 5D32A 4CNOA 1KTCA 1SPQA 3V75A 2TYSA 5KTLA 2Y7FA 3BGGA 3S1WA 1EP2A 1FQ0A 1MEIA 2QCLA 1BTMA 4MZ1A 3E96A 1JQVA 3TCEA 3LBMA 3LHWA 3PC0A 5HUPA 2WSRA 5CPMA 3QW3A 4O11A 3I7QA 1SW0A 5DLCA 2FPYA 3A5VA 5FEWA 2DZSA 3BLFA 3LXBA 4MVAA 4QITA 2A6LA 5BW6A 4QNWA 3E49A 1OG0A 3GXPA 5I3IA 4JS3A 4IMDA 4BK9A 4E0CA 1QMLA 3IIOA 3TSDA 3IGSA 3T40A 2A4AA 3L5LA 3LXAA 4XBKA 3STGA 2G95A 1JVNA 3P84A 5D30A 3RF9A 2CZDA 3GR8A 3HOJA 3M7WA 3STCA 3LHVA 4JTIA 1E51A 4UXDA 2YX0A 4MFEA 2V5LA 5CZ0A 2ZRUA 4O52A 2ATSA 2QAPA 1SZFA 1WYIA 3NA8A 2QR6A 1UB3A 1SW3A 3QRHA 2D73A 5CZTA 1DL3A 1TCDA 2O7SA 4JGDA 1S5VA 1EUAA 3N3MA 4JTKA 3W3OA 1TPFA 1LYXA 1F73A 1JCYA 2VEPA 2TMDA 5BNKA 3GNDA 1DJQA 1EB3A 1SSGA 2DU2A 2CLHA 1EUNA 1KFCA 2JKEA 4QSHA 4WXYA 2FQIA 4JTLA 2CWNA 4EVZA 2NWRA 2EF9A 2Z0IA 3YPIA 2WNQA 4IMGA 1GEQA 1X7FA 1H1ZA 3WJZA 1W1ZA 2Z1BA 2BSLA 3NYZA 2DZUA 4JTUA 2WJZA 3T44A 2E68A 3LXCA 1AW1A 2QEZA 3LCXA 1R30A 1JULA 5HR7A 4GUIA 4Y8FA 3CTLA 1WX0A 2WKJA 3ABOA 3ZWTA 4FNPA 3I65A 3JR2A 3W1PA 1FWSA 2WSQA 1EA0A 4M6VA 4N9DA 1MO0A 1FXQA 4TIMA 3NQ2A 4DPQA 1I2PA 2R94A 3C8FA 2C3ZA 2FIQA 3UY8A 3WJYA 1JCNA 4M6PA 3QM3A 3W1TA 2YFNA 3IV3A 2FPTA 3W84A 3FEMA 4NNAA 4UMAA 5HULA 4MYXA 1QOQA 4A2RA 5FEPA 4JX6A 3M5YA 1F05A 3PSWA 3W74A 3MI2A 2LLEA 5F2IA 3PSVA 4UR8A 4WD0A 7TIMA 3PS7A 4TX9A 3SECA 3FYPA 2ZZ5A 3CLMA 1AW2A 3THAA 3G0XA 3VFLA 3PG8A 1K8ZA 4AWUA 4PH6A 4UTKA 5IBXC 1BWLA 4UTHA 1KFEA 3HPSA 3W72A 1ZJIA 1F6KA 1GTEA 4JN6A 1G4EA 4LS0A 3U8GA 1WOBA 4DO6A 2WOQA 3KVLA 3R5EA 3QH2A 1OFRA 1KA9F 2VFHA 3P5ZA 3PB2A 4MJMA 3B8DA 3D0CA 5C6MA 1I8JA 1PHWA 5CSSA 4D2JA 3NQEA 3PR2A 3DENA 1DBTA 2C16A 3I7SA 4CNNA 1LBMA 3Q2DA 5AYZA 3S1UA 1OF6A 3ABSA 4WX2A 3IVUA 1LBFA 4LC8A 3LHYA 4Z0SA 5CZSA 4UIOA 5D33A 2NXIA 1KTBA 2RKXA 5DCEA 1IXOA 2F84A 2E6AA 2H3DA 1O60A 4JTFA 4P2VA 3M9YA 4WQ6A 1ZCOA 1W5OA 1H51A 1VZWA 1WBJA 5DXYA 4O17A 5LNVA 2J6XA 3W76A 1TJRA 1BKSA 3W6YA 2Q3RA 4N2YA 1TPB1 4AVFA 1LP6A 2Y70A 4O0KA 3DFNA 3QMTA 4NXKA 2ATMA 1A5BA 2ZCGA 4O1DA 5F1VA 3CPRA 2HTMA 3QYQA 1FUYA 2EHHA 4JTSA 2G97A 4GXMA 2I9EA 1XDLA 3EX6A 4DF2A 4O14A 1GJPA 1A5SA 1TPVA 3CT7A 5FEXA 1TREA 4PC8A 2FJKA 2XFWA 1BWKA 1KLYA 5CPOA 4WXZA 5T26A 3NXFA 5LGXA 3MO7A 4MKNA 4NVTA 5DY2A 3WJXA 5D02A 1CW2A 2E1DA 1QFEA 2QCFA 2YGYA 3W73A 2ZRWA 4LC6A 3TW7A 5ABTA 5F2LA 4JDYA 1FDJA 1RQHA 4DBDA 3P7YA 2GQ8A 3VKJA 1GTHA 1RQBA 3CIXA 3TFCA 3DHFA 4DF1A 2Y61A 2B7NA 2YZRA 5CGQA 4EWND 3TJXA 3G1YA 3M47A 3NPWA 2WO5A 1KM6A 1TV5A 1D3GA 4UFMA 2DZTA 2QUTA 3GDLA 4ORMA 5SWUA 3QFEA 1UBSA 4I9AA 1K7FA 1FCVA 1W56A 4HSNA 4XTIA 1NFBA
chains in the Genus database with same CATH superfamily
3NQ7A 3WQFA 2FTWA 4OV9A 4GUJA 4LT9A 4IX2A 4GFIA 4LEQA 1ECQA 1VBHA 4PMOA 4P8UA 1Q4WA 3WF0A 1GVYA 3TQPA 4AQLA 4ZQNA 4WOZA 2YOCA 1AVAA 2BWGA 3URBA 3L2LA 1XX1A 1IGSA 4Z2JA 1EOMA 3AZRA 2BVWA 3UFYA 3FA4A 3W88A 5LA0A 1H63A 3ES8A 2XU2A 3K46A 1FOBA 4MWAE 4L4PA 3BCDA 2XISA 4PBGA 3H55A 2ACSA 2Q09A 3REQA 2WPGA 1VYRA 4NZ5A 3ZT7A 4UFKA 1AH0A 1XRTA 1WDSA 2YYTA 3DFQA 2QVNA 4AY1A 1C93A 4MNJA 1M5WA 3VCCA 1EPVA 3FA5A 2E8YA 3AHYA 1ZALA 4DJED 3DCPA 3H4XA 3VNLA 4NP7A 1XIBA 2PLKA 1O6IA 4P5UA 2INFA 4EAMA 2OZ3A 3EB3A 4K7YA 3ZOAA 1YIXA 2CXGA 2EJAA 1DVJA 2A7NA 1E4MM 3VM5A 1DYSA 3AWNA 1KCXA 4UR9A 4L6HA 1EHNA 3F4WA 1XIIA 3NL5A 1G67A 1H50A 1EJVC 2Y8KA 3W85A 2J24A 8TIMA 2JIEA 3AOFA 1J9YA 4JTJA 4ES4A 4YXGA 1FWWA 3NDOA 1IYXA 3ZLFA 3K4DA 1F4AA 3V5OA 1TO3A 4GJIA 1XI3A 3GC4A 2JKPA 3AISA 4XZLX 2HVNA 3TC3A 4W85A 3TNOA 3CAQA 2A3AA 2C7FA 4I8YA 4IPJA 4HPNA 5KZEA 3CV7A 1QTWA 3U2EA 1WB0A 1RJPA 3UZ5A 1IIHA 5ENLA 2A7PA 1SFLA 4DF0A 3ENLA 4O8AA 1WQ5A 2O4MA 3WQVA 3KFTA 4X0VA 4TTGA 1XYCA 1W37A 2G4FA 1ZENA 3R43A 4H9VA 2E25A 4LANA 3G1FA 3LSCA 