4HN4A

Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 103
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hn4A00
1TPUA 3BW2A 2VFFA 3R8RA 1Q3NA 3SR7A 5D2XA 1RVGA 3G0UA 1WA3A 4UCGA 4JY8A 1UASA 2VKZG 4JYDA 2O7SA 3S1WA 4JTLA 1K7XA 3LLDA 4O0KA 3THAA 2VEMA 4UR7A 5EKYA 2Y7EA 4W9TA 4NZFA 4FNTA 5C55A 2X2GA 4S1FA 2ZZ5A 3O1NA 1KM3A 2WO5A 4GUJA 4WY0F 2QCMA 3M0ZA 4QM1A 2UV8G 3S1XA 1W3NA 3MW7A 2B0MA 1H7WA 1P0KA 1FCBA 4FNQA 4O50A 3TC6A 3JRKA 3NQVA 3LTSA 4EOUA 1JQVA 4RXGA 2YSWA 5AHLA 5LGZA 1CW2A 3OHIA 4KFNA 2B7OA 1OFBA 3W75A 4E2BA 3LGEA 2ZRYA 4UFLA 4DQWA 4ZMGA 3G1SA 5TBOA 1RZMA 4TX9A 4IX0A 4YWIA 3H53A 4PL2A 3QFEA 3B8DA 1OX6A 1X1ZA 1T8XA 3PUDA 4DO6A 4HSOA 2CLEA 4MFEA 4JTFA 1Q6QA 4JNMA 3BK0A 2A0NA 3N14A 3FKKA 1SO3A 4MJZA 1Z41A 1Q6RA 3FYPA 1RR2A 3EX1A 4Z0JA 3E49A 3P5ZA 2QJIA 2BSLA 3G1VA 3OG3A 3NQCA 2QCGA 1QPQA 1MEIA 4LRTA 3VCRA 4LWWA 3P81A 3W7JA 4BF9A 2V0TA 4CNPA 3QW3A 3W1UA 4O14A 3MYOA 4HNVA 2DZTA 2CLHA 4DEFA 4O17A 2TMDA 4HHPA 5D2VA 2YDAA 2QDGA 4NJGA 3TSDA 4MY8A 1UBSA 4IMEA 4YL2A 3L67A 3W7KA 2VFGA 3W7NA 4UMBA 2PC4A 3UYCA 3LXAA 1KLZA 3EXRA 1QPNA 4Z1AA 1XUUA 1NEYA 1N7KA 5FEXA 5U4NA 1H7PA 1JR1A 1F5ZA 3HG5A 1PIIA 3W7EA 2NX9A 4XTDA 1PS9A 1SZFA 1I45A 3CEUA 2E68A 1H51A 3FFSA 3NZ1A 2X30A 1NF7A 1O5KA 3NAVA 3G0XA 2H6RA 3HJZA 5CPMA 2ZYFA 2A85A 1LOQA 4K38A 3ZWTA 3TU9A 4KWWA 1TSIA 1PCWA 3LB0A 3DKLA 1XDMA 2CLKA 4LTSA 4OV4A 1K8YA 4UTJA 1TTJA 3W1MA 3GR7A 1QO5A 2NXIA 3L5MA 4D2JA 3KRSA 6ALDA 4AF0A 2I14A 1H5YA 2ZRZA 4RV8A 4Y6GA 3DZ1A 3L66A 3OEXA 3TIMA 2XN0A 1H7RA 2H8XA 3EWWA 4R33A 5TIMA 1I8JA 3FLUA 4K8HA 3Q58A 3EKLA 1YLVA 4RLIA 3GR8A 2J27A 4FXRA 2E09A 3S1VA 3BLIA 1W31A 4GE8A 1W3TA 4DXVA 3CT7A 3NQDA 1LBFA 1OF6A 1P4CA 3YPIA 1WXJA 5LNUA 2GQ9A 3SFKA 3C61A 4Q32A 3W7GA 3G3DA 4XWUA 1OFEA 5G1TA 2GPTA 3P80A 1B4KA 3BGJA 4FO4A 4BI5A 5KMYA 1S3HA 1MXSA 1ZFJA 5E0KA 1PL9A 4RK8A 1EUAA 4NU7A 1EUNA 1OG0A 1R2TA 4C1KA 4PC8A 3NQ6A 1S5WA 4MIMA 3OVPA 1B3OA 3NOEA 5G2HA 3GKFA 3STGA 2Y7DA 2Z6IA 1W56A 3W2JA 2G97A 3CEPA 4MVAA 2FPVA 3GKAA 4XKYB 1EA0A 1JRCA 3DGRA 3NZRA 4WZHA 1XBVA 3QSTA 3USBA 1BEUA 2E77A 1ZALA 1D3GA 3PY2A 1H7NA 1EIXA 1R30A 4YMZA 4A22A 2V5LA 1WOAA 4OGZA 1ZAIA 2V30A 2C3ZA 2YPIA 1EEPA 2Q8ZA 2B7NA 2E1DA 3M16A 2J24A 1MO0A 4JTEA 1SZGA 4IXHA 1GYNA 3SI9A 5DLCA 3TDFA 1LRNA 1FDZA 3UY7A 3DI0A 3VE7A 5HNRA 2A1YA 4NXKA 1C8VA 2Y85A 3SIZA 3TA6A 3BLFA 4JD4A 3OA3A 1JCYA 3IIVA 4H4IA 3FJLA 3TSMA 2BWGA 5SWUA 1XBXA 4NNAA 3RNDA 3LBMA 1X7FA 1LCOA 3PG8A 4EVZA 3PC0A 1JCXA 5LZLA 4WXZA 5FESA 1LOSA 1M6JA 4IGHA 5G4WA 1TPC1 1MSSA 1VYSX 3NQ8A 3FYOA 2DZSA 3R12A 1VH7A 4A29A 3ABOA 1LROA 3W76A 4O10A 1I2QA 5CPLA 3BLEA 3CPRA 1F73A 3W2LA 5U7SA 4LNYA 1RQBA 5G2WA 5EPDA 2ZZ7A 2QUVA 5I3GA 1WYIA 1KFJA 4K7VA 3RK8A 4EWND 2V5BA 4FNUA 3R89A 3MUXA 3HG4A 3HPZA 2HSAA 2CLIA 1OF8A 1E51A 3ABSA 3LDVA 2NUXA 1I2RA 2PRHA 4AF0B 1OX4A 1QMLA 1SW3A 1GG0A 3KX6A 4KKXA 1VHNA 5DBUA 3MP3A 2ZTJA 4XBSA 1KTBA 3UPWA 3WK3A 5I3FA 4E2DA 3TUUA 1I2NA 1R46A 3W2UA 2CZDA 1JUBA 2NXHA 3NG3A 1ICPA 3I7RA 2A4AA 4LY8A 3KFTA 5D32A 3W87A 2XN1A 4B5NA 4GBUA 3I7SA 3NPWA 4IMCA 2Z1BA 2Q3RA 1OVDA 4ZVJA 3CLMA 4NJKA 4GNJA 3CC1A 3IIXA 5E93A 1YXDA 1IXPA 3S5ZA 1SO4A 4MUZA 4M6PA 3L0GA 5HUOA 1DHPA 2A7RA 5D38A 5FEWA 1W5QA 3W7IA 2CLOA 3O6YX 1ADOA 1WQ5A 3IV3A 1QOQA 3NPUA 4NNBA 4FXSA 4S2BA 5LHFA 2HMCA 3NL3A 1GTEA 2EPHA 3IIZA 5HR7A 1ME8A 4LT9A 2C6QA 2X1RA 5EY5A 3W1XA 4O1DA 4LOCA 4UTHA 1M5WA 3EWXA 1MZHA 4NT0A 3S8HA 3N34A 4UFHA 1GVOA 3PB0A 1TTIA 2G5WA 1LRQA 3M7WA 3B03A 1ICSA 3EX6A 1TPWA 1YADA 1XCFA 1ZHAA 3CIXA 2C19A 3LRLA 3IVUA 1SSGA 4NUWA 1SW7A 1HTIA 1OJXA 4M5PA 2VEKA 3PSWA 3L2IA 3N2XA 5IM51 2WSRA 1A5SA 3F4NA 4H3DA 2V82A 3NPVA 1K03A 2C18A 4MY9A 5KZDA 1I2PA 4UUIA 1SUXA 1QFEA 4X9SA 5EBUA 1G7VA 1S5VA 5DELA 2V9DA 3EWYA 3DFOA 3L5AA 3MHUA 2HTMA 4JEQA 1EX5A 4JTUA 3GAYA 1R47A 4ZQOA 1KM4A 4EF9A 4MKNA 2QF7A 1TPDA 3WFAA 1OFOA 4JS3A 2VENA 2A7PA 4UXDA 3B0UX 4XQ6A 2WSYA 5KINA 4OQVA 5TQLA 2ZQ0A 5EA9A 4MPQA 5CZSA 4UNKA 1DKWA 4O19A 3TE9A 3P61A 3LX9A 1U83A 3LTPA 5LHEA 3W1AA 3UQNA 3TROA 4K7YA 1HL2A 3TAKA 4FB7A 1RQEA 5CGQA 5CKSA 4AB4A 5A8GA 1OX4B 1VCFA 5F2GA 1W5MA 2X16A 3C2FA 2GJLA 3UWWA 3W2MA 3QRHA 4G1KA 1FWWA 2TRSA 1A53A 3C2VA 1OYAA 3HF3A 3IRDA 3P82A 1GTHA 4O1BA 5CZJA 1FWSA 4BWLA 4POCA 1UCWA 2EGZA 4OHQA 3NNTA 2P0OA 1R2RA 3I6RA 1OHLA 4FNSA 2V2CA 1TPB1 4RJEA 1F7BA 1GPWA 2ABAA 3HGSA 2FIQA 2CLLA 1XC4A 3QEZA 1ZCOA 4M6QA 2C13A 4PODA 4FF7A 1Z42A 3EWBX 2DU2A 2P10A 3WJXA 3PM6A 1RPXA 3G3MA 4IX2A 2F84A 3QJAA 3EX2A 3W7DA 3PS7A 3QW4B 3I68A 3IVTA 5F2LA 1H50A 2ZDRA 5A5WA 3FS2A 3W70A 1OABA 1PV8A 2WOQA 5AC7A 3V1PA 1UUOA 3O07A 4IWWA 4O57A 2ZA3A 4UTTA 3WJWA 3PG9A 2ZA2A 2FDSA 3F4WA 5F1VA 2ZRWA 3B04A 5AN7A 2FQIA 3VKJA 2RKXA 1H63A 4M7TA 2QJHA 5BOOA 1T99A 4DO5A 5AHIA 1LDCA 4XZ9A 4NQ1A 1H1ZA 2Y6ZA 3R5EA 2FJKA 4UFJA 4HNTA 3W7RA 2XN2A 2Y89A 2YFOA 3OIXA 3W1NA 3BG5A 4KFOA 4K6AA 1GVRA 1TJPA 3SW6A 4AH7A 2XFWA 3M5YA 3STEA 2QKFA 3CHVA 1R2SA 4A21A 3WK1A 3QMTA 1B9BA 4O1CA 2I9EA 3UPBA 3HGOA 1KM5A 3EXTA 4P2VA 1KM6A 3RLVA 1BKSA 1G4SA 2YCEA 5HR6A 3JR2A 1YTDA 1THFD 1KFBA 