5A2BA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
452
structure length
452
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
molecule keywords ANOXYBACILLUS ALPHA-AMYLASE
total genus 167
structure length 452
sequence length 452
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2bA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2bA01
1NP0A 3AZRA 2WBKA 2YDSA 1VEOA 4BCEA 4ZENA 4ZEPA 2XYLA 3RDKA 4BQ5A 4KRUA 1V03A 3HG5A 4YHEA 2VURA 1UD8A 2WHMA 1E9LA 5IFTA 3OLGA 1JAEA 4JKMA 3NDZA 3GXMA 3VOCA 1UHVA 4JFVA 2D1ZA 4PN2A 1GJWA 2WMKA 2C0HA 4CD8A 1VFFA 1LG2A 4U31A 5AC4A 3DX4A 5A8NA 3GNRA 1TQSA 2ZWYA 5ABFA 4LYPA 4AZIA 3AXIA 5ABEA 1HKKA 3TTYA 3GXFA 2J75A 3IANA 3WY4A 1GQKA 5HPCA 1ECEA 4KGLA 5A6AA 5A8QA 4B9ZA 1QBBA 3ARRA 1R87A 4HA4A 1JAKA 1KQYA 1H4PA 3WKZA 3MKKA 4CD5A 3A23A 1ISXA 4Z2LA 3W28A 3OGSA 4PUDA 4AD5A 3AMKA 2E9BA 3CUIA 3AHZA 4HMEA 3TTQA 3VGBA 2ZUWA 5A8MA 4AZBA 3E1F1 3NUKA 1J0JA 2V3GA 1I75A 2PWEA 5A69A 4JHOA 4PMDA 2WC3A 1HWWA 5CQ1A 5A1AA 3W29A 3ZJKA 4AMWA 3AMGA 3SCSA 2XGIA 3VSTA 4GZIA 4UZSA 4MNKA 4JFUA 3DX3A 2DT1A 5JBDA 1DWIM 4JCLA 3AHYA 2F8QA 1SMAA 1R7OA 3SCOA 2CXGA 4AMXA 4RE2A 4AMCA 4PYSA 3TOPA 2IUZA 3M6DA 1QX1A 1V6XA 3CTTA 4S3KA 2ZX5A 3WUEA 1UH3A 3H54A 3WH7A 1W3JA 4N42A 1H0IA 2WB5A 3WQ4A 2WVSA 3WENA 3RIKA 3GNPA 1E55A 2A3AA 1ZBKA 1ITXA 1DWHM 5I24A 3OA5A 3WMCA 1EO7A 2X0YA 3W26A 1NOWA 4NRSA 3HJEA 2WMHA 3M07A 2PBOA 5LA2A 1V6WA 4AZ7A 3UESA 4KMQA 3UR7A 3WF2A 1MXGA 1KGUA 4KRTA 4UFMA 1E1EA 3BVXA 3MI6A 5FKYA 1W3KA 1W1YA 1UASA 1MYRA 5A6KA 2A3BA 1LWHA 4NSBA 4Z2KA 1HJSA 3RO8A 2CBUA 2ZOXA 5I3DA 1BVZA 2YA0A 3HG3A 3WNPA 2DDXA 2GJPA 1V02E 1JYNA 4D6JA 1OGSA 5I77A 3B9EA 4CN4A 4AZ5A 2QPUA 1MWOA 4LXFA 4X9YA 3VD5A 3WNMA 1EDGA 4B3KA 3BAWA 1QW8A 4ML4A 3BLPX 4TUFA 3VD7A 4D71A 1BSIA 4NXSA 1SMDA 5FD0A 1I1XA 3WY3A 1HJWA 1XSIA 3VKKA 4GO9A 3AIRA 1TFVA 1B3VA 3ZR5A 4MNLA 4GI6A 1ZJBA 7A3HA 1QNQA 1WZKA 1V3JA 4AW7A 5CPTA 2J7DA 1YQ2A 3T2PA 1E4LA 3DYOA 1ZJAA 2IXVA 1UKQA 1L0PA 2FGLA 4OBSA 3G6MA 6CGTA 2XG9A 3J7HA 5I79A 4R27A 4P8WA 1E5NA 2YBTA 3EMCA 3VILA 3CUJA 4QFUA 1BLIA 3VGDA 4W7WA 4P7RA 1V08A 1X6NA 2QF8A 3VD9A 1R8LA 1MQQA 1NWSA 5BXRA 1GQJA 1E4MM 2XVPA 1CXIA 4LQ1A 1H5VA 1PZ2A 2UWFA 4J3WA 5FIPA 1BVNP 1CYGA 3UG5A 1JI1A 5DF0A 4UFHA 1WZMA 1LWJA 4NXKA 1OD0A 1W32A 2Q8XA 4GQRA 2GJRA 2HISA 2EPKX 1HXKA 3CMGA 1GHSA 3MUY1 4N0RA 2AMGA 3GBEA 1TUXA 3S2CA 4GZEA 1UWUA 3CUGA 2OW6A 3CZGA 3WEOA 4AYSA 3ALGA 1B31A 1E73M 2PWFA 4W87A 4D6FA 2A3EA 4FLSA 2B31A 7TAAA 1GHRA 2X8RA 3BUIA 4UFKA 4PCSA 2C8NA 3A3HA 1PJ9A 3NSMA 1EQPA 4E8CA 3EBVA 2Y2WA 3CZLA 3BAJA 1J12A 5E1QA 1FHLA 1UR9A 4MPKA 3VIMA 1J0IA 5HXMA 3UEQA 1JIBA 1H3GA 5F7UA 3CC1A 4LYQA 5EBAA 2XWEA 3PTQA 1ZBCA 2YA1A 3DHUA 3T2OA 2EPNA 4WKFA 4B16A 2VQUA 1M01A 2WZIA 2ZXDA 2GK1B 4P8XA 2ZX9A 4TX8A 3VX1A 3SUSA 1UH2A 4PMYA 2WMGA 3WD1A 3N04A 2V38A 5I5RA 4IUGA 3OIHA 4HP5A 1BYAA 2WYSA 4MNMA 4HMDA 4UR9A 3WQWA 2WKGA 4AZGA 4W88A 4UZUA 1JF5A 1UOKA 3PZVA 2J78A 2XN0A 3AIUA 4UFLA 3AHTA 1UD5A 2VZOA 4FLOA 2JALA 2J47A 4HTYA 4ACYA 4CGTA 1L8NA 4EKJA 1LL6A 3I3DA 4CN6A 2QMKA 3OLEA 1H41A 4W93A 3GXDA 1E70M 2AOSA 3EJPA 4JCMA 1S46A 4MJ2A 3CIVA 1MFUA 3OZOA 2F7QA 5D9PA 1KXVA 1C90A 4H41A 3VUPA 4AD3A 1QVBA 5E6YA 1Q6GA 4PMOA 3W27A 2W66A 4M56A 3NCOA 5LA1A 1WCGA 1UWIA 8A3HA 1AQ0A 3GH7A 1OIFA 2DH2A 2NT0A 4F66A 4FF5A 5GNYA 3CLWA 2E8YA 1E4IA 4MB5A 2RGLA 3ARXA 4MADA 1FHDA 5I6SA 1QNPA 1B1YA 3H53A 4V2XA 4FK9A 1WZLA 3H55A 1OBAA 5FOOA 2GFTA 2JEPA 3WL1A 1XRVA 1QOXA 2C7FA 1N82A 1H09A 4CD6A 3ARYA 1R33A 4J3SA 3POHA 2XWDA 4WLCA 5E9AA 2J74A 1G0CA 1A47A 3ZQ9A 3WDHA 4PMZA 3GXTA 4C7FA 1CXKA 3AOFA 4JL2A 5E0FA 4XZWA 4MAVA 4HZ6A 5A8PA 1ESWA 1M7XA 1VFOA 1XC6A 3WMBA 3BLKA 4JIEA 5ECUA 2OSYA 2XM2A 3EMQA 3VMNA 3VMPA 1JNDA 4DWSB 3L4YA 4H8VA 2WMIA 1R86A 3WY2A 4EK7A 2F2HA 1HNYA 4OJYA 1K9DA 4ZE5A 2QMJA 3WD3A 4GI9A 2D0FA 3WMSA 2OWCA 1M53A 3AJ7A 2ESCA 2GSJA 1HJVA 3HU7A 5ABGA 4TVUA 1DWAM 1OT1A 1HVQA 1W9BM 3K8KA 4E8DA 1GNXA 1VJZA 2Y5EA 1J18A 3FAWA 3KEHA 1TR1A 4HPHA 1UG6A 1QI5A 4BA0A 4ACZB 1E0VA 2J7BA 3APGA 5A2AA 3VSVA 2XFFA 3GBDA 4KH2A 3BMWA 3UCQA 3FHQA 4B15A 1X6LA 1SZNA 1KWKA 3LPGA 2D24A 5BROA 3A22A 1W3HA 3BVTA 3UETA 4ATDA 3U7VA 4HU0A 5HNNA 2V5CA 5M17A 3B9DA 3QGVA 3K8MA 4TX6A 1RD6A 1QI0A 3PZOA 2DIJA 1CBGA 4JAWA 1Q6EA 3A4WA 4IPLA 3AMLA 1MQRA 3VDBA 1C92A 1JNEA 1EH9A 5M03A 1DHKA 4X0VA 2NT1A 4QCFA 4DM2A 1HKJA 2WSPA 2YKKA 8CGTA 4B3LA 1E6ZA 3CHFA 1V0LA 1DTUA 3IJ8A 2WCAA 1KR1A 4MNJA 1E1FA 2EABA 2E9MA 1Q4NX 1G94A 3NJ3A 1GUVA 4D1JA 2Y8KA 2D22A 3VIIA 2UY5A 3D50A 4QP0A 3ZOAA 4CUCA 1BFNA 2WBGA 1E0WA 1DP0A 1RPKA 1M04A 1PPIA 4PTVA 2ZXAA 2BV9A 3WNLA 3ZSSA 1UQZA 3U7BA 3WFLA 1ZBVA 2O92A 2EACA 1UYQA 2G41A 4UQBA 2YDQA 2XVGA 2GK1A 2J8FA 1KXTA 1VRXA 1FOBA 1QBAA 1OSEA 5A94A 2A3HA 3T09A 3ARSA 1JGIA 4AIOA 3LPOA 3N1AA 3POCA 1UR4A 2JIWA 2ZX6A 1BG9A 1H2JA 3D52A 1KWGA 1CENA 1HP4A 2CESA 4NX0A 4XB3A 3AIWA 3W0KA 2EEXA 2VRKA 1WNOA 1XCWA 2OYKA 1VIWA 2EPMX 4HU8A 3AI0A 4Q7NA 1E40A 3WDJA 4GKLA 4DUVA 4TTGA 3L4TA 3ARWA 4BF7A 1CGVA 3IAQA 2CETA 2IGTA 2A3CA 2J7FA 1WDRA 1E6RA 2ZX8A 1B3YA 1W91A 4AY1A 1H1NA 3VIOA 5I0DA 