5A2BA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
452
structure length
452
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ANOXYBACILLUS ALPHA-AMYLASE
publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
total genus 167
structure length 452
sequence length 452
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2bA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2bA01
2EPMX 4W8AA 3GYCA 3UR7A 2IXVA 4PBGA 2DIJA 1V03A 4AIEA 4IPNB 4OUEA 1E0XA 3N9KA 1KWKA 4GQQA 1US2A 4HOZA 5CG0A 2WWDA 3AI0A 3W0KA 1XSKA 1GOMA 5DFAA 4AIUA 1O7AA 3GBDA 4NRSA 2EQDA 2WM0A 3CUHA 4W5UA 3MMDA 4NZJA 5CLTA 1WP6A 4AIOA 4BS0A 3ZSTA 1F4AA 3AIQA 1E72M 2NSXA 2Z1SA 3UESA 1E70M 4CD4A 3AIVA 5BCAA 1LF1A 4XZBA 1J10A 1E6SM 1W9DM 3UERA 1C91A 4LYQA 2FGLA 3AQUA 4UQEA 1GOKA 1IZJA 3T2PA 2B31A 3KL5A 3FAWA 2W61A 2W91A 2PWEA 2WBKA 4C7DA 1NOWA 2XN0A 5E1QA 1C8QA 3OB8A 3CHEA 5IHSA 2XSAA 1H4PA 5A8PA 1AQMA 3T2OA 3SEPA 1VRXA 1GJUA 2WHKA 2VQTA 3TA9A 1JDCA 1E1EA 2BS9A 3VIIA 1AQ0A 3WQ5A 3EJPA 1GW1A 4PMQA 4J27A 4HOWA 3THCA 5IFTA 1E3ZA 1XYZA 3S6TA 1VBUA 1OB0A 2WW5A 1UQZA 5CJ5A 3VGDA 1Q6EA 4V28A 4U5IA 2G8ZA 1JAEA 2EXOA 4HOXA 4P7RA 4AZCB 3NDZA 2QF8A 1G94A 1CGUA 3WMBA 1MQQA 4YN5A 2WMHA 4ACYA 4CCDA 2WCAA 1W9BM 4PTMA 4JHZA 5E0CA 4AZBA 1GORA 2EPNA 1ZBCA 2VZSA 1NP0A 2ZOXA 1WAWA 4AZ5A 3L4XA 3L4WA 2DT3A 4NF7A 1E3XA 1VB9A 4PMVA 3BSHA 3ARSA 4PMXA 4TX6A 1W9PA 3K4AA 2DT1A 1KBKA 4DUXA 4WKAA 3M46A 1PEZA 1UKSA 3MMWA 2VMFA 4WK9A 3WEMA 4V2XA 2OWXA 1UKQA 2OWWA 4UZUA 4U3CA 5D4YA 3U5UA 4NX0A 2O92A 2F2HA 1XSIA 1W1YA 1QI5A 3WF2A 4AEEA 2WC4A 1JFHA 2IUZA 1UD6A 3BXWA 3LRKA 4UZSA 4KWUA 1EOKA 1PS3A 3CPUA 1MW3A 4NRRA 4J3UA 2WCGA 4UQBA 3E1F1 2X1IA 1R33A 4M82A 4UOQA 3SURA 2ZUUA 4GINA 3IK2A 1BF2A 3CC1A 5BXRA 4HU8A 4UTFA 2OSYA 3OGSA 1CPUA 3RILA 1GQJA 2XVGA 1BVNP 3EYPA 5C71A 4W8LA 1AMYA 4JFUA 4KRUA 3H55A 2JEQA 1G9HA 1V08A 1JI2A 4UQDA 3VSUA 3HG4A 4RE2A 3WD2A 1CXEA 3WD4A 5AY7A 1KBBA 1O6IA 3RIKA 2J7DA 2XM2A 4CKQA 1E6NA 3CUFA 3VIJA 1C7TA 1Q6CA 5JBDA 1UR4A 5BXSA 5ABGA 4PSRA 5D9OA 2YA0A 1HTYA 3TOPA 4ZEPA 3IJ7A 2WC7A 4HMEA 4TVUA 1UZ4A 5JIPA 5C8BB 2F7PA 1LG2A 2F1BA 3GBEA 1UH4A 4D1JA 2G3NA 3MSDA 1US3A 1NWUA 2JIWA 3ARYA 3L4TA 1Q4NX 1DWJM 2ZUWA 4PTWA 2F61A 3KWXA 4WJXA 4UQAA 3QOKA 2OYMA 3THDA 1FHDA 2EEXA 2JE8A 5A69A 1QI4A 2VO5A 3ZJKA 1J0IA 4AD1A 3A6OA 1KTBA 1GOWA 1BLIA 2F18A 3B9EA 3ZMRA 4AZGA 2JF7A 3A4AA 3VNYA 1UZ1A 3GXPA 2XHYA 2BV9A 1HJXA 2Q8XA 5FKYA 3LRLA 1CWYA 1SFSA 1BG9A 3OLIA 3AIUA 3FNDA 1R87A 3L4ZA 3AS0A 3W6LA 2A3EA 3ZIZA 5A8OA 4B16A 3VIMA 4AEFA 1HKKA 2X2YA 5AYIA 2UY5A 3BLBA 1TA3B 3AFBA 2WSPA 2VNCA 3GXMA 5KEZA 2ZWZA 1E0VA 2GJXB 4LX4A 1KCKA 5M03A 4XX6A 2DSZA 4TTUA 3UG3A 3VVGA 1TQSA 3CZ8A 1E4IA 4H7VA 3KL0A 5HPCA 2PF0A 4UCFA 2VQUA 3HN3A 2V3EA 4M56A 3G6MA 3NSMA 1KB3A 3D4ZA 4U33A 1HJUA 3W6MA 1H3GA 3BAYA 2XFFA 3W81A 2F1AA 1VF8A 1EXPA 3SCVA 2O9TA 1KR0A 2BFGA 3T2QA 2F7RA 4JL2A 4XB3A 3AYSA 1GUVA 3ZJ7A 1JG9A 3N12A 2CERA 1J0ZA 4DWSD 4FNTA 2WHMA 4JIEA 1MVYA 2ZWYA 3EDFA 1B3WA 1IT0A 2E8YA 4WSJA 4DWSC 1ODUA 3ALFA 3WH8A 1KXHA 3ZOAA 4OBRA 1KXQA 2D3NA 3MV11 4NSBA 2G4FA 5A6SA 3HG5A 2WKLA 3K8LA 2ZX9A 2E9BA 3PZQA 5IDIA 1J18A 4OBSA 5E6YA 4PMNA 2NT1A 1U33A 3AIEA 1J0JA 3DC0A 1E6XM 4BA0A 1B31A 3FXYA 2EBNA 2XGBA 3AXIA 4TX8A 4S3KA 3WL1A 1V3MA 3MKKA 3SCUA 2VZOA 1GOQA 3MU7A 2A3HA 2IGTA 5A2BA 1GVYA 4CU8A 2BY2A 1LL6A 2BNJA 2V3DA 2XWDA 4ATLA 2CBIA 3W29A 4Z2GA 1M01A 3LMYA 3WNLA 1MW2A 3GZAA 4U2ZA 4MDPA 3CZSA 1CGYA 3MV01 1KGUA 3VOCA 2VR4A 4W7WA 2J78A 1S46A 1ISZA 2YL8A 3GXIA 1MXGA 3BUDA 1GPFA 2W92A 3DX0A 5A6MA 1WKYA 3LPGA 3WKZA 2GDUA 2X8RA 3CTTA 2WXDM 1KWGA 1DP0A 1TFVA 3IAQA 6A3HA 2J62A 2YIHA 1M04A 4P7OA 4AZIA 1VEPA 1XD1A 2QPSA 3EDJA 2XIBA 5E70A 4JKKA 1H2JA 4J28A 3NSXA 2ZXQA 4Z2KA 1PX8A 5DMYA 2RGLA 4M1RA 2VUYA 3SCRA 4W85A 2ZE0A 1EHAA 4FNRA 4AZCA 2J7BA 1CYGA 2VCBA 3AJ7A 1NWRA 2PI6A 4BQ3A 3L4VA 6TAAA 2WLZA 4HA1A 4PMDA 1DWHM 4F8XA 3PZVA 4PTVA 5BRQA 3VGEA 4CD7A 3VDCA 3U7VA 3T0DA 4CCEA 4DO5A 2VRJA 1W3HA 3AS3A 5I3DA 1DWAM 4D6EA 4P7QA 2YFOA 4WF7A 3WF0A 1KQYA 2E8ZA 3VU2A 4GIAA 3BAXA 2G41A 5BXPA 3EJSA 1KGXA 2WHLA 4MB5A 2VVNA 1JYXA 2EPOA 4MNLA 3SUSA 5A1AA 1UH2A 3A24A 2BHUA 1WNOA 1B3XA 3BC9A 4XV0A 4JAWA 5KZ6A 3A47A 4KGLA 3EJQA 1EDQA 2JFEX 4A3HA 2E40A 2ZX8A 2CCRA 3BLPX 3K8KA 4AC1X 3WNOA 5CSYA 1W9XA 4W88A 3GM8A 2EABA 3AHYA 3PHAA 3NSNA 2XN2A 1ZL1A 2O9PA 4H04A 1UASA 1OGBA 2GK1A 3TTSA 3PZGA 1ZB5A 2D20A 2CXGA 4AYSA 1LL4A 3AYRA 1QNSA 3K8MA 1J12A 2G3JA 2WMIA 3MUY1 1I75A 4MNMA 4LQ1A 1HWWA 3EMZA 2D3LA 3W26A 3F5LA 1VAHA 3AS1A 3VSVA 3NDYA 1V02A 2XYLA 3W24A 2D73A 1JYWA 2FGZA 1E4MM 2YKKA 5JUVA 1LQ0A 4PMRA 3HU7A 1UD5A 1G1YA 3BMWA 4D72A 4A4AA 3EJRA 1I1XA 2F7QA 1WE5A 4JCLA 2G3IA 4W7UA 2V3GA 2UY3A 1TR1A 1BHGA 3AICA 1KR1A 1LL7A 4ZE5A 3BAIA 5CGTA 4QDMA 3LXBA 3CUIA 2J7EA 1CNVA 2G3MA 3WSUA 1F4HA 1HXKA 3CZKA 4MAVA 1HNYA 4EAMA 3SCSA 2X09A 2WSKA 1UWUA 3D52A 3CZNA 1W3KA 1CECA 4D71A 4R27A 2W62A 1W32A 4Z2HA 2WMFA 5E6ZA 2J7FA 1CXIA 4J3WA 3L2MA 4PMYA 1JNDA 1JF5A 5JIWA 2FHBA 3UEQA 2GVYA 1E9LA 1H0IA 4Z2JA 4N42A 4B9YA 3A4WA 3RM4A 1HX0A 1JIBA 3N11A 3DHUA 4GI8A 2VL4A 3DX4A 