4HN4A

Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
total genus 103
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4hn4A00
3F1QA 1Q45A 4JTLA 4OV9A 1KM6A 2ZDRA 1SO4A 5HINA 2H8ZA 3P80A 1H5YA 3OBKA 1ZNNA 1DQWA 3LHYA 4EOUA 3HMJG 3KXQA 2QDGA 2QDHA 3OHIA 2CLEA 4JTTA 1SZNA 4M5PA 3ANYA 1VLWA 2I1OA 5AHIA 1YXCA 4HNNA 3PBVA 1H7PA 2QCGA 1C9DA 2NX9A 2QJIA 2QR6A 5G4EA 3A22A 1M6JA 3EEGA 1IIGA 2DORA 4IMDA 1FBAA 2QUTA 2Q8ZA 3E49A 4JTFA 3TC7A 4PC8A 3KHJA 3Q2DA 2AQWA 1OFRA 3HGSA 4O1CA 5G2WA 3NZ1A 3N3MA 1DHPA 3LOTA 3QH2A 2NUWA 3M41A 4N6FA 3EX2A 1OG0A 4M7TA 3KAOA 3LHTA 3NQ2A 3PBUA 4JD4A 1TREA 1P5BA 1DJNA 4N9EA 1M5WA 5AHEA 3UWZA 1I4NA 1OX6A 3I7QA 4ICNA 4UXDA 3BPWA 4CNOA 4PCFA 4GJ1A 3Q58A 2V81A 5D32A 2ATSA 1WYIA 1XCFA 4FNTA 3TSBA 4MYXA 4DQWA 5DY2A 1EB3A 4M19A 3T78A 2A6LA 4QITA 1J2WA 3GXPA 3NPVA 3ZWSA 2V2DA 1O5XA 2B7PA 3C2VA 4B5NA 4JTUA 4FO4A 1KFLA 4Z1CA 3AJXA 3C8FA 1OVDA 4CCCA 2CLLA 1PIIA 3O07A 2E5CA 2X2GA 1OFBA 1LP6A 2CLFA 1TQXA 2W6RA 5E1QA 4AHOA 1JUBA 2PCQA 3GDLA 3W7HA 4DF1A 3PSWA 1XFBA 2H8XA 5BMWA 1OF6A 4UR7A 1TTIA 4LOCA 1OX4B 4YMZA 3T44A 3TAOA 3OVPA 3SGUA 4Z0JA 1FCBA 2FFCA 1GOXA 3QMRA 1UBSA 4UTWC 1LBMA 3B06A 5AYXA 1Y0EA 3T7VA 2QCHA 2B0MA 2C14A 3A5FA 1FWNA 1PV8A 1IXQA 1YXDA 4JY8A 4OQVA 4IOTA 1OABA 1GT8A 1M7PA 3UQNA 3QSTA 1PHWA 1LYXA 3W2JA 3P67A 3R2GA 2CLHA 2Q3RA 2F84A 2BTMA 3EXRA 3TC6A 4AAJA 4Q32A 5AN7A 3B04A 5F1UA 1ZALA 2V0TA 1Q6OA 1XDLA 4Y96A 1WV2A 4UFMA 1Z42A 4IJBA 5BMXA 5G2IA 4S1FA 1BEUA 3P61A 3U2OA 3W2KA 3WK0A 2Y7DA 2X16A 2B7OA 4C1LA 2ZZ3A 2GJLA 5LNWA 1TV5A 4JIQA 1GQNA 3ATYA 2WO5A 3QW3A 3W71A 2OJPA 4PL2A 3PUOA 2A7NA 3GYEA 1WBJA 3THQA 5D02A 1H62A 4FF7A 1L2UA 3NNTA 5AOUA 1CW2A 3BLFA 3NL6A 4LVGA 4P61A 5A8GA 1X1OA 3W72A 4I7WA 2JKAA 4DPPA 1SQ7A 4IX2A 1EEPA 4KFPA 3JR2A 4L4MA 4WXZA 5U4NA 5FF3A 1I2OA 2EF9A 4FX7A 1F7BA 2ISSA 3IV3A 3PC0A 4NJHA 1EUAA 5D33A 1X6UA 5LSMA 1KLYA 3G22A 3TIMA 1W31A 2C18A 3CLMA 2QCDB 3G8EA 4O4WA 3W7QA 2H90A 4HT3A 3U8GA 1F2JA 2WPBA 5HULA 2V8ZA 4U4MA 3P62A 5I3HA 2GUUA 1WDWA 4IPJA 1T99A 2C3ZA 3N19B 2ZRWA 4X3ZA 2QCNA 3RFAA 3LCIA 5J5RA 3TW6A 2G96A 4UTTA 4M6QA 5D30A 4JIPA 2XFWA 2CFFA 5DELA 1WOBA 4EF9A 2OMAA 3LM7A 3PG9A 3VNDA 2X30A 3NQMA 2G97A 1ZAJA 2FPTA 1VGAA 3L67A 3UPBA 2RKXA 5EA9A 5ABTA 3NL3A 3JS3A 2VXNA 3RLUA 2E6AA 3DHFA 3EWWA 4K36A 1KV5A 3GZ3A 1K7XA 3MW7A 3Q94A 4HSNA 3TH6A 3RMJA 1OFAA 2E5BA 4A22A 5IBXA 3NQ8A 3QQ1A 3G3DA 2A21A 2NUXA 2ZRUA 3NL2A 4LUJA 3OIXA 5DLCA 4WX2A 2O7QA 1SO3A 3QPZA 1B4EA 1PL9A 1TPUA 4XTDA 4WOQA 3LBMA 4HNVA 4FXSA 2JKPA 3MWAA 4O16A 1KBJA 1FCUA 1LRTA 4OGZA 3W86A 2C6QA 1MXSA 4E38A 1BWLA 5EPDA 4ADTA 2R94A 3FIGA 3EWYA 3TV8A 1G67A 1ONRA 4XKYB 3THAA 1HL2A 2VFIA 1KTNA 2FPYA 4H4IA 4QM1A 2R14A 3NG3A 3HF3A 4O14A 4RR4A 4ZQOA 3N14A 4BI7A 5FI8A 1K8ZA 3CWOX 1S5WA 3NA8A 1GVRA 2E1DA 2VC6A 4NZJA 1FXQA 3M5ZA 4JYDA 4QAIA 3W2MA 3W07A 1Z44A 3NL5A 1RQEA 4NJIA 4I7UA 3QQ0A 3BARA 4JDBA 4JX5A 3S9YA 3W7KA 2KZHA 3GNNA 1DJQA 4O18A 3BO9A 5KZDA 2RFGA 1SZEA 2CWNA 2J24A 4RXFA 5T26A 2CW6A 3IVTA 3C6CA 2FLIA 1SU5A 3DFTA 2YYTA 3CIWA 3G1XA 4NNCA 5CZJA 4PFMA 2Z6JA 1SZFA 1NVMA 1PVNA 2P10A 4AH7A 4LT9A 4AB4A 3CEPA 4GFSA 1JUEA 4RX0A 4WD0A 5D38A 3TQ0A 3B0UX 2CZ5A 4AWSA 1PS9A 1LOLA 1MSSA 5K4XA 3T55A 1VJIA 1JULA 1ML1A 3EKLA 1FY6A 3LRKA 4O52A 1JRCA 1SW3A 2DZXA 2Y85A 4UTUA 5CPOA 3W7MA 1OYBA 3PULA 1LOQA 2DZTA 3EB2A 2RDUA 4NX5A 4ORIA 1LM1A 2ABBA 1WX0A 3BW3A 2ZRXA 1ZHAA 4I9AA 1XKYA 3L0NA 3GDKA 3HBLA 3OVQA 5CZTA 3W9ZA 4FB7A 4UTWA 3TU9A 4N2YA 4LY8A 4JS3A 4O19A 3VI2A 1K03A 1KM3A 3DI1A 3O6YX 5D2VA 1H7OA 1JQXA 3W1RA 3NQCA 4IMEA 1KA9F 1FX6A 1VHNA 2JK2A 5EKYA 3R13A 3W7CA 1GEQA 1ME7A 4K8HA 3PS7A 2ZZ4A 4MZ8A 5KSWA 3PVFA 3LERA 4MY9A 3PUDA 1OFEA 3W1UA 1AMKA 1QNVA 2VELA 3TDFA 1V5XA 3W88A 3FKRA 4MJZA 1XDMA 2EKCA 4P2VA 2V30A 2YFNA 1BKSA 5HR7A 4ZQMA 5F2GA 1KLZA 3VE9A 4O53A 2V5LA 2WSYA 1D9EA 2VFHA 1JCLA 3WJSA 4DBDA 1KV8A 4XUGA 3QFEA 1KFKA 4LV4A 1TPVA 3ABQA 1H7NA 1IXPA 4JICA 3GNDA 4N9DA 2NWSA 3DENA 1EP1A 2GQ9A 3L0GA 5F1VA 3E0IA 1QPRA 1Z41A 1EA0A 1TPFA 4CCDA 1THFD 1FCQA 1SSGA 4NNBA 5D2XA 5FF0A 3M5VA 1JCXA 4KFNA 1VYSX 1YPFA 1KFCA 4O1BA 5EMUA 2FDSA 2J6XA 3MJYA 4JXCA 3TKFA 5HWMA 3S1VA 1QR7A 4FX8A 4MY1A 4WXYA 3M43A 5CZSA 1KFEA 1ADOA 3CU2A 1TTJA 1NAL1 3S5ZA 8TIMA 4LUIA 3SIZA 2QUUA 3S1WA 1FWRA 4N9CA 4AVFA 2I14A 3TXVA 1JJKA 3R8RA 2WV8A 1M7OA 5K3VA 1TV7A 1GZGA 1G69A 5HWNA 5BW6A 1FWTA 3FEMA 4IMCA 5E0KA 4FNRA 3C56A 1O5KA 1P0NA 4QNEA 1XUZA 3M5YA 4A3UA 1MEHA 4WY0B 2H6RA 4XQ6A 1LLZA 3VE7A 1TV8A 1G7UA 3NPUA 1F73A 3NYZA 3W1NA 2ZRYA 3G1DA 1DORA 5D37A 4OE7A 3TNOA 2FB2A 4YL2A 5AC6A 3L9CA 1KTCA 1ME9A 4YWIA 4Y6GA 5FEXA 1W1ZA 1RD5A 4K37A 1I2NA 2QJGA 2Y61A 1W56A 4A2RA 3DAQA 1GTEA 2FIQA 5CGQA 3TSDA 1Z48A 4CNNA 3UWQA 5I3IA 3LI0A 1YDOA 4O12A 1ME8A 4RZ5A 3UZJA 4QIUA 2I9EA 4WUIA 1R2SA 2YW4A 3O05A 5KITA 3RU6A 3W2LA 5FF4A 5L6UA 4DELA 4AMAA 1XXXA 1RQHA 2C19A 4FXRA 3QSRA 3N2MA 4XWUA 3FA5A 4AF0B 4POCA 1ZFJA 4QNWA 1TIMA 4JYEA 1W3TA 3OA3A 3M5XA 2CZFA 4UFJA 4KWVA 2J9ZA 4OWGA 3UYCA 1WA3A 5MHBA 3QMTA 6TIMA 3LB0A 1N55A 4MJMA 1A5AA 2NX3A 3NGJA 3UXAA 3IEBA 