5A2BA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
452
structure length
452
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
molecule keywords ANOXYBACILLUS ALPHA-AMYLASE
total genus 167
structure length 452
sequence length 452
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2bA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2bA01
3FNDA 4P7QA 4EK7A 1WZKA 2VL4A 4ZENA 3EDEA 2O9TA 2VMFA 2VZUA 4JFWA 1WB0A 4CD4A 1JD9A 1DP0A 2J7CA 1UHVA 4W85A 3WH8A 2D3LA 3EMZA 4D6CA 1E70M 3WY1A 5ECUA 3I3DA 1KGUA 1NOFA 5EFFA 2PI6A 1ZBKA 2VRJA 3VDCA 4MDPA 2WC3A 3I3BA 3ZMRA 4FNSA 2XJ7A 4TTGA 3WMCA 4Q7NA 3FN9A 4B9YA 1SFSA 1V6XA 1AMYA 2D0GA 2JEPA 1E73M 4CN1A 4CVUA 3OGRA 5HPCA 3IJ8A 1UWUA 3K4AA 1Q4NX 4D6DA 1W2PA 3WL1A 1C91A 5LA2A 2FDMA 5GNXA 1DEDA 4UZSA 4UQAA 1U33A 5A3HA 3AHYA 1K9EA 2CBVA 2DDXA 1V02E 1L8NA 2BY1A 5A2AA 3CUIA 2BVDA 4MJ4A 3SUUA 5AYIA 3ARQA 4MJ2A 1VFMA 1KR1A 1BYBA 1E0XA 2G8ZA 3WNPA 3ZJKA 4UR9A 3DX3A 1WAWA 1ODUA 3DYPA 4Z2IA 1KXVA 2BFGA 4P8WA 4B3LA 4DO6A 4PMOA 2ZUMA 2BY0A 1QX1A 2UWFA 1GJUA 3WQWA 3EDKA 4PSPA 3PBGA 2ZOXA 1V3HA 6CGTA 2EQDA 4R5EA 4GXPA 4MPKA 4P8XA 1E40A 3OLEA 1CXKA 1IZJA 4GZIA 3W25A 2ZXQA 4XB3A 4KGJA 5AYBA 2F7QA 2W4XA 2ALWA 1HX0A 4TVUA 1JD7A 4WF7A 3K8MA 2PWHA 2VCBA 6TAAA 2VURA 3VIHA 3NSXA 3ZR5A 3CZEA 1HJXA 3N04A 3LPFA 1EHNA 4H2CA 1JDDA 3T2OA 3A22A 3LXBA 4MB1A 1GJWA 4TX8A 2DT0A 3CUFA 3VU2A 2WCSA 4UFIA 2C0HA 1UWIA 3TTQA 2V5DA 1E3XA 1UH4A 3ZO9A 2QV4A 7A3HA 1IV8A 4PMRA 4OUEA 3MUY1 2WHKA 1OINA 5A95A 1KXHA 4AMWA 4UOZA 1XSIA 3MANA 4BQ2A 1ZBVA 3WF1A 5BXPA 1DWIM 2W61A 2DH3A 1UZ1A 3FXYA 4U33A 2VI0A 4E4PA 3CHCA 4W7UA 3WENA 2V38A 5E9AA 3VDAA 3QHNA 5M3WA 4P7RA 3BVXA 2WHLA 2G3MA 4L4PA 2PWGA 2X09A 2DIJA 3RPMA 3T2QA 2E8ZA 3VIFA 3W82A 4KRUA 3KL5A 3ARZA 5TD4A 3BSGA 2J8FA 4A3HA 4YPJA 1J11A 3S2CA 5DMYA 2CHNA 3GDBA 1B31A 1OWQA 1K9TA 2DSWA 3CMGA 5D9OA 2DH2A 3NJ3A 1TQVA 1E56A 1J12A 3IANA 4MB5A 2VJXA 5CZKA 3A24A 4AWEA 2EPKX 4TXEA 3QOKA 1GNXA 3SUVA 1BGGA 3DX0A 3IJ7A 3ARUA 3T0AA 1BYAA 2BHZA 4GO9A 3UETA 5FCZA 3CHFA 2A3EA 2D23A 3WDJA 4Z2HA 3S5YA 3RJXA 5M17A 3W0KA 1B3VA 2ZWYA 3M7SA 5E09A 3VM7A 2Y8VA 1QVBA 1JNEA 3HG3A 4UQ9A 2F7PA 3EDJA 4E8CA 3WY3A 3FY1A 3CZ8A 4ZXOA 1R7OA 1CWYA 1NP0A 1UG6A 2WMFA 1CGYA 4JHOA 1PAMA 3O6AA 2E9LA 1C93A 4EAMA 4TTUA 1E6NA 3CTTA 1H2JA 1GCYA 1HTYA 3T2PA 4HOXA 1MW1A 3AIUA 2X2YA 1KBKA 1WNOA 3CGTA 1ZB5A 4CCDA 4QFUA 6A3HA 4BA0A 2AOSA 4AY1A 4FLRA 2D1ZA 4UFJA 1HNYA 2WC4A 4BS0A 2X8RA 4FLOA 1R34A 1US2A 3K1DA 3WUGA 1Q6EA 4GZJA 4J3XA 1AQ0A 3AXHA 3H54A 3AROA 1LQ0A 4AD1A 3PTQA 1T0OA 1HXKA 3SCRA 3VD3A 2PF0A 3WBEA 1XV8A 1KWGA 2WNWA 2RGLA 3OGVA 4XX6A 2VNCA 2FHCA 2NT0A 4WJXA 1ISWA 1NOWA 3T09A 1CEOA 1B2YA 3GNOA 3VGFA 2IXUA 2WMIA 2F2HA 1PX3A 4N0RA 1CXIA 4XUYA 5A8QA 3EYPA 5I24A 4PTXA 5GNYA 4FNPA 5I5RA 1HJQA 3LPPA 3QHMA 1UR2A 4LQ1A 2DT3A 2WKLA 3NDYA 3FHQA 1C8XA 2J62A 4AZ6A 4KWUA 2X2HA 3BUQA 2A3BA 2XTKA 4URIA 5D9NA 5A6KA 5IFPA 2X0HA 4W5ZA 2V3DA 4FNRA 1W9PA 1J18A 1KWKA 3SIMA 5CLTA 1CYGA 4Z2LA 1VFOA 1L0PA 4K68A 4LGXA 3TV8A 3OZOA 2G41A 4U2ZA 1PBGA 1W3HA 2J7GA 4LX4A 5A1AA 2VUYA 4F9JA 3PZGA 1UUQA 2W62A 5I0DA 4PUDA 3WF2A 1W91A 3SCSA 2E9MA 4JFSA 1BG4A 2WMGA 2XVGA 1CPUA 1GOQA 1XD0A 3F5JA 3CUJA 5C70A 3CZSA 2Y5EA 2ZUTA 3GBDA 3L4YA 4J27A 2J7HA 4L4OA 1HIZA 2XGBA 2YLLA 3K46A 5BRPA 1MW0A 4GQRA 1GORA 4W7VA 4PMYA 2X2JA 2EACA 5A6BD 3GNRA 4LYPA 3OLIA 1QW8A 3RM4A 4AC1X 5HOSA 3WSUA 3QGVA 2EADA 1MQPA 3CBWA 1BSIA 4RE2A 1A3HA 3PZNA 1B1YA 4HA1A 3EDDA 1TR1A 2YL6A 1Q6DA 3EDFA 1ZBCA 1WCGA 4ACZA 3DX4A 5I23A 2WMIB 4P8VA 1QNQA 2CPUA 2EPOA 4HZ7A 5CG0A 2OYLA 1QNSA 3AMGA 2J7FA 4HP5A 3CMJA 4AZIA 4UQEA 3UERA 1JGIA 3TOPA 5ABHA 4F66A 2BVTA 1X6LA 1BF2A 2F1BA 1CLVA 2XVPA 5DO8A 2WMKA 3D5HA 3NSNA 4CUCA 2WBKA 3UR7A 3VOCA 3AHTA 4HU0A 4UOJA 9CGTA 1B3XA 1SYTA 7CGTA 2DEPA 3GXTA 4D6GA 1UD6A 3BAYA 1VEMA 1V03A 1BVNP 1E0WA 3DDGA 3ARVA 1HF6A 5DT5A 4WSJA 1DWAM 3G6MA 4PMZA 1YHTA 2BVYA 3WDIA 2YL9A 2WXDM 4W8BA 1JG9A 2WKGA 1GW1A 3CZKA 2GJRA 1ISZA 3CZJA 4ZE4A 5IHSA 2YL5A 3UG5A 2YFOA 4U2YA 1KFWA 1GUVA 3ARYA 1UA3A 3GM8A 3AIWA 5E6ZA 2OWWA 2IGTA 2OYMA 1R46A 1UKSA 1HKJA 3DX1A 4KGLA 4QP0A 1W9UA 3F4VA 4ATDA 2CITA 1U2YA 3A4AA 3VDHA 4D6EA 2XSAA 2WM0A 3BVTA 3D50A 5I2UA 1V3IA 2G3NA 2XN2A 1BLIA 3TTSA 3AIQA 8A3HA 1KQYA 1TQSA 3MUAA 2QPSA 5I3DA 3BXWA 3VGDA 5A69A 1W9DM 2XM2A 4DO5A 1TA3A 1H49A 3IGUA 4FNQA 3AYRA 2UY4A 1MWOA 2EAEA 2A3HA 3T0DA 2X0YA 1PPIA 3ZJ7A 1WZMA 1GQKA 5KZ6A 2XFYA 4HPHA 3PHAA 4MADA 1V3LA 1R86A 1TQUA 3MV11 4W93A 2Y2WA 5JBEA 2VZVA 4WKAA 2AMGA 4JKMA 2PBOA 2D2OA 5BRQA 2FHBA 3AXXA 3MSDA 2ZX7A 1UYQA 1W9BM 3FAXA 1XC6A 1Y7VA 1J0YA 1EQPA 2J4GA 4PTVA 3WH7A 3WUEA 3MUZ1 2Y24A 1LWJA 4EANA 1FH9A 3PZVA 1CGWA 4D6IA 2NW0A 2O9RA 1M53A 1BPLB 1J0KA 2D0HA 1JL8A 3WDRA 3OLGA 1PEZA 1XH1A 4E8DA 3VIIA 5I79A 1JI2A 3MI6A 5A8OA 3CZGA 4HTYA 3IK2A 2XIIA 2GSJA 3W53A 1G94A 3PZUA 5E70A 5CPTA 1UD8A 1EGZA 3L4WA 3WQ8A 1UKTA 2WHJA 4PMNA 1CXLA 1AQHA 4U3CA 3BH4A 2OWXA 2DIEA 4XZWA 4PRWA 1BYCA 3VPLA 4AZ7A 4PMUA 3ARPA 4P7OA 4ATLA 2D3NA 4ZEPA 2CEQA 4PTMA 1VFFA 1UZ4A 2WAGA 1Q6FA 2GK1B 2VR5A 1KQZA 4MAVA 1PX4A 2Q8XA 5LA1A 