1TA3A 1UH3A 1YQ2A 3OGRA 2WCSA 5A2CA 5I77A 1ODZA 1FFQA 1GJWA 4H2CA 3POCA 1JZ3A 3CZGA 4E8CA 1QHOA 4LYPA 1CBGA 4X0NA 3HG2A 1A3HA 4PYSA 4GZEA 4FNQA 1HKJA 1FA2A 1PX3A 1JD7A 4GO8A 5DEZA 2MANA 4HMCA 2EADA 3LXAA 1O7DC 2QLYA 4AD3A 1J9YA 3VINA 3EDEA 4URIA 1MYRA 1JFXA 3AMCA 4DO6A 1QX1A 3OLEA 1H49A 1UKPA 5CQ1A 1X6NA 1DHKA 2YLAA 1FH8A 7CGTA 3TTQA 3RM9A 1XD0A 4FNUA 1TQUA 2QHAA 2BVDA 5BXTA 4D6FA 1ITXA 1WDPA 3GNRA 5A94A 5ECUA 2WNWA 2OYLA 1W9UA 1MQPA 1OWQA 1QNRA 1XH1A 4OOUA 5LA0A 4QCEA 2X05A 1BPLB 3AXHA 1V02E 3NUKA 3ZT6A 3EBVA 1DWFM 3WY3A 3WNPA 5IHRA 3B9DA 1E0WA 4FLRA 1B30A 5I79A 1XRVA 1OD0A 3BUIA 1EIBA 5M17A 1MFUA 2D22A 4M81A 4BZYA 2X0HA 2ZUSA 4PMOA 3AMLA 3VIKA 2YFNA 5GNXA 4D6HA 3VUPA 1C92A 4UFHA 3AIRA 1PIGA 5LA2A 5I23A 1DTUA 1CTNA 2W4XA 3ARWA 1R75A 4IPLA 2YL6A 1C8YA 3VDHA 4AD5A 2GJPA 4BQ5A 3BVWA 4UQ9A 1GVIA 3I3BA 1GOOA 4B3KA 3S5ZA 1JXKA 3FN9A 4PSPA 1C7SA 4ML4A 2ZX6A 1MFVA 1B3YA 3WDHA 2WVVA 3ZQ9A 1UA3A 4CU7A 3WELA 3PTMA 2PWHA 1HL9A 4YHGA 2YA1A 3LXCA 3RCNA 1QHPA 2QV4A 1UWRA 2DSKA 2UWFA 3WEZA 3BGAA 2VCCA 1RH9A 1HXJA 1CXHA 5EFFA 3AZRA 3CMGA 2GUYA 4PRWA 3CH9A 1BYAA 3VMNA 3A3HA 3VDAA 5D9MA 4CD6A 2D0GA 3J7HA 1WZMA 2ZUTA 5DO8A 1QNOA 4CN6A 5CLWA 3WNMA 3ZR5A 3F5KA 4GZIA 1TCMA 4C7GA 1UWIA 4UFJA 4QFUA 1ZJAA 2GJRA 4BCEA 4C7FA 1B3ZA 1UA7A 1PAMA 1B0IA 1JAKA 5AYBA 1R8LA 2EPKX 1X1NA 3IAPA 3BCDA 1BQCA 2VRQA 3RDKA 3BVUA 3VIPA 3IJ9A 2FHFA 3CHCA 4HP5A 4AD4A 2CBJA 4DUWA 7TAAA 1MW0A 3WNNA 3QHNA 2YL5A 1J0KA 3WY4A 4GXPA 4PTXA 2XIIA 1MQRA 1TG7A 1GOIA 1XYFA 4ZFMA 1TE1A 1HJSA 4JZ5A 4W8BA 1UD4A 2CBUA 2CKSA 1J01A 3GH7A 1QWNA 3VIGA 1UWSA 3LPFA 1W3JA 4L4PA 3M7SA 3WD0A 1QNQA 4W7VA 3VGFA 1V0MA 3AMGA 4MNKA 1E43A 2A3AA 1EQPA 2E4TA 4HA4A 3KEHA 1V6VA 1BAGA 2CHNA 1C3FA 2CNCA 1HJQA 2CBVA 1JF6A 3UCQA 1DWGM 2CEQA 1UR8A 2BY0A 1JDAA 2XWEA 1K9DA 4NI3A 5TD4A 1GQLA 4TTGA 4ACZA 4U3AA 1NM9A 1LWHA 3VTRA 1XCWA 3VNZA 1V6UA 2GDVA 3WF3A 3AZSA 1B90A 3I3EA 1TMQA 3N1AA 3OG2A 3A21A 4OJYA 3ALGA 1UG6A 3WEOA 1E4NA 3WY1A 1CGWA 4U5KA 4U2YA 1PJ9A 1TQWA 3VSTA 5FD0A 7A3HA 5A6BA 3WD1A 2DT0A 4D6IA 1BGGA 3LPPA 1ECEA 1OINA 4MADA 3SUUA 3KZSA 1TVNA 1FOBA 2WZIA 1CIUA 2JF6A 3H54A 2C8NA 4BF7A 3RJXA 3UETA 3N15A 2J7GA 4JHOA 1OIFA 5HDRA 1CDGA 3GH4A 1OIMA 1UKTA 1W1PA 1OSEA 3AHXA 5FOOA 4ATWA 5E09A 3RO8A 3ARUA 3QHOA 4AZ6A 3K1DA 2VTFA 2UY4A 3VIFA 3A4XA 1JL8A 4BQ4A 2J25A 1UWTA 1UWQA 3SCTA 1U2YA 3PZUA 1CGTA 1B9ZA 1WB0A 2ALWA 2PWFA 1CGVA 4Y7EA 1XV8A 3WL0A 2WVTA 4FNPA 3VX0A 4NZCA 4QLKA 4PCSA 1GNXA 1UHVA 2W63A 2EACA 3TP4A 4TVCA 1CLVA 1OCQA 2YDRA 2EJ1A 3BVXA 1CXLA 1HKMA 3FY1A 1CXKA 4EANA 4NXKA 3CV5A 1SYTA 3O9NA 2CESA 5A6KA 2FDMA 2JALA 4WKHA 2QMKA 3CUGA 3POHA 3PZ9A 4PN2A 2GFTA 2J7HA 3VIOA 3VO0A 3ZT7A 3ARXA 3BSGA 3D3AA 1JDDA 4AD2A 2F8QA 3TTOA 3VD3A 2DEPA 4KRTA 3ZM8A 1VFUA 3WUBA 1D3CA 2D0HA 3PZMA 4LXFA 8CGTA 2YJQA 1V3HA 1JZ7A 4EK7A 3VD9A 1CENA 3W38A 1MW1A 1XC6A 4JFVA 1JZ6A 1D2KA 1WDQA 2ZX5A 1VEOA 1R7OA 1PZ3A 1H5VA 2WMGA 4ZXLA 2GSJA 3VM5A 3CBWA 2W67A 4TXEA 3WMSA 1G5AA 2BHZA 1EGZA 1GHSA 5EMYA 3RJYA 3MI6A 4P8UA 1GZJA 2ZUNA 4UOZA 3F4VA 3PZIA 1H09A 4OKDA 3VGGA 4HPGA 4FMVA 4W89A 3PTQA 4KH2A 3WQWA 4FLSA 5A95A 3U57A 1W3LA 1ZU8A 2J74A 3BUPA 1W2PA 3VD4A 3U7BA 1JNEA 3OZPA 1OGSA 4OIFA 3W53A 4MB3A 1C93A 5A2AA 5A6AA 4Q7NA 4HZ7A 1YHTA 2DPEA 4UFKA 4J7RA 2XSBA 3VGHA 4AZHA 5ABFB 1W91A 2WYSA 1LLOA 1VENA 4WSKA 1NOFA 4J3XA 4S3JA 1BFNA 2YBUA 4CVUA 3MANA 1HT6A 1Q6DA 2CPUA 2VZUA 3DDGA 4GI9A 1RPKA 2OLHA 2XVNA 1JZ2A 3L2LA 4CGTA 3PZTA 3QHMA 3VKKA 3VX1A 1J0HA 3FHAA 1EQCA 3WFLA 2BY3A 4QLLA 3AISA 3ZO9A 3PZOA 1KQZA 3BVVA 4W93A 1OBAA 1E73M 4IUGA 3T08A 1GHRA 3ZJ6A 3MSGA 1H0GA 3RM8A 2VT0A 3ARRA 1HP4A 1WDRA 5DF0A 1FP9A 3VDBA 2XVPA 3HMCA 5GNYA 4FNSA 3OBAA 2VI0A 4FF5A 2FH6A 1E55A 2ZIDA 1K6AA 1KTCA 4EKJA 1VFFA 3AHZA 3VD7A 3KE0A 4P8XA 2XFYA 3WH7A 1NH6A 1QI3A 3WFZA 4AISA 1E6ZA 2AMGA 1VEMA 2E9MA 5ABEA 3WF1A 1HVXA 4GQRA 1CEOA 2XVLA 5BRPA 2W66A 2D24A 2WMJA 3WENA 1GONA 1G0CA 3MUAA 2XN1A 1GQKA 5EB8A 1EDGA 5BWFA 2VZVA 2J47A 2XM1A 4R5EA 3ARVA 4L4OA 2YBTA 1K9FA 3WNKA 2C0HA 1WZKA 2V3FA 4BQ2A 4MJ2A 4M8UA 4W84A 1RP9A 3JUGA 5BROA 2TAAA 4F66A 5IFPA 1WDSA 1W9VA 4CD8A 4JFWA 3NCOA 4X0VA 5I5RA 4ZE4A 3KL3A 4D6CA 2V38A 5D8WA 5JBEA 5C70A 2X2HA 2D0FA 3DYPA 5FIPA 3ARQA 2PWDA 3S5YA 3MUZ1 4X9YA 1E4LA 2NW0A 3CGTA 4CN1A 1QPKA 5CPQA 1EDTA 4P8VA 2YA2A 3AHTA 2XPKA 4W86A 1UD8A 2YLLA 2WANA 5CPTA 4B3LA 3K4DA 3ARPA 3GXDA 3SIMA 2VRKA 4JCMA 9CGTA 2DQXA 1M53A 3MUIA 1KCLA 1V3KA 1OT1A 1LG1A 3CHDA 4HPHA 3M6DA 3NJ3A 3GH5A 3DX2A 1E6QM 1UOKA 1ISXA 1I1WA 1HL8A 1QW8A 1ITCA 4LGXA 4D6DA 1XCXA 1BTCA 4FLQA 1C90A 3CHFA 3N04A 3AMKA 3ZT5A 1E71M 3DHPA 1GCYA 1A47A 4JFTA 3FAXA 4WIWA 4J3TA 3IANA 3SCOA 4QLJA 3GXTA 3L4UA 3BLKA 2VX6A 2GJXA 4IM4A 1QVBA 2Y8VA 3OLDA 1TQTA 2Y4SA 3BCFA 1J11A 5CZKA 3BUBA 3II1A 2J75A 3PTKA 1NWSA 4U31A 4DWSB 2PWGA 2BXZA 1Q6GA 5FL1A 2VX5A 3CMJA 4P7NA 3LRMA 2J4GA 2FH8A 4F9JA 1MXDA 3VD5A 3WH6A 1PZ2A 5CPSA 1J0YA 5CGMA 3DX3A 1V6YA 1ISWA 1BYDA 1W1VA 2FE0A 1BYBA 2VURA 3ZR6A 3H53A 3WDJA 2JEPA 1OGGA 1PIFA 3EDDA 2VR5A 4CVWA 1BG4A 1R85A 1LWJA 4K68A 1EOMA 4AMXA 1P6WA 4W5ZA 4MB1A 5A6JA 4TOQA 2O9OA 2BXYA 