3MYPA 5D2YA 5FEPA 3O15A 4GE8A 5HUOA 5K9DA 1EP3A 4MPQA 3M47A 3WJZA 1ZY9A 3G3MA 3OEXA 1QWGA 3FOKA 4LW7A 5HWJA 1QCWA 3EX3A 3GLCA 4ZZ9A 1HG3A 4Q4KA 3USBA 3DFQA 3IGSA 4XBSA 2ZA2A 1S5VA 3LXCA 1P1XA 4Z1BA 5DXYA 2TMDA 4RXGA 3P7YA 4RV8A 3S5OA 2DZWA 1XBYA 4YCOA 5D03A 1W5PA 3B05A 3HJZA 3QJAA 1X8FA 1Q6RA 1QO5A 3D0CA 1A5BA 2E5DA 3O6DA 1RZMA 1H1ZA 1S5TA 3IVUA 1D3GA 1VQTA 5LGZA 1LRNA 2OZ0A 2QKFA 3HG5A 1OYCA 5CSRA 1I45A 3MHFA 3KVLA 4RZ4A 1K8XA 2V82A 2J27A 3FYPA 1ZAHA 2XN2A 3STCA 2OCZA 4JYFA 3I7RA 5DXXA 4MLJA 3KRUA 4NUWA 4X22A 2A7PA 3GR8A 4PTNA 5K9CA 4N6EA 1VPXA 1LCOA 3L5AA 5HUPA 3W6YA 3W7JA 4K7YA 1SR9A 1KM1A 2GOUA 3G8RA 1GVFA 4O50A 1GG0A 2YZRA 4NZFA 1VCVA 1FXPA 2Y88A 1FWSA 5G4WA 5AYYA 1N7KA 2TPSA 2ZZ6A 1HFBA 1HO4A 3R12A 5CSSA 1O4UA 4JTHA 5LZLA 3C61A 1IF2A 2J9YA 2NXGA 5AYZA 3C3NA 2BWGA 3ZFHA 1ZJIA 2BX7A 5CG7A 2PRMA 4M6VA 2ZQ0A 3H53A 1XBVA 3QRHA 1MO0A 3SW6A 2A6NA 4AF0A 5LNVA 1K02A 3LBCA 4UFHA 1OFQA 4BWLC 2HSAA 1F6PA 3P8JA 1YTEA 3LX9A 2C0AA 2ALDA 2H3BA 1KM0A 1O95A 1WXJA 3KVKA 2NUYA 5DN1A 2EHHA 4O54A 3ELFA 1DBTA 1KM4A 2BLEA 1BWKA 3BG3A 3LTYA 1K7EA 1LOSA 3DFNA 5I3GA 1DV7A 4L4LA 5DCEA 1OFPA 1AW2A 1OK6A 1RPXA 3TCEA 3P8IA 3C0JA 1WAUA 4UTIA 2NV1A 4H6KA 4TU1A 3G18A 3PR2A 3W7RA 3BLEA 3HPSA 1G4TA 1SFJA 4HPJA 2NWRA 4YCPA 3EWZA 3O6CA 5AHNA 3EX6A 3G1VA 3P74A 1GVSA 3SY5A 3L21A 4NXSA 5KZEA 3MHUA 3DFPA 1VH7A 1J4EA 1I8JA 1X1ZA 4LRSA 4WY0A 3M9YA 3STEA 1X7FA 3CM4A 2YGYA 4Y8FA 1GVOA 2ZBTA 3A21A 1QAPA 3HGRA 1W5OA 3GK0A 3LLFA 5G1YA 3LXAA 4M7SA 3P81A 2O7SA 3S42A 3S8HA 4NJKA 3NPXA 1W37A 2Y62A 4K38A 1C8VA 3LTPA 1H50A 2E6FA 5HR6A 1G6CA 5AFDA 5CZ0A 3CC1A 3PG8A 4JTEA 4DO5A 4JTGA 4J9JA 3LRMA 3CEUA 4KFOA 3I7SA 2E68A 1JCMP 1VZWA 3W1LA 3G0UA 3MYOA 2QAFA 3GVGA 3G0XA 3P84A 4Y9AA 1DVJA 1TMHA 4MUZA 3NOEA 3W76A 1WBHA 2UV8G 1W0MA 1KBIA 4WOZA 4M6PA 3E96A 5CPLA 1H7WA 4EIVA 3TK7A 3UWWA 3OG3A 5BOOA 1SUXA 3PM6A 5C6MA 5I3FA 3E9AA 5HJLA 3NDOA 4MY8A 2AAMA 4HKPA 3MI6A 4GUHA 3GIYA 3EWUA 4N4PA 3STFA 4R34A 2YPIA 2Z6IA 4N02A 1ZAIA 2Y70A 4O17A 2GQAA 5AHLA 4BI6A 2ZTJA 1PE1A 3DFOA 1J5TA 3A24A 2CU0A 4UTJA 2QEZA 3VFLA 1LBLA 3CTLA 3QMSA 3QEZA 4R53A 4HSOA 2NX1A 1DL3A 1LORA 1AL8A 1O60A 3KRSA 4RZ6A 3A23A 1D3HA 1EP2A 3UY7A 3HGOA 1FWWA 1T0OA 1R2TA 4BI5A 4C1KA 4PODA 1EWDA 3DKLA 3L5LA 1G4EA 5KTLA 1GPWA 4TIMA 2Q8LA 3EX1A 3C2OA 4O57A 1JQVA 1HO1A 1W8SA 2DU2A 2FQIA 3NM3A 3UPWA 1VRDA 2A1YA 4O28A 1GYLA 2YXGA 7TIMA 1FDJA 1K7FA 1W5QA 4Z1AA 4H3DA 4UTTC 1EUNA 1VS1A 3M0ZA 3MO7A 4LVAA 3TR2A 5H2ZA 4LVBA 2DZVA 3S0CA 4JTSA 2DZPA 3GX9A 1B4KA 1LROA 3M44A 3NQGA 2ISVA 3SFKA 3QM3A 3PUEA 3NQ6A 2EAWA 4ZQPA 1TPB1 3CQ0A 3HG3A 3OVRA 3BV4A 1IIHA 3DHDA 3HQ1A 2ZFAA 2WSQA 3SZ8A 1JUKA 4X2RA 4GUGA 5IBXC 1OFDA 3PY2A 3W7OA 5FESA 1H1YA 3NQ7A 1IXNA 3CWNA 1JCJA 3UZ5A 3QC3A 3UXDA 3UWYA 1CX9A 4O4VA 2DZSA 4ZMGA 3N34A 1RQBA 4UCGA 4PH6A 4BWLA 2A0NA 3DZ1A 1W3NA 3TJLA 5K2ZA 3RF9A 4WZHA 3PSVA 3HG2A 3KX6A 3INPA 4Z1DA 4KWWA 4K39A 4O1DA 1A53A 2YFOA 2QF7A 2QCFA 4JY9A 4GUFA 3S1UA 1W5MA 1GTHA 4PL1A 1GWJA 2A4AA 3M16A 5LNSA 1AG1O 2WKJA 2G95A 3TMQA 1MEIA 1H7RA 2Y63A 2NXIA 2OX1A 1YDVA 1QFEA 2JBMA 3B03A 2WNZA 1FQ0A 2RH9A 3LHVA 2YSWA 4IMFA 1F5ZA 1SW7A 4W9TA 1H63A 1KM2A 3GXNA 3TMLA 2W79A 3G0SA 3IIPA 4AHQA 5BRBA 4LRTA 1KTBA 3PBYA 4R7JA 2D73A 2TYSA 3MP3A 3P82A 1UASA 4QQ3A 4NX0A 2FTPA 2H3DA 4LVDA 2BSLA 2QCCA 3CPRA 3UWUA 4MLRA 3SGZA 3EWBX 3GDTA 4ZL1A 1FCVA 1SPQA 2VFDA 3W87A 1P0KA 3N9RA 1NF7A 2J9XA 5CKSA 4DF0A 4NJGA 1Q6LA 4GXMA 4OHQA 2YR1A 1EPXA 3M1ZA 5GVJA 4K8EA 2V2CA 1OJXA 1DQXA 5AC7A 5F2IA 5F4WA 3W83A 1UUMA 1GJPA 1ALDA 1OX5A 3LCHA 4DEFA 3C2EA 3ATZA 2C16A 3CIXA 4UTHA 1F76A 3NZRA 1TRDA 1LBFA 1L6WA 2VEPA 3GKFA 1QOPA 1FDYA 3P5ZA 5C2XA 3TQVA 2TSYA 1I2QA 1RR2A 3W3OA 1B9BA 3W70A 3C52A 2VEKA 3O1NA 2QUVA 4FHAA 4ORMA 4ZQNA 1SO5A 1ICSA 1VYRA 3JRKA 2CLOA 4EWND 3V1PA 3TAKA 3RK8A 1YADA 1R46A 2FB3A 2QAPA 4Q33A 2G5WA 1JCYA 2OT0A 4UUIA 4JTIA 2ABAA 4NQ1A 3M6YA 3BG9A 1H51A 3P60A 1AW5A 4R33A 1NFBA 2E77A 4Z08A 5DCBA 1H60A 1B57A 1YTDA 3S1XA 1H61A 5LHFA 1RV8A 4ALDA 1F05A 2X1UA 4A21A 4FIQA 4GUIA 4ZQRA 1SW0A 3UD6A 3NQVA 5HQEA 5LNUA 4CNPA 3S6DA 4HPXA 3HOJA 3KVMA 4HIBA 2A85A 4BR1A 1XUUA 2V5BA 5U7SA 2Z0IA 3W7DA 5EBUA 4GWEA 4LV9A 4AWTA 1TTPA 4FNPA 1YLVA 4YXGA 5LHEA 3W2NA 2B4GA 3FS2A 1KFJA 4CQ8A 3NEVA 3TQKA 1K3UA 2W0UA 4YLWA 5D04C 4O11A 2ZA1A 5IM51 3GXTA 3LCXA 5DBTA 4IQLA 4LC6A 4MFEA 1EX5A 5H91A 2E6YA 4AWUA 4OT7A 5L9FA 1ICPA 3SECA 4JX4A 2EGZA 4DO4A 5C54A 3TUUA 2CLIA 1VCGA 3W1TA 4DF2A 3NAVA 4GRSA 4JN6A 4UMAA 3DU0A 4N4QA 4UFKA 1QDSA 3DI0A 4CQ9A 3IVSA 3QF0A 1IXOA 1W5NA 1CI1A 4MFDA 1VR6A 3W73A 4RJEA 1AL7A 3LDVA 4QJ1A 4BFAA 5F2LA 3GB6A 2PC4A 2X1RA 1JVNA 4XTIA 1SSDA 3HGJA 2VOMA 2NZLA 4JTKA 1KFBA 4S2BA 1L6SA 4ONVA 1TPDA 3QW4B 3PB0A 2P1FA 1U5JA 1NEYA 4ADSA 5AHFA 1KW1A 4MYAA 1OK4A 3NQEA 3L5MA 1TO3A 1DKWA 3UY8A 4A29A 5EL1A 4RCXA 1I2RA 4WJEA 1EWEA 2A5HA 4BK9A 5CPMA 4O15A 1MZHA 3F4NA 2ZZ5A 4MOZA 2C13A 4X9SA 3HIJA 3HO8A 5SWUA 4S2CA 2HS8A 4Z0SA 3F4WA 2E09A 3NR0A 3BGJA 4ML9A 1E51A 3KFTA 1W54A 2ATMA 5HNRA 4O0ZA 3G1HA 2Y7FA 3NPWA 3B8DA 2RHGA 2C15A 2ZTKA 4O13A 