5A2BA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
452
structure length
452
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
molecule keywords ANOXYBACILLUS ALPHA-AMYLASE
total genus 167
structure length 452
sequence length 452
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2bA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2bA01
1WZMA 2E8YA 2VR4A 2X2IA 3K8LA 1TQVA 1E9LA 1V02A 2Z1SA 3HU7A 3QHMA 4P7LA 2JF7A 5CPTA 3D4ZA 5A6AA 1MVYA 1HKKA 1PX4A 1NARA 2BHZA 3N1AA 4OBSA 4B15A 1MWOA 1L0PA 4TX6A 4U31A 4Z2KA 3VO0A 1AQMA 5M17A 2XVPA 4JZ5A 4ZE5A 2PWGA 3AZTA 3LMYA 1QNOA 5A95A 1V3HA 2ZXDA 1AVAA 3ARWA 2GUYA 1HJQA 4UOQA 2WLYA 2FGLA 2GDVA 3AMDA 1WZAA 4H8UA 5DMYA 3WNNA 1CGUA 4DM2A 1W1PA 1H1NA 5CG0A 5JIWA 2OWWA 1I1XA 2BY1A 3WBEA 2EPLX 2XPKA 3VM5A 1GVYA 1UH4A 4JL2A 4E4PA 3ZR6A 3VIJA 3CTTA 5HBFA 1O7DC 4AW7A 1M7XA 1B9ZA 1GUVA 4HA1A 1W3KA 2E9MA 2AMGA 4HPGA 4UFIA 3OIHA 2YBUA 4OZOA 3EDJA 3UG5A 4K68A 4E8CA 4DM1A 2ZX5A 4U5KA 3ZJ6A 3WMBA 2BY0A 3AROA 2F8QA 2BXZA 1QNQA 4EAMA 1C91A 5HPCA 3MSDA 2CITA 5A6LA 3CZEA 3ARZA 4CCCA 3E1F1 3A4AA 1UWRA 3KLKA 4ZFMA 1SYTA 3O6AA 4W7WA 1ISVA 3ARPA 3F4VA 3VD4A 2XJ7A 1E5JA 3SCTA 3L4ZA 1Q6EA 4JL1A 2PBGA 4PSPA 2GFTA 3LRLA 1EO5A 3A6OA 1CYGA 2EQDA 1XD0A 5ABEA 4FLRA 3CUGA 5C8BB 1QW9A 2EBNA 1ISWA 4W85A 3WQWA 4FLOA 3POHA 2G41A 2XIBA 4S3JA 2IXUA 2W92A 3VGFA 4GI9A 4F8XA 1TA3B 4X0NA 3WQ5A 1QHOA 4H04A 3U5YA 3EMCA 1KQZA 4M1RA 4ATDA 2BVTA 5GQBA 2WPGA 4MB3A 4LYQA 4M80A 5LA2A 5FCZA 2DT3A 3ZT5A 3PZ9A 1ZU8A 1EDQA 3IAPA 3ZO9A 1UA3A 4H41A 4IM4A 2CETA 3SUWA 5M03A 2WM0A 1FH9A 3LPOA 5BXSA 4QAWA 1B3VA 4W86A 2WVSA 4PMRA 4GO8A 1H4PA 3WH8A 2VCCA 1OSEA 2D73A 3AMKA 3WD1A 5DO8A 2X05A 3WF0A 4QLLA 3BCFA 4PBGA 5A6JA 3MUY1 3WNOA 3DHPA 1JI1A 3DC0A 3GXDA 2DPEA 1VFUA 4J3UA 4UR9A 2XM1A 3TTQA 1PIGA 1H2JA 2CBVA 2YKKA 1XRVA 2CIPA 2ZUTA 1NP2A 3BLPX 4CGTA 