2WK2A 3CH9A 3ZT7A 1HVXA 2E8ZA 2WLZA 1W9PA 4GQQA 2XFRA 4HZ7A 1BAGA 3BCDA 1VEPA 3AMDA 1U33A 4H2CA 5HBFA 1PIFA 1IV8A 1DWFM 2DGAA 5A8OA 2EQDA 5DFAA 5JBEA 4UFIA 1R75A 2BFGA 2VR4A 3WL0A 2WM0A 3TP4A 2VVNA 2FHBA 2G3MA 4GIAA 1US3A 2CITA 1LLOA 3S6TA 1UWQA 1C91A 4UQ9A 1WKYA 2OSXA 3N18A 1AQMA 3VDHA 1HKIA 4IISA 1JF6A 4PMVA 3WH8A 2O9OA 1V02A 2VR5A 1H11A 2QLYA 1XHGA 4PMRA 3PZMA 1K9FA 1UKPA 2W5FA 1WDSA 3ARQA 2EO7A 1W2PA 1NWRA 4ZXLA 3W81A 1B0IA 3ZR6A 1QHZA 2WXDM 3GH4A 1JZ3A 4UQEA 3UR8A 1OB0A 3BAKA 3ECQA 3MU7A 1I1WA 4RL3A 2Z1SA 1HL9A 1ZL1A 2WMJA 2VTFA 5D8ZA 3VMOA 3SCVA 1VEMA 1OCQA 3VDCA 3VIFA 3EDEA 4TXEA 2XIBA 2HVMA 1W1PA 3FW6A 2D2OA 5FL1A 3RMEA 2BXZA 3U5YA 2BY2A 3WD2A 4IM4A 1G01A 1EHAA 2XIIA 2DSUA 4U2YA 5C8BB 1NP2A 2OLHA 3VIHA 1OGBA 4X0NA 1YHTA 3CO4A 5KEZA 4W8AA 1VJSA 2EAEA 4MB1A 4AD0A 1PIGA 1CGUA 3NDYA 2WCGA 5E6ZA 3MMWA 1PX4A 1BGGA 3WDPP 3BCFA 4BS0A 1E6PA 1EDTA 3VVGA 3SUTA 3LRKA 3DDFA 2OW7A 4W89A 1FP9A 1LG1A 1JZ8A 4DO4A 1C3FA 3AICA 3CPUA 4M29A 1GVYA 1XYFA 2J7EA 1ISZA 3VX0A 3MV01 2BHZA 1ISYA 3VGFA 2PF0A 2X2YA 3GH5A 2WHJA 5ABFB 5IXEA 1TG7A 1G9HA 1UZ4A 1V0NA 1E0XA 1W1TA 4W5ZA 1R34A 3VIGA 2DEPA 3FNDA 4M81A 4QLLA 4UOJA 4DWSA 1GJUA 1UWSA 4J27A 4HMCA 3PZTA 2PWDA 1E6NA 4AISA 3LRLA 2PC8A 4AIUA 4CU7A 4W84A 1CPUA 1GOQA 1GOIA 3K46A 2JEQA 4TOQA 1CWYA 2VL4A 4AD4A 1BYDA 3WQ5A 5BCAA 4DWSC 1PX8A 3DX2A 4AYGA 3BUQA 1UKOA 1RH9A 2Y4SA 4TVDA 3WY1A 3AIEA 2VUYA 1UQYA 3O2LA 2BVDA 4MB4A 3L2LA 2E4TA 3ZO9A 1OIMA 4PMNA 4AD2A 3BSGA 1G5AA 3PTMA 3L4WA 3OG2A 1JZ4A 4DO5A 4A3YA 3T0AA 1HXJA 2VCBA 4RE4A 2J7HA 3T0BA 2WCSA 5GNZA 4F9JA 1ITCA 3SCTA 3S5ZA 2UY3A 4PTMA 2W61A 2CHOA 1E15A 5DO8A 1BPLB 2JFEX 1MQPA 3IK2A 4PBGA 5M3WA 2V3FA 1KBKA 2AAAA 1J9YA 1V3HA 2YL5A 2F61A 4ATLA 5JBFA 2GDVA 3PZUA 1E6SM 1BHGA 2F7OA 3RILA 4B9YA 1H49A 3LXAA 3AROA 4UQDA 3AXXA 1CGXA 3M46A 3AZSA 4CVUA 3QR3A 2PWGA 3DYMA 1UR2A 3MSDA 4CCDA 4W7UA 4D6IA 1MFVA 1WP6A 1VFUA 4GINA 5ABHA 5DT7A 4AWEA 3TONA 1TVNA 1TZ7A 1SFSA 3DDGA 2E40A 3MUIA 5AY7A 3ARZA 4JFWA 3L4UA 3BLBA 1PX3A 3ARPA 3HG2A 2EJ1A 3CHEA 2XSAA 2XSBA 3LXBA 1H0GA 4AZHA 3CUHA 2VX4A 5A3HA 3SCPA 4P7LA 1V6UA 2W4XA 4AZCB 3IAPA 1JI2A 2NW0A 2CNCA 1K9TA 2UY4A 3K1DA 1BTCA 1JYWA 4K68A 4PUEA 3VIJA 3W4RA 3D51A 5BWFA 1CEOA 5GNXA 3WDQA 2CCRA 2CBVA 3L2MA 2ALWA 1R47A 1UKSA 1CGTA 3AS3A 5A2BA 2D3LA 5JUVA 4AZ6A 2YFNA 3DX0A 3FXYA 4OUEA 4E4PA 4DUXA 1V3MA 4EANA 3VD3A 3QOMA 4D6CA 4LYRA 4U2ZA 5AYIA 2F1AA 1UWTA 4KWUA 3SCQA 4NRRA 5CZKA 5KZ6A 4W86A 1GORA 2XGBA 4Z2HA 1WE5A 1UD4A 3BUBA 4UCFA 4FNUA 5D9MA 5HPOA 1QPKA 1C8XA 4ZFMA 4W8LA 3KLKA 4CCEA 1HL8A 4H8UA 2G8ZA 3SURA 1F4HA 1UD3A 2J8GA 4BQ2A 2J7CA 5A6LA 4XX6A 5BXSA 4KGJA 4QAWA 1UD6A 1QNOA 3B9AA 3DYPA 4HA3A 3CBWA 2XUCA 4AD1A 1VB9A 4J28A 2DPEA 5DT5A 2XFYA 1HT6A 3VGGA 3ZMRA 2DSVA 3UG3A 2ZUMA 1WPCA 1KQZA 1TE1A 3GYCA 3BAXA 1MW2A 3A21A 4GPNA 4AXNA 3DC0A 3BAYA 4ZE4A 2WC7A 3HG4A 1J0KA 2Y24A 2VX6A 4BQ4A 1SYTA 5CPQA 1LL4A 1JD7A 3EJQA 2OYLA 1BG4A 4HPGA 3K8LA 4JFSA 5C70A 2WKLA 2ZX7A 3BVWA 1B30A 1KFWA 5CSYA 1QI3A 4PMUA 3AMCA 4CKQA 1B3ZA 4JHZA 3AHXA 3W53A 4CCCA 4J3UA 2XHYA 4HZ8A 1HN1A 4UTFA 2O9RA 3T2QA 3AHVA 5HDRA 4E2OA 3TTOA 2YA2A 1NOUA 1BYBA 5FL0A 4PSPA 1GOOA 4CN1A 1HJUA 3KL3A 1JZ2A 3WD0A 3RCNA 3AISA 2EPLX 3WDRA 3JUGA 7CGTA 1CGYA 4OGZA 3PTKA 1GQLA 2DT0A 3ZT5A 4CVWA 3GXNA 3BC9A 2G4FA 2VI0A 2VMFA 1V3IA 1XD0A 5JIPA 3OLDA 1E5JA 3AIVA 1UH4A 2MANA 4M8UA 4PTWA 4Z2GA 1MW0A 3T0DA 3N17A 4U5KA 5E70A 1KXHA 4YHGA 5M5DA 2YDRA 3MUAA 1DEDA 5A2CA 2X09A 4M82A 1RP9A 4NI3A 3WQ6A 2VQTA 3WH9A 5GQBA 3OGRA 1V0KA 3W38A 3EDDA 1PZ3A 4P7OA 3L4XA 4HOWA 3AS0A 2BXYA 3SUUA 2VJXA 1X1NA 3ARTA 3OLIA 1E71M 1JFXA 1ODUA 1B90A 1E3XA 2WLYA 5CPSA 4UQAA 4A4AA 4OKDA 3RJXA 1GCYA 5I2UA 4U33A 3HMCA 4D72A 4JFTA 2VO5A 3CUFA 4Z2JA 1TQWA 3BUDA 2XVKA 1B3XA 3OB8A 3L4VA 1O7AA 3EDKA 3FHAA 3MS8A 3HZ3A 3WBEA 4FNTA 1FH9A 1VF8A 3WF4A 4AZCA 3WQVA 1ISVA 1QHPA 1QWNA 2WNWA 2DT3A 1EA9C 1NOFA 4QCEA 3VM7A 3A5VA 1AQHA 2YLAA 1JYXA 5D9NA 3GXIA 2CYGA 3TV8A 2FH6A 3VU2A 2ZE0A 1GW1A 1XV8A 1CIUA 4CU6A 1VFMA 2GJXA 3VGHA 5E0CA 5HOSA 1XH0A 3PZNA 1XSKA 2EADA 4LX4A 1IZKA 2WC4A 2PWHA 4V28A 1GONA 3PZIA 1XH1A 4R5EA 3KL0A 2Z1KA 4WIWA 1MVYA 2YBUA 4HA1A 2W62A 1V6VA 3WFZA 4EAMA 4P7NA 3D5HA 5A6JA 3N11A 4FNSA 5D8WA 3U57A 2WVVA 3CZSA 2EXOA 4PRWA 5A95A 4UOQA 1VBRA 3QHMA 5D9OA 1B3WA 2FE0A 3A47A 2OWXA 3W24A 2EPOA 2YL9A 3RJYA 4C7GA 1TA3A 4D6DA 2YL8A 3CMJA 2CERA 3PN8A 3L4ZA 1XYZA 2FHCA 5I23A 3I3BA 2WWDA 1WB0A 2ZICA 1QWUA 3F4VA 4MAZA 3VNYA 1EOKA 3NSNA 3QHOA 1LQ0A 2D3NA 5LA0A 4CD7A 2F7PA 5BRQA 1EXPA 5EFDA 1MW3A 2QPSA 4HOZA 2DT2A 1IT0A 1W2VA 1D3CA 3FN9A 4YN5A 1XSJA 3D4YA 3VPLA 3KL5A 3GDBA 1BYCA 4FLRA 2CEQA 3FY1A 5EFFA 3EJTA 3MV11 4P8VA 3VIPA 5CLWA 2CHNA 4PEEA 4XZBA 3AYRA 2D0GA 1Q6DA 1HP5A 1OWQA 2DSWA 4Z2IA 3NYDA 2WZEA 1JZ6A 3VSUA 3UERA 2VCCA 2VZTA 3WUFA 3LRMA 4D6HA 1JXKA 4PMQA 3EJSA 1J11A 1Y7VA 1U2YA 4WSJA 3ZSTA 1C8QA 4L4OA 2IXUA 2J62A 4U3CA 1ODZA 2D73A 2JF7A 3WQ8A 1MXDA 2X2JA 4DO6A 3BXWA 1V0MA 2JE8A 4PCTA 1CLXA 4P8UA 2XVLA 4CD4A 2CBIA 3WNKA 1PEZA 4TVCA 1NWUA 4WKAA 1KCLA 1UA7A 3AS2A 1HKMA 4W85A 4ACZA 4WJXA 1OINA 1SR0A 3BAIA 3LX9A 