5FF7A 4NU7A 4WQ6A 2YDAA 3EXTA 3NO5A 3AO0A 1TPH1 1PCWA 4TO8A 3MHGA 2QCEA 2BXVA 3MI3A 2V9DA 1F6KA 1PCKA 2QCMA 3WJYA 2GVJA 4HN4A 1TCDA 3LTSA 1C29A 2YYUA 3LXBA 3TSMA 3LCFA 4N9BA 4IXHA 1JR1A 3T4CA 1W3IA 4LTSA 3TFXA 3YPIA 3MBFA 4IUOA 5D2WA 5F4XA 3W2UA 2VFEA 5F4SA 4U28A 5AHMA 3EWXA 1H7XA 2Y89A 1XBZA 4KKXA 4PEKA 2NLIA 1A50A 2AGKA 1O94A 1QPQA 3CB8A 3NXFA 2GJNA 2WQPA 1TPEA 4LVFA 2DJLA 1HTIA 3N2XA 1UJPA 2VEIA 3WK1A 3TX9A 4NNAA 4NVTA 3V75A 3STGA 3E12A 4O10A 2HS6A 4LS0A 3S5YA 1QO2A 4OBTA 1XBXA 3IIVA 3KOFA 2VENA 3LGEA 1TSIA 4UFIA 3C2RA 4AXKA 3LI1A 1OFOA 4NXKA 1G7VA 4QSHA 3HB9A 4FX6M 2ZCGA 4IXXA 4UTMA 3MBDA 3PB2A 3NM1A 2VFFA 2Z1BA 3L2IA 3DH7A 3SI9A 1TPC1 3Q37A 3TA6A 3EKZA 3BVJA 1QPOA 1A5SA 1NSJA 5F2MA 3W84A 2CLKA 2ZRZA 3W74A 5AC8A 1OX4A 4OU1A 2FJKA 1LZOA 3QYQA 1UCWA 4RKAA 1IGSA 3K30A 1AK5A 2A7RA 4TR9A 1G4PA 2GPTA 3MP5A 4DXVA 4UTKA 3BGGA 3W7NA 2J88A 5FEWA 3FKKA 4DPQA 3PBWA 4NJJA 3LCGA 3LCWA 4LS2A 3MP4A 4JX6A 2WJZA 5D05A 2X1TA 1N8FA 1I2PA 1U83A 5DY3A 3LCLA 4TX9A 3NQFA 1L9WA 4FNUA 5LKYA 3BW2A 1ICQA 3CT7A 2Y6ZA 2DP3A 3GDRA 1SZGA 1P4CA 4MIMA 5I3KA 3W1PA 2Q3OA 4XKYA 3H55A 4E2BA 1FUYA 3LHZA 3G1YA 2VFGA 3C4UA 1VC4A 5FF2A 1Q6QA 3FLUA 4K6AA 4ZQCA 1V7YA 2B7QA 3PF3A 2V2HA 3W7EA 2P0OA 4GC4A 3L68A 4IGHA 4UMCA 2ZZ2A 3WJWA 3ZS4A 2NV2A 2NXHA 4D2JA 3T40A 2ISWA 3GKAA 2RDWA 3R5EA 4LWWA 4MKNA 3B4UA 5KINA 3KVJA 3W1AA 3BLIA 4AHPA 1UB3A 2LLEA 1TJRA 3EX4A 3RLVA 2Y7EA 3W23A 2YX0A 4XBKA 3LV6A 4IPIA 3G1SA 1OHLA 2DZUA 3WK3A 2F7FA 2GVGA 4WY0F 3VKJA 1TQJA 4NT0A 1LTDA 4FEZA 5TIMA 4Y90A 1TPWA 3QPYA 5G2HA 2YCEA 2JGYA 2JKEA 4A2SA 1HUVA 2X1SA 1QPNA 4RK8A 4HHPA 1EIXA 3BK0A 4RLIA 1TTQA 1FDZA 1VLIA 3SSJA 3W75A 4LU0A 4JGDA 1K8YA 3ZR4A 3BG5A 4O0KA 4O1AA 3DXIA 2FPVA 3SJ3A 5E93A 1KM5A 1XC4A 5FEZA 2WNQA 4UFLA 3NQAA 1VYPX 3LHUA 4GUJA 4I7VA 4GNJA 1OYAA 4K7VA 2PE4A 4FNSA 1LRQA 3N73A 3HPXA 3PWAA 4FNQA 3O06A 4UC5A 5J5DA 5EYWA 2WNNA 4EVZA 2QCDA 1XM3A 4CCEA 3FJ6A 4HNTA 5G1TA 3P5YA 3UNDA 2Z2UA 4EF8A 4JR5A 1YXYA 3TW7A 1VCFA 1LDCA 1OF8A 3WJXA 1A5CA 3MUXA 3TFCA 1F74A 4MZYA 3O16A 2IQTA 4CLMA 1SFLA 2VKZG 4IWWA 4UR8A 3L66A 4ADUA 3IRDA 4E2DA 3U6WA 2GVLA 3ZWTA 4O8RA 4IMGA 3LV5A 2CLMA 1RVGA 1GVQA 2PRLA 3I68A 4UTLA 4OV4A 1AW1A 5G5IA 1YDNA 3IIOA 3KRZA 3FYOA 5D2TA 1R30A 3TE9A 3LRLA 3G24A 3WFAA 3NVTA 4BF9A 5HMSA 5KMYA 4HNUA 4MVAA 3TXZA 2RDTA 4ZVJA 3L0KA 3SR7A 1YTKA 4UMBA 1S3HA 1PHQA 3L65A 1LLWA 3WK2A 1JRBA 1DOSA 3NQDA 4JTJA 1TRIA 2WOQA 5LNRA 1L6YA 3ABOA 1YYAA 3ABSA 5LGXA 2B7NA 2QCLA 2GQ8A 3ABRA 4G1KA 3IGUA 3N9SA 5C5YA 2BZNA 4E0CA 1QMLA 1QOQA 3GDMA 2R8WA 5DBUA 5K4ZA 2ZYFA 3QZEA 3B0VC 3PAJA 2QJHA 5BNKA 3EXSA 2A2IA 4UIOA 4QISA 5I3JA 2JGQA 2XN0A 3B0PA 1T96A 1VHCA 2HMCA 2WSRA 3A5VA 6ALDA 1UUOA 1Q3NA 3HG4A 5DCDA 4UNLA 4LS1A 3GAKA 3W7LA 3DGRA 3S5NA 2CZDA 3TROA 3W7IA 3W7GA 2TRSA 5D09A 1WQ5A 3UWVA 4JNMA 2E6DA 1XI3A 3DKJA 2OT1A 3I6RA 5AB3A 3BW4A 4GBUA 4CQAA 2EPHA 3A9IA 2DJXA 2PRHA 3FFSA 3IIZA 5TQLA 2XN1A 1TB3A 1MEWA 3LHWA 3IGXA 3W7PA 3O63A 2HTMA 1SO6A 1R2RA 3MI2A 1T8XA 2ZZ7A 1JCNA 4MZ1A 2PURA 2ZZ1A 5CPNA 1GG1A 3I65A 3R89A 3W1XA 4XZ9A 2CZEA 5K9XA 3DBPA 3G1AA 1TYGA 1BTMA 1TJPA 2ZA3A 1B3OA 3HPZA 1GYNA 4DO6A 4UNKA 4TMCA 1YPIA 3TJXA 4PA8A 3H54A 3GR7A 3G1FA 3FJLA 5TBOA 3VCRA 2R91A 1ZCOA 1G4SA 3MMTA 1ZENA 2YW3A 2ZRVA 5KZMA 4TMBA 4JEQA 4LC8A 4AEOA 5A5WA 5EY5A 2VEMA 3W1MA 3DFSA 4IX0A 3RNDA 3O8AA 3IIXA 3E02A 4LNYA 3F03K 3C2FA 4JDYA 3CHVA 3W85A 3W22A 5C55A 5K7JA 1XL9A 4DBEA 2Y7GA 4FIRA 3M7WA 2C1HA 1WOAA 3LLDA 3W1QA 3GAYA 1R47A 1NF0A
chains in the Genus database with same CATH superfamily
4JTLA 4OV9A 1JG9A 3RM8A 4KRUA 1ZNNA 1DQWA 2XHYA 3PTDA 3MB9A 2ZUTA 2CLEA 1EPVA 2PWVA 3WF3A 1A3WA 1H7PA 2QCGA 3AHXA 1C3FA 1F8MA 4IPLA 2NX9A 2WKLA 5BWAA 5BWFA 1CGUA 1ZUAX 5A95A 2VDGA 3KHJA 3Q2DA 1ZJHA 3PZOA 4LUTB 3SDOA 4O1CA 5G2WA 3NZ1A 1DHPA 3GVRA 3LOTA 2NUWA 4B4HA 2WSPA 3MSGA 2VX6A 4N6FA 4M7TA 4JD4A 1TREA 4QDPA 2D2OA 3EOOA 4N9EA 4TV5A 2PI6A 5GJMA 2YBVA 3N4FA 4WJ8A 2BHUA 4WDTA 3UWZA 2YBUA 3QY8A 3BCJA 1FFRA 1FRBA 2GDVA 4ICNA 1IWBA 4JN8A 2WC3A 4FP1A 4MWAA 3S9IA 2P0IA 3AXMA 3TSBA 4A3HA 1EB3A 4PTVA 3T78A 1J2WA 3GXPA 3ZWSA 2V2DA 3GYCA 1CNVA 4B5UA 3AJXA 3C8FA 1D7KA 2ON3A 2CLLA 2QNEA 4U3AA 2X2GA 4ZB5A 4P7QA 1W2VA 2C79A 2PCQA 3ARYA 3GDLA 3LSCA 4UR7A 4LOCA 5LIKX 3KOXA 3ZJ7A 2HBVA 3OVPA 4GZ7A 4AD4A 2FFCA 1UBSA 4UTWC 5H6HA 1TVNA 1R9ZA 2JIEA 2FZ9A 1PKNA 4PMYA 2IS7A 5D9NA 1PV8A 4JY8A 3W26A 2X8RA 4CD4A 1IWPA 1XLMA 3C5QA 4JIRA 4XZWA 4Q32A 5F1UA 3CASA 4UFMA 4XVDA 3WNNA 1KXVA 1N8IA 2QPUA 1TG7A 3EKGA 4DVOA 1UC4A 3HV9A 3P61A 4A8LA 2Y7DA 3KHDA 3LNMA 1TV5A 1UH3A 3VGHA 4UCFA 4KQNA 1A0CA 3PUOA 2A7NA 5E6ZA 3THQA 4LY4A 2F6XA 1EIBA 4WF7A 2JKAA 4JIIX 3WD0A 1E1FA 3TC3A 4L4MA 1P6CA 2DIKA 4AX6A 2DIJA 4Q8NA 3WQ8A 2EF9A 1F7BA 2GGGA 4QCEA 4M81A 2Y8KA 5IHRA 2C18A 4O4WA 5E6YA 2E25A 3W7QA 2H90A 1TA3A 3A3XA 1F2JA 4U4MA 1CPUA 3B8VA 5I3HA 1XF0A 2C3ZA 3AI0A 3VNYA 3F7JA 1C9WA 1BYAA 3RFAA 5J5RA 1E5JA 2EPNA 4CN1A 4S38A 2HBXA 4EF9A 4RL3A 5FJOA 3PG9A 3NQMA 2FPTA 3GNXA 2Z25A 5ABTA 3TJIA 1UP3A 2VXNA 2E6AA 1KV5A 4L6HA 4YVPA 3Q94A 3TH6A 1KCKA 