1TCMA 4OIFA 1VJSA 3GTNA 3KL0A 5CSYA 3CZLA 1V08A 3AS2A 3WD4A 2W5FA 3N11A 4CU7A 1HN1A 1H09A 1EDTA 1OM0A 1S46A 4W8AA 1NARA 3GH5A 3NUKA 4UCFA 1XHGA 3WF0A 2EO7A 1H0GA 1NWRA 3OLDA 2ESCA 3PTKA 3PZOA 5A8NA 3CV5A 4OJYA 1NM9A 3D3AA 3HJEA 1E6RA 1R47A 4D1IA 3RILA 1BTCA 1EO7A 4UQBA 1OB0A 4W5UA 3T0BA 1QI4A 3WDPP 2PC8A 2PWFA 2CERA 1JYNA 1N82A 4FLQA 5DFAA 2J7DA 1C8YA 3ALGA 2QHAA 1ZU8A 3IAPA 4WSKA 5IFTA 3RM9A 2IXVA 3BLPX 3WNNA 5A6LA 1OCQA 2OYKA 1VIWA 2D22A 3NCOA 2YOCA 3RM8A 3GXDA 1OD8A 2ZIDA 4V28A 2VO5A 4UFKA 4CVWA 3AIBA 1E43A 1NWTA 3AYSA 1JZ4A 1W1VA 2BXZA 1WDQA 1CXFA 3NYDA 4JHZA 4JFUA 1KGXA 1HWWA 4YHGA 1MQQA 1JXJA 4Y7EA 4AD4A 2WMJA 3PZ9A 2UY3A 3WNMA 1ESWA 3OZPA 1WO2A 4AYGA 3AICA 1UD2A 1JAKA 4AMCA 5DEZA 1XH0A 1MVYA 3KL3A 1UR4A 1W3KA 3BAKA 3OG2A 3BAJA 3O2LA 3MUIA 1HKMA 2YBTA 2XWDA 2FGZA 4ZFMA 2GFTA 2J74A 3WD3A 4OOZA 5E0CA 2V3FA 5AC4A 3N17A 1R8LA 5D9PA 1TMQA 3OBAA 4N42A 3WUBA 4CD8A 3MMWA 4WIWA 4OKDA 3N13A 1JIBA 1IZKA 1MFVA 3VNZA 2ZUVA 3EMCA 3EJQA 4P7NA 4HPGA 4H8VA 5F7UA 3UEQA 2F7RA 1UKQA 3M6DA 4X0NA 4M80A 3OB8A 2J75A 4HU8A 1W2VA 3AS0A 3THDA 3ZT6A 5C71A 2J7BA 1QNPA 1RH9A 2OW7A 3MV01 3APGA 3N1AA 2WWCA 4P8UA 3SEPA 3W81A 2CIPA 2YA2A 4IPLA 2ZE0A 3WF4A 4AD2A 2J8GA 1KTBA 1GOOA 5E1QA 1E5JA 1UR8A 3CH9A 2FHFA 4QCEA 1LF1A 2QLYA 5C8BB 5AC5A 1EO5A 1UD3A 3BC9A 1UQZA 3GXFA 2YBUA 1CTNA 1E72M 3WQ6A 4NXKA 4U31A 3S6TA 4BQ3A 3M07A 1EIBA 3POHA 1GPFA 5JIPA 1E6XM 3TA9A 3VINA 2CETA 5A2BA 3N9KA 5FIPA 1CGUA 3GXNA 1CZ1A 3U7VA 5HXMA 3BUIA 2O92A 2J79A 2ZUNA 3SUTA 3CZNA 1JZ8A 3VD4A 1B9ZA 1XSJA 2O9OA 2XN1A 1GHRA 5ABEA 2JF6A 2WPGA 2EPNA 1E3ZA 1GHSA 3AZSA 1W3JA 1ITCA 1GOKA 1QHZA 2YA0A 3VSUA 4OZOA 5IXEA 2GJXA 2PWDA 4OGZA 1TG7A 4UTFA 2ZX8A 1HVQA 3ZT7A 3FHAA 3WNLA 2F7OA 4DUXA 1KCKA 3SCWA 3U5UA 1UWSA 3DC0A 4J3WA 4QAWA 4NX0A 2HISA 1BGAA 3AIEA 5A6AA 5HNNA 2XM1A 1AVAA 2WCAA 1OGSA 4YN5A 4BQ5A 2X05A 4GQQA 1FHDA 2WVVA 1XYFA 3WH9A 3HZ3A 2XHYA 3BAXA 1ISXA 1TVPA 3QHOA 5EMYA 2ZX5A 3W29A 3A6OA 4GI9A 4UQDA 2GJXB 4DWSC 1OT2A 4AZGA 3D51A 4DO4A 2VTFA 3AS3A 1UWTA 1GQLA 2WWDA 1NH6A 2DT2A 3VMOA 4NXSA 5CLWA 4WLCA 4CD6A 1QI5A 2E0PA 3GNPA 2OLHA 2XWEA 3VDBA 2E4TA 1W1PA 3CC1A 4GI6A 3TTYA 4GINA 3L2MA 1QNOA 4WKFA 1U30A 2CHOA 1BQCA 2HVMA 4XZBA 1UA7A 2OSWA 3BLKA 1HP5A 2BNJA 3AMDA 2WC7A 1UR9A 3MO4A 1NP2A 1MXGA 4UFLA 1ZL1A 1SMAA 3VX1A 1UH3A 1HKKA 4U5KA 3MSGA 4B16A 3VGGA 1TUXA 4FNUA 2ZX9A 2WVSA 1C90A 3UG3A 1V3KA 1D3CA 5JBDA 3AI0A 2DT1A 1XH2A 4MDOA 2XUCA 3WKZA 3SCTA 1O7AA 3WFLA 2ZUSA 3EJUA 2FE0A 2YDRA 4U5IA 2BV9A 4GI8A 1ITXA 2BY2A 5CGMA 3VMPA 1D2KA 2VOTA 5A8MA 3RO8A 3RMEA 1QPKA 4PBGA 1OIFA 3AHXA 3NDZA 1W9VA 1W1YA 1J9YA 1H41A 1UH2A 1X1NA 2W92A 3WFZA 2A3CA 4QLJA 1B90A 2XN0A 2WZIA 5I77A 2FH8A 4AZBA 2EEXA 3WIJA 1W1TA 1V6YA 5DT7A 4MNMA 1ZS2A 2E9BA 5D4YA 2W63A 4V27A 1LG2A 1R85A 3CIVA 2F1AA 1VF8A 4AXNA 3T08A 1F4HA 2WB5A 2WANA 1FA2A 1DWHM 4B3KA 3MKKA 4LXFA 1YQ2A 3MU7A 5GPRA 3DYOA 1B30A 3AJ7A 3LPGA 2D20A 1E4MM 1TQWA 2Z1KA 4X9YA 4F9DA 1QI0A 5CGTA 3AOFA 4C7DA 1AQMA 5LYRA 1LL4A 4F8XA 2XVNA 3SCUA 3AMKA 4JKLA 5BCAA 3ZJ8A 5KEZA 3JUGA 4UOQA 2DSUA 2JIEA 1TVNA 4AD0A 3WY2A 3VGHA 5E6YA 2XGIA 4D71A 5CSUA 3VSVA 1ISYA 3H53A 2DGAA 4MB4A 3I3EA 3NSMA 1JDAA 5BWFA 1X6NA 4LPCA 1CGTA 4A3YA 3VO0A 1VAHA 4FK9A 5CQ1A 4JCLA 4W88A 4JAWA 1IT0A 1P6WA 2WK2A 3W27A 1JYWA 5BYWA 1VBRA 2E8YA 3K4DA 3A47A 4OOUA 1R33A 1G9HA 1JF6A 2VT0A 5A6JA 3NIYA 2ZX6A 3EJRA 4AD5A 2RGMA 4MAZA 3EJPA 1QNRA 1QHPA 1G0CA 1UKOA 4ATWA 1OSEA 3LRMA 1US3A 3WMBA 3CUGA 4F79A 2OWCA 1R75A 1CXHA 1LL7A 3QR3A 4IISA 3CUHA 1HJSA 4S3JA 2WMHA 2UY5A 4NF7A 3L2LA 1PS3A 1E55A 3VD5A 3WEZA 2MANA 1V6UA 4D1JA 3AHZA 3PZQA 1B0IA 3ARXA 3AMCA 3VD7A 1JDCA 4D6JA 1FFQA 1EQCA 1HL9A 3D4ZA 3ECQA 1H4PA 1JNDA 2VZOA 1B3YA 4TVCA 2BXYA 4UNIA 1HKIA 4NRSA 3WDHA 3WDQA 4AW7A 4DWSA 1FHLA 2W66A 3VUPA 1E6QM 1HJWA 2V3GA 5EFDA 1VB9A 4PMXA 3ARRA 3BMVA 2E3ZA 4S3KA 3DDFA 1VFUA 4J3UA 2G3IA 2WLYA 3HU7A 5BROA 2QF8A 4MNJA 1SZNA 1QWUA 2PBGA 4BZYA 2WVUA 1I1XA 1CXEA 3UR8A 3W6LA 4ML4A 3EJTA 4B15A 3LX9A 5HDRA 3WNOA 3VIJA 3MMDA 3GH7A 2OSXA 3DX2A 3BAWA 4CKQA 1OD0A 3WMSA 3RJYA 3KLKA 4KH2A 4D6HA 1KXQA 4HA4A 4AISA 5HPOA 4AZCB 3VX0A 3SCQA 1W32A 4EKJA 4PEEA 4AIUA 2CBJA 3VIPA 4PMQA 4HMCA 2VCCA 2WSKA 2TAAA 1KCLA 3A5VA 1LG1A 1BHGA 3HMCA 1UASA 1H1NA 5FOOA 1PIGA 3S5ZA 4M29A 4DWSB 3HN3A 3OGSA 8CGTA 2JFEX 3AZTA 3VTRA 1JZ2A 2D73A 1JF5A 1J0JA 1HJVA 3WNKA 1CGXA 5BXRA 4AZCA 4GKLA 4AEEA 4PCTA 2YL8A 3SCPA 1BFNA 4KRTA 1QBBA 2VR4A 5I78A 1A47A 2CKRA 3W4RA 4UZUA 2YLAA 1BAGA 1MXDA 3PN8A 2D24A 4MB3A 2VX6A 3RDKA 3BCDA 4TX6A 2CYGA 1VEPA 2Y4SA 3O9NA 3PTMA 2GK1A 1MW3A 3ARTA 3KZSA 4HMEA 4PYSA 3WQ4A 4MTVA 1XCWA 4HMDA 4TUFA 2V5CA 1O6IA 1JZ6A 1CECA 1RPKA 2WZEA 3M46A 4Z2JA 5BXSA 1W3LA 2JALA 3LXAA 1E0VA 1GONA 4CD5A 1E1FA 4ZXLA 1RD6A 1CENA 4DUWA 3HG4A 1CGVA 1DHKA 4H8HA 3QOMA 3RCNA 1EA9C 2JEQA 3ALFA 1E4IA 1UWQA 3VIGA 5A6BA 4PMDA 3PZMA 3SCVA 3IJ9A 1XSKA 1JZ3A 3E1F1 3KEHA 1UQYA 1OGGA 4JFTA 2XFRA 4LYRA 1W9XA 3CLWA 3POCA 2J25A 4RL3A 2JIWA 3ARSA 1WDRA 1PX8A 4HOZA 1VJZA 4NZFA 1J01A 2F8QA 4AZHA 4Z2GA 1E6PA 4NSBA 2XIBA 3L4ZA 3U5YA 1J10A 5ABFA 5M03A 1GVIA 1E5NA 1MW2A 