1B3WA

Xylanase from penicillium simplicissimum, complex with xylobiose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3wA00
4F79A 4ACZB 2WHJA 1C3FA 4AZGA 4R27A 4TX6A 5C70A 1NARA 1VIWA 3CUIA 4XV0A 3TONA 1KGWA 1BF2A 1HL8A 2DGAA 3WNOA 1BFNA 2WMIB 2ZXBA 4D6HA 1Q6CA 2AAAA 2OWCA 1SMAA 4P7OA 1QHPA 3WBAA 3A4AA 4ZXOA 1H0IA 3WSUA 2VI0A 1B9ZA 2XVKA 1ISXA 4YHEA 1CXLA 4AD4A 5ABHA 1XSIA 2BXZA 2J75A 1B2YA 3UG4A 1J0YA 4PMDA 3GH5A 3WF2A 1E6NA 1US2A 3CUGA 3SUVA 4PTXA 3VINA 3WH9A 3WMBA 3UETA 1KXTA 2DSVA 3BAKA 3WNPA 3WDIA 4KMQA 1OT1A 5EFFA 2VRQA 1H1NA 3FY1A 3VGGA 5JIWA 3PHAA 2J8GA 1GJWA 3SUSA 4J3WA 1W9VA 1DTUA 1V6UA 3CZJA 4UCFA 3BCFA 4B9YA 4OUEA 3OZPA 2UY4A 5ECUA 1TCMA 1KQYA 3KL3A 1W2VA 4EAMA 1V0NA 1WCGA 2F2HA 2YLAA 2VCBA 1ITCA 1H5VA 1JNEA 4IISA 2WLYA 1HJXA 1BGGA 3SCNA 3ZT7A 4C7DA 5CG0A 3U7BA 1MW2A 2YL6A 4KRUA 4NI3A 2J7GA 4RE4A 2HVMA 1XH2A 3A3HA 3VIPA 2WCSA 4JCLA 2VRKA 4XUYA 1CNVA 2E8ZA 4GQRA 3VIGA 4GO9A 4PTWA 2CERA 3AS3A 4ATLA 4AIUA 2UWFA 3M7SA 4H04A 3W6LA 1WDRA 2OWXA 1R8LA 1W1VA 2QPSA 3OGVA 4GI9A 4LX4A 2EXOA 3EMZA 1BYBA 4DUXA 3ZT6A 1Z32X 1K9TA 4GO8A 3RILA 1OINA 1UWRA 4WSKA 1RPKA 3DYPA 3FAWA 4AD1A 1W3HA 1CENA 1E70M 5GNXA 5DT7A 3ZR6A 3CHCA 3GBEA 4AXNA 3WNLA 2XYLA 1KGXA 4LYQA 4DWSA 1R85A 2PF0A 4UQBA 2VZTA 3ZSTA 1C90A 3BLKA 2VX6A 4CD7A 4W89A 3WY1A 4QFUA 1FH7A 1E3ZA 1F4HA 1GONA 4KGLA 5I0DA 3VDBA 3WUEA 1V3JA 3ZJKA 2DPEA 4OJYA 4A3YA 1S46A 2WVSA 1V08A 2DT0A 2FHCA 5I23A 1H3GA 2D23A 5A8PA 4L4OA 2W5FA 1PIFA 1B3YA 1EDGA 3ZQ9A 2QLYA 4AD0A 4MJ2A 4J3TA 2WW5A 2X0HA 1CXHA 2WYSA 5A94A 3U57A 3AIBA 1IZJA 4AIEA 2WM0A 4XZBA 4E8DA 4CN6A 3AMCA 1QI5A 3VGHA 2OLHA 5A2BA 1JYNA 5EMYA 2G8ZA 1NWSA 2VCCA 3FHQA 1MWOA 4HA3A 1FOBA 3D5HA 4AC1X 2GVYA 2WHMA 2A3HA 2GFTA 3NSXA 2DT1A 3RMEA 4AZ5A 5A6SA 2WVUA 3THDA 3LPPA 1UKSA 3GXFA 3WH6A 1KQZA 3AMLA 3VNZA 1JFXA 4WKFA 1H49A 2ZWZA 5EBAA 4JKKA 4PTVA 3AICA 1RH9A 4FLSA 1HJVA 3KZSA 3BAJA 4AZIA 3VD4A 3PTKA 1JYXA 5AYBA 1DP0A 2OSXA 3QOKA 4PSRA 3WDJA 2EO7A 1TUXA 1CXKA 4JCMA 2PWEA 4AD5A 1NOUA 2NT1A 1HP4A 1WZKA 1UWTA 2DSKA 4W8LA 1I1WA 3NUKA 1GOQA 5D9MA 1C8YA 4HU8A 1UKOA 3F4VA 1XRVA 4QCEA 1J12A 4W85A 2XFYA 2GK1A 3A6OA 3DECA 3TA9A 1J0ZA 1WZLA 3WDHA 3MMWA 4J3UA 1AVAA 2WSPA 4CU6A 2WVVB 1UD8A 3GXIA 3PBGA 8A3HA 4D6EA 1U33A 2PC8A 3GM8A 4TUFA 1L8NA 1ZU8A 4IPLA 1TVPA 5I79A 1BAGA 2WB5A 2YDSA 2WMKA 4PEEA 3WKZA 1OIMA 4XZWA 1CGYA 2DSUA 4J28A 1LL7A 1G1YA 2W62A 3I3EA 2WMJA 2BVTA 6CGTA 4D1IA 2XG9A 3WH5A 3CBWA 4M24A 1ZBWA 2ZXAA 3VD3A 5BXTA 3QHNA 4OKDA 2OYKA 4HMEA 3GBDA 3TTOA 3ZJ8A 3SCTA 2ZOXA 4AIOA 2BY1A 4LYRA 1NWUA 2YIHA 3HMCA 5CPQA 1V03A 2PI6A 4FLRA 2ZX5A 1JZ7A 5A6BD 2WKLA 4NRSA 3U5UA 1L0PA 3WQVA 5FD0A 2BHUA 3CZLA 2QV4A 1QI3A 4N0RA 4MPKA 2G41A 1RP9A 4P7QA 3GXMA 3M6DA 4AZCA 2BHZA 2Y2WA 3N11A 2OSWA 2X8RA 2XIBA 4IM4A 3RM9A 1CPUA 2E9BA 3WUFA 1V3LA 3T2PA 4B3KA 5M03A 3O6AA 3CZ8A 5HOSA 3TOPA 1KR0A 3IJ9A 2ZUNA 2PB1A 2YA1A 4GZJA 4W84A 4TVCA 1M03A 3WIJA 1UR0A 1FA2A 4MNLA 1CXFA 4XB3A 2W66A 4HZ7A 3AMGA 3ARSA 3T08A 5IFPA 3VUPA 1XSJA 3RM8A 1GOIA 4ML4A 1GOOA 1HF6A 1R86A 3WDPP 4W8AA 4BCEA 5D8ZA 2IXVA 1JGIA 5IHSA 5I78A 2J4GA 3ZM8A 1ZS2A 3WQ8A 4U2YA 5IHRA 4D1JA 2BY0A 1US3A 5DMYA 2OYMA 2PBGA 4CD8A 3ZSSA 1E4MM 4MAVA 4ATDA 2EPMX 1VB9A 1TA3A 2O92A 4Z2KA 4FK9A 3VOCA 1XH1A 3QHOA 2J25A 1G5AA 1E6XM 1EDQA 1XCXA 5D4YA 1VJSA 2WC3A 2D0HA 4AWEA 4DWSC 4JKMA 2WCAA 5KZ6A 1UR1A 5CZKA 4F9JA 6TAAA 4D72A 3ZOAA 3CUHA 4V28A 1WB0A 4MTVA 1Q6DA 2V5CA 3GH7A 1CWYA 5ABFA 3ZT5A 1BVNP 2J7FA 2YJQA 1QW9A 1E4LA 3RDKA 1LL4A 4EE9A 3VIHA 1PEZA 1JYWA 2WZEA 3BAIA 3GXDA 3N04A 1CXIA 1LWHA 3VGFA 1PZ3A 3W27A 4LXFA 5BROA 2E0PA 5IDIA 2AOSA 1E6PA 3B9AA 3VD7A 4DWSB 3E1F1 2XWDA 1E0VA 2X05A 5CJ5A 1M7XA 2J47A 3OGSA 5E6ZA 5C8BB 2XTKA 1E3XA 1V0LA 3UCQA 1OGGA 3BMWA 1NP2A 3WDRA 3W0KA 1GVIA 2WMFA 1V6YA 2OYLA 4EK7A 2A3CA 4UNIA 4JHOA 2YKKA 1W3KA 2VX4A 3D3AA 3VGBA 2VR5A 5LA0A 2VQTA 2YOCA 4GKLA 3WNNA 1GVYA 3W81A 1XV8A 4AD2A 4B9ZA 3OLGA 3PZQA 4OZOA 3EMCA 1UKTA 3WBEA 1E9LA 1WPCA 2J7DA 3N17A 5D9OA 3O9NA 4HMDA 3W29A 5E0CA 5CXPA 2D22A 1TG7A 3AHXA 5HXMA 2WVTA 3I3BA 3S2CA 1HJSA 2VX7A 4D6JA 4K68A 2BS9A 3DC0A 3W38A 2A3EA 5I3DA 4U2ZA 3WUGA 1D2KA 2XUCA 4M1RA 1W91A 4CU8A 4OBRA 4D6GA 5DO8A 1KXHA 1MW0A 3ZJ7A 4JFWA 4HPGA 2WPGA 3MUAA 2NSXA 4F9DA 3KL0A 2Y24A 3CUFA 1KWGA 1KBBA 5GNYA 5EB8A 1V02E 2WC4A 1EHAA 2EEXA 2GK1B 2DH3A 1ZBKA 2E40A 1KFWA 1W9PA 4W5ZA 2VQUA 4LPCA 3VU2A 2RGLA 4P7RA 3WUBA 3F5KA 3RJXA 4HP5A 4FMVA 1CEOA 1VEPA 4PMUA 1B3XA 3VDCA 1CLVA 4QP0A 2OSYA 2GSJA 2DT3A 1UR4A 4Y7EA 1HN1A 4HA1A 2J7BA 3L4VA 1RD6A 1QI4A 1ODZA 5CGMA 3N13A 4ZE4A 2J8FA 3WN6A 3ALFA 4CCCA 1X6LA 1Q6GA 5HNNA 3UG3A 3MKKA 5KEZA 1HXJA 3CUJA 1JL8A 2VOTA 4CGTA 3VPLA 1E73M 3K1DA 3N9KA 3EBVA 1VF8A 1V3HA 2ZWYA 4Q22A 5AYIA 1JDDA 1MQRA 1WE5A 4BQ4A 4BQ3A 4WSJA 2FH8A 1JXKA 5E9AA 1ZBCA 1UZ1A 5CSUA 2GJXA 3NJ3A 3ALGA 3T2QA 2WBGA 5JBDA 2EBNA 1NOWA 1K9DA 3SUTA 1BQCA 4AZCB 2BNJA 3WH7A 4ZENA 2Y5EA 5E0FA 1B31A 3WQ5A 3T09A 4HTYA 1ZL1A 3APGA 2FDMA 2BXYA 5AC4A 1E43A 3QGVA 1C93A 4JFUA 4PMZA 1G01A 5E09A 1WZMA 3CGTA 4BZYA 1NWTA 1MFVA 2VNCA 1IZKA 3NSMA 