2NSXA 2D20A 1K9EA 4RE3A 1KCKA 5EB8A 1XGZA 3PZ9A 1EO5A 1JDAA 5CGMA 2VCAA 4ATWA 1TVPA 2J25A 3AYSA 1FA2A 2X2IA 4H8HA 2O9PA 1QI4A 3BVUA 4URIA 3GM8A 3WD4A 3W6LA 1FH8A 3WNNA 3CHCA 1TQUA 4A3HA 3EMZA 4UFJA 3ZT6A 1JL8A 2VOTA 2YIHA 2BHYA 2WZHA 3PZQA 1HTYA 3OGVA 3D4ZA 1C93A 1EIBA 2F7RA 3CV5A 3EJUA 5C71A 2DSKA 1GOKA 1EGZA 4UOZA 2YLLA 1KR0A 3O6AA 3MO4A 4AEEA 2RGMA 3N9KA 1UKTA 3HN3A 5BXTA 1T0OA 2BY0A 4F9DA 2CIPA 4DUWA 1W3LA 2ZXBA 3VNZA 2BVTA 3A4AA 2WWCA 1UR0A 5LYRA 2PI6A 1DWJM 3ARVA 3MANA 1C8YA 3WUGA 2PBGA 3THCA 3GZAA 1F4AA 4OBRA 4W8BA 2W63A 4UQCA 1O7DC 1UWRA 1E43A 1QNRA 1V6YA 3MUZ1 4L4PA 3WSUA 1JD9A 2V3DA 3N12A 1WZAA 3AIBA 2FDMA 5CSUA 4JKKA 2XVNA 4LPCA 3AQUA 3RM9A 1KGWA 2J4GA 3ARUA 4M24A 5DEZA 5BRPA 3VGEA 2ZUTA 3D3AA 1CLVA 1E6QM 1RP8A 3SCRA 1QNSA 2ZXQA 2BNJA 1ZB5A 1C7SA 5BXPA 1C7TA 3II1A 4S3JA 3GXPA 1GZJA 1HIZA 4MJ4A 3AZTA 1J0YA 4Q22A 4P7QA 4J7RA 3CHDA 4QLJA 1CECA 1KBBA 1Z32X 1V3KA 4WK9A 2OSWA 3N15A 1US2A 2YJQA 2CBJA 2J77A 4FMVA 5E09A 1HJQA 2WPGA 1VBUA 3VM5A 1A3HA 1J0ZA 2QV4A 3S5YA 1KXQA 5IDIA 3VTRA 1LL7A 4H04A 4NZFA 3ZIZA 1LJYA 5IHRA 4IPNB 2X1IA 2J79A 3K4DA 2WHKA 3WDIA 3W82A 3IJ9A 3LXCA 1EHNA 3I3EA 5IFPA 1TCMA 3M7SA 2JIEA 4W7VA 3CZEA 2W91A 1FFRA 4Y7EA 2CKSA 4XV0A 3LPFA 4MDOA 4PSRA 1HX0A 1JZ7A 1JZ5A 5CG0A 2ZUVA 3BMVA 1E4NA 2DQXA 2QHAA 3N13A 2CKRA 2VZUA 4FLQA 3CZKA 1CXEA 2GJXB 2WMFA 3DX1A 4PTXA 3WIJA 4NZCA 1UZ1A 4PMXA 4F8XA 3CZNA 2E0PA 3F5KA 2BY1A 2BVYA 2PB1A 1CXHA 1EQCA 1QI2A 2ZIDA 1QW9A 1KGXA 2YFOA 2BHUA 1LF1A 3MSGA 3SCNA 6A3HA 4AC1X 3WF0A 3NSXA 2OWWA 3TA9A 1XCXA 1CTNA 1W9DM 2VRJA 5GPRA 4GO8A 1WO2A 1FFQA 3CZ8A 4QDMA 4M1RA 1Q6FA 4JZ5A 1D7FA 1CDGA 1R46A 2ZUUA 1JDDA 3WF3A 3ZJ7A 2WMIB 6TAAA 1J0HA 3KLLA 1XD1A 1CXFA 4DM1A 5IHSA 5A6BA 1HF6A 4AIEA 5CLTA 2V5DA 3GTNA 1Q6CA 1W9XA 2GUYA 1CGWA 1U30A 3AFBA 4DWSD 5A6MA 2YOCA 1CNVA 3BSHA 1B9ZA 1ZU8A 1GOWA 4GXPA 1JDCA 1B2YA 4H7VA 3WNOA 3WUBA 1AMYA 2W67A 4WF7A 3ZJ6A 5AYBA 2VT0A 1EOMA 1JFHA 3PHAA 2X05A 2XTKA 3F5LA 4J3XA 3OBAA 3VO0A 1NH6A 3OZPA 1UR8A 3SIMA 3G6LA 4ZXOA 1TMQA 2DIEA 2VVSA 1ISWA 3WEZA 4BQ3A 2ZUNA 3VIKA 3CGTA 3VINA 1GOMA 3EYPA 3IJ7A 1VENA 3AS1A 4BZYA 1CXLA 1VAHA 2GDUA 2UY2A 3K4AA 3EDFA 3O9NA 1NARA 1JG9A 1JYVA 1E72M 2VZSA 3KZSA 4J3VA 3VD4A 9CGTA 1UUQA 3EJRA 2VC9A 3GNOA 1BGAA 2DH3A 3WH5A 5CJ5A 4W5UA 4GI8A 3THDA 1GVIA 3DECA 2ZUSA 1NWTA 2W92A 4GZJA 3ALFA 2XPKA 2YL6A 3AIQA 4UNIA 2WHLA 4FNRA 4TTUA 1BQCA 3BVVA 2XM1A 4MDPA 3PBGA 2WW5A 3WELA 1NQ6A 3BGAA 4C7DA 2WVTA 1HJXA 5EMYA 3RM8A 4FNQA 1M03A 2G3NA 1TA3B 1PAMA 2ZWZA 5TD4A 2FH8A 3MMDA 1JXJA 2X2HA 4LGXA 3ZJ8A 3WF1A 1OM0A 2GVYA 2G3IA 2VZVA 3B8SA 4FNPA 5AC5A 1O6IA 4OZOA 1MW1A 3A24A 3F5JA 4AEFA 3PZGA 5I78A 1DWGM 1K6AA 1UD2A 1TQTA 4MB3A 1W9VA 3SCWA 3T08A 2JF6A 1PBGA 2O9TA 4OOUA 3SCUA 5BYWA 2V3EA 3SUWA 3AXHA 3WBAA 3W6MA 3MMUA 2VRQA 3UG4A 1FP8A 1WDQA 3EDJA 4JKLA 1PS3A 3BUPA 1KB3A 3LPPA 1ZS2A 4NZJA 4QLKA 3WH6A 5D4YA 1J10A 2VX7A 5FCZA 1BF2A 3NIYA 4OIFA 5CGTA 3LMYA 1KTCA 2VX5A 1WDPA 5DMYA 2DSZA 2Y8VA 3WN6A 2E9LA 2WVVB 2X0HA 3W25A 4U3AA 4YPJA 3TTSA 1TQVA 2WAGA 2XN2A 1J01A 1EDQA 4EE9A 2F1BA 3CZJA 1NM9A 1UA3A 1W9UA 2EBNA 1D2KA 3KWXA 2J7GA 1E3ZA 1OGGA 2FHFA 1E56A 3QHNA 4WSKA 2XJ7A 4XUYA 2FGZA 1R7AA 1GPFA 4V27A 3U5UA 2OYMA 2BS9A 1UR1A 3RPMA 1OT2A 3KE0A 2D23A 3A4XA 3SUVA 3A6OA 5JIWA 2WSKA 4J3TA 1W1VA 4OOZA 1ZBWA 1R85A 1FH7A 3SEPA 2BY3A 4NF7A 3IGUA 3BH4A 4MTVA 3FAXA 3W37A 3WEMA 2CPUA 4WKHA 5CXPA 3VDAA 4D6GA 1G1YA 1GQIA 1AVAA 1IZJA 1XH2A 2D0HA 1E6XM 4HOXA 4D6EA 5A6SA 2XN1A 4CU8A 2G3JA 2WANA 1OD8A 4JL1A 2E3ZA 2FYVA 4F79A 4D1IA 4M80A 2VNCA 4U5IA 3ZM8A 2WVUA 1QHOA 1KTBA 1WAWA 2TAAA 3RM4A 2F18A 1CZ1A 5A6BD 3DHPA 1P6WA 1V3LA 3QOKA
chains in the Genus database with same CATH superfamily
1I1AA 2JIXA 5CZ0A 2OQLA 3W7KA 4MFEA 2DQJH 4NC2B 5H94B 4ZB0A 5HUPA 2DMCA 2O5XH 3KDNA 4POCA 1ZJIA 4PJ5E 3KCOA 2WUBL 3GTXA 1AGDB 4L4TE 2XYLA 5AL8A 4YBLC 4PP2B 3MRNA 4JREB 4ZW5A 2O7QA 1U41A 3TU6A 2J43A 1V03A 4KRUA 3SRFA 4AZUA 3TX9A 3U82B 3QJSB 2J6EL 5BV7C 3QCVH 4UIOA 3T3MB 1A6AA 1B4LA 3MA9L 2EG7A 2IPJA 3FDKA 3HLKA 3OJGA 2K70A 1LQ2A 3MRBB 3QN3A 5IFTA 4ZNCD 1IAOB 2NVDA 3UBXA 1NWOA 2X1RA 5D2TA 4HBCL 3NPUA 2W0LA 5E56A 1KIQB 1UHVA 4JFVA 4PN2A 3G5XB 2DIAA 1FWJC 2WMKA 4C65A 2HJKA 1YZZA 1ZSDB 2UZXA 2IJ0C 3NCMA 2BW5A 3RG1C 1MFDH 3QQ0A 4GNKB 3R8HA 3PNUA 2INZA 3OC5A 3GEFA 3PSWA 1KBVA 1VPOH 3IXTA 4O5LH 3T4AA 4CSSA 1GPOH 2J21A 4AQEA 1PKNA 2H3XC 4XVEA 4FF9A 3NOIA 4PUBL 2D7PA 4EF3A 3EYSL 3MA7A 4KZ0A 1JUFB 3PAZA 4YNGA 3TTYA 4YLWA 3GXFA 1WCBB 1IU1A 2A74C 4DBEA 2X6UA 3TC3A 5HPCA 2GCYB 4PS8A 4J3OD 1DTNA 5CPQA 5A6AA 4Y9CA 4YUEH 3ZE2E 3DKJA 1QBBA 4HYTB 3TZVB 2YD8A 5T9BG 3TU9A 1NGPL 1HQTA 1NA8A 4U1SA 1JF1B 1JAKA 4HA4A 3O6YX 4QGCA 2V9QA 4I8YA 4M3PA 4YXLL 3W83A 3BJFA 3H4HA 3P0YH 3MKKA 3F7QA 3UEZA 3S1VA 4OZIE 2V2TB 1RVFL 1QRQA 3WJYA 2AFNA 4PUUA 4XB7A 1FWFC 3N25A 3S1UA 4RFOH 4U6TA 1Q9OA 2G2NA 1J8VA 3AMKA 5I73B 3EX1A 1YPZA 3EYUH 1J79A 3AHZA 1S5IH 4HMEA 3UAJA 2FBJH 4N4QA 3G7TA 2E6YA 1ZZMA 1OGTB 4CBPA 3QEQA 4WCYL 3VGBA 2OB3A 2V30A 4L9ZA 3JZYA 4WFED 4AZBA 5IVXF 4NAMA 4Y8AA 2V3GA 1F56A 1QASA 4BSVB 1N8ZA 4PMDA 5IR1B 