4W86A 3AS1A 2YIHA 4JL2A 2XG9A 1JYVA 3A4WA 3VVGA 4M82A 4PCSA 4W7WA 1CIUA 2ZXAA 1HVXA 1WPCA 1EOKA 2F18A 4CU8A 5GQBA 2EBNA 4DM1A 3W6MA 3BGAA 3ZOAA 1FP9A 2VX7A 3BMWA 2UY2A 1TA3B 3W37A 1K9FA 3AHVA 3IAQA 1V6VA 3CHEA 3H55A 3PZIA 2ZUWA 1XD1A 1UWRA 1QW9A 1XCXA 4J3VA 3A4XA 4H8UA 2DSZA 4CU6A 3OIHA 2C7FA 3GYCA 3W28A 2DSVA 4NZCA 1E15A 1R87A 3VD9A 1JFXA 4PMVA 3U7BA 2XVKA 4QDMA 1PZ3A 2F61A 1V0KA 2CBUA 1WDPA 1KBBA 1EXPA 3MMUA 3AIVA 1PZ2A 1M7XA 5EBAA 4J3SA 3ZIZA 4AIOA 4NI3A 4Z2KA 1E1EA 4GZEA 4BQ4A 1WZAA 2W91A 3MS8A 3CHDA 1WE5A 1EHAA 2YKKA 4H04A 1K6AA 3WQ5A 2C8NA 1QOXA 1I1WA 5JUVA 5A6SA 5FD0A 5ABFB 4KMQA 3ZR6A 5ABGA 1ISVA 4W89A 3SUWA 4E2OA 4CCCA 3BLBA 3VIMA 2XVLA 2EJ1A 2X2IA 3BUDA 5A8PA 1UD4A 3WN6A 2CCRA 3B9EA 3WD1A 2FYVA 2EPMX 1GOMA 2VVSA 1UKPA 4CD7A 1EDGA 3D52A 3N18A 3ZQ9A 2VX4A 3N15A 4XV0A 3A21A 2ZXBA 3L4UA 4AIEA 3SCOA 1M03A 3UESA 1LLOA 4CGTA 2X1IA 2D0FA 4U3AA 1LWHA 3WH5A 2B31A 1PIFA 1ZJBA 5E0FA 1OT1A 1DWGM 4TOQA 2WYSA 3AQUA 4M56A 1FH8A 5CPQA 1J0ZA 1C8QA 4HZ6A 4PUEA 1SMDA 3GBEA 1GQJA 2VQUA 3GXIA 1J0IA 1OBAA 3VILA 1KXTA 1V0NA 1I75A 2WCGA 3DECA 4WK9A 2NT1A 3VGEA 5BXTA 1C3FA 4JKKA 4P7LA 1FFRA 2VX5A 4AZ5A 4FLSA 1JXKA 1V02A 4A4AA 3WQVA 3DHUA 3TP4A 3WUFA 1EOMA 3VIOA 4C7GA 1MQRA 4GPNA 2CESA 1J0HA 1V0LA 4FMVA 3N12A 4PTWA 3EBVA 2VVNA 3ZSSA 2FGLA 2WSPA 4HOWA 1OIMA 2W67A 4OBRA 3EJSA 4IPNB 2ZICA 3VSTA 3RIKA 1QI3A 1BG9A 2WW5A 2CNCA 4H41A 2VRQA 5FKYA 1E6SM 4AEFA 1KGWA 3TTOA 1EDQA 1JYXA 5FL1A 4J3TA 3AISA 3GH4A 3VGBA 3AIRA 1DWFM 4FF5A 5AY7A 3VMNA 3GXPA 4D6FA 1HT6A 1XYZA 1JI1A 4RE4A 1H3GA 3BVUA 1FOBA 1WP6A 3HG2A 2XFFA 1VRXA 2XYLA 1Q6CA 3VNYA 2XPKA 2DQXA 4M8UA 4EE9A 2OW6A 3F5KA 4ACZB 1UOKA 2E40A 1DTUA 3LRKA 4JZ5A 2WLZA 5CJ5A 3AFBA 3SCNA 4D72A 3DYMA 1ZBWA 1H0IA 1DWJM 1GVYA 2Z1SA 2CXGA 3KE0A 4C7FA 1UR0A 2GVYA 1WZLA 1E4LA 4H7VA 3L4VA 1CBGA 4DWSD 3TONA 3B9AA 1O7DC 1V6WA 2Y8KA 2BHUA 3BCFA 2ZWZA 1FH7A 1C92A 3ZJ6A 1GQIA 2DSKA 3UCQA 2YDQA 3ZT5A 2BS9A 1D7FA 5FL0A 4JL1A 1QI2A 1Z32X 4CN6A 1H5VA 4QLLA 1LJYA 2GJPA 1SR0A 3LRLA 2WHMA 2BY3A 3SURA 2EPLX 1JZ7A 3B9DA 3BSHA 3SUSA 5I6SA 2OSYA 3OA5A 3WEOA 1MYRA 4MNKA 3BUPA 4AYSA 4M1RA 4W87A 5LA0A 1V0MA 1RP9A 2O9PA 2J78A 1GOWA 1WDSA 3A3HA 3WD0A 2BHYA 3J7HA 4CN4A 3KLLA 1HL8A 4RE3A 2VZSA 4UFMA 1VEOA 4GIAA 4M81A 1G1YA 1G5AA 1V3JA 2QMKA 3CO4A 5JIWA 1CDGA 1KB3A 2YA1A 4W84A 4NZJA 7TAAA 1JAEA 5HBFA 1UR1A 2ZUUA 3A23A 1CNVA 1VBUA 2CBIA 3VIKA 1KTCA 5IHRA 1HP4A 1Q6GA 1TE1A 4LYQA 4M24A 4UQCA 3II1A 3WD2A 3VM5A 1QWNA 2YJQA 4WKHA 2JF7A 2PWEA 3W38A 1KR0A 2YFNA 1QHOA 1H11A 1NWUA 4NRRA 1LL6A 3K8KA 3EMQA 4QCFA 4FNTA 2V3EA 1E9LA 3GZAA 3ZM8A 2G4FA 3K8LA 1FP8A 4IM4A 5IDIA 3D4YA 3WELA 1NOUA 2WZHA 2IUZA 1K9DA 1E6ZA 1E71M 3WF3A 3L4XA 2GDUA 5A2CA 1C7SA 3HG5A 3B8SA 3BUBA 4AMXA 2EABA 4UFHA 2FH6A 2J47A 5DF0A 3WBAA 1GOIA 4CCEA 2XSBA 1B3WA 2J77A 3VKKA 3W26A 2CKSA 1BVZA 5A6MA 5M5DA 4YHEA 1G01A 3ARWA 2G3JA 2ZXDA 2YDSA 2WVVB 1WKYA 1VENA 3LMYA 3UG4A 3BVVA 2A3AA 2GDVA 2J7EA 4ZE5A 4TVDA 4JIEA 3LXCA 3ZSTA 3CPUA 1TZ7A 1EH9A 3AXIA 5D9MA 1RP8A 5EB8A 3FAWA 2AAAA 3G6LA 2DPEA 2WBGA 2VRKA 4HA3A 3THCA 4QLKA 4DUVA 3KWXA 4DM2A 2NSXA 1TQTA 5D8ZA 2VQTA 4BCEA 1JZ5A 3W24A 3PZTA 3WEMA 3U57A 4B9ZA 4AD3A 1PJ9A 1UD5A 1M01A 4J7RA 3AZRA 2VZTA 2JE8A 4X0VA 5CPSA 2EXOA 4GO8A 1ECEA 5GNZA 1BYDA 2GUYA 1XRVA 1ODZA 2QMJA 4J28A 1CLXA 3F5LA 2PB1A 5A94A 1NWSA 1JFHA 4JCMA 4PSRA 3FW6A 2VCAA 3L4TA 4R27A 3DHPA 5D8WA 1C7TA 1TFVA 1NQ6A 1MFUA 4BF7A 5CXPA 1M04A 1XGZA 1ZJAA 3AMLA 1E4NA 1QBAA 1HXJA 4OBSA 4W8LA 2QPUA 1B3ZA 4V2XA 4HZ8A 2WVTA 1F4AA 3BVWA 1OGBA 4ACYA 1R7AA 3WH6A 4JFVA 1V3MA 3WY4A 1HJUA 4IUGA 3BAIA 3GXMA 4PN2A 5JBFA 4MNLA 3WL0A 1GZJA 4Q22A 3LPOA 2VC9A
chains in the Genus database with same CATH superfamily
3TBTA 3SE3A 3O4LA 1MFDL 1XIDA 4JRXB 3PPFA 2BJML 2NR6A 1XT5A 1OV8A 1WZKA 2IAMA 3EDEA 3OHMB 4HKZB 4AYBA 3RWEA 5BO0D 5EY5A 2M26A 3OD3A 3FX4A 4JTEA 4R3SB 4RR4A 3QUGA 4JFDA 5F4WA 8FABA 4XMLH 5DUPL 4XVTL 4QOKA 3GMOB 5LHEA 4ISVA 3ZVVA 2A7NA 3HFML 3PHQB 4IGBB 2AJSL 4OCRH 4RAVA 4CVXB 1XF2B 3DI1A 3DXAB 2AJSH 3AWNA 4XCFL 4LP8A 1WG3A 3GEWB 4RWYH 5EOQL 5LKNA 5EO9A 5BRZD 1J1XH 1TYJA 5CCKH 1V77A 3M0ZA 4I5BB 2J4WH 2WQAA 3S37L 1EJFA 3I3DA 4IWWA 4GY7A 4S1RL 4BJHA 2YPKA 5INCA 3NCCB 4X7TB 5EU6B 5EFFA 1BXNA 3EKCA 3ECBA 4FG6D 1QLEH 4NENB 1RJQA 1IGJA 2DMBA 4NVTA 2OL3B 2PO6C 2OZNA 3CUZA 2PTUA 1TQBC 4RISL 1Z5LB 3QO0B 1UZ8B 5F7FA 1QNZH 1T4KA 1C1EH 3LEYH 4IBLT 4LAZA 4K73A 1XCTB 2Z31D 3U0TA 3VUSA 3ZMRA 3BFWA 4F8PA 4FNSA 4CC4C 1JUEA 1PCXA 3ARBA 2W0KA 1P0DA 2XJ7A 5JIKA 1F73A 3Q06A 1XF0A 5HULA 1ZT7A 1SFSA 4K3JL 4PJ7B 3WJWA 1E73M 1MZZA 4CVUA 4NNAA 3OGRA 2BFVL 1OGAE 2AQQA 2E6JA 1BJ1J 1J9CT 3TZVA 4LEXL 3RLSA 4F2MB 1NAL1 5IW1A 1GZGA 4L3AA 4L3CA 3K4AA 4YUEH 4LSRL 4ADIA 3QMRA 5IDZA 3RFZC 4YFEA 1FVEA 3SE9L 2I5QA 3GU2A 3L0KA 4E41A 4TULH 3WL1A 5LA2A 1YN7A 2FATL 4RA0C 1J5OL 4Z7WA 1GGIH 5GNXA 1WQVT 5IJDC 2VYOA 2BVQA 2OJEA 4UZSA 1BG1A 5F1UA 4UQAA 5A3HA 3JTTB 2VX6A 1ILSA 5DJCA 2HXAA 4ZUUB 2XCMC 1QSFB 2YD7A 1FC2D 5LGJB 1KLGA 4OSUH 2CBVA 2YPKB 1MZYA 4YBQC 5INCB 2DDXA 2J9YA 1MIEH 2Q5BA 3LJ3A 4ADJA 3IKCB 1T2JA 5AW7B 1NIBA 4ZQRA 