1TIMA 2WKJA 4LUIA 3P8JA 3TAOA 3W7MA 4WY0B 1G6CA 5G1YA 1KTCA 1ZENA 4UFIA 1LOLA 2A2IA 1TRIA 3NL5A 2DP3A 2ZZ2A 3QPZA 5LSMA 1W3IA 3RLUA 2YR1A 4UNLA 1O94A 4GWEA 3NYZA 3DKJA 3G8EA 1H60A 4XKYA 4LC8A 5BMWA 5G2IA 2ZA1A 3HOJA 4IPJA 1WOBA 1FBAA 1GG1A 1K7EA 5AC8A 4JTHA 1O95A 4YCOA 1ME7A 4O4WA 5HJLA 1JCLA 2E5CA 2V8ZA 1TQJA 4QSHA 1FDYA 1PVNA 5DY3A 3S9YA 3BPWA 5AYYA 2OJPA 3LCIA 3LOTA 5K4ZA 3BG9A 3NM1A 2QEZA 5L9FA 1DL3A 3UWVA 3DBPA 2JKAA 2CZ5A 5C6MA 4JICA 1EP3A 5KITA 2A6NA 2A5HA 1OFAA 1F05A 2DZXA 2NZLA 5EYWA 4AHQA 4A2SA 3UZJA 1WX0A 4WUIA 2C14A 2HS8A 4N02A 3TNOA 4HT3A 3QMSA 2QCNA 5AHNA 3TQ0A 3EX3A 1XBZA 2GQAA 2EKCA 3RMJA 5K9DA 2X1TA 1YPFA 4XUGA 3W73A 1YXCA 3C3NA 2VFIA 3OVQA 2VOMA 5ABTA 1H62A 1YDNA 3WJZA 3LCFA 1W5OA 3W85A 5KZMA 1L2UA 1ME9A 2QCDA 4BWLC 4GUGA 1SPQA 4CQAA 1V7YA 5BMXA 3G18A 3NL2A 3MJYA 2W79A 2J9XA 3O06A 2NXGA 1LZOA 5D03A 4O0ZA 4E38A 1DV7A 5LNWA 3G1FA 4X3ZA 2B7PA 4RZ4A 3HGJA 4JDYA 3SGZA 3STCA 2F7FA 4E0CA 4Q33A 3W1TA 1LORA 4AWUA 3LI0A 3P62A 4O4VA 4MZ1A 5LNVA 2YGYA 5H91A 1P0NA 4IUOA 1N55A 3PULA 4ZQCA 3G1DA 2GVJA 4EF8A 3L0NA 4UTTC 5H2ZA 4EIVA 1VCGA 4O54A 5FF3A 3FKRA 5AB3A 2H3BA 1GJPA 2ISVA 2YX0A 2WNNA 4ADSA 2NUYA 1KFCA 3HPSA 3OBKA 1PHQA 1ZAHA 2H3DA 1ZAJA 3QQ0A 1SFJA 4NZJA 3G1XA 5L6UA 3FJ6A 1VJIA 3EKZA 2CU0A 4NVTA 2Q3OA 5DCEA 5AYZA 2VELA 1JCJA 5D30A 1B57A 2B4GA 3LCWA 4BI7A 3GXNA 3T44A 3TFXA 1W54A 4R53A 1F76A 3KOFA 3LBCA 4NNCA 2OZ0A 3NQ7A 3O15A 1TV8A 5KTLA 2C16A 3L0KA 1W8SA 4DELA 3N3MA 2NX3A 2CLMA 3A24A 4AEOA 3PSVA 1SQ7A 5FF7A 3W23A 1M7OA 2Z0IA 3CIWA 4O13A 1ZY9A 2R91A 5F4WA 4J9JA 1SFLA 3BV4A 1WAUA 3ANYA 4N4PA 2H90A 1IGSA 2E6DA 4LVGA 4JTIA 5LNRA 4Y8FA 1M7PA 4H6KA 2YZRA 2CLFA 4N9DA 1XUZA 7TIMA 4GUIA 1JCMP 3QF0A 4FEZA 4O52A 1LP6A 3S5YA 1GYLA 4UTLA 3Q2DA 3P8IA 4IQLA 1K7FA 1DORA 3G0SA 1VRDA 4JTJA 2TSYA 3NO5A 1JVNA 3NDOA 2VEPA 4WOQA 4ZZ9A 4CCEA 3E9AA 2VXNA 4N9CA 2VFHA 4MYXA 2ZCGA 1ZJIA 4LVDA 3I65A 2FPTA 3O6CA 1SW0A 3C56A 5K9CA 2ZBTA 3DHFA 2J9ZA 3W07A 2HS6A 1Z48A 1Q6LA 2QCDB 1RD5A 1GOXA 2WQPA 1C29A 2ZZ6A 3QSRA 2YW3A 3HQ1A 5DBTA 3W86A 4UTIA 5IBXA 1NSJA 1C9DA 3S0CA 4OBTA 2QAFA 1QR7A 3M1ZA 5AYXA 2ZZ4A 1QPOA 5E1QA 3QQ1A 1WBJA 4C1LA 4NJHA 1VS1A 3TR2A 3A21A 4I7VA 4HN4A 4FX8A 1X6UA 3N19B 3VFLA 1KTNA 5J5DA 2FB2A 1FWNA 1IXNA 3P74A 1YTKA 3MMTA 3L21A 3O6DA 4OU1A 2JGQA 3NL6A 1D9EA 4FHAA 3Q94A 1K3UA 1GT8A 3P84A 4HNNA 2OX1A 4CNOA 1KFKA 3TXZA 3CM4A 3PBVA 3MP4A 2NWSA 2C0AA 3O63A 4TU1A 2TPSA 4FNPA 3B4UA 3BGGA 3PVFA 5K2ZA 1G4TA 1KFEA 2C1HA 2QR6A 3TH6A 2GQ8A 2X1UA 1GVQA 1SZEA 2ZFAA 4O53A 4U28A 3NGJA 1GQNA 1SR9A 4K8EA 1OFRA 3A5FA 4WOZA 1KM2A 1TV7A 3LTYA 3LLFA 3W6YA 5F2IA 2RDTA 3TC7A 3I7QA 3KVMA 4QNEA 1I2OA 4O15A 4CNNA 3QZEA 3C6CA 2FLIA 2ISSA 2BLEA 4I7UA 4O8RA 3KHJA 1KBJA 4MZ8A 3C8FA 3PUEA 1FQ0A 1A50A 1LBLA 1K8XA 1VYPX 3DAQA 4DF2A 5HWJA 2CZEA 4JTKA 4FX6M 4AWSA 4N6FA 2GUUA 4WXYA 3ABQA 3NQGA 3HBLA 5D02A 1ICQA 3PUOA 4Y90A 3DFNA 1JRBA 2DZVA 2NV2A 4ZQPA 4UTKA 3H54A 4ZQMA 1TREA 3W72A 4X2RA 4O16A 3L5LA 4UTWA 1P1XA 1DBTA 4IPIA 5HINA 2BZNA 4DF1A 3R2GA 4PEKA 4IMDA 4QJ1A 3RF9A 2AQWA 1XL9A 4WY0A 3GDLA 1FXQA 3GDKA 1QPRA 4Z08A 5K3VA 3CTLA 2GJNA 2E6YA 4HIBA 5FEZA 3DI1A 1EB3A 2EHHA 3UXAA 2YYUA 5HMSA 1OK6A 4Y96A 5K7JA 3O8AA 3GNDA 3Q37A 4GC4A 1OX5A 3U6WA 4NJJA 3M9YA 3JS3A 3S5OA 2EF9A 1FUYA 2EAWA 3M5VA 4QISA 1HUVA 1YPIA 3DXIA 2Z6JA 2VEIA 2VFDA 1T96A 5BW6A 1BWLA 3WK0A 4ML9A 2NWRA 2QJGA 2Y61A 1YXYA 4LV9A 4RX0A 4UMAA 4TR9A 1TJRA 1Q45A 4RR4A 1TCDA 5FF0A 3E0IA 1TV5A 3GIYA 5HWNA 2NUWA 1NFBA 2A6LA 4CQ8A 4DPQA 3P7YA 3LHUA 1JCNA 3LM7A 3DENA 4L4LA 3RU6A 2CZFA 4JR5A 5C2XA 1WDWA 2E5BA 4AMAA 3LCXA 4Z1DA 5CZTA 3AO0A 3L65A 1FCUA 3IVSA 3QMRA 4IXXA 1VQTA 3LHZA 4QQ3A 3SECA 5I3JA 3U2OA 1TPFA 5DY2A 3SSJA 3LHTA 3FOKA 2PRLA 2FTPA 2E5DA 4ICNA 5CZ0A 3KVJA 1MEWA 3W7LA 1N8FA 4JX5A 3F1QA 5D09A 1OFQA 1XBYA 4JIQA 2JKEA 3TK7A 4LC6A 2GVGA 1IXQA 3DFTA 3W2KA 1BWKA 1IIHA 5T26A 1TPEA 5I3HA 3LV6A 4JGDA 1FCQA 1L6SA 4M6VA 5I3KA 1U5JA 1J2WA 4N2YA 3N9RA 1L9WA 4DBDA 2V81A 3F03K 1Y0EA 1H7OA 2OT0A 1O5XA 2OT1A 2ZZ1A 1TYGA 3NR0A 4DO4A 1VC4A 3EB2A 1LRTA 1SO5A 5BNKA 4ZL1A 4Z0SA 2G95A 3EEGA 4A2RA 2BX7A 3GDRA 2WNZA 1A5AA 1IIGA 3C2EA 3C0JA 3KAOA 2CW6A 4KWVA 3FEMA 4UC5A 2ATMA 4ALDA 1ZNNA 1YDVA 3TMLA 5D33A 3M43A 4ADUA 1SSDA 1QCWA 2QDHA 4TIMA 2Z2UA 3FA5A 1GVSA 3DFPA 1FWRA 5AHEA 4OT7A 3MWAA 1W37A 1FCVA 3U8GA 3LERA 2ZRVA 2WPBA 1W0MA 1B4EA 1GEQA 1XI3A 1QNVA 3NQEA 1LLWA 1F6KA 5D37A 4MYAA 1KM1A 3W3OA 2RFGA 3BARA 2ZRXA 2TYSA 4MOZA 4CCCA 3TXVA 3INPA 3TQVA 4UTWC 1CX9A 3W7OA 1NVMA 1D3HA 4AAJA 2YFNA 4HKPA 1P5BA 3UZ5A 4ZQRA 1XKYA 1AL7A 1G67A 4PCFA 3DH7A 3W1RA 2E6AA 3M41A 2QCFA 3H55A 1HG3A 1TRDA 2GVLA 4S2CA 3ZR4A 3NM3A 4I7WA 3W83A 4QNWA 3UWZA 1S5TA 3UNDA 4UTUA 4MFDA 3OVRA 4GUHA 2Y88A 3SZ8A 4IMGA 1W5PA 1QAPA 5G5IA 4HNUA 3N73A 3BO9A 1VHCA 3PBWA 2JGYA 3PR2A 3MI6A 3E12A 1Q6OA 3HIJA 3PF3A 2DORA 3IGXA 3C52A 4ONVA 1GWJA 1LBMA 4K36A 5D2YA 3TKFA 3ATYA 2Y7GA 4LVFA 1EWDA 5F4SA 3A22A 1RV8A 3GX9A 1BTMA 4JTTA 3TV8A 3LXBA 3SY5A 1ONRA 4TMBA 1JUKA 4CLMA 4O11A 3STFA 1YYAA 3B0VC 3DFQA 4DPPA 3PAJA 1FX6A 4DF0A 1TPH1 1KV5A 