4TKWA 3G1FA 4ZUWA 2WC3A 5CQ1A 3ZLGA 3ZJKA 1D8CA 3WEXA 1BMZA 1W80A 2HDJA 4NU7A 3Q2WA 4KAQH 1KMGA 4LC6A 1PCXA 3U4EA 4Z76B 2XGIA 1VF5C 4TVPD 1FL3B 1QMLA 1QO5A 3CQJA 3U2JA 3LOTA 2FDBP 3UP6A 1JXGA 2F54A 3DX3A 2DT1A 1KJ2H 4DK3A 1FFOB 5F0MB 3TXAA 2F8QA 2VC2H 2OCZA 4P4KD 4AMXA 4WUKL 1NCHA 3AZUA 3OXRA 4BR1A 1XGUA 1H15A 3EGXB 4HB7A 1V6XA 5AVZB 3R7MA 4N9GA 4N2CA 3MBEC 3BQUB 4BJLA 2EIDA 2PCYA 4F7EA 4ZX5A 5JW4Q 4PZVA 2DZEA 3NQKA 4AQZA 1P6AB 5B38A 1Q9LB 1W3JA 1OFDA 2OBGA 3WFDL 1GTFA 5FWQA 4N42A 2PDBA 1T3FA 1UTDA 4Q3MA 5I8KH 2WB5A 3PXJA 4PUWA 4DLMA 2CR0A 1D7DA 3X3GH 2AXFB 2QCDB 2R9RA 1SDYA 3D8MA 3F85A 3T8MA 3RTQC 3PAJA 1YIXA 1E55A 1A5CA 4RAVA 1Q90A 4WHDA 2NY7H 3KVLA 2MUCA 1KRCC 3NDOA 3GEWB 4PJ8A 1U95A 4PYGA 4B97A 1AOHA 5I24A 4LDOB 5TAOA 3EO1A 5EOCL 5D7HA 1OSZA 1XF0A 3KAOA 2W0KA 3C12A 3ETBJ 3MFFB 3B7SA 1W32A 3FUFA 1EEUA 5T9CE 3M07A 2DYPB 2LV4A 1OFQA 4PJFF 4V15A 4MDJA 4ZOAA 3ZYJA 4BXVA 1OTTC 3J8F7 5I1EL 4AZ7A 3EGDA 1TPC1 4HK5A 5I71B 5FDWA 3EOYG 1BVLB 3MLXH 5DMMA 2AGKA 5KSBA 3T4YA 3QNYA 4YYCA 1J87A 3OQRA 1ADSA 2O30A 3PWPD 2HRWA 1H9DA 4E68A 3DX8B 3MI6A 1PZSA 3K6DA 4KQ0A 1WK0A 1OF6A 5A3IC 1D5ZB 2VFFA 5AOLA 4L05A 4PLKC 4C56E 4ANUA 5I6OA 3TEXA 1UASA 4TSAH 5A6KA 3NRQA 1ONRA 3HB3C 3TVAA 2MCG1 4L61A 1RZ7L 5BS0E 2X6BA 2CGYA 1PLGL 3T0EC 4NSBA 5E6IB 3WJXA 1GMIA 5KJ7E 3NOEA 2M1KA 5D70L 2ZOXA 4NZ8A 4F9PA 4N6EA 3TXVA 3WNPA 3TZVD 1VPYA 1HI6B 4QE4A 3RWIA 1CW2A 5I1CL 4OECA 3REVB 1JDFA 2OP4L 4Y2DD 1ZHBA 4Y4KB 3RWCB 1TPDA 4JIIX 2QPUA 4O00A 3U0TB 1A7PH 3QORD 4JO5A 4K94C 4PJFE 4XVSH 5EO1B 3LZFH 2RDWA 3EWWA 2ZJSL 2YAMA 3NTYA 4IFOA 5D7SL 3NIFE 1YNKH 4B3KA 3KBPA 4RWYH 3D85A 2EPHA 3F4CA 3RWJA 4DI9A 4DJEC 1R0MA 2TRHA 1II4E 4F15C 5JNYB 4TUFA 3VD7A 4IIQA 3KH4A 2DMBA 4XMPH 4NXSA 2QDVA 5DGRA 5FV2A 1NSNH 3ZE0B 3HBGA 3QKZA 3QV9A 3BPLC 1ITBB 2OQHA 1O5PA 2IGFH 3KGTA 3NJFA 1W8OA 1HJWA 1YX1A 3WG6A 1OGAE 2R4RH 3VKKA 1KN2H 4L3CB 4OCSL 3U2IA 3AIRA 4F2MB 1TFVA 9RUBA 2Y1YA 3H9SE 1KRAC 3KRSA 2OI9C 5ITBH 7A3HA 3KHQA 5T1DH 4Z0BL 4G42A 1R5WA 5ANHA 3ULVH 3ZGHA 1HAWA 2YOAA 4XCEA 3IVSA 2OMVB 4D3CL 4KIEA 2WO3B 4ODVH 1WYJA 2B1AH 2V5RA 3H26A 3N4EA 5FKPA 5I8EB 1MHCA 3MW7A 4WVXA 4XD4A 5FAJA 4WXYA 1L2QA 3FB5A 4RE0A 3ERPA 2DJ4A 1G7PA 4EI5B 4IFRA 3U0TA 2XUWA 1E4LA 2BVPB 3BOLA 2ZXCA 4XWUA 1YG9A 4IIFA 3EH4B 3LIZA 4PJ7E 2MRYA 1AJ7L 4AENB 2ESVD 1M3UA 4ZQCA 4OBSA 3VI4F 3UC0H 3G6MA 4JTRA 3LNMA 5IZ7A 5BVPL 1Z2KA 3ANYA 3GSWB 5IHWA 2CR3A 1KCXA 2CLIA 1R3HB 3Q3GB 4G56A 1A7NL 3FYOA 4XKMA 2IPWA 3ZIMA 2H3BA 4MPQA 1J7VR 2NNAB 4Y5VA 2R0KL 5C2BL 3L9CA 4X2PA 4QFUA 4L4TD 4M3HA 1BLIA 3VXRA 5AVHA 4A21A 4OUOA 4LNVA 4UAHA 3SDCC 3PHSA 4UMGA 1GZ1A 1X6NA 2EC8A 3EF7A 4L3CA 5FOJA 2QF8A 3IFLL 2XH0A 3MRGB 5DCEA 4C6BA 2P76A 1IAIM 4NKCA 3IRCA 3W76A 5JYMA 2L7QA 3S9DB 3WQEA 3DN5A 3GIYA 1C8PA 1AS8A 2FQIA 1WEJH 3MMTA 4H9YA 4RISL 2A2IA 5FCZA 2DQEH 3PG2A 5TK2A 2G60L 2EDOA 4HJUA 4MNGA 2QEJA 1PY4A 4LQ1A 4OF3A 4P23A 4WI2A 1H5VA 3AVEA 5EUOE 5FIPA 3BWAB 1AGEB 4FXLA 1U4FA 4JTAA 3JW7A 2E5DA 1JI1A 3R1GH 2IAMD 1YUKB 5D9SA 4X83A 5JORA 4S0HA 1DE5A 2F6UA 4XP5L 2HZGA 4UFHA 1LXMA 4FB7A 2D31B 3GMOB 6XIAA 5IB3B 1EF3A 3G8RA 2GJRA 3KP0A 1RK6A 2DZWA 2EPKX 4RIRA 4QROA 4YZFF 5IJVB 1AJZA 3I65A 3OYXA 2G4EA 2G5WA 3PBVA 4GWEA 2BNRA 1O7SA 5HGBA 4GSDH 2ZYFA 3CFKB 4WUUA 3AREA 3R13A 4AYMC 4KTGA 2OW6A 1KY6A 4JPKH 4OFVA 4WFGD 2EH8H 2XI9A 3M0HA 2FGWH 4K8RC 2ZZ7A 4IPIA 4IBYA 5EPMA 3ZE0E 1MF2L 1DPMA 2A3EA 2VELA 3F62A 7TAAA 1GHRA 5FLUA 4OFYA 1DVQA 2Y5TB 5DD1H 1ZJHA 1CICD 1EIXA 3SE3C 2DQTH 4WHYG 4WK2B 1H3XA 1IBDA 1G9MC 3N1QC 4HVBA 1EZVY 2Y2WA 3EA2A 3BE7A 3G22A 1ZVNA 2AQSA 5E8NA 1MDLA 4JZJC 4HCDA 1J12A 2X9ZA 4ERSH 3GXUB 5SWSB 5DHEA 5E1QA 2CJSA 5IR1A 1M05A 4W4OC 3A4FA 4U0QB 4WI0B 2UZ9A 3THAA 1DQTA 3F7JA 1JIBA 3K4WA 1NGZA 2XA8L 5AHNA 4XD6A 2ED8A 2G2RB 1INEH 3IB4A 5IT2L 4L1GA 4LFHD 3TK7A 5EBAA 1W16A 3PTQA 1I3RA 4J3OG 3C6EA 4E5XG 1ZBCA 2YA1A 3DIPA 5DD5L 5XINA 4DHLA 2HT3C 4WDTA 2P8MB 2BH0A 4WKFA 4XPAL 1AKJA 5KSAC 1M01A 4P8XA 3PP4L 2OMUA 2VUOA 4APQB 1H0DB 4K7FB 3VX1A 3SUSA 5LNWA 3F04A 4PY7A 1M7OA 2QIWA 2OMWB 1HSBB 4L64A 4PMYA 3SD5A 1H3TA 4GXUM 5AW5B 3VA6A 3N04A 2Z2AA 4KWVA 1DR9A 2GBTA 4JQVA 3SJVA 5BZWA 1IAOA 5AZEL 1OCOB 3WFHA 1FCQA 2I14A 3FB6A 2WKJA 1RY8A 3E9AA 5I0XA 4Z7IA 4AXWA 3U6RA 3LTYA 5EORH 3WQWA 1WBYB 3K6OA 5HD8C 3P0VH 2WKGA 3P3YA 1FO0B 5KSBF 3TR2A 3QTPA 4IBQA 3MNZB 4YSCA 2UX7A 3LSOB 2EG6A 4W88A 4C4BA 1OFOA 3PG9A 4HD5A 4DYJA 3GBMH 1EWHA 1JF5A 1UOKA 2X6AA 2IWEA 3F4NA 4N6RB 2FCBA 2W65A 1HZHH 3P4MA 4JNMA 1R3TA 2OLDA 1CFTB 1THCA 4IP7A 2HX7A 1YDPA 1Y6NR 5EUKA 1QSEA 4UU9A 5KWYC 1AQFA 1NGQH 3BDBA 5CP7B 1L8NA 1ED3A 1QRKA 4N9EA 4EKJA 1A4KA 1W0VB 3JV6B 2HFTA 1JZDC 3U36A 1E4JA 2BZ7A 4F3FA 4JCMA 1SEBA 1S9XA 1S9YB 3KPSB 3WLMA 4GW4A 1UXSA 4WW2C 1E28A 3O0LA 5BS0A 1MFUA 4JFOA 4BFIA 4E9RA 2F7QA 1E4HA 1T1WB 5B39B 1MSSA 3LTSA 1KXVA 1J8HE 1C90A 4AD3A 2XOTA 2CWRA 1D9KC 2VMJA 5E6YA 3CDFA 3W1MA 3GINA 3IMTA 5DD3L 2QCLA 3IGHX 3TMQA 3UWZA 3W27A 3X12B 3QFJD 4CQBA 1AGFB 1ZIAA 1CDJA 3BP5A 3NK3A 1A6ZA 4KHTL 5EOCJ 3M16A 2VLJE 4NUJB 1EF2A 2BNQA 3UGUA 4Y90A 2WYZA 5KYYB 3SN0A 2B20A 3GO2A 