2BSCA 4HKBA 4DPQA 1H0DB 2BX7A 2H3XC 2R7EB 1IC7H 1D6EA 3NJNA 2CMRL 2QVHA 3SUUA 1DVFA 2QSCL 4QRQB 1VFMA 4JZJB 1DQXA 3H2NA 1IGIH 3AAMA 2G8ZA 3WNPA 4HOMA 3V0TA 3ZJKA 4NJAL 1NEPA 2V5MA 3DYPA 1WAWA 1ODUA 4Z2IA 2YEZA 1PDKB 3O4OC 5C1MB 3KW3A 1HNFA 4I90A 3K6IA 2WQ8A 5KS9B 4LBSA 4Y88A 1QPXA 3TIDB 2BY0A 3FT3A 3IRZA 1GJUA 4GAJH 5DUBA 5HGHB 3PBGA 2Z0BA 2IWGA 6CGTA 3KGUA 1E0OB 2YAEA 5IR1A 2EQDA 2L8AA 3GIVA 1KCRH 4WUUD 1QYGH 3FKKA 3FF7A 1ONQA 2R69L 3VTAA 4PR5A 4PV9A 4G5ZH 3TFKD 4MPKA 3R06A 3WO3B 4P8XA 2XTSA 1F8TL 5MERA 3OLEA 4M6OH 3HOJA 3GTVA 5FJJA 3B8VA 4UDTA 4NB7A 4IRJA 4JVUA 4WTZG 1IZJA 1IC4L 1MCPL 1ZHBB 3W25A 2ZXQA 5SX4I 4F1SA 2ZZ1A 1T2XA 3NDYE 3QDAA 4C8XA 1R3IH 2F7QA 4ZXBD 5AOKA 3V8OA 5JDSB 5CAYB 2WJ5A 3P4MA 1NBZA 3IJYB 4FF9A 5BZWA 3FT4A 5CCJA 4PFMA 5C0BD 2ALWA 2Z65C 4N8UA 2MCMA 4FP1A 3AREB 4JRFA 1N0XL 2ABAA 4OCYL 3D39D 2R9HC 3HPLA 4U3HA 5F7AA 3LZ3A 5TE4L 4MSWB 3PWAA 2AANA 1QFOA 1X7SA 3N50A 3HLAB 4LSSH 5E5UB 1QUMA 2VDNB 4IBSA 4PTTA 3ZR5A 1MCBA 4O51B 4CW1A 1H3XA 4Z8FL 4OLYL 3WE6A 3CSPA 3LMJL 5FM8A 3T4AC 5JW5B 5SV4A 3USZA 1EC9A 5J6GB 5B8CC 1HJXA 1A7PL 1N0LB 1ED3B 1VFAA 3VCRA 2PP9A 5DD5H 3MUUA 5D1ZC 1WA1X 3TR9A 3PPSA 2R1XA 1UT1A 3MXWH 4XKYB 2Z35A 2E7CA 3E9UA 2AQPA 4OR1A 3BJTA 4TX8A 1IAOB 2VN4A 5HHNB 4G5ZL 1ZVSA 3WFCL 4HV8B 2Z31C 3NTCL 3ZKND 3RX7A 1ZHBA 3QEHB 4XBPB 4WI6A 4UFIA 4PJXB 1CFMA 1MY5A 2OMTA 2C0HA 1AXIB 2CO4A 3IJQA 2LVEA 4G1MA 2V5DA 1T89C 3HFYA 4N0UA 2NYZA 3KPSA 4UM9A 3LV3A 1V5JA 2GI0A 2CGYA 5C0NC 1ICSA 5H8PA 4XNYL 1U91B 3BP4B 1IV8A 1SLXA 4OUEA 3MUY1 4RX4D 1OINA 2FJKA 3GJFK 1ECZA 1KXHA 3FUMA 1P5UB 3L5XH 3KCOA 3MANA 1XSIA 3EGDB 4ZFFB 4G8EA 4ZOAA 5K9CA 3QDJE 4LCRA 1V7ML 3WF1A 5CLXA 5CUSH 2RQEA 3ZLFA 5GRUL 3FXYA 2N0MA 3GBML 4P5MB 3LRHA 4PJ9B 4AEIL 2HBVA 3FQTB 3U4EA 2PRLA 4YTQA 1I7TB 1D7CA 3CVIH 5A43C 4FZIA 4IIGA 4W7UA 3IDYB 3R1GH 4X7DC 3IFLL 3WMLA 1E4WH 3QIBC 2XKNB 5BOZG 4KXDA 4S0SD 1MQ8A 4XIMA 1BEYH 2XHNA 1Y0LA 3MLTA 4JAMA 4FHAA 3ZO0A 3BVXA 1UEYA 3QW3A 3N9RA 1M9SA 5C9JB 2G3MA 2QQKH 2PWGA 3FQUB 3S3BB 5ITFA 4JTKA 2VN3A 4L4PA 4Y6GA 4GXUN 4I0PD 3RPMA 1S3HA 3KYKL 3REVB 3VIFA 3VC6A 2FJUB 2FQIA 3QJRB 2PTZA 4LS0A 1GXEA 4PJXA 1ZANL 2UWEF 3IDJB 4AY8A 2BZ7A 4NZUL 2C1IA 4JDZA 4MMZA 4XPHH 4APXA 4Y9PA 1H9VA 1NGYB 5BS0A 1MNZA 1JZGA 4U1MB 5J1TC 2IW0A 2GHWB 2J88H 4MMXC 5TD4A 2YW3A 4JGUA 2HRWA 4PUUA 3AT8A 1FRBA 2OO0A 1J11A 4QR7A 5ABAA 2E56A 4B9PA 2G60H 3SYCA 4N20A 4LRNH 1K9TA 3CMGA 5EG6C 1F5WA 3R18A 5EIQA 1CD1A 3UTPE 4MD4B 2JBMA 1E56A 3GK0A 4FQQA 5H8MA 2ZF9A 2IDSA 1N7ML 4IU2A 1E3FA 1CUOA 5CZKA 4I6VA 1HZHL 4TVPL 2YD5A 1SJEB 4RISH 1PZAA 4APQB 1HZHH 3SUVA 1FWWA 4HFUL 4DZIA 1JWUA 3DX0A 4LLQA 5D03A 3RL2A 2XSKA 2E4FA 3T0AA 4E9QA 1NDVA 1DL7H 2VLKE 3NJHA 4N9OB 4TLUA 1AH1A 1K6QL 1T1YA 5I1CL 1U8IA 4L3EB 1PTGA 1T41A 4R96B 3HRZC 3C6CA 4KQ4L 5FCZA 2X9XA 5GS1C 3CHFA 3NVTA 2E67A 1HXYA 1IBFA 2CW6A 4ODVH 5G2NA 1JCVA 5KBKA 4JTRA 1U3JA 1T2QL 3J2PA 4EPSA 4U7KA 5IB4A 1BD2A 3ZDXE 4YTRA 4IRSA 4WHYG 1JDFA 3W0KA 1P7KB 3MODL 5C09B 1GR7A 3IJSA 1J9SA 3VM7A 4AZUA 3H26A 1YY8B 3A6CL 2Y8VA 2QW5A 1VZWA 3S4SB 4YDVB 2V2CA 2YN3A 1A3ZA 1R3KA 2F7PA 2O5YH 3TH2T 1EGVA 4RGNC 5IZ7A 2Q9OA 1UC4A 3R5EA 2XDFA 3BOLA 1GHFL 1M1XA 1MFBH 15C8H 3T8MA 3A0OA 3ZHDA 3WY3A 1XR2A 2GYIA 4GH3A 4EWND 5DEFA 1YPZE 3G5ZA 1R7OA 4JDEB 1J05A 4JE0A 1WIPA 2ITEA 2JCWA 4G6AC 4G8IA 4JQVA 1F76A 3AQZA 4WO4C 3LHPH 4BFAA 4RMVA 4A2RA 4HN8A 1I8IB 1Q1JH 4JB9L 3MN8A 1AHWB 5F93C 4EZKA 3U7AA 4POYA 2FIRT 4F5CA 1KW1A 2E9LA 3PF2A 5GSRB 1E4XH 4ZAKB 4FX6M 2A77L 1SUXA 3EGSA 3S7GA 4TTUA 3O4LE 3RWCA 1WQ5A 3VDGA 1TSRA 3CTTA 1MLCA 1GCYA 2VDQB 4OZFA 5AW3B 2QQ6A 3EKGA 5MKGA 4FG2A 2DWYA 4HOXA 1JFQH 1MW1A 2AQ3A 2VM9A 2X3CA 4IU3A 3BPNB 1IIIA 2JLLA 2BDNL 2GFBA 4TSCH 2TRHA 1WNOA 2K1MA 4FQPA 1ZNNA 1T3FB 5IVZB 1INEH 4JFPB 5ERWA 1QFPA 4QFUA 4WY0B 1NVMA 1LE9B 1RHHA 2JWYA 3C60C 1WAPA 2ACRA 3QJFB 3KEDA 4FLRA 2D1ZA 1NIEA 4UFJA 1IT7A 3PWNB 5FYLH 3OMNB 4KXCA 3K1DA 3E7JA 1B4RA 2AZAA 3I68A 3PY2A 3HNSH 1TJRA 2IALB 2OK0L 4RLIA 3AXHA 1XLJA 5KZCD 5L9FA 4W9EC 1OZTG 1SJXA 2WXHA 1F2JA 1Z0NA 2HJKB 2OKTA 1S7UA 4JPGA 1HXKA 5D2WA 1UT9A 5E5CA 5IBXC 3O6FD 3JV4A 4PGBB 3VA6A 2HTLD 3UTTE 3D18A 3JR2A 3GSUB 4HCHA 4G8IB 3PPHA 2LU7A 3LCYA 3ZE2B 3WK0A 2XH0A 1YDVA 4E2BA 2OLSA 1NFDB 2IBZX 2VNCA 3FUNA 5HGAB 5AVTB 5DWUL 3O9WA 1PZCA 3W9EA 1LT7A 4JNZA 1HQ4B 5HAOA 3T09A 1ISWA 1MHHA 1BQRA 2IPTL 1JCNA 4RE0A 4O9HH 2CWRA 3GMNA 4I9XA 4JHUA 3ULAB 2BLFA 4DO7A 1F90L 1B3JA 1XMWA 4F37F 4AQOA 3EPMA 2O1AA 3ZE1F 3ZYIA 3AYVA 4IMLB 4XQ6A 2F2HA 4N0RA 3TX4A 4PJHF 3V0SA 3W1ZA 4XUYA 3Q8BA 4BSJA 4RMWA 3DJSA 4F7CB 5IOKA 3RWJB 3MLSH 3OB0K 5B1JA 3TTEA 1RZIB 3LPPA 4PY7A 2IALA 1FL3A 1KCRL 3AM8A 3C5ZA 3DTDA 3K7UA 5EWIL 5LWYH 4Q74A 2ITCB 4OI7A 1OX5A 2DT3A 3PAJA 2ZBTA 4I8YA 3WQPA 3MA7B 1ZIAA 3MV8B 5E99L 3MLUL 1AW5A 1F1GA 2WIIB 1ESOA 2RACA 1IEBB 3HF3A 1P7KA 5H8DA 1TCDA 4GYBA 5IM7A 3QI9C 2LTQC 4X7CC 5GISL 1QO3B 1M56B 5AOLA 3H8AA 2PLMA 1HAWA 4YDVA 5JIIA 1R3KB 3U0PA 1CMOA 3RNKB 3LHYA 5I3HA 1YEFL 3UTZA 4KERA 5A6KA 3WEXA 4JQIA 2V3DA 1W9PA 4UTTA 1GKOA 3ETBJ 4R7NB 4IIQB 1S39A 3NH7L 5T5NF 1J1PH 5JPMB 5XIMA 