3VNYA 2X1IA 2CYGA 3TTSA 1HIZA 5D9NA 1H0GA 2VTFA 1JI1A 2DSZA 4JFTA 1UH4A 1VFOA 1KCKA 4HOZA 4TXEA 5AY7A 5A6LA 4AEEA 1FH9A 2J79A 1JZ5A 3CZGA 4E8CA 3VM5A 3WEMA 3PZOA 5I77A 2O9TA 2C0HA 2ZICA 3KEHA 1MW1A 3IANA 1TA3B 4D6FA 1UQYA 2QHAA 3BXWA 4AYSA 2VX5A 5JUVA 4WKAA 2GDUA 1B30A 4UOZA 3DYOA 4KGJA 1BYCA 4OOZA 3IAQA 4NSBA 3AZSA 4AW7A 1HJQA 1FP9A 3NCOA 1J0IA 1UD2A 4UQEA 4PTMA 2EJ1A 3WNMA 1JNDA 1NQ6A 1QHZA 4H2CA 3IJ7A 5ABFB 3VMPA 4UFKA 4QLLA 3AYRA 4EKJA 2ZUMA 1Q6FA 1JZ2A 1UR9A 1HP5A 3EYPA 1OSEA 1LF1A 2ZUTA 1XHGA 2E9MA 1H09A 1LLOA 3PZNA 2YA2A 1HNYA 2DIEA 5A6BA 3MS8A 2JEPA 4MNKA 1M01A 4MDOA 3VVGA 1VENA 3VILA 2IUZA 1XCWA 2TAAA 3WF3A 3WENA 3PZGA 3WDQA 4UFHA 4UQDA 2F61A 1B1YA 1I75A 4Z2HA 2WCGA 1BSIA 1GPFA 2V5DA 7CGTA 2WK2A 3NDZA 4FF5A 1M04A 1B3VA 4NRRA 2W61A 1UR8A 3CTTA 1JDCA 2FGLA 5A2AA 2DH2A 1GQJA 2J7HA 1G94A 5I6SA 5A8MA 4PMRA 8CGTA 3ZO9A 3WNKA 1UHVA 1QNSA 2PWHA 4P8XA 2D20A 4IPNB 1CGXA 3SCPA 1E6QM 4PMYA 1QVBA 3AQUA 3WD0A 1ZBVA 2WWDA 1UWSA 3CO4A 2O9PA 1XH0A 4GI6A 1JAKA 1W3LA 4C7FA 3ARQA 3AHYA 1CZ1A 5CQ1A 1OGSA 3WEZA 1TZ7A 2Z1KA 3PN8A 4WKHA 3VDHA 2ZUUA 1C7SA 1TVNA 1ECEA 3I3DA 4AMCA 3OB8A 3FAXA 1U2YA 1GOWA 4D6CA 4W8BA 1EO5A 3L4UA 2XVPA 1E6RA 3POHA 4MAZA 4PCSA 4V27A 1UWIA 4ZE5A 5I24A 4J3SA 4R5EA 4DM1A 4Z2JA 1G0CA 1MYRA 3J7HA 3AISA 3AXHA 4GIAA 3WMSA 1WKYA 1VAHA 4F8XA 1DWGM 3GH4A 4TX8A 1W9DM 3VX0A 2NW0A 2WHKA 2YBTA 4ZXLA 3GYCA 1CXEA 4PUEA 1TR1A 3CH9A 4S3JA 3VD9A 4YN5A 5HDRA 1QNPA 4CCEA 1J10A 2WHLA 4CN1A 1KXVA 5M3WA 4CN4A 4B16A 4CD5A 1V0MA 4L4PA 3SCVA 4HZ8A 3WD3A 1TFVA 4E2OA 2VC9A 3SCWA 4P8WA 3AFBA 5A6KA 1EHNA 1BYDA 1FP8A 3HJEA 3RPMA 5A6JA 4KH2A 4PMXA 3W37A 2WAGA 3SCSA 2VZOA 3UR7A 1GCYA 3L4ZA 2DQXA 4M56A 3SUUA 1DEDA 3EDFA 5FKYA 1GQLA 1HVXA 4PMNA 2QMKA 1AQMA 4RL3A 1ESWA 2FHFA 4EANA 3OA5A 1K6AA 1QI0A 5DT5A 1OD8A 2VJXA 5HPOA 3BAYA 1GHRA 2XM1A 2G3MA 3MSDA 2CESA 4ATWA 3VX1A 2YLLA 2GJXB 4H7VA 4QLKA 4DM2A 1J18A 3AIUA 1BLIA 3A4XA 5DEZA 4PBGA 3VO0A 3OGRA 1CGUA 4MNMA 2VT0A 4M29A 1KR1A 1ZB5A 3ARPA 5BXSA 1SYTA 4AD3A 1PX4A 5CLTA 1XC6A 3EDEA 4AZ6A 4KRTA 2G3IA 2PBOA 5A6MA 5CPTA 5ABGA 3LMYA 1LG1A 1JIBA 1Q4NX 2V38A 3WD2A 3QOMA 1EQPA 2CPUA 1MQQA 2ZX8A 1BVZA 5I5RA 2ESCA 4PYSA 2CBIA 1PBGA 3OZOA 2ZX9A 1UQZA 2J7EA 1UD6A 1W1PA 2D1ZA 3CPUA 1VFUA 2XWEA 3MO4A 2XJ7A 3MANA 2QMJA 3VIFA 1MVYA 1JD9A 4PN2A 3SCRA 3G6LA 2CCRA 1R87A 5FCZA 3BH4A 5M17A 4P7LA 4RE3A 3VGEA 1VRXA 4D71A 3PZVA 1H11A 2XFFA 4Z2IA 2PWGA 3WELA 1HKKA 1KBKA 2YDRA 2VVSA 2XSAA 1CGTA 2YA0A 2ZUWA 2F8QA 1P6WA 2ZIDA 4JHZA 4MJ4A 4J7RA 3ZJ6A 1EXPA 2EPOA 3KL5A 2D0FA 1JZ6A 3AHZA 3SURA 2CETA 1EGZA 4MDPA 5FL0A 3HU7A 1DWFM 5A6AA 3N15A 4AZHA 3N18A 3ZR5A 1PIGA 4ZFMA 2CBJA 3K8MA 1E1EA 4GINA 2A3AA 1GW1A 3WF4A 5BCAA 1PX3A 4ACYA 3II1A 4TTUA 5IXEA 1H4PA 3CMJA 1B90A 4HZ6A 1ZJAA 2WANA 1K9FA 1CTNA 1V3IA 5AC5A 1CGWA 5I2UA 5E6YA 4WK9A 5D9PA 5EFDA 4S3KA 5JIPA 3KWXA 1LL6A 4UFMA 4PMQA 3BAXA 1EQCA 1KXQA 5BYWA 4UQAA 3W82A 1VFFA 3NIYA 2GJPA 2GDVA 3AIEA 5A8OA 1OBAA 1WO2A 1UD3A 2JFEX 1WDPA 4QDMA 1AQHA 4WF7A 1UWUA 4W87A 4JFVA 4TTGA 2YBUA 1NOFA 3OIHA 1E5JA 1JAEA 3L2LA 3OBAA 1R7AA 3LPGA 1W1YA 4BA0A 1AMYA 1IV8A 3BC9A 1C92A 1OWQA 5DFAA 4GPNA 1GQIA 2VCAA 4MB3A 3MV11 1EO7A 1V3MA 2D24A 4HOWA 3BAWA 1TE1A 1GORA 3FHAA 5LA2A 1NH6A 1JF5A 1E6SM 2A3BA 5A1AA 3JUGA 2Q8XA 2YL5A 1GOMA 2BY2A 4JFSA 3AS2A 1UR2A 3AIWA 2CKRA 1UUQA 2X0YA 2BHYA 3B8SA 1E15A 2CKSA 1BPLB 4ZEPA 1ISZA 2OWWA 2DT2A 1OIFA 4MB1A 4OIFA 3ZIZA 2FHBA 2CXGA 3CLWA 4CD6A 5LA1A 4M80A 3GTNA 3MMUA 3SUWA 2FH6A 2DDXA 1RP8A 2WMHA 1M53A 1HKJA 3DHPA 4V2XA 4JKLA 1E4IA 1QI2A 4CUCA 2CITA 3WH8A 3TP4A 1VFMA 1CIUA 4D6DA 4U3CA 1SMDA 1V3KA 2ZXDA 3SCUA 3FXYA 4CD4A 4PRWA 2JEQA 3AI0A 1WDQA 4UFIA 1UD4A 2Y4SA 3OLDA 3S6TA 1UWQA 4JL2A 1LWJA 4Z2GA 3G6MA 1OB0A 4GZEA 2XVLA 5CPSA 4H8HA 1FHLA 3VMOA 1QNOA 4H41A 5GPRA 3AJ7A 1C8XA 1HT6A 1GOKA 2IXUA 2EPNA 1BHGA 1UA3A 1LJYA 3AIVA 3GNOA 1BG9A 1WAWA 4AY1A 2CEQA 3EDDA 1E56A 1HVQA 5CSYA 1KGUA 3W28A 2ZX6A 3CZEA 1FFQA 1XYFA 1GJUA 2VL4A 1QW8A 4UFJA 4U31A 4CVUA 3DHUA 2QF8A 1E1FA 2D0GA 3K4AA 4QAWA 4GQQA 2W91A 5BRPA 2C7FA 1CBGA 2BY3A 4UFLA 1W32A 4B3LA 1JZ8A 4HMCA 1B0IA 2WXDM 4PUDA 1XGZA 1E55A 2W67A 3LPFA 4NF7A 2VZVA 2D3NA 2ZXQA 2BVYA 4H8VA 4J3VA 2D3LA 3VM7A 3W26A 3DYMA 2ZE0A 1SR0A 3VIIA 4CKQA 2VUYA 2ZUVA 1H41A 1W1TA 1FHDA 1QOXA 3EDJA 5A95A 1E6ZA 1BTCA 3GNPA 3ARXA 2CNCA 3MSGA 1XSKA 3GDBA 2EQDA 2VURA 3AHVA 2JALA 2CHNA 4UOJA 4CCDA 1QNRA 3BSHA 3PZTA 4U5KA 1IT0A 3W6MA 2JE8A 1K9EA 4IUGA 3PTMA 5E70A 1E0XA 4J3XA 3NYDA 1PAMA 4M8UA 3W24A 3AYSA 1UOKA 2G4FA 5BRQA 2AMGA 2BVDA 1HX0A 2XGBA 1MFUA 4LGXA 4X9YA 3UEQA 1HL9A 3NSNA 4PSPA 5FL1A 2J74A 1TMQA 4AEFA 1XD1A 2YL8A 1EIBA 5CGTA 5D8WA 2NT0A 5IFTA 1UD5A 1XD0A 5HBFA 3WQ4A 5HPCA 4YPJA 3IK2A 4AZBA 2ZX7A 1E0WA 3EMQA 4OBSA 3THCA 5A8NA 1UH3A 3ARWA 4P8VA 1OT2A 4QLJA 4W7UA 1VJZA 2JF7A 1W9BM 3F5JA 2WWCA 1JYVA 1DWAM 2JF6A 4LQ1A 4W86A 2YL9A 3WQ6A 4CU7A 5DF0A 4A3HA 2E3ZA 5A2CA 4HA4A 3EDKA 4TVDA 2EPKX 3VGDA 3B9EA 4Q7NA 4TVUA 5FIPA 2WMGA 3KE0A 2WLZA 4B15A 4UZUA 1OD0A 3WD1A 4W7VA 1J0HA 2XFRA 3MMDA 1QHOA 4GI8A 3WL0A 3VKKA 1J0KA 3FN9A 