1LE5B 4F66A 1W1IE 4Y2LA 1CU4H 3GNNA 1D9EA 4ODTL 3QJVB 3B97A 4F7KA 1UWXK 3MA9H 4PRPD 4Y16D 5DYOB 5EB9A 2DQFB 2H0FA 4MY8A 2GJ6B 1IC0A 3TEYA 1X1ZA 4I4WB 3GE7A 1EGJA 3DFSA 5FF7A 1N19A 2R59A 2KQMA 1DSFH 4UT7H 4V2XA 4FK9A 4ERGA 2BODX 3R79A 3GBNH 5AOIA 3NIDB 4GQPH 1BQUA 3VD2A 1OBAA 4G8TA 4QSFA 4FTVD 1FGVL 4PM1A 5T3XD 4JN7A 3BPOB 3UJIH 4P48A 3RGTA 1VPOL 3LZ5A 1QK0A 2N7SA 3IYLW 5C6MA 5JIIA 4ZJ9A 1R33A 5IVXA 4J9JA 3DJRA 4J3SA 3BSZA 1J05B 4NQCD 2Y07H 3POHA 3JTTB 1GGYA 5GJNA 4Q8QA 1WD9A 4GY1A 1TQCC 1KLFB 2BIPA 5HMDA 4LGRB 4WLCA 1PLAA 2H0PA 1G0CA 1CYXA 1EEYA 3C2FA 3RHWK 2B1OA 4PODA 1Z3NA 3LQAL 1ET7A 3N0AA 4LKCB 2NV2A 3RU6A 4C7FA 3II2A 3AOFA 1RJYA 3CN0A 5E23A 3X13A 4DFIA 3H2NA 1LE5A 2FZMA 3S3GA 2A7NA 1NMCB 3G04B 4PGCB 5FYKD 2FK9A 1UT2A 1YEFH 3ZKQD 3W7GA 5HGDA 1PYWB 1MHCB 4N8PA 4AHPA 4FQPA 3VWJB 1J5SA 1YDYA 2OSYA 5EMUA 5AQ0A 3VI3F 4CC4A 4RVBA 2XM2A 2A7RA 2HPIA 3LA4A 1QSFB 5D7IB 1EP2A 4APXA 1AACA 4C4KT 4FQXB 1XGRB 4AJ0A 3LD8C 1DBAH 1JNDA 4F5CA 4H8VA 1I9RH 4FDWA 2D2CC 2VDPB 5I03A 2FRGP 2DBLL 5FJPA 2GAZB 3JXAA 4NKOA 4ZK8A 4A3UA 4HK3J 2J5LB 1HNYA 2BOBB 3ZHFA 3KOYA 2EDKA 2QMJA 2NUPA 2V9TA 1ETJA 3ML8A 4MZIA 5EZOL 3TFKD 2A9AA 4GI9A 5ITFB 1E9OB 5AENA 1M53A 3AJ7A 3FQTA 3BX7C 3VC6A 1O5DT 1MZYA 2H1XA 3FCSA 2J56A 3OC8A 4YX2L 4F7PB 1XAUA 4J2QA 1DWAM 3H2CA 5EMKA 2PAJA 1Z42A 3QJAA 5EYWA 1ES0B 4GS7C 3TR9A 3ITLA 1F61A 4PWFA 1P7KA 4YK4C 1NMAH 1F3WA 4NYLA 1GNXA 4M1GL 4LAMA 3W7PA 5G4OA 1RJYB 3X13B 1UWXH 2Y5EA 5E6IA 3JV0A 3KEHA 1UG6A 2UXFA 4H6EA 1QI5A 1X9UA 3WIFA 4AKQA 4K8RH 4BA0A 3R6IA 3NQIA 3W2KA 1PO9A 5ACZB 2J7BA 1FHGA 3U9UA 1UB6B 4LAQH 1WA2X 1TCDA 3DO7B 3LHYA 1SZNA 4OF5A 5JQHC 2GBUA 4J3ZA 5GS1C 3S2JA 2FJUB 1YEGH 3E8UH 3LPGA 4EXBA 1X9LA 4M61B 1Q6LA 5DD0L 2D24A 2I16A 3Q58A 4U1SB 4MD0A 4XI5C 4DP6X 3U7VA 2A6DA 1WUZA 2OMTB 1OQXA 1ITUA 4HCLA 4ZMOA 3DARA 3M0JA 5I9QB 2VQ1B 1SPQA 4NBXB 2V5CA 5HHNA 4JN8A 5DY2A 3QZMA 2YXFA 4PJDB 3L45A 5FPIA 3K8MA 4MS6A 4ES4A 2E6QA 4KZEH 1EV2E 1RZQA 3FQUB 2YD1A 1F1DA 4OV6F 1YUHA 4Y4HC 4HN8A 4QJ3B 1Q6EA 4JAWA 4HHAA 4X8JB 4N8VG 2PPGA 1RUQL 1FWWA 3GSQA 5BRZD 4YDIL 5EIIG 5T1LB 5HULA 2J88L 3KYKH 3RM9A 1XCQB 1DHKA 2RDTA 4RDVA 4EN3B 3DFNA 1IAII 4QCFA 5D2VA 4D71A 3ENEA 2YKKA 4HWEH 4HUKB 8CGTA 3GMLA 1ZT1A 2C3WA 4JO1L 5DR5H 3GUFA 3VGAB 1OADA 3GO1H 4LPUA 3IJ8A 1MJ7L 3X1FA 3GFUA 3ZU8A 4EX4A 3Q43A 5B3SB 2CW6A 5SWZE 2EABA 3KGSA 4HK6A 3SQOH 3OB0H 1GOXA 2ZOTA 4WUUD 5EEUA 2VABA 4MS8D 3IE9A 3MB9A 4LSUH 3OA3A 1Q4NX 4E2VA 1KSRA 4URKA 2OMAA 1JGUH 2DYSB 1XDTT 3GSRA 3SQBA 2ARJQ 3MCKB 1MQKH 2HE5A 4D1JA 2Y61A 3PM6A 3L5WB 1G6RA 3FU6A 4PS7A 1YXYA 1PKQB 1LUCA 2CUIA 2HT2D 2WTRB 3V6FB 4CVXB 2CLRB 4CUCA 3ATZA 3WUWG 3MVTA 3ZMEA 1TMLA 3CH1A 1RPKA 3QWNA 1JRCA 4TQ8A 3ZSSA 3UCRA 1UQZA 2VDOL 3MRRA 3N42F 4GG8A 4FN0A 3SQRA 4XP9L 1ZBVA 1F13A 4YHYC 5ICZB 3PE9A 1ZK5A 4YE4L 4ELMB 1UYQA 4LPWA 4O8RA 2IADA 1E5ZA 4A04A 5T1LA 2ZSVA 1U3NA 4MWFB 2IPTH 3LKRB 3HI1A 3LHVA 3LZFL 2WQSA 3S37H 5HDBB 1R3KA 4JBSA 3EJZC 5H2BA 1PU0A 3GY1A 1CMOA 5A94A 2BWIA 4HUWB 3ZX1A 3VKAA 4MLJA 5GGVH 3LCYA 1KELH 4HIJA 4AL8H 4FXFA 4GKNB 1IJNA 1WC7B 1EXGA 1JGIA 2A38A 1RZIA 2JKLA 3BZFB 3PF2A 3CQHA 2NQLA 3KM8A 2K3TA 2KL6A 2ZWKA 1MMFA 3EOSA 4OSUL 4NPYB 3LU2A 2V7NB 5DWPA 1EBPA 4DKEL 1KWGA 2AGJH 3NJLA 2CESA 3M47A 3CH0A 3FVDA 1TJ2A 5AB2A 3AIWA 2YMTA 1OM3L 4CNIB 3QNZB 2HVKB 1M6JA 2WTRA 4CVXA 4IIDA 1KN2L 3W84A 4YL2A 3W23A 1BBDL 1XCWA 4JQIA 2CFFA 3S47A 3L3GA 4BWWA 4B96A 4L0YA 4GC3A 2I9EA 5ICYA 3LJ3A 4L4VD 4PWHA 3AI0A 2BTMA 1KM3A 3IKCA 1NKGA 4DUVA 1DVUA 4QF1B 2JKIS 4NDMB 4N02A 3MAWA 4OQVA 3TNBA 2H9AB 4M5TA 5DFVC 1OF8A 3BJSA 5D2NE 2KZHA 3EWBX 3U2EA 1N2VA 1RJRA 2A3CA 4QEEA 2J7FA 1TU2A 2IADB 5DT1L 4EAEA 1E6RA 3SCMA 2VW7A 4CNPA 2J72A 4KV5F 2JKPA 1N8ZB 2ZX8A 4Y19E 4F9LC 3MLPA 1J5DA 3QY6A 2PTWA 2EVIA 2YXWA 1BQGA 3GMNA 2FECL 2PPEA 3PGFL 4TUOB 5I06A 3BP7A 5I8CB 2BGQA 5FA4A 4HUWA 3UC0L 3CWOX 1F6YA 1WT5A 2YN5A 3MJ9A 4UUJA 3V5DA 3VK5A 3OVUB 5C0BE 4N2AA 1XBVA 2OL3B 2UUDH 4HBCH 5F9DC 2ZKWA 2WIMA 3DJTA 1GVQA 1MSPA 1IUZA 4CNIA 3FTGB 2AEQL 1BAGA 1JTPA 3C08H 3ZTDC 1EGMA 3AMDA 4HHLA 4LIQH 3IFLH 1MCBA 1IV8A 4Q74A 4JE4B 2E09A 1FFNB 2QCEA 4L4TB 4W9LC 1OTSC 2EQDA 5GGUB 2ACSA 3N42B 3NZRA 3A6CH 3HR5B 3SDXF 1EPXA 4C6KA 1UJ3B 1HL4A 1KO0A 2VR4A 5GJSH 3K13A 4GKZB 2OMZA 3JWNG 5SWZA 2AK4E 4NO0A 3JTSA 1NAMA 3WKNA 1U3JA 2UYLA 2WM0A 3QUXA 4GKSB 3TP4A 4P49A 2EIEA 4D0DA 1R3YA 4JRXE 4R9OA 3MBWA 1HKFA 4PRPA 3T3MF 1US3A 1J1OL 2CITA 3I4KA 2NR6D 4JX4A 4OVXA 1M7IA 5LUMA 1QR4A 2DQCL 2VMCA 1S8DB 2XTJC 2HVJB 4S11A 5FKAA 1E9IA 1OK4A 1UWQA 2C14A 3FH5A 1J05A 3WQGA 4NQCE 3N41F 1MCRA 1X5LA 1Y0LB 2C3VB 2XWRA 4YZWA 1HKIA 2RDXA 3MHFA 2ACRA 3VDHA 1JNLL 1SYSB 1W3IA 4LANA 4OAWB 2YQGA 4EI5A 3WH8A 3GIVB 3RLHA 5JHDA 2O9OA 3RZWA 2EECA 3DBPA 4S3DA 2LT9A 3PL6A 3MGOB 5KBLA 4IG2B 5FJJA 2EDYA 2QLYA 4TQPA 2XTLA 4J35A 2OGJA 4XVUD 4M4RA 1TUPA 2UZYB 3V4PH 4BZ2L 1NWRA 3W81A 5BOFA 3C6LA 1FVPA 3P4NB 1QHZA 5AEAA 4LS0A 3WS6C 2MQGA 3D30A 3KXFA 1EJSC 4JQ3A 2NY0D 1OPGL 4UQEA 2NZIA 3U48A 1IQDB 1OB0A 1WZ1H 1BXNA 3PUEA 1UP2A 3FCTA 1H7RA 1TV4A 5KN5A 4I3RH 1SHWA 3MNWA 2DJSA 3B3IA 4KO6A 