3CFEA 1Q38A 5H37G 5LGHL 3WTVA 5K2ZA 1SGKA 4YU1A 3KVLA 5C6TL 4LGXA 3N1PC 1LM8V 4UTBH 3L81A 3HNSL 3OHXC 2R2HA 1MRFH 3Q3GB 4XZUB 2G41A 5L6UA 4JZNB 1JOIA 4WKZB 4FADA 1JHLL 5CJNA 5DJZB 4Y9MA 1N68A 4YZFE 2O93L 3PZGA 2GTZA 1R5IB 4AL8H 1YMYA 3MACH 2A85A 3E6FA 1VYSX 2HUEA 4JPQA 4P3WA 1O9WA 1GS6X 1X38A 2C18A 4O5LL 3RWGB 3NESA 2A5HA 3MJ7B 5D72L 5EORL 2C9QA 1EL3A 1KA9F 3QCUH 5E2TH 2I9TA 3N2XA 2Y5TB 1BG4A 3DBXB 1RZ8A 3E2QA 3ZS4A 1U8OB 1CPUA 3R79A 3SKOA 2GK0B 1H5BA 2BNUA 2UZXB 4B60A 2BOFX 1H8SA 1XD0A 5DGQA 2GTWA 2EP6A 2AZUA 4K3JH 2EJAA 3E96A 3F6LA 2EECA 4OZIA 5HJ3A 4GSQA 5JMUA 5FUZL 1I1CA 2VW4A 4ANWA 1ORSB 1O7DE 2AABH 1YNTA 1QSEB 1HIZA 1S5WA 2XGBA 3G1YA 1JZFA 2W95A 3EH2A 2Y6SD 2VAJA 4BIKA 4AY0A 2EACA 5IG7A 3ULVF 1FWAC 2XWBA 4L0YA 2P5WE 3GO1L 5C86A 3IACA 4N7QA 3I9GH 2FZBA 3WKNA 3L9EA 3BPCA 4YSSA 3EFFB 3MCLH 4MCYA 3RM4A 3QGVA 4C1NB 5GJTL 1BSIA 3EOAB 2OCCB 4RSYA 1A3HA 4RAUB 4B5SA 4HA1A 5D7LB 1JPTH 3TA4D 1BFVH 4UNVA 3KTCA 1U5VA 1Q6DA 2ORBL 4WGKA 4ZX3A 2HT4D 3L54A 2QTVA 2SFPA 3SCMA 3B34A 3EJZC 4MS6A 4BV1A 5I23A 5EF1A 1PYFA 4D9RD 4G8GA 4EQ3A 2FZDA 1U21A 4P8VA 4UBDC 4OFCA 3LS4L 1PKLA 4XB7A 3V0FA 2FZ9A 2QVFB 3AMGA 1WAEA 1YEJH 4HP5A 4PJDE 1KV8A 5B22A 3U9WA 4H8PA 1RY8A 3H0TA 4LCYB 3VKJA 3PV6B 3IVKA 2X2GA 3IU4H 3FSTA 3T2LA 5HMEA 4PJ9D 2IBZY 2ZRVA 4IDJL 4F66A 2H3BA 2C1OA 5DX7A 1HZLA 4W9FC 3RY5A 2DWSA 3M0LA 1A6AA 2IAMD 2BSLA 3SSZA 1N7MH 1BFOA 4MJID 2WMKA 1EGJA 3ZKNC 3A4JA 4Y4FC 5CBBA 3NQKA 5FYJE 4RAVB 5M94B 1CN4A 2IDUA 3ONBA 4M5ZH 5GRVL 4ZFOA 1ZV5A 2QADB 3LOWA 1BAWA 5EBMA 4JFHE 5AVQB 2VN6A 3KM8A 5F2LA 3WJLA 3CE1A 1TOXA 4DEUA 4MJMA 4AVOA 2AQNA 4PUMA 3U2CA 2CUAA 2LOEA 3N55A 1SYTA 3CFEB 3TCTA 3CT2A 4TNGA 3NCJL 3X11A 3V3WA 3V0EA 5I6NA 1PJWA 5LAXB 2PO6D 4OCWH 1SU5A 1A4KB 3DOHA 4A2LA 1NA8A 3X14A 2R0KL 1X98A 1G84A 5IVXE 3DK2A 1OVDA 3PK7A 2UZIH 2R14A 1NFAA 2WOYA 4OZHB 4ZFGL 2FMNA 3YPIA 5IT2H 1V03A 4UILH 1E0WA 1E9ZB 4YEFA 1UUOA 3DDGA 3L5AA 1LD9B 1VGKB 1OGAA 3F12A 3RWEB 1HF6A 2VR9A 3UP6A 1DWAM 2ZZUT 1J96A 1Q7QA 2DW7A 1EZ2A 4PMZA 5I3FA 3RKPA 4H19A 4AM0B 4UV7L 1EXBA 2JQZA 2CM5A 1G9EA 1QPRA 3OR7A 5ESVA 2YD9A 1ZDSA 3D2TA 3VFRB 4DB7A 3KWTA 4XXCA 2FQFA 3VE0B 2FWOA 3UJTL 3VRIA 1MFCH 3UWUA 5KZMA 3L0GA 2QL1A 3PFQA 4E9VA 2JIXA 1WKEA 5K9XA 2YL5A 4OFDA 4EI6A 4PRIE 1QR7A 2NX5B 3MSRA 4MCZB 3S8WA 5HSFA 5GRJH 4DJFA 4ERGA 1KFWA 3FO0L 2E7BA 5IQ9A 4L9LC 43C9A 4UBPC 1AC0A 1WBZB 2IBBA 3TNBA 3AIWA 3W9ZA 2CKNA 2G60L 4ABVA 3FSUA 1B0GB 1JPDX 4LKCA 4Y19A 3RWHA 4BWLA 3SRDA 2XPZA 5IW3A 3DGGA 3CV1A 1UKSA 1Y18A 2JTDA 3DG3A 3UJ2A 2CHXA 1I3RA 3MRNA 3CNYA 1DVFD 3E2RA 2R27A 1DLFH 5EO9B 2VXTL 3QQDA 3LRGA 5ETUB 5A2IH 4A05A 3B8TA 1F86A 3V6ZB 1CBVL 3MTWA 4K8RC 4XVSL 2FGWL 3QDMB 4Y16D 3CFTA 5D96B 1VKFA 4EF3A 1PYWA 1TVBA 3L9RB 4D6EA 2ZVRA 3LN5B 1XR9B 5IBLD 3QW9A 3QEGH 3KPTA 3D0AA 1CLYL 1FL6A 2AAVA 3BVTA 4LOFA 4UV4L 5I8CA 2RUSA 3U4AA 1T99A 1CE6B 3UBFA 4TPRL 1T7WA 4Z3HA 1V3IA 2YGOA 2Q86B 3QC5X 5HDBF 3E2VA 2PXYA 7FABL 3S9IA 1JN6B 3BQUD 4P46C 4QHNB 4KIEA 1VGEL 2QPSA 1IU1A 5D1QC 3BXWA 4NQCD 4UDTB 2HK0A 1Z0MA 4QRSB 1YNKL 2A3TA 2JTYA 3IGUA 3EGXB 3QWRA 4HXBH 1VDGA 5DU7A 5EU5B 4JN8A 2A3HA 1PPIA 3VAEA 1MEXH 5DCCA 5ISZD 3ZJ7A 3MYOA 2Q20A 2APSA 4KKRA 3TOYA 2ATMA 2WTRB 5HINA 1V3LA 2ZUYA 3V6ZA 1GKPA 4F7PB 3KRBA 1TQUA 2AL1A 2PP3A 4W93A 2K78A 2Y2WA 1K8DA 3QUZD 1ZVNA 1P7HL 4P59L 5FUCC 3G5XB 2VZVA 4JUTA 2ED8A 5SWZD 3RTQD 5IFJB 1KM5A 1PLAA 3TYFA 1FL6B 5CO1A 2R1MA 4JKMA 4FYRA 4ZB2A 2D2OA 1VC4A 2XQYK 3SDCD 2FHBA 3HHRB 3QUYA 1UXSB 4QJ4B 2XTJB 3FTUA 3OJDA 5D7SL 4JN7A 2H32H 2DM7A 2EKCA 2ZX7A 4O2EB 1S2TA 5LIXX 1UJQA 1LO4H 3OGCB 4YHML 3GU1A 2PKDA 5BMXA 5IRPA 3TBVB 1XC6A 5DA4A 1R17A 2X70A 4WHCA 3OR7B 2FEDC 4PTVA 3WUEA 4I2XA 3VXGA 3PGDA 2AQWA 3ETBF 1N8FA 1I7RA 1LWJA 4LOVA 4Q6IC 4FALA 4QQ3A 3VOJA 3VRJA 1T66C 1SOSA 2KT6A 1HW6A 3W3BA 3PZVA 3RU8X 3FQ4A 3WQCA 4GSUA 4PAZA 3STLA 2GQHA 3BP4A 4MTMA 3JZYA 2OMBA 4M5PA 3QFJB 1P0SE 2NCMA 4QF1B 5KSBE 2GC4C 3LUTA 1D5MA 3WDRA 3GJEB 3OLGA 5I75C 1JPTL 4EI5C 1H3WM 1YNLL 1IKOP 1NLBH 2JJUA 4MKMA 2AC0A 5A8OA 1U3ZA 1TZHB 3IK2A 1I1AB 4OCXL 5C0RL 4PLJC 5ES4B 3EO0B 4AWSA 2VKWA 3HN8A 1B6DA 2GSJA 1W1ZA 1HH9B 3ITTA 5EC2B 1G94A 3ESVF 2BOCA 3HMXA 1M5WA 2VMEA 2CO6B 5IQNA 1V6TA 1UD8A 1ZENA 5E9DE 4XZ9A 4PBWD 5CPTA 3UWWA 2DEYX 1KC7A 5TF1H 1PNCA 4JJ5A 5F89B 5LCVH 3RPKA 2GSIB 5CJOL 3UH8A 1E90A 2WHJA 2X7VA 4Y2OA 5DY2A 4PG2C 1NANI 4WW1A 3DJTA 3O3DA 5I6LA 1CXLA 2XWTA 1AQHA 1V05A 1L9QA 2GJNA 3I7QA 3EYFB 1BVNT 2L4OA 2N3JA 1A2YB 2V2WA 2YQ3A 3AADB 2WP3O 3KH4A 3MROA 4HWBA 4HK5A 4XZWA 2OTWA 3KBJA 3BDKA 1KCZA 4P7OA 4E0RA 1JWSA 2R1YA 2NOYA 1JGUH 3GLZA 3GFZA 4PJAA 4DI9A 1XYMA 2OG9A 4A37A 4P2QB 2OEJA 4HKJB 4I4WB 3EWZA 4R90L 4H83A 1SZFA 2H6UA 3GSVB 1GS7A 2ERJC 2ESVE 5CJQL 1WEJL 4R2GC 3HG0A 3UP8A 3TA6A 3UWVA 4MAVA 2BP0A 4R7VA 4MWAE 4FKHA 3D0VA 1IBGH 2GSEA 4Y9FA 1EJTC 1MF2H 4WU7A 3LHZA 4NKDA 3G3MA 2K6WA 4WXYA 3QFJE 4UMSA 1DYZA 1V08A 4PHZA 5C97A 1OX6A 4XO8A 1JPST 1JV5A 4EDWL 4JLRB 4KXZI 2ZA2A 3LBOA 4HUNB 4G9FA 5LGHH 1SO5A 4F8OA 1YKWA 2AJVL 3P3UA 4PP2B 2I1OA 2R1LA 4BWTA 4C6OA 1XYAA 4IZGA 3PGFL 4P5MA 2IKGA 1S6NA 1MLBB 