3OG2A 1MXGA 2UY3A 1UA7A 3AIQA 1J9YA 1Q6EA 4HOXA 1HKMA 1UZ4A 1OGBA 3SCQA 2WZHA 4W5UA 2VZUA 3WL1A 3SCOA 3VDAA 3CHEA 1E72M 4MB5A 5TD4A 4BF7A 4U33A 4MB4A 1JDAA 4DUVA 1MQPA 1W2PA 5BXRA 1XYZA 1OCQA 3MU7A 2PWDA 2VR4A 2V3DA 3AS0A 3RCNA 4F66A 1JFHA 1DWHM 1UH2A 4UQ9A 1I1XA 1W9UA 2J62A 1JG9A 2G3JA 4QCFA 4A4AA 2W92A 1FH8A 4KWUA 3OLIA 3ARZA 1JXJA 3L2MA 4HU0A 2MANA 2WSKA 5ABEA 3PZMA 4TOQA 9CGTA 1UYQA 2J78A 3AHTA 2G3NA 3SEPA 2WC7A 4C7GA 1O6IA 4UR9A 1JF6A 1B3WA 1W9XA 4MNJA 1WP6A 4ACZA 1NM9A 2V3GA 3UERA 1V02A 1EH9A 3RM4A 3BCDA 4GZIA 4AZ7A 3WFZA 1GZJA 5BXPA 2GJRA 2BFGA 3MUIA 2WMIA 3K8LA 4W93A 2VMFA 1E71M 2VO5A 1UKPA 4H8UA 1EOKA 5LYRA 5GQBA 3AMDA 3B9DA 1G9HA 2XIIA 3K46A 3AIRA 1V6XA 5A69A 3ARUA 1A3HA 3WD4A 1GHSA 3T0AA 1WDSA 2DSWA 2B31A 3ARVA 4DWSD 2VRJA 2WZIA 4X0VA 3W53A 3A4WA 1QPKA 4JL1A 4BS0A 1VBRA 1E5NA 3ARYA 1D7FA 2E4TA 4MADA 1ITXA 1FFRA 4N42A 3F5LA 3N12A 3TTYA 5GNZA 6A3HA 3L4WA 3OLEA 2VVNA 5CLWA 2CHOA 1DHKA 3BLPX 2EPLX 1WZAA 4BQ5A 3WF0A 2V3EA 1ISWA 1O7AA 2BV9A 2QPUA 3WEOA 1V0KA 2XHYA 3A47A 4M81A 1X6NA 3SIMA 1CYGA 4JAWA 3VMNA 1E40A 1PX8A 1GUVA 1V6VA 2E8YA 5JBEA 1PPIA 4URIA 3QHMA 1F4AA 2XSBA 4WIWA 3AMKA 4AISA 2V3FA 2XVNA 4D6IA 3PZUA 2CBVA 3IAPA 5A8QA 1VEMA 4YHGA 1JZ3A 2WBKA 4W7WA 1CDGA 3ECQA 3W4RA 1U30A 2O9RA 1W3JA 3CHDA 4U5IA 3UESA 4PCTA 3VIOA 1JI2A 1VBUA 3VD5A 1BYAA 4HPHA 1CLXA 3VIJA 1LQ0A 4RE2A 2DIJA 4E4PA 1C8QA 1HKIA 2Y8KA 4P8UA 1UKQA 2Y8VA 1EOMA 1HJWA 3MV01 2E9LA 4M82A 2CBUA 1PJ9A 3AXXA 1EA9C 4JZ5A 1X1NA 4PMOA 2XVGA 3T0BA 1J11A 2XGIA 5F7UA 2UY5A 4JIEA 7TAAA 3U7VA 4X0NA 1UG6A 1MW3A 3O2LA 1OM0A 3AOFA 2O9OA 3ARRA 4UTFA 4W88A 2Z1SA 1CGVA 3BMVA 3POCA 4UOQA 4DUWA 5C71A 2X09A 1JD7A 1SFSA 2W63A 4UZSA 3RO8A 3TTQA 1ZJBA 2PWFA 3L4YA 3T0DA 1LG2A 2J7CA 3BSGA 3RJYA 3NDYA 1JZ4A 1PZ2A 1GQKA 4PMVA 1QNQA 1BG4A 1QBBA 1WNOA 4XX6A 2D2OA 3U5YA 1YHTA 1YQ2A 4NZCA 3GZAA 2C8NA 1DWJM 2DEPA 2FGZA 1E4NA 3FW6A 3W25A 4P7NA 2W4XA 3BGAA 2J77A 4UQCA 1DWIM 1H2JA 2CIPA 3CMGA 4FLOA 1NP0A 2HISA 1HJUA 3CZKA 4J27A 3K8KA 1D3CA 1A47A 1MXDA 3LPOA 4GXPA 2X2YA 1V6WA 1B3ZA 3PZ9A 3HN3A 3AS1A 4WJXA 3ZMRA 4BQ2A 3WFLA 1KB3A 3FNDA 1CECA 3PZIA 1VEOA 3UR8A 1KCLA 1C91A 2ZUSA 2UY2A 3T2OA 5JBFA 3CHFA 4WLCA 2VZSA 4OOUA 1ISYA 3WF1A 2JIWA 3CIVA 3VIKA 3AROA 2JIEA 2WKGA 3M46A 3M07A 3MUY1 7A3HA 3VIMA 1C7TA 3WQWA 2YDQA 3ARTA 3PTQA 5M5DA 3L4TA 1EDTA 3RIKA 1ODUA 3AXIA 1N82A 1AQ0A 1NWRA 2GUYA 4LYPA 3WMCA 2WVVA 3GNRA 1J0JA 4CVWA 3AZTA 5BWFA 1R7OA 2WNWA 3AZRA 4U3AA 2XM2A 1BGAA 4Z2LA 1KWKA 3MUZ1 5A3HA 1QBAA 3L4XA 1ISVA 1GNXA 1J01A 2XPKA 3VTRA 3K4DA 3N1AA 1Y7VA 5FOOA 3QR3A 4FLQA 3UG5A 3IJ8A 2RGMA
chains in the Genus database with same CATH superfamily
3M0KA 4PB4A 1IXOA 1NARA 1VIWA 1W5NA 3H21A 4XV0A 2PWVA 3HFYA 3UR2A 1KCXA 1MRAA 2ZZ7A 1PTGA 5I3JA 2WMIB 2P0IA 2PRLA 4C6QA 4B5WA 1SMAA 1JUBA 3M6YA 1XKJA 2GSHA 3DBNA 3NQ2A 5D2TA 1AA1B 3A4AA 4HK7A 1H0IA 3BV7A 1W5PA 3NQGA 2XVKA 1CXLA 4AD4A 2J75A 2UZ9A 3UG4A 1J0YA 1E6NA 3CUGA 3O3RA 3WMBA 1MEHA 3ANYA 1EWDA 8TIMA 3CV2A 3WNPA 4AHOA 4Q6XA 4WDXA 1XLKA 3RX2A 3QYSA 3FY1A 4AUBA 3TEVA 1DTUA 2YCIX 1VCFA 3GNXA 1UOZA 5AC8A 1RCQA 1GZGA 1GTEA 1OZMA 5F1UA 3W7GA 4QITA 2NQ9A 4CNUA 4K1GA 1WCGA 2VCBA 3BGGA 8RUCA 1W8SA 1H5VA 3VOFA 4XD4A 3ZT7A 1BGGA 3SCNA 3C2FA 1K8YA 3AAMA 3C52A 3HG4A 3CL8A 2P1FA 1GKPA 2WCSA 3C2YA 2VRKA 4XUYA 1CNVA 4PTWA 4QSFA 1RHCA 3EWCA 1Q2RA 3GKFA 1R8LA 5CC5A 2QPSA 2D2HA 3OGVA 3E5BA 3AO0A 4OTKA 3LM3A 2EXOA 3NQEA 3HQNA 4DUXA 2I7GA 3FAWA 1UIPA 4NJJA 1YXDA 2Z28A 3REQB 4GH1A 2BB0A 3WBWA 1DIOA 1KGXA 2PF0A 4IIHA 5JH2A 3PK7A 4W89A 5TIMA 4AVOA 4HBKA 3VDBA 1V3JA 4GBDA 4A3YA 2WVSA 2DT0A 1LLZA 3TA6A 3IV3A 3QKEA 1YADA 2C14A 1B3YA 1Z41A 2J9YA 4J3TA 2WW5A 1A0CA 2WYSA 6ALDA 4Y6GA 5DXXA 5D05A 3B3DA 3NL6A 1D8WA 3PB0A 3EWXA 3MSRA 2B7PA 2OLHA 4JX4A 4UTJA 5EMYA 2PFHA 2W9MA 4HPNA 1ONXA 2G8ZA 2VCCA 4NXSA 3OO2A 4HA3A 4BEQA 2FZNA 2GVYA 3NSXA 1RY8A 2DT1A 1LROA 4GISA 4OVXA 5A6SA 2FZ8A 2FGBA 4EPKA 3GXFA 1F8IA 1JFXA 1VP5A 2ZWZA 3XISA 4DEFA 1DBTA 1HJVA 4LUJA 3BAJA 2JGQA 3V0SA 3PTKA 5AYBA 3QOKA 2QAFA 3WQOA 3WDJA 2OZ8A 3VNKA 1TUXA 4GGBA 4JCMA 2PWEA 3BG3A 4AD5A 3KTSA 3Q4DA 1NOUA 4IIFA 2RDUA 1WZKA 3L68A 1GOQA 1M9HA 3CQHA 3TLLA 3CWOX 2B7QA 3F1QA 3T81A 1NU5A 1XRVA 2Y63A 4QCEA 3UBPC 3RCMA 3A6OA 3M0YA 4C6NA 4H9XA 3HPAA 3T4CA 3MCNA 2WVVB 4DBUA 1H62A 3PBGA 3NQCA 3G24A 5D2VA 3EEGA 2I57A 1Q6LA 4QJ3B 1HL2A 1P0KA 3UJFA 1DJXA 3W75A 4IPLA 5I79A 1BAGA 4C1NA 3GB6A 4IP4A 2H8ZA 4XZWA 3RF9A 4K2SA 2VKZG 3CYVA 2H3BA 1MXSA 1EA0A 2BVTA 3NM1A 2NX9A 4D1IA 1W31A 3CBWA 4M24A 1ZBWA 1R9XA 3C0QA 4H6KA 1IR2A 4LYRA 1A5OC 3HMCA 5CPQA 3PC0A 2P8BA 2VFGA 4GKTA 4CQBA 1XLMA 5A6BD 4GQ0A 3W1TA 2X1TA 5K9DA 1JPMA 2DZUA 2G41A 1RP9A 2GQ9A 4P7QA 4Z0JA 1A0EA 3RPDA 2WZMA 3GXMA 2Y2WA 1B5TA 5CAKA 2OSWA 3UJ2A 1V3LA 5HOSA 2BGSA 1RQHA 3TOPA 3QGKC 3IJDA 2PB1A 2YA1A 3A64A 4W84A 1UMLA 2YCJA 2Y5SA 3GTHA 1FA2A 4KESA 4MNLA 1XYLA 4XB3A 1YNQA 1X38A 3ZR4A 1GOIA 4ML4A 4AX6A 1PS9A 4O57A 5D8ZA 1OZQA 2GSEA 1KTNA 2VFEA 3B06A 3FSUA 4B5XA 3KTXA 1NAL1 4AIBA 3WLHA 1US3A 2ZADA 2OYMA 4JYDA 4IXXA 3ZSSA 3GG0A 1E4MM 3U2OA 