3SCQA 4Z2LA 4MPKA 2DH2A 1UR0A 4D6GA 1E6PA 4Z2IA 2CETA 3MMUA 1PX4A 3APGA 2WHJA 3DDFA 4P8WA 2WZEA 4N0RA 3UR8A 4JL1A 2DSVA 2WKGA 5HBFA 3HJEA 2WK2A 3WUFA 2VX4A 3SCPA 3DYOA 1NQ6A 4NXSA 3VMPA 2VX7A 1UKOA 2CITA 3TV8A 1FHLA 2X0YA 5AC5A 3WBEA 3IJ8A 4KGJA 3CO4A 1E1FA 3D50A 1R34A 1L0PA 3RPMA 4TUFA 2YDSA 2X2IA 2CKRA 2DIEA 4AMCA 3GNOA 4H8UA 3HZ3A 2VOTA 4OGZA 3BVTA 2ESCA 3T0AA 1M7XA 5GQBA 3VGBA 1WZLA 1EO7A 3HG3A 3T09A 2XVKA 2OWCA 3AHVA 2PC8A 4HZ8A 4LPCA 5I2UA 2FHCA 2YOCA 1N82A 1NP2A 2DDXA 1RP8A 1V0KA 3GTNA 1NOUA 3UG4A 3WDRA 4NZFA 1TZ7A 1CLXA 4UFLA 1SR0A 3GNPA 3T0BA 1V0LA 3K46A 3WQVA 5GPRA 2J7CA 2CIPA 5BYWA 2GK1B 2J77A 4UOJA 3MO4A 5DT7A 2XGIA 4RE4A 2BY1A 3WQ6A 2XG9A 4GKLA 2WMIB 2Y5EA 5JBFA 2WBGA 2WVUA 2A3CA 1R47A 2XUCA 3S2CA 5A8NA 5ABFA 2VCAA 1JZ8A 1JYVA 2FYVA 5LA1A 1BGAA 2WVSA 1D7FA 2QMJA 1K9EA 2WMKA 4IISA 4MAZA 2JIEA 2EAEA 4AD0A 1ZS2A 1U30A 2CYGA 1XSJA 2Y24A 1UR2A 1VBRA 3EJTA 3GXNA 4HMDA 2ZICA 1XH0A 3OIHA 1PBGA 2DGAA 1BYCA 5HOSA 1SMDA 5A6BD 3G6LA 3GXFA 1QI2A 3VM7A 4EE9A 5DT5A 2VJXA 1H11A 1ZBVA 5D8ZA 3FW6A 5FCZA 2HISA 4RL3A 2PBOA 1KXTA 3EMCA 4UQCA 2PB1A 3OGVA 1K9TA 4M80A 2WPGA 3AROA 3N13A 1PPIA 3NIYA 1ZBKA 3WIJA 4RE3A 4ZXOA 1QI0A 1SMAA 2XTKA 2HVMA 3SUWA 1UD2A 1EA9C 2EPLX 1JXJA 4D1IA 1TQVA 1R46A 2Y8KA 3VMOA 1W1TA 1KGWA 4AZ7A 2F7OA 1DWIM 2XJ7A 3W28A 1V6XA 3WQ4A 3VPLA 2ZX7A 2RGMA 4AWEA 3AZTA 3NYDA 5M5DA 2AAAA 5HPOA 3CZLA 1E6RA 5I78A 4WKFA 3RMEA 1Z32X 1JZ5A 3ARTA 3B8SA 1WZAA 3TTYA 3F5JA 5HXMA 2VC9A 4FK9A 4PMUA 2OSWA 3EDKA 4UFMA 2J8FA 1HIZA 4H8VA 3SCNA 3W37A 4B15A 2V5CA 2DT2A 2AOSA 2WAGA 4LYRA 4A3YA 4HTYA 3KLLA 1UUQA 3BUQA 4TVDA 3OLGA 4AYGA 3QOMA 1MWOA 4F9DA 4GZJA 4QP0A 3WN6A 3D51A 1OT2A 3BAWA 1Q6FA 4MDOA 3ARZA 1ZJBA 5A6LA 2VZTA 1AQHA 3CZJA 1R86A 3BAJA 2D23A 5GNZA 4KMQA 2XFRA 4XUYA 4CD5A 1V3LA 1W2VA 3LPOA 4V27A 3PBGA 2E9LA 2YL9A 4H41A 1QWUA 3CZEA 2J79A 4FLOA 1L8NA 5A8QA 2DSUA 2DSWA 4ATDA 4M29A 3KLKA 1FP8A 2ZXBA 5F7UA 2A3BA 5E9AA 3O2LA 4AMWA 2EO7A 1H1NA 3I3DA 3M07A 2J8GA 4DO4A 3D5HA 3OA5A 1WPCA 1VFOA 3AS2A 2WWCA 1VFMA 3A23A 3ECQA 1KXVA 2Y2WA 3OZOA 3IGUA 4J3VA 3TONA 2IXUA 2WLYA 3AMDA 3WF4A 4DM1A 1HP5A 5M3WA 4JKMA 4QAWA 1E5JA 1X6LA 1JGIA 4PMZA 1V3IA 4B9ZA 4E4PA 1ISYA 3CLWA 4DWSA 1IZKA 1VJSA 1E40A 1RD6A 1EH9A 2OYKA 4Q22A 2Z1KA 3WY2A 2YDQA 2NT0A 2X2JA 1WCGA 4E2OA 4HZ6A 3LX9A 5ABHA 2WVVB 4WLCA 6CGTA 3WQ8A 3DECA 1DEDA 3B9AA 4AW7A 3SUVA 1UQYA 3WH5A 1FFRA 3WUEA 4F79A 3L4YA 4PUDA 5E0FA 1JZ4A 1UYQA 5D9PA 2DH3A 1XH2A 4DM2A 3W4RA 3WD3A 1BSIA 4PCTA 1IV8A 1HF6A 3SCWA 4YPJA 1AVAA 3U5YA 3WDIA 1QBAA 4W87A 1UD3A 2W5FA 2ZUVA 1LJYA 5FL0A 1QW9A 2VVSA 5EBAA 4AY1A 5CSUA 5CXPA 3DX1A 5IXEA 2QPUA 1TVPA 3WDQA 5A3HA 4MB4A 3PN8A 3VILA 5LYRA 4QCFA 1VIWA 3CIVA 4H8HA 3O6AA 1M03A 5I0DA 1QOXA 2V5DA 1OM0A 4UFIA 5A8MA 1E56A 5I24A 2CHOA 3EMQA 3UG5A 1ISVA 3ZSSA 3WMCA 3BAKA 2WZHA 1C8XA 2PBGA 3EJUA 2WC3A 4GPNA 3WH9A 3WDPP 1BVZA 3FHQA 1UR1A 2C7FA 4GI6A 1KFWA 3A5VA 4JFSA 4UR9A 2OW7A 3A22A 1V0NA 1FH7A 4M24A 4OOZA 2O9RA 1R7AA 3N17A 2E0PA 1XGZA 2OW6A 1EO5A 1QHZA 8A3HA 1B1YA 1TUXA 2D2OA 1HN1A 1CZ1A 1SZNA 1B3VA 4PUEA 4ZENA 3ZJ8A 5AC4A 1XHGA 2BVTA 5HNNA 4ACZB 3VIHA 1Y7VA 4HU0A 4MTVA 1V3JA 1V6WA 3SUTA 4HA3A 3W27A 2WB5A 4CU6A 3BMVA 1T0OA 1G01A 1HJWA 4CCCA 1GQIA 3CUJA 1B2YA 1HVQA 1UR9A 1WO2A 4CUCA 1QNPA 1VJZA 4PEEA 1JYNA 4J3SA 1NWTA 3WBAA 4E8DA 2OSXA 1JD9A 3D4YA 1NARA 3QGVA 1ZBWA 4CN4A 4JKLA 3DYMA 1EHNA 1CGXA 1OD8A 1E5NA 3MS8A 1E15A 1ESWA 1CXFA 3AXXA 1FH9A 4UNIA 1H41A 4D6JA 2E3ZA 2ZUMA 3PZNA 3WUGA 2ZXDA 3W25A 3AOFA 4MJ4A 1QBBA 5EFDA 2BHYA 3GDBA 4GO9A 3N18A 3AIBA 5D9NA 3W82A 1HKIA 3QR3A 4DUVA 3BH4A 2BVYA 4OZOA 4XZWA 1HJVA 4YHEA 2D1ZA 4AXNA 5I6SA 2UY2A 3AIWA 4P7LA 1JI1A 2ZXAA 4MNJA
chains in the Genus database with same CATH superfamily
2PSNA 3HPLB 5I8CB 3P74A 2W6RA 1KWKA 1C12A 4PRNA 3NJLA 1UWFA 4GP8B 5DFAA 2WD0A 1UPMB 4W5UA 4M3KB 4UF7C 3UZQB 1SEQL 1E70M 2XKNB 3NZHL 4GLRI 4CRPA 2FGLA 1NUFA 4OV6F 1YPFA 1NTDA 1JE6A 4F37K 4Z77B 5GIRB 4LNRB 4B2DD 2QVHA 3D6NA 4JDBA 3DG6A 2Q20A 3MNZB 5AVXB 5B39A 5LQBL 5G4NA 1P6FA 4DZ8B 3JUZA 3FQ2A 1XF1A 3UP6A 3KPSA 4E9RA 3OBKA 4X4YB 1ZZMA 3S8WA 3MACL 4OGYL 1PW3A 3ZGHA 5E5CA 3U2CA 2LR4A 4BSVA 4JQXC 3HGOA 1NDMA 3GINA 4JB9L 2QQ6A 1R5WB 1F3XA 4JM0A 3SJVD 3NO3A 1R5YA 4HHWA 2P28B 1MFBL 5EC1A 5EU7E 3M46A 4YHPA 2XH0A 2X16A 4LEXH 1N7ML 1XBXA 1UKQA 4PJEB 5TTRA 2Q8AH 2IPUG 4YR6B 3EOTL 2EVHA 1I7UB 2JKSA 4BHYA 2WZTA 3VCLA 3S4SG 1L6YA 1JWMA 2FUTA 2J88H 3RILA 3OGSA 4RNRA 1RCXB 4W8LA 1P5UC 5HR6A 1SO3A 1SYVA 3H55A 5EORH 4R34A 4UQDA 1ZLVH 3B6SB 3PJSA 4GX8A 5CCHE 3MNVA 3ALPA 3UW6A 4L1BA 4S1DC 5B7MA 5I1EL 2FT8A 1YDPA 2YXXA 3KYAA 3QHFL 3UCCA 3WKQA 3QJQB 1BZOA 5HMEA 2F7PA 2GSHA 4RZCB 2Y63A 4PJFF 2DMBA 1IUZA 2G9HA 3ARYA 4BFEA 1LE5A 1LK2A 4F0SA 4LSSL 5PCYA 2BWDA 5EBWA 3PJTA 1DQDL 3HIZA 1KLYA 4KO6A 4WQ6A 4GNVA 3ITTA 3K6SB 2E7BA 4OLVL 4MG4A 2R9HC 5A8OA 4Z7WE 2F74A 3UFIA 1QATA 4WX2A 5KEZA 5AB2A 4PL2A 3M0VA 3S3PA 3KL0A 4DEUA 4QXGH 2J88A 3MV8A 1A7NH 3T3ME 2XFFA 3W81A 4HNUA 1HE7A 4RZKA 3LDBB 1OANA 2GUUA 3NFPB 3UGXA 4JFXA 3C5ZD 4IOIA 5HHMB 2PRLA 4F58L 3NZPA 1PY9A 1YYLH 4NENB 5F7YC 2VC2B 3ZOAA 