3RFAA 3W9ZA 1VGAA 1NF0A 1WBHA 1PCKA 4NX5A 2WNQA 3NQ2A 3GLCA 3G1HA 1GVFA 3MBDA 4YLWA 1OFPA 1EP2A 1TO3A 2QCCA 3M5ZA 8TIMA 2B7QA 4KFPA 3C4UA 4M19A 4JIPA 2WSQA 3IGSA 3B06A 3LCHA 1AL8A 4N6EA 2YXGA 5EMUA 3TW7A 3NQAA 4LU0A 4JDBA 1UB3A 3W7CA 4O28A 4ZQNA 1VCVA 4IMFA 4LS0A 4U4MA 3B0PA 3KRZA 3NPXA 3B05A 2Y70A 5DCBA 1AW2A 3UWYA 4RZ5A 5MHBA 2JK2A 3HG2A 3DFSA 2J6XA 2WJZA 4N9BA 4O12A 1J4EA 4GJ1A 4FIQA 4RCXA 5GVJA 5J5RA 3A5VA 4UMCA 2Y63A 1JUEA 3QH2A 1O4UA 3FIGA 3HO8A 4MLJA 4UTMA 4GXMA 1G4PA 4O1AA 1SO6A 3UWUA 2NX1A 4JX4A 3EX4A 1VPXA 4WX2A 3W1LA 4X22A 4JYEA 2Y62A 4FNRA 2X1SA 1DJQA 3N9SA 5D04C 4UFKA 1MEHA 2DZUA 5D2WA 1VLIA 3ELFA 4Y9AA 3KRUA 3E96A 5D05A 3HMJG 1YTEA 1OYCA 3KXQA 1AK5A 3LHYA 4LV4A 2YW4A 2C15A 3IIOA 3W71A 2QCHA 2ZTKA 1AW5A 3GDTA 5I3IA 4LW7A 1UUMA 4GRSA 1I4NA 3BG3A 2RHGA 2E6FA 3GAKA 3S42A 3MO7A 5CPOA 2YYTA 1TQXA 2VC6A 1KM0A 3MI3A 4MY1A 1EP1A 1X1OA 3NQMA 4N9EA 2ALDA 2J88A 2ZZ3A 3W1QA 4OV9A 3AJXA 2P1FA 1SU5A 1XFBA 1G4EA 5G4EA 3EWUA 5DN1A 5HUPA 3EXSA 3PWAA 3MP5A 3BVJA 5D2TA 4WD0A 4LVBA 5AHFA 3QYQA 2PRMA 3BW4A 2DZPA 1AG1O 3G1AA 2JBMA 3GVGA 1KW1A 4TMCA 2R8WA 4MJMA 2LLEA 4AWTA 4TO8A 3QC3A 4N4QA 3MHGA 1AW1A 5AC6A 2VFEA 3KVLA 2QUTA 3T78A 3DHDA 3W1PA 4YCPA 1KV8A 4UFMA 1SZNA 2QAPA 1K8ZA 1DJNA 3T40A 3GK0A 3O05A 5LGXA 5LNSA 4PA8A 3TFCA 2ABBA 1DQWA 2FPYA 2A7NA 2PURA 1LTDA 5CSRA 1HFBA 3MYPA 3L9CA 1KFLA 3WK2A 5FF4A 2OMAA 3G24A 5HQEA 2V2HA 4XTIA 1FXPA 5BRBA 1KLYA 5AFDA 1T0OA 4O18A 3L68A 1QDSA 3W7HA 1FDJA 4BK9A 3HPXA 4JXCA 3ZFHA 4I9AA 5F4XA 3M47A 3W2NA 1TPVA 1FWTA 1KBIA 2G96A 3PB2A 1YDOA 4Q4KA 3K30A 3W88A 1Z44A 2BXVA 3IIPA 1L6WA 3GNNA 1OYBA 4NJIA 4Z1BA 1FY6A 1WV2A 1XDLA 3P5YA 3C2RA 3PBUA 1EWEA 3G22A 3PBYA 1H61A 2RDWA 3HB9A 3M44A 3BW3A 3LXCA 3EWZA 2NLIA 2W6RA 4PH6A 3HG3A 2PCQA 1JJKA 4PL1A 3UY8A 4ADTA 4JY9A 1A5BA 3VI2A 5CPNA 1X8FA 3ATZA 2QCEA 3CB8A 3V75A 2AAMA 3GXTA 4WQ6A 1DVJA 1K02A 4AHPA 4JN6A 1DQXA 3W22A 1VZWA 2FFCA 4ORIA 1G69A 3QPYA 5AOUA 1VYRA 4K37A 4BR1A 2GOUA 4WJEA 3G1YA 1QOPA 3LRKA 2ISWA 2Y7FA 3NA8A 3ZS4A 3MI2A 1OK4A 3WJSA 2DJLA 5F2MA 2AGKA 5DXXA 4QIUA 4P61A 5FI8A 4AHOA 1F74A 3CU2A 4NX0A 4UR8A 1CI1A 5KZEA 5C5YA 5K4XA 3GZ3A 1ML1A 1RQHA 2RDUA 3ZWSA 1VR6A 3LV5A 4BI6A 4FX7A 3UD6A 1L6YA 4JYFA 4BFAA 4PTNA 1EPXA 3S1UA 4AXKA 1W5NA 3HGRA 5EL1A 3IEBA 2CWNA 1IF2A 2O7QA 3W7PA 3W84A 4JTGA 1F2JA 2IQTA 1H1YA 4OWGA 1HO4A 4RZ6A 1ALDA 3MBFA 4Z1CA 3SGUA 4NXSA 2WV8A 4FIRA 1HO1A 1JULA 4MZYA 3GDMA 3D0CA 1W1ZA 3CQ0A 2RH9A 2DJXA 3QM3A 3WJYA 1VLWA 4LS1A 2DZWA 5K9XA 1H7XA 3LCGA 2PE4A 5F1UA 4IJBA 3M5XA 4LRSA 1XM3A 4QITA 4M7SA 4L4MA 3GXPA 3NXFA 3S6DA 3THQA 3W7QA 4DBEA 2J9YA 3NQFA 5CG7A 3VE9A 3TSBA 6TIMA 2V2DA 4GUFA 1PHWA 3CWNA 1OFDA 3LCLA 2ZRUA 4K39A 4UIOA 1G7UA 1TMHA 4CCDA 3UWQA 3DU0A 4JX6A 2BTMA 2QCLA 1O60A 5FF2A 4OE7A 1TTPA 3ABRA 4GFSA 3N2MA 3GB6A 1IXOA 1JQXA 1QO2A 3R13A 4QAIA 2W0UA 1LLZA 3W74A 4IOTA 3IGUA 5CSSA 3TQKA 3E02A 1DOSA 1TTQA 3SJ3A 2OCZA 3LHWA 5HULA 4PFMA 1J5TA 3S5NA 3TMQA 5IBXC 1LM1A 4HPJA 2R94A 3NEVA 2H8ZA 5AHMA 5HWMA 2R14A 3A23A 5C54A 4R7JA 3NVTA 3T55A 1F6PA 4LS2A 3P60A 3GYEA 5DXYA 3O16A 3G8RA 2CFFA 2ATSA 1AMKA 3TX9A 1NAL1 1LYXA 3TJXA 2D73A 3T7VA 3LRMA 1KA9F 3M6YA 2FB3A 3TJLA 2QUUA 3TW6A 4RKAA 3C2OA 4HPXA 1XXXA 3P67A 4CQ9A 3CWOX 2NV1A 4MLRA 3A9IA 2I1OA 5FEPA 4LVAA 4JTSA 4HSNA 3T4CA 4A3UA 3KVKA 1A5CA 4AVFA 3UXDA 1TB3A 4R34A 1QWGA 4LUJA 5DCDA 1PE1A 4YXGA 2JKPA 3VNDA 1GZGA 3MHFA 4ORMA 1UJPA 4RXFA 2Q8LA 1V5XA 4XBKA 3TCEA 2KZHA 5KSWA 3LHVA 2A21A 3LI1A 5LKYA
chains in the Genus database with same CATH superfamily
1ZBKA 2X41A 3R8RA 1OD8A 3V0SA 3G0UA 1V6VA 1UASA 3S1WA 2BP1A 1ECQA 5LA2A 2VEMA 3N04A 4FNTA 4Q8PA 3WY1A 2B81A 2CLPA 3V7PA 2ZC1A 4GUJA 3OLDA 4DZAA 4HQVA 3S2CA 1MFVA 2QLYA 3H70A 1W3NA 1HX0A 4MWAC 1FCBA 3SN4A 5FL0A 3C0QA 4KGLA 3WFLA 1NWSA 1M65A 3TC6A 1UG6A 3S9IA 3IUDA 4RXGA 4UQEA 4YVPA 2YSWA 3TA9A 1Q7QA 4KH2A 5LGZA 2TODA 2B7OA 5IFPA 2E28A 5REQB 1MFUA 4QSFA 2PDMA 4ZMGA 4MG4A 2YBVA 1D7FA 4NZ1A 4PL2A 3SCSA 2CWXA 1F4HA 5FIPA 4K68A 1BF6A 3FKKA 4J3ZA 3PUGA 4AD0A 1T5AA 1HQTA 3FYPA 1XIJA 1RR2A 1PDYA 3G1VA 4G7FA 3OG3A 2QCGA 1KGWA 5H8MA 4L7ZA 4AWEA 1V7AA 4H9MA 2PDGA 2MNRA 1I1XA 2I56A 3MYOA 4HNVA 5D2VA 2DZBA 2YDAA 4GX8A 4ASTA 3R25A 1R87A 4XZNX 1UBSA 2W5FA 3L67A 5A3HA 1Q6FA 4GGBA 1TJ1A 1UMYA 3QN3A 3ZYZA 4EE9A 3U4FA 3W7NA 5A6AA 4JEJA 3UYCA 1KLZA 4LBUA 3ABXA 3AHZA 3EEZA 4Z1AA 2QUNA 5FEXA 1JR1A 4A3YA 2AQOA 1Q7MA 2TAAA 3PZMA 2GK1B 1NF7A 3NAVA 3TTEA 2H6RA 1REQA 3HJZA 3S2NA 4KWWA 1V4YA 2VRJA 1WDQA 4PUKA 5KEZA 4Q4RA 1Q4WA 2HEJA 1UD4A 4XZMX 5I6SA 1ODZA 3H24A 2NXIA 4LUYA 4OIFA 2WNWA 4D2JA 4J2MA 3R8HA 1FWHC 2XUCA 4HJWA 3DZ1A 3L66A 1X96A 2XN0A 3GDBA 3EWWA 1FP8A 2XVNA 3M6DA 1PIFA 5C8BB 3BMXA 4K8HA 3Q58A 4KWOA 3CUFA 4RLIA 4G7EA 2BY3A 3VUPA 2X0SA 4AD1A 4GNKB 1IZKA 2WCGA 3S1VA 1LF1A 3C86A 2NW0A 3CT7A 4DXVA 1OF6A 3YPIA 3UESA 1WXJA 3COTA 4IP7A 5CBBA 1BVWA 4Q32A 3W7GA 1OFEA 3CUJA 3V4BA 5G1TA 2W27A 2XH2A 3KRBA 1B4KA 3BGJA 4AD2A 3V18A 3V35A 4BI5A 1G94A 1OC6A 5E0KA 1PL9A 1HJXA 4RK8A 1JDEA 1R2TA 3PPCA 5AZ1A 4C1KA 1S5WA 3FSTA 4W86A 5G2HA 4M3PA 