3SFKA 3VNLA 3VOCA 4I6VA 4GACA 2J25A 1G5AA 3HGRA 2G3FA 4Y9NA 4AWEA 4JKMA 2WCAA 4WDTA 3O7UA 4F9JA 2KX9A 1O68A 2I9UA 3BK0A 4RDZA 3ZOAA 3DFNA 3CUHA 1R3TA 1DE5A 3COTA 1Q6DA 3R8RA 2V5CA 4OWGA 4GUIA 3GH7A 1G4TA 2O56A 4KETA 5FJUA 3RHGA 2V69A 2YJQA 4LVGA 4S3BA 3CASA 3RDKA 1PEZA 1JYWA 2WZEA 3GXDA 1LWHA 5DMMA 5C9XA 1F61A 2OOGA 1PZ3A 3VGFA 3U0HA 4IIEA 4LXFA 4Z08A 4AWUA 1MMFA 1DJZA 3BW3A 3R0DA 2LLEA 1E6PA 4L4MA 3P5YA 5HNUA 3E1F1 1OFBA 1M5WA 4YLWA 2V63A 1A53A 3C8FA 4ZL1A 4QG8A 3MZNA 1M7XA 2AQWA 4HB7A 1QAPA 1RPXA 1IGWA 3KP1A 1R9YA 2PDJA 1XS2A 2BBFA 3BMWA 4EK7A 2WMFA 4AHPA 1G7VA 3B0YA 4X22A 3AALA 4QR6A 2BOGX 4UNIA 3HQOA 2OZ3A 2NXGA 2WPBA 1FWAC 1WV2A 2ZA2A 3CPRA 2VX4A 3NQMA 3DI0A 3VGBA 3DFPA 2VR5A 3B03A 2VQTA 4DBWA 2YOCA 3QSRA 4WJEA 4FNUA 3TXVA 4G56A 3E0VA 1XV8A 4AD2A 3JVAA 2C91A 4OZOA 4MJMA 1P1XA 5JMUA 4IFKB 1VBHA 3N17A 3LMZA 5HUPA 4CQ9A 1WDDA 4KF1A 1XDLA 4JDBA 2OLSA 5HXMA 1JDFA 3I3BA 5AYZA 1UZDA 3GX9A 3GDMA 1E0UA 3QN3A 4DO6A 5FESA 1FKXA 4U2ZA 4DNMA 1D2KA 2YXGA 4LVFA 2H90A 4CU8A 5DO8A 1KXHA 5BU6A 4QG6A 3KL0A 2BTMA 3VKBA 4I5XA 1QWGA 3UXIA 2NXIA 3M5XA 1XLJA 4TV6A 2EEXA 1JGMA 2DH3A 1ZBKA 1PVNA 1W9PA 2RGLA 3JR2A 4GUGA 3IJLA 3RJXA 5CZ0A 1JUKA 3LQGA 4Q32A 1A5KC 1E0TA 4Q4QA 1QT1A 3WK0A 3VDCA 2DW6A 4Y7EA 3QMSA 3L4VA 1RD6A 1F3EA 1TWDA 1XLAA 2IKGA 1ODZA 2V30A 3N13A 1TPDA 3TZFA 3IJIA 1TTJA 3LCLA 5G4HC 5F2MA 2YX0A 4CCCA 3MKKA 3CUJA 3LNPA 3QMRA 4CGTA 1GQNA 3VPLA 3DN5A 5I3IA 3N9KA 4C6MA 3EBVA 4NASA 5T91A 3OVGA 2ZWYA 5HATA 2YFNA 1I0BA 4Q22A 1JDDA 4WY0A 4BQ3A 3B97A 2FH8A 1PYMA 4M0XA 3V18A 1JXKA 3L0NA 4H9ZA 1W56A 5CSUA 3NJ3A 1X7FA 4J35A 3ALGA 3U6WA 3TJIA 3S2LA 2EBNA 3GTFA 4O0QA 2BG5A 1Z9AA 2YYUA 4DZIA 4WRHA 2FZMA 1BF6A 4YTSA 3GY1A 3DERA 3VNJA 2PTWA 3SUTA 1BQCA 3WH7A 1D3GA 2YGYA 1AMKA 2VP8A 3WQ5A 4YYFA 3T0CA 4NILA 1MUCA 3ITYA 1DPMA 3HJZA 3UVIA 1C93A 2OLAA 3DEQA 1OFOA 2J9XA 2P50A 1G01A 2IPJA 3F2CA 4QJ1A 5E09A 1YYAA 4FP1A 1XYMA 5H8UA 3TMLA 1JEZA 1TTIA 3A21A 3AYVA 5D9NA 4XKYB 5ECVA 2VTFA 4JFTA 5AHEA 1Q8JA 2XSXA 3F2DA 2YB4A 3MMTA 2FZ9A 3E0WA 4FO4A 5AY7A 1G67A 1K7FA 2J79A 1OX5A 2FZBA 1JZ5A 3CZGA 4E8CA 3AU2A 5E1QA 1K70A 2O4MA 3A12A 5I77A 3QV9A 2O9TA 1V8EA 1SM9A 4ZO8A 3IANA 3W2KA 4UTTC 2VEPA 3N2TA 2PAJA 1UP2A 1UQYA 1DJHA 2QHAA 3BXWA 1B30A 4KGJA 4HCHA 3KRBA 3VYLA 3IAQA 2Z00A 1DXIA 2Z4GA 1WUFA 4Q8NA 3NCOA 2VGFA 1FDJA 4UQEA 3LXBA 3IIVA 2FFCA 2R14A 1X1ZA 2YB1A 1XLEA 4B90A 4ZQMA 4QLLA 3EYPA 1LF1A 4O14A 1K8CA 1HNYA 1UUOA 5A6BA 2OVLA 3SY5A 1TMHA 2QCEA 1LBFA 2IUZA 4K6AA 2WJEA 3PZGA 3IUHA 1K7EA 3IJ6A 1I75A 1CT5A 3BICA 2WCGA 1BSIA 2PDXA 3CLMA 4A8RA 3N9SA 2VXNA 2CU0A 3UU0A 4C6EA 3SB0A 2FGLA 2MNRA 4O0ZA 1R6WA 3NXLA 2J7HA 4A22A 3R43A 2ONEA 3E3HA 1KM6A 4BR1A 8CGTA 1F9CA 1QNSA 3BJSA 3S3GA 3SCPA 1QVBA 3AQUA 1V6TA 2WWDA 6REQB 1P6BA 3DESA 3CO4A 3S83A 1WOAA 4NU7A 4YTRA 6ENLA 2HZGA 3LM7A 3S2MA 4QHRA 2QCDB 1TTPA 5DX7A 3LCXA 4S2BA 1CZ1A 1OGSA 6TIMA 4V1XA 3PN8A 1QUMA 4WKHA 5FEZA 4IQJA 1C7SA 2VOMA 4AMCA 3OB8A 1U2YA 1S2TA 1UASA 1TELA 3PWAA 1GPWA 2XVPA 4LCSA 1E6RA 4MAZA 1UWIA 4IP7A 4R53A 1AG1O 1YPFA 4R5EA 1UC4A 4TQTA 3U4FA 1MYRA 3TAOA 1XPGA 1QPQA 4J5NA 1LQAA 3R7MA 2P53A 5I3KA 3OW1A 1A80A 3GDTA 1IZCA 1ONRA 3B8TA 3C3UA 1LRQA 4F8XA 2R1PA 2PDFA 3LTSA 3UNTA 4RZ6A 3KBMA 2R24A 4PUEA 5I02A 2XISA 2VGGA 3D3FA 3TQKA 1TR1A 4QDPA 3CH9A 3E49A 3TJ4A 3VD9A 5CGQA 3S47A 3UR5A 5HNTA 1LORA 1EFZA 5LGZA 1KXVA 4IF2A 3VKJA 4EXBA 1V0MA 1W37A 3C0SA 2VC9A 1OC5A 3LHVA 5A6KA 4JIHA 4HHHA 1FP8A 2GQ3A 2NSOA 3RPMA 3O0KA 4KH2A 3W37A 3G18A 1GCYA 1AD4A 3L67A 2E09A 3MB9A 1IWBA 1KM5A 2DQXA 3EDFA 5FKYA 1GQLA 3SM0A 1XP3A 2XN1A 1L6WA 1AQMA 5FACA 1ESWA 3BW4A 3R94A 3OA5A 4EANA 1O4UA 4MFEA 5HPOA 3BAYA 3GTIA 1FDYA 1KA9F 2NQLA 1EP2A 4IFOA 2GJXB 3UWWA 1NEYA 3A4XA 2PPGA 1S2WA 2VT0A 3EA2A 1FWJC 3QV6A 5BXSA 1GEHA 3EDEA 1YNYA 3FOKA 4KRTA 3IWPA 5CPTA 8XIMA 2AL2B 5PTDA 4E2DA 4IX2A 2A2IA 2YPIA 1MQQA 3FDKA 1B57A 4H00A 1BVZA 1L6FA 2ESCA 2WO5A 3S1GA 2V82A 1PBGA 2BP1A 1YTEA 3IEBA 3C5QA 2G50A 1UD6A 3CPUA 1VFUA 3TUUA 5EMLA 3VIFA 3UZYA 3LSBA 2QDDA 1RK5A 3SCRA 1R87A 5FCZA 4ASTA 1OFQA 2QNEA 2R6OA 3DXIA 4P7LA 3VE9A 4RE3A 3VGEA 1VRXA 1QU4A 1H11A 2XFFA 3TYEA 2QCMA 2NWSA 2PWGA 4Z2IA 2EG7A 3DHFA 5LNVA 2YDRA 2ZUWA 1P6WA 3FEMA 1UP0A 2ISSA 3B8VA 4JHZA 3OVQA 2F9RA 4MJ4A 1JPKA 3TW7A 2BX7A 2NV9A 2D0FA 2PDLA 4POCA 5HWMA 4DYJA 4US6A 5BOFA 2R9RA 3SSJA 4K8HA 3N18A 4ZFMA 2CBJA 4N2YA 3K8MA 1XM3A 2VR2A 2ZC1A 1KM1A 2A3AA 2PLMA 5BCAA 1NFGA 5HR7A 3CMJA 5EA9A 3P81A 1TE6A 3V0TA 2F6XA 2Z2UA 5I2UA 4WK9A 5EFDA 4XAPA 5JIPA 1LL6A 3O1NA 4YTTA 5A8OA 1UD3A 4C90A 3T8LA 4JFVA 5HINA 2YBUA 4L6OA 3OBAA 3IVTA 1R7AA 4C6CA 3V1HA 4K7YA 3JRKA 3LPGA 4GUFA 3GIPA 3MTWA 5HANA 1OWQA 4XO7A 1I8JA 1GQIA 2VCAA 3LHUA 2ACUA 1R3VA 2D24A 1IIHA 3IACA 1JF5A 3V5CA 2YL5A 1J4EA 2BY2A 4JFSA 3UXDA 3NVTA 4KT2A 1B4EA 4NJHA 2V2DA 1UUQA 2X0YA 3B8SA 2CKSA 5CC6A 1X6UA 2QPXA 4B5VA 4WR3A 3TE9A 2OWWA 2DT2A 3W7OA 3ZLHA 2CXGA 3E9AA 3CLWA 4CD6A 4GJJA 2FVMA 3AUOA 5AZ1A 1RP8A 1ZJHA 1M53A 3IJQA 3DHPA 5LIUX 1L9WA 4DI9A 4IFRA 5C55A 2VM8A 1EBGA 3E12A 4GMEA 3V35A 5KITA 2CITA 2R8WA 3CO8A 