5EDXA 3TWYA 3MV11 4NWUH 2W80C 4ADGA 4RX4A 5BZDA 4DJEC 2GQ3A 4XN8A 1C9WA 1KJVB 5KUKA 5E5MB 5C9XA 3DHDA 4MD0A 3CVCA 5CEXA 1AL8A 4S1RL 2VFGA 2ISVA 4FJZA 2CBIA 1WXZA 2D69A 2PP9A 4ATTA 2OMVB 2CLMA 4H8WH 4KJWC 2OO0A 3DI0A 1IWPA 1AMKA 5HQMA 2PKDA 1KGUA 4W7WA 4G1MB 4M61B 1FLTX 1JZDC 5C55A 5AW5B 1E0UA 4PTUA 3LPGA 4EJ1C 3I9PA 2FYYB 2W9DL 3T8VA 3R8GA 4P7OA 1MUJA 2WWKO 3C2AL 1F6LL 3B05A 1PX8A 3D3VA 3PNUA 1KFAL 1QWGA 4TM9A 4W85A 3F00A 1W1IE 4KUZH 2JLLA 1RMFH 3H0TA 3RMJA 4BQ3A 1ONXA 2NXYB 4HA1A 3SZ8A 3L3GB 3KVDD 3L3HB 1DWAM 1T1YB 5KYNA 3FTUA 2V2TA 3CIAA 2R2CA 2VVNA 3DVNB 3SUSA 3QAZB 2A9AA 2TRYA 3IPEA 1KYUA 3OMIB 1F2QA 3GUWA 4NNXB 1U8CB 5BZAA 2B5IB 4JFFD 2WNZA 2E9JA 2RQEA 3B8IA 1RIVL 1MF2H 3UTTE 1XIJA 5D02A 4ZUTA 4HQQL 4S3FA 2V8LA 1PAZA 3OHXB 3GD6A 4R4FH 2J8UE 3AQXA 1V7NL 3U4KA 4X7TB 2XYLA 3F4NA 3CPGA 2NZ9D 1FWFC 3OXRA 1AJ2A 1KSRA 3WHE0 4WHDA 2BZNA 4PMRA 4WUKL 4IL0A 1CMOA 2WNKA 4ACPA 1FI8C 4P04A 1OGTB 1I1XA 5DRXB 2XDFA 4WWKB 2CD0A 2A9DA 2UY3A 1N59A 2JKJA 4KVPA 3C6LD 4CSZA 3OODA 3CZKA 1S8DB 1RUSA 1NBZA 5EF3A 1MJUL 3U7AA 3IJQA 4LIQH 4Q7IA 5AVTB 4FEMA 4PODA 3WIIL 3WU1A 1D7KA 3L2MA 3OJDA 4JTEA 3GIQA 1U4EA 4I9WD 4OZIB 3LMJL 1BXNA 2B08A 1F3DJ 3PWNA 1AR1C 5CU9A 2AK4B 3WBWA 1UH3A 4TR9A 2X88A 4PRPA 1ODZA 2AJXL 5EULV 3P30L 3ISRA 1UFGA 1FQ9C 3BG5A 1QK2A 3I50L 4A29A 1ZGLM 3VXMD 4KU1A 2E6YA 4JRXD 9RUBA 4X0KB 2AJUL 2GTZA 7CGTA 1N12A 3OR6B 3GKZA 2HKHH 3A6CL 4ZFCA 3ARBA 1X5JA 5BOPA 1U0QA 2HRHA 5HJLA 3TYAA 1QNRA 4B3EA 4ROPA 3TURA 1BPLB 3TNMB 3AXHA 5EGRA 3BFQG 1DBKH 2ZTKA 2DLEA 2Y69B 1OD0A 1A3ZA 3QIBD 5C9ZA 1IXNA 4P23C 1FWCC 5HWJA 4ZUWB 2IKIA 3AMLA 4MTMA 4YE4L 4R90L 4YDLC 2DMGA 1YY8A 4Y4FC 5CSZA 2UZXB 1KN4H 3NM3A 5HYFA 5KN5A 1H7RA 4BQ5A 2VDMH 4LPYA 1GVIA 5F44A 4S1QH 1GOGA 2ZWSA 4NEHB 1F3JB 5DD5L 3MRGA 4XVUC 5C0BA 1J8HD 1QNIA 5F93C 1UA3A 1T89A 4JQ3A 3ULUL 1TEGA 3LMZA 5GGSY 2GUYA 1CE1L 5CZXC 3VDAA 5D9MA 4P3CH 1TQCB 4HBQA 2RKXA 3C60D 1A5MC 4RBPK 1JUEA 4ZSTA 2WYTA 4EO5A 2UZYA 4LLDA 2ZWLT 4OLXH 1UA7A 2BPBA 2ADFH 1FN4B 4I2XA 3FZUD 3RB5A 1B4EA 1DQUA 1X1NA 5ID1B 5CJQH 3IEBA 4UAOC 1AZ2A 5D7IA 1AXTH 1AGEB 5H8DA 1TJHL 3BOVA 2GGIA 4Y2OA 3PWLB 1T6MA 5HNTA 1J0KA 4H1LG 1XYFA 2P5WE 1Z3NA 4C6QA 3NGFA 5HBBA 1IC0A 3NQ8A 3UABA 5I26A 1D2OA 3E6FB 3PPSA 3N4FA 4LAJH 3PF2A 2ATAA 1T3FB 3CC5B 2XN9D 1EO8H 2E27H 1QR4A 4PREA 2HROA 4LNVA 4HAKA 1MPAL 4WRHA 5IFHH 4AY8A 1KCUL 4HWEL 2XZCL 3BPNC 3ZYOA 2PYEB 3AALA 1LD9A 3GGWA 3TLRA 1I1RA 1TQWA 4BK8A 3WLKX 4EI5C 2YXGA 2DT0A 5T5NG 2HRPL 1E5ZA 2X53A 1TVNA 1CIUA 3IIZA 4H44C 4J1UB 4JRYD 5ESVA 3IXTB 3HNVL 4YXLL 3KR3H 3UMTA 1A14L 1B0RA 4XK2A 3GH4A 4XI5D 2DEYX 5FOOA 2DJXA 3TJXA 1XH3A 4K2UH 3ARUA 4C6FA 5CCJA 3MR9A 3NQDA 3EFFA 4LAQH 2XWRA 3IKCA 3D85D 3MV9A 2WVTA 3QDGD 1KCXA 5DT1H 2W63A 2EJAA 4B60A 2RH9A 1U6AL 4L8BB 3QE5A 4OZGB 5F6IC 2QAFA 1QRNE 1CBJA 4O1CA 2FDMA 3TYGH 4ML9A 4JO1L 4JYFA 3NQVA 2YXMA 3HBZA 1LDSA 1TTQA 4IICA 4OE7A 1G1KA 2WWKT 4L3AA 3OJVC 3VD3A 2ZXGA 2YJQA 4QRUB 4A04A 3DHFA 3F2DA 5HWNA 5H4YA 4L8CB 2AJSH 1E2ZA 1G7JA 2NR6D 4XVTH 1A7RH 3MI6A 1VACB 3ZE2E 1N6VA 5GGTH 5C2GA 4FMVA 5C3TA 3PBUA 5KVGE 4OLEA 3SDXA 2MRYA 4KJYB 3OB0H 4HZMA 2CJUH 2IPJA 1JNHB 2A4AA 1ZLPA 4TOYL 1U8HB 3GHEL 3OZPA 1OGSA 2YAFA 3V6OE 3UBXG 4J3XA 1FO0L 1YEFL 2CPUA 4W4QA 3H9SA 3C8HA 4XVOA 5CU5A 4X6CA 3GRWA 3FHAA 2PP1A 3LOTA 1W5NA 3X13B 5D5MA 4H8WC 1QUNA 5LXXA 3H2PA 1LLAA 1HHKA 4MNGE 3D06A 5T1KD 2XVPA 1TKWB 2CLLA 1TREA 5MHBA 3I4EA 4UIMA 3UYPA 2P5PA 3KE0A 1A6UH 4LAMA 1GEQA 1Q0XH 1MNSA 4U1HA 2OZNA 2E9MA 2R1WB 1ZQ5A 2XVLA 5BRPA 4MIMA 4W81A 5GGVH 4YEFA 1EUAA 3MUAA 4HNOA 1JFQH 1EDGA 1H6TA 2VZVA 4NOFA 1TPVA 8FABA 3FQ1A 1BZ8A 3JSSA 3R0KA 2D2GA 1INEH 1KPVB 3DV4A 5DRNA 2WWMC 1L0QA 4I6KA 2BZ7A 4OF8A 3STLB 3L0NA 5IFPA 2UXVA 5GGTA 1VHNA 1EWEA 3EZ8A 2QQKL 3CXDH 3DYPA 3S4SB 5C0NC 5AZ1A 2NW0A 2X4UA 2Q7YA 4W86A 2Q76B 4HQVA 3TFBA 3OO2A 2WV3A 4W9TA 3RGVD 4XNMA 3SCMD 4GS7B 4F20A 4RRPA 4BUGA 4APQC 3MUCA 3FA4A 4M51A 3NJ3A 1AKPA 2VUOA 1NICA 4DKFL 3QSTA 3MZTA 3NP3A 2GJJA 5CZSA 4RAHA 3LKQB 5IW1A 2W0PA 1T41A 1KA9F 2FLMA 3ARBC 3DHPA 2Y89A 4GMTH 4QHMA 4IM4A 3ETBJ 3DFNA 1VYSX 2GOKA 2J75A 3QCUL 5J5DA 5BW6A 3IM1A 5FL1A 2Q8LA 2HPOA 2L04A 3HW7A 4PG9A 1UPPA 4XKYB 4LTSA 1V6YA 3V79C 4WHBA 2FBOJ 3H53A 3N9SA 1FNLA 3URAA 1CT5A 5EA0L 1NCDL 5KYWA 2H8PA 2NW3A 1TZOA 1UR0A 5FOJA 2TSAA 1Q63A 4MM1A 3IDJB 2WZEA 2DSVA 1B3IA 2WKGA 3E2HB 1BQHG 1A80A 3UYRH 2NY3B 4JY9A 2GJNA 5SX5K 2VDOB 4OCWH 4EDWH 2OODA 1JGMA 1NMCC 2X6BA 3OZYA 4QIRA 1SJAA 3HN5A 3FRPG 4PS8A 1JK8A 3L5XL 1JV2B 1QEWB 1E5BA 2FJSA 3N91A 4UTLA 5AVRB 4WKXA 4TQEH 2YOCA 1KRCC 4U7KA 1MUWA 3M7OA 3LG3A 2ATMA 2LQRA 3K7UA 5AZUA 3T0BA 2BIIA 1HI6A 2PPCA 1R5IB 4N68A 4Y2DA 3RWFB 4NM4H 1PZUB 3AREB 2B4CH 3HUJE 1DQIA 4WO4D 4IMFA 1N2RA 3QORC 2G0KA 2FTPA 1FRGL 3IFPA 1BGAA 3ZUNC 2JIEA 1ZS2A 1VCFA 1I1YB 1ZLWK 3UFYA 1A5CA 2J2ZA 3OIHA 1CLZL 5DFTA 1F3DH 1IE4A 5JOFB 3N13A 3PGDA 2BVQA 1QRQA 3V55A 2J1WA 3HR5A 2YJLA 2NV2A 1PB0A 3S8HA 4FQLH 4MX7B 1JZJA 2C3VA 1M3JA 5GXBB 4NC1C 4EBQH 1QPPA 3USBA 1DVUA 3BJFA 4JO3L 1KBVA 5BS0B 3F7LA 4KZDH 5HDBF 1CURA 2VR6A 2DT2A 2CUHA 5ANMA 1KPRA 4MNQE 3DO7B 