4WUIA 3TNBA 3ZFHA 3DUGA 2V8ZA 2WLZA 1E6ZA 3ZVHB 4XAZA 4HZMA 1SW7A 4JNMA 4JQ4A 3BZGA 3S3GA 3CQJA 4MWAB 4DUOA 4QBXA 1QCWA 3HTWA 2W66A 5AC7A 3GZAA 1GJWA 3C3NA 3TU9A 3STFA 1OC6A 1C29A 1X38A 1UZ4A 4R7WA 3BSGA 4AC7C 3LCIA 2W79A 2P5NA 1V5XA 3RIKA 5HANA 1J18A 4HGXA 1MXSA 4Q7IA 3DH7A 4P8VA 3TN3A 1ZAJA 3UJSA 3W86A 3APYA 3NUKA 3DKLA 2D2OA 3M0XA 1P0EA 1Y5XA 4S3EA 2OSWA 2R9RA 3HV8A 3K30A 3FW6A 1SJDA 2QCDA 2CZ5A 3SADA 1ICPA 4V33A 2G3MA 5JQ9A 3N3TA 3GG7A 4MLRA 3JRKA 2YL9A 4H6KA 1UPMB 4O50A 1J0IA 3VOHA 5JIPA 1Y0EA 3U4FA 3DBPA 2PDLA 2ZUTA 5HJXA 4DM1A 3CLWA 4W4QA 1DQWA 3IUDA 3EB2A 5ABFA 3SY1A 4B2DA 1QWKA 1KBBA 1O5QA 1E0VA 1X97A 3UYCA 4ZFCA 4EAYA 3CHCA 2J8FA 3A13A 3CWHA 2C0AA 3W37A 5IOBA 4UMCA 4CN4A 3WH9A 3UCDA 3N14A 3POHA 4CQ8A 4NI3A 2AL2B 3ERPA 4JTRA 1IT7A 4Q22A 2VQTA 4C5YA 3GD6A 1TE6A 3LEPA 5DRIA 3SQLA 4XIAA 1EBGA 4DNMA 4WDXA 4CN1A 1BKHA 5HJLA 2BY3A 4S3BA 4J3VA 1EFZA 3IIZA 4I6VA 5LIWX 3QJAA 4PUNA 3ZSSA 4XO6A 1HJUA 3M0VA 3D6NA 4UOZA 4S3CA 1EZWA 1IXNA 3AQUA 2BV9A 4S2CA 3R1ZA 4D6FA 4KCWA 3WBAA 2ACRA 4N9BA 4REQA 2O9RA 4M1BA 5M2FX 1LM1A 2OO6A 5BYWA 5H8MA 4QEEA 1R3RA 3I4KA 1AQHA 3SIMA 3MCNA 2H9AB 4IUOA 1QW7A 4HD5A 5I00A 2Z1SA 2BHZA 4JQ2A 3HA1A 3SGZA 4O4WA 3W7DA 2XVNA 4J1OA 1Q6LA 4OOUA 2PDBA 4NXSA 4RDZA 3RLVA 3GKAA 4XZIA 1FY6A 1Q6FA 3ZIZA 4HYVA 2V81A 3GXNA 4IGHA 4EANA 4K8HA 1F07A 3H21A 4HZ8A 5G4EA 1LROA 5IFTA 3TUUA 4KCTA 3MJYA 1XGDA 4CCDA 4BHYA 1FWNA 3CTTA 2Q02A 2A3LA 2C8NA 3EX2A 2GSJA 4LVFA 1JPDX 3IANA 2AAMA 2V2DA 1W9PA 4H6EA 1QBBA 1YTDA 4S38A 3RMJA 3HPAA 4HT3A 2V63A 1IXQA 2XN2A 1NFGA 5J04A 1EJTC 3QXBA 3OHIA 4JHMA 1XISA 5CZKA 2C91A 1T8XA 4MGGA 3W0KA 3TWBA 3RR1A 1UIOA 1MQRA 3B4YA 3VTRA 1LWIA 3WNMA 1FWBC 5AYBA 1OX4A 5HA7A 2V5JA 2E28A 4HBKA 1QOPA 2Q01A 2FFCA 3OQ8A 3WFAA 3BV4A 4HZ7A 3LI1A 3SFKA 4ZOAA 1KNWA 4JTDA 1XL9A 1NF0A 4LVBA 1Q63A 4Q8PA 3B40A 3BG5A 2ISSA 5CPLA 3G1AA 4X61A 1EDTA 3H2AA 1B90A 1NAL1 4LAMA 4Y9AA 4Z2HA 4H83A 3AIWA 1JUBA 2J75A 2NV1A 2ZX8A 4G9PA 3NJ3A 4XTDA 1KFLA 3EXRA 4S3KA 3WDRA 4G8TA 3CK5A 1VEMA 1QWGA 3G8EA 3ZVIA 3CQHA 2OLAA 1W5QA 3OZMA 5MHBA 3M4HA 4X2PA 4PMYA 4HHPA 3W83A 3EWBX 3FKKA 4A8NA 5HWJA 2J7GA 4ZOBA 3G1XA 4MKVA 3MHGA 3P8JA 1VHNA 2WKLA 1I2OA 3GVGA 4WJ8A 1G94A 2GDUA 4H6QA 5JVLA 2FGLA 1ML1A 3CZKA 4GNKB 3AXIA 3WD1A 2J4GA 3W2JA 1CNVA 2CBIA 5AHMA 1YBQA 3AIEA 2G96A 2HBVA 4MUPA 4CKQA 1QT1A 4HTBA 4O1CA 5L6UA 3SURA 3KLLA 3NL2A 4LVDA 4ZQCA 1C92A 5AHNA 2UV8G 3W28A 2TAAA 4C5ZA 4ZOEA 4HOZA 4PCFA 1RPXA 1W3HA 4AH7A 1YPFA 1CXFA 4RXGA 3OJGA 1TFVA 3L65A 1PBGA 4WJEA 3PJTA 2J25A 3OGRA 1S39A 4NQ1A 3WMBA 1UKTA 1QI2A 2XH2A 2RAGA 3WK3A 1EP1A 3KXQA 3DERA 4Q8QA 1LORA 5FEZA 3RX2A 1OD0A 3BGAA 4UQBA 1U22A 3CWOX 4DIAA 3EA2A 4AZCB 3CUJA 2VC7A 4F48A 3ABXA 2QUUA 3W7GA 1RVKA 2V9DA 4ML9A 1E9YB 2DUXA 1R87A 3BSHA 5GQBA 3AHVA 1M6JA 3O6YX 4CCZA 3A6OA 2OWCA 1V08A 1LL7A 2Y7DA 4I9JA 2P50A 4UWMA 3RILA 1KBIA 3E2RA 1MDLA 1FDZA 1KFWA 2WNZA 4NZFA 3U4AA 3W75A 1NM9A 1SR0A 4OUIA 5JH2A 1J6OA 5DF0A 4RE0A 2Z2UA 4FIQA 4IJRA 3BV7A 2GQ9A 1A5AA 4Q8UA 5HOSA 1ZNNA 1C7SA 2PP1A 3HJZA 2VOTA 3RAOA 2VZVA 3OTRA 1GQIA 1ZPTA 3S2MA 3P74A 3PUOA 5D9MA 5G2WA 1SJAA 1OSEA 4UOJA 4S39A 3OODA 1D7KA 3F2DA 3M0IA 3FJ4A 4FNTA 3VIMA 3E12A 4KRZA 1XWYA 3CL7A 4ADTA 1CXKA 5K2ZA 3SRKA 4QDWA 5I3DA 3IWPA 3PANA 3WEOA 1SO4A 2WM1A 4DBSA 5C55A 1UWAA 3OA5A 3PTKA 4O19A 1JPIA 1T8QA 2ZFAA 1HW6A 1XSJA 4PFMA 2A5HA 2PF8A 3L7RA 5FD0A 4IP7A 1KRBC 2AGKA 2FHCA 4OKDA 3LPFA 2SFPA 2VL4A 3KCJA 4FR1A 4O16A 3QY7A 4UCFA 2FHBA 3TW9A 3QOMA 4H9ZA 4QG8A 3PBYA 5EMYA 3W2MA 6TIMA 2J7HA 2PZ0A 2ZUMA 5DMYA 1XBZA 3UD6A 1EHAA 1UMLA 4UUIA 1L8PA 3I6TA 3S5YA 1ADOA 4XV0A 4AD2A 1YDYA 3GH4A 4JIPA 2CLIA 2G0WA 3FYOA 1Q6OA 2RGMA 