2IV9A 1FCBA 1W5OA 5HI4D 1QFWH 1IE7C 3KFTA 1NARA 4ZR8A 5AFAA 3UROR 2F0CA 2L5HA 3U2OA 4UNTA 4AVHA 1MRQA 3SDDD 1FJ1A 4NQDB 2JJWA 3NZ8A 2E5CA 3WF0A 5AECA 4J8QA 5JQ9A 3MBEA 5DJDA 1XIMA 1GH7A 2ESCA 3PNRB 1NWRA 5KZEA 2ICEA 5CNHA 3S4SG 3PZOA 4OJYA 1CZ8H 2IPKB 2A4AA 2Q3XA 3FQUA 1XBVA 4X9IA 4A2MA 4PRDA 3UGXA 2NX3A 1EXHA 3WLRA 5C08E 3PL6B 4XN9A 4QITA 1VFHA 3IF1A 2DKSA 1UGNA 2TSBA 3TPUA 2WYHA 3EYSL 3VACA 2C1HA 3FJNA 3HIJA 1M9WA 3IJEA 2KQMA 1J93A 3WO4C 1EO7A 2FX7H 3V5KB 4M9OA 2PGFA 3RGTA 1OARH 4S38A 3P4NB 1QI4A 3NFNB 3QFJA 4FFZH 4PJDF 5FF6A 5D32A 4JDTH 3HG1B 2PWFA 3GKFA 3N9GH 3SQOH 5CMAA 4EBQL 3M5VA 2REQB 3TW7A 1J8HE 1O5PA 1SPDA 5GSRA 1JGVL 3QUMA 1Q90A 3GMLA 4BINA 2PF6A 3MFFB 3IAPA 1P9MC 4NUPA 5DSCA 1H5YA 5JXAL 3VCLA 1SR9A 2IXVA 3EWXA 5EZOH 4PS8A 5T1LA 3C2EA 2EXTA 1OCQA 3REQA 1VIWA 2YK1L 4GJJA 1DVXA 1GS8A 2PXYC 2ZXEB 4WFHE 3HE7C 2YLHA 3LS5L 5D5MB 5HHOD 3W7PA 3NA9H 3PU7A 1NFIA 4YAQB 1NBVH 2EEDA 3NCOA 3V0VA 3ZE2E 4I6KA 4DEPC 2A2QT 4JUSA 1OD8A 4A6YL 3GBMH 3QNFA 4AEIH 4V28A 1P4LA 2V7NA 3AU1A 4I1PA 3SZKC 4CVWA 4M4RA 1YNPA 2ZQ0A 3W1QA 4U6VL 4ANUA 3KBSA 4K94H 1DBML 2JGYA 1HKLL 4W4OA 2P5WA 4AQEA 4X6DA 1W1VA 4MZ3A 4U49A 1DUYB 2ZKXA 3SRHA 1CXFA 1P6CA 1BD2B 4TL4A 2V8ZA 1KFEA 3DI0A 2FSDA 2DJSA 1N10A 2H8PB 4JFUA 1VERA 1HWWA 3GSUA 3O3EB 4MZRA 1N26A 5IOPB 1ZGLP 3QQ0A 1UWGL 1JXJA 4Q32A 3MACL 1NAMA 4AD4A 3DFOA 2UY3A 4IRJB 4AK2A 1ESWA 2O6EA 4OAWA 4WJ5A 4JFYB 4XXCC 1KM0A 4O12A 3KHOA 3L13A 4OHQA 3MV9B 1AI1H 2R8SL 2CLRB 2BSTA 4DXKA 4WUIA 5DEZA 1TQCC 1MVYA 4U4IA 4E9YA 1S2EA 3IS4A 3BAKA 4QHKI 2ADFH 1L9MA 2QDEA 2W9EH 1A14H 1T5AA 1TTRA 1DN0A 3MUIA 4K36A 1W72L 4JEJA 2JK5A 2YBTA 1RQBA 2P0IA 2RIKA 1AZCA 3GVGA 3PS6A 4KKAD 4LVHB 3E0WA 3R89A 2VDOB 2FGZA 2CA3A 4L3CB 1HEJC 1OG6A 3V4VA 5K3VA 4UILL 3WD3A 3SE6A 3FK3A 2X9YA 4MXQD 3D18B 1RK5A 3NGFA 1Y1UA 4B9FA 2V3FA 3PPCA 4X6DB 3N17A 2NY1D 5C0AA 5F9AC 5IB1B 5CZRA 5FO8B 3X12A 3E49A 2NRDA 3OBAA 3G04B 3QI9A 4UQ2A 5DJCB 3D3VD 1XGQA 1T3FA 5IVZA 3MMWA 5EA9A 3S3CB 5CC7A 5IM7B 1TUPA 3W1TA 3MVIA 1MHHB 5HTSA 1ONXA 4WIWA 4Y4KD 2JKAA 2FJHA 4P5TC 1JTPA 1IZKA 1MFVA 5HYSG 1U36A 4WVRA 2X9ZA 2YPLA 1ZHLA 2ZUVA 2OXGA 3WHXA 6REQB 4TOYL 4AMKL 3QORC 4P7NA 4I3SH 2ATPA 5HY9A 1SYSB 5F7UA 4JZJA 1SO6A 1DEEB 3OKNA 1UUMA 4QQUA 3RYSA 3UEQA 5LHFA 2FO4B 2V5TA 1OFAA 1NZRA 3R8BB 1KULA 2X7WA 2E6YA 3A12A 4NCC1 5LG1A 2VLKB 1OB1A 4HHLA 3OXSA 3ZKXB 1OF0A 3MYPA 4HYVA 3W7OA 5CP3A 3DFYA 5D2XA 1R3HB 5K9OB 1GVSA 1W2VA 1QDSA 4V1YA 1G7MB 3N5AA 2KUTA 3ZT6A 3LCFA 3IPBA 4NZ1A 3HI1A 1RH9A 5F0LB 2HJPA 3MV01 3SDYL 4XBGB 4ELKA 4APQD 5CN3A 4G6KL 3BN3B 2WWCA 4ZMAT 4P8UA 4G1EB 4GLEA 5DANA 5I6OA 1W8EA 3TEZA 1JZEA 3HGOA 3UZJA 2XNAB 1SY6L 5J89A 3O2WH 4YSUA 1IE4A 5AYUH 3DRTB 4WTWA 3PAOA 4D3CL 1KLFB 1B2WL 5DQ9B 2ZC8A 1P4LB 1KTBA 2V7NB 3MRIB 2CJ3A 1UJ3C 4ELMA 1GOOA 4JQIL 3FTXA 4PU2A 3ZLHA 1B6UA 1E5JA 1AD0A 3MMEA 3GHEH 1UR8A 1OFDA 1SFDA 2QLYA 4LCWB 3CH9A 5C8BB 4JG0H 3ILQC 1EO5A 1UD3A 2OMWA 4YPGA 4XRCB 5SWZE 1DUYA 2Y06H 3RVTD 4AYID 3P93A 2BOGX 1UQZA 1HIML 1W0WB 5L7XH 3ENLA 4RFOH 1B54A 4UR8A 4X61A 3GXFA 4PE8A 2R51A 4AQAB 3FB7B 1KN2H 4H25A 1CTNA 1T0NB 3LHTA 3UAJA 2HJFA 4FXGC 3R8QA 2AV1A 1EV2E 4G6FB 4KQ3H 2DJXA 4PJ7E 1TTAA 4U31A 3PPGA 4R83A 2C13A 3W7MA 1GPFA 3HCVA 4WV1B 3BDYH 4RAUA 3N9KA 3VINA 1WBXA 2PTXA 3RTQC 3OBKA 2NY7H 3QJUB 4XWOD 3VFPB 2ICWI 4WO4A 2J79A 3QUML 3CFBB 4PCNA 1GL4B 1LM1A 4FSAA 2XZCL 3BLIA 2G50A 2O9OA 4AL8L 5IHZA 1M7DB 1ORSA 3KVKA 4L3EA 5EU7C 2FR4B 1TV4A 5ABEA 3VNKA 3UGVA 1JQVA 1PSKH 4N2GA 4H9UA 4ZBJA 4LPWA 4LZKA 2XPGA 1W3JA 3WFBH 1N6UA 4MS8C 5ICZA 1MUMA 3G1FA 2YD4A 3UX9B 3DBPA 1E9QA 3V0AC 3F7LA 2VD8A 3THAA 4HN4A 1TEGA 2FX9H 2NY1B 1OAUL 1ZPLA 5M7QA 4L7ZA 2BERA 3ROOB 3NFPA 3MJ7A 1RCOB 2BS8A 4GJ1A 5J12B 4S3DA 5J1AB 2P5PA 4PRHE 3RF9A 3DTUB 4N9BA 1DANT 5EC1A 4TQPA 5DHVB 5EGRA 2XWJA 1P6BA 1E6OL 2R0KH 1KB5B 5GGRA 1IQ8A 3NIGF 4OT1H 1UWSA 4LSSL 4XC1H 2LAGB 3SO3C 3SBWA 2I5IA 3QV8A 1XRFA 1BVWA 1DVZA 2X88A 2HISA 2JKIS 4PP1C 4EOUA 5A6AA 3FGCB 3QY6A 4JM2B 3OWEA 5C07A 1MCSA 1URIA 4KK8C 3V7AE 2D7OA 3K6DA 3BQ6A 1EANA 1T6BX 3O6KH 1WS8A 2X05A 4L1DA 1XMEB 5ECGA 5J0BA 3MJYA 2BLEA 2HRHA 1PF3A 2ZCLH 1NFBA 1L6FA 2YHGA 3QRGL 1VS1A 4E5XA 3QJZA 4LL4A 4KI5E 1TVPA 3PUCA 3W0WA 4YHOL 4EDXB 3RIFF 3JV6A 3M16A 4REQA 1HDMB 1W72A 1Q9KA 3A6OA 3IDXL 4GI9A 2QZ5A 1WKFA 3HJZA 4JPWL 3TYZA 2Z6JA 1H50A 5JW4R 1KBGL 1QHQA 3D51A 3QIWB 3OPZH 1GC1H 2O61A 1XBZA 2I14A 2GEQA 1U8JB 4CAGA 1GQLA 1IM3B 2VEFA 1FFOA 1FL5A 2DT2A 4WOQA 3F65A 3WJJA 2HB0A 4I88A 5AHIA 1QI5A 3M5ZA 1HH6A 5HGDA 1UXWA 3B03A 3AT9A 1PTZA 2CRYA 3BUYA 3GDRA 1SW7A 3QUXC 3LCHA 2UZPA 4LCCA 1F97A 2JCCE 1T04B 3TEWA 4H20L 2QCFA 1XIFA 5ENWA 3U9IA 2RGSA 3L2MA 2L7UA 1QNOA 1LO3L 5FO7B 1H9DA 4O14A 2CHOA 3QGAC 4A6GA 7PTDA 1YYLL 2BP3A 3LDBB 2OK0H 5DHEA 1HP5A 2AV1B 3BLKA 2HVMA 3AMDA 3O6DA 4PH6A 4EPKA 1UR9A 2ZG2A 3WCYA 3O41A 5EEZA 3HPFA 4HHHA 4GT7A 4UFLA 4DYKA 3QCTL 4H7ZA 4XPTL 3PGCA 1SMAA 3VX1A 2WD0A 2R83A 4WDUA 2X38A 2HG5B 2HPTA 2BGQA 3IMTA 2OQHA 1A1NA 3MSGA 5L8KB 3UTSA 3QP3A 4FNUA 4YWGH 3TO4A 2HSAA 1C90A 1OPGH 1KBGH 1ZHNA 3QQ4B 4GSRA 2ZZ6A 2PYFA 1G7LA 2H0FA 