2E5BA 3MDUA 2YA0A 5IBXA 2ZE0A 4C6JA 4LUJA 5DLCA 1JI1A 4TUFA 1IHIA 3GR4A 3N1AA 2DSZA 4BZYA 1W1IE 2OLSA 4OGZA 4L61A 2UBPC 3C0SA 3VM5A 1UD2A 4JOMA 5KZ6A 4AZIA 1QHZA 4ADTA 1A4MA 2OLHA 4NILA 1M7XA 2WW5A 5G1MA 3NG3A 1VFSA 1OCJA 4Q6JA 3KBWA 4H9VA 4C6DA 4HNOA 3NA8A 2E1DA 4LYRA 1FXQA 4KEZA 3W2MA 3OLGA 1RQEA 5HDRA 4I7UA 4DLMA 4JX5A 3UF9A 3S9YA 3AYTA 1QNQA 4Q4PA 3W7KA 1OCNA 3GNNA 1LG1A 1Z7AA 4WDXA 2YA1A 3BO9A 3KM8A 2RFGA 2J24A 5T26A 2GK1B 1XLGA 3RMEA 3AIBA 1XCWA 3DFTA 1H0GA 1GVYA 3RCMA 1DWAM 2Q71A 2CCRA 3CK5A 1LL4A 1FTXA 3VYLA 1IT7A 4LT9A 4GFSA 4HU8A 4JHMA 1Q65A 2OO6A 2VRQA 1PS9A 3TA9A 3T55A 1CZ1A 2EG6A 3ARTA 1GW9A 4GIYA 3LRKA 1JRCA 1SW3A 3WF2A 2DZXA 3ERPA 3VD3A 5CPOA 1OADA 1OYBA 1G01A 1E6SM 1K6AA 3EB2A 2RDUA 1MQRA 2D22A 4C6LA 1XC6A 3RLGA 1Y7VA 3PNUA 4DZIA 1B2YA 1E6QM 5C7HA 2ZVRA 2GUBA 2FGBA 1KM3A 3Q65A 3GFZA 3B0XA 1TR9A 5EKYA 4AFYA 3V16A 2IW0A 2Y0FA 3H70A 5TNVA 4K8HA 1ME7A 2ZZ4A 3PVFA 4MY9A 3ARRA 3PUDA 5AECA 2WMJA 1YKWA 3QR3A 3W1UA 1R87A 4HMEA 2VELA 4YTQA 8XIAA 4DN1A 1JYWA 3HA1A 4MJZA 1BKSA 5HR7A 1IT8A 7REQA 4QQUA 3VE9A 1NQKA 1W9VA 4XUGA 1HT6A 4C6IA 1CLVA 1HJSA 2XPKA 1MNSA 3OYXA 4JICA 1TWSA 5TD4A 1D3CA 2WMIB 2ZUSA 2Z27A 3DENA 2GDUA 4E5TA 4CCDA 1SSGA 4GNKB 4NNBA 4Q8WA 2ZXQA 5DEZA 4H9ZA 3EB4A 3M5VA 3R58A 1V6UA 3SSZA 2FZ8A 3TQPA 1HNYA 2D20A 1VD6A 1G94A 3WEZA 3QHNA 1VBGA 1LJYA 5CZSA 5TF0A 3BE7A 3H6OA 3TYZA 1TTJA 4LUIA 4EPBC 2MANA 2HJPA 2VZVA 4AD5A 1XV8A 3IUIA 1MQQA 3I6TA 1JJKA 2VC5A 1W9PA 5BW6A 3R8GA 3FEMA 1AQ0A 1QXLA 5E0KA 1OM0A 4FNRA 3C56A 1P0NA 3DYMA 4QBXA 1YEYA 4H19A 2CXGA 4GCAA 3QTGA 4WY0B 1X39A 4CEXC 3R4IA 1LLZA 3KOYA 2PGWA 2PGFA 4DUXA 3FJNA 1M41A 1W9XA 2VI0A 3WLRA 1OT2A 3L4XA 3KL5A 1KTCA 3NO3A 4Y6GA 1BQGA 1FWBC 1I2NA 1V3KA 1XSKA 4JAWA 3CV2A 4A2RA 3TSDA 4C6KA 4ZBCA 3TYEA 2PMQA 1YDOA 1ME8A 1Q6GA 3AXKA 5HMFA 5IDIA 3P3BA 2I9EA 2YW4A 3PZQA 2OG9A 5HMDA 4H9YA 5FF4A 1JZ3A 3RAOA 3WBWA 4DELA 1V0NA 3W81A 4UR9A 4TVCA 1RQHA 3MCMA 3WQGA 4GABA 1EJSC 1EJ7L 4UQEA 4AF0B 5HPCA 1TIMA 4R7OA 5GJNA 1MRAA 2EQDA 4OWGA 3N6JA 2GFTA 1WDDA 1WA3A 3QMTA 2F2HA 4GCXA 4Q4SA 1TJ0A 3V35A 2BOEX 4HA1A 5FAJA 3TYBA 3TW9A 3WUEA 3IEBA 2GWNA 1W1A1 4W84A 5K9DA 5HUOA 1EP3A 3PNZA 1R9YA 3OEXA 4HTYA 3VGDA 4LW7A 1WO2A 1OD8A 5A8PA 4PSRA 4CD5A 1HG3A 4Q4KA 3USBA 4EXQA 3IGSA 3N15A 3UZXA 1X96A 3MSYA 4HJFA 2GSJA 3LXCA 1WDRA 3NDZA 3FHAA 1J6OA 2TMDA 4RXGA 3SO7A 4RV8A 4MDOA 4AWEA 2Y4SA 1HL8A 4NASA 1OGSA 3B05A 4CU7A 3LM3A 1RZMA 1H1ZA 4Z2IA 1VQTA 4LUSA 1OYCA 4NAFA 5CSRA 1BYCA 4YVXA 1QK0A 2FH6A 1K8XA 2BG5A 3ARSA 4E8GA 2J27A 3WMLA 2XN2A 1EL3A 1TR1A 3M6DA 4Z1YA 1E56A 5DXXA 4MLJA 4X22A 2VWTA 1YDYA 4PTNA 4JN7A 2VUYA 1LCOA 3W6YA 4DLFA 2G37A 1ZBKA 4JFUA 4G5DA 4K7YA 1IZCA 3U57A 3BLOA 4J35A 3G8RA 3DOPA 1WZAA 5A2CA 2Y88A 1XIJA 5A6LA 3SUVA 1FWSA 5G4WA 4BQ2A 3CYVA 5AYYA 3WNMA 1N7KA 1CYGA 1GKQA 1HO4A 1L2QA 1Z32X 3C61A 3ARZA 3ZFHA 1DJHA 5HOSA 1UA7A 5CG7A 1OINA 3KCOA 3BL3A 5HXMA 3SW6A 2A6NA 1E40A 3GHRA 1OFQA 4BWLC 2HSAA 1H49A 1VAHA 3T0BA 1FHDA 3AHTA 1TWZA 1KM0A 3KW3A 1UOZA 2FHBA 1CBGA 5DN1A 4H9MA 4O54A 3AMDA 1EHAA 1IEVA 4ZO7A 2BLEA 1DV7A 4L4LA 5DCEA 1PKYA 1O12A 3TCEA 1YRRA 4CEUC 2P3EA 1WAUA 4TU1A 3G18A 3PR2A 3HPSA 3VM7A 2ASHA 4GK8A 4QFUA 4HPJA 3WH8A 1CB2A 3S2MA 3T8QA 3EX6A 3P74A 2OQYA 4NXSA 3UERA 1J9YA 1X1ZA 3ZVHA 4C60A 2WAGA 1DXIA 3H8AA 3A4WA 1GVOA 2A3EA 3HGRA 3K8LA 4KS0A 3GK0A 3LLFA 2DGAA 4B5XA 2O7SA 4LGXA 4NJKA 4FOJA 4Q8OA 1KBBA 3NURA 2Y62A 1XSJA 4AZGA 1H50A 4EXBA 1DJWA 1NDVA 5CZ0A 3AHYA 2PDPA 3PG8A 3WBEA 3FXGA 1Q6FA 4KFOA 1GQKA 2E68A 4QCFA 2QAFA 4UOZA 5T9BG 3P84A 3VDHA 2J7DA 4DWSA 2Q09A 3FVDA 1KBIA 3NZQA 3E2VA 1DIKA 4D6EA 2P53A 4GISA 5AVHA 3PM6A 2GQ3A 3IUHA 3IWPA 5I3FA 3E9AA 2FMNA 2X0SA 4MY8A 4UOJA 1MDRA 4G6CA 1CXHA 1SMDA 3I3EA 1KGUA 2Z6IA 3EBVA 2UZ9A 4O17A 3NJ3A 1OIMA 4ACYA 4KESA 2WYSA 4W88A 1PE1A 3DFOA 3VOCA 3LYEA 3ANVA 4UTJA 3WLMA 2QEZA 3GG7A 2VUNA 1LBLA 5C9RA 1S2UA 4IP5A 4HSOA 2NX1A 2XGZA 1GOKA 1PZ0A 1AL8A 4LUSB 4IIBA 5EFFA 4Y8EA 1U5HA 3VKKA 4DXXA 3UY7A 1Q8JA 1NJJA 3WDQA 1K6WA 1GUVA 3DKLA 1KGWA 3L5LA 4AIBA 5IDZA 5KTLA 1QU4A 3EX1A 2D3NA 1DJIA 1E43A 1W8SA 4H00A 1W17A 4K3ZA 3T2QA 5CPTA 4F4RA 4OBRA 2XFFA 1GYLA 1NH6A 1PTGA 2O55A 4FK9A 7TIMA 1K7FA 4C90A 4Z1AA 1IT0A 1GOQA 2ZOXA 4UTTC 1R9XA 1H5VA 1VS1A 4AX7A 1E0TA 3MO7A 1UZHA 5H2ZA 2ZXBA 3S0CA 2WCSA 4GG9A 2V68A 4TOQA 4WKFA 2VWSA 4S3AA 2WMGA 5GNZA 3NQ6A 1TPB1 3BZGA 4IICA 2PDWA 4JHZA 5GQBA 3H4WA 4J3UA 4FS9A 5JBEA 3TN5A 3BV4A 3DHDA 3UR7A 4D8LA 5JIPA 4D6CA 2ZFAA 5IBXC 3BMVA 3EPNA 3PY2A 1POJA 5FESA 3NQ7A 1A5OC 4MMWA 3KZSA 3CWNA 3UZ5A 4B5VA 1IEQA 4A8RA 7ENLA 2OQLA 3GTHA 1ZP4A 5C9XA 1DHKA 4DNMA 1FHUA 4ZB0A 4HZ8A 4KWWA 4O1DA 1A53A 1A3XA 2QF7A 3W24A 3L4WA 4GUFA 1W5MA 1RUSA 5AYIA 3UZZA 1AG1O 1A0EA 1NELA 4GD0A 1H7RA 3WD1A 2YCJA 4NG3A 2OX1A 4W7UA 4HU3A 2D2GA 2WNZA 4F2UA 4TV6A 3M4HA 4FAMA 3WDRA 1LL6A 4HPHA 1Y65A 4AHQA 4QLJA 4HGXA 4LRTA 3UCQA 1NARA 4DI9A 3E5BA 3MP3A 3WLHA 4JQAA 1UASA 2UY3A 4QQ3A 2FTPA 4AZ5A 1PPIA 3CPRA 3BXWA 4MLRA 4H01A 3GNRA 1RLDA 3RYSA 3TLLA 3W87A 4J4KA 5CKSA 4NJGA 4JNZA 4O1FA 3RJYA 2YR1A 1ZJBA 4K8EA 2OPJA 