1OAKL 3WKPA 2VTFA 3EG9B 2WMJA 5FGBC 3VMOA 4PJ8C 5D8ZA 2WBJD 1Y07A 4OCRL 1MWAL 1VEMA 3QHFH 1UIOA 1OCQA 1XLAA 1MFEH 1KTDB 3ISWA 3DJ9A 4AK2A 3ELAT 3DESA 2VN6A 4TXEA 1AW2A 1I1AC 4PCPA 3FW6A 1J9TA 3S5LA 1WFIA 1SO4A 2PR9A 4PV1C 3L16A 3EOTH 1CT5A 4K0OA 4U1GB 1ZVSB 3TURA 1ECYA 1RK0A 4HYWA 5J1AA 2QUNA 1XIFA 5DD5H 4HPJA 3L1EA 4PWJA 1EX5A 3E6FB 1SBSL 4ECNA 3LS5L 1JULA 2XIIA 2YAEA 4IMLA 2YPLB 4X5RA 4P2OC 5ETUB 4QYOA 3MLSH 4TMPA 3TVMC 3ZHDA 3IACA 4QG8A 1AZCA 4UQ3B 3IWPA 4PS4L 1T5XA 5DHYB 3RDTB 2OLHA 2YQ2A 4X0NA 1OGBA 1I82A 2EDJA 2ZP8A 2HMIC 4XKYA 2A83B 4I3GA 3KRUA 6FABL 1JGVL 4JTUA 1VJSA 3TSBA 1P4IH 3H3KA 4DGVL 5F7MC 4ZX3A 1ZDQA 4LCQA 4MZ8A 4O58L 3RX2A 4Z77A 4W9TA 4AD0A 1DFBH 3NDYA 2WCGA 5E6ZA 8RUCA 3MMWA 4UV7H 5D7LB 3QA3B 5EA0L 3UTSA 3BH9B 1IWPA 3WDPP 3CVDA 2AQRA 1UB5B 2FLMA 1GJPA 2YSSA 1N0LA 3SUTA 3DDFA 4R2GB 3T3ME 4HUVA 4O1AA 4PW9A 5GVJA 1NLDH 5FCSH 5L4JA 4WWID 1KKRA 3K71A 2E27L 1P1ZA 2WTOA 2QKFA 3MV8B 1JZ8A 1E1CB 1P1MA 4NAJA 3B9VA 1TPB1 4KF1A 4DO4A 1C3FA 4DP1X 1NCAH 4E41D 2NLJA 3QVAA 1KYDA 2X3AA 4PN6A 3HG1E 5T5NG 4WGXA 2NYYD 4K9EH 2ZYIA 4PY8J 4ZSOE 5EWIH 2AABH 3O2DH 4L3EE 4Z78A 3KOWA 3I6LD 4E4UA 4JY4B 2JB6A 4S1DC 3V10A 4XC1L 3K2KA 2EDLA 1Y18A 1G9HA 1ZA3A 4P23C 3PANA 1OABA 3MLVL 2PP7A 2BSCA 2G2RA 3LZ3A 3RE0A 1AW1A 3SKUD 1I2NA 3ZKSD 4DIAA 4RCXA 5I8OH 3VWJA 3V5CA 4IRZA 4DGIL 2NZLA 3D7PA 3IGAA 5B8CB 3QY8A 3TH4T 1H3WM 1S9VB 3O05A 2R1YB 4AEIL 3FO0L 1U5VA 4ZOBA 1MCSA 4LPVA 5CEZD 1U8QB 3AU1A 3SGJA 4DWSA 4KI1A 4KHXL 4J27A 3KYOA 3O4LB 1EX0A 3OPZH 1UWSA 3PZTA 4GACA 2PWDA 1CLKA 1OHLA 4MMWA 4LEBA 1KGIA 4K3EH 3N2OA 4Y5VC 4HQQH 1TLMA 3HZMA 2QVTA 1B6DA 2XWCA 3RP1A 2ZJSH 3JZEA 4G9DA 3OKMB 3ZQXA 5A6TC 3DHFA 3LHUA 4W84A 5J04A 1T83C 2HG5B 4ENZA 3M8OL 5ABAA 3C5ZD 3APDA 1XIWB 5LXVA 5DSCB 1ZT7A 1FNHA 2OU4A 1WFMA 2FPYA 1FAIH 3BYTA 4UT7L 1OE1A 1AXSB 4DP4X 3Q48A 2GK0A 5BMWA 5I02A 5E2UH 4ZTYA 1VLWA 1T7WA 3TA6A 3F12A 1PX8A 1THAA 2QJIA 3DX2A 4GG6A 4ROQA 3U6XA 1MHPH 2R4RL 3CU1A 3BXNA 1RH9A 4G7VH 3P8IA 4S3FA 5CPMA 4TVDA 4IOIA 2LU3A 3BW9A 1MAJA 3CDZA 3MRHA 5DC9B 4PJCF 3V7MA 3I50H 2OZ3A 1DHPA 4IKNA 4WEEA 3TJHD 1YADA 3H12A 5KJRL 1C5DA 4TUKL 5LDSA 2YB1A 2R29L 3BSGA 5E5MB 3C4UA 3HTWA 1TEGA 5D33A 4CLMA 1I60A 2I9TA 3QFGA 4GAYA 2EKSA 5DDHB 2YK1H 4NBZB 3T0AA 4DO5A 1W56A 1BKHA 2RGSA 3EBAA 3ECVA 5FM8A 1UGNA 4F7CB 1D7KA 4JTLA 3BKMH 3T0BA 3W2NA 3B6SB 5A43C 2H2PC 2AJYH 1REQB 5CPOA 3CLMA 4CVZA 1PV8A 1A4BA 3ARBA 1CT8A 4UAOB 3D47A 1XRTA 1Q0XL 3TV3H 5CEZE 1QABA 1ULVA 3GZOA 3C56A 1DQDL 3N4AA 5B7EA 3ZL1A 2PS2A 1V7MH 1E15A 4HKPA 5CC7A 5KVMC 3FCUB 5HGAB 1F8TH 3VXRB 2GL5A 1J86A 3FB7A 2ESVA 4KU1A 2VGBA 4WTXA 3LKQA 2NNFA 1KBKA 2QR0A 3B37A 4JRYE 1J9YA 1V3HA 3ENLA 3TE9A 1A66A 4ANVA 1P0DA 2WZHA 5CEZH 5FYKE 3ZRCC 2DZTA 3OAUH 4GP4B 1U95B 4EEEA 1SO3A 1SJMA 1I8JA 1UC4A 2XFWA 2ZKHL 2XETA 3S4SA 3MJGX 1I2OA 4ZG1A 4NHVA 2I26N 1XDLA 3S1XA 1F58H 3LXAA 2PYFB 4AV5A 2QNEA 5E5MA 1WEJL 3HAEB 1CGXA 3M46A 3AXXA 3OHXB 4OUUB 4POUB 5BOPA 4GY7A 4M48L 1Z1WA 3FB8A 4YX2H 1IQWL 3IDNB 2PWGA 3DJZA 4L2LA 4MA8H 3WAKA 2EG8A 2G97A 4L4PA 1RPXA 1WKFA 2CBTA 2F84A 4IXXA 1AC0A 2DWEB 4LQFH 9XIAA 1MEWA 2XG4B 4TL5A 3ZMNA 2WUBH 1JN6A 4YSSA 3EWUA 2H1LM 1XL9A 4XCCH 5GSRA 1W1B1 2AEPL 3DV4B 5BQ7A 4Y2WA 1BQHA 3IJYB 3MYJB 4DPRA 1A53A 3GD6A 5A8GA 1WWBX 2H1PL 4FJZA 3DDGA 3EIFA 3O7UA 3ASNB 4TM9A 4JGUA 4N1EA 1CB2A 2QJHA 3BLOA 1KTLB 3E8UL 4RAUA 4DELA 3L4UA 2QKSA 3DLQR 5GGTL 2DW6A 4R7DA 4LT9A 4G6JH 3F00A 4HNNA 5C0FB 4K2SA 1OAYL 2CZFA 1WOAA 3HNTH 2CLVA 2FYYB 3CJJA 2NY2D 2EJ1A 3P4OA 4QXTB 3FIGA 2BOEX 3LB0A 3VXOB 2VC6A 1NEZG 35C8H 1SO5A 1J9CT 4Y5XA 4NNPL 4JTCA 4GKNA 3L21A 2KZ1B 4OZ4B 2B9AA 5HI3D 5LWYH 4XBSA 4XG1A 2RAGA 3CL7A 4AL8C 1BWMA 3IU3B 4ZVJA 4QXUH 3WUWA 5A3HA 2DQTL 1FDZA 4OTKA 4X7SH 3PWIA 2EIBA 3IAPA 1WAEA 5ECVA 1KZQA 4FCHA 5J6HA 1F6PA 1QRNB 3BGGA 4PJHF 5HHVL 2J7LA 4KH9A 1K9TA 5DUPL 5EUOA 6PCYA 3K1DA 4H4IA 4GY0A 1X5KA 1A6UL 3RUGE 1X7IA 4ADSA 3VSQA 3H7UA 3ETBF 1WBZA 4GSRA 1E9QA 3CS2A 1KCRH 1LO2H 1EL3A 5MENB 1PKYA 1RI8A 3LN9A 4NQDA 1OYCA 1NGPH 2NW2B 3RIAF 1DVZA 5D1XD 3DETC 4K23H 1J9RA 1K8IB 2GQHA 2RH9A 3EWDA 5BWFA 4IGSA 2FEDD 2D8KA 2CCRA 3O6DA 3IV3A 3I6RA 2X4NB 3AITA 2TMDA 5A2BA 2D3LA 2OSLB 4B9GA 3QJFA 1SUHA 3PP4H 4MJID 4AZ6A 4DAGH 4PVNA 2YFNA 4K5MA 1KJVA 1AQKH 4MYXA 3B5GA 3HFML 3L7EA 1FQ0A 4GMSL 4XN5A 4YPGB 4EPEC 2X7VA 2VDOH 4TV3A 1PMYA 1V3MA 1ECZA 1Q0EA 3L4CA 4YDKL 1FE8H 1QAWA 3VD3A 4BGDA 2K7PA 2X1WL 1K4CB 4PJHA 2RFGA 3QOMA 4D8PA 4D6CA 1I4FA 5AYIA 4NSKA 3KDOA 1R38A 5EORL 5J11B 5LAXB 2X40A 2Z8SA 4Y9OA 5FF4A 4PJCB 1KBLA 4MF4A 4AY0A 1RUPH 5JHLH 4PWGA 2RCSH 1QFHA 5BRZB 2XGBA 4PV9B 5IG7B 4ZS6C 3UJJH 2EH7H 1GS7A 3R06B 1BTMA 3QDGA 4UCFA 4AZ8A 1VSCA 1A4CA 2MTAA 3T2LA 3FTSA 4FNUA 4JR9L 4PVBA 3V4BA 2OMZB 3PJTA 1C8XA 4ZFMA 3N43B 3BFWA 3N0PB 1TVLA 3ONBA 4W8LA 3U9PH 5CZSA 2B1HL 2VDQH 2WLNA 4OGYH 1HL8A 3UZVB 1XXDC 5IFAH 2NV9A 3MRGA 5JHBA 4DKEH 1I9IL 4QLWA 4Y1SA 2X89A 3HS0A 2O0TA 1K1DA 4XX6A 5KAQF 4ANWA 4E5XA 1QBMH 4CQ9A 3QAZB 1UD6A 1F1GA 3H56A 3VXNB 1LRQA 5E1HB 1QNOA 2Q6ZA 3VFUB 3GHPA 3HC3L 3QIWC 3CBWA 1G1CA 1W2KT 3NACL 4G6AD 2XUCA 2Z24A 