3CZGA 4U4MA 3LK6A 4HA4A 3T81A 4D6IA 3AUJA 1Z48A 2EKGA 1D9EA 5AB3A 5J5RA 5CGTA 3MZ2A 4F9DA 1RQEA 5GJNA 2VFEA 3H7UA 4KBXA 2GJLA 1ME9A 1QPNA 1TQJA 1FKWA 2OPJA 5LHEA 3OW1A 3VMPA 1KTNA 3VCRA 4Y9MA 4E5TA 3LCHA 3GW0A 4PA8A 2FZ9A 4QE4A 3U7BA 3DHDA 4HB7A 5HUOA 4UQCA 2ZE0A 2FFIA 3EX1A 1R3YA 8XIMA 1TZZA 1YMYA 2VO5A 1QXLA 3QPYA 2CERA 4JQ3A 2WNWA 2YZ5A 3APGA 5AC4A 1VFSA 3GNPA 1WZMA 4GA8A 4R7OA 4A3QA 3UXAA 4DZIA 2Q71A 5H91A 3GXFA 4FF5A 3L0KA 2QVHA 3MSYA 4AB4A 2W3ZA 2J9ZA 4K6AA 3JS3A 4JTEA 1FH9A 1KO0A 4XKMA 1ISXA 1I1XA 1R2RA 4JICA 4BKNA 3U7VA 1QBAA 3VIGA 1NARA 5FL0A 1RK5A 2JBMA 2QQ6A 2VC6A 3O07A 3HPFA 3SEPA 4UNLA 3AYRA 3DFPA 2DZVA 3QEZA 4NJIA 1XSKA 2HE5A 3DU0A 3NG3A 4NAFA 4RE2A 4AZ6A 1XXXA 4NAEA 1G4TA 4OBTA 3VKDA 1XG4A 3L4UA 4RL3A 1FA2A 3LD5A 1P6WA 1DTUA 3ARVA 1QHZA 4FOUA 4UR7A 5LKYA 1VJIA 1XDMA 4XG1A 2MNRA 4GYJA 1A80A 5HWMA 3ZWSA 2ZZ7A 2X30A 2OQHA 1KR1A 1E70M 4MY1A 2XWDA 3UZWA 1EPXA 1REQA 1PKNA 3POCA 3Q65A 4GOAA 4KT2A 5EY5A 4YVPA 3PTQA 3O6AA 1K6WA 2CLFA 4B5UA 1DHKA 1CXHA 4DEFA 1L0PA 1YHTA 2J7BA 3CB8A 1XIHA 3L0GA 1EGZA 4GXPA 1NFPA 1W5PA 3NQVA 3W2UA 1W8GA 2HNEA 2AOSA 3DGBA 1UG6A 2AL2A 3BLPX 3DBNA 3UW6A 2ZX9A 1UASA 3OEXA 1CWYA 4HMDA 4GZJA 4P8WA 2V3DA 1W8SA 3MYOA 2QZRA 2Y0FA 3P5YA 4B5SA 3KCLA 3DG3A 6ENLA 4L9YA 4QM1A 3LMZA 2DGAA 2OXNA 5DCBA 4MOZA 4S2BA 4WSHA 1TJPA 3UP8A 1JR1A 4NZ4A 4XKYB 3T0CA 4PEEA 3CL6A 3UJRA 2VCCA 2O9PA 4DO5A 2UY3A 3DI1A 5G2IA 2FVKA 3W23A 2A21A 2I9UA 4B2DD 1UC4A 1LUCA 5CC5A 2ODOA 4BF5A 1UR9A 2QNEA 2PBOA 3SSJA 1LTDA 1FWTA 1H7NA 2I1OA 1XYLA 4AF0B 1D7FA 1ME7A 1O5KA 4PGLA 3ZO9A 1PO9A 3TYCA 4B3KA 1YXCA 3ALGA 3SUTA 3VMNA 2UBPC 5K9CA 3I3DA 3PZOA 3B0YA 1THFD 3W6LA 2ZC1A 4Y90A 1L8NA 3MP4A 1V02E 1OYCA 4FNSA 2ZDSA 4OOZA 3OGVA 1XIEA 1ZJAA 4CQ9A 2OSXA 4EE9A 3KLKA 2H6RA 3W81A 3NPVA 2Q3OA 3E0VA 3M41A 2FMOA 3SCVA 4BF9A 2YDSA 1EGVA 3VDAA 3C86A 1H60A 4WKAA 3PJWA 2WSPA 3IVSA 3NM1A 3NURA 3HG4A 3TP4A 1JYXA 4DYJA 5CLWA 5LNSA 4J3XA 3A3XA 1AW5A 2XTKA 1JJKA 4NKCA 1PSCA 5C9UA 3QR1A 3CAVA 2EPKX 3M43A 4K7VA 3AU6A 3G18A 2L5HA 1GOQA 3GLCA 2ZX6A 3M16A 1KM2A 1R3QA 4YN5A 4AEFA 5C7HA 4LJ3A 3WQDA 1GYLA 3UERA 1E1FA 3S42A 2Y5SA 1S2UA 2DH2A 1Z3NA 4AY7A 3LPOA 3MW7A 9XIMA 2X1RA 3GU1A 4IM4A 3AAMA 1XBVA 5EMLA 4RJEA 3PM6A 4LF2A 3A3HA 3KUMA 2VFFA 3IAQA 4NRSA 3E9AA 4YTSA 3CHEA 1KGXA 3BJFA 1LZOA 3E02A 4JKLA 1B4EA 1JCXA 4AISA 1U83A 1J11A 3CV1A 4H8UA 5AN7A 5EMKA 4DAFA 1H7OA 5DT7A 7ODCA 3G5EA 1RD5A 1JDFA 1UHVA 4PTNA 2Z27A 1XLBA 1R3WA 2E0PA 4GYPC 3GDBA 1P4CA 1S3TC 3A9BA 1MW2A 2OFJA 4Z1BA 2VGBA 1UKOA 1E71M 1YW1A 1YDVA 1GHRA 3H2CA 5E0CA 5EKYA 2BODX 4W87A 3MWAA 4PBFA 2IQ0A 3EAUA 1LQAA 3PN8A 3RPDA 4I7UA 4AX6A 1M68A 1M53A 4RDWA 2CHRA 1Q8AA 3QSRA 4CD8A 2O56A 2Z1VA 3FJLA 3TVAA 3LQLA 3A23A 3WY1A 1V79A 4HZ6A 1KW1A 4YCOA 1A5LC 2X0HA 4PSRA 4J9JA 4MB3A 5KZ6A 4EP8C 3O1NA 4N6EA 4D8AA 3LGDA 2EG8A 3PPCA 4MTVA 2RDWA 1NU5A 1X8CA 3HPXA 3MANA 3OGSA 1H41A 3QZEA 4J3SA 5EMUA 4QCEA 1A5UA 5HNTA 2WB5A 4QSFA 1PDZA 1VGAA 3HGSA 2GJXB 4TTUA 2F38A 5CH9A 1E6PA 3DKJA 1ICQA 3QPZA 1VP5A 1VS1A 3L4TA 2OEJA 2QF8A 4ZTYA 4UTLA 2J9XA 2C1GA 3MQTA 1VQTA 1RCOB 1OIMA 4YYCA 2DQWA 4MZYA 2CLPA 3NQMA 4PMZA 3UPBA 5LNWA 4Y8EA 4QE1A 3TC6A 1P5BA 4DJFA 5FJRA 1S1PA 2VR4A 2G50A 2NSOA 3U57A 3W7PA 1XIGA 1CBGA 3E3HA 2PC4A 2JK2A 5T9CE 3DEQA 4CQAA 3FS2A 3GAYA 5HATA 3VOCA 1DJGA 3TZNA 4LWWA 1KM4A 2HSAA 1LWJA 3N73A 3MS8A 3KDOA 3A22A 4FNQA 3W53A 4PL1A 2WHMA 1AMKA 3OQEA 3FGCB 3BDKA 3KX6A 5HNNA 4W89A 1UUQA 1R38A 2BTMA 3EKZA 3WK1A 4NX0A 3GUWA 2GVJA 4HIBA 3MWCA 2ABAA 4FXRA 4CNPA 4PN2A 3C2FA 9RUBA 2RHGA 4Q8VA 3I6RA 4S3GA 4EF9A 1UZHA 1TPWA 3LRLA 3LX9A 1Z42A 2FZ8A 2WLYA 5D38A 3C0QA 5LSMA 3SJNA 3VI2A 1TZ7A 2YCJA 2GZXA 