3XISA 3HZ3A 1FWEC 1AD1A 4J3XA 4S3GA 2REQA 4MNKA 3QZ6A 1GJPA 5HMEA 2HXTA 1LG2A 2C16A 1W9BM 3CPUA 3B8UA 1ITUA 1M1BA 1AUSL 1GCYA 2J62A 3S2JA 1LBFA 1UKOA 1L6WA 3JZUA 1X7IA 1TFVA 2O9PA 4P8UA 2TSYA 2Y8VA 3HN3A 2ZUVA 1VFTA 3QGVA 1MDLA 1ISYA 2VEKA 2QUVA 3IJLA 1UP0A 1PJ9A 9CGTA 3SADA 5CLTA 4EWND 4MWAD 3ITVA 3TAKA 1EH9A 3RK8A 4PUDA 4JQ2A 2FB3A 2QAPA 2BS9A 3GIQA 3A64A 3GBDA 2J47A 5GJPA 4NQ1A 5A6SA 1P0DA 5DCBA 1YTDA 1B57A 5LHFA 1MQPA 2OYMA 2QVHA 4A21A 5FSEC 3UD6A 3E2RA 3EDFA 3LMYA 3NIYA 3BLDA 3KVMA 1GVIA 1HX0A 1XUUA 4DYJA 2V5BA 5U7SA 5I23A 4GWEA 1M7JA 4R9OA 4DUWA 4YXGA 2BP1A 5JXQA 3W53A 7CGTA 1R0MA 4HSHA 2B4GA 3F2CA 4CQ8A 3TQKA 3AS0A 3PJTA 2BASA 1TX0A 3GXTA 5DBTA 1D7FA 3CT2A 3GVWA 1DTNA 1YW1A 4AWUA 5L9FA 2JALA 4JX4A 2J7HA 4Y9MA 3TUUA 2XU2A 3Q4DA 1EO7A 4ZOEA 5CXPA 4UMAA 3OZMA 3THDA 3IVSA 3QF0A 3HM7A 4ZR8A 4MFDA 2RGMA 3OODA 3WCZA 5FA5A 4AQLA 5F2LA 3VD9A 4F0LA 2WANA 1L6SA 4ONVA 3AS1A 2PDYA 3V5FA 1QT1A 5AHFA 2Q8XA 4MYAA 2DW7A 1I60A 2IKIA 4RPQA 3UY8A 2AQVA 5EL1A 2DVTA 1EA9C 4MDPA 4BK9A 2I9UA 4KCTA 5A6MA 1QVBA 1L8NA 4O15A 4PMDA 3HIJA 3WBAA 4S2CA 4Z0SA 4OUIA 3NR0A 3BGJA 4DJFD 1XPGA 1WZMA 4GKLA 2Y7FA 3CWHA 4JIHA 4M82A 4O13A 4RPPA 4AZCA 1PKMA 2QS8A 3AO0A 3B8SA 1PCWA 4TO8A 1KRAC 1VB9A 1B3ZA 4WRHA 3VOIA 4HNLA 3GY1A 1WXZA 1REQB 3RITA 4ATDA 3ITXA 3ZVIA 3DFYA 2AQOA 2PEVA 3ARQA 3LXBA 1E5NA 3KBJA 1LUCA 1I75A 3OP2A 1I0BA 3D6NA 5E5CA 1JR1A 1W3IA 2QIIA 2WXDM 3TP4A 4UB9A 3B9DA 6REQA 1KXTA 5F4XA 4LF2A 5F4SA 1OIFA 5AHMA 1H7XA 5IOBA 3W25A 3ITCA 4KKXA 1A50A 4WGXA 5JMUA 2X42A 4GINA 3NXFA 2VURA 4O8AA 1JL8A 1Y5WA 2CNCA 4LVFA 1NDWA 2PWHA 1VBHA 3FHQA 2CHOA 3N4AA 2VEIA 1FWJC 3TX9A 2DH3A 4NNAA 2VM8A 2DUXA 2HS6A 4E8CA 3S5YA 2F6UA 4WEVX 3IIVA 3KOFA 2VENA 1BGAA 2DPEA 3E5PA 3AALA 4AXKA 4GY7A 1OFOA 1S39A 2FVMA 3BOXA 2E1WA 3HB9A 1TE1A 1CLKA 2Z1KA 4IXXA 3PB2A 3NM1A 3PUGA 3WUBA 2Z1BA 2VD8A 3RRXA 5I00A 1QI5A 4E2VA 4HYRA 4MWAB 3SI9A 3Q37A 3BVJA 3R43A 1QHOA 5F2MA 3W84A 2CLKA 2VVSA 3VDAA 1EGZA 3W74A 1OX4A 1LZOA 2QMJA 2ONEA 4RKAA 4GI4A 1AK5A 2OWWA 2XIMA 3WH9A 4E4PA 4PSPA 4F48A 3W7NA 5T8GA 1BKHA 2J88A 2WZEA 5FEWA 4Q6XA 4DPQA 2JEPA 4UTFA 2AMGA 3DG6A 1Q7ZA 1TZZA 3QVQA 2WJZA 2X41A 2XGBA 4REQB 1BLIA 4NZ3A 4TX9A 4JKMA 4V2XA 1ICQA 5C7VA 3H7VA 2CBVA 1P4CA 4MIMA 3AIVA 3UFYA 2Q3OA 4E2BA 3MCOA 2VFGA 2WVVA 1JZ6A 3AWNA 1VC4A 5FF2A 1HJWA 4ZQCA 1DWGM 1V7YA 3L2LA 3PF3A 2ADAA 3WDIA 2ZZ2A 3NDYA 3T40A 4JTAA 3R5EA 2HV5A 9XIAA 1IYXA 2V5KA 1E6ZA 2ACQA 5AC4A 1NFPA 3OU8A 4XZIA 4JCMA 4E8DA 2QUMA 4JZ5A 4H8VA 2QDEA 3G1SA 2X05A 4P7NA 4IQDA 3WK3A 2BHYA 2GVGA 2PP1A 4WY0F 1TQJA 3O6AA 5M3WA 1TPWA 4MNMA 4QDMA 1XR2A 3FVMA 4F66A 2OGJA 4BKNA 4AIOA 3OJGA 3S6TA 1EIXA 2EPKX 3FSUA 2I5QA 1JPHA 3WSUA 4AZCB 1UIPA 4DXKA 4ERGA 3VK5A 3W75A 4XK2A 4LU0A 3EWDA 2PPGA 2QLYA 1KXHA 3PPFA 4UFLA 3UG5A 3M0VA 1VYPX 3LHUA 1A5NC 1FWHC 1N8WA 1LRQA 3PWAA 5J5DA 5EYWA 2WNNA 3CL6A 4A8IA 3S4TA 1Z89A 5EBAA 3WYZA 4DX3A 1DIOA 4IPNB 1FH8A 1VCFA 4WJXA 3WJXA 1A5CA 3MUXA 3TFCA 5H8PA 3L66A 4E2DA 2GVLA 3HURA 2CLMA 4XO6A 2OYLA 2HZGA 2X40A 3IJ7A 3ZLGA 3IIOA 4MB4A 3TE9A 3LRLA 3WFAA 3NVTA 1FFQA 5HMSA 4MVAA 4ZVJA 2JF6A 4S23A 3R79A 4ZA0A 3CGTA 4AIEA 1GOWA 1S3HA 3L65A 1LLWA 3ITGA 2R1KA 3H4GA 3WK2A 4EX4A 1DOSA 2VX4A 4JTJA 2WOQA 1H2JA 3TOYA 5LGXA 2QCLA 2GQ8A 1WAWA 2X7VA 3ABRA 3TN3A 4G1KA 1ZQ5A 3N9SA 2W91A 2OSWA 2GL5A 3WG6A 1QI3A 3ZLFA 4C6PA 3AS3A 1XFCA 3K2GA 4PTMA 3B0VC 3PAJA 4KRZA 4F9JA 1W1TA 4ZO8A 4QISA 3LQLA 2JGQA 1ECEA 3GUWA 1HQTA 4KW2A 3B0PA 4RZBA 2CIPA 4MB5A 3HG4A 2XFRA 1T6MA 1KFWA 3C0LA 4LS1A 1DJGA 3GAKA 1JZ2A 2CZDA 3W7IA 4GPNA 2E28A 4LCRA 4EPDC 3EOSA 4IF2A 1XI3A 1BXBA 3G6MA 2JF7A 1V3LA 2BVTA 2OT1A 3POHA 2FH8A 2W67A 1CENA 2OEMA 2XN1A 4C6OA 2NSOA 3LHWA 4PTDA 1XLIA 4B92A 4E4FA 4GMEA 2D3LA 1R2RA 1CGVA 1JCNA 1VFMA 5CPNA 3ONBA 4Y7EA 1OC7A 3R89A 2XWEA 3QOMA 1RVKA 5K9XA 1PDZA 3G1AA 4LYPA 3MA8A 4GLEA 3GFXA 3OGSA 3BLKA 4DO6A 1XPYA 3V4BA 3REQA 4PRWA 3JUGA 4C1NB 3P93A 3TTOA 3PBMA 1JNEA 4IUGA 3QC0A 1B3XA 5ABEA 2R91A 2G8ZA 3MMTA 1DJZA 1KBLA 2Z00A 3SCVA 1DJXA 1AA1B 4TMBA 4LC8A 5A5WA 5EY5A 3M07A 3EDDA 4LNYA 4J2PA 3F03K 3W85A 3W22A 3QV6A 2HVMA 4FIRA 3MMUA 2C1HA 3LLDA 1NF0A 3F1QA 4AY1A 3CBWA 1KM6A 5HINA 1SO4A 1OQFA 3P80A 1H5YA 5BXPA 4RNJA 3GUGA 3WELA 2QDGA 1ECQA 2XTKA 1UHVA 4JTTA 1SZNA 1QI4A 1VLWA 2REQB 3NWRA 4U3CA 2YLAA 2SFPA 1C9DA 2QR6A 1LUCB 1M6JA 3OO2A 3EEGA 2DORA 2YBTA 3TC7A 3SCRA 3HPAA 4QRNA 1EDGA 1MZRA 2YLLA 2GK1A 3HGSA 3O7UA 4L64A 2QXWA 3CQKA 3PK7A 1XG3A 2ZUUA 5I02A 3M41A 1OG0A 3NQ2A 4G1NA 3D46A 1R3WA 1DJNA 1F6YA 1E1CB 3GXIA 3TN4A 4J3TA 3BPWA 1X38A 4GJ1A 3WEOA 4WHBA 1V3MA 2V81A 5D32A 2ATSA 1XCFA 4FNTA 4MYXA 4DQWA 5DY2A 2A6LA 1OG6A 1O5XA 2B7PA 3A13A 1XYAA 3C2VA 4B5NA 1KFLA 4WIWA 1OVDA 4CCCA 2E5CA 1UROA 1GYMA 1XQLA 5E1QA 1JUBA 2PWEA 3D3FA 1V3HA 4KF1A 3QTPA 5BMWA 1OF6A 3Q67A 1OX4B 4GO9A 1UR8A 4PR4A 1ITCA 3SGUA 3PJWA 3N04A 2PLKA 3QMRA 1LBMA 4D72A 4KPLA 5AYXA 1Y0EA 2EG8A 2WC4A 4H7CA 2QCHA 3A5FA 4GACA 1FWNA 4GGHA 3VZXA 1FKXA 3R6IA 2EJ1A 4Q8TA 4OQVA 1PWLA 2YCIX 4I5RA 4IGSA 1M7PA 3R94A 1LYXA 3W2JA 3K4DA 3R2GA 3C3UA 2BTMA 