5A2BA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
452
structure length
452
Chain Sequence
b'ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANOXYBACILLUS ALPHA-AMYLASE
publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
total genus 167
structure length 452
sequence length 452
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2bA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2bA01
4UCFA 3WF1A 1HTYA 3AOFA 1G94A 4MB1A 2YDSA 1CGVA 3K8MA 3FNDA 3ZJ8A 4FMVA 2JE8A 3NDZA 4P7LA 4Z2KA 4CVWA 1UR1A 1LL4A 2TAAA 3DX3A 1B0IA 5HXMA 3A23A 2J7EA 2F2HA 1H41A 1HJUA 1JZ5A 1GOIA 4FK9A 4FNQA 4QLJA 4QDMA 2OW7A 1QPKA 3W24A 2Y24A 5E6YA 1E1EA 3GH5A 4JFTA 1UZ1A 4UFLA 3AROA 1R46A 3MUY1 1E1FA 1HL8A 1ZB5A 1O7AA 2J77A 3SIMA 5I77A 4PCTA 2EJ1A 1H0GA 2IXUA 2WZHA 2J8GA 2JALA 4M24A 4CKQA 1W2VA 3D52A 3CGTA 5CLTA 3SCOA 1TE1A 3BVXA 1C91A 3W38A 4OOZA 1G0CA 1GHRA 4LYRA 5I2UA 2BVTA 1BYCA 1TVPA 1VF8A 1GUVA 3WFLA 3MUZ1 3D4YA 1CXHA 1X6LA 3DX2A 3WNLA 1QBAA 3RIKA 1GQIA 4DUWA 5HPOA 4P7RA 4V2XA 2VUYA 1R8LA 3S5YA 2DQXA 4W86A 5CPTA 1OD0A 1LWHA 4D6FA 1BLIA 3WNPA 5BXTA 3WF2A 4H04A 1WZAA 1OCQA 1OGGA 3ZO9A 4CGTA 1GCYA 2E3ZA 1VFOA 4JL1A 1VAHA 1ISYA 1NWTA 3DYPA 3PZOA 3PZTA 5IFTA 3S2CA 5LA0A 3I3BA 3ALFA 4AYSA 1PZ2A 4BQ2A 3GBEA 4NXKA 1MXGA 5LA1A 2VRKA 1ZS2A 1Y7VA 2O9PA 5A6KA 5CJ5A 4AZIA 1I75A 1CENA 2WMIA 1VEOA 1E0VA 4LX4A 3A47A 3T2OA 3AXHA 3GXIA 1UD4A 2GSJA 1ITCA 4ATDA 2WVSA 4JFWA 3SCWA 2BV9A 1UQYA 3EJQA 1W1VA 1KQZA 3AIBA 2J7FA 1QNRA 4JFVA 1JDCA 1H3GA 1EO7A 3JUGA 3POCA 1TQSA 3BVWA 1HNYA 1OD8A 2VZSA 3ARUA 4JFUA 3VX1A 2BHZA 3MANA 1KB3A 2XUCA 3VD7A 1DWGM 2DH2A 1J0KA 3KLLA 3L4UA 1CXLA 1QI4A 4OJYA 3N04A 2O9RA 4J3WA 4PSRA 4H8UA 3WY1A 1CLVA 5A8MA 1VEMA 3SCRA 3A5VA 3F5LA 3BCFA 3AZTA 5D8WA 4X0VA 2Z1SA 2WVUA 3SCSA 1RD6A 2D2OA 2DEPA 4W89A 4BA0A 4B16A 1YHTA 1JZ7A 1LWJA 2BHYA 4H7VA 3LXAA 2QMJA 1UWSA 2BY1A 3J7HA 1R86A 5E09A 3VGEA 3UESA 1U2YA 4W88A 1J0JA 3BSGA 3IJ8A 3SUWA 1LF1A 4D6IA 3RILA 3GNPA 5C8BB 1V0NA 1JAKA 1V6XA 5E1QA 1CGTA 3CTTA 1WKYA 1J18A 2W92A 5LA2A 4TX6A 3BXWA 2J78A 2XVGA 4XZWA 1QI5A 4A3HA 1KFWA 2YOCA 3AXXA 1CGWA 3ALGA 3A22A 1JZ3A 1PZ3A 3BUIA 3WIJA 1JI1A 3ARPA 3LPFA 4R5EA 3SCQA 1XRVA 3O2LA 5CPQA 4IPLA 3VVGA 4ZXLA 2VI0A 1B1YA 3NJ3A 1IT0A 1UA3A 2QPSA 5CPSA 4W85A 1SZNA 1VJZA 2D3LA 5I5RA 2J79A 4NZCA 3CC1A 3U5YA 2ZXQA 1OM0A 1XV8A 2WNWA 1TUXA 4XZBA 4J3TA 1VFUA 2NSXA 2ESCA 4B3LA 1JF5A 3A4AA 2C8NA 3W37A 2XWEA 2FGZA 4X0NA 4D6GA 3UETA 2OSXA 1US2A 2WXDM 1FP9A 3ARWA 3M46A 2WW5A 1MW2A 1R85A 4MDOA 3RJXA 3VIHA 4P8UA 3L2MA 1DP0A 1ZBCA 2VRQA 4PMQA 2XYLA 1JYNA 5BRPA 3BUPA 2WHJA 3PBGA 3UG4A 3UR7A 4Z2JA 4L4OA 2JF6A 3DDGA 3AIRA 1UASA 1HIZA 2CXGA 2WMKA 2YA1A 3SUUA 1D3CA 2ZX6A 2J62A 4Q22A 3FAWA 3W0KA 4MPKA 1HVQA 5D8ZA 1H2JA 4WKAA 3LMYA 3BAIA 3HU7A 2VVSA 5GNZA 4AY1A 2WWCA 2A3BA 2J47A 3VNZA 3TTYA 1UQZA 5E6ZA 5FL1A 2V3GA 2WMIB 3RO8A 4PMXA 1KGXA 4W5UA 5JIWA 4BQ3A 1DHKA 2A3HA 3W27A 4PRWA 2E9BA 5BXPA 1JZ6A 1UWIA 4M8UA 3GXFA 4V28A 2ZUWA 2J8FA 3HG4A 1F4AA 2OSYA 2WPGA 2GUYA 3G6LA 1GOMA 2BS9A 3T0BA 1EDTA 4RE3A 1XH1A 4NZJA 4PSPA 4XX6A 3WD3A 1UUQA 4TVUA 1EO5A 2D0FA 2NT1A 3ZR5A 3TTQA 3T0DA 3GDBA 1HKIA 5FD0A 3WDPP 3I3EA 2QV4A 3GM8A 2EQDA 3WNNA 3W29A 1OWQA 3WMBA 1BG4A 1NARA 1UH2A 3MSGA 4AD0A 1TQWA 2WB5A 3SUTA 2DIEA 3ARYA 1KWKA 4GZEA 4RE2A 3EYPA 2YKKA 4TVCA 5A8QA 3FXYA 2DT1A 4UNIA 4MAZA 3DECA 2J7DA 3A24A 2WVVB 1BYAA 1QWUA 4W7WA 3CZKA 3FN9A 3N13A 1QOXA 1VRXA 1EQPA 1WZKA 3NUKA 3VO0A 2VX5A 2G3IA 1R47A 3U7VA 2W67A 4C7GA 1U33A 2W4XA 2G4FA 2XIIA 3K1DA 4RL3A 3KE0A 3NCOA 2YFNA 4JAWA 3DHUA 1AQHA 5DO8A 1WO2A 3DDFA 3FHQA 4FLQA 1W2PA 3OG2A 1XCWA 1UKTA 4HA1A 1G01A 1E3XA 1MQRA 1E6PA 3WEMA 1GZJA 1TQTA 5LYRA 1UKQA 3DHPA 1XD1A 3SCPA 3PZUA 4JIEA 3WQ6A 4F79A 3KWXA 4OGZA 2PBGA 2FHBA 2WLYA 3WL0A 4AYGA 4GINA 4CCCA 3PZVA 3EDKA 2DT0A 2WBKA 3K8LA 1C92A 2GJPA 1G9HA 1QVBA 2G8ZA 2E0PA 1XGZA 4NZFA 4CD7A 4P8VA 5CQ1A 1CECA 6CGTA 1HL9A 3SEPA 1FH9A 4KGLA 2WMJA 2XSAA 3AISA 1E4NA 5I78A 3THCA 2EBNA 4HOWA 3VIKA 1RP8A 3WDRA 5FOOA 4HOXA 4HMCA 1BHGA 4PUEA 1WP6A 3K8KA 5M3WA 1KCKA 1JZ2A 4V27A 2CKRA 4PBGA 2DSKA 3SURA 1KXVA 4D6JA 1AVAA 2W63A 2WK2A 1PPIA 3U5UA 3WEZA 4D71A 2VR5A 1V08A 5DF0A 4AZBA 3CBWA 2VZVA 3VSTA 1DWJM 3T2QA 5JBFA 1XYZA 4TVDA 1HX0A 3N1AA 5A8OA 5A1AA 1O6IA 2VMFA 4LYPA 4B3KA 3VDCA 2ZOXA 4FF5A 3U7BA 1KBKA 3AMKA 1KGUA 3GBDA 4MB3A 4MADA 3VGGA 1XSJA 3HG3A 4WJXA 2CEQA 3DC0A 4F9JA 3WEOA 5GQBA 5HBFA 3ZIZA 1K6AA 4WKFA 3IAPA 1GOWA 4D6CA 2Y4SA 3ZQ9A 5A6BD 4HTYA 4FNPA 1C7SA 5KEZA 1PX3A 3ARTA 1GHSA 2X05A 2RGLA 3FY1A 3DX1A 2JF7A 4BS0A 4PYSA 1ESWA 2XGBA 4UFHA 2G3MA 5ABHA 1W9VA 5ABFB 1JD9A 4P7QA 1TVNA 2PWEA 2F8QA 1H11A 1LG2A 2OLHA 1GOKA 2F7OA 4UFKA 1ZJBA 1NOUA 1W9PA 4GKLA 3AYRA 3RM4A 4IISA 4W87A 5HPCA 4F66A 3CMGA 4KRTA 2V38A 4AC1X 2AOSA 3ZJ7A 5AYIA 5DMYA 1W91A 3QHMA 4GIAA 3RM8A 3D4ZA 1KXHA 3A3HA 1W1TA 4PTVA 3VMOA 2PF0A 3VIFA 1CGXA 3FHAA 1JYVA 1FFQA 2WM0A 1UR4A 3ZSSA 3CZJA 4TOQA 1ZBWA 3QOMA 5C71A 1R75A 3RPMA 4JZ5A 2WC7A 5CG0A 4B9YA 2XFRA 1UG6A 2O92A 4MNLA 4MJ2A 4UQEA 3OGVA 3VILA 1BVZA 4EAMA 2X2YA 2WCGA 3VDHA 4AD4A 3AIEA 1UD2A 3GYCA 2VJXA 