3U57A 3OPSA 2Z6IA 1W56A 4PUEA 3MMWA 2G97A 3CEPA 5CG0A 2HNHA 3CT2A 4XKYB 1EA0A 4D8AA 3H22A 3QSTA 3FW6A 1JZ6A 1D3GA 3M07A 3PY2A 1C3FA 3AXMA 4RW3A 4XISA 4YMZA 2V5LA 3LPOA 4G6CA 2C3ZA 1JZ7A 1S5MA 1AD1A 1EEPA 3PBGA 5CH9A 1UPMB 1GYNA 4XX6A 4Y9PA 2NV9A 4DI9A 4GIAA 1LRNA 1FDZA 3UY7A 1CXEA 1BXCA 3VE7A 2WC4A 3MKVA 5BRQA 4AIBA 4C6QA 4Z42C 3UVIA 2CBJA 5GQBA 1EO7A 4GNVA 4PUWA 4H4IA 1W3JA 4PRTA 3RRAA 2GYIA 4C6BA 1K6AA 5C71A 3WH9A 1LCOA 2PLKA 3SCWA 1JCXA 5E0CA 4H8UA 5FAGA 1TG7A 1F8IA 1TV3A 1YE4A 4IGHA 3BQ6A 1MSSA 3NQ8A 1MMFA 2DZSA 4IFKB 1RHCA 4D6DA 1REQB 3OLIA 5CPLA 4BEUA 4QROA 1F73A 3W2LA 5U7SA 5AECA 4LNYA 3BTNA 5EPDA 2ZZ7A 2QUVA 3GY1A 4QE4A 2VX5A 3PNUA 3MUXA 2DPEA 3HG4A 3HPZA 2HSAA 4U10A 1PZ2A 4WKHA 1JYNA 3ABSA 1I2RA 3SM0A 1OX4A 1SW3A 3PZTA 2V6AA 3WUFA 3MP3A 3P3BA 1LUCB 1XP3A 1KTBA 1MUWA 3CAWA 1S5NA 3TUUA 4GQGA 4G7EB 4KBXA 2YDQA 3NG3A 1ICPA 3I7RA 2BOEX 5EMLA 3W87A 2XN1A 1WZAA 3AALA 2YLLA 4GZ7A 4GBUA 1MW1A 2Z1BA 1UZ4A 2Q3RA 1EXPA 4MUPA 2YA1A 4JQAA 4GNJA 2AGTA 2CCRA 1TIWA 3CC1A 3MVTA 5T9BG 1IXPA 3S5ZA 2DDXA 1UKQA 3RDKA 1VBHA 2NSXA 2A7RA 2J6VA 1J0KA 4GK8A 3QHMA 1PIGA 2VX7A 4NNBA 3AI0A 5CGMA 3H2FA 5HR7A 3L4YA 2C6QA 5EY5A 3K2GA 2DH2A 3WQOA 1MZHA 3LA4A 2XFFA 3AICA 4LF1A 1CGYA 1IE7C 2F6XA 5BXPA 3KZPA 1GVOA 3KEHA 5FJIA 1JPDX 1TTIA 5A1AA 4JQ1A 4A4AA 4GKTA 2FZBA 1YADA 1XCFA 1ZHAA 3K46A 4NUWA 1SW7A 1HVXA 1I0DA 2VEKA 1R3VA 2VCBA 3L2IA 5IM51 3TYZA 3F4NA 4J4KA 4LX4A 2DVXA 3GG1A 3MO4A 4ZENA 5D8WA 3RR1A 3GUWA 2C18A 2PDKA 4MY9A 4DJDA 2CBIA 4UUIA 2E9MA 3UA4A 1RPKA 1V8EA 5DELA 1CB7B 3LNPA 2ZIDA 2V9DA 3EWYA 5FJUA 3CAVA 4YYCA 3MHUA 4JEQA 4CQDA 4NZ4A 2MUCA 3CV6A 3B9DA 3ARYA 4FLRA 2A3CA 4CQCA 1E4LA 1JXKA 1DE5A 4EF9A 3PNZA 2XIBA 4FK9A 3RLHA 1ITUA 4QE1A 4XQ6A 2J7GA 4C5YA 5KINA 2I17A 1PWLA 4ZOEA 2V5CA 3W1AA 3OZOA 5CGQA 2VURA 1ISWA 4LAZA 3T2OA 4AIUA 1OX4B 1VCFA 1L8NA 4RZBA 1JYVA 5CXPA 4ML4A 4HYWA 4PUMA 2J7BA 2L5HA 3BMVA 2PD5A 3LG3A 1W9PA 3ITTA 1UR9A 4D6HA 1CENA 4M8UA 2EGZA 2P0OA 3DC0A 4FNSA 4XAGA 4IJRA 1TPB1 3HGSA 1YE6A 4C6EA 4ZFCA 1XC4A 2DQXA 4AZ7A 2WM0A 1ZCOA 1Z42A 5CPTA 4IX2A 2IPFA 3EX2A 1QI2A 3MUCA 1IT7A 3IVTA 3VOIA 4BQ2A 3U2CA 2WOQA 4LAMA 1JD9A 4FOUA 3VCCA 4YTTA 5F1VA 5AN7A 3CAQA 4CNSA 2RKXA 4M7TA 1RLDA 4ZCWA 1G01A 4W88A 3QR3A 1H1ZA 2Y6ZA 4H2HA 2FJKA 4DJFC 2PU0A 3E1F1 3OIXA 3W1NA 2VDHA 3KOWA 3BICA 2PCEA 3W82A 1EZWA 1UKSA 1RCOB 1UA3A 4E4UA 5I03A 3ZT5A 3WK1A 3QMTA 4AEFA 3UPBA 5HNUA 3VIGA 1KM5A 3EXTA 1QUMA 1HZYA 5HR6A 2QVNA 1UBPC 4QLLA 1TIMA 5A94A 3O2LA 4QJ4B 4WY0B 1G6CA 4XZIA 4GI6A 4HPHA 1ZENA 2A2IA 3NL5A 1XSKA 1CGTA 3QPZA 3NZQA 1ZQ5A 2YR1A 1GK8A 4GWEA 3CHFA 5CPQA 4ZOBA 3DKJA 1TKKA 1A3WA 4IPJA 2E8YA 3CJPA 1WOBA 2E67A 1FBAA 1TWDA 4O4WA 5HJLA 3ZMRA 4AD3A 3UF9A 1W17A 5C9XA 3QLLA 4HA4A 2E5CA 2V8ZA 4GI9A 4FF5A 4DUWA 1PVNA 3BPWA 5AYYA 5K4ZA 3NM1A 4AZGA 3GXMA 2JKAA 2J79A 1EP3A 5KITA 2A6NA 1C93A 5I24A 2ZDSA 2NVCA 1XICA 2FYMA 3UZJA 3VKAA 1E6ZA 1UP2A 4ZGYA 4C6OA 2PDHA 1W2PA 3AXHA 1KXQA 2PDFA 2C14A 1X6LA 1QWKA 3RMJA 2D2JA 4GQQA 4NY2A 2X1TA 1OGSA 1YPFA 3WQEA 5CBIA 3CBWA 1POKA 3OVQA 2FHFA 5ABTA 1H62A 4PB4A 1W5OA 1P6WA 4B91A 2PP3A 1TX2A 1DWFM 3OZYA 3SGGA 3NL2A 4A8IA 3MJYA 2C79A 2E9LA 3S6TA 4AY1A 4O0ZA 4X3ZA 2B7PA 3LBOA 4DWDA 3HGJA 5H8UA 1XV8A 3SGZA 1W6TA 2F7FA 1KR1A 3EA3A 1WPCA 3TZNA 4K8GA 4O4VA 1W1YA 4MZ1A 1EFZA 1S38A 3PJTA 2BDQA 4ZQCA 4GLEA 4EF8A 1O1HA 4DZ5A 1PDZA 3T0BA 3GR4A 1XX1A 1W1TA 5FF3A 4XD6A 3KBMA 2HBXA 3VFCA 1NP0A 1ZAHA 2X7VA 1ZAJA 3QQ0A 3TLLA 3QZAA 4XSLA 5CBJA 1UOKA 1Q2SA 4WJXA 1AD4A 3G1XA 5L6UA 4JKMA 3EKZA 2CU0A 4Q6JA 1A5LC 2Q3OA 1A4MA 1UD8A 1IEVA 3SCNA 1B57A 3LCWA 4BI7A 3PBMA 1YEYA 4J1OA 3BSHA 4R53A 4DJDD 1F76A 3KOFA 2Q6ZA 3NQ7A 3WLNA 3SCUA 5BOEA 2C16A 4UQAA 1NOWA 4DELA 3EDDA 2I7GA 5M1TA 1X39A 1RH9A 4QLJA 1SQ7A 2Z0IA 7REQB 4J9JA 3UZZA 1V79A 2WZHA 1EJSC 1A4LA 2VZUA 1K9FA 1JD7A 4N4PA 3DG6A 2H90A 1IGSA 1KXVA 3GRIA 1GQIA 1DHKA 4JTIA 5A8PA 3QY6A 9RUBA 5I07A 4Y2WA 2XINA 3VDCA 2CLFA 4N9DA 3UZWA 1NY1A 4UTFA 3WELA 1QI5A 3UPMA 4LSBA 1TWSA 4HN8A 4QS6A 1EX1A 5EMMA 4QR6A 5DMNA 7PTDA 2VXNA 1XLGA 3H7UA 1TZ9A 4C1NA 4UZSA 1SW0A 1UP3A 2ZBTA 3ZM8A 2FGLA 4J35A 2J9ZA 4JQ3A 1OQFA 2HS6A 3TJIA 2OEKA 1K4HA 4YTRA 1HL9A 3EAUA 2YL5A 1C29A 2PDPA 2YXOA 2ZZ6A 2DT1A 5FJOA 1V51A 2CKSA 2O56A 1RY0A 4PE8A 4U33A 4UTIA 1NSJA 4X2PA 1F3EA 3M1ZA 4Z17A 1RUSA 1J5SA 1TWWA 5E1QA 3QQ1A 3AC0A 4HTBA 5ECUA 1VS1A 3F2CA 4CU8A 4I8DA 3ZT6A 3ZJ6A 2FDMA 3CO8A 1HP4A 1JPMA 3ZR6A 1IXNA 3HZ3A 3O7UA 4OU1A 4MB4A 3B97A 4FHAA 5DMMA 3APTA 1GT8A 4GX9A 1PUDA 2A3EA 2ISFA 1IWBA 3PBVA 3C5QA 2C0AA 4FNPA 3IK2A 3F5JA 5I02A 2YBUA 3B3DA 3B4UA 5K2ZA 2C1HA 2QR6A 2GZXA 5EMKA 8A3HA 2Z28A 3NGJA 3W29A 2XTKA 4K8EA 1JNEA 3A5FA 3LLFA 4EKJA 2RDTA 3AXXA 4QNEA 4GMEA 2QZRA 1I2OA 4DUOA 4O15A 2W92A 2CBVA 4PULA 4MZ8A 3PUEA 1FQ0A 1K8XA 4H9YA 4CU7A 1FOBA 1SFTA 3IJ8A 1Y5VA 1CLVA 4AZCB 2R9RA 3ZSTA 3MCNA 3ABQA 4PMRA 2FZNA 4MWAA 4Y90A 3AYTA 5GJMA 3DFNA 1W1A1 2DZVA 2NV2A 4AXNA 4UTKA 3H54A 4JFSA 1TREA 3KHDA 4G1NA 4O16A 4UTWA 1GYMA 1DBTA 5HINA 1R9ZA 4S3JA 3OG2A 4WF7A 4DF1A 4Z2JA 2WANA 3AMKA 4IMDA 1OZMA 3RF9A 