5JPNC 3AI0A 4N6FA 3BISA 5E93A 2ITDA 2Z4TA 5JBDA 1QEWB 2DT1A 1F07A 4B95C 4E2VA 1EFXA 5DRWA 2PW1A 3WKZA 3O4LB 2X4NA 2P8LA 1QVOB 4CJ0A 1W16A 3CSFA 4NKIL 3RLHA 2NNXA 5LBVA 3WFLA 2I7GA 1YEKH 5IV2A 2FE0A 4J1OA 1TETH 1ME7A 4TXVB 3DIVA 2BV9A 1K8CA 4GI8A 4I9AA 4IRJC 4LUJA 2FBJH 3BKJH 4V2CB 3VWKA 4H4IA 1KIUB 4PRPA 4G3YL 2NY1C 2NQLA 2Q6ZA 3IFPA 3MLXH 3W7HA 1QPKA 1H3PH 4MCZA 1OIFA 3GHRA 3BUVA 2KZWA 1KD0A 4H26A 4OIIH 2I24N 3TC7A 1X1NA 2XQBH 2ODHA 3N9GL 5G4OA 5ICUA 2W92A 5ERWB 4JDTL 4UQ3A 3G8EA 4Q33A 5DQPA 1TYRA 4XPBH 1R24B 5IVNA 5I77A 4N0YL 1M7JA 1F1DA 3LTSA 1EJRC 1TJPA 1W8GA 4YVVA 1RZ7L 1F61A 3UIYA 4ZQMA 2JKTM 1FFNB 1K5WA 3TQKA 4AX6A 4YHKL 1CFBA 3SPJA 4LHQB 2ZTJA 2UZYA 3ZTDC 1G4RA 5DT7A 4K8EA 4N85A 4U6TA 2HRGA 1XI3A 3MXVH 4WGWB 4X9HA 1WXJA 1JNNH 3FTGA 4DBEA 2CLZA 4Y4HC 4A66A 1I9JH 1SBSH 3ZVIA 3KAAA 3VQMA 2WBJD 4KK9C 5DLML 3S2JA 4FQXB 2NZIA 4HCDA 3QNZB 3H22A 3QFDA 5I6MA 1HK6A 1P7BA 4JFFD 4JVWA 2CGRL 5C0DA 3ULUH 1FA2A 2P3EA 3B8IA 4NQEB 4TNFA 1U3HA 2C9UA 4GLRI 4CJ1A 4HWZB 3MJ9H 1L6YA 3H24A 3PG2A 1JV2B 4A29A 2BZDA 3P82A 4MA3B 1Z1WA 1KPUB 5T3XD 1G7IB 2IAMB 3QJXA 5IMMA 1T4KB 4N2LA 3BWUC 3LQAH 1RV6X 1EJ8A 4DAGL 1E4MM 1JPMA 4X9YA 2RB8A 2AJUH 4NAQA 3ITVA 5CCGE 5EIIG 1HH9A 4PWJA 4MWAD 1U42A 2DPKA 1AQMA 5BXFA 3S1GA 3MRPA 5HYJD 4B2DA 3P0GB 4NZ8A 3LOTA 4ERAA 2GWNA 2PDIA 3CV7A 3SCUA 3TSDA 1KFAH 3QYQA 1RHCA 3B2VH 4JS7A 2V63A 3CIAA 3ZJ8A 4W9JC 2W9DH 3THUA 4WW1B 2EDHA 3DOSB 3FU7B 4XXWC 2HG5A 3S8FB 3F7KA 3GMPA 4YXHH 5CSUA 2ROYA 2FX9L 4BSWA 5E1GA 1ZLEA 2W65B 4D3CH 4HJTA 1ISYA 2OGJA 3TO2A 4PJIF 2VR8A 1FRGH 4AGPA 1IL1B 3K5SA 5I74C 4LJ3A 2ESVA 1NIFA 3CK0H 2PPDA 4X99A 2A4EA 5F7DA 3T04D 1X6NA 4Z08A 5BWFA 1MWAH 4LPCA 5IREA 4F0HA 1JRHL 1IT8A 4HKJA 3VO0A 2BHFA 2PA6A 1FLTX 1FZMB 1HYSC 1QO2A 2ZWSA 2Z6IA 3W56A 5J5EA 4C4BA 1XGUB 2CSPA 3TQVA 1T8QA 1NWOA 4P5TB 4N8VA 1SVDA 1V7AA 3AC0A 4EOWH 1U2CA 2WK2A 4MJIB 5LCVL 1OGTB 1WWAX 5BYWA 2QKIA 3I50H 4E9RA 4OD1H 4DBDA 3DK0A 1P0BA 2CBTA 4TUFA 3VWKC 4LANA 1PDKA 4PGDB 3EH5B 1AGBB 1S9WA 4GKSB 3P9WB 1R33A 4P2RB 1ZAHA 4OOUA 1A9BB 2VT0A 3ILPB 2HUHA 4AMKH 2ZX6A 1KBIA 4PCKA 1FWEC 1OZQA 5HNRA 4I9WD 3HNVL 5BUGA 3EJRA 1JXFA 3IE4A 1WTLA 2EIBA 3BVDB 4Z7NF 3AG3B 4MAZA 3LNEA 2BWIA 4XHJD 2RGMA 3EJPA 1CLOH 1MLBA 4PWHA 1QHPA 4Q8UA 3BD3A 3ZTEA 1J8HD 4XVTH 1US3A 1ORQB 1COBA 3VCNA 2QKSA 4BCZA 2VC2H 2OQJB 1CDYA 4OZGF 4LB8A 4B9JA 4KNQA 1F8MA 3PUGA 4PC8A 3IGLA 4GGHA 1GZPA 1TJIL 4QDGA 2ZF8A 1SY6H 5GGUB 1ZK9A 3DGRA 3NH7H 4KKPA 3WFHB 2P80A 3L2LA 3MRQA 5D1XE 5BJTA 2JMRA 1MNUH 1WFTA 3CT7A 2B1AL 4IGSA 4PS4L 1RBOB 1DLHB 3CN0A 4QRRE 1Q72H 1ZIBA 1DDHB 5DS8B 3N14A 3TPKA 1KJ3L 4IRZH 3GSVA 4NNBA 2A6DB 3BKCH 4JO2H 3EAKA 3MX0B 4BRVA 4HH8A 4G5AA 1MVFA 3C9NB 1S2WA 5JZ7D 2O26U 4N4PA 5CEWA 1AR1C 2CHDA 3C09C 4FFYH 4MASA 4D8PA 2FNBA 3G5VB 2QULA 4XMVA 3AMCA 4D6JA 3VD2A 5CD3A 3VE7A 4LCQA 5BUPA 6TIMA 4MXWL 3FT4B 1REQB 4ENZA 4QEHA 2V4LA 1ZZMA 4N6RB 2A9NH 1DXEA 2G4JA 1RMFL 4HALA 2OQJA 3PWIA 4C47A 3S97C 3I6TA 3ML9A 4NRSA 2BMKB 1MRDL 4L3FA 4PUBH 1FWDC 2JFCA 4LS1A 1J8RA 3FRPB 2IAMC 4ESKA 2AQ2A 4DQOH 3WDQA 4AWTA 1NSNH 4OD2B 4P48A 1E6QM 4OFVA 1HL4A 1CQYA 3MRQB 3UTTD 1M7PA 4PMXA 3KVPA 3APYA 1BQLH 3Q13A 1EEXA 5G2HA 5KITA 4MCNA 4BJLA 5KVEL 4LIQE 3NRQA 3AALA 4LSQL 3EXTA 3CFIC 1XF5A 4J3UA 5D7JC 3IV3A 4Z0XA 4YGVA 4HH9B 3P3BA 4DERA 4X9FA 3V18A 5JXAH 3NZPA 2IPKA 5J12C 3BL3A 3W7KA 5KYWB 2F5BL 2Z93B 2QF8A 2QELA 5EEVA 4DBWA 4AJWA 1BQGA 3BZ4B 1SZNA 1QWUA 3CZFB 3BPNC 4B50A 4N1CA 4KKZA 3ISRA 3TPUB 1I1XA 5CUSL 1O6SB 5D1QB 3ZL4L 2EICA 5I03A 2NXZB 3N3EA 3VXRA 1YNQA 3TESA 1T83C 2DQIH 1OYAA 3Q0HA 2IKIA 2V30A 4TLSA 4WR3A 3TSMA 1LLAA 4ZNEE 3SB0A 3U82B 3KVMA 2DZXA 1VRSA 4W9LC 4M6QA 4UM8A 3IMRA 4ZODA 2BO0A 5HHMB 5HDRA 4ZMWA 1Z3NA 1TWIA 3VIJA 3MMDA 2CBPA 3GH7A 3DX2A 4PWFA 5DJ8A 3TE9A 4J12A 4HK0A 3L12A 5KBMA 5IFJA 4HA4A 4AISA 4YL9A 3RWDB 1I7TA 5HPOA 2Y6ZA 3HPJA 4XODA 1JGEB 5F3HB 1W32A 2BVOA 1IRAY 1NUGA 3FUDA 3S47A 2APVA 4N2NA 5IB4B 2F6KA 4YWGL 4A6YH 5CBJA 4R8WL 1S7VB 2ZCLL 3QIBA 5FM5O 5T5NG 5D5MF 1AQ8A 5K1JA 3TWAA 3II3A 2C1GA 2QDWA 3VXPB 4Z3IA 4OGQC 2ZC1A 2VAAA 1LLWA 3XIMA 4QLWA 3N40F 5ALCH 1GPWA 1LG1A 4JM2F 2A5UA 3BZ4A 3R43A 3WLBA 1BHGA 3HMCA 2ATPB 1A22B 1I3RB 3MRNB 4LCCC 1YRRA 1UASA 1TJ2A 2NX1A 3BOFA 3KWWB 2J7LA 4AXWA 5I15H 4UZGA 1T7ZA 1CL7H 4JRWA 1SZRA 3S5ZA 1FO0B 2AFNA 3UZEA 2I5YL 1E8WA 4DWSB 3TS8A 3HPXA 3OGSA 3AZTA 4H20H 3BP5A 5FLUA 1NAMB 4P5KB 4KMLB 2WQRA 4Q7BA 4RW5A 1AYOA 3QV6A 1NAMH 2WPBA 5C0AB 2VDKH 4XNZC 5KSBF 2OP4L 1HE8A 2TSAA 1NBQA 4MNQE 3DZ1A 3VXNB 5IT2L 3CPLA 3PJSA 2NXZD 1PZBA 1PKYA 4CA4A 3G1HA 2HN7B 4RZ5A 1Z41A 4TNWF 4JPVH 3HPJB 1NJJA 1IKFL 3BLLA 4GKLA 3BYYA 4AEEA 3SCPA 3OC5A 2ADJB 4CVZB 1QNVA 2GGHA 1SM9A 3IN2A 4K23L 4BBWA 2NSOA 2HJLA 3SO7A 1T1YB 3F4DA 5I78A 2AGKA 3RRXA 3WL9B 1A47A 1VFBB 4ECLA 2CE6A 4X50A 3UZXA 3CU1A 4O11A 4BYHA 1G87A 5D1XB 5D37A 4QGTA 5CJOH 2D7NA 1IARB 3UWEA 4F0KA 3NRFA 3MCG1 1D7KA 5IB1A 1I8IA 4MB3A 1YYCA 2MTAA 5SWQB 3KYMB 1GKRA 3NA8A 3VYPA 1OFBA 1VEPA 4BK4A 3U9UB 2EAWA 3O9NA 3WV0A 1E2VA 3C08L 3MBWA 5DMGD 1MW3A 5JHLA 4OZIE 3D1MC 3T65A 4FQLH 4HPYL 3C87A 1Q5MA 3PQYB 