3TC6A 5HAOA 3QV7A 4DWSD 3VUPA 3I6EA 4W8LA 1XDLA 1EJWC 4IJBA 1UMLA 4DI8A 5T91A 1ZZMA 3U2OA 3KS5A 2B7OA 5LNWA 1J10A 3F4CA 3B8WA 3AUJA 5TAOA 3U2EA 2F61A 1PZ1A 1IZJA 3GYEA 1WBJA 5D02A 4XB3A 4ZOAA 3NNTA 1CW2A 5CGMA 3APTA 3W72A 1SJDA 4JBRA 1T40A 3EDKA 4DPPA 1SQ7A 2BB0A 4J1OA 3LLXA 4KFPA 4XSLA 3JR2A 4HP5A 4QSFA 1C8XA 2PDHA 2VCBA 4WXZA 5U4NA 4QLKA 1XDJA 1I2OA 2FDMA 2ZE3A 3N11A 4FX7A 3IV3A 2ISSA 4NJHA 1EUAA 5D33A 4ACZB 2IMRA 3O0KA 4M1BA 1JD7A 1KLYA 1W31A 2G3FA 4XX6A 4R88A 5IRPA 1L6GA 5EFDA 1VEOA 4QROA 4LJ3A 1NP0A 2WPBA 5HULA 4JL1A 2CYGA 1WDWA 4IPJA 3GH4A 4BQ3A 2ZRWA 4X3ZA 2QCNA 5EMLA 3MQTA 3TW6A 4KEVA 4UTTA 2VYOA 1P43A 4ATWA 2CFFA 1UR9A 3UEQA 5DELA 2OMAA 3LM7A 1R3YA 2PDNA 2RKXA 4K36A 4PB3A 2X0YA 3V0TA 3AZTA 2XVGA 2WLYA 3M0XA 4V27A 3DHUA 3QQ1A 3G3DA 2A21A 2PSNA 2OEKA 3IPWA 3OIXA 1J0KA 3CL8A 1B4EA 1PL9A 3K4AA 2BXYA 3LA4A 3LBMA 4HNVA 2JKPA 1KBJA 4NAEB 5MF5A 1XLAA 1DP0A 2C6QA 1MXSA 2IPGA 4HHLA 4IP4A 1VPYA 3FIGA 3TV8A 3PPGA 3B4YA 2WHMA 1W3KA 3LZ3A 1B1YA 5CSYA 3HF3A 4QJ4B 4RR4A 4BI7A 5FI8A 1S5WA 2PAJA 2OXNA 2VC6A 1S5NA 1Z44A 1E55A 4YYFA 2QGYA 3NL5A 4NJIA 2XVKA 3BARA 1QBBA 1Q5MA 2HXUA 5BRPA 1DJQA 3ARVA 5KZDA 1AJ0A 2NQHA 4EAMA 4DIAA 5E09A 2CKSA 4HBKA 4B90A 3IVTA 3V5CA 3UJEA 2YYTA 2W66A 3DC8A 2W4XA 1V03A 4PFMA 2Z6JA 1NVMA 1PVNA 3O9NA 5FIPA 2JIWA 2MUCA 4MHBA 1JUEA 2YL8A 4WD0A 5D38A 1YE4A 3B0UX 1LOLA 3LEPA 5K4XA 1XINA 1PIGA 3UG3A 1JULA 3DG3A 5H1WA 1CGXA 1EQPA 1ML1A 4M8UA 1FY6A 2QT3A 4GI8A 5LIWX 2VC7A 2Y85A 1V08A 4UTUA 4H41A 1Q4WA 3CV1A 4ORIA 2ABBA 4XO7A 2ZRXA 3HBLA 5CZTA 4UTWA 3EPMA 5FD0A 4HMDA 4N2YA 3UZWA 4O19A 1VEMA 4P8VA 4TQTA 2CHNA 4Q8PA 2J8FA 3O6YX 3E0FA 3W1RA 4IMEA 6XIMA 1FX6A 2JK2A 1GEQA 5CAKA 4MZ8A 3J7HA 1NWRA 2PDUA 1OFEA 5D8ZA 2FGZA 4K8GA 2DT0A 4DWSB 4P8WA 5JU6A 3L7RA 4XD6A 2EKCA 4P2VA 1OZMA 3LGDA 1KLZA 1E1CA 3WJSA 2QDDA 3WH5A 2VT0A 2HPMA 4QE1A 3RX2A 4JHOA 3QZAA 5AY7A 3GNDA 2INZA 2NWSA 1S2CA 3RR4A 3WNOA 2GQ9A 3L0GA 3LPGA 1XYBA 4CVUA 4XAZA 3E0IA 3GE7A 1QPRA 1THFD 1GQLA 2RJHA 5FCZA 3LBOA 3R0KA 5D9PA 2CHRA 4KFNA 2FVLA 2GZXA 1VYSX 1YPFA 4HYVA 1U33A 1TE6A 2FDSA 3MJYA 5D9OA 2WVTA 4JXCA 1QHPA 1RBLA 1QR7A 4MY1A 1ADOA 1K9EA 3CU2A 3M0HA 3S5ZA 8TIMA 3SIZA 1JAKA 2QUUA 2GJXA 4H6EA 2I14A 3WQOA 4IL2A 1A5KC 3I10A 5B7ZA 4GOAA 2I56A 2YDQA 1G69A 5HWNA 4CD6A 3SUTA 4WGHA 3W37A 3GG1A 3AXHA 3MSDA 5BU9A 1OCQA 4A3RA 1PTAA 1J6PA 3H2EA 3LNPA 3M5YA 4RE3A 4XQ6A 3WQ5A 3CMJA 1G7UA 2OOFA 3NPUA 4HA4A 4IFRA 2A3LA 1J0ZA 2OODA 3TNOA 4YL2A 3WL0A 1LWIA 3L9CA 4GXWA 4YWIA 4IMAA 5FEXA 3VVGA 4K37A 3PTQA 3A9BA 1ISXA 1RBAA 3UJFA 1GTEA 2FIQA 5CGQA 3DN5A 1Z48A 4CNNA 5ABFB 1K9DA 3T05A 4O12A 2V3DA 4CCZA 1R2SA 2G4JA 3O05A 3ZJ8A 1YIXA 3MS8A 4LNCA 3W2LA 4B5SA 1I9CB 2C1IA 4AMAA 4LAOA 4F0MA 4CQDA 1BG4A 4B16A 4KH2A 3N2MA 3WQDA 2AMXA 4ILSA 3BAWA 5HATA 4POCA 4HHHA 1ZFJA 4QNWA 1Z3NA 4GGBA 2C91A 4L1XA 1EXBA 1SMAA 2IKHA 4UFJA 3WMSA 2DVXA 4M0XA 5MHBA 2DZBA 4DJDC 1XJBA 6TIMA 2H9AB 3CMFA 3LB0A 1N55A 4MJMA 3T9PA 4L56A 2WSKA 1A5AA 2QVNA 2BODX 4IL0A 2YA2A 4W7WA 1VJZA 5FEPA 4IISA 4GZJA 4REQA 5EMYA 4AC1X 3G77A 3GLCA 2AAAA 4JEJA 3PZTA 2NSXA 3E0WA 2VCCA 3WLJA 4U5KA 3T2OA 2A3AA 1UR0A 2XIQA 3P7YA 1XBYA 5D03A 4JTQA 1N82A 2A3HA 3QJAA 3HJZA 3AIUA 1QO5A 2E5DA 1YNYA 4MPKA 2OZ3A 1D3GA 2Q6ZA 1RK5A 3KLKA 4I3GA 1QOXA 4DUOA 5LGZA 3OBEA 3HG5A 4PUEA 5JQ9A 2PLMA 4RZ4A 3K1GA 1MMFA 3CQIA 3WNLA 2E40A 1XIBA 3FYPA 1V6VA 3VAVA 5DX7A 3G1RA 3STCA 2OCZA 1RLCL 4W85A 3KRUA 1CECA 5C2CA 1P6BA 3CS2A 3E0LA 1M9HA 1JGIA 2XH0A 4C65A 3B3DA 2GOUA 3U0HA 4O50A 2OYKA 1VCVA 1TUXA 2GDQA 4J3WA 4OOUA 4QTGA 4XIAA 3L23A 3AZSA 1XWYA 1GVEA 2VX7A 3BQ6A 3KEHA 4LEQA 4G8TA 3M0LA 1O4UA 5LZLA 2J9YA 2X2YA 4XD3A 1ZJIA 4LBRA 2XSXA 3SCQA 3GG8A 4M6VA 1U22A 1MW0A 4D9PA 3GVVA 1K4GA 1MO0A 3KCJA 2W3ZA 3ZOAA 4GO8A 1EFZA 1K02A 3WFLA 4UFHA 3S9ZA 2W9MA 1F6PA 1UBPC 1UZDA 2H3BA 2V3GA 2NQLA 2Y8UA 3KVKA 3VCCA 5E9AA 2Z26A 1EKOA 3MCNA 3GD6A 3COTA 4GI6A 3BG3A 3QYSA 1LOSA 3DFNA 3GNOA 5I3GA 3QGAC 1Q2RA 1RPXA 3UGVA 5I09A 3RPMA 1E6XM 3C0JA 1FH9A 5EMJA 4LAZA 1RJPA 2IPWA 3I3BA 2PF0A 3V7PA 3A4XA 1E6PA 2NWRA 1V51A 5AHNA 2ZIDA 1GVSA 3UETA 1I8JA 4LRSA 4WY0A 3M9YA 3STEA 4XAPA 4D6HA 4Y8FA 3U4FA 1KO0A 2ZBTA 1QAPA 4PE8A 1W5OA 4MSSA 3V0UA 3BICA 3SCWA 3N12A 4M7SA 4H2CA 3P81A 3S42A 3S8HA 3NPXA 1W37A 5ECUA 3WLKX 1B9ZA 1NOFA 1JPIA 4IIFA 2E6FA 4JKKA 4B91A 1G6CA 5AFDA 3CC1A 2PTDA 3CMGA 5M17A 4ZFMA 4BY3A 3HU7A 3SY1A 3QKEA 3M7SA 5EB8A 3LY0A 4WSHA 1E73M 3G0XA 4W4QA 3AYSA 3OVGA 3CL7A 3EMQA 4Y9AA 3MZNA 4MUZA 2UV8G 4WOZA 4D6JA 3E96A 1REQA 3MMDA 3VIFA 3TK7A 3EMZA 1R3RA 3LGGA 1EF2A 1WE5A 2YCLA 2VCAA 1SUXA 5C6MA 3UJSA 2Z1SA 1XH1A 5HJLA 2AAMA 2VQTA 3U48A 4GUHA 1C91A 2Z7GA 2WMIA 3EWUA 2GGEA 5I03A 1R86A 2DT1A 1ZAIA 2Y70A 5E0CA 3P0XA 2GQAA 4BI6A 3WNPA 1J5TA 3QEZA 4R53A 4LAUA 3B97A 3WLPA 3NGFA 2E8YA 4Z2LA 1VBUA 3KRSA 4RZ6A 1P48A 4A8NA 2CKRA 2CPUA 2VHLA 3HGOA 1FWWA 1T0OA 1R2TA 4C1KA 2PDIA 1JFXA 1IQ8A 4PMUA 5D9MA 4P7OA 4O57A 1HO1A 2DU2A 2QGHA 3SB0A 3AWOA 3BAIA 2FQIA 3RGTA 3NM3A 4A3YA 2A1YA 2JEQA 4O28A 4FLRA 1FDJA 3DERA 2PDCA 3H2NA 1W5QA 4H3DA 4PYSA 1F9CA 3M0ZA 4W8BA 