2FDMA 3SUUA 2OSYA 3CHFA 2J7CA 3W6MA 1WP6A 3A21A 1O7AA 1H0IA 1UR9A 3WKZA 1HIZA 1UR4A 3WQVA 2VUYA 2YL6A 1E72M 2WMKA 5A2AA 1W9UA 1E0WA 1MQPA 3T2QA 3VIGA 1JYVA 2VRKA 4MDPA 1E6PA 1EH9A 2VT0A 3BH4A 1GNXA 2FGZA 3AYRA 1NQ6A 1IT0A 1K9DA 3W25A 2VOTA 1E0XA 3SCWA 4HPHA 4JCLA 1U30A 1VEMA 4A3HA 2VTFA 8CGTA 2A3CA 3I3DA 1CXLA 5I6SA 4WSKA 2DSUA 4U5IA 3DYOA 2WHKA 1LG2A 3AIVA 2DH3A 1E71M 3VU2A 3TOPA 1CGTA 1C8YA 2BXYA 5HXMA 3L4VA 2WCAA 3F5KA 2QMJA 4CN1A 3L2LA 3D3AA 1J10A 4AZ5A 2J47A 1PZ2A 1HJUA 1TG7A 1JZ4A 3A23A 1QBBA 1WNOA 5HNNA 1V6VA 5A8MA 2VMFA 4CD8A 5BXRA 1GOOA 4JFUA 4QFUA 3KWXA 1LQ0A 1E40A 2G4FA 4FMVA 3OGRA 2WMHA 5M3WA 4DWSB 1V03A 1BVZA 4MNKA 5A6BD 3I3BA 4NXSA 2VZSA 5E09A 2QPUA 3N13A 3AFBA 3WFLA 3ZM8A 5GNYA 2E40A 4PMNA 1QVBA 4JFWA 2WZIA 3CUFA 3AQUA 3MUIA 4ATWA 3CZSA 1SMDA 4MB4A 4PMZA 1IZJA 3AIWA 2WHJA 5IXEA 2WHMA 2E8ZA 3M07A 2YJQA 3G6MA 3BSHA 4AMXA 1B3XA 1V0LA 2F7QA 5HPOA 4BF7A 2YLAA 2X0HA 2DSKA 3BUDA 2VX6A 4P8WA 1W9DM 2RGMA 4QLJA 1C3FA 3MMWA 2X2HA 2CCRA 4BZYA 1E6SM 3MUAA 3CLWA 3VDCA 1BG9A 5CJ5A 1NWUA 1B1YA 1I75A 4PMXA 1UH2A 3PZNA 6A3HA 1JDAA 2J7FA 1UWUA 2VVSA 2EO7A 1TVPA 4LYPA 5HDRA 2AAAA 5AC5A 1DP0A 3VOCA 1QNSA 2X1IA 1XH1A 1PPIA 3EMQA 2BHYA 3CMJA 3MU7A 1F4HA 3DX2A 5A94A 1S46A 3N18A 2X09A 3OZPA 3CUIA 1CDGA 3UR8A 4CKQA 4LXFA 4JHZA 2J77A 4PRWA 1A47A 4F9DA 1V6YA 2XVKA 3N17A 3EDFA 1NOUA 2Y4SA 5D9PA 1XSKA 4JAWA 4LQ1A 4PN2A 3KL0A 1JNEA 1X6LA 3AJ7A 1DWIM 4P7RA 5DT5A 4FLSA 5BRQA 5JBDA 3EDEA 1W9BM 2V5DA 1WB0A 5DT7A 3RILA 5TD4A 4AD1A 5LA1A 4M8UA 4S3KA 1R47A 1SR0A 1PX8A 4X9YA 3DX0A 1PAMA 1H0GA 1PX3A 3UESA 2G8ZA 3VILA 1CXEA 3PTKA 1VENA 1VJSA 3OLEA 3T2PA 3IJ7A 1OGSA 1MFUA 4AXNA 1Q6CA 4W7VA 4ML4A 3LPGA 1UD5A 3AYSA 4GZIA 3BUIA 1UQYA 3VD9A 2IGTA 4AYSA 2JF6A 3D4YA 3W6LA 3CHDA 4RL3A 4AYGA 3MSGA 4QCFA 2BS9A 2CESA 1E1EA 1UG6A 2QHAA 2QPSA 1KCLA 1MXGA 1E0VA 3N11A 2DSWA 4KGJA 