1XL9A 3GDLA 4GPNA 1FXQA 2XZ9A 4G9PA 1S3TC 2OO6A 1EC8A 5FCZA 2CZVA 1QPRA 5J8LA 2E6YA 4C1NB 4KRZA 3W27A 5HMSA 1OK6A 3GE7A 3BWWA 3O8AA 3Q37A 4A3RA 4GC4A 1OX5A 3U6WA 3B8TA 2DSKA 2EF9A 2EAWA 4Z2IA 2PA6A 2D1ZA 1I0BA 1W32A 2PWDA 3EMZA 1KB3A 5BW6A 4IFRA 5JIWA 3WK0A 2QJGA 3CK5A 2YCLB 2Y61A 3RO6A 3OHMB 1R5YA 3N11A 3WUBA 4CU6A 3UT0A 1TJRA 5B7YA 4FOKA 3E0IA 1TV5A 4CN6A 2CKRA 3T0TA 5HWNA 3B9OA 1XLIA 2A6LA 4XZWA 4L1XA 4CQ8A 4DPQA 1B3XA 1QNRA 4UOZA 2WK2A 3REQB 3SCPA 4FR6A 3DENA 1XYMA 3D3FA 3UJEA 1Y65A 4Z1DA 3L65A 1FCUA 4IXXA 3LHZA 3U2OA 1T8QA 5DY2A 3W00A 3LHTA 2VOTA 1QI4A 4MF4A 4ICNA 3VDHA 2BS9A 2HZGA 3VDGA 4JIQA 1XG3A 3R0DA 4W5ZA 1H2JA 2OLAA 4I6VA 3W2KA 3WLHA 1IIHA 4XD3A 1TPEA 4GO8A 2D2GA 1A3HA 4J3VA 1V0MA 4LAOA 4IGMA 1L9WA 1H7OA 3B0XA 2OT0A 3WCZA 2ZZ1A 1W9XA 1E1FA 4ZL1A 4MKVA 2G95A 2REQA 5I06A 1E40A 4A2RA 4A05A 4RPPA 3WLPA 4CUCA 3T05A 2HPMA 2CW6A 4KWVA 4UC5A 4I5UA 2ZXQA 4KCTA 4PUDA 2DSZA 3MCOA 3KWXA 1P43A 4ADUA 1SSDA 3DOPA 4MWAB 2J7HA 4GY7A 4H7ZA 3FA5A 5KZ6A 4LEFA 1J0IA 2PDYA 4OT7A 2D2OA 3FN9A 4QDMA 3U8GA 1ONEA 1DWAM 3LERA 4D71A 1VIWA 3PTQA 1XI3A 3T8LA 2PLCA 3L7RA 1LLWA 2YL6A 4MYAA 1VFTA 3W3OA 1DYSA 2RFGA 4MOZA 1T7LA 1PX3A 4GC3A 5JBEA 4CCCA 3RILA 4C6NA 3BCJA 1X1NA 4ATWA 2AMXA 1KCKA 4Q8TA 3LUTA 5XIAA 1AL7A 4PCFA 2E6AA 4O1FA 4S2CA 1TRDA 4OUIA 3BAIA 4MB5A 4S3FA 1EYWA 1MQQA 4QNWA 3HJEA 3UWZA 1S5TA 5FA5A 4C65A 2Y88A 3MMDA 1W5PA 1QAPA 7A3HA 3N4FA 3PBWA 4PZVA 3E12A 1QOXA 3PF3A 3IGXA 3C52A 4GZJA 1DP0A 4S3CA 4XAYA 5F4SA 3A22A 1BTMA 3KCOA 1OC5A 2YCKX 1ONRA 4GQRA 1S46A 4O11A 1YYAA 3DFQA 1ZJHA 2VTFA 1KO0A 1SJCA 5HPCA 4BQ4A 1QRQA 1PJ9A 2BXZA 1V6TA 1FX6A 4DF0A 3AZTA 3WDIA 1E6RA 1KV5A 2NQ9A 4QG8A 1NF0A 2RJHA 4HOXA 3NO1A 3NQ2A 2DSUA 3GLCA 1W3HA 4YLWA 1OFPA 4IM4A 1EP2A 4GVGA 3SQMA 1TO3A 3M5ZA 8TIMA 3NXLA 3UVAA 5GNYA 1ZL1A 3A13A 5JH2A 2JQXA 2VX4A 4RNIA 2WSQA 5D9PA 1FH7A 1AL8A 4N6EA 2A3AA 2YXGA 2WCSA 1TV2A 2QPSA 3E2VA 4JDBA 3SUUA 1UR4A 3B0PA 1Z3NA 1H5VA 3B05A 5DCBA 1AW2A 1B54A 4BY3A 4RZ5A 2PDLA 3CYVA 3AIWA 5LIWX 2JK2A 3HG2A 4L6OA 4F2BA 2J6XA 4ICMA 4O12A 5GVJA 2Y63A 1JUEA 4TQTA 3FIGA 4TVCA 1V3MA 4UTMA 5A8MA 3VNKA 4O1AA 1PKMA 1N82A 2WHKA 2VC9A 3GVRA 1K9EA 8XIMA 3IUHA 4X22A 1WDRA 3KDOA 2Y62A 3WH7A 4MWAD 3BJTA 3ZO9A 3WLRA 3E96A 3HMJG 1YTEA 3KXQA 1HP5A 1XH1A 3LHYA 4LV4A 3MC5A 1W9DM 2YW4A 2C15A 4IHCA 1BG4A 3LMZA 3IIOA 3SIMA 3W71A 2ZTKA 5I3IA 3PFMA 2V3FA 3RIKA 1JDFA 2GWGA 1EQCA 4GRSA 2DZAA 3BG3A 2RHGA 3MO7A 5CPOA 3CPUA 2YYTA 4H7VA 4EPEC 1KM0A 1AJ2A 4EXQA 1EP1A 4WDTA 3CQKA 3NQMA 3K8LA 4M82A 4GA8A 3AJXA 4HU4A 5G4EA 1EOMA 1YX1A 5HUPA 2Y4SA 3EXSA 3MP5A 4NILA 4DBUA 4JTRA 3K4WA 3RLGA 4ZO8A 3BW4A 3W0KA 1TR1A 3WMBA 3CZEA 5M5DA 3AMLA 2R8WA 3HQOA 5D9OA 1TMQA 3V5OA 3QKEA 1OM0A 2XIIA 1GKRA 3MHGA 1GNXA 1A5OC 5EFFA 2FH8A 3TN3A 1BHGA 4OTKA 4UZUA 3UXKA 4RNJA 3DHDA 3W1PA 4YCPA 5CC5A 4LALA 2BODX 1SZNA 3T40A 2O4QA 2ABBA 3RPTA 4PRRA 2X0HA 2A7NA 2PURA 3GS6A 1LTDA 5C9RA 1HFBA 3MYPA 3L9CA 4JCLA 1J11A 1FH8A 1YPXA 4FOJA 4XTIA 5JIPA 4PMQA 4YIWA 4FALA 1EC7A 4EANA 3W7HA 4JXCA 4I9AA 2P5NA 5HAOA 1E9YB 4ACZA 1TPVA 5C9UA 4U3AA 4QHRA 4GQBA 4Q4KA 1SJDA 2ZUMA 3K30A 3W88A 4OBRA 7TAAA 1KCZA 1L6WA 3WMSA 3GYCA 1WV2A 2HK1A 2J4GA 2I5QA 3PBYA 1PYMA 3M44A 3EWZA 1JJKA 3UY8A 4ADTA 4GINA 2ZX8A 3V75A 2BVTA 4ZA0A 4F0MA 4E5TA 3RM9A 4DLMA 2KAUC 4PBEA 1NWTA 3HV8A 4D6CA 5M3WA 5DO8A 3VIIA 4AYSA 3KL3A 2W62A 3ITLA 2VCCA 3QPYA 3UGRA 4BR1A 4F48A 1UZHA 4GYFA 1CGUA 3PZVA 1QOPA 3NA8A 4L9ZA 1XGDA 2VGFA 3EOUA 5DXXA 2WVUA 1JZ8A 1BYBA 1JZ2A 1F74A 4UR8A 5CAKA 4HOZA 1PX8A 1RQHA 4BI6A 3A4WA 4BFAA 5KETA 1CECA 4REQB 2Q71A 2QNEA 1L6FA 1OGBA 3HGRA 3IEBA 3UZXA 4JTGA 4I9TA 2Z29A 1Q6CA 4HYRA 1V6YA 1SZRA 1F2JA 2POZA 4XG1A 1DXIA 4ZEPA 4Z2LA 4RZ6A 3UR7A 4JOMA 3MBFA 3VO0A 3HM7A 2WV8A 3JU2A 3WLLA 2Z7KA 4QRNA 4PUUA 1PYFA 3CQ0A 2VI0A 1UWTA 3WJYA 4KIRA 2DZWA 4DNMA 4E4FA 5K9XA 3G6MA 1DE6A 2C1GA 4GIYA 2X05A 1E4MM 4LRSA 1NOFA 3GXPA 5BXSA 4AYGA 2ZWYA 3SY1A 4C6KA 1QVBA 3TSBA 3R58A 5H8PA 2QMJA 4UIOA 1E4IA 4CCDA 3UWQA 3DU0A 3KBWA 4JX6A 2BTMA 4LANA 4NASA 3VGDA 3EDEA 1TTPA 1PB0A 4GFSA 1IXOA 1OADA 2W0UA 2PDXA 1TUFA 4IOTA 3OZMA 5JMUA 5CSSA 2VNCA 1PZ3A 4C60A 1DOSA 3GTHA 3TTYA 2W3ZA 1TTQA 3F4CA 3SJ3A 1XRVA 3DUGA 5HULA 1J5TA 1B3VA 4JHMA 3NEVA 5HWMA 2R14A 5C54A 4R7JA 3T55A 4NAEB 3OGSA 2WZMA 2CFFA 5EB8A 1WKFA 2ATSA 1NAL1 3DESA 2D73A 3TJXA 3T7VA 3LRMA 4QE5A 2YB1A 3TJLA 1ZBWA 1PXGA 4B4HA 1F3TA 3UW6A 3BAKA 3TN4A 1G0CA 4M24A 1EBHA 5FEPA 4WK9A 3FK4A 3AYRA 2G3JA 2XJ7A 3VMPA 4JTSA 4IH3A 3T4CA 3UXDA 1LQAA 1EKOA 4YXGA 2G0WA 2ISDA 3ONBA 3SJNA 4RXFA 3VKBA 1ZS2A 4YVVA 3TCEA 2KZHA 1MNSA 3S83A 3WH5A 3UG3A 1UWAA 2VYOA 2OELA 4P8XA 1OCQA 4Q8MA 3BW2A 2VFFA 1RVGA 1WA3A 4TXEA 4IIBA 2VKZG 2FZMA 3VIPA 2AL2A 3CV7A 1ITCA 3MY9A 2JALA 4WRHA 3AFBA 1K7XA 3LLDA 3K4DA 3AU2A 3THAA 3TP4A 2Y7EA 1E9LA 1F4AA 2BHUA 3AYSA 4S1FA 3R11A 2UV8G 3G1RA 3S1XA 2FMOA 2B0MA 1H7WA 3TTOA 1E9IA 5GJNA 4UQBA 3NJ3A 3PWIA 3WENA 3BAYA 3G77A 4FNQA 4A3HA 2VR4A 3B9EA 1XLHA 3LD5A 2WVSA 5BU6A 4KFNA 1A5MC 2XSXA 4E2BA 3LGEA 2VX6A 2ZRYA 4UFLA 4DQWA 1QTWA 5JVLA 3GXIA 2FZDA 