3TR2A 3A47A 4JTSA 3UT0A 3QPEA 4Z17A 3NQGA 3PUEA 3UJ2A 1UG6A 1IIHA 4ASTA 2WSQA 3SZ8A 1F3XA 3VOHA 4X2RA 3VMPA 4GUGA 3MU7A 1Q8AA 4NYYA 5HJYA 3D5HA 2L5HA 3VX1A 4JFTA 1DTUA 3UXDA 3UWYA 4O4VA 4ZMGA 3N34A 1RQBA 4UCGA 4GBDA 2HNEA 3DZ1A 1XLEA 2YL6A 1W3NA 1RBOB 1US2A 3TJLA 5K2ZA 3PSVA 3HG2A 1V6YA 4Z1DA 2INEA 3INPA 4ICMA 4JY9A 3F2DA 1B30A 2PWFA 4IFOA 4PL1A 2A4AA 1AZ1A 4RNFA 4MWAE 3CAWA 2WKJA 1E4IA 3F5JA 5XIMA 1FOBA 2Y63A 5I79A 1PWMA 5C71A 3ICJA 4X0VA 3TN6A 1QFEA 4UOQA 1YX1A 1BD0A 4ZXOA 4S3EA 1VFLA 1SW7A 3ES7A 1X8CA 1KM2A 3GXNA 1BYDA 5DMMA 1XICA 5ABHA 1PZ2A 2OSXA 5DMNA 2FVKA 4NX0A 4KEMA 2BSLA 2QCCA 3N3TA 4F0HA 9RUBA 1E71M 2PB1A 4YS1A 3KWXA 1JZ7A 3SGZA 5C2GA 3EWBX 1FCVA 3CLWA 3FXYA 5FKYA 1P0KA 2DZAA 3MSRA 3FCPA 4DF0A 1Q6LA 1JYXA 3P2VA 3FW6A 1JPKA 2V2CA 3KE0A 1OJXA 3U2CA 3ABZA 2YKKA 1DQXA 1EJTC 5F2IA 1JDDA 4YU1A 1UUMA 1OX5A 1R3VA 4DEFA 4UTHA 4ZSUA 3NZRA 1EYEA 3BC9A 3OW1A 4L5ZA 1XD1A 1FDYA 5T9CE 3SY8A 3W3OA 1KXQA 3O1NA 4ORMA 3OA5A 2PU1A 1ICSA 1VYRA 3JRKA 1DWJM 4IIEA 2P3ZA 5A2BA 1NDYA 2PDBA 4PUJA 3SN0A 4P7RA 2OT0A 3AUOA 3KBNA 2NV9A 5F7UA 4JTIA 2UY5A 2EPLX 3M6YA 3IJ9A 4G7FA 4X61A 3B9NA 1UZ4A 2X1UA 1BRLB 4FIQA 4ZQRA 2NQ5A 1DIEA 4UQDA 3CZJA 4HIBA 2A85A 4BR1A 1VF8A 4LV9A 4GIEA 3XINA 1TTPA 4FNPA 2EG7A 5BYWA 2WHJA 1S2AA 5LHEA 4H9TA 5ENLA 3W2NA 4ZFCA 2EO7A 3FS2A 1KFJA 1A49A 2VRKA 1GZ1A 4CQBA 2UY4A 3F4DA 1ZLPA 1K3UA 2W0UA 4YLWA 1CWYA 4J3VA 1K1DA 1XHGA 5BROA 3BCFA 3LCXA 1UD4A 1XS2A 1ZGDA 4PRRA 4MFEA 1EX5A 4JNYA 4Q4MA 2E6YA 1E3ZA 1PYFA 1BVNP 1ICPA 4YYCA 2EGZA 1BG9A 1LWHA 5LYRA 5C54A 1LL7A 3SFWA 2NQ9A 3VILA 2CLIA 1VCGA 2PDQA 3VIGA 2OR2A 1WDQA 4GRSA 2Z28A 1QDSA 2Z29A 3DI0A 4CQ9A 1W5NA 3E6EA 1CI1A 4MB3A 4RJEA 4H6RA 1AL7A 3LDVA 4QJ1A 3GB6A 1J2BA 4XTIA 5I06A 3THUA 2GGJA 1FWFC 4KIRA 2GSEA 2VOMA 2GLKA 1KFBA 4GVHA 4RE4A 3GHTA 4GA8A 2VDHA 4TX8A 1NEYA 2E9LA 3LU2A 2FTWA 3W27A 3LENA 4OTKA 4A29A 4RCXA 3EZ4A 1EWEA 2WNWA 3BOFA 2JE8A 3S47A 4KERA 1MZHA 3F4NA 2C13A 3WQWA 2AGTA 5REQA 4X9SA 5ECVA 5SWUA 1B54A 3F4WA 2E09A 4JPGA 4YTTA 1S46A 3RG6A 1E51A 1W54A 4JIEA 3NPWA 4OJYA 2RHGA 2C15A 2ZTKA 3ITTA 2ZX9A 5LIYX 3GH7A 3MHGA 4RUBA 2NW0A 2Z1VA 2V9DA 1CXKA 1EX1A 2PTWA 2P8BA 5CH9A 2J66A 4D6FA 1E4LA 3BAKA 1PCKA 3FV9A 1VFFA 2DVUA 4HN4A 1TCDA 3RRAA 1C29A 4F0KA 3HQOA 3C8NA 3CV7A 3LCFA 1HP5A 3V0SA 1CIUA 4PBEA 4PB4A 4AG0A 4GQGA 3YPIA 3AIWA 3M0IA 4Q4QA 4X63A 4U28A 4QG8A 1RJQA 2Y89A 4RV3A 3BTNA 1NY1A 3S83A 4HCHA 3QHOA 1QPQA 3CB8A 3ZQ9A 4PMVA 5C0QA 1JZ8A 2VEGA 2BGSA 2DJLA 4J3SA 4HVXA 3V75A 3STGA 5HPOA 5HNNA 3U5UA 2VQUA 1XBXA 2IXVA 3C2RA 3RN6A 5CBIA 4NXKA 2ZCGA 3SURA 3HPFA 1H1NA 3RLHA 2INFA 4US5D 3CUHA 4P5UA 1V93A 1J5SA 3LG3A 3AMGA 5HK4A 3TA6A 3EKZA 1YQ2A 3K46A 5JBDA 1QPOA 2Z2AA 1DYSA 4BHYA 4HK5A 1RALA 1B3VA 1XLKA 8A3HA 3TTQA 3KP0A 2A7RA 1M53A 4UZUA 1W3HA 2CETA 1KNWA 1POKA 3FKKA 4FPSA 3CUFA 3PBWA 1AZ2A 2QJMA 2XM2A 4LS2A 1BHGA 1IR1A 3N17A 5D05A 5CC7A 1ONWA 1A47A 3CZGA 1EJXC 3W02A 1I2PA 1RXOB 4YTUA 3NQFA 4PUUA 1JF6A 4FNUA 4RDZA 2V69A 4DAFA 3CT7A 4MB1A 1K8CA 4ICCX 2EJAA 3PFMA 3H55A 4BCEA 2WB5A 1XLLA 1X1NA 4K6AA 3ORWA 2V2HA 3W7EA 2J7EA 4UMCA 7PTDA 2PA6A 5JBFA 3WJWA 3UVIA 2IKJA 2RDWA 3ARXA 1XYCA 3WMBA 1HJXA 3W1AA 2FFIA 2LLEA 3ZO9A 4BQ5A 1PAMA 1ONXA 1BYBA 4GVIA 1IV8A 3W23A 2E0PA 4DY1A 1H09A 1OHLA 4UQ9A 4XKMA 4AZHA 1NQ6A 4NT0A 3VOJA 3GRIA 5TIMA 4Y90A 3VIOA 3QPYA 3UCDA 2YCEA 2Y5EA 4C5YA 3SBFA 1HUVA 1UR2A 3OLDA 2X1SA 1QPNA 2WBKA 1CDGA 3PHAA 4DYEA 3BK0A 1TTQA 3RM4A 4F40A 1VLIA 3K8MA 2IQ0A 4EE9A 1Z8AA 1K8YA 3RPTA 1MW1A 4F79A 3SJ3A 2FPVA 2XISA 3MKKA 5E93A 1KM5A 1XC4A 1KCXA 4GUJA 4I7VA 5A8NA 4QDWA 4K7VA 1K4HA 1TWDA 4EVZA 3NSXA 1XM3A 4CCEA 3KS6A 3O0FA 2WCGA 3UNDA 2AL2B 3QR1A 3WLIA 3UPMA 2HRWA 4FXFA 4CVWA 3GVQA 3N6QA 3OG2A 2AL2A 1F74A 3O16A 2IQTA 4CLMA 1SFLA 4UR8A 4ADUA 1UWIA 2BOGX 3U6WA 4O8RA 1P1MA 1DE6A 2F38A 1RVGA 1NP2A 4LB4A 4ATLA 5G5IA 1ZU8A 4KBXA 3KRZA 1X6NA 1R30A 1SFTA 1C8QA 4NRSA 2WVSA 3TR9A 2RDTA 2FZMA 3L0KA 3SR7A 1YE6A 4GZEA 2J7CA 1WNOA 3BANA 3QY7A 2XH7A 4DJDA 4W86A 1VEPA 4Z2HA 2WKGA 1DJYA 2OVLA 4DJDD 4AD1A 4E0CA 3CNYA 1QOQA 1UWSA 3GDMA 4H6QA 2R8WA 5DBUA 3ARWA 5FACA 4M56A 1UQZA 2QJHA 3D47A 3EXSA 1R3TA 2A2IA 2HVOA 2WJDA 3MUCA 4FLSA 1GNXA 4C91A 2XN0A 2V3EA 2ODOA 3MC5A 8CGTA 2WSRA 6ALDA 1UUOA 3SUSA 1Q3NA 1YMYA 3W7GA 2TRSA 1YPXA 1WQ5A 3UWVA 3C2YA 4R85A 3SCOA 4JNMA 3M0KA 4V15A 1TMLA 4ZTYA 1FWIC 2P5NA 3BZJA 5AB3A 3ZXWA 4GBUA 3PZ9A 2EPHA 3VXGA 2WWDA 4GYKA 1LF1A 1HVXA 9XIMA 2PWDA 3ABXA 1NWSA 1C92A 2XVPA 1RCXB 1M68A 3MI2A 1T8XA 2ZZ1A 4UNIA 2R1NA 3I65A 1AQHA 1E15A 1TZ9A 2GWGA 1CXFA 1M04A 1VBJA 4Y9NA 4EK7A 1J8VA 1SJBA 1GYNA 3EOUA 4PA8A 3A12A 3H54A 1RD6A 5AVNA 4DBWA 3N25A 1EQCA 1L8PA 3VCRA 1ZCOA 3TWAA 5BOEA 4KGLA 3RXZA 2ZRVA 3MVIA 4JEQA 2BXZA 2IXUA 4GKTA 4DB7A 1BGGA 3DFSA 4IX0A 2V38A 2KAUC 4OVXA 1UYQA 1V02E 3E02A 3APGA 1Z69A 4OECA 1XL9A 2Y7GA 3MO4A 1WOAA 3GAYA 1XSIA 3W07A 3RHGA 5I78A 2H8ZA 3VGBA 3OBKA 1EC7A 2DW6A 4EOUA 5BZAA 2W92A 3BJTA 3ANYA 4W89A 2I1OA 2RAGA 4HNNA 3DECA 2BGQA 3PBVA 3B9EA 3KP1A 3T0CA 5G4EA 3A22A 3FN9A 1IIGA 4IMDA 1FBAA 2QUTA 1NFGA 4ZTXA 2Q8ZA 