1BHGA 5CGTA 5KEZA 2W66A 4ACYA 3U57A 4D6CA 1NM9A 4MNLA 1B31A 3SUSA 3EDKA 4BQ2A 2DQXA 2FHBA 4OUEA 4TUFA 1KWGA 1JYWA 1GZJA 1MYRA 4HU0A 4IUGA 3GM8A 4ATLA 1OINA 5C71A 1TQTA 1E6RA 4TTUA 2V3EA 1XD1A 3EJQA 1PS3A 2WMGA 1V3IA 1AQHA 2YA2A 1BGAA 3NDZA 4Z2JA 3ARRA 5IHRA 4MAVA 4QP0A 4AIOA 2VL4A 4CD7A 3D52A 1XV8A 2CBUA 2OSXA 2FYVA 4QLKA 3WD0A 3BAIA 4D72A 1O6IA 1PIFA 2CKSA 2XIIA 1BF2A 3PZQA 1H41A 2Z1KA 3VIFA 3SCRA 1Q6FA 4EKJA 2J7DA 5EB8A 3WNKA 1OBAA 6TAAA 1W32A 1P6WA 3SIMA 4CN4A 3BUQA 4W8LA 2CKRA 5E6YA 3BUBA 3KL3A 1VIWA 4XX6A 2XFYA 5I79A 2PWHA 2ZUVA 5CPQA 2XN2A 1UYQA 2ZUMA 1JD9A 3DDGA 4GKLA 3FW6A 4UQ9A 1K6AA 5JBFA 3BC9A 4YHEA 4J3SA 1BTCA 1QI3A 3ZIZA 2ZWZA 4AZ6A 4YPJA 1ODZA 1EDGA 4JHOA 4AZBA 3A4XA 2V3DA 2YIHA 1U2YA 3BMWA 3VIMA 1VBUA 1JXKA 5BYWA 1ZBKA 4ZE4A 3WH6A 1JNDA 1HKJA 3NCOA 3U7BA 3WL0A 4W88A 1B30A 1JIBA 2WKGA 1CZ1A 5I0DA 5FL0A 3L4UA 5FOOA 2X8RA 3BSGA 1RD6A 2HVMA 1HN1A 3CHEA 1JFHA 4MDOA 1PEZA 1JZ7A 1XSJA 3WQ4A 1GCYA 4HZ8A 3MO4A 1FHDA 2FHFA 3CZGA 1PJ9A 3VNYA 1DTUA 1E6XM 1LL7A 1GOWA 1G5AA 1RH9A 2DEPA 2WNWA 3VDBA 1QW8A 3DX1A 5DF0A 1E4LA 3SCUA 1E73M 1HL9A 1Q4NX 2JIWA 1OT2A 2YL5A 1X1NA 3M6DA 1QI2A 2EPNA 5I5RA 4QCEA 2BY3A 3MS8A 3IAQA 3GXTA 4HZ7A 1C7TA 2WANA 1FOBA 1FP8A 2UY5A 4EK7A 3WEOA 3MANA 4YHGA 1OIMA 4MJ4A 3DHUA 4PMQA 4HA4A 3VGDA 1W3JA 1CWYA 1J12A 4NI3A 2BVYA 5AYBA 4DUVA 2VNCA 1IV8A 3UG3A 3W81A 1JDDA 3ALGA 3S6TA 2GSJA 4HMDA 3ARTA 4HP5A 4WSJA 3GH4A 4FNQA 4D6JA 1WDRA 2D20A 3T09A 1H5VA 1CEOA 3SEPA 1E70M 2J7GA 3PZVA 3EDDA 4AZCB 1ODUA 4F79A 3FHQA 4PMDA 1TMQA 4WIWA 1CPUA 4NRSA 4AZ7A 4KMQA 4PYSA 3ARSA 1ESWA 2WVVB 1V0NA 2DT0A 2CXGA 2OYMA 1WO2A 3SCQA 3A5VA 1ITXA 3GH7A 1D7FA 2VJXA 2GK1B 2EAEA 2PWFA 3VIIA 4W87A 3CMGA 2WBGA 1UHVA 1E3XA 3GBDA 4HZ6A 4MNMA 1C8QA 3OLDA 3ARXA 3WFZA 4ACZA 5KZ6A 3WH5A 3K46A 3ARQA 5ABFB 1TR1A 4PMUA 4NZJA 3IK2A 1JD7A 3W28A 4FNUA 2CPUA 3CZKA 