1XCWA 4HMDA 5KYWA 1RUML 4HPOL 3KWUA 2NPLX 3WLWD 4F58H 1PUDA 4GS7B 3N43B 4NZUH 2V5CA 3DI3B 3GMQA 2OX1A 4Y2DA 1Z5LA 4LNVA 5HHQB 3IDYC 4MDIB 3TN0A 5BXSA 1K4DB 5EN2A 4MYAA 3W7JA 2ZOOA 3GJFB 3PDGA 5JQIB 2IPJA 3PJXA 2GITB 3QZWA 1BM3H 4PJBB 3T78A 1BIIB 4JQIH 3QZAA 1YMMD 4FOMA 5IQ7H 2Y7EA 3I2CH 3KAOA 2XA3A 3HG4A 1F3XA 1CGVA 4L37A 4YS1A 4H8HA 4ZPVA 3IFOA 4OU3A 1J6PA 3MUJA 1KGIA 1XLAA 2JEQA 5AW1B 3SDAD 1UWQA 4HJGA 1BXVA 3HE6A 2CPCA 3RG1C 4E68A 1TQCB 3LCWA 4UC5A 3IJDA 5I82A 4YSOA 2Z0UA 4B5TA 5D1XA 2XRAL 1TYEB 4DCQB 4X4XA 3ITXA 4QXUH 3BLEA 4JEGB 4NZ5A 1XSKA 1U2HA 4K71B 3ERPA 3E1F1 1H1ZA 2DKMA 3F2DA 1YUHA 2ZKHL 4H1LG 5LGJA 1ICPA 1RU9L 1AK5A 4LYRA 2BNQE 2F08A 1LE9A 1JCTA 3HR6A 2RDTA 3EEGA 4FEMA 3I9PA 3FN0L 4UT9H 5EA0L 1RUSA 1KYOJ 3K30A 4KDWA 4YHNB 2J8UE 3QQ3B 3REWA 2QF7A 3KD4A 4JEQA 3RX3A 2WWMC 2OQYA 4RL3A 1EJ6A 3C2AH 1E8YA 1NPJA 1PX8A 3AQXA 4HAKA 4LPUA 4U6XB 1VJZA 5AYZA 4XZIA 3HI5L 5EDSA 2G5WA 3PTDA 2CBMA 3BXNB 3GKWH 1EVUA 4MD5A 3FUIA 1IEWA 4IJRA 4Z2GA 4F15B 1PG7L 4NSBA 3L4ZA 4KTDH 3U5YA 1S5TA 4O2CA 3V4UL 3VXUE 1AKJA 4EUPA 3M0YA 4DI8A 1RBAA 5DRIA 1GVIA 3MRDB 4PJ8C 1PS9A 5BNKA 3AS1A 2HG0A 3K72A 1XP3A 4S3CA 1OABA 2ZWKA 1SQ2N 4K8GA 3JVGA 3A4WA 3B0YA 2AXFB 2LLGA 4LOUC 3EYUH 4HZ1A 4PCSA 2QPXA 3FEQA 4KWVA 1TVHB 4LLUA 2O72A 4OCWL 4X6CE 5DMJB 4UIKH 4NQDE 2K7QA 1LE5A 2OSLA 1HVXA 1C5BH 3QNYB 1EOKA 2F18A 5AZ0A 3O2DA 5H91A 1HSBA 3H42H 4GI4A 3P30L 3VG9B 4YNGA 1F6LL 3O3RA 1JRHI 4M6UA 1FP9A 4EXPX 1WFIA 2VX7A 2XPGB 3SY0A 4AIZA 4WWKB 3BG9A 3C2VA 4LLAA 1QQDB 2ITCA 4Z7UA 4BUHA 1ENUA 3AYTA 3G9VA 4K8RD 4HUXB 4CMHB 3PFMA 1BD2D 3CIXA 4QTHB 1XINA 3HV8A 3QPQD 4RSVA 2ZXWB 5CZJA 3HLAA 1KEML 4ORGB 4Y4KB 1WD8A 3NOIA 4ZMTA 5ACZB 2BOEX 1MIMH 3WS3B 3PZIA 5HNUA 5JHDB 2EYTB 1NOAA 3O6ML 1YY9C 1XD1A 1LVEA 2EDNA 3WEXB 1XCXA 1EGJH 3A4XA 2R1KA 4IMKA 1I60A 1YG9A 3CDZB 4PJFF 1OM9A 5I6KA 3RU6A 2ZONA 4NDMA 2NY4D 1BM7A 3GLDA 2PYEA 2WLNA 3HZKA 2GVJA 3W2UA 5KYYB 2AXJA 2B7DT 4NJAH 2BK8A 1R87A 1A6WL 4QRRD 2PURA 1QABA 4WO0A 3T44A 1UWEL 2YSSB 1S7RB 4LVOB 1CDCA 3TJHD 3VXMA 4OZIB 3GSXB 4GSDH 2TODA 3DV4B 3W2MA 5ESQA 5DJZA 2IFGA 1L4IA 1XLEA 4KESA 4M62H 1BWLA 3QFGA 3GLCA 1NDMA 1HDMA 1W72B 4A35A 1U91A 1S5VA 1UB5A 1X5KA 1TZAA 4NHCL 5CJ8A 5KUMA 2XIQA 3B8UA 4WHTB 3BPCB 2W1NA 2E7MA 3AU6A 3L3KB 3BIAX 1F7BA 1YUHB 9RUBA 3EUUA 1AO7A 2IANE 1YBQB 1PLBA 1R9YA 1E1EA 4Z2KA 2G2RA 4EBQH 4RZCA 1AHKA 2P8CA 2PNDA 3VI4F 1WZAA 5B39B 3SE9H 4ZFOB 2P50A 4BKNA 3S3JA 1H6UA 5FGCE 4M43H 1WE5A 3KVJA 2YKKA 2VMCA 1DQWA 3SN1A 4JN1H 3WLLA 4PJFB 2C8NA 1W1IE 2RKXA 2PDNA 4LVHC 2Q2EB 3RPBA 2E9JA 1YNTF 4BKLA 5JXED 1XICA 2XN9E 5IJVA 5A6SA 4PVBA 3BJSA 3L3HB 5DRCA 1QEWA 2K3HA 2VLKA 2HFGL 2POTA 4ZQNA 3NL5A 2X4PA 4KMQA 4QR6A 1LO0H 1AHMA 1ISVA 4JFZL 3SI9A 1M6JA 3VFOB 1IEIA 2AL2A 3R7MA 2X2IA 3FRPG 5BMWA 2CXKA 1GYMA 1DBKL 2XG5A 5FA3A 1CICC 5F9JB 1WITA 2WXKA 3AXLA 3IU4L 5FX3A 3WN6A 3QZ6A 1CI3M 2FYVA 3QVAA 3R7RA 4X8XA 1W0YT 2JCCF 4CD7A 1HI6A 3D0LA 1E8XA 4ZZ9A 2GY7B 2VLRA 1FP5A 4JGJA 4WW2C 3RU8H 3N15A 3RDKA 2D7TL 4PBXA 3A21A 2VE6B 2WV3A 1PKQA 2HKFH 2VLJA 2X1QA 4OV5A 2AMXA 2MJWA 4DYJA 1LLOA 1RZKH 5FHAL 4JFEE 2DMCA 2XN9B 3T0WA 3QEZA 3C8HA 4YMPA 3U83A 2D0FA 3W2DL 2VEMA 4PJ8A 3RL1A 5HVFB 4LAMA 2I85A 4F40A 3JS3A 2Z29A 3C0SA 1DVQA 5I00A 2I5YH 4HEPG 2B31A 4MA8L 1G7IA 5JO5A 3FO9B 1DVFB 1DWGM 2WINA 1PSKL 2WYSA 3NCJH 3KCWA 5A2LH 4M56A 2G9HB 3L3IB 4R26H 3GIZL 1UCTA 4HK6A 4DX3A 3VFTB 1J0ZA 5HHME 3EOEA 1C8QA 2J20A 1UP2A 1ZV2A 5CPQA 1DUZA 1G7HA 2K9FB 4HZ6A 1JCLA 3EX2A 4KHXL 2P3ZA 2R69A 1IGWA 1J0IA 1OBAA 3VILA 4H26B 1I75A 4PI2A 2NT1A 2E3VA 2D31A 3VGEA 5E9XA 3GMPB 4ZD3L 3L5MA 3L2IA 4IPIA 4P7LA 1NCJA 4HJJH 3TCLA 3LNMA 4PV9B 2A1WH 3GSXA 3VXQB 1ZHLB 5GS1A 2A7RA 5FV2A 3TYAA 2ESVD 1XGRA 3WO4B 5B7FA 3MP3A 4KPLA 4FA8A 1TX2A 4F33B 4M1DH 4JFQB 4S10A 3CMOL 4J3OD 3TP4A 3BX7C 4XAFA 3OKNB 5JTWA 4JKPH 3VIOA 3BO8A 3NCEB 2Y06L 1WX0A 3KJ4C 4EN3A 3UYPB 1AH3A 3R0DA 4OB5H 1ROCA 1DIDA 3HPZA 4GPNA 5AOIA 3S83A 1EDHA 1KV3A 3DXAD 1V0LA 3MC0A 3VYNA 5EU4B 4OZFH 2H32A 3ZDYE 4C56B 3N0PB 2H6PA 3N12A 1A80A 5AW2B 1R3HA 1AKPA 4LSVH 4FN0A 1Z48A 1ALDA 2P43B 2NDFA 3ZSSA 2FGLA 4K4KA 5A16A 2GJ6E 1TV8A 4O02A 2EGZA 2YB4A 4RMSA 2OB3A 1OM3L 3PWLA 3EA2A 1KPRA 3P84A 3LEXA 4TNVK 3RIKA 1QI3A 1BG9A 2B7NA 2CNCA 4H41A 4IXHA 2XNAA 4A8NA 3NO5A 4IQHA 2VRQA 5CZVH 4ZUWA 4GUOA 1E6SM 1RHHB 1GEHA 3DSFL 1ZEAH 5C0BE 3WK2A 2XX0A 3QYNA 4JRYA 3UA4A 3TTOA 4NT6B 4OTXH 1EDQA 3EW3B 2VGFA 1WS7A 4Q52A 5E95B 3U4KA 1BP3B 3QH3B 3V5DA 4FOKA 4CQBA 3KGTA 4MQXD 1NEYA 4MUZA 5LWYL 2ZYFA 1SGJA 3L66A 1XS2A 1CD9B 2B59A 4FXKA 5DRNA 1SJBA 1I3GH 1MVUA 5CEYA 2WHVA 5CKAA 5AAWA 4I3SL 2W07A 3F7YA 3LN5A 3CIQA 4GLRH 1F8IA 1JI1A 4B91A 1T1WA 3MV7E 2VLRB 1EX0A 2VQ1A 3WTWA 3LGEA 4YHLH 2NXYB 4ES4A 1QSFD 4PRBB 1FFOB 3L5WA 3UAEA 1XG3A 2XFFA 1HXMB 1P5UC 4M4PA 5A40E 1Q6CA 1VRXA 4A22A 3W1LA 2J43A 1I1AD 3WTTA 4ADUA 1FGVH 5LGZA 2XT1B 3WNJA 4YJZL 2LFGA 4HETA 5D7KD 2IPTH 4HGWB 3S5LB 4ONFL 1SDDB 3A6CH 4ODHH 2E40A 4O2FA 2A99A 3F85A 1DTUA 1F4XH 1Z9SA 2CBQA 5HJGA 5CJ5A 1C12B 1Q6RA 5DK0B 4C56D 3W86A 1QLRA 4RAHA 3LD8B 3U1PA 3EO0A 4JQXC 3DYMA 4QOKB