3IAGC 5DC4B 3SGGA 1NAKL 1ZJBA 5IVXE 1J5OL 3W1UA 2R69H 3R8HA 4XNQB 3L9EA 4EN2A 4RPPA 5DY3A 4DEFA 4W9IC 4RZ6A 4DGYL 4JM2F 1WDDA 2BC4A 4NZ4A 4GSUA 5PTDA 3SDYL 2V9QA 4JYDA 3IGKA 1BQLL 1JWSB 4KI1A 4KX9A 4B90A 3M07A 1MCPH 3IMUA 1VFMA 1CFTA 3G9AB 3M64A 4TQPA 1X7TA 1TPXC 3B9KD 4DM1A 1UVQB 1YECH 1JGIA 2ZD0A 1XCFA 1ZA3B 3EJZC 1IC4H 2VLLB 2Y2TA 1O5QA 1OCWL 4B6ZA 1NGQL 2QKFA 3RUGB 3P82A 1MUMA 1H7OA 1TNMA 1DEDA 1FPTH 2Z64C 4AKOA 1JZ4A 2AQOA 4DZBA 5F70A 1F6PA 1BAWA 3UBGA 3U5YA 4PJIA 5HD8C 1OCRB 3G5WA 3MCKA 3ZE2F 3P2DA 1HHIA 3F64A 2EDQA 2EKCA 5A3HA 2R69A 1H7NA 4Q6JA 3KBSA 4FPSA 4ETQA 2HLEB 3W9DA 3B8VA 4UFIA 5D7KD 4MAUH 2VGLM 3T4AC 2YD2A 4M7ZB 3ABZA 4M8QA 2H7WA 1AZCA 4K8GA 1X5GA 3HHRB 3D30A 1EBAA 4KFMA 5I00A 2OOFA 2X70B 4J4PA 3AWFA 4FL4B 2FX7L 3FB8A 4AG0A 4D3CH 4OQ1A 5F9JB 5EB9A 1RJYB 3KS5A 4L0PB 1HYSC 3WJZA 3G04B 4GIYA 1VCGA 3PGCA 1T0OA 4Q4IA 2IANE 2YQ3A 4MSWB 3TO2A 4PLKD 5E5UB 3RWHB 3WTTA 4TVPL 2PWUA 4XHJC 4JKLA 4G9FB 2QJIA 1CGXA 1SQ2N 1MEXH 1OD8A 3PWUA 1E15A 3L23A 3GG0A 1GYNA 4L9DA 1FH9A 4B5WA 2E3ZA 3QDME 2X44D 3BW3A 3NJNA 5F0JB 4H1ZA 5EDSA 4TUUA 4ES9A 2ITDB 3DGCR 3KJ6L 1KCZA 3QUKA 5HVHB 1AQ8A 4XZWA 3ZN6A 1NAMH 1MJ8H 2H1PL 3VI2A 1OAKH 4U4IA 1A6PA 1UB5B 1CGVA 3UXDA 1ACYH 4H9VA 2P5WD 1WGVA 1MIEH 5E2VL 4F37F 5FEPA 1HWHB 1TVDA 1FL6B 3B0PA 1E6OL 4H4NA 4PMJA 5IVZB 3RWIB 3LRHA 4ENED 4MF4A 5GZNA 5BNKA 5B7YA 4H1LB 4XNAA 5FF6B 4H9YA 2DTML 3U0TB 2DQEH 4BCYA 4BFBD 3Q2DA 2IAMD 3M8OH 5D2LB 2W91A 3O7UA 3ARDB 3LQMA 1OTTC 4OJFH 5CBAB 4UM9A 3TZVD 1A5OC 3JTTB 1BXBA 4M3JA 1QRKA 3I6GA 4MGGA 1LLZA 1E3ZA 4JM2D 4JHAH 1U8KA 3LH2H 6FABH 3G9VA 4N0CC 1AHWB 1QO5A 3T8LA 1MQQA 1HCFX 2X6VA 1NGXB 1T1ZA 5E0CA 7FABL 1FNSL 1OFQA 2CZFA 3SDAD 5DGQA 3C3UA 2ZQKA 2ZZ1A 3HHSB 3L4XA 1NAMA 5IREA 3ZBMA 2CWNA 4KNUA 2PLJA 4N0UA 2EXWC 4TULH 4X5WB 1OXYA 5JIMA 1NDYA 1KEMH 3FIGA 4L8SB 1VF5C 4Y2DC 2QQLL 4GYKA 2AKZA 1QRND 4UZUA 1ZTXH 4U3CA 3KPPB 2V9UA 2EICA 2Z0UA 3DOSB 3TX9A 3S2AA 2EC9T 3SKOA 1M9SA 3FDWA 3GMMB 2P24A 4OLWL 3NG3A 3LRKA 1KNOA 3W1MA 4GXVL 4PW9A 1JGUL 4F48A 4UOQA 1VS1A 3TXAA 5DUBB 1C1EH 4UTFA 5C71A 4J5NA 1QLEH 2Y61A 5MEOB 3LHPL 3PDGA 2JLPA 2C9VA 3HG4A 4RE2A 1CXEA 4ODTH 3W2JA 3ULUE 1X38A 4JFZL 2IFFH 1FAIL 5BXSA 5H91A 3DSFL 4ZBJA 4OZHF 2PETA 4HMEA 3MCG1 4BK4A 4GUOA 5CINH 4POZC 3S47A 2Y8UA 3HUJF 2VDNH 4NQEA 2MHAA 4QRRE 4JANA 1VH7A 1UA6H 3PV6A 3UTQB 4IGSA 3UBXB 4OH2A 5IB3B 4DN4L 4QYOB 1ZK9A 3UGUA 4I0KA 1GOWA 2JF7A 3WHE1 1VFAB 1TENA 3KYOA 3DX7A 4V1DA 2B4CC 3BSZH 3ZIZA 1BD2A 2Y1YA 1ZCCA 4OFCA 4RAVA 1XISA 3AWEA 4F8QA 3GAYA 5IQ9A 2PO6D 2J7LA 5CGYD 4LP4A 3ITLA 1P84J 2Y7LA 1XB6A 1VYPX 4ALAL 3QG6A 3N42F 3NPVA 3I9GL 3WZ0E 3FMGL 3AQDA 3W7HA 2ADGA 4MNHA 4HIXH 3ZJ7A 3BK0A 3TU9A 1G6RB 4JIEA 5LJYH 3L5LA 2E8YA 4R88A 4PJ8A 3KZPA 3C87A 5K9QI 1NOLA 4W9KC 3G18A 5CLZA 4EOWL 2BRQA 3V4PL 1TCRA 2QSTA 4X8XA 5KW9L 4PUKA 2K9UA 1U33A 1E6XM 1YEKH 2VL5B 3C2EA 4NNYA 2Z7ZA 3WL1A 2CR6A 5DRWB 4G7QB 1NGPL 4WU5A 1SZFA 3EADA 4G6FD 1NMAH 4QDWA 4DP0X 1S5HA 3ARFB 2WZ6A 3I02B 4GO6B 3VOCA 3U83A 2KLSA 3JUYA 1A1MA 2PR4L 4XC3H 3FT9A 4AF0B 2UZIL 1KLFB 3DX9A 5FSDC 1XYBA 1ACXA 2J62A 1M71A 2QPSA 4Z0BL 1QABA 3CG8A 1H2JA 4Z2KA 3QXDA 1S7VB 5FOBB 1NQBA 4WKZA 4J4PC 1JGVH 4C56A 1IRAY 2NY2D 4QM1A 2OJPA 1ZLUH 2Y07H 5EKYA 2Q0ZX 5C09E 2EGZA 3NQAA 2GGEA 2V5SA 5T26A 1AACA 1UQSB 3KCLA 5TE6L 1U8PB 3HNSH 1T4KB 2VJ0A 4XPFH 3NTYA 1Q90A 2OXGB 3LEXA 4C6CA 4LSUL 4XZIA 4OFPA 5E8NA 3QIWA 1KXTB 5KAQF 3E0VA 1RHHA 2YLHA 3HZMB 3SBWA 1SOXA 3KVKA 1MZRA 2OJZL 2E40A 3E2VA 2FQEA 3OKNA 1AO7E 1MNUL 3WEBA 3S83A 5EU6B 1R38A 4LQFL 3LTPA 5LHEA 3B0UX 5SWSA 4Y89A 3NSCA 4J1OA 3R18A 4KRZA 1W56A 1B4TA 4MNMA 3FRPB 3T0WA 2NY1C 3AS1A 3VSVA 1JPFB 4DT2A 4L9LC 3GRBA 5BZWA 1M2OA 1F2JA 4G59C 4LCUB 3BLFA 4LAKA 3FRUB 4NT6A 2NX5E 5IUSA 2IWEA 4GW1A 4XWOC 5DHXB 3MJ9H 3GHPA 3SE3A 3EJRA 3ESPA 1H63A 4XZUA 3FU0A 4W7UA 4UB0H 2IEPA 4HWBH 5DQJA 1OB1A 3ANYA 3F7YB 3IVKB 2XBDA 1TTJA 4KDWA 2CFFA 1ZENA 4X80L 1AFVH 1A4KB 3ZFHA 2PA6A 4ZS7L 3MNMA 5IW3A 4GRLB 1CECA 3K1GA 4F2UA 5CILH 4ZMLA 4D94A 3PABA 1S7TB 3K5SA 2HTLD 3RDTA 2BVOB 3UEQA 1YN6A 3CT7A 1FWAC 1ORSA 4YWGL 2DV0A 4NQCA 5C7XL 4FS9A 2VL4A 5DHDA 1U21A 3OWRA 1BXCA 1TMHA 1M3UA 3KPRE 2XRAH 1LHZA 3HPXA 4B5VA 3UTZB 3BFWA 4QROA 5KSUB 3S88L 3ZS4A 1TWWA 1FA2A 2EO1A 5C97A 4MCYA 4N2GA 1J9YA 3HC3L 4XP9L 1U8JA 2HNEA 3HKFA 5IM7B 1TQUA 2B2XH 2V5RA 3IDNB 4D6FA 1PSKL 5CKGA 3MJ9A 1BVWA 1W9UA 4Z3IA 4OOUA 5AVWB 1SLXA 4Q32A 4HDIA 1YXDA 1FL5A 4HWBA 5I79A 1WIPA 2Z65C 2VEIA 4OVXA 1IE7C 5GJTH 4MKNA 3VDHA 1MH5B 2GJPA 2X4QB 4LU0A 2BSED 3I3BA 4ZI8A 2LU7A 2R8WA 4ERAA 4FXKA 1NEYA 1C29A 2IDFA 4B9IA 4JTHA 2ZX6A 5J1TC 2C1GA 4C8XA 4QTFA 5F7WC 3X12A 3BWSA 3LXCA 3V9CA 1ORQA 1QKZH 4NO2B 4PRWA 2ZP8A 1UJ3B 4GG6A 1TNNA 4G80A 4ECNA 3EGDB 2FLIA 4M6NL 1XYLA 3Q45A 3IIVA 4HEPG 1DJQA 1DVJA 5IB1A 1EF2A 1J88A 4R26L 5C6PB 1XLGA 3GFZA 3NAAH 4R7LA 4ODUA 4AUUA 3MRIB 3OC8A 3TIDB 1BQRA 2FHFA 3VFWB 1S7SA 2BS71 2KZWA 3PP3K 4MDIB 4U3SB 1IHIA 1KENL 2FRGP 1IKNA 4DUWA 2OMWB 3VFRA 1TG7A 1RZJH 4GOSA 3W0WE 4UI2A 1S1RA 2Z0BA 2CNCA 4A7SA 4OI9A 3RR1A 3AYVA 1UR8A 5CP3A 4HK3J 3E0GA 1YEGH 3WO8A 1N5AA 