2W63A 4MTVA 1UR8A 2G3MA 5A8PA 3KZSA 4D6DA 3WSUA 4TVUA 2FH6A 3CUJA 2WMJA 4BQ5A 1GQIA 1OB0A 2D23A 4D1IA 2YBTA 3UEQA 3WMSA 1K9FA 1LG1A 1YQ2A 5D8WA 2JE8A 1CENA 5ABGA 4LPCA 4M56A 3PZMA 2WVVA 1UD3A 3RPMA 5LYRA 2WMIB 3VINA 3CZLA 1JXJA 2EEXA 1BFNA 3WDRA 2QV4A 3HN3A 4PTVA 4TXEA 4UOZA 5D8ZA 1ZJAA 2XSAA 4UFHA 4L4OA 1LL4A 3N12A 3AXXA 5DEZA 1VFMA 1ISZA 5A6MA 1QHZA 2EXOA 4KWUA 3IJ9A 3KEHA 2XN0A 1KXQA 2XVLA 1YHTA 4MB5A 3W29A 2OWXA 4N42A 4PMVA 1CIUA 1AQ0A 4J28A 2F7OA 1CXIA 1V6WA 5FD0A 2Y2WA 4QDMA 2FHCA 3VGBA 2BV9A 2CNCA 4BQ3A 5IFPA 1TVNA 4Y7EA 3RDKA 1TE1A 3WF3A 2PC8A 2AOSA 1M04A 4EE9A 4U33A 5AC4A 4DO5A 1TUXA 1MW3A 4JFTA 4CN6A 2X2YA 3IGUA 4PEEA 2IXVA 3NJ3A 1GPFA 4PTXA 3QOMA 4BQ4A 4PCTA 3HJEA 2VO5A 1Q6DA 3VTRA 4IISA 3A47A 3WENA 4NZFA 3KLLA 2CEQA 4CCEA 3PTQA 2EADA 2G3IA 4PUEA 1WKYA 2XGBA 4FNTA 1GOMA 2VR5A 3AS1A 2YFOA 2XFRA 3HG2A 2VZUA 3BXWA 3WNLA 1ISXA 1GHSA 2GJXB 1BGGA 5CLWA 1GONA 3AS3A 3RO8A 3W0KA 1M53A 2OLHA 1C8XA 1D3CA 3CO4A 1B3YA 3VMOA 5FL1A 2W61A 4MB1A 1B3ZA 3L4WA 5I3DA 3CGTA 2WAGA 4GO9A 4W8BA 1BAGA 4E8DA 1G0CA 3VGGA 1HL8A 1UR2A 4AIEA 4DWSC 4OOZA 4ZXOA 1XH0A 1VFOA 2ZE0A 3GXIA 1TQWA 1W3LA 4R27A 2X2JA 1KBKA 3DYPA 2WVUA 3AICA 2DSVA 3VD5A 3VGHA 2A3BA 3RM8A 3ZJKA 4RE3A 4RE2A 3F5LA 4B3LA 1UWSA 3EJTA 4OJYA 3BVWA 4H8HA 4U3CA 5JIPA 1EA9C 1JF5A 1KGXA 3A22A 3W53A 2GJXA 2DT1A 4CUCA 2E9BA 5IFTA 2DDXA 1EOKA 1NOWA 5I2UA 3BVXA 3PZTA 1X6NA 3WH9A 1VRXA 2YL8A 1E55A 3NSXA 5AYIA 4P8VA 3WELA 3WNMA 1JFXA 4UZSA 1UR0A 3THCA 4J3XA 3FN9A 3D51A 4CU8A 3AXHA 2VZTA 1QNRA 3EJRA 5JUVA 1LWHA 2OW6A 1R33A 1I1WA 2C7FA 2HISA 3T0DA 3QHOA 4J3WA 5EBAA 3VNZA 5A2CA 5D9NA 2GK1A 3L4XA 3OLGA 3MV11 1KCKA 1VAHA 4HTYA 1UH3A 4WKFA 1W1VA 1GHRA 2CYGA 2W67A 2A3HA 2EACA 3AIQA 7CGTA 2XVGA 1FFQA 3L2MA 2CERA 5ABFA 1UKSA 3QHNA 1W9XA 3LX9A 5EFDA 3M7SA 4JIEA 3AHYA 1GW1A 3NSNA 3ALFA 5ABHA 4UTFA 1HJXA 4L4PA 4HMEA 