1VFLA 2IPFA 3P6LA 1XLCA 1SPQA 1BYAA 2D3NA 3UF9A 4MPKA 2Y7FA 2PP0A 4NASA 1XLKA 4M1RA 4MAZA 2XPKA 1JQVA 2QIWA 4XK2A 5I2UA 3LBMA 3PC0A 1QJWA 2ZWZA 5HUPA 5CPMA 3UT0A 4DJEC 3AZSA 3I7QA 2PWHA 1X6LA 2BGQA 4JIIX 1TZ9A 4Q8MA 1LT7A 3NFUA 3AJ7A 3E0WA 2A6LA 1KBKA 3VDGA 4PTWA 1Y5WA 3GXPA 4JS3A 3TSDA 3VNYA 3ZZ1A 1P0DA 2W61A 3KTCA 1PYMA 3L5LA 4GG9A 3RF9A 4AZ5A 1DEDA 3GR8A 3QV9A 3MU7A 4UXDA 3FHQA 5A8OA 1JDDA 1ZP3A 2XUCA 3WD2A 3AMDA 2QDDA 4Q3MA 2ATSA 2QAPA 1MVYA 1T7LA 1FRBA 5C0QA 1ZBVA 3AMCA 3B9AA 3WQCA 5CZTA 1DWJM 3QGAC 4I9TA 4AIOA 1AD4A 2AL1A 2YBVA 8RUCA 1S5VA 1Q5MA 1LYXA 1F73A 2FGBA 3V16A 1RSCA 2TMDA 3IJQA 1VFUA 3GHSA 1EUNA 1VFOA 1MUMA 1WCGA 2FQIA 3HQOA 4JTLA 1N8WA 4BQ5A 4XO7A 4QG9A 2WNQA 3MPGA 4Q8OA 4I5UA 1ONEA 1W1ZA 2Z1BA 2JQXA 3T44A 2HXTA 2E68A 2W63A 4LB4A 1AW1A 1WX0A 4AD5A 1WZAA 2JIWA 1FKXA 3I65A 3W1PA 2HK0A 2WHJA 4M6VA 1MO0A 5A6AA 1GKQA 1J79A 4FOJA 3NQ2A 1I2PA 2J8GA 3C8FA 2FIQA 3UY8A 1TIWA 5M03A 1MNSA 3WDIA 3W84A 4CVWA 2NT0A 3FEMA 4MAVA 4UMAA 4H9XA 5FEPA 5I78A 1UOZA 4JQAA 4ZO8A 2FZNA 3CZ8A 3PSWA 3MI2A 1EXPA 5F2IA 4GVFA 4JNYA 2Z1KA 1T5AA 3CLMA 4R9XA 5DX7A 2O0TA 2P8BA 3BE7A 1HF6A 3KOZA 2A3HA 3HN3A 4UTKA 1PIFA 2PDYA 3TOYA 1BWLA 4G6CA 3W72A 1F6KA 1GCYA 4JN6A 4LS0A 3U8GA 3U3HA 4GD0A 4ZB2A 3RCMA 4ZA0A 4DO6A 1UD3A 3R11A 3TLLA 1M3UA 1JF6A 3OLGA 3BURA 3K2GA 1W17A 1OFRA 3KL5A 3P5ZA 2VFHA 5C6MA 5CSSA 3PR2A 1XGEA 2C16A 1LBMA 3FY1A 3AXMA 3Q2DA 3WSUA 3A4WA 3AALA 1P1MA 2OODA 4C1NA 3MSRA 5CZSA 4A3HA 4OIFA 4EPEC 4J3UA 3B8IA 1PX3A 4URIA 3K13A 2EG7A 3T1GA 4Q7BA 4O17A 5LNVA 2I5QA 4W8BA 2Y70A 3OO2A 1V3JA 4LX4A 4O0KA 1HT6A 3UESA 5HPCA 1A5BA 3E0LA 3KM8A 4JTSA 1GVIA 2XSAA 2OWWA 4DI8A 4D72A 4GXMA 3VKBA 2VDIA 1UMYA 3GU2A 3XIMA 2CXEA 1QOXA 3N2CA 1GJPA 3M0JA 1A5SA 3CT7A 4YU1A 1TREA 2D24A 2FJKA 1BWKA 4ZEPA 1OM0A 3MO7A 1CGUA 4NVTA 1J10A 5D02A 4PUDA 2ZXBA 4P8XA 4XX6A 1UZDA 1XH0A 1ITUA 1FDJA 2OG9A 4GK8A 2V3GA 2ZVIA 4FS9A 3LG3A 4Z2LA 1BLIA 4GX8A 2DSVA 3GG1A 4J35A 3ZT5A 5KEZA 3WLKX 1V3IA 4QRNA 2Y61A 2YLLA 4IIHA 5CGQA 5I6SA 4EWND 3TJXA 3NPWA 1BGGA 1DTNA 8CGTA 3PWGA 3BCJA 2A79A 1D3GA 4UFMA 1JDAA 2QUTA 4MKSA 3GDLA 4ORMA 5SWUA 3QFEA 2I56A 3VD9A 4HSNA 1POJA 2XIIA 2P0IA 2XH7A 3N11A 3VIFA 3B0UX 3BARA 3LGEA 1P0NA 3NL3A 3EDDA 2FDMA 5AKQA 5HQEA 4AD4A 1ZBWA 2VCBA 1JEZA 1A5KC 3NZRA 4JR5A 5DO8A 2DT3A 5T91A 4H04A 3W2KA 4JFVA 3GC5A 4S3AA 5H2ZA 3S5OA 1PTDA 1M7PA 3QMRA 1G4SA 5F4WA 4WVXA 3ARRA 4JYDA 2OKOA 2VDHA 3EPNA 2ZADA 4KGJA 4DUWA 4KFPA 3IJ7A 4Q4QA 5IBXA 1E1EA 3E5BA 1F8IA 2ISFA 1V3KA 3MUXA 2Z1XA 3G6MA 5DQPA 1B0IA 2HBXA 3KVMA 4PEKA 5A2BA 3VGBA 4OFCA 3GY1A 2FDSA 3S8HA 1M65A 3C0JA 1TVPA 1MEWA 1SO5A 2CLEA 3ANYA 1KB3A 1W9XA 1U1HA 2Y24A 2V5CA 3UQNA 1QASA 4RLIA 4GH1A 4CCEA 2BB0A 3T7VA 4MMWA 1EBHA 4XVEA 1E6XM 1ELSA 1OK4A 4IL0A 1SSDA 1SJBA 1AD1A 1PIGA 4HNNA 3WEMA 3R89A 1Q66A 3W1MA 2Z2BA 1EC7A 4GGHA 1H7RA 4W5UA 1XLIA 4PMQA 3LTYA 3G1HA 2G41A 4LYPA 2WHKA 1Q6DA 1YXDA 1DV7A 4JHZA 1R46A 2GGJA 1GEHA 1XGZA 1M04A 2QKFA 4TV6A 3WBXA 4MWAC 1FXPA 4A22A 5A6LA 2GGHA 4BY3A 4P7OA 3LLDA 3GNXA 2R1LA 4GHRA 5FIPA 4QIUA 4GH3A 3VMOA 4AX7A 3KWXA 1W1PA 5FF2A 1YTKA 1RLDA 1I2NA 1C9DA 4V15A 3ZLGA 1V6VA 4IOTA 4LU0A 4JXCA 3NDZA 3LCWA 4E4PA 2HS6A 3EKLA 2E3ZA 3W7LA 4UNKA 3GIPA 1V7YA 2CLOA 2QCMA 1OGBA 3OIHA 4H7CA 3VK5A 3PWAA 3BAIA 3EGJA 3WLLA 4O12A 4C7FA 3K5XA 5BXSA 4G7EB 3TMLA 1FFRA 3DHPA 1I45A 3USZA 4TMBA 3B9EA 4L1WA 2XIBA 1TE1A 1XH2A 4FSAA 3UVIA 3S2JA 4QP0A 4J28A 1QRQA 4LF1A 1NOFA 1OFAA 3TYZA 2D0FA 2V5BA 3AUOA 1TELA 4B5WA 2VHLA 3CNYA 4JOMA 3N2TA 4HHHA 1XR2A 2CESA 4HKPA 4LVGA 4BQ2A 2R24A 3NWRA 4GABA 3BJSA 4EIVA 3BANA 4O1FA 2R82A 1RVGA 4DJDC 3VE7A 4ROPA 3BAXA 1TRIA 2GJXA 2RFGA 3CJPA 4OUEA 3B4UA 3OVGA 