5FIEA 1YY9C 3DUUA 2XZ9A 4Q9CA 4IKLA 5I9QC 2ZCKH 5FEBA 1FCBA 2VO8A 5T1DL 2XA8H 3FN0H 4OJYA 1UG6A 2O5ZH 1ETZA 1PJ9A 5EBLA 5FD0A 2XGZA 1ECEA 1QR1A 3REWB 2IAND 1OAZH 3P0XA 4YJ5A 4DPBX 4MCZB 5CIPH 1AJ0A 3U4EA 3UETA 1J05B 3FQUA 5DS1A 3DMMB 2EUVA 2XFGB 1I1CA 1Y0LB 1ZCRA 4IOTA 1YEEH 1BMGA 2FD6H 2LW3A 2NY5H 3QDMD 5A2KH 4UM8B 2QGDA 2RTTA 4A39A 3SCTA 1UZGA 2IDQA 4MJIB 2ODHA 3TN3A 4PB0L 1A6WH 2JH2A 3TASA 1AOHA 5CJOH 1EGMA 3D0VA 3FTZA 3JW7A 2P43B 1HKMA 3HG0A 2Z1WA 3RO6A 4MWFB 5I76A 5IBXC 4KXAA 4OZ4B 4TN9A 4UBDC 2EYTB 2OJEB 1ZT4B 2JXMA 1QFUL 4A2DA 3BSGA 4RISL 3V5HA 4AD2A 1SZRA 4XPHH 4ZQKA 4MD4A 5L0QC 2JGQA 1V3HA 4R3SB 1JZ7A 1CENA 4ZX5A 1RJLB 4GW4A 3WAJA 4A2LA 3UWYA 1GPOL 5KVGL 3GU1A 4KQ3H 5I1GL 2CUMA 4QSFA 3QPEA 2CGZA 4N4QA 3HN8A 3F4VA 3BGMA 5HGDA 1H09A 3FB6A 4JFEE 4ORGA 3WQWA 4KH2A 3B0YA 1NUGA 1KEGH 1ZU8A 3QIWC 1UXWA 4WZHA 2JKPA 1MZYA 4O12A 4F7MA 1FWGC 3T1FA 5CIPA 3W07A 1T6WA 2OSLB 5HHPA 3SBWC 4OCYH 4D2JA 5B7FA 4DLMA 4KRMB 4Y9FA 2BRRH 5EF1A 1JZ2A 4BQ8A 4F7CA 2P46B 3LKNA 4CGTA 1DANU 1OX6A 1DL3A 1I8UA 4W93A 1MLBA 3VRJA 2NXZC 4R5XA 4B95C 1KGCE 2QVMA 3CSTA 3M17B 2DQUH 1TX0A 1EJSC 3VXRD 3NESA 3B2VH 2Y7EA 2FH6A 4KZEL 2IPTH 4KHTL 2QJJA 1OF8A 4Q9QL 1Z9NA 5DN1A 3TMQA 3BQUA 2MNJB 1NDGA 3W7DA 2DKMA 1A0DA 2VITA 2A77H 1H7WA 4XN1A 4DNLA 3P2VA 1NGWB 1RP9A 4PJAF 4AVFA 4HUMB 4L4JA 5FYJL 3ENLA 4US5D 1N67A 3GDCA 5KS9F 3RDTC 1UCWA 5C70A 5EZOH 5HI5C 4PRIA 1AD9A 4UDTB 4TVPE 4HGXA 2DYPD 2P4AB 4A8RA 3EWCA 3DBSA 3PPHA 1OO2A 1U93B 1LO5A 5D72H 3GS4A 3I74A 2VGFA 1L3WA 5JORB 4HPHA 2BP0B 3ESUF 4QRRD 5FFOA 1IIHA 2RJHA 1X5HA 1BBDH 3WEXB 3TFKD 2FMNA 5IHUL 4W9CC 3P11H 4LGXA 3J07A 2N59A 1Q45A 3CHFA 4FG0A 4WY0A 5ACLA 1FF5A 3MV7D 3WIAA 1QVBA 2G96A 1U83A 35C8H 2ZSVB 3U7YL 5J89A 3HNTH 4GAAA 4I3SL 1QPOA 1OARL 4X2RA 2LE9A 3EOYG 3C8KB 1Q6GA 5G4OA 3CMJA 4RDYA 2H1XA 2OKMA 2FH8A 3O6LL 4NL1A 1JGEB 1ZLEA 3MLZH 4HB7A 2VXUL 4YVPA 1W1VA 3BZEB 4U1SB 3UEZA 2MOVA 3T07A 4L3EB 1BG4A 4TUJA 2EIDA 3N2OA 5A6JA 1Q9KB 5BVJB 4MPKA 2JI3A 2HDJA 3R5EA 1GGOA 1L9TA 4PM1A 3QP3A 4X99A 3CQPA 4A2HA 5I6KA 5EA9A 1T0NA 2QCNA 4WHCA 1KOAA 3DYOA 1ICPA 1NQ6A 4KF1A 2V30A 4WDUA 3T42A 5BOFA 3P0WA 4H19A 1R3IH 3FU8A 2J55A 1FNGB 2GVJA 1WKDA 4LCWD 1G7VA 1BBJB 3RRAA 2Y6SC 2X2GA 3RZCD 1WH0A 3IIXA 3L68A 4FQ2L 2VHLA 1ZD6A 4ZX3A 3BE1L 3FUEA 1NOUA 4ZNCD 2OMTB 2CKBB 3ZKSD 1OAYH 1JHLL 5AVYB 3TCXA 2CIPA 2EDBA 4UOJA 3MO4A 4OLYL 5SV3A 1DUZA 3DRTB 5LGJA 1OP9A 4YXHL 5BRBA 3VI3F 3VXQB 4NUJB 5DSCA 5CO1A 1JYVA 4L0YA 5TQ2H 4B0MM 2Y2YA 2NUWA 5HYQB 3GSWA 1A9EB 1VBRA 5T5FH 1BYCA 1QI2A 1H11A 3KLHC 2IH1A 2FL5A 1ZVSB 3C0SA 4R33A 3WK1A 3W1LA 3GVGA 3V1PA 1T2JA 3OVUB 3KCOA 2IKJA 3GUGA 1ND0B 2ZKHH 4JKPH 4HHPA 1T0PB 2IS7A 3SUWA 2GDQA 2WTPA 3F7JA 1EJTC 3ISIX 4PJCA 4M4RA 4FYTA 2PN5A 4QT5A 2DP3A 3X1FA 2HS8A 4MJJA 5M5DA 5BW7A 2E7DA 3CZLA 5I78A 1XVSA 3V4UH 4ZMWA 5CWSB 1QFWL 2WLIA 4OT1H 4YHKH 2I9TA 1K8DA 3ESNA 2OL3L 3EDKA 2YSSA 1G0DA 3PREA 2AOSA 3WGVB 1RZJC 3GRGA 1EZUA 1MWAH 3S9IA 4R7NB 1QVOA 4ILSA 4LPTA 2NX5D 4MDOA 4IPPA 4KUCF 2JB6A 3VXSD 1KG0A 1ZS8B 2EDXA 1W2VA 3PBGA 4Q4RA 4H41A 3A9BA 3NFNA 2OB3A 3U9UB 2K7PA 2ZAIA 3EHBD 5TPWH 4H5SA 5T5FA 5CBJA 4J2QA 3KLKA 1DEEA 1ZV2A 1XXXA 3S3CB 3ZDXE 3OA5A 2Y7GA 4UIKH 4OV5A 4LHUB 4JICA 3VG0H 2TSBA 1Z9PA 4JKMA 1J1XH 4IRZA 3P77A 2C3ZA 3PAYA 5GZOC 1E40A 3JZEA 1G1CA 1RD6A 2PDCA 2NY5C 4YSPA 3NGJA 3DROA 2DZXA 3WY2A 1J8KA 3SPVB 3FQNB 1BECA 2CIIA 3QDJD 3R58A 2DZAA 3O6FA 3ERXA 1KIPA 3SCWA 3QG7H 3NFSL 1QBAA 4KEVA 2CNZA 5J8LA 4IRSD 3ZL1A 1MWAA 3ZK0A 1E4XH 3DFPA 5EBAA 1E1CB 1CFQA 4HUWB 4LLMA 4GRWB 1LYQA 3V0EA 3HE6A 3CEPA 1T96A 4YL2A 1UGKA 1VESA 1M03A 1QOXA 2P8PA 2HXTA 4CJ1A 3F84A 4XX1E 2HTMA 3NCCB 4IHOA 3LV3B 4ICXA 3WDPP 5EU5B 3E2SA 4QR6A 2PLKA 5FYJU 3A5VA 5ILTH 1V0NA 1FH7A 3UADA 3INUL 2AV1A 2OW6A 5IEKA 3LB0A 4F7EA 1IBGH 4O14A 3L54A 3NABH 3CASA 3W27A 2YRBA 4LDCA 4IT1A 1KFBA 1B2YA 4CMHB 5LSMA 4KJPD 3IBOA 2C1OA 4K23L 3VFCA 1TIUA 3W1RA 4YJZL 1DDTA 4YFEA 2DV6A 1RHCA 1IGFH 2C16A 3BYYA 3O4LB 3ILPB 4MJ4A 1AXSA 1R6VA 4YU1A 1P53A 2BNUB 2GC7C 3N18A 4EIUA 2BVYA 4HNCA 4HEMA 3SFKA 2V17H 5I3JA 2A73A 1FKWA 3NG5A 3X3GL 3I6SA 4MAYB 5DLCA 1OF0A 1RD5A 4LARL 5JOPE 2NPLX 3D0LA 3W0WD 3KTXA 3E80A 3JT2A 2BSLA 2NUXA 2WWDA 3FV9A 2Q6WA 4MJ5B 4O11A 2XTJE 4C4BA 3I9IA 5EN2B 3D0AA 3IPBA 1X8CA 2C4FT 3MXVL 2XY2A 3UTSA 3R6IA 4GUHA 5JHDA 4XP4L 1K3ZA 2CLEA 2EIJB 1LP9B 4JQAA 1YPZE 5GS0L 5CAKA 3HPJB 1RK1B 1NOWA 1G7LB 3J27A 4GVIA 5JQ6L 5T9BG 4BFKA 4KUCD 5I28A 3E6HB 2GJLA 3FSVA 2QIIA 4EI6B 4BCXA 1A7PH 3V0TA 1HDMB 1XYZA 5J12C 1F4XH 2FATH 2OGYA 1MI5A 2VEKA 2PGRA 3NDZA 3DETD 4WFFE 4N5ED 3EFDH 3L12A 3NCEB 1FFOA 1U42A 4KCTA 1E42A 4HIQA 4JY6B 1WAWA 3L4WA 3QQ3B 1VB9A 5FFGA 4F2EA 1FGNL 3TO4D 2Y85A 3G6JE 5FK9B 3UZXA 3W86A 1F11A 5D4YA 4N2NA 3AC0A 1HHJB 1FUYA 3IS0X 4N85A 1K8IA 2ZADA 2IQ0A 2VWEC 1UD6A 2B7OA 1X7SA 1MW3A 3WAKA 3K2MC 3SPHA 4UQBA 3VFVA 3VYPA 1PLAA 1E7UA 3ZE0B 5K9OB 2E7HA 1UM4H 4DF1A 3DRQB 3PK7A 2EYRB 1ZTMA 1E2WA 3HI6L 4YS4A 3HFYA 5BOZG 1KV3A 2RBLA 4CNUA 2VD9A 3IJDA 3QBUA 1P2CA 2C3GA 3MLRL 3CFBB 4HKXA 2XM2A 1Q6CA 1IL1B 2A7PA 3O41A 5BVPL 5D9OA 1G4PA 2WC7A 3FQRA 