2OSWA 3WQ8A 1WDQA 4CD5A 1B90A 1H49A 3LPPA 2NSXA 4J3TA 5E70A 2UWFA 4UFKA 3WUEA 1FHLA 1MQQA 2WB5A 3VVGA 2EPMX 4UQEA 1CGYA 2J8GA 3ZJ7A 4OKDA 1M03A 1OCQA 2DSZA 1QHPA 4N0RA 4P7OA 1CGXA 3AS2A 2GJRA 1LL6A 2ESCA 5E1QA 3WF1A 3RMEA 1QWUA 3TA9A 2ZX8A 3TTYA 4AMWA 2ZUNA 1NWTA 2J78A 1JI2A 4ACZB 4M81A 2J25A 1WAWA 1CBGA 4KRUA 3ECQA 3CV5A 1V3MA 5BWFA 2DIJA 3BAWA 1GQKA 3KE0A 2V5CA 5AY7A 4AD3A 4XZWA 3ZOAA 1QI0A 2XTKA 2QF8A 4W7UA 3ZSTA 5HOSA 1ZBWA 3VUPA 3RCNA 5DFAA 3GXPA 4ZXLA 3T08A 1BYBA 3K1DA 2C8NA 2FE0A 2Q8XA 1HXJA 2BVDA 2VQTA 1NOFA 3AI0A 4U3AA 2XHYA 3A3HA 3DX4A 3WD3A 3GBEA 5IDIA 4NXKA 4AZHA 4V2XA 2WWCA 1WZKA 4CU6A 1E4NA 4D6EA 2VCBA 1G9HA 2O92A 4D6HA 1C90A 2JALA 3OA5A 2XSBA 1EHNA 1CNVA 2F7RA 4HOZA 2YDQA 3U5UA 3SUTA 2VX7A 3VDHA 4TTGA 2YA0A 1FH8A 1XYZA 3WY2A 2VRQA 3AHZA 2OW7A 1B3WA 1VFFA 3W24A 2V3FA 1OD0A 1UOKA 1GORA 4UQBA 3WD2A 4PTWA 4WF7A 2YA1A 3CH9A 1IZKA 5BRPA 2GDUA 1J0KA 3AMGA 2W5FA 3WF4A 2JFEX 3QR3A 4W5UA 3BAJA 2J74A 1CECA 1DWGM 3EYPA 3OGVA 2WKLA 1JL8A 4CU7A 4URIA 4AEFA 1OWQA 1VEPA 1W1TA 3GXNA 3N9KA 1LJYA 2IUZA 3VIHA 2F2HA 2ZOXA 1SMAA 2XUCA 2YDRA 3CZ8A 3TTOA 2BNJA 2EPKX 1JG9A 2Y5EA 5A3HA 3GTNA 1HJVA 1UR1A 1CTNA 2D24A 3BGAA 3NIYA 4NZCA 3VIKA 4AZGA 1XSIA 1WE5A 3WEZA 3WY3A 4GINA 2Y8KA 3U7VA 4F9JA 2WSKA 3KL5A 3HZ3A 2CHOA 2E9LA 3VSVA 3VX0A 3ZSSA 2A3EA 1OD8A 1E4IA 2DT2A 1HP4A 1GOQA 5CXPA 1XGZA 1UKPA 4NF7A 1WCGA 1KQYA 5E0FA 1EHAA 2TAAA 1J11A 1J9YA 1FP9A 3FAXA 3B9DA 3PZIA 2E3ZA 1W1YA 1BPLB 1CLXA 1Q6GA 1QX1A 1HVQA 4WKHA 5E9AA 2JIEA 3W82A 4JCMA 4FLQA 4JKLA 2CBIA 1HVXA 3VX1A 2ZUSA 4HOWA 2J7BA 2V3GA 1JAKA 3K4DA 5I78A 3VD3A 2PI6A 1HXKA 4OGZA 1EGZA 2F1AA 4MADA 4AEEA 1V3JA 4X0VA 4UOJA 4D6FA 2D2OA 3WY4A 3MV01 1JZ5A 3W38A 2J7HA 1QOXA 1KTCA 1HKMA 4KH2A 4UFJA 1WZLA 5E0CA 4WK9A 5A8OA 2V38A 1CLVA 2J79A 4MJ2A 4CCDA 1T0OA 3CZNA 3FXYA 4Q7NA 4EANA 1US2A 3SCNA 4ZENA 2Y24A 1US3A 