2XG9A 3W6LA 1QHOA 3SCTA 4UZSA 5ECUA 1J0YA 5DT7A 1IZKA 2RGMA 1HXKA 4OKDA 2ZUTA 1UD6A 1P6WA 1BFNA 2VQTA 3N17A 1B9ZA 1CYGA 1EDGA 1W3LA 1PAMA 2BY0A 5C70A 6A3HA 1CXKA 3CZNA 1GJUA 1CEOA 1VBRA 2WSPA 4HU8A 1KXTA 2V5CA 1V02E 3PHAA 5IHRA 3ARVA 1M03A 3IAQA 1GQKA 4DO4A 3AS0A 3KZSA 4HZ8A 1NOFA 1LJYA 1UHVA 5CGTA 1UWTA 3VIIA 3OZOA 2FYVA 1BG9A 2CHOA 4KH2A 1DWFM 1JNEA 1JFXA 3BLBA 3VIMA 2BXZA 2VZUA 2ZXBA 1PIFA 1WDSA 3VUPA 2IXVA 4WF7A 3WD1A 3OBAA 3WH7A 4OIFA 4E2OA 3NIYA 1E9LA 3KEHA 4PMDA 3VIPA 5JBEA 3GXTA 3LRKA 1HP4A 3EJPA 2XM2A 1JD7A 3THDA 3H54A 3O6AA 2WAGA 4GXPA 1ISXA 3WBEA 1UR8A 1S46A 3WSUA 3VD9A 2VR4A 3PTQA 3CHCA 3EMZA 5A95A 4TTGA 4CU7A 2WSKA 3BVTA 5EMYA 1VENA 1J0IA 3VGFA 1KR1A 3VKKA 2VCCA 2ZUNA 4QLKA 2WZEA 5I24A 3WUGA 1EIBA 3GH4A 1EGZA 2OYMA 3WF4A 3B8SA 4UOZA 4M56A 3WQWA 4ZEPA 4HMDA 2AAAA 3MUIA 3CZGA 1ISZA 4HZ7A 4PMNA 3LXBA 3FW6A 4GZJA 1JYWA 4UQAA 3BAJA 2DIJA 3M7SA 3AHZA 3LPGA 1MW3A 3AZSA 1JGIA 4PTXA 1CLXA 1UKSA 2W5FA 3WDQA 5JIPA 1GVYA 3DX4A 2FGLA 1QWNA 1R34A 3ZJKA 5AC4A 3IJ9A 1L8NA 3UEQA 3WY2A 3ARRA 1SMAA 1E0WA 2CNCA 4DM1A 3H53A 1FOBA 4LPCA 1LL6A 1R87A 2X0YA 1BYBA 5A2AA 1W32A 1W3JA 5D9NA 1C90A 3BLKA 2XTKA 1W3HA 2ZIDA 1KTBA 2ZWZA 5ABEA 1CXEA 3WMSA 2YBTA 3WFZA 3UG3A 4PCSA 1XYFA 3VMPA 4UQCA 1XSIA 1V0LA 4P8XA 4D1JA 1EA9C 4PUDA 4AZHA 2WVVA 1OIFA 1LG1A 3AQUA 1CTNA 4D1IA 1QW8A 3WN6A 4UTFA 3BAKA 1C8QA 2FHCA 3EDEA 2CESA 1TZ7A 2QMKA 1E6ZA 1WDQA 3PN8A 3UERA 5CXPA 2XVLA 4Y7EA 2JFEX 1HP5A 1E6SM 3LXCA 4GI8A 5KZ6A 3BVVA 4ACYA 1UWRA 3OB8A 2CETA 3NSXA 5JBDA 1HN1A 3PZIA 3UR8A 2FH8A 4OOUA 2FHFA 1HJQA 1NWRA 4NRRA 2UWFA 2JEQA 4KWUA 1GONA 1KBBA 4D6EA 2YL5A 3VD4A 5FL0A 2X09A 3AHTA 2EEXA 3VIGA 3PTMA 4DUXA 1Q6EA 3W25A 4EK7A 2EADA 1OSEA 4DWSC 2Y5EA 2Y8KA 1NM9A 4J3UA 1VIWA 1QHZA 4Z2GA 3VM5A 2YBUA 3TTOA 1PX4A 4HPHA 5CLWA 5D9MA 1GQJA 1X6NA 5I23A 3WD2A 5E70A 5I0DA 2VRJA 3T2PA 7A3HA 1T0OA 3ZM8A 1JFHA 2YFOA 4UFIA 1TCMA 1Q6CA 2ZUUA 3N11A 3CIVA 5A8NA 1FH7A 3OA5A 4U3CA 4OBSA 2XFFA 4CD6A 5E9AA 4M81A 1CZ1A 4DWSD 3PZGA 1EDQA 4H2CA 1ISVA 3SCUA 4AMWA 2WYSA 3A6OA 3VGDA 2A3EA 2DDXA 1Z32X 1QNPA 2CHNA 1H0IA 1BAGA 1E73M 5JUVA 1KGWA 1HKKA 4W8BA 2JIEA 2WCAA 5EB8A 4JFSA 4FLSA 1M04A 1V03A 3HMCA 1J12A 1H1NA 4ACZA 2FE0A 5EFDA 1WE5A 3CMJA 4AD1A 2F1AA 2VC9A 4AMXA 4Q7NA 2PWHA 1B30A 2VZTA 2F1BA 1WB0A 1ISWA 1E5NA 4AZ6A 1D7FA 4AISA 1PJ9A 2E8YA 2XSBA 4PMVA 1EH9A 4GQRA 2GK1B 2CBUA 4GI9A 2J25A 1WZLA 3AS3A 4GPNA 4EE9A 1HJSA 2GVYA 3GNRA 4AIUA 3K4AA 2CKSA 2YIHA 1JIBA 2VO5A 3T08A 2YL9A 2PB1A 2GJRA 2EPLX 4TXEA 2ZX7A 5ABFA 3CUHA 3MUAA 4NRSA 1XC6A 3NSNA 1KXQA 5IDIA 2E9MA 3W4RA 3VTRA 1US3A 5BCAA 1JDDA 4CD5A 2BHUA 2XPKA 3AI0A 3OLGA 4ZENA 5AYBA 1HT6A 3ZJ6A 4AZ7A 3WNOA 1WNOA 1D2KA 4MJ4A 2JIWA 2YJQA 1LQ0A 1TMQA 2F7QA 1V6YA 1I1WA 3T0AA 2VX4A 5IHSA 1H4PA 2G41A 1JNDA 4PMOA 5CSYA 3POHA 4LYQA 3BGAA 2HISA 4GI6A 1U30A 2VNCA 2F18A 4URIA 1W3KA 4N42A 4P7NA 4QCFA 4A4AA 2ZXAA 1K9DA 2Y2WA 1WDPA 3ZSTA 3N18A 1MFUA 5M17A 3EJTA 5A2CA 1JDAA 2PI6A 2DH3A 2J7CA 3GH7A 2G3NA 3B9AA 3CUJA 3CZ8A 5GNYA 2ZE0A 1XD0A 5I79A 1ZL1A 3BAWA 4BZYA 3W6MA 4ZE4A 1GOOA 3S6TA 1OIMA 2WWDA 2CIPA 3D50A 1HKMA 4M29A 3VD3A 1R33A 1NP2A 2C7FA 1TA3B 3TA9A 3AMGA 4FLRA 3WUFA 1GOQA 5BXSA 2YL8A 1AQ0A 3VSUA 3B9EA 2X8RA 1QNQA 3BC9A 1UR9A 4N0RA 1A47A 1UKPA 1SR0A 4DO6A 2ZX8A 1UA7A 3OZPA 4HA4A 3HG5A 4E8CA 1O7DC 4GZIA 4JHZA 2E9LA 5A8PA 5E0CA 3BSHA 3MSDA 4Z2LA 1Q6DA 3UG5A 4AEFA 3KLKA 1E6NA 3WF3A 4YHEA 1NH6A 3EDFA 2WHKA 1V02A 3W82A 3WQ4A 4AZ5A 1CWYA 3QOKA 1CPUA 1JXJA 1EXPA 1QNSA 2A3CA 1J9YA 2GJXA 4R27A 2IUZA 3AMCA 2DT2A 2PC8A 2ALWA 1KCLA 4JKLA 4FNUA 2V3EA 1FH8A 1ZBKA 2D20A 4NX0A 5D9OA 2D73A 3GXPA 3TTSA 1HF6A 2E4TA 1ODUA 4J3VA 3BCDA 2J7GA 3WD0A 1BSIA 2YLAA 3AIQA 3WBAA 3BAXA 3BLPX 1Q6GA 2F61A 1E0XA 4OBRA 2G3JA 3G6MA 1MXDA 2ZICA 1PX8A 4J3SA 2XJ7A 5I3DA 3ARQA 4MNJA 1MVYA 4DUVA 1RP9A 1ZBVA 4ACZB 3WQ8A 1BTCA 2UY3A 3PZMA 5HOSA 3WL1A 1B3XA 2DSUA 2J74A 1HJXA 1V6UA 4JKMA 4W8LA 1EOKA 3MU7A 1IV8A 3AJ7A 1E4IA 2VVNA 4NI3A 3GXDA 3F5KA 3UCQA 3WF0A 3A4XA 3AXIA 3EMQA 1ZU8A 1NOWA 3E1F1 5HDRA 3A4WA 1ODZA 4J28A 2BY3A 1GPFA 4KMQA 2WHLA 4H41A 4ML4A 2QLYA 2ZUMA 2WVTA 4FNSA 4PMRA 1FP8A 2DSZA 2ZXDA 4CCEA 2EPKX 4CUCA 1JXKA 3EBVA 4CD8A 9CGTA 4TX8A 3ARZA 4X9YA 2A3AA 3WY3A 1CNVA 3WD4A 4F9DA 3WDIA 1IZJA 3BUBA 1M01A 4W7UA 2CCRA 1WZMA 1MQPA 2X2HA 1RH9A 3MV01 4U3AA 2VCBA 3U57A 5A6AA 1MWOA 4KRUA 4AIEA 3AIWA 2WANA 3AHVA 3CO4A 3MMDA 4HA3A 3N15A 3QR3A 3NSMA 2VL4A 4GQQA 3RCNA 2Q8XA 1VEPA 3MKKA 1V6WA 3GZAA 5AC5A 1FHDA 3EDDA 3MS8A 1PBGA 1K9EA 1VJSA 1C93A 4IPNB 3EMCA 1Q4NX 3FAXA 4J3XA 5BWFA 3PZ9A 4S3JA 5BROA 1SYTA 4MNKA 1FHLA 4MB4A 1B90A 2B31A 1QX1A 1TQVA 4QP0A 4XB3A 5FIPA 3W53A 3KL3A 5EBAA 3ARXA 3N9KA 1ECEA 3IANA 3ZR6A 1H49A 2W62A 2WKGA 1QNOA 2XHYA 3VDBA 3HG2A 2YL6A 1Q6FA 1TR1A 4K68A 3M07A 3WKZA 4W93A 1HWWA 5A69A 2EABA 3WNMA 1VFFA 3ZT6A 1MW1A 2YA0A 3LRLA 3SCVA 2CITA 4UR9A 1C3FA 2BXYA 1OGSA 2XIBA 1V3HA 5A6LA 1XH2A 2OWXA 1L0PA 1EHAA 4D6HA 3BMWA 3VX0A 5TD4A 3N12A 2J75A 4CN4A 3L4ZA 2YDRA 1E4MM 3AHXA 3VDAA 3AICA 5GPRA 3BH4A 4E4PA 2FH6A 4PTWA 4JL2A 2WMFA 2X0HA 2Z1KA 1BQCA 3BAYA 2CBIA 4KGJA 4AD5A 3ZOAA 2WKLA 