2WBGA 1V3MA 3PZ9A 1PUDA 4F0SA 5JU6A 4Y96A 1P48A 4XSMA 3WN6A 1DHPA 3LCLA 3A4AA 2J7FA 3CYVA 2E77A 3KRSA 3C4UA 1TPEA 1XLLA 2BS9A 3K4AA 3H24A 3CH9A 3DN5A 4EXAA 1CIUA 4N9CA 3SR7A 2VZTA 4AUBA 5C9ZA 3CEUA 4HMCA 4ACYA 4LY4A 2G3IA 1SZRA 2ZZ3A 1W3LA 4IXXA 3KZPA 1HO4A 3NR0A 1WKFA 4DWSB 4ALDA 1XRVA 4D9PA 3S1XA 1OFPA 1GZJA 2WMIA 2NZLA 2ZWYA 1F74A 2OEMA 3L0NA 1I6NA 3UXDA 1BSLA 2O4QA 5D2XA 1PYFA 1O95A 3W29A 4M80A 3WQGA 1MZRA 5EU9A 4FHAA 3BL3A 4LGXA 2PZNA 4GX9A 5D2WA 2IW0A 1PEZA 3T09A 3MCMA 1YKWA 4QROA 4LAZA 1WZKA 4FA3A 3WD3A 5GJMA 3IGUA 4DJFD 2FB2A 4LAOA 3V18A 1UD5A 3CV2A 3UR5A 1LJYA 1JFXA 1QNSA 4AHQA 3UWUA 5BXPA 4GJ1A 5I03A 4ACZB 3THQA 4UFJA 1SQ7A 2C13A 3PK7A 1PL9A 3F7JA 4KF1A 4GE8A 3IUIA 5HWNA 4V1YA 4DXXA 4F2TA 3GNOA 2GVGA 4ZSTA 1OY0A 2F6XA 4KRTA 2BOEX 3N6HA 3GFYA 1R3TA 4C6NA 1RA0A 4A6GA 4DZAA 3UJ2A 4AZIA 3LUTA 1VB9A 3UR8A 3TROA 3JZUA 5GJPA 1SMDA 4XZMX 1EWEA 2CU0A 4PCNA 3MP5A 3VX1A 1QNPA 4YWIA 4KIEA 1L6FA 3KRZA 4N9EA 1EH9A 1GQNA 3TCSA 2EPHA 2CPUA 3EWCA 1IE7C 3PZVA 1TV3A 4UTIA 1QU4A 1NJJA 2FH8A 1DQUA 3SY8A 5I3KA 3WF1A 2QJNA 4FP1A 5CC6A 2W62A 3WQ8A 1C91A 2AKZA 4UQAA 7A3HA 4I5XA 1W32A 2X41A 1HXJA 1VC4A 2G37A 5F4XA 2PURA 1LWHA 3ANUA 1WDWA 4HNVA 1WZLA 2YCKX 4WSKA 1AA1B 1RLCL 5CJMA 1J0YA 3T07A 2RJHA 1O1ZA 3A12A 3G8RA 2PSNA 3UXLA 1W1B1 5E93A 1R9ZA 5JUVA 3HO8A 1X6UA 1H1YA 2PD9A 1K7XA 4AC1X 4MPQA 3IJDA 5MKGA 1VAHA 2FTPA 1B3VA 1FWFC 3N04A 3I10A 3G3MA 3FJ6A 1F6YA 3LPPA 4KMQA 1E0WA 1NP0A 3EDEA 1M1BA 3W1AA 4D8LA 3EOEA 1G1YA 4GI9A 1GZGA 4JCLA 2E7FA 1OYAA 4A8IA 2PGEA 1VYSX 2VEKA 1L6WA 2UWFA 2F2KA 3KL3A 3Q4DA 1LLWA 4LUTA 1Q8JA 4PCTA 3NZ1A 2ACQA 4IJBA 4H8VA 4GVHA 3VOIA 1LDCA 1EO7A 1S2VA 3OIXA 5TQLA 3LNPA 3TOPA 2CLMA 5HR6A 4MB5A 1S5MA 5EBAA 3UXKA 2ZZ1A 1V4YA 3M0KA 4HPHA 2BBFA 3KS5A 3KOFA 2RDTA 4L4MA 3PF3A 3UWWA 3VZXA 1JCJA 1DPMA 2POZA 1S5WA 4NYYA 3SGUA 3JU2A 3F1QA 2Z7KA 4HYWA 4UMBA 3VNKA 1GORA 1YDOA 3U2ZA 1J5TA 4KWUA 2BX7A 4YHGA 1EC8A 2PDXA 5FI8A 3MCOA 1JI2A 3IJ9A 3NO5A 2PTYA 4HCHA 1B4KA 2J27A 4O28A 5IFPA 1EIBA 1E6QM 4JL1A 1IEWA 1UWTA 1Z9AA 2VEMA 3CZLA 1P6BA 3CO8A 3N17A 2YB4A 3E0FA 1MEHA 5FF3A 5AC6A 4DWSD 5C2CA 4N6FA 3HJEA 3LU2A 3BAYA 3TN4A 3URQA 5E5CA 2GWNA 2YL8A 2FZBA 1HTIA 2ZZ2A 4LOCA 3B9NA 3T2QA 1W9BM 1B3YA 1P6CA 4PE8A 4JAWA 4MB4A 2ZTJA 1GG1A 5K9XA 1ESWA 1ZJBA 4BWLC 5CEWA 4F2UA 1JZ4A 3AYSA 2WZTA 4PUWA 3R4IA 1VCGA 2NXHA 3TJIA 1V6XA 2V0TA 1QNQA 2GQAA 1KXVA 1H7XA 4HPJA 3IV8A 2V5DA 1MXDA 3PZNA 1O68A 3QGVA 4UTJA 1S2CA 3S83A 3SIZA 1F3TA 1CGVA 1UR3M 4XZHA 3WLNA 2PU1A 2QDEA 5A8NA 3PZGA 4D1JA 3OVQA 1FVPA 4JFSA 4NI8A 1FP8A 2YJQA 3SCUA 3CV6A 4WLCA 3XINA 1VLWA 6REQA 4L5ZA 1B5TA 1R5YA 4RK8A 3AHXA 1IEXA 4ZENA 3L5AA 1DKWA 1BXNA 1B30A 3M0YA 2X7VA 3CU2A 1W1IE 3N4EA 3ARYA 4MNKA 1R7AA 7PTDA 2GL5A 3B0XA 3LB0A 3LLFA 4YTUA 1XKJA 4ATWA 4ICCX 4NT0A 2RUSA 4MLJA 4RW3A 3W1XA 4UTWC 5I06A 1Y5VA 3WX7A 4ZQPA 3W7KA 3V0SA 1SZEA 3TJLA 3UWYA 4TO8A 3ES7A 5C5YA 2XIQA 4ZB0A 2HRWA 3BG3A 2ZX5A 4CEXC 3WBEA 2YLAA 1YNQA 4J27A 1VJSA 3N9RA 1H11A 3DG6A 1NDZA 4FO4A 4IL2A 1D2KA 2DFAA 4FAMA 3U5UA 5LA1A 4OTKA 2B31A 1O4UA 2OEKA 3T8LA 1CI1A 4AIEA 5AVHA 1RY8A 3FEQA 5KINA 2BASA 1OHLA 4O54A 4PULA 3ARWA 1MXGA 4H4IA 1XKYA 1DJNA 4KH2A 4LUJA 4PMJA 4ZZ9A 2EAWA 1Q65A 4A8RA 2O55A 2KAUC 5D09A 1HG3A 3ZJ7A 5DXXA 3PBWA 3PZUA 3QY6A 4C6DA 1MUWA 1VIZA 3LN3A 4WY0A 3RUBL 2BFGA 1JYWA 3LOTA 4XAPA 2DZWA 5D04C 2XZ9A 5M17A 3UG3A 5C2XA 4Z0JA 2HISA 3TSBA 4NYUA 2YDRA 4GI8A 4UQDA 4NJKA 4U5KA 3M0MA 3TQVA 3C2RA 2Y88A 1JPMA 1K03A 1CXIA 1JYNA 3OLEA 4KFNA 1AMYA 3FV9A 5FCZA 4C6PA 4HK6A 4I7WA 4XIMA 4KWVA 2ANUA 2O9OA 2XN0A 3K8KA 4US5D 2ZICA 3L5MA 1LCOA 4OECA 1A0EA 3DHUA 1J5SA 1SMAA 1V6YA 4TXEA 1ENUA 2A6NA 5K4XA 