5JBEA 1QI5A 3S2CA 4AWEA 4H2CA 4BS0A 1DWHM 1BQCA 4TOQA 1KXVA 1E5NA 1AMYA 3BVUA 5CPSA 2YLLA 1UZ1A 3ZR5A 1XH2A 1W91A 1ISYA 3ARUA 1JZ6A 2D0GA 3VKKA 2ZX6A 2A3AA 3VGEA 2ZWYA 2WC4A 3WD4A 5LA0A 1EOMA 2EJ1A 3AISA 4PSRA 1FFRA 1OGGA 3ZJ8A 5I23A 1RP8A 1VBRA 1E56A 1MXDA 1UD6A 4PMYA 3W37A 3HG5A 3B8SA 1K9TA 1JF6A 4OOUA 3HG4A 1CGWA 3WDQA 2VCAA 1GVIA 4MAZA 3T0AA 3NUKA 1OGBA 2VI0A 2GVYA 3B9AA 2JEQA 2C0HA 3QGVA 3JUGA 4AD5A 2VVNA 5I24A 1HNYA 2WXDM 1TCMA 4P7QA 1ZBVA 3BUPA 1UD4A 3AHXA 3K8MA 3WF2A 1E3ZA 4CVWA 4FK9A 4A4AA 3WN6A 4C7FA 2YL9A 1XHGA 4PTMA 3TV8A 3VDAA 3WEMA 2WCGA 2VRJA 4M29A 3ARVA 1BSIA 1KXHA 3FAWA 5EMYA 1GOIA 5CSYA 3GXFA 1KXTA 3T0BA 2WK2A 3LXCA 1H09A 2OYLA 1OT1A 3AZRA 3VMPA 5GPRA 1JAEA 3A4WA 4GXPA 4B16A 1K9EA 1CXHA 3AMLA 2WC3A 4KRTA 1UKOA 2O9RA 2WMIA 1JZ3A 4WKAA 5IHSA 1JGIA 1GJUA 3AIUA 1TA3A 2QLYA 3GNPA 4BA0A 1QWNA 2BFGA 5A6KA 3WDPP 4D71A 2UY2A 1E6NA 3BVTA 4OIFA 3WDHA 3LRMA 1UD8A 3B9EA 3ARYA 1J0HA 1UWIA 2OYKA 3OB8A 3RJYA 4AC1X 1E15A 4TX8A 5BROA 2WW5A 1WDSA 3T2OA 1XC6A 3OGSA 1PBGA 1TQUA 3ZT6A 2NW0A 3POCA 4B9YA 1XYFA 2OWCA 2WC7A 4D6IA 5A8NA 4UCFA 2ZUUA 3TP4A 1J01A 1W3HA 4J3VA 1KGWA 1GQJA 1NWSA 3BCDA 2J75A 3RJXA 3WUFA 1V0MA 3CIVA 4AZIA 3AOFA 3RM4A 3QOKA 1KB3A 2FH8A 1ZL1A 3PBGA 5ECUA 2XWDA 3H53A 2ALWA 4PCSA 5C70A 2WBKA 2BHUA 5CGMA 3D5HA 4UNIA 5F7UA 2F18A 1W2PA 1UA7A 3FHAA 1KTBA 1M01A 1EDTA 4Z2IA 1UUQA 5A6SA 4M24A 3O2LA 3AIEA 4JFVA 3J7HA 4AMCA 1SZNA 1JYNA 3PZOA 2WWDA 1JYXA 1C92A 3LPFA 3WUBA 1JZ8A 3GDBA 1GJWA 1G94A 3AIBA 1HJWA 1CGVA 3EMZA 3N15A 4FNRA 2X0YA 2D0HA 4JKKA 1TFVA 3ZMRA 1C7SA 4UZUA 2MANA 3AIRA 2D0FA 2ZIDA 3VPLA 3OLIA 2PB1A 4JKMA 1R75A 2NT0A 4UQDA 1FH7A 2VURA 1RP9A 4UFMA 2E0PA 2WHLA 3BAYA 3CZJA 2XWEA 1KR0A 3PHAA 2F61A 5I77A 4NX0A 1BG4A 1GOKA 4CVUA 4YN5A 3RM9A 1C93A 2NT1A 3BAKA 4CD4A 3BVVA 4H8VA 3L4YA 4AY1A 1Y7VA 4PMOA 1V3LA 1R87A 1E43A 1QPKA 1MW1A 5A2BA 