2XN1A 1AMYA 4FNRA 3VU2A 4BCEA 3OIHA 3NYDA 1BF2A 3KL5A 1CXFA 3CHFA 4MTVA 1MYRA 4M1RA 2HVMA 2CPUA 4W8AA 1UR2A 3D51A 3L4VA 2DSVA 5AY7A 4TTUA 2OWWA 3H55A 1M53A 2VX6A 4ZFMA 3MI6A 1XSKA 5CGMA 3B9DA 1W1PA 2F7RA 2GJXB 2UY4A 1OINA 2E40A 1UD5A 1AQMA 1MQQA 2XN0A 2GK1A 4EKJA 5M03A 5E0FA 4DWSA 3GXMA 4CN1A 2QPUA 4W5ZA 1NWSA 4CCDA 2EPNA 1M7XA 1DWHM 1E15A 1UH4A 4J27A 6TAAA 2PBOA 1E6XM 1B3YA 2Y8VA 2C0HA 5BXRA 1CXIA 4P8WA 3EJUA 4NXSA 4UOQA 1CDGA 3TONA 3A21A 1JYXA 1E3ZA 3RMEA 4AEEA 4IUGA 3OGSA 3I3DA 3ZT7A 3VIOA 4LQ1A 4B9ZA 3VSVA 1QW9A 1J0HA 3L4YA 3AZRA 3VPLA 4HMEA 2E8ZA 3WMCA 4AD2A 4UFJA 1KWGA 5A6SA 4DO5A 4ATLA 4AWEA 1UR0A 2GDUA 3AHYA 1BPLB 4YN5A 1QHPA 4EANA 1WDRA 3CHEA 4IM4A 1J10A 4MB5A 4AMCA 5M5DA 4ZE5A 4F8XA 1DWIM 1OBAA 1BYDA 2FDMA 3MMWA 1UD3A 3W26A 3OGRA 4QCEA 1HVXA 3F4VA 8A3HA 3LPPA 3CH9A 4AZGA 2VTFA 4AIOA 3CPUA 3S5ZA 5ABGA 3SUSA 5CZKA 2WCSA 2PWGA 4U2YA 1JZ8A 1GQLA 2XWDA 1PEZA 1GJWA 4C7DA 5BRQA 1UKOA 1ZJAA 3L2LA 1W1YA 3W28A 1TQUA 4YHGA 4Z2HA 4JHOA 3SCNA 1NQ6A 4RE4A 1TA3A 3WUBA 1SMDA 1E72M 5FCZA 2YA2A 2QF8A 3MV11 3VGHA 2WC3A 1C8YA 1CGYA 1OT1A 2V3DA 3RM9A 4CU8A 1E43A 3ZT5A 2W91A 1JAEA 2UY5A 1FFRA 1GVIA 4XUYA 1BVNP 4QAWA 3VMNA 4U5IA 1MW0A 1R7OA 1VFMA 4H8VA 4UOJA 3K46A 3DYOA 2O9OA 2EPMX 4W84A 1J01A 1B3WA 4U33A 2W61A 4JKKA 1GNXA 3PTKA 4GO8A 1JL8A 2GDVA 4BF7A 2O9TA 3WDHA 3ECQA 1EQCA 2BVYA 4WIWA 4ATWA 1FA2A 1R7AA 2ZX5A 3EJRA 1OT2A 3AMLA 4W7VA 2IGTA 1ITXA 2VZOA 3EDJA 4HPGA 4UFMA 3L4WA 3DYMA 2JEPA 2J4GA 4MAVA 1NWUA 3W81A 2D0HA 1V0KA 3WQ5A 4BQ4A 3RDKA 2BY2A 1N82A 2EO7A 4YPJA 1XCXA 2WMGA 2GFTA 2YLLA 3D5HA 2OWCA 2WBGA 1EOMA 3CLWA 3HJEA 2NT0A 1CBGA 3TOPA 2XM1A 2XFYA 3WUEA 3GNOA 2NW0A 3CZSA 3AS1A 4C7FA 1WCGA 4ZXOA 5DFAA 1MFVA 3LRMA 4AD3A 3WH5A 1E70M 3MMUA 1GORA 3OLEA 2OSWA 3SUVA 1UZ4A 4H8HA 3WENA 3PZQA 2X1IA 2D24A 1WPCA 2CBJA 4OUEA 1KR0A 3QGVA 4DWSB 2ZX9A 3VIJA 3O9NA 5GNXA 1JG9A 4CVUA 3AFBA 1E6RA 3F5JA 1W9UA 1W9XA 1V0MA 2W66A 4NF7A 1XHGA 1G5AA 4JCMA 3BUQA 4BQ5A 4NSBA 3AYSA 4AZCA 3OLDA 4HP5A 2D22A 2VOTA 1OB0A 3QHNA 2XN2A 5IFPA 3CUFA 2D0GA 4FNTA 3VINA 1UYQA 1V6VA 1V3MA 3M6DA 2DGAA 2WMHA 3WH8A 3WY4A 4PN2A 3WH6A 1VBUA 4CU6A 3AIUA 1PIGA 2DPEA 4MDPA 4FLOA 3VM7A 2WHMA 3QHOA 5D9PA 4L4PA 1C8XA 5A6BA 2WZIA 1QI0A 3WELA 1BGGA 4UQDA 2V5DA 2ZUVA 3K4DA 2VX7A 2OYKA 2EAEA 1NP0A 3CV5A 2UY2A 1WAWA 1HXJA 1LL7A 2CBVA 1J0ZA 1UD8A 3AIVA 1TFVA 1V3LA 3VNYA 1BGAA 2DT3A 4UQ9A 3LPOA 2EPOA 3WNKA 2J7HA 1G1YA 1J11A 4XV0A 2X2JA 1E6QM 1JI2A 1YQ2A 1W9BM 5D4YA 4HOZA 7CGTA 3CHDA 4AXNA 1DEDA 8CGTA 1E55A 1VB9A 1EHNA 5A3HA 4CN6A 1E5JA 3ZMRA 2XVKA 3WH9A 4UQBA 7TAAA 1E71M 1XH0A 4WKHA 4LXFA 1QI2A 4S3KA 3RJYA 4DM2A 3CZEA 1K9FA 5CSUA 4CD4A 4D72A 3CUGA 4PMZA 1HJWA 1V3JA 1I1XA 1QBBA 3BUDA 2EXOA 3KL0A 1B31A 2XGIA 5IXEA 1KQYA 2OW6A 4PMUA 3OLIA 3MO4A 1GW1A 1H5VA 4OZOA 4A3YA 3HZ3A 1UH3A 5I6SA 4U31A 4Z2IA 3AMDA 4P7OA 2VQUA 3NDYA 3AS2A 5FKYA 2EACA 3D3AA 2XVNA 3CZLA 1HJVA 1V3KA 5A2BA 4QLLA 5BYWA 2WLZA 1W9DM 1C7TA 4AW7A 1QI3A 3APGA 2BFGA 3PZNA 3LX9A 3BMVA 2DSWA 2WC4A 3VGBA 5A6JA 4MNMA 4HU0A 3IK2A 1JZ4A 1DTUA 1SFSA 3WDJA 1A3HA 2CYGA 4QFUA 3VD5A 2VURA 4PTMA 1JF6A 1PS3A 3HN3A 1LLOA 2X2IA 3DX0A 2YDQA 1CIUA 1TG7A 5HNNA 2QHAA 1B3ZA 3WQVA 4UZUA 2D23A 4WSKA 4PMYA 2XVPA 1DWAM 3GTNA 1K9TA 4PEEA 4JCLA 1OGBA 5DT5A 4U2ZA 1H09A 2BVDA 5DEZA 1E40A 3TV8A 2D3NA 2F7PA 4J7RA 3L4XA 5A6MA 2ZWYA 4GO9A 1F4HA 1B3VA 4E8DA 4M82A 5F7UA 3IGUA 2MANA 2VT0A 3EJSA 1B2YA 3GXNA 1X1NA 2BNJA 1UWQA 4AZCB 1V3IA 1KTCA 1HKJA 4D6DA 3BVUA 4TUFA 3IJ7A 2VCAA 3T09A 2J7BA 2V3FA 4LGXA 4B15A 3L4TA 5A94A 2ZUSA 4HZ6A 1UWUA 3CUIA 2PWDA 4WLCA 1E4LA 3VOCA 1RPKA 2CERA 4WSJA 1E56A 2D1ZA 3II1A 4U5KA 2PWFA 4WK9A 4M80A 1CGUA 1UOKA 5EFFA 2OYLA 2AMGA 3TP4A 3ARSA
chains in the Genus database with same CATH superfamily
3VJ6B 1A0QL 2X88A 2AXFB 4Q8UA 4KTYA 2VLKA 2JGYA 2EDFA 1OANA 4H8QA 2XFWA 1B0IA 2ZQ0A 1YEGL 2DW6A 4IJCA 3FJNA 1FIGL 5FJUA 4G9PA 1TZGH 4QKXB 2C7UB 4ZTPL 3MUY1 3BLLA 2A1WH 5IHZB 4DH2A 3DBSA 2FX7H 4PCTA 2IXUA 1D9EA 2AAMA 2JJSA 4FFVD 1DVJA 3QF0A 4NQSB 4YZFE 1Q0XL 3FCSB 3X1EA 4U0QB 1SJHB 3SKNB 2IOOA 2ARJA 3GUTA 1X6LA 4X6FA 5TE7L 1BOGA 1GQIA 4GRWB 4P7RA 4YHOH 1U8QB 3S4SA 3L1FA 5K9JH 2NW3B 4ASTA 4KI5C 5F8QC 5A43C 1F07A 1ZHBA 5KSAD 2MKLC 3GKWL 1MCNA 3H3PL 3B2PA 2CLVB 4H04A 5EY5A 3RTQB 2OX5A 2I16A 4WY0B 3D2UA 3TVMD 4TL5A 4PGDB 4JL1A 5AKTA 2OMXA 1ISYA 4KQ4L 5D7IA 4PZVA 1CFSB 3OA3A 3O2DL 2R27A 3VXUE 1CENA 1F6LL 4LANA 3A47A 1NGXA 4Q6XA 4AMKH 1QFUH 1OO2A 3U8GA 2XDFA 3PUUA 2AP2A 2DQFA 4NKCA 3LS4L 2C6QA 1EO7A 1TQSA 3U9WA 1OD8A 4JFUA 3T3MB 1P5VA 4JB9L 3W23A 5C07B 3EKGA 2GIMA 3B0PA 4GXVH 4P46A 1NOAA 3K2GA 1F5WA 3F5LA 3PXHA 4KK5C 3U0PA 1UURA 4D9PA 4N3TA 1FFTB 1HFUA 5BZXA 4X5XA 5HHVL 4B16A 3WKML 4IGBD 1XRTA 4HKXA 4HKJA 1UWSA 2VR3A 4HIIA 5I6KA 3VGEA 4NO2A 4ORIA 3HMXA 3DV6B 4LEQA 5ES4B 3IGFA 4LGPB 3SUWA 1LF1A 4XPGH 5D1ZC 2H8PA 2JQAA 5E94B 4YJ5A 2UZPA 4JGNA 3GPEA 1KW1A 2OMZA 4FTVD 2X89D 2LT9A 1E9PA 4Q9RH 3ZDYF 1Q1JH 1QSFD 5HWJA 3CPGA 1KTLB 2NQ5A 4GISA 4G6AC 1TEYA 1BLNB 4IPLA 1ZIBA 3B97A 3EBHA 4L3EE 4L8DA 3F1QA 3LNHA 1SZNA 3UXAA 5FUOL 3RUGB 5F93C 3WFBH 4BV1A 3CXHJ 3TW9A 