4TX9A 1R3RA 4IX0A 5JU6A 3H53A 4W5UA 3NFUA 4PGLA 3M7SA 3B8DA 4L9YA 5HMEA 1T8XA 3PUDA 2GDVA 4LCQA 4HSOA 4A35A 4DO6A 1UJQA 3LQGA 3OW1A 3MANA 4JNMA 3N14A 1SO3A 4PRWA 4G2DA 3E0WA 1Q6RA 4B16A 2WBGA 3EX1A 3P5ZA 5XIMA 2BSLA 2O55A 2ZUTA 2V68A 4M81A 1MEIA 3VCRA 3P81A 3W7JA 4IPNB 3QW3A 4J40A 2CLHA 5IDIA 3UJSA 1W9BM 4P7QA 1ZRQA 2AOSA 3TSDA 4MY8A 4US6A 2Z1KA 4YL2A 3U3HA 2VFGA 3GW0A 2WZIA 2D0FA 4MJ2A 2WYSA 3W24A 1NEYA 3CUXA 1N7KA 1BVNP 5U4NA 1BXNA 1PIIA 2NX9A 1BG9A 1H51A 3FFSA 3NZ1A 4FPSA 2BGNE 3MSDA 3G0XA 5FJPA 2A85A 2VR5A 1PCWA 1XDMA 4PB3A 3Q65A 2DIEA 4Q7BA 1XPYA 1L2QA 1H5YA 2PDBA 4CKQA 3LZ3A 1VFUA 2OODA 3TIMA 2BVWA 2H8XA 4P8UA 4DJFD 1HGWA 3H4XA 1I8JA 3FLUA 3UA3A 1YLVA 1VJZA 1IR2A 1R86A 1SJAA 2F2KA 4D8ZA 2GL5A 3GR8A 2E09A 4Z2GA 1W31A 4GE8A 3VGBA 3BLDA 3RM4A 5LNUA 3WUGA 3L2MA 3SFKA 1MVYA 3G3DA 4XWUA 1C8XA 4IISA 3QV8A 5EMYA 4J3SA 3M0KA 2GPTA 3EMQA 1OSEA 2ZX7A 1ZFJA 3DDMA 3PPGA 3IUIA 4W89A 3NQ6A 1XIIA 1ENUA 3OVPA 1XLDA 2AMGA 2IW0A 2CXGA 1XJBA 1AH0A 1U2YA 4MVAA 3GKAA 1IV8A 3GW3A 3OTRA 1JRCA 1EGVA 5JUVA 1MI3A 1XLLA 3NZRA 1XBVA 1P6CA 1PTAA 1TVNA 3K8KA 1H7NA 1EIXA 1R30A 1BLIA 3VPLA 1UUQA 1ZAIA 4S39A 2V30A 1LWIA 4IXHA 3SI9A 1TVPA 5DLCA 1PO9A 3TDFA 3DI0A 5HNRA 3HQNA 2Y85A 1FWCC 4W8LA 3OA3A 1JCYA 2OKTA 2BWGA 5MKGB 2DT3A 2X0YA 1DWJM 5LZLA 1LOSA 1OCJA 5G4WA 1TPC1 4E3TA 1RCQA 1UWRA 1LROA 4O10A 2Z2AA 3CTTA 1M1BA 4HHHA 1RQBA 4K2SA 5G2WA 1F07A 4ZXLA 3N2BA 3CYJA 3ZQ9A 1KFJA 2OLHA 1ZZMA 4K7VA 4EWND 1TZ7A 1EO5A 5TF0A 3URBA 2D2HA 3VMOA 1XD0A 4ZFMA 2WMIA 3LDVA 2PRHA 3WZ0E 1EJUC 1NDWA 1QMLA 3IJIA 1GG0A 4KKXA 3CWHA 1CIUA 3UPWA 1CLKA 3UCQA 4AC7C 1H0IA 1R7OA 2CZDA 2NXHA 3T0AA 4LY8A 3KFTA 5CAHA 2VGGA 4XD5A 2QPXA 5CLWA 1A47A 4JNYA 3NZGA 5E70A 4ZVJA 1S2AA 2WXDM 4NJKA 3WF1A 1AQHA 1QJWA 1TJ0A 2I9UA 5E93A 4MUZA 3OBEA 4M6PA 5HUOA 5D38A 5FEWA 1HJSA 1W5QA 2JEQA 3O6YX 1XG4A 3Q45A 3NOYA 4FXSA 1D7KA 3ITYA 4P7LA 1ME8A 3VA8A 1LT8A 1LQ0A 2W9MA 2OYLA 4O1DA 3W1XA 3WLQA 4NT0A 4G8TA 4IP4A 3H2MA 4F66A 4GH3A 2ASHA 4UWMA 4F9DA 4IG2A 3PB0A 3THUA 1R3SA 1KRAC 3GFYA 3M46A 3EX6A 1TPWA 3ARVA 3LRLA 2IS7A 2WSRA 4H3DA 4E6MA 4ICCX 2DY3A 1MRAA 2ACSA 5KZDA 2OKOA 3BAJA 3QGAC 1QFEA 2XSAA 3QTPA 2ZVIA 3ES7A 3NSNA 4QJ5B 3L5AA 2HTMA 1XQKA 4NRRA 1S2TA 4MAZA 3KOYA 1ONWA 3WF3A 1XDJA 1HJVA 2CPUA 3N15A 1TA3A 1KM4A 3UZYA 1XC6A 3VXGA 3PHAA 1OFOA 1OEPA 2VJXA 2ZX9A 2A7PA 2QHAA 4UXDA 1Z32X 2OOGA 5TQLA 1RK6A 3GU1A 3L23A 2WCAA 3KTSA 2BBFA 4UNKA 1DKWA 2G41A 1E15A 3P61A 3LX9A 4AVOA 1EOKA 3MUY1 3UQNA 3NEHA 3TROA 2EJAA 2DQWA 1A0EA 1K1DA 4WKFA 4LYKA 4GVHA 1X97A 1J8VA 2G37A 2HE5A 3GFZA 1PTGA 3WEOA 3UWWA 3QRHA 1XIBA 1FWIC 3FJNA 3IRDA 5AYIA 1EJTC 4BWLA 3P0XA 4POCA 3BXWA 3NNTA 1R2RA 2PLMA 3I6RA 3U0HA 2DUZA 4RJEA 1FTXA 1L8PA 4XZBA 3GVVA 2CLLA 1RA0A 3SUSA 4AY7A 2C13A 4PODA 4BQ3A 4FF7A 3EWBX 2DU2A 4JKLA 1YQ2A 3PS7A 1VIZA 3I68A 3TC3A 4JFUA 2CEQA 1NU5A 2EQDA 3OYZA 4R9XA 3V1PA 4Q3MA 4PTMA 4O57A 2ZA3A 4UTTA 1EH9A 5H6HA 5AVNA 3B04A 5I3DA 2FQIA 3A64A 1KGUA 5DMLA 5BOOA 3MSRA 3PN8A 4DO5A 1HKMA 3VD9A 4O1EA 2PU1A 4NQ1A 1V0LA 1ZJAA 3WUEA 2C0HA 1UWSA 3UG8A 1KRMA 2XN2A 2J75A 3OGRA 4J2PA 3IK4A 2YFOA 3N3TA 3BG5A 4JN7A 3AMGA 4Q4PA 1MWOA 4DRSA 4PTVA 1GVRA 3MV01 4HD5A 4CD4A 2CC0A 1XSIA 3OU8A 1U33A 4PTWA 3WMCA 4A21A 3SUTA 4O1CA 3AS3A 2I9EA 1DIEA 3RLVA 1G4SA 2NQLA 3F4DA 3CPGA 1YTDA 1THFD 2Y5SA 3UERA 5B7ZA 2WKJA 3KBSA 1KTCA 1LOLA 3GNRA 2DP3A 5LSMA 1S2VA 5HATA 1ZJBA 2ODOA 3RLUA 4DJDC 3DC8A 2DUXA 1H60A 4JTDA 2PGFA 4LC8A 1BYDA 3CUGA 3HOJA 3WQVA 2G4FA 6XIMA 2QQ6A 3CHDA 4RE4A 1JNDA 2PF8A 1R7AA 1H49A 2XGBA 3T09A 1GG1A 4JTHA 1O95A 4U3CA 4YCOA 1B3WA 4ZBCA 3GHTA 3VAVA 3IGHX 3LQLA 2OPJA 2GOKA 4H9XA 4B3LA 1O1ZA 3CGTA 3K1GA 4ZSUA 1FDYA 3B9NA 3S9YA 2WHLA 1GOWA 2QEZA 1DJZA 5L9FA 4L9XA 3DBPA 2CZ5A 4JICA 4PCNA 2NZLA 3AOFA 3TWBA 1Q63A 2OVLA 4B4FA 1MXDA 3RRXA 2PS2A 4ROQA 2HS8A 3WYZA 1GQKA 4HT3A 3QMSA 3TQ0A 2GJXA 1XBZA 3EX3A 2GQAA 4RE3A 3WLKX 3GU9A 1C7SA 3AJ7A 4XUGA 3W73A 2WM1A 4DWSA 1YDNA 3NSXA 1HKKA 1CGWA 1TX0A 3AIVA 3W85A 3TYCA 1L2UA 3T6CA 4U2ZA 2H9AA 1CNVA 1WNOA 1GPFA 1SPQA 1EXBA 2PTWA 3TQPA 2PGEA 1Q6EA 1UW9A 2NXGA 3MPGA 4IPLA 5LIXX 1LZOA 5D03A 4AD4A 1HT6A 1RJRA 2PDUA 2Z1VA 1UROA 4JDYA 1VB9A 3ALGA 3STCA 2AAAA 3ZJ8A 4E0CA 4Q33A 3U4AA 4OVXA 4J3TA 1DQUA 1ZP4A 4YPJA 4RDVA 1QBBA 4GI8A 3PJXA 3EOEA 1N55A 3RITA 4F9JA 3G1DA 4ZTYA 4DAFA 3SEPA 1JZ4A 5H2ZA 1ZGDA 3D3AA 4JKKA 4XVEA 1ELSA 1YMYA 1G5AA 3FKRA 5AB3A 5I7GA 3SFWA 4UBPC 3GG7A 4ADSA 1R6WA 2BVYA 3BH4A 3CLWA 1CYGA 4V33A 1C7TA 2Z24A 3FJ6A 4R7OA 2CHRA 1IHIA 1Q8JA 4HMCA 5A2AA 2RDXA 2HQAA 3PZUA 1Q13A 2VELA 4CNTA 1M7JA 3LPGA 2PBOA 5FSDC 4PMUA 1VFMA 2GSHA 3TFXA 1HNYA 4NNCA 1XD1A 3RCNA 1EGZA 3WKZA 5KTLA 1ZP3A 2NX3A 4GXPA 4AEOA 3PSVA 2CHOA 3CIWA 3BAWA 1ZY9A 3AS1A 1VRXA 2HE8A 1JF5A 3VGGA 3VIFA 4LNCA 1OY0A 1FHLA 1FWJC 4LVGA 4NAFA 2XPKA 2Z2BA 4J28A 2P3EA 3VNLA 5LIYX 2YZRA 2DSVA 2OZTA 1HKIA 3QF0A 2R1MA 1H09A 4QCEA 4RE0A 1S2CA 3JW7A 4O52A 3ERPA 1LP6A 3MUZ1 3B4YA 4H2CA 3P8IA 3CHCA 3WBWA 1JVNA 3PZGA 4WOQA 4ZZ9A 4B5VA 2HWGA 1GONA 2O9OA 4N9CA 2Y8VA 4TTUA 3RJYA 1V0NA 1ZJIA 2PGWA 2O9TA 