3T0DA 4UNIA 3IK4A 3LHTA 1AFSA 3H4WA 4J40A 2GVLA 4IFRA 4IT1A 4QISA 3TYUA 3NZPA 5JMUA 4R7JA 3A47A 4WDTA 2NVCA 3B8WA 3SCRA 3KBSA 4IPLA 2Z24A 4LW7A 1W9VA 2W6RA 4HNTA 2Z1WA 3J7HA 3TN6A 4UTTC 4UB9A 3BQ5A 3TA6A 1RHCA 2EPMX 4G7FA 3CUIA 1QPRA 4OU1A 1GK8A 4R85A 3GVVA 3R8GA 4L56A 4P61A 1UQZA 4RX0A 1B9ZA 5KSWA 1DXIA 4AD0A 3G0SA 2DSKA 4G56A 1RA5A 5J5DA 1LOLA 1UCWA 2TSYA 4DI9A 1ZGDA 5CXPA 4IG2A 2R8WA 3R0DA 1FCUA 1B57A 1JPKA 4M5PA 4E8DA 4FNUA 1BXBA 2X05A 1BHGA 3SUVA 1J0HA 2PDQA 2NVAA 1KGUA 4NJJA 1TV7A 2Y63A 3ZM8A 3SM0A 4HHMA 1ZHAA 4IIBA 3APTA 4QHRA 2NQJA 2JKAA 1GZ1A 4JFUA 2OYMA 2UY5A 4L4OA 4J7RA 3E2SA 1LRQA 1UD4A 4LNYA 3NO3A 1HIZA 3VX0A 1DWIM 1RJQA 4N42A 3LERA 1WUFA 2HDJA 1OK6A 3H26A 4IMFA 4HNUA 2GDQA 3NPUA 3UEQA 4K8GA 3AZTA 2DUZA 4DHGA 1G5AA 2ZRZA 4R27A 2ADAA 2DJLA 3VKCA 1H7WA 4LCSA 2ACUA 3TTEA 3ISIX 3WQ4A 1XV8A 1LLOA 3D47A 1BGAA 2C6QA 4CD4A 3GG8A 1EDGA 1GVOA 3LENA 1GNXA 4FR6A 4X9SA 1R3VA 3W7NA 4MHBA 2DW7A 1QHPA 2AGTA 3GKFA 3IJLA 3KP1A 4HA3A 3IEBA 4NILA 3NQFA 1M7XA 3EWXA 3I68A 2XGIA 1ZBCA 2H3BA 1VPQA 5HK4A 4ZFMA 1FWGC 2ZXAA 3NQ8A 2GFTA 3O05A 3OPSA 3VNJA 4ZQOA 3QHOA 1OFDA 1JUEA 1PZ3A 1FDYA 1UKSA 2CEQA 4K1GA 2QGYA 3VKKA 3W07A 4ZBCA 1VHCA 3QFWA 2PWDA 3UJFA 4Q7NA 4GCAA 1S5NA 2CW6A 2D1ZA 5CAHA 1M7OA 1UR8A 4GO9A 3S6DA 2Q8XA 2BY0A 3HFTA 5CLTA 1TMQA 2VUNA 4PFHA 1CPUA 1ICSA 2BP1A 3SFWA 2YL6A 2QUVA 1X39A 3AIUA 4GISA 3QKZA 3LV5A 4S3JA 4D1IA 3S2CA 2XM1A 1XLDA 3CEPA 4LAKA 1FX6A 4PMVA 4TX6A 2QPUA 4R3UA 4LYKA 2A7RA 2YFOA 4MDPA 1TR1A 4IH3A 1U1UA 2J78A 1C9WA 3MUY1 5DMMA 2OYLA 1TA3B 3MO4A 3G1SA 3PAOA 1P0KA 3VPLA 1B1YA 1XCFA 3KZSA 5CSYA 2NUXA 4WJXA 1B31A 2VURA 1D8WA 3U6WA 4AD1A 1W9UA 2PTXA 3LRMA 3UCCA 1O12A 4UFIA 3TW6A 7REQB 4ZMGA 4JFWA 4FX7A 4QR6A 4HN4A 1H5YA 1Q7QA 4QJ1A 1GVSA 2YW3A 1I60A 1XIDA 4K39A 1LQ0A 1QVBA 4ICNA 4HU0A 1GPWA 2OX4A 4FB7A 3H23A 4WSJA 4AYGA 4EXBA 3VABA 2OSYA 4HU4A 3I7RA 4AIUA 1W5MA 1P7TB 3ID7A 1IEVA 1V0MA 4LCQA 3VE9A 2HCVA 2VENA 1OJXA 4W8AA 4QQUA 4MJ2A 1UP2A 3ITYA 1Q6CA 3TFXA 1Z8AA 4S1FA 3N4AA 2GPTA 3VIOA 2Z4GA 3W01A 1RALA 2E6FA 3B9DA 3FFSA 2E67A 1H09A 2XJ7A 3EXSA 1CLKA 4GQQA 5DRCA 4XZWA 1YE4A 4NY2A 4LB3A 1ITXA 4MNLA 4PR4A 5IHSA 1UR1A 4ERGA 2CZFA 1FWCC 2OLHA 3KAOA 5A6JA 1E1CA 4U5IA 3F5KA 3OOQA 1OCQA 3EX4A 3UGRA 1M41A 3OB8A 1WBHA 5G4WA 1BQGA 2OZ8A 1ZCCA 3INPA 4LUSB 3S0CA 1ODZA 3TTQA 5AYXA 4HVXA 4X60A 5A6BA 4GC3A 3BW2A 1E6NA 1RY0A 1HKIA 2HZGA 3OZYA 3P60A 1CTNA 5XIAA 4D8ZA 1XC4A 1NF7A 3CASA 1W1A1 5BROA 3VNIA 4FK9A 2IKHA 5TIMA 4GCXA 1MWOA 3ZLHA 3AMLA 1Q2RA 3WUEA 5C7VA 2FB3A 1NEYA 3EPOA 3C2EA 2XFYA 4GMEA 3WLHA 4RNJA 4ADUA 1U30A 3ARZA 4RCXA 3AXKA 3MSGA 5H8UA 3RLHA 1VCVA 4G2DA 4LRSA 3TAKA 4C6KA 4DBWA 4F40A 2NUWA 3W26A 2XH4A 1TR9A 4IQJA 2NV9A 3W2NA 1E3XA 3CL8A 2JF6A 3THDA 5CC7A 3COTA 4CQBA 3V0TA 3TK7A 5LYRA 4HMEA 1G7VA 1A4LA 1H7PA 3SSZA 4QDPA 2IQTA 1FWRA 1XRSA 5A95A 3GB6A 3W6MA 4RE3A 2AMGA 3GFXA 4C6EA 4A2SA 2EO7A 2ZQ0A 4O57A 2VYOA 1J93A 1Z89A 5BXRA 1N7KA 3GDRA 3AWOA 3QKEA 3T8QA 4KEVA 1QNRA 2NT1A 1KKOA 4E2BA 3VKAA 2QJHA 4C91A 1LT8A 2OOGA 1IZJA 3UG8A 3TQKA 4HNCA 4M56A 3DYOA 4AEOA 4ASTA 1QR7A 8A3HA 1QHOA 3EMCA 2YCLB 4A4AA 4Q6JA 3TC7A 4KEZA 1WP6A 2NSXA 4C6QA 2B7OA 1KM3A 2V67A 1PHQA 1JG9A 1TWSA 1OYBA 4MY9A 5D2TA 3I3EA 3EKGA 4UC5A 3ARSA 5LGZA 3BG9A 1OG6A 1KC7A 3GK0A 4PMNA 4YS1A 3SY5A 4V28A 1XC6A 3N19B 3ARTA 2GOKA 3E1F1 1ZY9A 3VU2A 2HV5A 4HA1A 4AZBA 4Q8TA 3NCOA 1TWDA 3NSMA 3FX4A 3QN3A 1RCXB 1U1JA 4GIEA 4YTQA 1XCXA 3OLIA 1CGWA 1XLAA 2NV2A 4LS2A 3L2IA 2ALDA 3R10A 3U0HA 3SRHA 4NSBA 4PODA 3RN6A 2OJPA 4X0NA 4GPNA 4E3TA 2GUUA 2PLJA 4K36A 5CZJA 3OYZA 5EYWA 2DT2A 1KV5A 1K02A 5ABHA 3ITLA 1ADSA 2DUAA 1WUEA 4GQGA 5CCZA 5A8QA 4V1XA 2TYSA 