2AV7B 5I6LA 2ZRXA 4RFOH 2ZP0T 3G8RA 5F9JA 1KACB 3VE9A 4D6GA 1Q4WA 5F7YC 3ARWA 3DIPA 2DM7A 2Z29A 4HWBH 4UCGA 1SO4A 5IEKA 4MCYB 5DD3L 2J62A 3NXFA 1PZ5B 3EB4A 2Q8BL 4MBRA 2XZCL 5D2YA 2DLFH 3QBUA 5CC7A 2HFEB 3WO4B 1UACL 2GGGA 4W5UA 4BQ3A 1DHKA 3W9DA 4M8UA 3VNMA 3CWNA 3G6LA 4J8RA 1XJBA 3IJHB 3OO2A 1XCTB 4WUUD 1IEBB 1UUQA 4E41A 4N25A 1PTZA 4OZHB 5DJDB 1EX1A 3ABGA 4NQEA 4BWLC 4WWKD 1EC7A 3Q6FB 1TRIA 5DURB 1K4DA 4XN9A 1H5BB 5F9OH 2PTXA 1JDFA 1CR9H 2DQDH 2J7DA 4Y2NA 2FWUA 2NV2A 3E6FA 3TM6A 1JN6A 4ZOCA 2EO1A 2J2ZA 1EF3A 2DJLA 1BDYA 1U33A 2G4FA 3B9KA 1S3KL 1U9KA 4PJFA 3K1DA 1P4BL 3V7AG 2JXMB 1EBPA 5D6CB 4ZTYA 4XBPB 3T1WA 1ICQA 2EDTA 4G6MH 3UXLA 4P59H 2J88H 2RJHA 3ULVD 4JIEA 4W9EC 5TIMA 1VGKB 2WBJC 4R5VA 3EDKA 4TL4A 3LVEA 2EDXA 3FO2A 3AYVA 2OU4A 2Z65C 1QD0A 4MDJB 5JIIA 1GPWA 3OGCA 4UIMB 4LB8A 2ZP9A 4HMCA 4HOXA 5F2FA 5FOBB 3EO0B 4NJ9L 1HKVA 2V5KA 5B3JE 2GWNA 3ZTEA 3B04A 4LYPA 3QFDA 4M00A 1SY6L 2CEQA 3HVDA 4HTYA 2AJUH 3HC3H 1PX3A 4JEJA 3ARDA 3I75A 5XIMA 4AIBA 4ZNEE 1A7PL 3VFWB 4HV8B 1N64H 5DHMC 1DTNA 3GRGA 1MFCL 4P7QA 3O1NA 2GK2A 2IPTL 2CJUH 3GB6A 1CLOH 1HYSC 2B7NA 1W17A 3VXNB 3WOVA 4AV4A 3TO2A 1IX2A 4N2YA 2IANE 4AT6A 3VMOA 1XYMA 5CJQH 4ANWA 3IJDA 4IYKA 1BFOB 3ZLFA 5I1AB 1UOLA 5H8PA 5DJXA 5K9XA 4WEBH 4PRNB 3WNIA 5F2LA 4DP7X 2X12A 4HISA 5FAJA 3VILA 2E6DA 3B5GA 2G2RB 5C0FB 3TMLA 4FQHA 5E51A 3W6LA 3QXBA 3W9ZA 4DKDC 1QHOA 3SCTA 1M9WA 5E2TH 2VLJB 1EDGA 3U6RA 5ABAA 2Z25A 3VXOB 5KS9F 4XODA 4J4KA 4HZ8A 1B4JL 3GEFA 1NEYA 3IV8A 5DLCA 2QZRA 5MERA 3TEUA 4OGYH 4OUUA 3E5PA 3UTSE 3WD1A 1I2RA 2F8OA 4NNCA 3RAOA 3WLQA 3WN5A 4KWOA 3MRCB 5BOZG 4FEZA 3GO2A 3H54A 1AZ1A 1S46A 3N25A 3PANA 3ABMB 3ZTNL 4I0PB 4MXWH 4OTKA 3FKRA 3M45A 5IUSA 3BWZA 2QSCL 1G9NH 1YDPA 3MUIA 3VAEA 4ZOEA 4G8EA 3L5MA 1QLFB 3PHOB 3ZVVA 2F54D 4AK1A 4Q7IA 2W9DL 5J8LA 4OI7A 1A1MB 3N9GH 3WLTA 5D7EA 1CLXA 1UKSA 3QZAA 5ICYA 5MF5A 5DZ9A 5AC4A 4IGMA 3ARRA 4DN4H 1YJDL 3QIWB 2WZ0A 1JGUH 5A2AA 1W3JA 4LAZA 3B83A 3FVMA 2CHWA 2W95A 5G2IA 4EQ2A 1QKZH 3LNIA 3VMPA 3CVHH 3BG3A 4MAYD 5FLVA 4RZBA 1QW8A 1U8CA 3WN6A 4Y9MA 1GGOA 1IXNA 3T9PA 2CESA 5DC2A 4FQIH 5I3KA 3VFSA 4Y7EA 5CXPA 4M5ZH 2JFEX 3NCMA 1I8LA 5FO8B 2PP3A 2I56A 3QNXA 3MCOA 2LABA 2WQ8A 32C2A 4KHXH 3E0FA 3RRQA 4J2MA 3HE7D 3G04A 2X1QA 4LSDA 2K0RA 5E1AA 1E0UA 1RVFH 4D6EA 1D5BA 4WX2A 3E0IA 3W2NA 2D7MA 5CPNA 5IFHH 4DWSC 1YBQA 1T89C 2W94A 2R83A 3VFOB 1DBMH 4UTWA 4L3CB 5KBNC 4JDTL 1XUZA 2IH8A 1Q6CA 1FH5H 4DOHB 3JWOL 1XF5A 4NM4H 4UF7C 2BCKA 2HVJB 1EVUA 4M81A 4MNQB 3L5AA 4L4VE 1QFPA 1Z32X 4JPVH 1FG9C 1QABA 4JTTA 5JUVA 1RZJH 5K1NA 4IRSB 4IK6A 5BVPH 4ZUSA 3K1KC 3HRZC 1JNHA 4PG2A 2P47B 2HV5A 4QRTB 3TN3A 1F8IA 4PU2A 1P1XA 5E4EB 5ENWB 1A8ZA 2RH0A 3RDTD 1D7FA 2H6RA 2OR7A 4FQPA 4PMVA 4GQRA 1ZSDA 4AFYA 2H0FA 4EUPB 3GSXB 2W5PA 3HQPA 4H88H 2IBGA 2ZOUA 5E6IB 2FO4A 3Q8EA 4QRSB 3G1HA 5ERWA 3T0EC 2EO9A 4GYBA 1I8KB 2K6ZA 1CCZA 1I9JH 5SX5H 4DPBX 4D9QD 4YSOA 2QDDA 3NOYA 6PTDA 4K3DL 2GQ9A 1YEYA 4JFQB 1FXPA 1YNTB 5EO9A 2DYPA 5J9PB 2G41A 4PJHA 3OZYA 1E6OH 2HE5A 4A38A 3MJMA 2QL1A 4IPPA 4ANVA 3D2TA 3P1VA 3E02A 1YPFA 2B7QA 5TPWL 4E9VA 3TA9A 4GW4A 3VNDA 1EANA 1A47A 3PABA 1AG1O 4LLUB 1EXUA 4HA4A 3HI5H 4R4BA 3JUYA 2OS7A 5TDPB 3D3VB 1KB5H 1S7XB 1MG2C 3ITVA 2B4GA 1D6EA 4FNUA 3Q8CA 4E9SA 3KXFA 3VKDA 2DQJL 3MSRA 1HOCA 1S7QB 1LOLA 3KPNB 3ZXWA 1K72A 1BWKA 1RPXA 1BBJB 2ISVA 4O02A 4IEFB 1EUNA 1DQJB 4XTRD 4J3SA 5I1IL 1VZWA 3BPLC 5DLMH 1EZSA 3V6BR 5GHWL 2DSUA 4OF7A 2FB2A 1VGEH 1IUZA 4KNSA 3ZZ1A 4J3OD 3MTWA 4MRCA 4HJ0C 1KJ2B 1XXXA 3DMMD 4U3XA 1E9QB 3CO8A 3ES8A 5JIMA 4HCIA 1GCFA 2CSPA 1LD9A 5DJCA 4K7FB 3WD4A 4F9DA 5DJ6B 4I5BA 3E2SA 2JKTM 1FWSA 1LL1A 4G8FB 4TUJB 4NQUA 1TWWA 4GRMA 4OVXA 1D8CA 4GQQA 3HZKA 4F33A 1UVQB 1UXWA 3B3BA 3G5XA 1GHFL 5K59E 3EZ8A 2YQBA 2C9SA 2Y72A 1J87A 4WJG3 1E28B 4WEMB 1JXFA 3N9KA 3II3A 3ILPA 3Q58A 3P9LA 4N8UA 4MQXD 1HDMA 4W6WB 1JMXA 3O3EB 2PZ0A 3UP8A 3LLXA 3NQBA 2AITA 4RFEA 2YDRA 3NBNA 5GPRA 3B2VL 3BH4A 2FH6A 4XAKD 4KGJA 4UTCA 4FEMA 2VSKB 4KDVA 3KL5A 4B53A 4MTVA 3N34A 1M68A 4HWNA 5C0AA 1B88A 2VQ1A 3NZ1A 4KFZC 2HX7A 4PY7B 5FO7B 1YXCA 4HQQH 4DVBA 4P2VA 4E0CA 2FBJH 2HTLD 5KJRL 1BD0A 1XR2A 1OD9A 1VPXA 4ZFMA 1T2QH 2PA6A 3A67H 4LAQL 4IGNA 1YMYA 1DWHM 1T7YA 3RWCB 5CEZH 4GQZA 3CN2A 3RIFK 4M1CD 3QPXL 1EFXD 2C0HA 4P8WA 3CFUA 1T2XA 1WLHA 1Q3NA 4LQ1A 3H2AA 3TLRA 3IGAB 4IOIB 2N56A 4JFHE 3WMCA 3MUGA 2P80D 4FQJH 3SQRA 2FQFA 5J11C 3WFHB 2VXSL 5L88L 3MAWA 1BPLB 3SYAA 2VDNB 4YN5A 4R7LA 1QBLH 4JRYD 1JRHH 5K2ZA 2OFJA 3RPIA 3S1XA 1DWIM 1BYDA 1SXBA 3SKUD 3ZWTA 2Q2EB 5D4QA 2BWIA 2HKFH 4L4TD 3QAQA 5BW7C 2VLKD 1BZ7B 5JQIB 3FYYA 1ADQH 1T83C 1CFVL 3FTZA 1BMWA 1IAII 4NHUB 5EBMA 1LQAA 3L95B 3B03A 2O4EA 5HDWA 1SOQA 1VF5C 2OXNA 4LIQE 2ZA3A 1E72M 3WJZA 5FCZA 3AITA 1DQUA 3QUMB 3OHXA 5T1LA 1EJTC 3U46A 4KTDL 3SGUA 5IB4A 1E43A 3VMNA 1PTAA 3P60A 4MKTA 3L68A 5F7BA 4JQIH 3NCFB 4ZAKC 4PJ5A 2QJMA 1INEL 5DUPL 4PGBA 1BD2D 4N24A 5TQ0L 3OZ9L 4HIHA 3HG1A 2K70A 2W0LA 4MX7B 4ERGA 4YHPA 4GUQA 1Q8AA 1USQA 1V5JA 2H3DA 3E1ZA 4LS0A 1SHXA 4P5TB 5LGYA 3HPSA 5DRIA 4U05A 4IIHA 3D2UD 3H2OA 3WQ5A 3LQMA 1V51A 3FOMB 2E7MA 3DFNA 