5C2GA 3R94A 5K9CA 2JEPA 5HJXA 2OLSA 3PTMA 3BANA 1Q6LA 2EG7A 3WLIA 3QSRA 4PYSA 2QV5A 4X0VA 3W86A 2OGYA 2DVUA 1QR7A 3OB8A 3AHXA 2WC7A 1WBJA 3TNBA 4NJHA 3A21A 4QX4A 2PDJA 4HN4A 3W53A 1X6UA 3N19B 3VFLA 1KTNA 4Q22A 3P74A 3MMTA 2YZ5A 3AXKA 4MKSA 2JGQA 3NL6A 3RG6A 4M1RA 3B8WA 4DZHA 1K3UA 4DM1A 3TR9A 4H01A 2FVLA 5CJ5A 2J7CA 4P7NA 4HOWA 4CNOA 4HGXA 3D5HA 3TXZA 3MUIA 5HBFA 3MP4A 2NWSA 1HVQA 2TPSA 3E2QA 4C7FA 1P0DA 1G4TA 2GQ8A 2ZFAA 3PZQA 2R1LA 1KM2A 3H12A 4CQBA 3W6YA 4GHRA 4IICA 3WQWA 3VD4A 3TC7A 1JF6A 4D1JA 2EG6A 3KVMA 4DUVA 4CNNA 3QZEA 4X0NA 2MANA 4GYPC 4DYKA 2Q02A 1WB0A 3TCSA 1KBJA 4HK6A 2DVTA 1VYPX 4H9VA 3THCA 1C8QA 4TUFA 2BY1A 4ZO9A 2AKMA 1WDPA 3EZ4A 4FX6M 4E8CA 4RDYA 3MKCA 2YXXA 3NQGA 3HBLA 5D02A 1ICQA 3BC9A 3PUOA 4JQ4A 1JRBA 4NAFB 4ZQPA 4CCZA 3S2JA 3W72A 4XAZA 3FDKA 1P1XA 1QNQA 4AW7A 3FSUA 5E5CA 1J01A 3H23A 3MT1A 1PKYA 5HOSA 5K3VA 5FKYA 3GC2A 4MSSA 3GSMA 1E0TA 3DI1A 2ACQA 3UXAA 3OIHA 2VVSA 4MB3A 1WUEA 2QUMA 1FUYA 4C6PA 1RALA 3S47A 4S3DA 3NIYA 1HJQA 2Z6JA 2VEIA 4BKNA 1T96A 2OEJA 4DWSD 4ML9A 2NWRA 2QDDA 5B80A 1YXYA 3KWSA 1OIFA 4B2DA 3GIYA 4U31A 2NUWA 4V27A 4IP5A 1SFSA 2QGHA 3LHUA 2YDRA 3KCJA 3LM7A 3R4IA 5XINA 2BY2A 5C2XA 1AMYA 2E5BA 3M0HA 3AO0A 1B0IA 3QMRA 5I3JA 4GQ0A 3SECA 3GNPA 1U30A 1UZDA 3SSJA 1M68A 2XFYA 3MA8A 2FTPA 1MEWA 2V5JA 5HNTA 3V1HA 4GISA 3F1QA 5D09A 1OFQA 1XBYA 3BJFA 1QHPA 3TK7A 1Q6DA 1BWKA 1ZSXA 1GW1A 5T26A 3LV6A 2UZ9A 4HHLA 5CJMA 5I3KA 1U5JA 1XLBA 3R79A 3NDYA 4HNLA 2V81A 1Y0EA 3F4VA 4GACA 5HJYA 2OT1A 4DO4A 1VC4A 3EB2A 1SO5A 1Y8BA 4LAUA 1VEOA 2JE8A 2WHJA 1J9YA 3GIPA 3GDRA 3DHUA 4WGXA 3C0JA 3WLSA 1ZNNA 4H8NA 3IARA 5LIUX 1TUXA 1QCWA 5E6YA 2Z2UA 1GVSA 1W37A 3T4WA 2YL9A 2WPBA 3WD0A 4H41A 1GEQA 1GUVA 4PMDA 3H8AA 4TVUA 1ZU8A 1F6KA 1JZ3A 2TYSA 2NQ5A 3TXVA 3INPA 4UTWC 1CX9A 4C6DA 4G56A 1VBJA 2VC5A 3UU0A 2YA2A 2YFNA 1P5BA 1G67A 3FDGA 4F0RA 4B15A 4NL1A 1RK5A 3L4ZA 3NM3A 3QV6A 1W1IE 5E6ZA 1JL8A 4UTUA 4MFDA 2WC3A 4HU3A 2IQDA 3OVRA 4WCJA 1DPMA 5EBAA 4IMGA 2GLKA 5G5IA 4L1WA 1XIEA 3E0FA 3AAMA 3TN6A 3UJFA 1O66A 3TTQA 1VHCA 3MI6A 3BCFA 5JQ9A 4ONVA 4K36A 2A3LA 1B1YA 3ATYA 5EFDA 4CN1A 1ITQA 1NQKA 1R3WA 3FGCA 1RV8A 3GFXA 1FWFC 4JTTA 3TV8A 3LXBA 1XYCA 1J0JA 1JUKA 4CLMA 1W3LA 4W8AA 3RGTA 3STFA 2WVVB 4DPPA 2FKPA 2INFA 4NZCA 3W6LA 1TPH1 1WBHA 3POCA 2WNQA 4R27A 5A6LA 4PN2A 5FD0A 3AIBA 1GVFA 3MBDA 3L4XA 2WW5A 4B90A 4KFPA 3C4UA 1V02E 4M19A 2F8QA 4JIPA 3KS5A 1W1PA 3MVIA 3IGSA 1W9UA 3RN6A 3LCHA 1CWYA 4XB3A 5HK4A 1UB3A 4UB9A 4ZQNA 1VCVA 1W2VA 3NQBA 3KRZA 3NPXA 1XPGA 2QS8A 1XQLA 1M9HA 2ZWZA 1NP2A 3DFSA 1TJ2A 4N9BA 4GJ1A 4FIQA 4RCXA 4UMCA 3CHEA 3QH2A 1O4UA 4GCAA 1FWEC 3VVGA 3HO8A 4MLJA 3SAZA 4Y8EA 1AJ0A 3EX4A 5BYWA 4WX2A 3W1LA 1MQRA 3R7MA 2DZUA 1XIGA 4GIRA 4FZIA 5EMJA 4HPNA 3E5PA 1OYCA 1O7AA 4IUGA 1TZZA 4E4PA 3QYSA 5CGTA 2XG9A 2BVDA 1ZTVA 1DJHA 5GNXA 1O68A 3WLOA 3H21A 2PWGA 3GHUA 4XVDA 4DVOA 4OUEA 2P1FA 3I3EA 1G4EA 4B5XA 5DN1A 1EBGA 1YRRA 4L4PA 4GZIA 1UKPA 5D2TA 1CGXA 3J7HA 4LVBA 4KCVA 3QYQA 2DZPA 4OKDA 2JBMA 5DRIA 1YBQA 4TO8A 3QHNA 4HK5A 3HPFA 3ZLFA 5IXEA 3ENLA 1DTNA 4US5A 5AC6A 4AC1X 3KVLA 2QF8A 4B2DD 3HURA 2FFIA 1IT0A 1K8ZA 4OBSA 1RVKA 1OD0A 4PA8A 1NQ6A 3TFCA 3GD6A 4HU0A 3MWCA 3VILA 4C6IA 2AL1A 1KFLA 1K77A 4A3QA 3AXIA 1KKRA 3B40A 3LN3A 4I8YA 2OMAA 3G24A 5HQEA 1FXPA 4JIIX 1T0OA 5FJRA 4O18A 4FXFA 3L68A 1FDJA 3UR8A 2Y5EA 4BK9A 3HPXA 5F4XA 4H8HA 3BL3A 1FWTA 2D3NA 4LBRA 4HTYA 5C9ZA 4F0KA 2G96A 3PB2A 1ISVA 3IIPA 1V03A 3GNNA 8XIAA 4Z1BA 3T81A 1XDLA 3G22A 1IR1A 3HB9A 1D8WA 3BW3A 3VC5A 3SDOA 1BGGA 3D47A 3ABZA 1A5BA 1PAMA 2QCEA 2JFEX 3UETA 1AQ0A 1J6OA 1DVJA 4AHPA 1EPVA 2OX4A 4K3ZA 5AOUA 1VYRA 1QPKA 4DI8A 4ERIA 5CCZA 3BGAA 2ISWA 2Y7FA 4DHGA 3MI2A 5T8GA 2GQ3A 4D6EA 4QIUA 5FI8A 4AHOA 1GJWA 3D46A 5DX7A 3U48A 3CU2A 5C2CA 4NX0A 1J96A 1CI1A 5C5YA 1WDDA 3GZ3A 1ML1A 1WXZA 3UD6A 4GZEA 1L6YA 4JYFA 4F3HA 3D6NA 3UCDA 4ECLA 3K5XA 2PTZA 1QI0A 1QW7A 1IF2A 2EBNA 3U9IA 2ZOXA 3WD2A 2Z26A 1H1YA 5IDZA 1AZ2A 4IQDA 2WMHA 2Z27A 1WZLA 1VFOA 3SRFA 3GDMA 3H7RA 2E40A 2DJXA 4EAMA 4WDUA 4EK7A 3FX4A 4UNIA 5F1UA 3IJLA 4IJBA 3STPA 1IWAA 2VRQA 3AWNA 3WQ5A 4QITA 3THQA 2J9YA 3VE9A 3S6OA 5M2FX 4GUFA 1WKYA 4BHYA 1TMHA 2IQ0A 3R0KA 3AUOA 3DG3A 3HPAA 4KS0A 4IT1A 5FF2A 2WLYA 4CGTA 1UWUA 3GB6A 3R13A 5JBDA 1LLZA 2ZXDA 5GNZA 4PSPA 1CXKA 3E02A 2J7FA 3IAPA 3LHWA 3S5NA 5IBXC 1LM1A 4HPJA 3KTCA 1NFGA 3A23A 4GJJA 3VZZA 1GVIA 5AVHA 2R82A 1F6PA 3TLQA 4AMCA 3P60A 5DXYA 2NT1A 5DT7A 4LXFA 4H6EA 4QEHA 2GVEA 4ENLA 3TX9A 2GGGA 4GY0A 4JHOA 3DFHA 3M6YA 1I6NA 1UC5A 5GPRA 2J7EA 1A80A 5I00A 3VIHA 5C70A 3KVKA 2JF6A 3KTXA 4AVFA 1UD3A 1TB3A 4R34A 1F6YA 3EB3A 3NWRA 1QWGA 3DBNA 4LUJA 3VGFA 5DCDA 4AZ5A 1UJPA 2F6UA 3CAKA 3H2CA 1V5XA 3LHVA 3MSYA 2HBVA 1E0VA 4FLOA 1QK2A 1J0YA 4JIEA 2HXUA 1Q3NA 2J13A 4WSJA 5D2XA 1XYFA 3A3HA 4JYDA 4AX7A 1CDGA 4S3AA 1PEZA 3EA2A 1FHVA 2J8TA 4BEQA 3TEVA 3A47A 4O0KA 4L6HA 4UR7A 5EKYA 4NZFA 5A6KA 5C55A 3PK7A 2ZZ5A 1KM3A 2QCMA 3M0ZA 3S3GA 4HU8A 3AHYA 4XIMA 1RP8A 4W8BA 3MW7A 1P0KA 3DHPA 2OQHA 4LEQA 3NGFA 1K8CA 4EOUA 1JYXA 4N42A 5AHLA 1CW2A 4MNKA 4W7UA 1UC4A 