1FYTE 1NEZB 2WNGA 4K5OA 5F7WC 1VB9A 4J28A 4K4KA 3TO2B 1IZCA 1SN0A 3B5HA 1FF5A 3QS2A 4HNCA 3ZMRA 4Z95H 1M3IA 4NGHH 2DSVA 3UG3A 2V5LA 1T04A 1VFSA 4EIUA 1WPCA 2AK1L 4EI6B 1JUKA 3BAXA 4UI2A 4GGHA 1JOIA 1MW2A 1FDJA 2DQUL 4R97B 1MCJA 3QEQD 4G8GA 5EOCH 2ZC8A 2BOFX 5JMUA 1J0KA 3VD1A 3PPEA 1WICA 2WWNA 2I57A 3KPSE 3QQ3B 1TV5A 2CLZB 5I3KA 1PZBA 4OU3A 2OYLA 1BG4A 3D2TA 4JG5A 3QTGA 2J8UE 2WKLA 1NGYA 4XMKL 3FTZA 1U8KA 1L6PA 4LL1A 5BUGA 3ORWA 4DGYH 1B3IA 4R33A 3STGA 3H7LA 1A6AB 2JK2A 3VZXA 1QI3A 5DI8A 1JGDB 5I3IA 4X6EB 1CZ8H 1A5FL 3C5ZC 4RZCB 3VWJD 1GVRA 1HSAB 2LU7A 3OJ2C 4CKQA 5FJTA 4HLZG 3U2OA 2NUTA 3AHXA 1IEXA 5DZNA 5A2IH 3OKDA 5C0RH 3IRDA 2VXQH 3VE0A 2DJXA 2F74A 1E0OB 1OX4B 1NOAA 2XICA 2HJFA 2QEZA 4HZ8A 1HN1A 4LPTA 1SHSA 1YEHH 4HPYL 3VTAA 4UTFA 2O9RA 3AHVA 3HN5A 1H3UA 2YQ3A 5AC8A 2F15A 4E2OA 3C5XA 2PF6A 1W54A 3L5AA 1LQSR 1V77A 2B0MA 3VFCA 1ZLUH 5EA9A 5DUBA 5KVDE 4OZGE 5BUAA 3VUSA 1FVDB 2NX5A 5FL0A 3FRUA 1J5OL 2PCPA 3BUTA 4JYDA 2C34A 5EU4A 4PJ5A 4CN1A 2X9YA 1JUFA 4JO4L 3U7WL 1HJUA 2F6XA 2ZUXA 3S6DA 2PTDA 3TL5A 4ODXA 3VCLB 4G8GE 1YY9C 1JZ2A 1DO6A 4PRPE 3GU1A 1ZE3C 4M4PA 4FP8L 4S1QH 2HWGA 3PAVA 4QMEA 3AISA 4QM1A 4YAQB 1FC2D 4F37K 2I56A 3DI1A 3MSRA 3MGTB 4NM4H 1EC9A 4JVPA 1OF2B 5GRZA 1CBVH 4W9IC 5BJTA 4FQXA 1Q13A 4LLVB 2CHRA 2KERA 2B59B 4KZDL 1YMME 1P4CA 4L8CB 2IBBA 4GBXA 5KVFL 4JDYA 4I5XA 1UWEH 1CGYA 3QPZA 1MY5A 5FM5M 4BE5A 1GQLA 4RZCA 3GXNA 3SOTA 5GZOD 1TB3A 2CZVA 1XCTB 2CIIB 1N59A 3IXAA 4GEIA 3VXSD 2EE3A 1CB7B 3BKJH 2GSIB 2CCWA 1WUNT 4E6MA 4IPJA 1TYGA 3U6XS 2E68A 3L13A 3AIVA 1UH4A 2TRYA 3NQDA 1RZFH 2N01B 5ITBL 1WAAF 4Z2GA 5HNRA 3T0DA 2MMXA 2INEA 1E42A 5C86A 2V17H 3N17A 3MODL 5C0NC 4QQ3A 1KXHA 1KBPA 1SGKA 4PIBA 3HOGA 5T1JA 2YDRA 3R8QA 2ZRUA 3MO7A 3ZTEA 3VXMA 5AVWB 1I7ZB 4QHRA 4UTAH 1E6OL 2DLFL 5G5DA 2HMID 5EUOF 3M7FB 3QISA 4QCIA 1MJ8L 1WGVA 2GGEA 3KPRA 4K3JL 4Y19A 2CO6A 2FKPA 2HTMA 4O0KA 4LLWB 3QC3A 1BLNB 4BUGA 4KKLD 4AIZB 3E0IA 4RDWA 1BMGA 1V0KA 4J12A 4KVCH 2ZDRA 4R53A 4P7OA 3D0LA 4A2FA 1OWWA 3OKKA 2J73A 4KBPA 3KPSA 4LVDA 2VJXA 1B3OA 1S8DA 1NCCH 1X1NA 3VFMA 2G75A 2ATSA 1ACYL 2Y6SD 3ARTA 3FFCD 4ONHB 2AL2B 4DJFD 2PYEE 5K9QI 4O51B 1RV8A 4CQAA 4JFHD 3THML 3FU7B 1QBLL 4YHZL 1F1AA 1PSKL 1UQSA 2ADFH 3FOMB 2FMNA 3MLYH 1YPFA 1RMFL 3DFQA 5HYQB 3IDMA 5CD3B 4UQAA 1X5HA 4OKDA 3ILEA 2NOYA 1INDL 3CN1A 5TE6L 2HNHA 2P80D 4BI6A 4R7DB 2GITB 3BHBA 4PJBF 5CJNA 4Q6IC 1I85C 4HEMA 1S4IA 3TCLB 1F4XL 2FX7H 2IQ9L 2VUKA 3KYKL 3EPOA 4X6FB 5BXFB 3UJTL 4ECLA 4Q6IB 3WMPA 1FLRH 4I9TA 1TQWA 2G60H 4HWEL 4LLYB 5REQB 4TVPL 1OAQL 1UURA 3LN4A 4NAEB 2XVKA 5GJMA 3GO1L 3FT3A 1CTOA 3L4VA 4KXZH 4RA3A 4E36A 4PRHA 3KGUA 4ZPTB 4Y2OA 2O5ZL 2WBJB 4F57H 4IK6A 4RV3A 4XP4L 5CC5A 1B0GB 5I1GH 2Z00A 5JPMB 3R2GA 4AUYA 1KM5A 1V10A 3MBXH 1TZ8A 1QWNA 4CEUC 4M43L 1EA9C 2K9FB 3D9AH 5JH1A 4ZMPA 1OAZL 3A5VA 4FFZA 1I8AA 4JRLA 2AAVA 4M6ML 3SZKC 4CMMA 2YLAA 4QIUA 2CKNA 3GXIA 4F7MA 3RWGB 3SQMA 4GSDL 3M0IA 1AQDA 4F20A 3I7SA 1SZRA 4ONGL 3TV8A 3L1OL 4TMCA 2EH8L 1K8IA 1DORA 3VU2A 4FAAB 3TW9A 3L3OC 2J57A 4FRWA 1ZPLA 4H25B 4M6AA 4YHKL 4WFGE 4PU2A 5E0CA 5HOSA 3MVSA 3G04A 3WTWA 4BSWB 3RAOA 1XSKA 3G5YA 2NY5H 2EADA 2E56A 4X6FA 1OM9A 3PHOB 4XBPB 4L4TA 2AK4D 4LCWD 4A1RA 5BXFA 5HYSA 2P3EA 5LGJA 4V28A 2HFEA 1RK1B 1VZHA 1C08B 4IKLA 1GONA 1XH1A 3O4LD 5F1OB 4KWSA 1ME7A 4PJGA 4ZQKA 3O6CA 4ERSL 4LV4A 2WXJA 4KRPB 5GGVL 1KELL 4AL8L 5I6LA 2B81A 5CKGA 4X6CF 4HA1A 2PCXA 2ITDA 5PAZA 1V6VA 1XQ4A 4XIAA 4Y9MA 1P2CA 3GSXA 3KVKA 4P7NA 1U3HB 2COQA 2AJ3B 4F3FB 4FFYH 4F8TA 2HLFD 3V0HA 1QU4A 1UOZA 1YPXA 2JTDA 4PJCA 1SQMA 3G0UA 3SN4A 4HLZH 2NWRA 4XAZA 1MHPL 1ZGLB 1OAJA 1QP1A 1OCCB 4XWOC 5E99L 1VBRA 4MJIE 4ZMWA 4IJCA 3B8IA 3W3OA 4F7PA 2OZ8A 4NDMA 1MDAA 3QCTL 5ADOL 5K9XA 4NRZB 2YL9A 2R29H 3RJYA 3I6KA 3IRZA 5D1ZB 1RY0A 2XHNA 4GMEA 1YNTB 1NKOA 1QWHA 1XSOA 1A5UA 2E6FA 2BP0B 2YK1L 4X0KA 3T65A 3VJ6A 3CMJA 3WE1A 2OZTA 3ZDZE 5ERWA 1OGAB 2WQ8A 3IDYB 5AZEH 5CAYB 3JU2A 4MDIB 1IE5A 4N68A 3RGVA 1JHTB 5G4NA 3V4VL 3A3XA 3JWOH 3TV3L 5AFDA 1MAKA 2WW8A 3NSNA 4YXGA 1MI5E 3NZPA 2WIIA 5LA0A 5G5IA 4HIXH 3ZJAA 3HS9A 1F42A 1WTGT 2WB7A 5BRQA 4BWTA 5DURD 5EFDA 5CP3A 2QPSA 3Q5OA 3LLDA 5GSVA 5TQ2L 3C5ZB 3S34L 5B7FA 5FOBB 3IWUA 1AH1A 5J6HB 2DT2A 7PCYA 2HPTA 4X5QA 4PJ9D 25C8L 2H41A 4YN5A 3K4ZA 2YPVH 4H8WC 4GG9A 1IKFH 2P46B 1L7IH 3EHBC 4O1FA 5HHMD 1DN0A 1ZT7B 2I9LB 1DBBH 2ZKHH 3TBYB 4NFCA 2MNWA 1BGXH 1LD9A 1RPQA 2DWYA 3SGUA 4DEWA 3VIPA 5C2XA 2V5TA 4LSPH 4H7ZA 4ETQB 3WK3A 2WJEA 2ICEB 3JWDC 3ZIYA 3NPWA 2ZNXA 3HJ0A 1Q6DA 3FT4B 3IJ6A 4CNTA 1WFNA 3RIFF 1E4XH 4LUYA 1UEYA 4H9UA 1TG8A 3R4IA 5CSSA 2XV0A 5LGHL 4G8IB 5LDUA 3I75B 1EKOA 2NUTB 1OP3H 5CD5C 3FTXA 5K9JL 4NJIA 1B2WL 1W8EA 2ZOKB 1EMTL 4JFEB 1KZYA 3X14B 1EHLL 1TZIB 4NNCA 5F7NC 1JXKA 2XZAH 4UB9A 5AB3A 5DDHA 3EYQC 5FGBA 2PCFB 3L5WA 1GYVA 2VITA 1A6TB 4MHHI 1LO4L 2GQ9A 3ANUA 3D6NA 3PNZA 4L4OA 2CH8A 5SWUA 2VRAA 5D7LA 4H4NA 1DBML 5FYLL 4O12A 4HBQA 3INUL 5L88L 4LVHC 3NZ8A 3UYPB 1NJ9B 2JF7A 1NBVL 4L5ZA 2WO5A 4DO6A 3UGRA 3TN4A 2B7QA 4P57A 2GGGA 3EO9H 5IW6B 3C2EA 2R8WA 2X53A 3ZL4H 3M0XA 1A3LL 2W0UA 4BZ2H 3RDTC 1P5UB 3QXDB 