2AI0H 1EOMA 4YYCA 1JUFB 2XFYA 3CLFL 2DQUL 3AS1A 2V67A 3VAVA 1E70M 4PBXA 1FWBC 4XD3A 4N2FA 3TT1H 1ETA1 3VRIB 3L7RA 4X4YA 4N8PA 1KJ3H 3ONCA 3MWAA 3C9NA 4G2AA 1XHGA 4PJCF 3BN9C 1P4LA 4BQ5A 3LHPL 2H2PC 2VEGA 1U91A 2HH0L 3IDXL 1TJGH 4FNTA 3VINA 2F53A 3M6DA 1NGZB 3PWGA 5I17B 1TMHA 1KJVB 2JCCA 2ARJQ 4AC7C 1NPNA 4L4PA 2OZ8A 2OJEB 1G9EA 4HHAA 1BGGA 1DJYA 2R0ZH 4MZ2A 3V4VB 3QO1A 2NYZA 3UYCA 1TFVA 3DUSA 3O9WA 2LAGB 3DI3B 3VB8A 3MCKB 5BVJA 3NQEA 1RL1A 2EPOA 3EGDB 1YY9C 2GQ3A 4XV0A 4YDKL 3NL6A 2PD9A 3PWJA 1YQ2A 3GS7A 1H62A 3QAZB 4F7MB 4H01A 3MHZA 5EU7E 2R9HC 2CHXA 4LEEA 3AU0A 1LE9B 2C71A 3IFNH 1IWPA 3LSOB 3X13A 2RDUA 3N55A 1O4UA 3QI9C 5MI0C 4JFZH 5CSUA 1LBLA 2I9EA 4W1TA 1SNRA 1KM5A 3R25A 1RY0A 3LHAA 4Z0BH 1VC4A 2BNQD 2OW6A 1ACCA 1W0WA 4A3YA 2WLNA 2X0UA 3S3JA 3C60D 2ATMA 2K9UA 2NY6B 2PC4A 3W71A 3NDYA 4O2FA 3O06A 1W0YT 3ITCA 5GRJL 4HF5H 3L9CA 1XQLA 3BGJA 3SDCA 5LNEA 3FXIC 2J1YA 4IRJA 2ENQA 3MO7A 4MNMA 2OP4H 4HU0A 1JZ4A 3KBSA 4G1MB 1G7VA 4O1EA 5C8JB 2GTZB 3DKJA 2VURA 1GVEA 2YDQA 1NANI 3P2DA 4H5SB 1EB3A 4ZQNA 1EUTA 5FDYA 4DKFH 4IGSA 4JFYB 1JPFB 2B15A 2GPTA 4OCYL 3PS7A 1UUSA 1INQA 3OAZH 4H8PA 1PYMA 1PCWA 4GO9A 4PJCB 4D6DA 3EGSB 1A5OC 1E9IA 4NQED 2VOMA 3X14A 4H8WL 2B2XH 1XWYA 2YAHA 4E8GA 4YPGB 4MJZA 2PWDA 1DQDL 2GFBA 1TYEB 3B2UC 3QUYB 2R24A 4FI8A 5J6SA 4QXGH 5IM7B 2DQTL 2J8UE 4FZ8H 1G94A 1SVZA 4R90L 4YAQB 4FMVA 1NELA 2JE8A 1EP3A 4XO3A 4O53A 3UJEA 3SKOA 2V9RA 3GBLA 2VYRE 1GTNA 5GJSH 4N4PA 2VW7A 3HW7A 4KUZH 3RTQC 3TCXA 5GGVL 1LCOA 3WBXA 4Y4KA 4HWZB 1A6PA 4GRLB 5K9OA 1CD0A 3VH8A 2Y25A 2EJ1A 1H0GA 2BWDA 2FJSA 5G1MA 1J79A 4C8XA 3EOAA 2Y07H 3QRFM 4MRBA 4KVNH 3VCNA 4QRPB 1JGDB 2X4OB 5DZOA 3WFLA 3SY1A 4ELMA 3ULAB 4F7EB 1GKRA 2DY3A 1WD8A 4HJJH 2YW4A 2IQAA 2UWEF 4KQNA 2NNXA 3M0LA 3PBYA 5KSVA 1X8FA 5FA5A 1E4JA 3I7SA 3QIUA 3QUXB 3WNPA 4NZRL 1WZAA 1HXMA 1ME8A 1TJMA 1F73A 2ZKMX 5BUGA 1ZHLB 1LLWA 5LNRA 4M3JA 3TJPA 1DVYA 1R9FA 4EPKA 3PBVA 2C1PA 2ACUA 1Z48A 1OTSD 3PL6B 4I88A 5I73C 4P49A 4RNRB 1QR7A 1Z3GH 5BMWA 3G24A 1FUNA 2I7SA 2PW1B 1P7QA 2VC2B 5SWSB 3QJZA 3VX1A 4F1ZA 4DN1A 5IOBA 4X7TA 4W4NA 2RD0A 4WI9A 1K02A 4YDLB 3ABLB 4MXQC 4GIEA 3QZWA 4PSRA 3I6EA 2XWBA 1ZNNA 3SCRA 3S0PA 5FYLH 2GGHA 4IHOA 1NOLA 3O05A 4XVTL 4EEEA 3B1TA 3SR7A 5U4NA 3ROOB 3UAJC 1JTTA 4Y5XB 1JZ7A 3LXAA 4RJEA 2BY1A 3GC5A 2ANUA 1TNNA 4ZW8A 3GSUA 5D1XB 3TAKA 1RY8A 1J0JA 2OMVB 3D0LB 3GNPA 1CGTA 5D1QC 2R1LA 2G75A 4OZIF 3QFJE 5SWQB 2GDQA 3OKEA 3M0XA 1JZ3A 3SRHA 3COOA 5HGHB 4PRID 4ODWA 2BNRA 4UTIA 4ZXLA 3T05A 2K78A 4G3YL 5D2LE 3FB6A 2VGFA 3WO4C 3ZDXE 5IW6B 5CPSA 1UQSB 4WD0A 2D3LA 1PKQB 4DVRH 3SN1A 3BZFB 4J3TA 3TC7A 2H3KA 3UTQA 2C3GA 3W37A 3DHDA 2Y5TB 1U83A 5SX5K 3NK4A 4UTBA 1ANUA 3ARGB 2F5BL 3QCTL 5E9DD 3GQFA 2A7PA 2OQJB 4HEPG 2PGFA 3CLMA 1DVTA 2RBLA 1OC6A 4E9TA 4D2JA 1MF2L 4YVPA 4RE0A 4JQVC 1H5BC 4JPWL 5LWYL 3GLCA 2R14A 1XGQA 1AD9A 2OXGA 5LCVL 4YDMA 2W9LA 4N6RB 5D6DC 3NM1A 1IKNC 4DJFA 4UANA 4CC1A 2DQGH 4A2FA 4F7TA 4H1ZA 3RURA 5LNSA 5D7JB 1B4TA 2YLHA 3RO8A 4ZB0A 4XO5A 3PRZA 4RGOH 4LPTA 5C2BL 1REQA 1OG0A 3GXFA 2WGXA 4U1LB 4Z7NF 4H0HB 3IDMA 3T0BA 3RFAA 4R4FL 4JJ5B 1GAFL 1KCSH 1FNGA 4QDGA 4NZJA 1IJNA 1WCBA 4PRRA 3DBXB 3RWEA 1OWQA 4UT6H 4PY8I 1AW5A 1U8LB 4MMZA 1KWKA 4Y5VA 5A8QA 4LCQA 3DECA 5GSVA 4RZCA 4LEFA 3BSMA 3Q06A 3S5NA 3L5HA 2GK0B 1SLXA 3IPEA 3QRLA 3QZEA 3QQ4B 2XXMB 3NRPA 3C5JB 1FGVL 1ALDA 3DDFA 2XA8H 4AG4H 1J1OL 1G01A 1XR9A 3NZHL 5ICXA 1A6UH 5LYRA 4JG0H 3WQ6A 4OZIB 4I87A 3PJLA 4GINA 5SWZB 3NA9L 4EAEA 3LCXA 2XG4A 5EGRA 2GJPA 1H1YA 5AALA 5JLZB 4NZFA 5AW3B 4Q7BA 3Q6GL 2W0FA 4PHXA 4XNQA 1OARL 4FXFA 2HX8A 1JULA 1SN0A 4DKEL 5KYYB 1R6WA 5LGKA 1HHKA 1XGRA 1F4YH 2CK0H 1RCQA 1C08A 4PBGA 1N10A 2YB1A 2YPLA 1XIIA 3VRJB 1LO2H 4ODUB 3HE6B 4ZUTB 1KGCE 4X80H 4DZ8B 2PXYC 3EZ4A 4XC3L 5DRCA 1HX0A 1Q9OB 1TKWB 3B8YA 5LGJB 3W0WA 4KX7A 3FUNA 3BPCA 3F6IA 4F9JA 4JKWA 3M47A 3ZIZA 4K6AA 3OXRB 4HEMA 3VXQB 1WDAA 3M9YA 4P4RB 1FO0A 3RWDA 4I0KA 1I9RL 1M56B 2XWCA 4LEXL 1ESWA 3VQLA 3VFGL 5E5RB 4OLXH 4A8LA 2F8QA 4XX5A 3MRLB 4Z7NB 1RUMH 3WKYA 4LOUC 2WJDA 5GISL 2FBRA 3LZ3A 2VDGA 4GIAA 2FL5B 2BSRA 2C1OA 2DZTA 5CGYC 3CE1A 1RHFA 4ERSH 3W7DA 3MCG1 2EYRB 2FEJA 3UGUA 2XPZA 3DX9A 2A21A 4GI4A 4CMMB 3PY9A 4POCA 1HFBA 2MCPH 3I4KA 2HG5B 2P4AB 4P2YA 1ZKAA 4M5SA 4WO4B 4I0PC 3MGOA 1B9KA 3CT7A 2WSRA 2AW2A 2KBGA 2QZQA 5HGAA 2FWOB 4NIYE 2XKNB 3CZNA 4Q6JA 3KXFD 4ZPVB 4O50A 1KG0B 2EE6A 3J2PA 4ZPTB 3GI8H 4G80B 3IFLH 4IXXA 4FP8H 1JOIA 2IXVA 3QIWC 5CZVH 1FA4A 3V4PB 4DGYL 3AAMA 2QW5A 4H1LB 3RU6A 3VIPA 2VDMB 1F9CA 5EMMA 1PU0A 2XWJB 5CJXC 3GX9A 1A7QH 4PWEA 1Y5XA 5A95A 4GLEA 2L8AA 3SY5A 4KAQL 1IU1A 4NYUA 4WNQB 4ZQPA 5HYSB 1AI1H 2W88A 1UJPA 2ZYFA 3K6OA 5FC9A 3HGJA 2XC8A 3ZZLA 5CF3A 3UW6A 4OZ4A 1QRKA 1IGYA 3UEQA 1G7JA 1E0WA 2CNCA 4DM1A 3H53A 2YGNA 4G7SB 2BM3A 2FSEA 1BYBA 1W32A 4TX9A 3SADA 1QQDA 4GBUA 3BLKA 1N8ZA 5I15L 4A2MA 3QIBD 4ROPA 2ZWZA 3HNSH 3LTYA 4IDJL 5FUCC 1XSIA 3H8AA 3EUUA 3OG6B 4D1JA 5I07A 3TZVB 2OQHA 3W73A 3PF2A 1ECYA 4XX1E 3XIMA 4O2CA 2OTDA 1KLGA 2CLKA 4IRSC 3EJJX 2OR9H 4FMKA 4DYKA 1H6TA 4ENEC 1YMHB 5DYOA 5K1VA 3CMFA 4YJZL 4QOKB 5E4EC 3UBXB 1FFOA 