4GKSA 1S9KC 5L7XL 4OJAA 5C8BB 3VJ6A 5JHLL 1KYAA 5BW7C 3EX3A 4OUIA 4XP5L 4R5VA 2JK5B 4WCJA 4JM4H 4NN6B 1K7EA 4E8GA 3OKEA 3EW3B 3OU8A 1C9DA 1XCQB 1TMCB 5F7MC 1KGCD 1T21A 5A69A 1U3YA 4AD1A 4B41A 5E0QA 3D4GA 4GUCA 4QGYA 1CF8H 1EJUC 1D3GA 2ABAA 4I77H 1JXFA 5JMUA 3L4ZA 4XE0A 4D8PA 1W8SA 4FN0A 1HKKA 2O7QA 2X2YA 2C9UA 2MTPA 1O7DE 3QZLA 1ZHKA 3KPNA 1GAFL 3MRFA 4TLSA 3SY8A 2AEQH 4XX6A 1JPEA 2IBZY 1E4IA 5A2JH 1JRCA 3HHMA 3FTXA 3G6MA 1KB3A 4XNUH 5EOTA 4N4YB 4Z7WF 5GGQH 3T2LA 1NIDA 6PAZA 2O5XL 1FC2D 1XGUA 4Q8TA 3SN4A 2FWSA 3CSBA 4O2CA 2BVPA 1JG9A 1I8MB 1KFGA 4NO0A 4GMSH 1OD7A 3SSJA 3ZQWA 2ATPB 3KS0J 1TO4A 3GRWH 3T3MF 2E3VA 4XTRC 2PPDA 3SY0B 3VW3H 2C1HA 4PJDA 1QNVA 3K8LA 5G2WA 3FCSB 2EDTA 3PZQA 5C0DA 3W2DL 1OQXA 2RUSA 1AG1O 3O6FC 4QCIA 4X83A 1YEJL 4DX3A 1NUDA 1YNTA 2XGBA 3E0FA 4QHNB 2YEZB 1WA3A 4BH8B 3FT2A 2Z6FA 4LLUB 3U4BH 3APFA 4K5LA 1WUFA 4KC3B 4ODHH 3ZDXF 2NTSP 3WFCL 2R15A 2IGFH 3HE6C 3STGA 3HG1A 1WAAE 2VR4A 4L1GA 4ZMAT 1NA8A 3RJDA 5ISZE 1GPFA 2W92A 3DX0A 1RY7B 3EGXB 5EY5A 2AF2A 1NLBL 3EYVA 4DPPA 1TFVA 2DEXX 2MPVA 4FF9A 3RVTD 4QRTA 5IMKB 3U4AA 4GUQA 4J3OG 2R1YB 3OQ8A 4ZZ9A 2XICA 3UPMA 3FQXA 4AZCA 3MRDA 3BPWA 1HAWA 4M7JH 1TV8A 3ZVIA 5JNYA 4L4TE 1KIUB 3L4VA 4LZKA 4BRVA 4KMLB 1W5OA 2QL1A 4IU2B 4PZVA 3AS3A 4F3FA 2BWGA 2ZPKH 2XG5A 3OMAB 3VI4A 2P0IA 3A24A 4CADB 5I2IB 5BXFB 4MASA 4XV0A 1WVZA 5TFSH 2OMXB 4BI7A 4QPEA 3T0EA 4A67A 1U95B 3QZEA 1BTMA 4GCAA 4IFOA 4HPOL 5FPIA 1RURH 4JG1L 1OGBA 1GGBL 5FDWB 4ODSL 3FO2A 3QUHA 4XWGL 1O7SA 5H2ZA 1DCLA 4Y1TA 1MO0A 2P48B 1P0BA 2UXGA 3W2LA 4B92A 4FFWC 3MPCA 4KK5C 5AYYA 3U0PB 2CUAA 3QJHA 1JGLL 4XMZA 1W3TA 4M6MH 3H2EA 2JB5L 3CCHA 3LS5L 3UJJL 3BWAA 5I1LA 3GJFA 4D72A 2QTEA 3ZTJH 4LEEA 2J8UF 4OIAA 5AAPA 5IV2B 3WHXA 1O1HA 1TR1A 4WVRA 2P1YA 1MHEA 5FYJE 4U7SA 1MI3A 5AVZB 1HEZA 4MKSA 1M1SA 3MRJB 4O50A 3I2CL 4FC3E 2BDQA 2Z9TA 4BIKA 4RETB 1N9PA 5LIXX 4DB7A 4ZFGL 1E27A 2VDPH 3D69A 4MA1C 2KLTA 4Z8FH 1FL3B 2HA1A 3N11A 4G8AC 3CFQA 3DX4A 1TA3A 1S5IH 4QE1A 1TV7A 2PCYA 4JX6A 5I77A 4P4RA 2BP5M 2FPYA 4I5RA 2WIIB 1XF2B 4UQ3B 1TZAA 1GKRA 1QLFB 2R1XB 2BSRB 5HHOE 3A3WA 1AGBB 2P5EB 5EEYA 1O5KA 1YPZF 1H49A 1AS8A 2YLAA 1C5DB 3UJTL 4FNUA 5BXTA 3LN4A 4LNYA 4E68A 3ZMEA 2UWEA 2XWTB 3IACA 4GGBA 1RY8A 1H50A 2YHGA 2VXVH 3QH3B 3NUKA 4PGCA 1T89C 4DQOL 4FQCH 1UM5H 3EYSL 1VFBB 4HIHB 3UZVB 5DK2A 1Q94B 1N6QH 2I5YH 4XO7A 5JH1A 4JUTA 2O6CA 3R12A 3GKAA 2YMXL 2NY6C 1DTUA 5L2JB 4IPLA 4UQ9A 2ADAA 3OPZL 3B3BA 3V0VA 1XCTA 5ESQA 2P9RA 1X1OA 2P5NA 3WLSA 3G6JF 4ZAKA 2X1PA 1QHPA 1RZPA 4MMWA 2HE5A 2F6UA 5BMWA 3FPYA 3CMGA 1BG1A 2XSXA 5AOUA 1XF3B 3A3HA 4CD6A 3CN4A 3CN1A 3CSYB 2E86A 1R9ZA 1V4YA 3QK0A 1UMYA 4C7GA 2OZTA 4JDVB 4M93C 1UWIA 4FFYL 2YAMA 3ZIMA 4QFUA 4QXTB 1B3ZA 1DVYA 5K9DA 2GSIB 5C0CB 2YRLA 4U6VH 3KW8A 1NF0A 3RDJA 1ZWIA 5DO2D 4OD2A 2JJSA 5CD3A 1ZKAA 4GJ1A 4U1NA 2BSSB 4GBXA 1SF3A 2E76C 5LAPA 4XPAH 3GHBL 3G1HA 4ZX6A 3TN0A 4XOEA 4Z7VA 3BN9D 1HJSA 1UD4A 4UNTA 4K39A 1X4YA 5GRZA 5JXAH 2I5QA 1L7TH 4W7VA 4ZMYA 4PV8B 2XDHA 1JV5B 4FP1A 4AK2A 4X22A 2XWEA 3T65B 1GQLA 3NT0A 4UT6L 5IK3B 2JV6A 3ZL4L 5C0AE 4KROC 3WF3A 5LNSA 4E2BA 1MQKH 1U8OB 4ERSH 2X4PB 4XNXH 1QYGL 1S9YB 1EAPB 2Y72A 3UTTD 2CJTA 5D2WA 4IXHA 5D32A 1A21A 4DEWA 3QN3A 1QLRA 2BOBB 2AJZA 1PTZA 5DJAB 3Q44A 4BH7A 5IMOB 4MD5B 4FXSA 3X3FH 3FVDA 5DURB 3BARA 1D2PA 4HJJH 4BQBA 4A6YH 5HSFA 3H9ZA 5TE7H 3KW3A 1CGTA 5CD5D 4OI7A 2XIJA 4X5PA 3UYOD 4NP9A 3TA3D 3RWGB 5HANA 3SE9H 3MBWA 1WAPA 5IZ7A 4M6QA 3FY1A 3OWEA 3NURA 1I7ZA 5AB1A 2OTUA 1QSZA 4JMNA 4PN2A 3DTUB 1TRDA 1OABA 2XTJD 6ENLA 2JKRM 3WXVH 1D3CA 3KGSA 5J6SA 3BH9A 3U6RA 4EK7A 3R8RA 3BEWB 3OM3B 4DK5A 4UTCA 3LU2A 4P2QB 5EIIG 1KY7A 4NSKB 2ZAHA 4LCYB 4HIJA 3K6FA 2XTLA 5I0WA 3W2KA 4P8UA 4OQVA 1EX0A 1D5IL 3VGGA 4LUTB 1KPUB 5GRUL 3U57A 2VLKB 2ITEA 4PJ9D 1GYCA 1DQLH 1WAAF 4PB9H 1W2PA 1W6TA 1BV8A 4NGHH 3IGAB 1N0XH 3NCFB 3OGCA 3T0EC 3FEQA 1LLOA 3S1WA 1NOFA 4S3JA 3V2AR 1HT6A 2JTYA 3A3YB 1Q7MA 1JERA 3QHMA 4ZPTA 3W39B 4BFIA 1IVLA 4QLLA 4A6YA 4OM1H 3PZOA 4WFFD 3BVVA 2INFA 3UWVA 4ZMQA 4KH9A 2W0FA 2R59A 2QR0A 3CX5J 4JFDB 3OBAA 5E94B 1U5JA 5SWZB 1I9JH 5G5IA 2XWBA 3HC0A 2OK0H 3CU1A 1EBPA 2QZ5A 3WH7A 1UEYA 4IGBB 3MRNA 2CLRA 5GRJH 5CPNA 2C7UA 3VXUA 1G0CA 1GGTA 1F6AB 2ENQA 4JLRB 3QUZA 5IJCC 3RHGA 1N4XH 3WNKA 2V3FA 4Y1AA 4GAJL 2H9AA 3N2BA 3JUGA 1Z66A 3ZIYA 5BROA 1WSST 4JFQB 3KS0H 3P0VH 2K4WA 3S1VA 3ESOA 2BNQE 1EWHA 1OV8A 1T6BX 4IQLA 1UBPC 2YAHA 4EVZA 2C26A 4WCYL 3NCJH 2OP4L 1JRHL 3QFJB 3OSKA 5EUKB 2WANA 3DTXB 2OZ4L 1AP2A 3ARPA 5IFAL 2LLEA 4P48A 2VDOL 5AVUB 3GBNL 2J12B 2BFVH 1MZHA 2YPVL 5AB0A 4U6YB 2CMRH 1R5VB 1XL9A 3VNLA 3BP4A 3RU8H 3WFBL 4ZXBA 3MWCA 5D1QE 1K77A 1BSLA 2WP3O 3FEMA 4CDGC 5LCVL 2VGIA 2NTFB 3SCOA 1O6SA 1JUFB 3AJXA 2BW4A 2ENYA 1EEZA 4PJEE 1NIFA 5J3HC 5TE4L 4AFYA 1N64L 3VNIA 3B3IB 2DWSA 4ZFZA 3IRZA 5DQ9B 3NZ1A 2H9GB 1EZSA 1PZ2A 1NEUA 1THFD 3L3OB 3QUXA 1BYDA 2VURA 4LO9A 2JEPA 4HJSA 4IQHA 3GUTB 4IGNA 3R7RA 4P2RE 4DTGL 1FA4A 4QJ3B 3LEYH 3SCQA 1HU8A 4ELMA 2BGQA 5EMUA 3UP1A 2H41A 4LLAA 4NILA 5E9DB 3SE8H 2CITA 3TV8A 1KM2A 4FQJH 2VDIA 2AXGA 15C8H 1I1FA 1IJ9A 4AUBA 2VDLB 1QFWM 