5F6IB 3N29A 3GMRA 4L0ZA 3LCFA 1PG7H 1GWJA 3TBYA 2F2KA 2Y7MA 2E7LA 3GVQA 4LALA 1FCVA 4WNSA 4TVCA 1NWUA 4NYYA 4MSWA 3S83A 2OLSA 4MHHG 1MCLA 4UWQB 3QULA 3RI5K 1IIGA 4EWND 4GCXA 4WIQA 5FUZL 5IBXC 3I9PA 4X7SL 3RKDC 3TQKA 3W00A 3T9PA 1UCWA 2G4GA 1ZRUA 2PLKA 1Q5MA 4W85A 3UXLA 2Z31A 2Y23A 2OMVA 5C7XL 4MMXB 4WOQA 5D2LF 3LX9A 4Q7DA 4RGNC 1YRRA 4XZNX 5E94A 4FOMA 4EP8C 1B4JH 3LTVA 1K4GA 1KCZA 2HCVA 3IS0X 2R1YA 5EB8A 3BZEA 3IEAA 1XGZA 1ZOXA 1U8NB 3NESA 1QPQA 4K23L 4GSXA 5CGMA 4L6HA 4LOFA 2V0AA 4Q8NA 2H4EA 1OCRB 5ANMA 5C8JA 3DRTB 1BIHA 4AJWA 3L12A 2JNZA 3CZUB 1DYZA 4JFDD 4P3DB 5CCHE 2PDNA 1UOWA 3CG8A 1XP3A 5SWSE 2C9XA 1MI5B 2A77H 2DQMA 4Y9AA 3BVUA 4URIA 1Q45A 3GSNB 4UTMA 5FECB 1UPMB 2R2EB 1XIJA 3W6LA 3AW5A 4P2QE 2GJJA 1FH8A 2AQQA 1DVFB 4RBPH 1AFVH 1W6LA 1NKRA 1WIPA 3W7IA 4UFJA 5LNVA 1C16A 4QHUA 4DJDA 2VOTA 5HGGS 4QNPF 4WI4A 2KDGA 4P0DA 1S7QA 2BHYA 3KWVA 3DOSA 2H0JA 4PY8I 3MTRA 4RMVA 5CGYD 5EZJA 3DFHA 3PZQA 6REQB 2ZA1A 1HTYA 3K6SA 4PH8A 4QWWD 2QUUA 3APYA 3H6OA 3OGVA 3ECBB 3SOBH 5AD0A 1IR1A 1FCUA 2F7RA 3CV5A 4KX7A 2XSKA 3GTHA 1SXAA 3UO1H 4FQXC 1XLCA 1IF2A 3FN0L 4PB5A 3KD4A 3DUUA 2PXYD 4MNGB 2PDPA 2MTPA 4EPDC 4PD4K 2Q09A 4DCQA 3MO4A 5AHMA 1FWCC 5IHUH 3N9KA 2WNXA 2APTA 3STPA 2B1HH 2ZOLA 3UYOD 1BVLA 4H1LH 3I02B 1T0OA 3Q2LA 4EF9A 1R2SA 2BY0A 3PGCB 1VCAA 3RX5A 5I1AB 3OM3B 4DUWA 2BZCA 3CDGA 3ITGA 4C6DA 4NL1A 3VNZA 2AI0H 4QXVA 3A4AA 2R4SH 2WWCA 4V1DA 2CXKA 3AT0A 3KPNB 3LYRA 3CVHL 4UDUA 2P80A 3REWB 5IGXH 2PI6A 3WTYA 1RIUL 4BV1A 5JA9A 1NBYA 4OIIL 4HNOA 4A05A 2OL3H 1X8CA 4EACA 1C8YA 4JTFA 4LRIC 2ZQ0A 3O6FB 3THCA 4K7PX 4PJAE 2MNJB 2X4NA 4YQXL 2AMXA 4AC7C 1ZV5A 1FRGH 4W8BA 2WLIA 4TPRH 3AJXA 5KBNC 5AZ2L 4FZ8H 5F7LB 1Q8MA 1YQVH 4LSSL 4UQCA 3EB2A 2JQMA 4Z95L 3NEXA 5EPMB 3BW4A 4OGQC 2Q2LA 3CVBA 4WU7B 3LZOA 1JD9A 4IIHA 3EYQD 3N12A 1WZAA 4K3EL 3C87A 1JBJA 3KVQA 1JFQH 2QGEA 5J9PA 3QQWA 4XPHH 4J6IA 3WQFA 5D6CB 3A4JA 3DXAE 4FA6A 5B38B 5B39G 1CDHA 3NSJA 5FV1L 4D8PB 1XBXA 4LSBA 3M88A 4RMUA 1PNCA 2XH7A 2XVNA 3KBSA 3NCEB 5E8NB 3AQUA 2Q86A 1KPVA 2NRDA 1NIUA 1KNOB 4Q97A 2XKNA 1IL1B 1AXSA 3IJDA 3HNSH 4NENA 4M24A 5DEZA 3NQMA 2O6EA 1O5QA 2W1NA 1DBKL 3B9KC 4WI0A 5EC2B 4DEPC 3D3AA 4Q9CA 5FUOL 2CGZA 1U36A 1ETA1 1SEQH 1CI3M 1TNMA 4HT1L 4LARL 1S3RA 1CZ8L 2X89D 1ZLWK 3U1SL 3ZKMD 5LGJB 5IREA 2YW3A 5AYUH 4L9DA 1SMOA 1UFGA 2R2HB 1HILA 3D48R 2A21A 3GJFA 2ZAGA 4MA1B 2FVNA 2AJXH 2FZBA 1NBYB 1U8LB 2VDGA 4S3JA 1XGQB 2XRAL 3VKDA 1XJBA 2NDGA 1GZJA 3QG6A 3AZTA 1BW8A 1A5KC 2WYHA 1JF1A 1FZJB 1NAML 2K0RA 2R0WL 4M00A 4U1KB 3RPKA 1YPIA 3HF3A 1Q6OA 4NJJA 3W72A 1CECA 3WLNA 4FNLH 4YMZA 5T1KD 1JCMP 1EJTC 1REQA 4WK9A 3RHGA 3URQA 3L6FB 4JW3A 4YE4H 4MJ5B 2YJQA 3QI9A 5J3HC 2QQLL 1BQ5A 4FQQA 3AYTA 1FWBC 4GW5A 4FMVA 3HG0A 1QPOA 4L9LA 4AM0Q 4Z08A 4E9QA 1A3HA 2VW6A 2C9VA 3QEQB 4RCAA 2Q86B 3L3DB 5A7BA 4KFPA 4DTGH 3RX4A 3TYAA 2D7QA 5A2JH 2JMRA 4KTEL 4ZUWB 3ZIZA 4QS6A 2GBAA 5CAKA 3D69B 4IPNB 3HPZA 1KGYE 4HU3A 1NUNB 3QRGL 1DJWA 4I89A 4HWBL 5C08A 5IESL 2YYTA 1EZUA 1HHKB 1DLFH 3UO8B 3FCPA 5I5MA 2YD6A 2AKRA 5GJTL 3QPKA 2VR9A 3QDJD 4HULB 3LXCA 2OELA 4HS3A 1EUTA 1YXDA 2NY6D 2UWEA 5HDOA 5KZEA 3KR3L 2JIEA 2D7TL 1E8XA 3NCYP 5H91A 1FFRA 1UOVA 1LP9F 4DGWC 3TQVA 4WAFA 2QVKA 3S9IA 2DPKA 4XOBA 1AD4A 1RULH 3QEUB 4MFDA 4ZYKB 3WS6A 3V0AC 2Z65C 2ZTKA 3UADA 5AYXA 3ISYA 1G0YR 1GY1A 2ZPKH 3GDRA 3KW8A 2PDJA 2XWJA 3BMVA 1IFHL 1E4NA 2QHAA 5CMAA 4H19A 5HAOA 4M6UA 1MAMH 2FT6A 2QSTA 2EDEA 1SDDA 1SQ7A 3QC0A 1GCFA 1ADQA 1ASOA 3DX1A 3LZRA 1FJ1A 3Q44A 4POZD 5CNHA 3RTQB 4PTXA 4NKIH 3EAKA 4OLXH 3WIJA 5EV7A 5JMOC 4N25A 4F8XA 1FFPA 3CZNA 2E0PA 5GRXG 4FQLL 5AC6A 5JDSA 4HJIA 4OGAC 1KEML 5FYKH 3N4FA 3W3BA 4H3DA 2XIMA 1PSKH 4UNKA 2HZHA 3O2DA 4ZXBD 3U46B 4Q6JA 2RFXB 1L6FA 4UM9A 1EQCA 4OUIA 1BQLH 2ZIDA 3PNWA 4DOHB 1EZSA 4WGWB 3QYSA 4JRWA 4Y0GA 4RW5A 2OCFD 3WFAA 1INDH 2YFOA 4YTTA 3RKPA 1G7IB 1AO7A 2BCKA 1VRDA 4O4YH 4QRPE 5DJXA 1ADWA 2GFBA 3BUVA 1INQA 3FU0A 1MEHA 5DJDB 2BIOA 6A3HA 4AC1X 5IK3A 1OAQH 2A85A 4GX9A 5I3FA 1OARL 5H2ZA 3IGLA 1HQ4A 1WXZA 1U93A 4UDTB 2VRJA 1RIHH 4ISVB 4PFEA 1A0QL 1GJIA 1L5GA 1WO2A 1IR2A 5ECGA 4HK3N 1FFQA 3S5LG 5D7JD 2ZCKH 4IMLB 4QDMA 4NUMA 1UM5H 4E38A 3CN4A 3MBXL 4IOIB 3R58A 5BRBA 3BDYH 4DPQA 4NZ5A 3IVKB 3D9AL 3GGWB 4GRWH 3CWNA 4RH4A 3I6GB 3T71A 1TKKA 3LHZA 3ARBC 4PRID 3ULSA 4JIPA 1R46A 4GLRI 1HG3A 2DLEA 3TVMA 4LRTA 1I9EA 1LP9A 1L9WA 4Q8OA 1MFBL 5CFHA 2IS7A 1BFOA 1K77A 1LROA 4HG4J 3SFKA 3WKMH 3WF3A 3QPQC 1HINH 1JDEA 1WWWX 3FFCE 4PCKA 3V4PL 4YDKH 5JMRA 3ZJ7A 6TAAA 2CNZA 1IM9D 3W86A 3HFTA 4P5RA 1CXFA 4LPYA 4NM8L 2BK8A 4MKTA 4J39A 3ZRSA 5JQ6L 5KVFE 5DFTA 3GTNA 2J6EA 1BD2A 1KPRA 2VKXA 3Q7JA 4RRPA 3ATFA 2JCCE 3EH3B 1CGWA 4AVJA 4L29B 4FA8A 2VDKB 2XIJA 3AFBA 2Z0UA 2ZSVB 4I18C 4MWFA 5E4IA 2GJZA 2GT9B 1ES0A 3BSHA 4NWUL 4XQ6A 1UWFA 4JO3L 1IYXA 2Z0BA 3D18A 3LBMA 5CPLA 1X1OA 5AW9B 4QOKD 3T40A 4LC8A 4S2BA 1G1OA 4XBEH 4N9DA 4JIRA 1JFHA 4G8IA 3PHAA 5GJPA 1ORQB 4XO7A 5H8MA 3F5LA 3TYFB 3RLSA 3FSWA 2BWQA 2V5MA 2B5IB 3P9MA 4YAQA 5FYJE 2RKXA 4E9TA 4N0UE 1RJZA 5EF3A 5SWQA 1MZHA 1T66D 4HSAC 1R3LB 3EFFB 3UCCA 2IQ0A 2G2PA 3QQ1A 1OLLA