4B9GA 1JCLA 1W54A 4MHBA 4FQCL 4HIEA 3VXRE 4Z3EA 5D5ME 3NCCB 4UIOA 2ZAGA 4QXUL 4DUXA 4PH6A 2NXZD 4Y2DC 3GYEA 5EOCH 2EVGA 1VIWA 1QHZA 3VM5A 2UVFA 5C0AD 2E6YA 3M5XA 4DJDC 5E6IC 3DROA 4JKNA 4CJ1A 4FFYL 1BZ9A 3TA3A 2YFOA 3MNZB 5SX4H 4ADJA 5EZPA 1YEFL 3WIHL 3W7EA 3NJJA 4K7PL 3VGDA 3KYOB 2R1PA 3V4UH 1FFPA 2IGLA 3RP1A 3S6DA 4TQEL 2J6VA 3HMCA 4AWUA 4JN6A 4ALAL 3FEMA 3IMUA 2PYEE 4BJLA 4U1MA 2VZTA 3WLWC 1FWFC 5JTWA 1ISWA 1E5NA 1NDMB 4AI7A 4GG6E 3VYNA 2Y5SA 3G0UA 2NX5A 4EE9A 3BWUC 2V17L 1YXDA 3BZGA 3I2CL 4Y5YA 2NNAB 3EADA 1H3XA 3WQPA 3H23A 1US3A 3BRFA 3V8OA 4F2UA 2Y8UA 4JAMA 3AI0A 3E7JA 2PS2A 1LO0H 2X4SA 4CSTA 1D2KA 5JW5B 1FRGH 1GW6A 4ABWA 3H9HA 2Q2LA 2DQEL 1Q90A 4BI7A 4G9FA 4QXVA 5JHAA 4POZC 4HUUA 3CQ0A 5CSYA 5T1LD 3N2XA 3C52A 4GI6A 2BDNL 3FV9A 4A8IA 3RWJA 3CPLA 4I2XE 1TR9A 3O8XD 3RZCB 3W7JA 4JREB 3L3GB 2Y2WA 3RHWK 4UWMA 3KGSA 5IFJA 4BINA 4O8RA 3FK4A 1XICA 7XIMA 3PGDB 3GH7A 5AVVB 3QARA 3FT3B 3W6MA 4UC5A 1XIGA 1HKMA 3RNDA 3NZ8B 3HG1D 3R0KA 1XEUA 2EH7H 1UR9A 3MJ7A 5M94B 2ZX8A 4K7VA 1KCVL 3TMQA 1QTPA 5E0CA 1SFLA 1L8PA 4PRBB 2I60H 5JXEA 3GR4A 1VA9A 1ZS8A 2TSYA 3F7LA 1CPUA 4JTGA 2ZSVB 2JKLA 4UNUA 4KKXA 3OAZK 1AG6A 1AIFB 4JKLA 5DJ8A 3INOA 2W07B 3DUHA 1TTAA 4FF7A 1JUBA 3JT2A 3H4WA 3SE4C 3TTSA 1LQSR 1DJXA 3FCTA 3WD0A 3WBAA 3ET9F 2MPAL 1KM2A 1XR8A 2J5WA 4JFED 2F61A 2G30A 3P30L 1MXDA 1ZCCA 3F5WA 4B5NA 2VERA 3MV8B 4EI5B 2A5UA 1FVCB 2WO4A 1WITA 5FYKL 4HNCA 2F53D 1PLCA 4OU1A 3EIFA 2ADIB 4C6BA 2NY4B 3P3YA 2BY3A 1HEHC 5AZ1A 5EBLB 2QPFA 1ZHKA 1VZGA 3PP7A 4UUIA 2CWNA 4MCZB 5ITFB 3O9WD 4O0QA 5ABTA 3TJEH 4LBEB 5FDWB 2YX0A 2DMKA 1NIBA 1AS7A 4LGSB 3AHVA 3NSMA 4QAIA 3ETBF 1QWHA 1K9EA 4IPNB 3EMCA 1IC0A 3RL1A 5BWFA 2NR6C 1RZGA 1BMGA 2FZMA 4RMVA 3W53A 3OVRA 1PV8A 2OJPA 1SPQA 1LBMA 1OGTA 3FO0H 1RK5A 2W62A 4F7CA 2XHYA 2YL6A 3KYKL 1F6AB 3IEBA 4Q2ZA 5HDQL 3V5OA 3QNZA 5HVHB 4ZSOE 2YA0A 4HCRL 4XXDA 1CL7I 4ODVH 3TYGL 2R1NA 1J6PA 2X3BA 1KDJA 2BXYA 4NAFB 4NQDE 5FWRA 4DEPB 5KITA 5MHBA 4WI2A 3VDAA 3AHXA 2C79A 4X4ME 3QEZA 3A3XA 3F58H 4HNUA 4DJMA 1MZHA 3SE9H 5I30L 2NUPA 4G8GE 1MYRA 1XH3A 1S5MA 3I02A 5AECA 3MZ2A 4DETA 3UY8A 2VDNH 3LOTA 3HAEA 2OWWA 2COQA 3IV3A 4H4IA 3B9DA 3CCHA 1VLWA 1H7PA 4PRPB 3LI0A 1QK0A 3GXMA 1ADWA 3QISA 1EHXA 2H1XA 3NPVA 4FYSA 3SGEI 3GIVB 3OEXA 4J27A 3K7UA 3OZKA 5CN2A 4JTAA 3NPUA 1CMOA 3UR2A 3AT0A 4LPVA 1VH7A 3EJUA 4YN3A 1CDGA 3BEVB 4HC1A 3T07A 5FYKE 2ADGA 1NF0A 1M7JA 3FOLA 5GZOA 1IM3B 5IMLA 1XLJA 5FFGA 4HBCL 4L05A 4AWEA 4N8CL 2UV3A 2GDUA 3D4CA 3MI2A 1M7IA 2XBTA 4L1WA 1OQOA 4WFEE 1TQCB 3OGRA 1LOSA 3F4VA 1SUJA 2OSLB 4ZI8A 1ICPA 2NV9A 4X8GA 1AKJA 2KZWA 1IGFL 4G5AA 1RUAL 5DSCA 2ITCA 2JVUA 1SQ2N 3TX9A 1GXEA 5ABGA 4FSAA 3CFTA 3PYCA 3VXSE 1E65A 3WS3B 4XKYB 1SJVA 2ZTKA 1MEXH 5LNDA 5GJTL 2JLLA 3AXKA 3WUBA 1D5MA 3TTEA 2NXHA 4OQVA 4M1BA 5F96H 2QF8A 2QQKH 4HFUL 2G4EA 4PFEA 3C6LD 3B6SB 4L9YA 2V3DA 3HHMA 2ZRUA 1JAEA 3VFTB 1NDYA 5FR3A 4FXLA 1G0YR 1NBQA 4MNGA 1JL8A 1KNOB 1QFWL 4IZGA 4UV4L 4WIWA 4Y19B 4JPSA 3TLQA 3W1XA 3QIUD 2VZOA 3BZ4B 4B5ZA 4YHNB 4Z1DA 3WKQA 3D5OF 2D0HA 4U7MA 1E2WA 5FUZL 1XCXA 3O4LA 5HNTA 3ZKQD 4Z0XA 3LD5A 5HP5A 1YTEA 1WYIA 1IARB 3KEDA 1P9MA 2BOCA 2K8MA 1M6OB 3INUL 2VFIA 4OKVA 5C6PB 3LUTA 1WPCA 3QQ3B 4KNUA 3S6CA 2V2WB 3TNNB 2R82A 2W66A 3QAZC 5HYEA 3A5FA 4AYID 1GS7A 4HP5A 5H35B 1FN4A 2PTDA 3MRKA 2PCXA 3GJFA 4HS8L 3VFNA 4BFKA 5HHQA 4F8PA 1SO5A 2NXGA 2GITB 2VDQB 4FLOA 1OCWH 3FN3A 2EZ0D 3F4CA 4W9TA 5GRVL 5C7XL 1HO4A 5KZCB 2OYKA 2WO5A 2GSGA 4HSHA 4XPBH 2ZZ4A 2NY6C 4AUUA 4G5ZL 1G1YA 3VNLA 4XP9H 2GSIB 3QM3A 3ABRA 4RGNE 1XPYA 4D9RD 1E4XI 4O10A 1BRLA 4PM1A 1WTLA 5C0CD 1RZIA 4QR6A 3OKDA 2ZCLL 2GBTA 3BZEB 1RHCA 2VR2A 3KCJA 3NH7H 3MV9B 3KJ4C 5F3HA 2FVMA 3EOTH 1LUCA 1OG6A 1OP9A 1PYWA 1TJRA 3R7RA 1CE1L 1LEGA 4HU3A 2X4QA 3IE9A 5LQBL 3CLEL 3QJVB 5DRZB 1JGVL 5C92A 4V2BA 3DJRA 4N0CD 3AG2B 3ZDYB 1QFWM 2YN5A 3VGAC 2QCEA 1GYCA 2C3VB 3LX9A 1RLBA 1P0NA 4UR8A 3IK2A 4PFMA 3SDOA 1JWUA 1AO7A 1G6RH 3OM3B 5IROC 3M17B 3V95A 4YVXA 3QUYC 1Z9SB 3W70A 2YZ5A 4JK0D 1PS3A 3ZTJG 3DX0A 5KINA 1O7SA 3FRPG 4DJFD 4HIPA 4AUJA 1PDKA 1ACXA 1YCSA 2G3XA 1QSEA 4W9CC 1EV2E 1FWXA 4LLMA 3FJLA 3NL3A 5F89B 2OCJA 5KJ4A 4LKCA 5JOPE 1T6MA 5A2FA 1NWPA 4A7GA 1R3IH 4A8RA 3P3TA 4LLVA 4CBZA 1GZHA 2PCPB 5L2KD 4HK3J 2E6FA 5BOFA 1GYVA 2EYSB 4HX1A 3TT3H 1X1NA 4AZCB 1C5CL 2NY1C 3CBJB 4G82A 2YSWA 4GRLC 3WCZA 1WKDA 4PJIA 1J1XL 3OMAB 2Q3RA 2ALDA 1IL1A 1BP3B 2ZUSA 2MEJB 2DD8L 3KWUA 2Y36L 3TUUA 4ZTEA 2A9DA 3NZRA 5EA0H 2Q02A 4MMYB 4XPFH 5IBXA 2HLFD 3RY6A 3CVIL 5CWSA 2WP3O 1S5HA 1CFMA 3K8MA 4KOCA 1UR1A 2TAAA 4F58H 2IO5A 3QUXC 2X6UA 3FRPB 4L0YA 4WHYG 4FK9A 3BK0A 3TWCL 2X4NA 2JKEA 1B0RB 4GAAA 3X3FL 2CUAA 3QO0B 1F56A 4Y9AA 5DGRA 4IP5A 1IC5L 3N9SA 4QJ1A 3AXMA 2I5QA 1CB4A 1FZOB 4TVPL 5MKGB 2JALA 3PL6C 1KFAH 3OW1A 3II2A 5HQEA 3W38A 2EC9U 1G0CA 1GHRA 2NXYB 4I18B 1VF8A 1OFQA 3OJDA 3D4YA 3VOHA 3G08B 3NJXA 3MP5A 1R8LA 2VC2H 1LWHA 1UA6H 4GAYA 1D9KA 5J13C 2YPLD 4GQGA 4YDLC 1Z1WA 1R3HA 3LGDA 3N5AA 3K71A 1F74A 1UM6L 3REWB 4AEIL 1AQFA 4BGLA 3WSQL 2GIYA 4EMZA 5FOJA 2DQIL 3V5KB 5E1HB 3K2KA 1CK0H 5CBIA 1SHMA 4AYSA 3GHBL 5FK9A 2NQZA 