3E49A 4JTFA 1KKOA 4X0NA 1IEWA 1MI3A 4NIRA 2WZTA 2AQWA 1DWFM 4V33A 3QH2A 3NZPA 3MPGA 1RCQA 2HK0A 3KAOA 1V8EA 3GSMA 1WUEA 1QW9A 3T07A 4M1RA 3O3RA 5AHEA 2ESCA 1LWJA 1N2VA 1I4NA 3F2BA 1GKRA 6REQB 1WCGA 4UXDA 4CNOA 4PCFA 3Q58A 1MVYA 5DFAA 4CN4A 1WYIA 2CWXA 3IGHX 4WKAA 4NHVA 4QITA 5E9XA 2NT0A 3QOKA 2ZUWA 1ITQA 4JTUA 4FO4A 4Z1CA 3TTSA 4C6MA 5A8QA 2VO5A 1JDCA 3O07A 3POCA 1OFBA 3LN3A 2CLFA 3ZZ1A 3ES8A 2VR2A 3W7HA 1K9FA 1BFNA 1XFBA 3E2SA 1QNRA 1GKPA 1JPDX 1A4LA 3TAOA 3KL3A 3BQ5A 2PF8A 5CPQA 4HPNA 1E72M 2B0MA 2C14A 2HDJA 2A3BA 3QHMA 1B31A 1OABA 1GT8A 4IG2B 4FR1A 1RPKA 2PZNA 2F84A 3EXRA 4AAJA 2HE8A 5C8BB 3M64A 3RCNA 4IG2A 2OELA 1ZALA 3IJQA 1Q6OA 4Y96A 2XH2A 5CJMA 4Q4RA 1BVZA 2NVCA 5BMXA 1BEUA 2P50A 3KRBA 3W2KA 3BSHA 2X16A 4C1LA 1GHSA 2GJLA 2VZOA 4JIQA 3ATYA 3QW3A 5A6KA 2QMKA 3GNPA 3RPDA 2XDFA 5XIAA 3KCLA 4EANA 1H62A 4FF7A 5AOUA 3BLFA 3NL6A 1PKLA 4P61A 1NM9A 1X1OA 2J6VA 1QRQA 4WSJA 3VD4A 2PFHA 4IX2A 3IANA 2PDJA 5DRIA 1BRLA 1UIOA 3BMWA 5FF3A 3TLQA 3I4EA 3PC0A 3TWBA 1X6UA 3ECQA 1PZ3A 3EDEA 1GJWA 3CLMA 2QCDB 3ONCA 1HKIA 4HT3A 4YIWA 3U8GA 3CQJA 3N19B 4B3KA 3SCNA 4DJFC 2GUYA 2G96A 3PWGA 1W2PA 3S1GA 2WK2A 4JIPA 4ZO9A 3FNDA 2XFWA 4XD5A 1O1HA 4P8XA 3LSBA 3L4YA 2X30A 2G97A 1ZAJA 3SN4A 3CUZA 4LAMA 5EA9A 3NL3A 3JS3A 3EWWA 3DHFA 3DIPA 2OQHA 3E38A 3GHSA 1A5MC 5IXEA 2FZDA 4HSNA 2EPMX 3RMJA 1KR0A 4RDVA 1Q4NX 4AVNA 2NUXA 2ZRUA 5I07A 3NL2A 2E3ZA 4CD7A 1JIBA 3I4KA 3AU6A 4WX2A 2O7QA 3QPZA 1TPUA 2YB4A 2QW5A 4INFA 4XTDA 3VDBA 4QJ5B 3OZPA 3T6CA 5HNTA 4QHRA 2GOKA 3MWAA 2P76A 1KD0A 1FCUA 4PGLA 6PTDA 4E38A 4CGTA 4DM2A 1BWLA 5EPDA 1J79A 2R94A 3CAQA 3WLSA 1G67A 1ONRA 3VKDA 4XKYB 3THAA 2PDMA 1HL2A 4LB3A 3WH7A 2VFIA 1KTNA 4OZOA 2FPYA 4H4IA 4QM1A 4FALA 4GQRA 1NOWA 5AKQA 4YTSA 5GNYA 3CWOX 1CXLA 4IJRA 4NZJA 4JYDA 4PB5A 4QAIA 3VNZA 1UW9A 1CCWB 3EDJA 4K1WA 5JVLA 1R38A 2YDRA 4ZOBA 4O18A 1Z6KA 1Q7QA 3DFHA 1E0UA 2G41A 2CW6A 5C9UA 3C6CA 2FLIA 3JVAA 5DO8A 3G1XA 4NNCA 3CJPA 1L0PA 1SZFA 2P10A 8XIMA 4AB4A 1J0IA 1HKJA 3CEPA 5FJJA 1WB0A 2CZ5A 1MSSA 3EKLA 3MUIA 4O52A 3SM0A 4B3ZA 3BUVA 1Q7MA 2DZTA 1NOUA 1WX0A 1ZHAA 4I9AA 1BF6A 1TVLA 1V6WA 1XKYA 3CH0A 3V3WA 4FB7A 3QR0A 4MG4A 1XD0A 3GIPA 4JS3A 3R0DA 1K03A 1UR4A 4Q22A 6ENLA 1CLXA 3RILA 5D2VA 1H7OA 3UA4A 2Y2WA 5A3HA 2ANUA 3NQCA 3NCOA 1HKKA 2I17A 1KA9F 1VHNA 3R13A 3W7CA 3IK2A 2Y5JA 2WVUA 1GHRA 5KSWA 1V3JA 3DBNA 1ELSA 3LERA 4B5TA 6TAAA 2QQ6A 1UWQA 3W88A 3FKRA 2C1GA 4FF5A 2V30A 2YFNA 3BOLA 3NEHA 1XIDA 4ZQMA 5F2GA 3TONA 2WSYA 2VFHA 1E1EA 3GXDA 3P6LA 1KFKA 1TPVA 4JQ1A 3R25A 1H7NA 4N9DA 2OFJA 5H8MA 1VFOA 4HA3A 1O6IA 1EP1A 5F1VA 2WMHA 4DM1A 3T42A 1OBAA 3V18A 1EA0A 1TPFA 3KLLA 5FF0A 5XINA 2YL9A 2VZSA 1V0KA 2WBGA 2HEJA 2GYIA 1C8YA 3KL0A 3U7VA 4MGGA 3RUBL 3U7BA 1XGZA 4O1BA 5EMUA 2J6XA 3MKCA 3TKFA 1G1YA 3CUGA 1GONA 3S1VA 4WXYA 3M43A 4A3QA 5I5RA 1OC6A 1KFEA 1WZKA 1SR0A 1MXDA 3S1WA 1QATA 1FWRA 2FYMA 4LCSA 3CIVA 4AVFA 3PZIA 3S2CA 1VIWA 3VABA 4WR3A 3VKBA 2WV8A 1M7OA 1TV7A 1XW8A 1GZGA 3GH5A 3AYRA 2X0HA 1Q2SA 4QNEA 1XUZA 4KCVA 2XZ7A 5EU9A 3E0VA 4A3UA 2QV4A 3AXXA 4I8YA 4IQJA 1F73A 3W1NA 2ZRYA 2OLAA 4HHMA 2QYGA 4QS6A 2PLJA 3G1DA 2YZ5A 2PCEA 5HNUA 2FB2A 2J8TA 5AC6A 4GXPA 5C9WA 2RDXA 4GVGA 3REQB 4HCLA 1RD5A 3IJDA 2QJGA 2Y61A 4W5ZA 2YXOA 4M51A 3UWQA 2FJUB 5I3IA 2V6AA 3B8IA 3LI0A 3TTYA 4RZ5A 3UZJA 5KITA 2D23A 3OGVA 4B2DA 2QUNA 3WF0A 3WQFA 3VIPA 2VR5A 3CZKA 4C6QA 3A3HA 3VIIA 4FXRA 3AIRA 3QSRA 4H7VA 4XWUA 1AJ2A 3U3HA 1DE5A 2BDQA 4H9UA 1P7TB 2ZWZA 1W3TA 1KB3A 1MW2A 3BMXA 3OA3A 3M5XA 2CZFA 2GJXB 3UYCA 2FZBA 1TZ7A 1HJVA 4HZ7A 5FOOA 1NWTA 1UH4A 4MJ2A 1S2TA 2Y1HA 3MYPA 3O15A 4GE8A 3CZ8A 4MPQA 2QPXA 1UH2A 4PUKA 2BNJA 1CGYA 3G3MA 1QWGA 5HWJA 3LMZA 1UP2A 2E9MA 3EX3A 4IIHA 2F8QA 1NDZA 4ZZ9A 1JZ4A 1UPPA 1TA3B 4XBSA 2VP8A 2ZA2A 1XGDA 4Z1BA 3WX7A 3S5OA 2ZX7A 3THCA 4YCOA 2VMFA 3ZT5A 1U1JA 3D0CA 4Q8QA 2PD5A 3TYDA 1AD4A 4IHCA 2OZ0A 2QKFA 3MHFA 3KVLA 1O1ZA 4HJWA 2XVLA 1HW6A 1VBRA 4CQCA 3VZZA 4LANA 4G9PA 3IAPA 4DJEC 2DV0A 4NUWA 2A7PA 5K9CA 4IGNA 1JXJA 1VPXA 3MUZ1 4N6EA 5HUPA 5A8OA 1SR9A 1KM1A 3WNKA 4CNUA 1FKWA 2C8NA 4DBSA 1KKRA 4NZFA 1FXPA 2UY2A 1E0VA 2B81A 3T1GA 4GJIA 4FSAA 4M3PA 3FA4A 7XIMA 2TPSA 2ZZ6A 4OOZA 3R12A 3GU9A 4JTHA 3KZPA 3UWEA 1IF2A 1Y5XA 3MTWA 2R1LA 1ZCCA 4GJJA 5AZ0A 3RR1A 4MNJA 2OX4A 3URQA 3QRHA 1BVWA 4AF0A 5LNVA 3DX5A 1KCLA 1K9TA 2FHCA 3P8JA 1YTEA 3LX9A 2C0AA 4U10A 1OGGA 1WXJA 2NUYA 3P0WA 4TXEA 3LPFA 3UG4A 2PBGA 3BLPX 3ELFA 4YNGA 1E9YB 1BWKA 4B15A 3LTYA 1K7EA 1XH0A 1OFPA 1FHVA 2Q02A 2EEXA 1JYNA 4DAIA 1F3WA 1TV2A 2Z4GA 4QJ3B 5I7GA 4MADA 4NY2A 1GW1A 2DH2A 3ZIZA 4GQQA 1SFJA 4PTXA 5A6BA 4YCPA 2OKTA 3EWZA 2PGEA 1KRCC 3G1VA 3LZ5A 2OU4A 4C6BA 2YOCA 3L21A 4J2MA 3SY5A 3TJ4A 3CAKA 4I5UA 4J40A 3DFPA 1EGVA 3UR8A 1O5QA 3CM4A 2XGIA 3A21A 1RSCA 4US5A 3RX4A 1BQCA 3LXAA 3N2TA 1D8CA 3KTXA 1EHNA 1PX3A 1RK6A 4J27A 4B5WA 4K38A 3OIHA 3CHEA 4DO5A 1WPCA 4IFKA 3AJ7A 4J9JA 1OGBA 3CEUA 1UQYA 3I7SA 3LS9A 1JCMP 3QV9A 4U5IA 1VZWA 3AU2A 2BVDA 1SJAA 1OT1A 1EZWA 2UWFA 1EDTA 2C7FA 1TMHA 2W61A 3R0UA 4QEEA 3W76A 3CHFA 1ZRQA 2RGLA 1EYWA 4M6PA 2GJRA <