5KTLA 1E0TA 1WNOA 1MEIA 1Q7MA 4I5RA 4XAGA 4D6JA 5E9AA 2WSRA 3HZ3A 1RD6A 1KXQA 2FPYA 5FEWA 4CU6A 4W5ZA 1ZU8A 4QNWA 2OOFA 5I3IA 4TQTA 4IMDA 2VUYA 4E0CA 4MDOA 3H2MA 3IGSA 5CPQA 2QJJA 2A4AA 4UQ9A 4XBKA 4ZO6A 1CGYA 4AEEA 4L65A 3P84A 1HJQA 3HFYA 3V4BA 3STCA 3UA3A 4JKMA 2I17A 2MUCA 4O52A 3SCPA 3T2OA 5REQB 2D73A 1DL3A 3MB9A 4JGDA 2QHAA 4F79A 2BNJA 1GOKA 1PTGA 1XFCA 3N3MA 3N9KA 4HJWA 1MUCA 2PC8A 2G3FA 5A69A 3V0UA 1XPYA 1EB3A 4Q8NA 2CLHA 2FH6A 2JKEA 4QSHA 4EVZA 2NWRA 2Z0IA 3MV01 1UH3A 1M01A 3R25A 1X7FA 1H1ZA 1E15A 4JTUA 1ONWA 1Z6KA 1RBAA 3LXCA 2QEZA 1FWJC 1R30A 4GUIA 4WF7A 2WKJA 1RAKA 4B92A 1US0A 1AJZA 2WHLA 4WDUA 1BQCA 1NWUA 3JR2A 3KW3A 4DYEA 2WSQA 1EA0A 4N9DA 1MRQA 4C6OA 4DPQA 1V3LA 2C3ZA 2F9RA 2D23A 4M6PA 1RP8A 3W1TA 1VKFA 3IV3A 3MKVA 4JQ1A 1V6WA 4QCFA 5HULA 4HOWA 3VUPA 1DJHA 4B4FA 3FNDA 3TONA 5RUBA 3MUAA 2O92A 1YEYA 2OELA 3W74A 4DX3A 4G5DA 1JNDA 4UR8A 1H2JA 4WD0A 7TIMA 4TX9A 4GIAA 1S1RA 2X42A 4JN7A 1KWGA 4TV5A 1GPFA 4AWUA 2ZOXA 3RDKA 3UZZA 1GTEA 2F2HA 5A6KA 2PDPA 2AAAA 2WOQA 3KVLA 5CPSA 3BXWA 1KA9F 3PB2A 1X98A 2VVNA 3B8DA 3D0CA 4MJMA 4RV3A 3UYIA 1PHWA 4C6IA 1EXBA 3NOYA 3S9IA 1DBTA 1MFVA 4EX4A 3RX4A 1BVNP 2DSUA 3N15A 1LBFA 4QJ5B 1E5NA 4LC8A 3WLQA 3LHYA 2V38A 4UIOA 3VM7A 4DJEA 1HKJA 3NYDA 5I07A 1IXOA 2F84A 4M24A 2QW5A 4WQ6A 2CWXA 2UY4A 4ZO7A 1W5OA 1VZWA 4UZSA 3W6YA 1BKSA 2Q3RA 4N2YA 1TPB1 2A3CA 2F61A 4AXNA 1LP6A 2WMHA 2VD9A 3DFNA 3BOLA 4TVUA 3W82A 3RYSA 3H2OA 4GACA 1V0NA 2ATMA 3ARPA 3VFCA 1SVDA 2RDXA 1IT0A 1ZBKA 3IGHX 2G97A 4YHEA 3K8MA 2WZHA 3ITGA 3ANVA 2EPNA 2IPJA 1E40A 2OYKA 2JALA 3REQB 5BRQA 3GHUA 1XSIA 3EYPA 1EKOA 1NDYA 5CPOA 4F0RA 2PI6A 4MKNA 5FJPA 3WJXA 4ZE5A 1CW2A 4DZHA 1XG3A 3TW7A 3ABZA 1CGXA 5ABTA 2XZ7A 4JDYA 1XLHA 5EGRA 3WMLA 1RQHA 3LNMA 4KWSA 3EOLA 1BXCA 5I02A 1RQBA 1E43A 3TFCA 2D2HA 3IUHA 5D9NA 1JGIA 2GK1A 4XB3A 2E9MA 4Z2IA 4OBSA 2E9BA 1FCVA 2RDUA 1XLEA 2Y4SA 3TR9A 2D0GA 3BOFA 1TA3A 3N18A 3KVJA 3TTYA 4B5NA 2QS8A 4MADA 2D22A 4ZQMA 2QF7A 4P7QA 1JQXA 2R91A 3FAXA 3GXDA 1IWAA 1S38A 2PODA 4JYEA 5FJOA 4Q4SA 1AQMA 1EC9A 5LIYX 2WQDA 2VGFA 2VXNA 7REQA 4JX5A 3A4XA 1EQCA 1K8XA 2QULA 1UP0A 1UQYA 1V3HA 1JXKA 3FOKA 1JL8A 1TMHA 3P67A 4LH8A 1E3ZA 5CQ1A 1XINA 2JF7A 2QCGA 3CO4A 3PZQA 2OR2A 3PB0A 1UH4A 2VQUA 2PDGA 1DIDA 2BG5A 4Z08A 3M6YA 3WLSA 4CEUC 2QCCA 1XBYA 4F0MA 2X2YA 4EPKA 1CCWB 5EA9A 1XYFA 3W1QA 3WELA 4FNRA 3R94A 1J12A 3WDHA 1OZMA 4QE5A 3S47A 3W7EA 4AU0A 2G3NA 2CLLA 4CQDA 1Q6GA 1K9DA 4NHVA 4RV8A 1XYZA 3GW3A 1WPCA 5I23A 1JZ2A 3B0VC 1TYGA 3Q94A 4K68A 3F2CA 4IIDA 3VNMA 3WQ5A 2V82A 2Y8VA 5A8PA 4HP5A 4UTUA 1N8IA 1HL8A 1ZTVA 4YTTA 2A2IA 1TV2A 1RP9A 4H9MA 2ICSA 3A5FA 4U10A 1WE5A 3BMXA 5G2HA 3JW7A 1OCNA 5GNYA 2ISWA 3LDVA 2A3BA 2BMBA 4U3CA 4NIRA 4B91A 2QCDB 4JIHA 3GTXA 2Y5JA 2KZHA 3NVDA 4LUSA 2WK2A 1G7UA 2OU4A 3EOUA 3WQEA 4D71A 4AMAA 4OE7A 2JGYA 4JTHA 2QMKA 4WRHA 3W1RA 3SCTA 3LTPA 1ZLPA 1DORA 2GUBA 2OVLA 1VBJA 3DI0A 4XBJA 3DFHA 1G01A 5FJUA 2PRHA 5DCDA 4TVCA 5E6YA 5HMFA 4XD3A 4GBDA 2J62A 4L6DA 4MY8A 3WD4A 3VDCA 1E9IA 1IZCA 3NQ6A 1LL4A 2IUZA 5LZLA 2PMQA 1H5VA 3PUDA 1A5CA 1UKPA 1X1NA 3VGEA 4MIMA 3RJYA 5F1UA 1UWRA 4N7QA 1CB2A 4H7VA 4ERAA 5EBUA 4IFOA 3S9ZA 1HKWA 1PKLA 1ALDA 5CKSA 3MVIA 4EWJA 4DWSC 5F7UA 4Z17A 4MZ8A 3W9ZA 4PTDA 2ZE3A 4W7WA 2J13A 1DWAM 5G1MA 1PPIA 5DN1A 1YNYA 5A6BD 2QAFA 4AHPA 3OG3A 4KQNA 1OVDA 4DLMA 2IXVA 3WH8A 3ONCA 1CEOA 3BGJA 3RPMA 2IPGA 2Y85A 3LA4A 4H00A 5FL1A 4N4QA 1MDRA 5MF5A 3P62A 3RLUA 3WF2A 2VX4A 3T08A 3ZJ6A 4HCDA 2AQWA 2BOFX 4REQB 2QDHA 3QR0A 4GKLA 1GYMA 5EB8A 4IPNB 3RLGA 2WWDA 4ATLA 1TWZA 4XISA 4Y9NA 3VNZA 1EEPA 2WMGA 1ZB5A 1D8CA 2YCLA 3CH0A 1I2QA 2XDFA 3M64A 5HMSA 3EBVA 3VIHA 4A21A 3A24A 3ZVHA 1HNYA 