2CUMA 4Y5XC 2VRKA 3AGVA 1A7OL 1S7SA 4HU4A 2CDEB 5D1XC 3N19B 1UQYA 4XMLL 4OV9A 5AAWC 1KQZA 4CQAA 4KKPA 4HPNA 1XWVA 4WKZA 4PS4L 4BI6A 2C9QA 2X3CA 3OPZL 3MLWL 1Q9KB 4YDVB 4MWAE 3C5QA 3Q8AA 1UB5A 3G5YB 2Z31D 2A77H 1YG9A 3WY1A 2PRHA 1CLVA 4A6GA 4JANB 3IJ6A 4K3EH 5ESQB 3ZYZA 1RD6A 3T6WA 4KCWA 2BHYA 4EE2A 4GYFA 3QJQB 1X5KA 2FX8L 5CIPB 1LROA 3HUJF 4QITA 5E6UB 5AUMA 4GRSA 1VPYA 1JAKA 4A7UA 3TEXA 5E1QA 3MLZL 4JM2F 1WKYA 4OTXH 3KS6A 3KRUA 4S1QL 2NY0D 1YIXA 2DEXX 1K2DB 1P7TB 3GIPA 4XZWA 3TWBA 4MDRA 4LCUA 3PCYA 3E0LA 4HSNA 3MOAL 4AH2B 3F7QA 1YA5A 3MYPA 5A3ID 3NJ3A 1I3RA 4P57B 5D7JC 5ICZA 5AZEL 5JDJA 4XP4H 1TTGA 3FO9A 1OTUC 3IB4A 3BQUB 3R8HA 5KS9B 4LQFL 5I1CL 5LNVA 4XZBA 4PJDA 3CMOH 4IKLA 3A4AA 4CCZA 2RDWA 4N6EA 4V1DB 1G7UA 1US2A 3U1PA 1FP9A 5AL0A 4B4HA 4QYOA 3S36L 2OMAA 1KTDA 1ZXKA 2VRQA 5C08B 4AC4A 4ZMTA 1JYNA 5ACZA 2D7OA 4Z2JA 1OGAD 1JVKA 2OMWA 3HBGA 3DUUB 2OL3A 4Y1AA 1AZ2A 4L8BB 1ZWIB 5J3HC 5CBAB 5KSBE 4H13C 4GFXA 1ODAA 3KPRD 2J47A 1T66C 2F9BT 3VNZA 1MSPA 2AQSA 3IRCA 2HRHA 1XC4A 2A3HA 4PRWA 3GTHA 3QJAA 2P7TA 3HMWH 2F6XA 4LCRA 1FL6B 5CINH 3DXIA 3CDZA 2EH8H 2Y6SC 5DU7A 1PVNA 1XH1A 3NP4A 2WAHA 4K7PX 2NT1A 2CR3A 4BH8B 3LDVA 5A6IA 4WJ5A 2JIXB 1TUFA 2CR0A 2QV4A 3X1FA 2YYUA 3WMBA 3NN8A 4F20A 2YB4A 1UH2A 4JG1L 3L9RB 5T5FH 1OAUL 1Y1UA 1A8JH 5F9WC 5E23A 1TIUA 3E5BA 4ICXA 3WUWA 5DK0B 4MZRA 5FM8A 3DGDA 4YWGH 3SY0A 2VKZG 2L04A 2FMNA 2FO8A 4DEWA 5JA8B 2R4SH 3ULSB 2V5BA 2O6FA 3HUJB 2C1IA 4EI6A 3TYFB 4JAWA 4YVNA 3HE6C 4P9HL 2JK5A 1WO2A 3H9SA 2CO6B 1UKTA 1E3XA 4JM2B 1X7QA 2CR6A 1E6PA 3DXAB 3KWVA 2WQSA 4JFPA 2VCOA 3HEIB 1A14L 4JFFE 4UTUA 1REIA 3EX1A 4AYGA 2JMRA 1T1XA 5BS0B 4L1DA 3O6LH 5IJVA 5I1KH 2HJLB 2L3BA 1S7RB 1CJYA 1KYOJ 1AFVH 3VACA 3QZPA 3CD4A 4XNBA 5EUKB 5B1JC 2JWYA 1UM5L 5EBWB 4Z7WA 1V7ML 1KCKA 2J6EA 1JZ2A 4Z8FL 1WDWA 4NJHA 3W2JA 1IEAB 2QVIA 1N2VA 1C5BH 4PRHB 3CBWA 3U0TA 4FAMA 5BZAA 5LIWX 3N1AA 5A8OA 5HANA 3ZHLA 5C1MB 3UPWA 3V6OC 1KLFB 5EG6C 5T8GA 3MYZA 3CL6A 1EC9A 3RLSA 3ZHDA 3ZRCC 1Q0YL 2L0DA 2I9LA 3EOBB 5JXAH 2IPUK 4O4YL 3J27A 4M3HA 4G9FD 1YMMD 2EE2A 1R3SA 2FDSA 3DX1A 4H20L 4MD4A 4UT9H 3AM8C 4Z78B 5CU9A 2ADFH 1M3UA 1UWEL 4IIQB 4JTEA 1ZDQA 2PDNA 4O0ZA 1NTHA 1HZYA 4JVWA 3QUZC 4XBGB 3NZUA 1AQKH 4FOUA 2VAAB 1R3KB 1GVQA 2W3ZA 4ZS6C 4HWUA 2QKIA 1NIFA 1L2QA 3TYDA 3TAOA 1F42A 3CZJA 5HULA 1THCA 4Z7VF 1T8QA 5IOPB 2F7FA 4QHKI 4HJFA 2R8SL 5G4OA 2HWZL 1CF1A 5GJMA 2X2YA 3E3QE 3T4YB 5JXED 3RKDC 4A6YL 3JV4A 3TH6A 5ECUA 3QA3B 4GJTB 2AMUA 4TUOB 1T22A 5EZIL 2VMCA 3DZ1A 1AGEA 1LNUA 1GY1A 3GFUA 1EC8A 4E42B 3FSAA 2Y88A 3LHTA 4NRZB 2L4OA 2DP3A 2OULB 3P93A 3ATYA 1VESA 1E5UI 1MCOH 3L0KA 4XCFL 3OBAA 1DBJL 1GR7A 5EZLA 2QUNA 3KRSA 5D4HA 2YPVH 3BDBA 4XOAA 3LKNB 3O6AA 1OF2A 4XCYA 4WRHA 3W1TA 1WV2A 2C3HA 5JH1A 1J5OL 1HSBB 3T8QA 2EVHA 5IBLD 1UFGA 5LGHH 1IZCA 5DXYA 3NEHA 5EF1A 5EU3A 1NBVH 3RCMA 5KSAB 4FIQA 3GMRB 4ZEPA 3C6SA 3QTPA 1U8OB 1XLEA 1U4EA 1ISZA 2CK2A 4GZJA 2WXIA 4QKTA 3RI5K 3TVMB 5DJYB 4F7PB 3ZJKA 2IPWA 4K8RL 1RZ7L 3SBWC 3NAVA 3KPSA 3DVGB 5BO1H 2CA4A 3DHFA 1N70A 5HY9B 1AANA 3R2GA 4Y8FA 3ROLA 1OIFA 4OIIL 1CTNA 5KYXB 2H3BA 4EPEC 3HFMH 1PWLA 5JZ7C 1TZ7A 2YXFA 5TJWK 4NNPH 3HQ1A 3BDYH 1LDPL 3AAZB 4NN7B 1ZUAX 3I9AA 2UWFA 4OCSH 2YEZA 2Z24A 1TRDA 5B8CA 4R83A 2FFCA 1TTUA 1FWDC 4X99B 4JZJA 2ZOKA 4Z2GA 3SO5A 2VIRA 3UEZA 5D9MA 4Q4IA 1GQJA 5I23A 5CJOH 1FNHA 1KF9B 4KX8A 3ZM8A 3BN3B 1SYVA 1OAZH 5CAKA 3CSYB 1HQ4A 3KGUA 4M8QA 5EC2B 1BX2B 4M6ML 4OM1H 1XDTT 5FF0A 4FTVB 3ULVF 2PDHA 2MKWA 1QSFB 3ME0A 5KG9B 4FA7B 1MXSA 4IX0A 4FG6D 2E6AA 4HDIA 4GBDA 1RA5A 5GZOD 1PJ9A 3DTDA 1EH9A 3UCDA 4ETYA 2ZONA 4GI9A 4A21A 1WZLA 2FECL 4W9IC 5LBSH 3B4NA 3TBBA 3KLAB 3RJQB 3STLB 1BXAA 3QVQA 5D7HA 3U2OA 2O6CA 4JR9L 4KDTC 3WQOA 3STZA 3NSNA 3LRHA 1YPZF 1AKJD 4L37A 2CJTA 1TZIA 5BCAA 5IM51 3QQ9D 1M6JA 5AOLA 2A4EA 4P46D 4XMZA 4EXBA 4GXFA 1K6WA 1V6YA 5TFSL 3E8UH 5DMNA 1EIXA 3UPCA 1DFBH 4R7VA 3V0JA 2P26A 4YUEH 5H6HA 3L54A 4RSYA 3RWHA 3I7RA 2DF3A 2YLKA 2CIKB 1XFPA 1MNUH 4Z3FA 2VDRB 2E86A 4YO0B 4RNHA 2AANA 1W3KA 3V5FA 2XG5B 5KOVC 1FVDB 1AD4A 3A64A 1KOAA 3ZSTA 4XVSL 5A2CA 4ZFGH 3NXLA 1ITQA 3CZ8A 1XD0A 3Q05A 1NCNA 5G4HC 3S2JA 1YEHL 3S6TA 1PWMA 4WWKB 1MIEH 3A4FA 4M29A 1KCRH 2C26A 2B7OA 4EI5C 1RIHL 4PRDB 1AC0A 3QP3A 4ZW7A 1XF2A 5EORH 1I8IA 5A2KH 4TIMA 4QS6A 1OIOA 2BOLA 3O6DA 2G5RA 4NIKB 1BYOA 4QTFA 1VBGA 3L5IA 3O4LD 3W2DH 1JPIA 4MY1A 1I3GL 3G6DH 4XZUA 4Z5RA 1QTWA 1WOBA 4HJGB 3R7MA 2LLNA 2EVIA 4CQBA 2PN5A 4D0DA 5D9OA 2IOIA 5I8KL 4CSPA 1MJJB 3GXPA 1O7DE 4Q4PA 1YNPA 4K2SA 4S38A 1SLUA 1QSZA 2EKSB 3OIXA 2WTOA 1HC1A 4MNJA 3VI4F 3P4OA 3L3IA 1VFSA 4XN7A 3GZKA 2CLRB 4DK6A 2CLZA 4UOW1 1Q66A 5H4ZA 4NO3A 4A68A 2VENA 3UCQA 1H0DB 4IPJA 1Z9NA 3BH8A 3DI2B 3P3SA 5HVHC 5IGXL 2ZUMA 3ZXAC 1MRAA 2EXWD 1ZVSB 5DMIL 2OPJA 4X9YA 3PV6B 3RL2A 4DEPC 4E41D 1CNVA 3K0YA 4EBQH 2QHRL 1A6ZA 3M64A 4HCGA 3RLGA 3U57A 5CUSH 4QHLA 3K6IA 3EYFB 3BTNA 3RF9A 2BDQA 3AREA 2P76A 5ADOH 1YTDA 3V0IA 5D37A 2IF7A 1OQXA 4WCYH 3H2MA 4EZJA 5LUMA 4ANKA 4XB3A 2R1XB 2DOCA 4GRWH 4KUCD 4K2UL 3MY9A 3LV6A 1E5ZA 4MD5B 4ONVA 4DBWA 1DUZA 2P8PB 3B9KD 2GUOB 1YNLL 4C56A 1BFVL 