2Z1BA 1VFMA 2NZLA 5FJIA 1F5ZA 4D6DA 1I2NA 4ECLA 4G1NA 1SO5A 1TRIA 3FGCB 2J9ZA 2GWNA 4JL2A 1YPXA 1LWJA 4Z2GA 1NJJA 3VMOA 4B5SA 3EKGA 1EZ2A 3K4WA 5GPRA 5L9FA 4JTLA 4ZB5A 4L9XA 1BKHA 4KIEA 3W7LA 3PF3A 1BG9A 1OX6A 4NJIA 1AL7A 1E56A 3HPZA 3W28A 4ZQPA 2DUZA 1XYFA 4MMWA 3W7CA 3T78A 1QWKA 3E0FA 1EEXA 4GQQA 5BRPA 4PUWA 3EWBX 1CBGA 2A7PA 2BY3A 1JZ8A 1F07A 1B0IA 1VZWA 1NIUA 3GR4A 2W67A 3LPFA 4ZA0A 4NF7A 3ME3A 4H8VA 2DUAA 4CKQA 5I3GA 2ZUVA 3OEXA 4CNTA 3MBDA 1H41A 3LENA 1W1TA 4RV3A 4KCTA 3TSDA 1FHDA 1H5YA 3GG8A 1W1ZA 3GNPA 3ARXA 2CNCA 3HG3A 2POZA 3AHVA 2CHNA 4CCDA 3TC6A 3BSHA 1IT0A 1DXFA 1K9EA 4US5D 5LSMA 3H54A 3HMJG 1ZSXA 1YE4A 1ME8A 4RNFA 1HX0A 4RPQA 1XIHA 5C2XA 3UEQA 5CSSA 1HL9A 4J9JA 4PSPA 3LS9A 1TMQA 4AEFA 1XD1A 4A3RA 5CGTA 5D8WA 5IFTA 3URAA 1F76A 4J2MA 4DVOA 4YPJA 1GKRA 3IK2A 4I6KA 4LTSA 4OBSA 2GLKA 1GZ1A 4PUMA 3ARWA 1KM4A 1KKRA 2R1KA 4IT1A 4QNEA 4GHRA 1IXNA 3QQ0A 1JYVA 1F6PA 2JF6A 4LQ1A 4W86A 5DY2A 1U5HA 3W88A 3S42A 4CU7A 4LC6A 3N4EA 5DF0A 4A3HA 2EHHA 4PE8A 4Q7NA 4MLRA 1TCDA 2G96A 3KE0A 3APTA 2WLZA 4UZUA 1RA5A 1NF0A 4LF2A 1ZP3A 1ADOA 3MMDA 3WK1A 3UWQA 4RK8A 4V15A 1NFBA 3VDGA 1UZHA 3OG2A 3XINA 2ACRA 1Q6EA 5D2WA 4HOXA 3SGGA 3SCOA 3CHEA 4U33A 3G8RA 5D03A 1S5TA 5K3VA 4MB4A 1JQVA 1EYEA 1ZZMA 3SRDA 1OCQA 3MU7A 3AS0A 3T44A 4BJHA 4KWVA 1JDEA 3A9BA 1W9UA 3BOLA 4ILSA 3UNDA 4DF0A 2G3JA 3CAWA 4HNLA 1FH8A 1YTDA 5IOBA 3UYIA 1U1UA 3ZVIA 3MWCA 2V68A 4EX4A 3BOXA 1OFRA 1XIDA 3PZMA 2E5BA 3ITTA 3MDUA 5TQLA 1EB3A 2G3NA 4KCUA 5FJTA 4UR9A 4WCJA 3NZQA 3M16A 2V3GA 3UERA 1V02A 1XLFA 1EH9A 1V93A 4DJDD 4MYAA 4AZ7A 2GJRA 1U83A 5LNUA 2IPFA 3K8LA 2VMFA 1UKPA 4H8UA 4LS0A 4XAGA 4UTLA 5FSDC 1XX1A 3K30A 2YW3A 1V6XA 3ARUA 1JPDX 1TPC1 2NWRA 3CEPA 1AH0A 2DSWA 2OX4A 3ARVA 4DWSD 3M0LA 5G1YA 1KFKA 3W53A 2PDYA 1QPKA 4MZ1A 5FF7A 3KBWA 4BS0A 4JEJA 2QCNA 1D7FA 3ABOA 3TCEA 1ITXA 1FFRA 4DHGA 3N12A 2OGJA 5GNZA 1XLDA 1KC7A 3CU2A 4BI6A 3ITVA 2WV8A 2CLMA 3KZPA 3GDRA 2V3EA 1O7AA 1ZALA 1V0KA 3A47A 4M81A 3C2VA 3UPWA 4PB5A 2BOFX 2GVLA 2YCEA 4JAWA 3VMNA 3U2CA 1WKDA 3W87A 3QW4B 3CXOA 1GUVA 1V6VA 2E8YA 4URIA 4XAZA 3CQJA 3G1RA 5IDZA 4CNPA 1YDVA 1S2AA 4IJCA 1TPB1 3IAPA 1EP1A 1AJ0A 6XIMA 1DQUA 1FWGC 1JZ3A 3PBVA 1U30A 1W3JA 3GU1A 4JTJA 1HZYA 1VBUA 3KRUA 3VD5A 1BYAA 1FWIC 4AEOA 4HPHA 2QJMA 1P0DA 1S2UA 7TIMA 4NHVA 1LQ0A 4QE5A 2AQVA 3VZYA 1C8QA 4P8UA 4ZB0A 4LVDA 3G1SA 3PR2A 2QUMA 5A5WA 2XH0A 4GYKA 1OFEA 2CBUA 2OR2A 1K7XA 4F40A 3WQGA 4F0RA 4JTEA 2UY5A 1BRLB 1R46A 1FHUA 4RNHA 1RCXB 7TAAA 2FMNA 2I1OA 3STFA 4HQVA 2Y0FA 3O2LA 1OM0A 3R89A 4W88A 1CGVA 3W3OA 1REQB 4UOQA 4DUWA 4EF8A 5CBIA 4WJ8A 2X09A 1Q13A 1SFSA 1AJ2A 3ES8A 1T99A 2J7CA 2VC6A 4Q7IA 1GQKA 2FVLA 4X2PA 4Q4PA 2CLFA 4XX6A 4OBTA 1UWAA 3GZAA 1SJAA 1XBXA 3RU8X 4IWWA 3S1UA 1U5VA 3FJ4A 5EBUA 1OK4A 1H2JA 1TPEA 4RZ5A 4HCDA 1Y65A 3W7JA 4FLOA 1NP0A 3CZKA 3K8KA 2X1RA 3LPOA 2XN2A 1V6WA 1B3ZA 3MKCA 3PZ9A 3VNMA 3AS1A 1A5UA 4BQ2A 1IQ8A 3KRZA 3HGJA 4HTBA 2HDJA 1CECA 4TR9A 2HXTA 4HNVA 1C91A 5RUBA 3T2OA 4IIDA 4AYGA 4REQB 3WK3A 3WF1A 2JIWA 2GVJA 2R1NA 4UMCA 2PZ0A 3HFTA 5D04C 3AROA 3QLDA 3GO2A 7XIMA 4XUGA 1V79A 5JQ9A 3ES7A 3JZEA 3VIMA 5REQA 3ARTA 1Q5MA 5J8LA 1U22A 4WZHA 1N82A 1O1HA 3DG6A 1PTAA 2Q3RA 3WMCA 3Q45A 5J04A 1SUXA 4BFAA 1K1DA 5BWFA 5LHEA 1TREA 2XM2A 4EF9A 1G4SA 4QISA 1PZ0A 3PJXA 4HPJA 2E6AA 1QBAA 4DQWA 1ISVA 2QDHA 1ZAHA 5GJPA 2QF7A 3WJWA 3N1AA 3S6DA 3QR3A 3PUOA 3PPHA 4AZGA 4R27A 4RXGA 4TX6A 1MZHA 2B81A 1F7BA 3LLDA 3CUIA 1KRCC 4NQ1A 2DGAA 3PPFA 3FA3A 4QEHA 3TK7A 2ZXBA 3NXFA 4QM1A 3SAZA 1KRBC 5CC7A 4XTDA 2C19A 4UB9A 4PCFA 1J2BA 3UPBA 4RXFA 4WUIA 1EX5A 3MP3A 4OV9A 1QHPA 2ZVIA 3WBAA 1A0DA 1B9ZA 3WLLA 2MUCA 1FHVA 4MG4A 4YHEA 3M1ZA 4BWLC 1SW3A 4E0CA 3PFRA 1KXTA 2DSVA 3BAKA 3KW3A 4KMQA 1OT1A 3EWDA 5EFFA 4UTIA 2VRQA 1YBQB 1H1NA 2CWXA 4S3CA 4LB4A 1KRMA 2J8GA 1GJWA 4DYKA 2PTZA 4EWJA 1W9VA 3S9YA 1V6UA 3CZJA 4Z0SA 3D46A 3LCIA 1AODA 2YCLB 3N2BA 3NPVA 4INFA 1AW5A 3OZPA 2UY4A 5ECUA 4ROQA 3KVKA 3KL3A 2PEVA 3W7KA 2F2HA 4CQCA 1FWWA 3NAVA 3UZ5A 1QO2A 3IGHX 1JNEA 2WLYA 1HJXA 3CQ0A 4XZ9A 4C7DA 3QKZA 2YL6A 3EEZA 3NZGA 4NI3A 2PP0A 1PB0A 2J7GA 4X9SA 3KUMA 3QYQA 5CCZA 4LH8A 2ZA1A 2PCEA 2Y8UA 3VIPA 1MNSA 3USBA 4GQRA 3LHTA 1MNZA 2CERA 5GVJA 5EMUA 2UWFA 4JN7A 3M7SA 1ZGDA 1VBGA 4O4WA 2C15A 1W1VA 3LTPA 3SY8A 2VFIA 4Y90A 3EMZA 1BYBA 1LM1A 3FXGA 1Z32X 3RILA 1UWRA 4AD1A 1ICQA 3L5MA 1E70M 1XLGA 5DT7A 3ZR6A 3GBEA 4AXNA 3W7MA 1IEVA 2XYLA 3NPXA 4DWSA 1QK2A 4UQBA 4V1YA 4PL1A 4CD7A 1LUCB 3GR8A 1E3ZA 1KD0A 2I5IA 4ZOAA 5I0DA 2QCGA 4R7WA 3WUEA 2A21A 2DPEA 4L65A 1PO9A 3M0JA 5C0QA 4G7FA 3N29A 2FHCA 4K3ZA 1JQXA 2W5FA 4HN4A 1PIFA 1EDGA 4XD3A 4LY4A 2HS8A 4AD0A 4MJ2A 1KFLA 5A94A 3AIBA 4AX7A 2Z26A 1GJPA 2WNNA 4AIEA 3BTNA 3TR2A 1X97A 3BARA 5A2BA 1M41A 1O60A 3TJXA 3SGZA 2V0TA 1MWOA 4AC1X 4MY8A 3TTEA 2GFTA 1S5WA 3RU6A 3LPPA 1F3XA 1KQZA 1YDNA 1ADDA 2OKOA 3PFMA 4WKFA 4JKKA 3CAKA 2VEFA 3AICA 1RH9A 4FLSA 1AL8A 4AZIA 4MKNA 2FTPA 1XC4A 1KM3A 3L5LA 4R85A 2GL5A 2Z0IA 3FVDA 3GG1A 1SVDA 4XKMA 2CLKA 2IPGA 1I1WA 4NAFA 2XN0A 1R3WA 4F0HA 3EX4A 3QMTA 5D9MA 1R30A 1C8YA 4LCRA 