4H8UA 2EUXA 4IMGA 4F7PB 1TFHA 1NCCH 4UT9A 3FQ4A 5C07B 1SY6H 4WW2A 1HEJC 2GSGA 5DXXA 3W7KA 3BO8A 5KJRH 1V0KA 3GZ3A 1SR0A 3TN0C 2CC0A 1Y07A 2FSEB 2ATSA 3CFCL 4OF7A 3MLYH 4Y88A 5ISZD 4PJ5A 5AVHA 1KBJA 3CFEA 4Z0JA 3MBEB 3LIZA 3KWWA 3S5OA 4XVSL 1UZHA 2ICWB 4WWPA 3LNEA 5C2BH 3KBJA 3SDCB 1WV7T 4F9LA 4K3EH 2ZWNA 4PTDA 2WVSA 1REQA 5B1BB 3RA7H 3UU0A 4KKLD 2P10A 4D0CB 4PUBL 4L4TD 1IEIA 2DJLA 2YPKB 1NUNB 4RL3A 3ROLA 4MKMA 2GAZA 1K2DB 4DRSA 2E46A 4XC1H 5H37H 5H35B 1RZ7L 4M80A 3PUOA 5EO1A 1EBGA 1SMAA 2PYFA 1TV4A 3VABA 4D1IA 1RPQA 3AU1B 2DDQH 2DQJH 2Z31D 1JN6B 4AKPA 1OEPA 3O6KL 4FI4A 3QR0A 2RGMA 4PP2A 1SY6A 2MQ0A 3ZZ1A 4FK9A 4BDVA 1IFHL 3W02A 1UWAA 4H88L 4TTDD 2J8FA 3QEHB 4FQQA 4AT6B 1RK6A 4DGVH 5C86A 1XBYA 3M0IA 2R23B 3HFMH 3E9AA 5F88A 1Z7JA 5BO0D 4X7SH 1GTHA 1XMEB 3HI1A 3BMXA 1CU4L 1DZBA 1EFXB 1I8JA 3PUUA 3GTXA 4G2DA 1ME9A 4ANXA 2ZSWA 1QWUA 5F9OH 4NZ1A 1L8NA 2DSWA 1YPXA 2HFEA 4LLQB 5IVXF 3O2LA 2YGOA 5KTLA 4JPWL 4D9RE 4RV8A 4RNFA 4NU7A 5H37A 2EE3A 3IGUA 4J3VA 2XFXB 3FH7A 1CB2A 5DJDA 3KYMB 3QNZB 1ZAIA 1IZKA 3V4VB 1OCNA 3U36B 3VQLA 2Y7DA 3RK8A 1EJ8A 2CM5A 2FT6A 1A7QL 5ABHA 2I9EA 4WLCA 3V5FA 4UUJA 1FWSA 4AW7A 1UQYA 5A5WA 4RE0A 5GJSH 1UYQA 1INDH 1AQDB 4Z7UB 4D0DA 1FUNA 3FUNA 1WJ3A 5HHOD 5ICYB 5DJ6B 4ACTA 4MXQD 3K2UH 1E67A 5CEZH 3QI9D 3P61A 4GSXA 3K91A 3CFUA 4BSJA 4WHYH 3LI1A 5I16A 3BP5A 5A8MA 1E56A 3M41A 3VOHA 2YDAA 3Q94A 4XMKL 5E6IA 5D7JA 3ZTNL 2HVJA 1PJWA 4CNIA 4LANA 3RRXA 2PTVA 4YAQA 3FHQA 3O6ML 4U0RB 2R2BA 3E8UH 4A7GA 2PCQA 1GJPA 1IAIL 3AU6A 2PDUA 4QEEA 2DM2A 4RDBA 1HN1A 4LC6A 5DUJA 4QTIH 1OTUC 4HX1A 4RX0A 1CBVL 4OZIE 3RGBA 3PDOB 4OLZL 5D4JA 1GQIA 3U1QA 2AK4E 3H6OA 1WO2A 3GZQA 2APWA 3CH1A 4ZXBC 2WLKA 4BWWA 5B8CB 1KT2B 2P76A 3MA7B 3BUVA 4UNIA 5I18L 2IPWA 3MUJA 2WP3T 4MZYA 3LCGA 1J79A 2ZUMA 2ZXDA 4WEBH 5F0PB 3W25A 3FO0H 1KJ3H 2H26A 2MIZA 4JUSA 3GWQA 1LEIA 4ZB0A 2CK0H 2Y3AA 4S0TD 5GZNC 1FDLL 3TEZA 3AIBA 2WZPA 4XGZB 3NQCA 2BOLA 2YZ5A 3THUA 4C5ZA 3IJYA 4YHLH 1E9PB 4BD4A 1JI1A 4LHUG 2EPMX 4W8AA 2AXHA 2DIJA 1ASQA 2YPLB 1UJQA 1E8WA 1YMMB 1RLBA 3HE7B 3NIDB 4JS3A 4HOZA 3HR6A 3QUXC 1VLIA 2WUCH 4GRSA 1UC6A 5B3JE 4YOKA 4AIUA 1M05B 3W7QA 1NWOA 3S35X 3ATDA 2Y5TB 5XINA 4PGEA 2YCKX 1E72M 2GVLA 4JQVA 2AKMA 3H2FA 3RCMA 5KBDA 3W3OA 1J10A 1W9DM 1OHQA 3H4FA 3ILDA 3VFGH 3N9GH 5C0AD 1I8KA 2FIRT 3C08L 1GOKA 4OLUH 3T2PA 3MP4A 3UD6A 2J8HA 3TAOA 2W61A 1HHGA 4PTTA 1MRQA 2XSAA 1H4PA 3N50A 1AY1L 4OBTA 4HS6B 5AKRA 3TA9A 5FCUH 4ZW5A 2W65A 2VFHA 1TV2A 4PS4H 1CIDA 5HQEA 5IB5A 3VFNB 4HOWA 4OZFG 4F15B 3KBMA 1OB0A 5HDOA 1ET7A 1F0LA 4QXUH 4WW2C 4MNQD 2Z91A 3AAZA 3HEIB 2CR0A 3QEQE 1LDPH 4PI2A 1CFMA 4KFZC 3WE6B 4HNTA 5CCKL 4AHOA 3W56A 2NX1A 4N8PA 2J1ZA 3VKCA 3KDNA 1T5XB 2ADJA 5KOMC 5CBEB 4XIAA 2KL6A 1U8IA 4PMVA 1NMBH 2F54B 1W9PA 4MOZA 1MJ7L 3H9HA 3JV6A 2VKXA 1OQOA 4YXKH 1YMHA 3MDUA 4V2XA 1RY0A 4M00A 2OWWA 5CP3H 1JULA 4KRNA 4YDKH 5D2TA 1QI5A 3WF2A 3KZ8A 3R89A 2NYYD 5EU3B 1VFTA 2QUVA 2X9ZA 4YSSA 2GABA 5I8KH 4IIQA 5CCZA 3C61A 4KO9A 2Z7WA 4GINA 1IXPA 3QEUA 3S34L 1YJDL 1H0DB 2OSYA 1IEVA 2OI9B 1XF5B 4ZFOL 1UR3M 4G82A 2F38A 4FR1A 2PYEE 1CFVL 2X1SA 4DHGA 3HTWA 4YS1A 5DVLA 2Q2EB 1MAKA 2MTAA 3KXQA 1C7TA 1G6RL 4KBXA 3BESR 3G3LA 4DP2X 2PXYA 1F5WA 5EIIB 2FJGA 3Q3GA 1KM0A 3U48A 4G1KA 3QEGL 2VDRH 3GHTA 2VC6A 2N0MA 2CPCA 3ULUF 3AU0A 1Z89A 1LO3H 1OG0A 1UH4A 2GKIA 2NUTB 3GR8A 1HHHB 5E8DL 1Z8AA 1A8ZA 1QQDA 1EVTC 1O75A 1IQWL 2PZ0A 1FHDA 4PJHE 1DVFD 1KZYA 4KRPB 4IPJA 3B9EA 1VD6A 1UZ1A 3UC0H 3IV3A 1CFSB 1BG9A 2OCCB 1MCEA 4S2SA 4Y4HB 2Y7OA 1JGDA 4X9FA 5F96L 1GZ1A 2XQYK 4PJ8C 1PUDA 2AABL 1YVLA 4UTJA 3JR2A 2HPMA 1PTGA 2GITA 3VVGA 1NBVH 4XP6H 4HH9A 5HPCA 5F6HJ 2I7GA 2ZE3A 4O19A 1LO2L 4WJKB 3LQZA 1KR0A 1LYXA 3QJFB 1A4JA 2J6WA 4YFLF 2BNQD 1OP3K 4EZMA 2V7NA 1J0ZA 1JNNL 1FFNB 1DPMA 3ITOA 1P1ZB 4IK6A 3M7FB 5J6GB 2QCLA 4JIRA 2EDEA 3TZNA 1A3LH 4LMQI 1FHGA 4BGLA 3LHYA 4PBFA 3B9OA 1ACZA 4XAFA 5KVDH 5EU4A 2Y1HA 4LV4A 4IL2A 5AVVB 1F3WA 5LAXA 5D1QD 4P46B 1GVYA 3CBKB 3D25B 1BRLB 1WDAA 4M9PA 1JCLA 4F33A 2UXTA 4A68A 3SYPA 5DD3L 3MV01 1LCOA 1ICTA 4XXCA 3ZZSA 1ZA6B 2EIZB 1MAML 3A6BH 3WKZA 2FVKA 4FOKA 4HPXA 1DBJH 3QJAA 5I1JH 2WXKA 3U7WL 4K5OA 4M1RA 1LM8V 4FNRA 3ECWA 5GS0D 4M5SA 4P2RD 5AC8A 2VXTL 3VKJA 3FQTA 5EFIB 3VXNA 5LWYL 5KBKA 2BCKA 5JQ9A 3WKML 4DJMA 1NGZB 2HLFD 2YFOA 2G41A 1BX2A 2BOFX 5DMMA 1GYWA 4MB5A 1JYXA 1E4XI 3TH2T 4MNLA 2IPGA 4FTVE 2NMSA 3LZOA 3BKYL 2IFGA 4A3HA 2B0SL 2JFEX 5IEHB 4UMAA 5IQOA 2VLJA 5EMJA 3SE3C 2EABA 1YEIL 2AGJL 5DS8A 3QYQA 3PZGA 3L3DA 2DVXA 1J12A 2BMKB 1UADC 2D3LA 5AYUH 2JCCA 2V2XA 3VNDA 1U3JA 3QLDA 5D4IA 3L7FB 3U3HA 1MCQA 1E8ZA 4GIRA 4JPIB 3Q5YA 5C08B 3BMWA 3ULUD 3LZLA 5DY2A 1KCVH 3VGAB 3MNWB 5C0EB 5DJ0B 5I19L 3QWRA 3GIVB 4X50A 5HY9B 4KK8D 4QYAA 3G5YB 2DM4A 4IMLB 1UWUA 3KRUA 3D52A 3GO2A 1KC5L 4IGMA 3STFA 3V0AC 2WJ7A 2J6XA 4TRPL 1JNDA 5JIWA 2GVYA 3DFSA 3BGGA 3UPAA 4CVXA 4IDJH 5BMXA 2DIAA 1ZHNB 2VZ1A 5FO7B 4EN3D 1ADQH 4JO2H 3BRFA 1KB9K 4P5KA 4M7LH 1FZOB 2DQFA 3BPCA 1SVBA 5B3JF 5GGSB 3CZGA 3T9WA 1RULL 3QPQD 5ACZA 4GZEA 1P0DA 1JPKA 3UWQA 2OXHA 2EADA 1ASPA 3LLDA 2FT7A 4LBUA 3AMCA 4Y7MA 5KBPA