3TJLA 2G9HB 3NFUA 4EN3A 3MWCA 4HALA 1SW3A 2WUCH 4BQ8A 5DXWA 2QHLA 3N12A 2EIEA 1R19A 2BSBA 3S1VA 2FT7A 3FTYA 4CQ9A 1PNCA 4U3SA 1J8KA 1K7FA 3NYDA 2ZJSL 4LS2A 1CXFA 3ML9A 2WYIA 1ICTA 3EKCA 4EDXB 4MS8D 2FB4H 2ZWLT 4XC1L 4GUPA 3W39A 2PYFA 3MNWB 1TQCC 5EPDA 2F7RA 1S3TC 4F3FA 1AQMA 2ZKHL 4Y1TA 1OCOB 2WIIA 4PYHA 5EZOH 1INDL 1UH4A 2VLLA 6TAAA 3FB5B 4W68A 1B3YA 4B9KC 5EC1A 3I6GB 3TONA 3TCLB 1BZ8A 4A2HA 4H0IA 4YFLI 3CNKA 5EF3A 5AYQA 4Q56A 4AX3A 3F3HA 3CC5A 4KVPA 3AALA 2YAMA 5B1KA 3ARDD 3I7QA 4N0YH 2YSSA 1CDBA 5AZUA 3H7BA 3S98A 1MVUB 8RUCA 4MB5A 1CN4A 3U4BL 4R96A 5D7SL 4JKPH 3MMWA 3W26A 4H9UA 3OZMA 3HR5A 3LERA 2EUVA 4XXWC 2F54B 2PWGA 2OX4A 2VKXA 3C86A 3CH8A 2CALA 3PUEA 4FFWD 5JO5A 4HXAL 2BCMA 4XWOD 4NRYB 5MHSE 3IFOA 3MV11 2H7WA 1E8ZA 4KROB 5AAMA 4U1NB 1O5RA 1FFRA 3RWFA 4XUYA 3PDDA 1WT5C 4MAYB 4ML9A 5IQ7L 1PG7L 1A3WA 2EF9A 1UENA 2ZZUT 4BF7A 2X0SA 4OCWL 3HE7B 1D9KD 3OVGA 1FNEA 1M71B 2EXYD 3LB0A 1IAKA 4NZTL 5DJAA 5CC3A 4ZMAT 3BEWA 4JPKL 4AE1A 3CWHA 3GMLA 3U36A 4DK3A 1KIRB 4LCYA 3MMUA 2UWEB 1UZ4A 4FO4A 2JI3A 2B1HL 3NJIA 3E96A 5GNXA 4HWEL 3IIPA 4UTTA 1JPST 3V79C 1AA1B 4KIRA 2NLJA 2VOTA 2W9MA 4KZDH 4PTDA 1XVSA 4XNUH 3RDTB 5F1SA 2JJVA 4JRLA 1ZT7A 3X12A 4J3OF 1AZVA 2G37A 3IFPB 3QHOA 5D9PA 3F7KA 1A64A 5I3IA 1ZA3A 1NMBH 4D0CA 2BJML 4X0KB 5D38A 3KDMA 1HXJA 3H7LA 5FGSA 4O12A 3BX7C 2GBUA 1Q94A 4MVAA 4UQ9A 3QPKA 4UWQB 4OLWH 3SDXE 4HOZA 1WAAF 3C2OA 3LEYH 3S36X 1I8UA 4CN6A 3R10A 1S5NA 2WOBA 2FO1A 4F40A 3BZJA 2JELH 4OLYH 4DTGL 3U1SH 3SOBL 4PMZA 4H25B 8PAZA 4EF3A 4UNKA 1BKHA 4R5XA 3D39A 5DFVD 1EZ2A 4RMWA 4HJEA 5BQ7B 4WGXA 4EAYA 5E0KA 4XNAA 4R3UA 1E5BA 5B7ZA 2XJKA 4G7EA 1CFQB 1QRNE 2D2JA 3NIFE 4J3OG 4L9LB 1HJVA 3JZ7A 4P3DA 4D8OA 1PKMA 4ZMQA 2ED6A 3SJVA 4HIJB 4HHLA 1HJCA 1ZTVA 4AXKA 4MJMA 1H6EA 2HFGL 1BWLA 4N68A 4L6HA 2YMXL 4M5PA 4GK8A 4GNKB 5F1UA 4LRIC 2DJ4A 4TLKA 2V5RA 2AABL 4H9ZA 3RPKA 2AEOA 4PMYA 1DWAM 3VFCA 1AXTH 1BQLL 2VE6A 4HH9B 2Q3XA 3B1UA 4EF8A 3ECWA 1QZ1A 2EDJA 4JX5A 3KAAA 2ZXCA 5FHAH 5CSRA 2HLAA 5E5CA 1IC1A 1X4ZA 3S9YA 5IVXA 4B15A 2DM3A 2DYPD 3H42H 3S96B 3G5WA 2Y1ZA 4WLCA 2OV0A 3BUYA 3U3HA 2NXYC 4I18C 4M80A 3DMMB 1FPTL 2ESVA 1P1MA 2VM3A 1G7HB 1JPSH 4C6CA 4Y4FA 2IXQB 3AOFA 3NJFA 2EAWA 3CXDL 2XY1A 4P23A 4CAGA 3A23A 2GG1A 2F2HA 1IT7A 3H9SD 2O5YL 2UV8G 1DQVA 3U82B 1SQ7A 4DFHA 3P14A 1ESOA 2IALB 5KSUA 2X38A 2BIQA 2VITA 5K9DA 4HZ1A 4UTAH 1WC7A 3BW9A 1MMFA 2CRYA 5I18H 2HRPH 2HTKC 1KC5L 3WNLA 3W1AA 3QG7H 3E12A 4Q9QL 4NYLA 1IGCL 4C1NA 4FXGA 4W86A 4BKNA 3GMMB 8XIAA 2Z64C 4ZQKB 4DT2A 4UUJA 1MCSA 3XISA 5EOQL 1I45A 2EDRA 3LQAC 2DLIA 6ALDA 1H5YA 1QLEB 1DBKH 4HD9A 5ALBH 3LQAH 1RZKC 4CNIB 5LA1A 1RZKH 3UXFA 5CJ5A 4FG4A 4GSXA 4FF9A 4K9EL 3OD3A 5K4XA 1OVZA 4ATDA 2WVSA 4WW1A 1FL3A 1W1VA 4XO9A 2YD6A 1CLKA 2QVHA 3FYIB 4U7SA 1EFXB 1BJ1H 4RPPA 3KLLA 5EEUA 1VCGA 4Q6IB 3L4UA 1G7PA 2F7IA 2ZNWA 4J3WA 4ZQMA 5C0BA 1QUNA 5LO7A 2Y7EA 2BZDA 4FYRA 2COVD 3QRGL 4FOKA 4HNLA 3K74B 3PP4L 4QRRA 3S4SG 4HKBB 2D2OA 4JRYB 2DEPA 2FT6A 3BQUC 3QW9A 4PJAE 2K45A 2VDOL 1ZT1B 1CG9B 3N2TA 4BEIA 4JTUA 3CFDB 4HLZG 4L4TB 2OMTB 3VG0L 4YSEA 2WYHA 4D6IA 4QEHA 4NQQA 5TE4H 4EZLA 3QH3B 4N0FB 3S7GA 1KZYA 5FB8A 5HI3D 2WWMD 2ED7A 1QI5A 3A22A 2WTRA 1NGYB 4V33A 2QEJA 1E0TA 4EUPH 4A2LA 4JGDA 1MRFH 5CPQA 2P10A 4HKZB 1JK8B 3KLHC 3FQ2A 3ERXA 4BE6A 3GNML 5FKAA 3EG9A 3DVNA 4KNQA 4WGHA 1F11A 4J8QA 4ZFOL 2NSXA 3GUTB 1BD2B 3BL3A 2C8NA 4X6FB 3L81A 1CO1A 1BOGB 2IDUA 3JWNE 1A3RH 2FD6L 1S2EA 3QYNA 3P6LA 4WQOA 1XAKA 1A5SA 2IMMA 4O9HL 3L2MA 3VXPA 3WQCA 1FLRL 4XO8A 2F8XC 1UASA 3D2UB 1D3CA 2O5ZH 2AK1L 3F05A 1OFAA 4WKAA 3VYLA 1IFHL 1XLDA 4Y9GA 5GNZA 4AY1A 2X7VA 2KUTA 1NAMB 4LESA 5C0JB 2HN7A 4TULL 4V28A 2OSYA 3E2RA 3GYRA 5DUBB 4JM2C 1EDTA 3WX7A 2Z93A 3CDYA 3T0DA 2WUBH 5F0LB 5A2IH 3O6ML 3WDPP 4MXVF 2MQ3A 4O8AA 2O1AA 4O2EA 5ESVA 1TQWA 7TIMA 1R24B 5AOMA 3SGKA 1KY7A 1RJZB 2RALA 3FXYA 2DT1A 4UNIA 2JJUA 5JR1L 3LMZA 4KO9A 1QOXA 4PJ5D 3TBYA 4EZMA 3NUKA 4LV4A 3C2AL 4HKXB 1JGLH 5EWIH 2G2NA 4PJFF 4BKLA 1JMZA 5B38A 3QRHA 2JKXA 3PWLA 4GUOA 3OKMB 3VQ1C 4JDEA 1TZGL 3WEMA 1QNZL 4PV8B 5GGQH 3MRDB 4IRZH 4XCNA 4KPHH 1XBDA 1C92A 1XG4A 1KJ2H 2BODX 1M41A 5F1VA 3FN0H 3V9FA 3FQXB 2WMJA 4YXLH 4EIGB 2BNQB 2J9XA 3RX7A 3LB6C 5FOOA 4YHOL 4IIQC 1A21A 3C60B 1EGJL 5M3WA 3CVDA 5K9JL 2AJXH 3UTTB 3TPKA 4V27A 1GY2A 4D6JA 3WEZA 5JOFA 3MZGB 2J3SA 5A1AA 4MDIB 4J6IA 4XPHH 4K3ZA 3U7BA 5IEKB 2VLRA 3L3HA 3PXJA 4QSHA 2QJNA 4MY9A 3DIVA 2Y4SA 3FGCA 4YVVA 4MJIB 4AMKL 1MRCH 1QFUL 3FY1A 1IGJB 5KN5A 1BXBA 3MA9H 3LNGA 2UY7A 3KCPB 4N3UA 5BMXA 4UFKA 3W2MA 4OGAD 4UBPC 3VOJA 2INEA 3BG5A 1KXHA 1F3EA 1W1TA 1S8DA 2PF0A 1TZAA 1FHNA 1D5ZB 4XVDA 5EA9A 4DK5A 4ZW3A 5J1AB 5GIRA 3TBCA 2A7NA 3KVKA 3E9UA 1HUVA 5LB1A 3AQZA 3E6FB 4G56A 3B37A 2J2ZB 2L7JA 3RX5A 5DT7A 2WSYA 4LVHB 4QD2E 5KSAC 2BIIA 1W3LA 1OGPA 4MJ5A 4J35A 3CFEB 2X87A 3ARVA 3SDCD 3VIIA 4IRJD 4KH2A 1CQYA 4HT1H 4Q9RL 3IDNB 3QUGA 3TVMC 2VZUA 4GLRH 4HGWA 4PVLA 2DICA 1KEGL 2E6JA 3MVIA 4DBSA 4LCIL 1YYAA 4ZT1A 2DTSA 4EX4A 2KMWA 5EU5B 3WFBL 3VD9A 3UC2A 5DVPA 3J07A 2P9RA 5LKNA 1OABA 3V1PA 2QKFA 1JP5A 4RFOL 4WTWA 2BG5A 1YAIA 5I24A 3WUGA 3CFCH