4HU8A 1UKOA 3DIPA 4I7UA 1Q3NA 2GK1A 2XFYA 3DECA 3PJTA 2OKTA 3CC1A 1WZLA 4CU6A 2JK2A 2C3ZA 4KEMA 4Y96A 3V0UA 3NEHA 3MO7A 4Z1AA 2PC8A 4TUFA 1L8NA 2O55A 2HEJA 3QFEA 3K2GA 1P48A 1TJPA 2YDSA 1QPRA 2DSUA 2HE5A 4J28A 3B9OA 3I3EA 4A3QA 3GNNA 2XIQA 4S2CA 2XG9A 3WH5A 4JTDA 4IQEA 2ASHA 3L2IA 3SN0A 3WX7A 3B9NA 2QJNA 3I4EA 2PI6A 2QZRA 3TLQA 1QNVA 1JZ7A 3P7YA 4O8AA 3MI2A 2BHUA 5JXQA 3WJYA 3GW0A 4MPKA 2WSRA 2WSQA 4HSNA 1TWSA 3LZ3A 4AZCA 7ODCA 3ITOA 4I8DA 4R88A 4EVZA 4Q8WA 3N11A 4IM4A 1CPUA 2E9BA 1KR0A 3WLTA 3IJ9A 4PFMA 3CAVA 4GZJA 5D33A 4TVCA 1M03A 1IEWA 1P6CA 2DZSA 3CT7A 5EGRA 1CXFA 3LEPA 3ID7A 2Q01A 4ZFCA 5G2HA 1IE7C 3ARSA 1FTXA 1DIEA 3VUPA 1XSJA 3KRSA 3ABXA 4K37A 5EY5A 3STPA 4ES4A 1R86A 4W8AA 3BJFA 1NELA 3IGSA 4FXRA 1P0BA 4GGHA 4J2PA 3OZYA 3NA8A 2OG9A 4NZJA 3UFYA 4DJDC 5I78A 1ZS2A 3WQ8A 2CLIA 4DBEA 2FB3A 3L23A 4CD8A 5KSWA 2CZDA 1QOPA 4M6PA 4MKSA 4MAVA 4R34A 4ATDA 1SU5A 1TA3A 3OQEA 1FWDC 2FLIA 3PY2A 1FWEC 3IK4A 5U4NA 3TZNA 4C6PA 4QAIA 1YRRA 1LT8A 1EDQA 3ZWTA 1VJSA 2D0HA 4DWSC 4YCPA 4GIYA 1UR1A 2QJHA 1TMLA 3GFXA 3LN3A 3PWGA 4HHPA 3KVJA 4Q8TA 1YLVA 4V28A 4A6GA 1E9IA 1WB0A 3KDOA 1CWYA 3PJWA 2QJGA 1RCOB 1BWVA 3WLNA 3ZT5A 1BVNP 1FWNA 2PGFA 2ZA3A 3OG3A 3VIHA 1GYNA 3N04A 1CXIA 3OBKA 3R6IA 5D37A 5BROA 3HPSA 2E0PA 3V75A 1EGVA 5D2XA 1P43A 4OT7A 5DCEA 3M0XA 1RVKA 4HCLA 2PE4A 1A3XA 5CJ5A 4JR5A 4JDYA 1MDLA 1E3XA 1OFDA 1RBAA 2BLEA 1V6YA 2OYLA 1QFEA 2A3CA 4JEQA 3B8UA 2PDBA 1IEXA 1VJIA 2YKKA 2C79A 5AC6A 3W76A 3D3AA 1YNPA 3GE7A 2PP1A 5LA0A 3USZA 5EMMA 2B0MA 3JU2A 2GWGA 4RNIA 3TFXA 1DOSA 4LF1A 4FEZA 4QX4A 1K6WA 4FIRA 1TJRA 5E0CA 2D22A 4W9TA 2POTA 2NQHA 1EX1A 1MUMA 3DU0A 2W0UA 4D6JA 4K68A 2ISFA 1LWIA 5I3DA 2WSYA 4G9PA 4Y9AA 2A6NA 4JFWA 2QGYA 4HPGA 2NSXA 3GIYA 3M5YA 3V16A 1EHAA 5T9CE 1KRAC 2E40A 1KFWA 4WDUA 4WQ6A 4LPCA 3F5KA 4HP5A 4NUWA 4MWAE 3CMFA 2G4JA 4QP0A 3PB2A 4HA1A 2J7BA 5DMNA 1QI4A 1T8QA 3EGJA 2J8FA 4N4PA 3WN6A 1S39A 3UG3A 5C9UA 4GE8A 2HBVA 2VUNA 1XKYA 3INPA 1RSCA 4GBUA 1P0NA 3K1DA 3KOYA 3C2OA 1OHLA 1MUWA 4UUIA 3NZPA 4WSJA 4I7WA 3L9CA 4QXIA 3MQTA 3IIOA 5JBDA 3HA1A 4LUTA 4XISA 3S5OA 1K9DA 1YX1A 5I00A 1GOXA 3W74A 3T07A 1CI1A 2BNJA 4IQLA 4ZENA 2C0AA 4HTYA 3S1VA 3APGA 1AH4A 3QGVA 3C0JA 4JTQA 4FOUA 4JFUA 4JIQA 2NUYA 2ZBTA 2CWNA 4PMZA 5LIKX 1FDZA 2VEKA 3RRXA 3F2BA 3NSMA 3O16A 2X1IA 1UMYA 4G8TA 2VC7A 1HIZA 1I9CB 4DF1A 1ECQA 1OYCA 2PF8A 3DH7A 2RDWA 2NV1A 1UH4A 1KCKA 2FTWA 4AEEA 1FH9A 4GYPA 2EG8A 5FEXA 2HSAA 2VWSA 4ZR8A 2C0HA 2E7FA 4ZSTA 2ZRUA 1B4KA 4AVNA 4E2VA 3TNBA 1XPYA 5JUVA 1A3WA 4D8AA 1PDZA 3CB8A 1BYCA 3CH0A 1SZRA 1XR2A 2NLYA 2QUTA 1Z42A 4S23A 4PTMA 1QHZA 1ICSA 1OFAA 2Z6IA 4H2CA 4DAFA 3BLFA 1Z69A 2TRSA 5K2ZA 1W8GA 2ABBA 1UR9A 4AVFA 1OSEA 2X0SA 1H09A 1KCZA 3OBEA 1JPHA 3MS8A 4IGNA 4MDOA 1VENA 4PC8A 3VILA 2PGRA 1XCWA 4NAEB 2TAAA 3TYDA 3MC5A 1JCLA 4JTIA 2GGIA 3MI6A 4GX9A 4XVDA 1GPFA 2V5DA 2VDHA 2GVEA 7CGTA 3QZEA 1B3VA 2ZTKA 4KWWA 4ZCWA 3SRKA 3B4UA 2ON3A 2W61A 4H9TA 2ZZ6A 3M43A 3HZ3A 5A2AA 1SW7A 1ML1A 3WBYA 3ZFHA 4DPPA 5AHLA 2QVHA 5I6SA 4PMRA 1T41A 4GIRA 4GUJA 2D20A 4XSLA 5MKGA 1OABA 2BGNE 1CGXA 1E6QM 4H6EA 4XTIA 1QPNA 3WD0A 2R82A 1AD1A 3EWYA 2JKAA 4C6JA 5CSRA 4JN6A 2O9PA 3P0WA 2QIWA 2YZ5A 3UA3A 2R91A 5ABTA 4P5UA 5CQ1A 1DL3A 2Z1KA 4FXFA 3VDHA 3O6CA 2ZUUA 1TVNA 3I3DA 5HWJA 2ZZ1A 1TB3A 4W8BA 3L4UA 3H53A 3C2RA 2O0TA 4V27A 2W6RA 3TMQA 4UTKA 1XLBA 3S6OA 5I24A 4J3SA 4Z2JA 2C1IA 1AK5A 4A2RA 4C6BA 3ONBA 1K8ZA 3AXHA 4XO6A 1WKYA 4YTQA 3G0SA 3LUTA 4AFYA 4G6CA 1DWGM 4TX8A 1LRTA 1W9DM 2WQDA 2NW0A 4WDWA 2WHKA 2YBTA 4NT0A 3N3MA 4ZB2A 4GD0A 4LANA 1QNPA 1S1PA 1J10A 1GEQA 2V2HA 3TV8A 4MWAA 4B16A 4ORMA 3C4UA 3DZ1A 4CEUC 4L4PA 3SCVA 3WD3A 3ZYZA 1TFVA 4E2OA 1M7OA 2JQXA 3SCWA 4P8WA 1EHNA 4GQGA 3HJEA 5A6JA 3SW6A 3P62A 2QEZA 3OHIA 4PMXA 3UR7A 3PSVA 4NNBA 3W1UA 3L4ZA 4M56A 3SUUA 2IMRA 1S5NA 1PUDA 1X39A 4NYUA 4RL3A 1KFEA 2FHFA 4M5PA 1QI0A 3GRIA 4DLMA 2WJFA 4WY0B 1GHRA 1W0MA 5HMDA 3B4YA 2XM1A 1VR6A 4LBUA 3RLGA 5HMSA 3QC3A 2CESA 4DM2A 1J18A 3ZLGA 1BLIA 3QQ1A 2VD8A 4PBGA 3VO0A 1DJGA 4DO5A 4MIMA 4XZNX 4MNMA 4GOAA 1QASA 1KR1A 1GK8A 5BW6A 1SYTA 4E4FA 1HUVA 2REQA 5HAOA 2G3IA 1F05A 2PBOA 1GVQA 1HKWA 1QCWA 4XKYA 4Q4SA 5A6MA 3LMYA 4IMDA 2IQTA 4X61A 1JIBA 4GYPC 1A5NC 3EWUA 3R0UA 3BLDA 1S2VA 3FJ6A 2CPUA 4Z1BA 4Q4MA 1Q85A 5I5RA 1HO4A 1TWWA 4PYSA 3H23A 3OZOA 3I65A 2J7EA 2OPJA 4YXGA 1W1PA 5G4EA 1R47A 1T5AA 1IHIA 3MANA 1JD9A 1VYSX 3G6LA 2CCRA 4JICA 3WBXA 3QR0A 4KW2A 1WBJA 3I7QA 3TYUA 2R1MA 3EXTA 3A23A 7REQA 1OG6A 2PDMA 4KIRA 4PODA 2V8ZA 1KBKA 2VVSA 2YA0A 2F8QA 2ZIDA 4L1XA 4J7RA 1EXPA 2EPOA 4ZOCA 3G0XA 3W70A 1JZ6A 3AHZA 3C61A 2PGEA 4LAOA 3PSWA 4TU1A 2C13A 3MJYA 3EX3A 3QJAA 1OQFA 1DJNA 4RE0A 4D9PA 3L65A 2AGTA 4GINA 3SQMA 1GW1A 3EOSA 1PX3A 5IXEA 4YNGA 1TQXA 4PEKA 4JTGA 1ZJIA 1GVFA 1FWTA 3RLHA 2WANA 3LCHA 3Q2DA 4RUBA 3FA4A 5CPLA 3QZAA 5I3FA 4NIRA 2PC4A 1GYLA 3UZWA 3BAXA 4ONVA 5BYWA 3W82A 1VFFA 3NIYA 4M7TA 3AIEA 4LNYA 1VCVA 2YXOA 1WDPA 1LZOA 2Y7FA 4WF7A 1RUSA 2G0WA 3K13A 3FLUA 3TNOA 2VWTA 3PJUA 1W1YA 3BLEA 4Q8MA 4BA0A 1AMYA 3UT0A 4A21A 1C92A 3G1FA 5DFAA 