3B8VA 3IAPA 2CYGA 1W1TA 2PDKA 3WQWA 1TRDA 4GUFA 1VCFA 4MWAA 1FH7A 4JDBA 1JAEA 2B7QA 3FDKA 1KBJA 5FF7A 4TVDA 3ZJKA 4QAIA 2J7CA 1BEUA 4NNBA 1NSJA 3S6OA 1VFTA 3MZNA 3KEHA 3M5XA 5K3VA 1EP3A 1XQKA 2VRQA 3GDKA 4IGNA 4DNHA 2DZXA 3E0IA 4DPPA 2GWGA 2X0YA 1JZ6A 3M1ZA 3WLTA 3W7IA 1A47A 3GC2A 3IGXA 3V3WA 5BXTA 2DT0A 2CBVA 4M7SA 2YW4A 3R0KA 1UPPA 1I75A 2VFDA 3O63A 1X8FA 2YXGA 2HNHA 4IXHA 3CUGA 1S2TA 5AOUA 4W7VA 1QATA 3O06A 4M6QA 4CLMA 1LF1A 1TPC1 1CDGA 3UA4A 3QLLA 4TR9A 3ABRA 3S2LA 1AZ2A 2VRJA 2I16A 4WOQA 1ITCA 4LBSA 5EFFA 1FHDA 3UWVA 1IEIA 1KV8A 2TPSA 2ZC8A 4FLOA 3L12A 1OX4B 3UWEA 2PGRA 2FJUB 3KBJA 4WKFA 3GRIA 4AAJA 1V03A 2WJDA 4KERA 3EDJA 4CGTA 4HN8A 1WDRA 1MFUA 1UC5A 2CHOA 1Y8BA 4IIFA 3CUFA 2OLSA 3OZPA 3KBMA 2C1IA 1H4PA 2X2GA 3QZAA 2Z2AA 1R47A 5KETA 3SUSA 3BW3A 4QQ3A 1SFSA 3HGOA 2OO0A 2Z6IA 1E6SM 2DVUA 2PPGA 3G24A 2ZTKA 3FHAA 5JH1A 1FBAA 3B8UA 5KZDA 1KR0A 4DJDA 4DWDA 2E5CA 3PUGA 3W71A 4D6GA 5K4ZA 5LA2A 1FCBA 1YLVA 3HB9A 1V0LA 4O1EA 5C8BB 3LTSA 4RZ4A 3LQGA 2WW5A 4XZ9A 2E5BA 2P53A 3GIYA 3LZ3A 1KCLA 1RZMA 4FMVA 3GU9A 1OFQA 3M5VA 2WVSA 1W1YA 3GO2A 2HPIA 5FAJA 1ZSXA 3MV11 2D2JA 3ELFA 2ZRYA 3S9YA 3CAKA 4JHOA 2YSWA 3PBVA 4R53A 1HJWA 1F3XA 3EPMA 1JFHA 1Z69A 4Z2KA 1I1WA 3RO8A 2ZVRA 2VZSA 1UWSA 4HNLA 5E0FA 2J88A 1FP9A 3FDGA 4QEHA 2W4XA 5ABEA 3MT1A 1TWIA 3CWNA 1YBQB 4X63A 3VIKA 1A4MA 3ZS4A 3H2FA 5C9WA 1KLZA 2WC3A 5CPTA 2CBJA 3IVTA 1B9BA 1NWSA 4A3YA 4DELA 3OP2A 2PS2A 2H9AA 1F2JA 5AYYA 3KS6A 3W7QA 1JRBA 2ZBTA 5CC3A 1F5ZA 3W70A 3W7RA 1P1XA 2NUYA 4AYSA 2VOMA 4GKTA 2VCAA 3HMCA 3TR2A 2VEIA 2YXOA 3GWQA 4PMDA 2XVLA 1Z44A 1TCMA 4IPIA 3VOGA 3DIPA 4CVUA 1EEXA 4JIQA 5I79A 3UU0A 3ITVA 5H8PA 4EK7A 2PCEA 1D3HA 3BW4A 4LTSA 3TYEA 1PV8A 3MA8A 3H6OA 3SBFA 4R33A 3I6EA 4C90A 3GTHA 1K1DA 3WQOA 2PDMA 4RZ5A 4FALA 3VAVA 4LUYA 1Y7VA 3MI6A 1SYTA 3S5NA 3WNLA 2DY3A 4PCSA 4O13A 1UP3A 4C65A 2PWFA 4KCVA 3WDJA 4ZB5A 2CNCA 7ENLA 5FF0A 4RKAA 2VMFA 3RMEA 4Y9PA 1TVNA 2CCRA 3SCNA 1RV8A 1JRCA 1W6TA 1DOSA 3C52A 5TF0A 2WMFA 5E9XA 3GFZA 2ZXDA 3G6LA 3C61A 4H2CA 3EWYA 1RBLA 2I5GA 4E38A 3PPGA 1JCLA 1SO3A 2H8XA 1MI3A 3VD5A 2Y7EA 4KRUA 2HE8A 4JNZA 4F2BA 1IF2A 1MW0A 3NGFA 5D2YA 4E2OA 5AC5A 1RUSA 4WZHA 4QFUA 1TPUA 3GAKA 4GGBA 3ITOA 1HL2A 1DP0A 1F3WA 3HBLA 1NIUA 1EYWA 4DN1A 1F61A 1V8EA 3NGJA 1SZNA 5ECVA 2DEPA 1A0CA 3AYTA 3CMFA 2G8ZA 3NQBA 4BQ3A 1JZ3A 3QQ0A 5AHIA 3PP7A 3GSMA 1FFQA 4EOUA 3V7PA 3HG2A 1E9ZB 3F03K 3NTYA 1PZ0A 3QMSA 2GVYA 1HVQA 2DW6A 1OGSA 2IS7A 3UPMA 1YQ2A 1X6NA 3BQ6A 2P1FA 2YDQA 3TN5A 4KW2A 4GWEA 1EO5A 2EKCA 1BTCA 1VYPX 5BOOA 3R6IA 3WD0A 4AD3A 2EJ1A 4P7RA 3CQ0A 3K1DA 1G69A 4UCGA 2PLCA 3QZ6A 1C90A 4A29A 3GDMA 3Q45A 2X1UA 4ICMA 2G5WA 5BOEA 2HK1A 1V6UA 1Q13A 2V68A 3GNNA 1JCMP 1JI1A 1AJ2A 3KRUA 3TV8A 3WJSA 5A6SA 3SCOA 2DORA 2UY2A 2WZIA 4BI6A 2NQLA 3TLQA 4TU1A 1U5HA 1PVNA 3KBVA 2OCZA 2YIHA 2Y7GA 3CPUA 4RXFA 4HCLA 2NX3A 1UR4A 3H2NA 4LBUA 5FKYA 3QY8A 4AXKA 4CU8A 1T0OA 2H90A 4GC4A 3KOWA 1ONXA 4AZCA 3PJXA 4F9JA 4E8CA 3MDWA 3ITTA 3M46A 5FSEC 1VEPA 2PDIA 3UR2A 2QYGA 1CB7B 2CZEA 3ZQ9A 4KFOA 4ZE4A 1EIXA 1DWFM 2WC7A 2XVPA 4AWEA 4IPPA 1H3GA 4F0KA 4Z1CA 3GTIA 3LYEA 3O16A 2YA0A 4Q4OA 2VFIA 1WDDA 3JVAA 4Y6GA 3WLPA 2PGWA 1GHSA 1UUOA 4EPDC 1A5MC 1HVXA 3C6CA 3NOEA 4C7DA 1K9TA 3LCGA 1XP3A 3VD3A 1W3JA 5JIWA 1LG2A 1DJZA 4GO8A 4M29A 1DJWA 2EPOA 1A49A 1ADDA 4BWLA 1ECEA 1MYRA 1TVLA 1H0GA 2P3EA 3R58A 1HQTA 4A35A 3VCNA 4JX4A 4B15A 1PAMA 3B05A 4M3PA 1GGOA 4NJHA 5DBUA 1A50A 1TTJA 1O66A 3QW4B 1WAUA 2VNCA 3P2VA 1E4IA 1EWDA 4POCA 1W2PA 4NAFB 1IXPA 1PCWA 2E6DA 4NAEB 2VEGA 4YPJA 3K4WA 5E6ZA 1RBOB 4HK5A 3WH5A 1NWTA 2BXYA 1DQXA 4H3DA 4X2RA 2Y2WA 3L9CA 2NXGA 3W7CA 5IDIA 4HSHA 4DY1A 1W31A 2CC0A