5G1MA 3LZ5A 4US5D 3CIVA 2Q8XA 3ZJKA 1QNOA 4IQJA 1RZMA 7CGTA 1TMLA 3E0LA 4YWIA 1H3GA 1RLCL 5D9NA 1SGJA 3QFEA 1OX6A 1EA9C 1X1ZA 2EPNA 3E0VA 2OR2A 2ESCA 4P8WA 2CLEA 4MFEA 3BK0A 1P6BA 2A0NA 4DN1A 1XIFA 1GZ1A 1Z41A 4AZBA 1I60A 3LPPA 1ZB5A 4YTSA 1P0EA 4AQLA 4Z0JA 2Y8KA 4QG6A 2QJIA 3H4GA 4ZO7A 3BDKA 4EACA 3NQCA 1QPQA 3QY7A 3MKKA 4LWWA 1E3ZA 4BF9A 2V0TA 3W1UA 1E70M 1EIBA 4Q7NA 1JIBA 4O14A 1E55A 1UPPA 4DEFA 4O17A 2V5KA 2TMDA 1ZBVA 2QDGA 3ZLGA 3OOQA 4NJGA 2P0IA 3SN1A 3DFYA 3W7KA 2O9PA 3PJUA 4UMBA 4LFYA 3QLDA 3AS2A 4MWAE 1XYAA 4BZYA 2AKZA 2D3LA 1J2BA 2WQDA 1H7PA 1F5ZA 3TWAA 3CEUA 2E68A 3T1GA 2OG9A 3WDQA 4D6JA 3EB4A 1O5KA 4ZR8A 5ECVA 1EJVC 5CPMA 1LOQA 4K38A 3TU9A 1DJYA 1HJUA 3DKLA 3PAOA 5I78A 2CLKA 2XFRA 3WQPA 2HPIA 1K8YA 2B31A 4UTJA 1TTJA 3W1MA 2PDIA 2GGJA 4CEXC 2WMJA 2ZXAA 4CD6A 1XLCA 3KRSA 3ME3A 6ALDA 2P50A 1KCLA 1HXJA 1ADSA 4AF0A 2ZRZA 4RV8A 4Y6GA 1E5JA 3OEXA 4R33A 3T42A 4M0XA 5TIMA 3I10A 3NZPA 3Q67A 4TTGA 1MDLA 2F38A 4ZTXA 3VTRA 4LJ3A 2OEMA 3NSMA 5LIKX 1JPKA 3RU8X 4KERA 1P4CA 1Y5WA 4L4OA 1NOUA 4KW2A 1BQGA 1HKWA 3RCMA 3VUSA 4FO4A 5KMYA 3PZ9A 1QNPA 1S3HA 3SURA 4GYPA 3IJQA 3HMCA 1EUAA 2UY2A 1XINA 3SRDA 1E6QM 1QI3A 4NU7A 1EUNA 1OG0A 4YWSA 3NOEA 2PB1A 3AQUA 4UQCA 2XYLA 4QXIA 1SR0A 3W2JA 5LA1A 2Z1SA 2VDGA 4S3EA 1E0UA 5TNVA 2D69A 3VOCA 4CVWA 3UFYA 3UXIA 1XCWA 4WZHA 4DIAA 3USBA 1BEUA 1D8CA 3LY0A 2E77A 1ZALA 5FACA 1SMDA 3EWCA 5E09A 3U2EA 1U5HA 2HVOA 1WOAA 3GXDA 2IPGA 4OGZA 4U5KA 2BB0A 3N18A 4Q4MA 3RX3A 2OYMA 2Q8ZA 2B7NA 2E1DA 2J24A 3VOFA 1O5RA 2XDFA 1U1HA 2VM8A 4F0HA 1IEIA 2A1YA 3W28A 5FAJA 4M6UA 3BLFA 3RCYA 4JD4A 4KGJA 3SADA 1TELA 3HU7A 3GVWA 3TSMA 5SWUA 4V28A 3WD1A 1XBXA 4NNAA 3RNDA 3LBMA 2V63A 1MUCA 4R7WA 3PC0A 4PMNA 4WXZA 1FRBA 1M6JA 3WDRA 2WWDA 3FYOA 4A29A 1XH2A 1V3KA 2P3ZA 3W76A 4ZE5A 1I2QA 5FJJA 2DW7A 3BLEA 1FKXA 3WNNA 3F5KA 4TX8A 5I3GA 3AROA 3QC0A 5CQ1A 4HCHA 1MW3A 3R89A 1KQYA 3HFTA 1OF8A 1OGGA 3RX2A 2VZVA 3WBXA 4KCWA 4X63A 4AF0B 2W91A 1TCMA 1PSCA 3KX6A 4H19A 3WFZA 5DBUA 3UNTA 4QDPA 4XIAA 3WK3A 3U5YA 3QR0A 4V1YA 4E2DA 1R46A 3W2UA 1T41A 1JUBA 3EBVA 2WKGA 3MS8A 2PUZA 3WIJA 4R9OA 2A4AA 3SSZA 1RY8A 2VO5A 1T40A 1ADDA 3ZOAA 4B5NA 3I7SA 3NPWA 3KBJA 4B92A 1VEMA 5IHRA 4NRSA 4PTXA 3ARXA 3AHVA 4KRTA 2C7FA 1FVPA 2OZ3A 6REQA 1SO4A 4R85A 4JHZA 1DHPA 1GHSA 1OIMA 3QQWA 3W7IA 2UY5A 2CLOA 3QBUA 4MM1A 2XH4A 4MJ4A 4RNHA 3IV3A 1QOQA 4GKLA 5LHFA 2HMCA 3NL3A 3RHGA 3P6LA 4LT9A 2X1RA 3OGVA 2QYGA 4LOCA 5HMDA 3S8HA 1J12A 3N17A 4UFHA 4LB4A 3VM5A 2G5WA 1CZ1A 4GOAA 3VABA 3M7WA 3CIXA 1K70A 3PSWA 3N2XA 3BLLA 1WXYA 2E25A 1EJ7L 1SUXA 5EBUA 1S5VA 3CZLA 3GH5A 3PZIA 1P0BA 3DFOA 2PWFA 4V2XA 4DX3A 1KBBA 1WO2A 1EX5A 2DIJA 5A2CA 3GAYA 4UQ9A 1UD2A 3ITOA 3IJ7A 3T9PA 3ZIZA 1BTCA 1QXLA 3WDHA 2QF7A 3VOGA 3RAOA 3WFAA 4JS3A 3R43A 5A6TC 5I23A 3DX5A 3B0UX 1K9TA 2WSYA 2ZQ0A 5HNNA 5EA9A 3M0MA 1OT2A 3RUBL 2WJDA 4MPQA 4RDWA 3TE9A 3WLJA 4JTAA 1U83A 3R10A 1KFWA 1HL2A 3TAKA 2G3NA 3G6LA 1FKWA 4EXAA 1MNZA 1VFHA 3UGVA 2FVMA 5F2GA 1W5MA 2X16A 1J79A 1R0MA 2P8CA 3W2MA 1DIOA 4G1KA 1FWWA 3C2VA 2POTA 4Q8UA 1IT8A 3HF3A 4O8AA 5CZJA 1BYCA 1V3JA 1FWSA 2I5IA 1UCWA 4OHQA 1HL8A 2RJGA 3QV7A 4ZO6A 5I77A 2HV5A 2V2CA 4K1GA 4X60A 2FIQA 2GK1A 1US2A 5A6MA 4M6QA 9CGTA 3OLGA 2P10A 3WJXA 3G3MA 1TWZA 4Q4SA 1E6PA 1UIOA 5M03A 2VVNA 5F2LA 2X7WA 3FS2A 3W70A 3DIPA 3S46A 1NFPA 3CZ8A 1IWPA 4B5UA 1UUOA 4IWWA 3PG9A 3F4WA 2ZRWA 4XD4A 8CGTA 1A0CA 3U2ZA 4PMXA 3VKJA 4C6JA 4LBSA 1WCGA 1T99A 1Z6KA 5AHIA 1LDCA 4XZ9A 2QXWA 4HNTA 5DFAA 2Y89A 1XWYA 3LU2A 4KFOA 2R1NA 1TJPA 2XFWA 3M5YA 3VIJA 3STEA 1RJQA 4B3ZA 1BQCA 3CHVA 5AYBA 3N2TA 1KM6A 1BKSA 1E0XA 1KR0A 2Z1WA 4LYQA 4DYEA 2BXYA 1XIDA 5ABHA 3BCDA 3HN3A 2OU4A 1DWGM 3W7MA 3P8JA 2FHBA 4JFWA 4LY4A 4UFIA 2ZZ2A 5EU9A 4GGHA 2FVKA 3IJDA 1MQPA 4UNLA 1O94A 4LGXA 3BSGA 1YNYA 1XCXA 3NYZA 3G8EA 4XKYA 1IEXA 1WP6A 5BMWA 4AY8A 2ZA1A 2X09A 3QOKA 2IKJA 2BHZA 4DYJA 3VZYA 1D2KA 4F0LA 4E2OA 3KOXA 1K7EA 5DANA 4W84A 3S2MA 4A8NA 1GW9A 2YL8A 1ME7A 3ITXA 1CLXA 1BAGA 5G4HC 5TD4A 5A8QA 5DY3A 2OJPA 3AZSA 3LCIA 3LOTA 3BG9A 4B5TA 4NZ3A 1DL3A 1BGAA 2JIEA 3WF0A 1V93A 4H1ZA 4URIA 2DSWA 3EPNA 4PR4A 1F05A 2DZXA 3ZVHA 5EYWA 4LB3A 4AHQA 5H1WA 1EL3A 5IOBA 1WX0A 3SRKA 1R38A 4WUIA 1XR2A 2YOCA 3TNOA 5AHNA 1AFSA 2XVLA 5K9DA 3KBVA 1YXCA 3C3NA 3R6IA 1NIUA 1EDGA 3R1ZA 4U2YA 2VOMA 3POHA 3LCFA 4IFKA 2WHMA 5FJTA 3E6EA 4HK7A 2QCDA 4BWLC 3VNMA 2X2YA 1GKPA 4JIRA 1V7YA 1XKJA 5BMXA 3G18A 2J9XA 1Z7AA 1W8GA 1DV7A 5LNWA 3DGBA 3G1FA 4RZ4A 1AQMA 2O0TA 4ATDA 3VGHA 3ORWA 3WQCA 1JDCA 2REQB 4A8RA 3LI0A 3P62A 5ABFA 4KEVA 2X1IA 4GY1A 1QW9A 1DIDA 4G5DA 3CXOA 2YGYA 5DF0A 1LUCA 3PULA 5BROA 2GVJA 3KW3A 4KEZA 1HGYA 3L0NA 4UTTC 1Q5MA 7ENLA 4WJ8A 2ZE0A 2YCIX 3GQYA 1VCGA 2PI6A 2ISVA 1FWGC 2WNNA 1UP0A 3OBKA 2H3DA 4JFTA 1YW1A 3VDAA 4XO6A 1SFJA 4NZJA 4HBKA 1DJIA 3WQ6A 5DCEA 3MQTA 5D30A 2B4GA 3VD7A 3GXNA 9XIAA 3T44A 1FHDA 4JBRA 3KE0A 1W54A 3BSMA 3LBCA 2FZ9A 1GOIA 4OJYA 1DWIM 4LH8A 3L0KA 2D0HA 3N3MA 1Q2RA 2CLMA 3QFWA 1M7OA 2C91A 2R91A 5F4WA 3URQA 3ZJ7A 1SFLA 3ARUA 1GHRA 3ANYA 1EHAA 2PDQA 1TE6A 5LNRA 4LAKA 4H6KA