3PVFA 4MB3A 1M7JA 2YR1A 1J2WA 1TR9A 4E2BA 1EO7A 4PGLA 1NDZA 4GC3A 3JUGA 2Q8XA 3TWBA 3WLQA 1QW7A 3AS2A 4I9AA 2CKRA 3MHUA 1SSDA 2BHYA 3TN5A 1E15A 4A8IA 4WSHA 4MPQA 3QV8A 2GQ8A 5LGXA 4ZEPA 4FNQA 4MB1A 4OIFA 3ZIZA 1PWLA 1ZAIA 2FMOA 3RMJA 1B9BA 4C60A 4PULA 5KTLA 2QT3A 5G2WA 4C5YA 4QRNA 3VI2A 1Z7AA 2FH6A 1ZHAA 2DDXA 1EZWA 1T8XA 5TF0A 1NVMA 3IS4A 3UA4A 4CQDA 4JKLA 2J6VA 1NDWA 3EX2A 1HGWA 2X2GA 1BXBA 4P61A 1QI2A 1FXPA 2FPVA 2V5LA 4KFNA 3N6QA 4YJ5A 1P7TA 1CIUA 3N6JA 4N7QA 2ZXDA 4YWIA 3SCUA 3FXYA 3AI0A 1WDQA 2P3ZA 4UFIA 4B2DD 1F3WA 1UD4A 3SADA 3S6TA 3G6MA 4GZEA 1Q6QA 2XVLA 3I7SA 1QNOA 3O05A 2RH9A 4XAFA 2BXVA 3AJ7A 4DIAA 4PTDA 4AAJA 4QQUA 4AMAA 2IXUA 1LJYA 3NEVA 1WAWA 3N73A 5CSYA 1KGUA 3WQCA 2ZX6A 3KBSA 3CZEA 4ADSA 3V36A 1RQBA 2FPTA 4CVUA 1E1FA 1Y5WA 3RFAA 3LGGA 1KBJA 3G0UA 2C7FA 5L6UA 4UFLA 1W32A 2Z7KA 4HMCA 4PUDA 4GXWA 4GFSA 4L4LA 5D02A 4LOCA 4K39A 1FWFC 3TYAA 3WYZA 4ICNA 2D3LA 4D2JA 4LCQA 3VM7A 4JTFA 3W26A 4EIVA 4Q8UA 3BE7A 2HWGA 2VUYA 1MI3A 2IKIA 1FWSA 3M41A 4QDWA 1JVNA 2E6DA 2WQPA 3HIJA 4IICA 2Y61A 1XSKA 2HE8A 5C7VA 2PTYA 3WLJA 2PD9A 2VURA 4LJ3A 2JALA 4UOJA 2GYIA 4U5KA 4KCVA 4LNCA 3KHDA 3TWAA 4PRRA 3UGRA 1CW2A 2DZWA 1UOKA 5HJXA 5BRQA 4JTHA 3BMXA 3M44A 1XJBA 3NSNA 2J88A 4YMZA 3MCMA 2J74A 2YL8A 1EIBA 1JRCA 2NT0A 3KDNA 3S5YA 3SBFA 1NSJA 3N6HA 3FYOA 2ZX7A 1E0WA 1UH3A 1YDYA 1Z44A 1Z89A 3QEZA 4DAIA 3P84A 3CTLA 3DENA 4QLJA 3SRHA 1P0EA 4W7UA 2JF7A 2XIJA 1TX2A 4H9YA 3F5JA 4GK8A 2WWCA 1EJXC 3P8IA 4ADUA 2YL9A 2Y7DA 3WQ6A 5D2YA 5GJMA 4IZGA 1G69A 4HA4A 4TVDA 2ALRA 5XIAA 3VGDA 3LK6A 4IL0A 4TV5A 2NQJA 4O54A 3WD1A 3H2OA 2PRHA 2XFRA 4ZQNA 1TWIA 3CIXA 3VKKA 1DXEA 3FN9A 1MXGA 1Q7QA 3AIQA 1HKMA 1UZ4A 1OGBA 4IMEA 5LNWA 4EPDC 3PNZA 3WLRA 3VDAA 4NZ4A 4LT9A 3LB0A 5DY3A 4BF7A 2CLHA 4HHMA 1JDAA 4DUVA 2DVUA 1MQPA 1RJRA 1W2PA 5BXRA 1RXOB 2P0OA 2VR4A 4JQ2A 2RAGA 2V3DA 4JNMA 4HN8A 1DWHM 4UQ9A 1I1XA 3GIQA 4S3GA 3L21A 3NO1A 4HZMA 2CLPA 5EL1A 3H4GA 1OCBA 3LCFA 2CZ5A 2MANA 1Z6KA 4BF9A 4M51A 1UYQA 1QRQA 4Q8VA 3SEPA 3UWUA 2X41A 4FNTA 1W54A 1W9XA 4ACZA 3W7RA 3HBLA 3BCDA 4UIOA 3V3WA 2E6FA 5KINA 4E6MA 1N55A 2BFGA 2PDHA 4XQ6A 1XWYA 4DO4A 1EOKA 5GQBA 1EJSC 3AMDA 3P93A 3B9DA 1I2OA 3R25A 2NVCA 3U8GA 5A69A 3SZ8A 4H2HA 3WD4A 3T0AA 4KPLA 4UCGA 2NVDA 2B31A 2WZIA 3QTPA 1XL9A 3PAOA 1JPIA 1DYSA 2QJIA 4EXAA 1E5NA 3UY8A 4QS6A 1FCVA 5CPMA 3SJNA 1BKSA 2GJNA 4BKNA 3N25A 2ZZ4A 2PP3A 2EF9A 6XIAA 3SRFA 3UZZA 6A3HA 1Q8AA 4DZHA 3L4WA 5CZJA 1DHKA 1UJPA 1VIZA 1ZRQA 3D6NA 1V7YA 2EPLX 1WZAA 1DIDA 3WF0A 1ISWA 2QPUA 1PKMA 2ALDA 3UZJA 3MA8A 4O11A 1X6NA 1OC7A 3PPGA 4OFCA 1E40A 1PX8A 4J1OA 3QHMA 1F4AA 1AZ1A 3QRHA 1MDRA 5K4ZA 1EUAA 4PUJA 3AMKA 3AUJA 2V3FA 3PZUA 2CBVA 5A8QA 1VEMA 3P8JA 3M5ZA 3DFYA 1VH7A 2WBKA 2PDGA 2PDUA 1EF2A 3W4RA 2O9RA 5FF2A 3H8AA 3GNDA 1EPVA 4RE2A 3I6TA 2DIJA 3NQVA 3FIGA 1POJA 3QR1A 3KOXA 3NPUA 2Y8VA 4UWMA 3EZ4A 5BOEA 4Z1YA 4I9TA 4KBXA 1AFSA 4F0LA 3N34A 3V4BA 3TW9A 4PMOA 9XIMA 1J8VA 3KFTA 3R12A 4JIEA 1W17A 3GZ3A 4X0NA 4XZIA 2VFHA 1MW3A 2C71A 1FBAA 1XXXA 4IIGA 2O9OA 1PV8A 3R13A 3W2JA 2ISWA 1LP6A 2Z1SA 3POCA 1VYRA 5C71A 1Y0EA 5EYWA 3I10A 1JD7A 4UZSA 2W63A 2YXXA 1ZJBA 4RDYA 6PTDA 5C2CA 4IH3A 4B2DA 3WQDA 4HNTA 3QY7A 2ZVRA 1ZCOA 1L8PA 2VEIA 5HNRA 4HU4A 4PMVA 3BO9A 4G7EA 1WNOA 4JGDA 2GGHA 3W02A 2C8NA 4NJGA 1DWJM 1L6GA 2H9AB 3A3WA 3FW6A 1N7KA 3W25A 4P7NA 2W4XA 4HJWA 2XGZA 1VS1A 3GK0A 4X63A 5ENLA 3YPIA 2CIPA 5TNVA 3CMGA 2HISA 1HO1A 4FXJA 3LQLA 4LAUA 2VEGA 5K9XA 1M65A 5FI8A 4JD4A 3T40A 1PHWA 3WQFA 2HBXA 3HN3A 1UUMA 3BG9A 3LV5A 4WJXA 3HF3A 1UROA 2ZZ3A 3PZIA 3UR8A 5HJLA 2ZZ2A 5BOOA 2XH4A 2VZSA 1ISYA 4P2VA 4TMBA 1JULA 1VGAA 3WMLA 1TV5A 2B7NA 2PDIA 1V51A 3M46A 1XIIA 3MUY1 1O5RA 1C7TA 3H2AA 3PTQA 5M5DA 1TV3A 3ABZA 1PCWA 1R38A 3EXRA 1F74A 4EP8C 1AQ0A 3CPGA 1NWRA 4Z1DA 3N2CA 1R7OA 1RZMA 1KWKA 3LHZA 1J01A 1DQWA 2DVTA 3CV1A 5B80A 1W3IA 4FB7A 3AWNA 1EC8A 1G4EA 3RR1A 5DBUA 2E1WA 4FLQA 3UG5A 1PKYA 2JEPA 4DB7A 2WHJA 3FCPA 1C3FA 4BK9A 5C70A 3NO3A 1KGWA 1BF2A 1R5YA 1HL8A 5CBBA 3QC0A 1BFNA 4WX2A 4D6HA 2I56A 1Q6CA 1RJPA 3NQAA 1SJBA 2IQ0A 3WSUA 2FYMA 4PFHA 3I6RA 3T0TA 2XFWA 5ABHA 3GH5A 3WF2A 3MHFA 4PTXA 5CPOA 3VINA 4FALA 3WH9A 3H2CA 2TYSA 4YL2A 1R2TA 2RHGA 3WDIA 2VFFA 4FI4A 1SW0A 1OCNA 4KERA 1ITUA 1J79A 3ZWSA 3W73A 1XLCA 2J27A 3T6CA 5H1WA 4BEUA 3MVTA 3L0GA 5LXXA 3RITA 4NXKA 3EOOA 2XIOA 4GJIA 3UW6A 3ITLA 4B9YA 5BRBA 3GVVA 3Q37A 5BMXA 4DO7A 1KQYA 1SPQA 2EKCA 3TJLA 1V4YA 3W01A 5JU6A 3GU9A 1ITCA 3R11A 1J5TA 4IISA 4ZQCA 4JTAA 1MW2A 5U7SA 4Q6JA 2BODX 2H8XA 4GVIA 1VRDA 5BU9A 3A3HA 3VC5A 3BSMA 1GGOA 4JCLA 3S5SA 3VA8A 4ZOBA 3ZVHB 3VIGA 4GO9A 4H83A 3AS3A 4XBJA 4ATLA 4AIUA 4I90A 4RX0A 4JOMA 1RLDA 1SFTA 2R94A 2I17A 3DFSA 4GI9A 4EPEC 1DHPA 3ZT6A 4GO8A 1K9TA 1OINA 1TVLA 1SO3A 1RPKA 3DYPA 4RW5A 4NX5A 4B92A 4LV9A 3P2VA 1GVEA 3CHCA 5T9BG 3TSMA 2QKFA 2VGBA 2CZEA 4GLEA 1HGYA 1R85A 3DKJA 3H7VA 9RUBA 1C90A 2GZXA 3BLKA 3W7QA 4B3ZA 3WY1A 1C9WA 4QFUA 2YDAA 3LBMA 2DJXA 3TU9A 3SECA 2BMBA 1R0MA 3NGJA 4YU1A 1NF7A 3P74A 4OJYA 1V08A 2VDIA 4PUUA 5I23A 2D23A 5A8PA 1OG0A 4GZ7A 1TV8A 2QUNA 1CXHA 4JY9A 4GJ1A 3U57A 1IZJA 1MEIA 5BZAA 3EB3A 3NTYA 1F2JA 4IG2A 2WM0A 4DNHA 2XDFA 1SFJA 3NOYA 4XZBA 4XZMX 3AMCA 1QI5A 4H8NA 4AWSA 4JIIX 4EPBC 4C91A 1YXYA 2PDCA 1KNWA 2TMDA 4LSBA 3D5HA 2OQHA 1XF0A 5H8MA 4YVPA 2E77A 2E5CA 3RMEA 4RPPA 2O4QA 2WVUA 1W5QA 1UKSA 3KP0A 3AMLA 5CPNA 3VNZA 1RY0A 1H49A 1TV7A 4JTCA 4I5UA 3OQ8A 4KEUA 3VD4A 3SQLA 1JYXA 2ODOA 1SJDA 3BZGA 2EO7A 3O6DA 3A22A 1CXKA 3IV8A 2NT1A 1SGJA 1HP4A 3HPFA 1UWTA 2DSKA 4O4VA 4W8LA 4L7ZA 2XH2A 3IGXA 1R3QA 1QPOA 5D38A 5H8PA 2DVXA 3F4VA 2A85A 4ENLA 1J12A 3G1XA 3GVWA 4C1LA 3TA9A 1J0ZA 4Q8PA 4MHBA 3WDHA 4TMCA 2WSPA 1GVOA 3LOTA 4ROPA 3EOLA 1HW6A 1UD8A 1I45A 4HYVA 4AWTA 8A3HA 3NGFA 4D6EA 2E5DA 5T8GA 1EF3A 2A7RA 3M0MA 3NM3A 4PCPA 2WMKA 4IMFA 3WKZA 1OIMA 1SJCA 4GA8A 1G1YA 2W62A 1BSLA 1K03A 2ADAA 2WMJA 3W1NA 3CAQA 3W1QA 4EWND 2QDEA 1L6SA 3TW6A 2ZXAA 3FVMA 3P5ZA 1VPYA 4IGSA 5BXTA 4OKDA 2OYKA 4HMEA 3E0IA 4PA8A 3ZJ8A 3U3HA 5XIMA 1FWCC 1YXCA 1LBMA 2QVNA 3I4KA 4KWSA 4J4KA 1VFHA 1V03A 4FLRA 3W1LA 3VCRA 4NRSA 3U5UA 1L0PA 2RUSA 5FD0A 3CZLA 3IARA 1F73A 2D69A 4KKXA 3M6DA 1L2QA 2ZRYA 2BHZA 1VYPX 5EKYA 3QXBA 1O5KA 2XIBA 2QR6A 1WXYA 3RM9A 5GJNA 3LRMA 1RBLA 3SFWA 2ZFAA 1ONWA 3CZ8A 3TCSA 3G3DA 1DQXA 5CJMA 4PB3A 1WBHA 3WIJA 4A8NA 3DBPA 4LUYA 1UR0A 4OU1A 2X30A 4FZIA 1ICPA 5AHIA 2W66A 1XIGA 3T08A 7ENLA 1D9EA 5KZMA 1DJQA 4N9EA 1ENUA 3BPWA 4GYJA 2DZVA 4AQLA 1GVSA 1SZNA 4K1WA 2VGIA 3H4XA 3W22A 1J6OA 2J4GA 3ZM8A 4MM1A 2BY0A 5DMYA 1XBYA 1U1HA 4O0KA 3T05A 4A05A 1AZ2A 3HG2A 1X98A 3QY8A 3ICJA 4FS9A 4LYKA 4Z2KA 1XH1A 1QJWA 1BTMA 5D4YA 4O15A 2WC3A 1TUFA 1Q7MA 4R7JA 5KZ6A 5F1VA 2Z29A 5CZKA 4H9MA 4F0MA 2YW4A 2G37A 4GNJA 5FJRA 4BY3A 3CB3A 1JCXA 1LUCA 2GQAA 3O06A 4Y9PA 5ABFA 4IGHA 3KLKA 1CCWB 3KOZA 4C5ZA 2J7FA 1QW9A 1E4LA 5MHBA 3BAIA 2EAWA 3IRSA 4JPGA 5KZEA 3RX3A 4GVGA 2V5JA 1FQ0A 4QJ4B 3W27A 2OQLA 4GWEA 2OO0A 1PSCA 2UBPC 3BQ6A 3VKCA 3VD7A 4DWSB 4XZHA 4F0SA 1JJKA 1PTDA 1E0VA 1LRNA 2X05A 5FJPA 3LLFA 3MY9A 4ZO9A 1UBPC 3PBUA 3SSZA 2HVNA 5TBOA 3W1MA 4Z1CA 4HT3A 3UZXA 4L5ZA 2XTKA 4PMJA 1XQKA 3GUGA 4DZAA 1K02A 3UCQA 4FNPA 2INEA 3F7JA 3OHMB 1NP2A 3WDRA 1GVIA 1OEPA 5CAHA 1WXZA 3ORWA 3EPOA 3IGUA 4DLFA 2D73A 1XRTA 3MI3A 3T1GA 4ZOEA 1YW1A 4I8YA 4GY1A 3FJLA 4UTWA 1GVYA 3BANA 3W81A 5D32A 4B9ZA 3OLGA 4OGZA 3AWOA 4FR6A 3PZQA 3EMCA 3S2NA 5CC3A 3WBEA 5DANA 1E9LA 1FY6A 2J7DA 3O9NA 3WLSA 4HMDA 4I9MA 2FIQA 5CXPA 4MUZA 1TG7A 3VCCA 3NURA 2CLEA 1E1CB 3L0KA 2BS9A 3DC0A 1M3UA 1RBOB 3W38A 1WAUA 4N9DA 2A3EA 1H1YA 3CK5A 1W91A 3LBCA 4OBRA 4D6GA 1MW0A 3K5XA 3MUAA 4GRSA 4Q4KA 5GNYA 5AHNA 1V02E 4NX0A 2GK1B 3RLVA 4XK2A 2VQUA 4YTUA 3WUBA 1TIMA 4XVEA 4FMVA 1CEOA 1VEPA 4LAMA 3TKFA 1B3XA 3MUCA 5EMJA 1UC5A 2GSJA 2DT3A 1UR4A 1HN1A 3UVAA 3NQ7A 4F2TA 5AYYA 4IPIA 4ZE4A 4PBFA 3C86A 1X6LA 1Q6GA 5HNNA 1OCJA 3B05A 5KEZA 1JL8A 1DTNA 2VOTA 4NNAA 1XLIA 1TKKA 4IUOA 3KCJA 5HMFA 4M6QA 5AYIA 1MQRA 1WE5A 2ICSA 2NV2A 1ZBCA 3TOYA 1HFBA 3W7PA 3GUWA 1HQTA 2WBGA 3S4TA 1ZNNA 1DJIA 1QMLA 3E74A 3W2UA 4RNJA 1PDYA 3UJSA 4AZCB 1K4GA 1B31A 3D0CA 3T09A 3G8EA 1H63A 1ZL1A 2W79A 5AC4A 2BXYA 2Q6ZA 2BVWA 1LOSA 4ZODA 4DWDA 5FJOA 3TC7A 2Z2AA 2HNEA 5G1MA 1ZP4A 1WZMA 3CGTA 5HULA 1MFVA 3VK5A 4NKCA 1IZKA 3DUGA 4HSHA 4GVHA 2CC0A 2QCLA 3TTSA 4NI8A 1H0GA 1JI1A 2DSZA 1EC7A 2W3ZA 3AXKA 3TDFA 4QQ3A 5AOUA 3R0KA 4HOZA 4TXEA 3W2LA 5A6LA 2OOFA 1XRFA 2XIMA 2EG6A 4HK5A 3PZOA 3WCZA 1MW1A 2OB3A 4DBDA 4L9ZA 1TA3B 4XIMA 4AYSA 2F2KA 2VX5A 3JW7A 4PZVA 4UOZA 3DYOA 5F4XA 2EKGA 2P3EA 2ZE3A 4AG0A 4AW7A 3A5FA 1UD2A 4HK6A 2Z7GA 4JY8A 3STGA 1AQFA 1JNDA 2Z1XA 1NQ6A 1DKWA 2QCFA 3IJ7A 3VMPA 3U4AA 4UFKA 2HTMA 3FS2A 4JN8A 4AF0A 4LEFA 4EKJA 1Q6FA 1JZ2A 2CFFA 2ZUTA 4HJFA 1XHGA 2E9MA 4WY0F 3TSBA 3V5OA 3DGBA 4MNKA 2EJAA 2F6KA 3R4IA 3WENA 1I60A 3N2MA 2ABAA 3W2NA 5AECA 2F61A 4QG9A 5IRPA 2Q71A 3RRAA 4UR7A 4UTWC 2GUUA 3NDZA 4I9JA 3N19B 1K77A 4EOUA 4L61A 1UR8A 3CTTA 1IT7A 2DH2A 1GQJA 4LBSA 4ZVJA 3GVRA 2GDQA 3WNKA 3R10A 1UHVA 2PWHA 2SFPA 3OODA 3R8GA 2ZRVA 4IPNB 2QXWA 3EXSA 5DQPA 5BMWA 5MF5A 4MFDA 3GHSA 4FR1A 1LCOA 4GY7A 5F2GA 1T0OA 1W3LA 1SO6A 1PWMA 4C7FA 4PUKA 3PP7A 4AY8A 3AHYA 2RDXA 3GU2A 1G6CA 1ECEA 2HVOA 2J6XA 4D6CA 3C56A 1TSIA 1NFPA 3KCOA 2E1DA 4PCSA 4F48A 2X1UA 1GWJA 3DGRA 1C9DA 5G1TA 1UBSA 2NQ5A 4NL1A 4H9VA 4DM1A 4IP5A 3J7HA 3ITGA 3AISA 4X2RA 2ZC8A 2V6AA 3C6CA 3WMSA 3R1ZA 1VAHA 1H1ZA 1AH3A 3VX0A 1OX4A 3TN3A 3WJXA 1CXEA 3MP5A 1J6PA 3PUDA 3LY0A 4RW3A 3HURA 4N9CA 1JUEA 4S3JA 4YN5A 5HDRA 3GHRA 4CCEA 3UXAA 3S0CA 4CN1A 1LOQA 2FTYA 4C6OA 3BL3A 3AFBA 1XCFA 2PLCA 2X16A 2WAGA 4DBSA 3B0PA 1DEDA 3RX4A 4M6VA 3U48A 2QMKA 4H19A 2A4AA 3UXLA 5DT5A 1OD8A 2WOQA 1N8IA 2C18A 3NR0A 3S9IA 2QS8A 2G3MA 3A3XA 3MSDA 4ATWA 2YLLA 4QLKA 2P5NA 4Q4RA 1OK6A 3CHVA 4LUTB 3ITCA 4M29A 1XGEA 3NOEA 3QPZA 1S3HA 2BWGA 5CLTA 1XC6A 4C6KA 2V5BA 4AZ6A 1H60A 1LG1A 5C7HA 1EC9A 2V38A 3WD2A 4O1BA 1EQPA 3DDMA 2V81A 4UTMA 4HIBA 5AZ0A 1POKA 2CBIA 4B5TA 3H2EA 3V5FA 4E5TA 3G2GA 2TODA 1UQZA 1TPWA 1O1ZA 3VNIA 3MO4A 2XJ7A 3HQ1A 2QMJA 2PDKA 1MVYA 2IS7A 4DYEA 3NDOA 4J3ZA 3BH4A 3GKAA 5M17A 3L7RA 3E2SA 1X8FA 1R3SA 2F38A 1A5CA 3PZVA 4K8EA 1XI3A