2F1BA 2J4GA 1HTYA 3PZGA 1V6UA 3NSMA 5D9OA 4AD0A 1UKQA 3EJUA 4P8UA 3WH7A 3TTSA 3GYCA 1HT6A 2ZX9A 2XYLA 1HX0A 2O9PA 3EJSA 4LX4A 2VZVA 2YDSA 1HKIA 4UQCA 4DUXA 3O9NA 4GPNA 1ECEA 2J7EA 3WL1A 1CXFA 1HJSA 1R7AA 1PZ3A 2ZXBA 4F66A 4XB3A 3SURA 1UKTA 4GI6A 4DWSA 1UQZA 5GNZA 1UWTA 1FA2A 4IPNB 2W4XA 3CHCA 2EABA 3LXAA 4RE4A 1KFWA 1BYAA 5BXTA 1DWJM 4GQQA 5CSUA 4AISA 1E1FA 3UR7A 5A6BA 1RPKA 1MFVA 3SUVA 3SCOA 3RIKA 4LYRA 4MPKA 2VX5A 3GZAA 4PUDA 4FNSA 3PTMA 3DECA 3K8KA 1G1YA 3FNDA 4CD6A 3W4RA 1G01A 1HWWA 3ZT7A 2D3LA 1ITCA 2PBOA 1LWJA 2EPOA 8A3HA 1MW2A 2W91A 3WBAA 4DWSD 1QI4A 3S5YA 4BCEA 3GNOA 4HOXA 1BVNP 4DUWA 3AZSA 3SCVA 3WMCA 2O9OA 4ZEPA 3AHVA 1D2KA 2DH2A 2VZOA 4H7VA 3F5JA 3G6LA 4AD2A 1R34A 4W8AA 3BLKA 1ZS2A 4KGLA 1QBAA 2Y8VA 4DO4A 1H3GA 4A3YA 4HU8A 1J0ZA 2UY4A 1BYCA 1LLOA 3VMNA 3LXBA 4D1JA 1HF6A 1QNPA 1DWFM 1V08A 3WDIA 1SFSA 4OBRA 4R5EA 4W89A 4DO6A 2PF0A 2WMFA 5E6ZA 4E2OA 3THDA 3UG4A 2DGAA 5CLTA 1N82A 3MMDA 1ZB5A 2WYSA 3AXIA 3FY1A 3WUGA 2CBJA 3AMCA 4XZBA 1OM0A 1R86A 4GQRA 1NH6A 3VSUA 2ZICA 4FNPA 1UZ4A 2PWEA 1UWQA 2XVNA 4P8XA 3VIOA 1UASA 1VB9A 3OBAA 4Z2LA 1EQPA 2WLZA 4TVCA 1KWKA 3N04A 4V28A 5GNXA 1B0IA 2ZXQA 1KBBA 4GI8A 4GZEA 3CC1A 4U2ZA 3SCSA 3MUZ1 3I3EA 3VIPA 3UETA 4Z2HA 4J7RA 2J8FA 4NSBA 4W5ZA 1ZBCA 1W9PA 1VJZA 1WPCA 2ZUWA 1VEOA 3UERA 1WDPA 2WSPA 4J27A 5A69A 4D6GA 3ZQ9A 3EJPA 5D9MA 4U2YA 4AZCA 5A1AA 4M82A 1DEDA 3MKKA 2D3NA 3LRKA 4XUYA 1H11A 1MQRA 3BMVA 1NP0A 2E4TA 3VM7A 7A3HA 5EFFA 1B2YA 2VX4A 3M46A 1KR1A 3WNPA 4UQAA 2WCSA 1EXPA 2BY2A 4FF5A 1W2VA 2XGIA 2XFFA 2UY3A 2DIEA 1UD2A 3BAXA 2GJPA 1L8NA 2B31A 4W84A 2JEPA 4HMCA 3DX3A 4C7GA 4AIUA 3WDJA 1J0YA 3AS0A 3PN8A 2WZEA 4B3KA 1E6QM 1GQLA 4JFSA 4IPLA 1EIBA 5CZKA 4HA3A 3H55A 4P7NA 1U33A 2D22A 2RGLA 4C7DA 2YOCA 1J0IA 6CGTA 3EBVA 4AD4A 2QMKA 1A3HA 3AHTA 1NWRA 5FIPA 2XM2A 3H54A 2ZXAA 1R85A 3WIJA 3CPUA 2WVTA 1BLIA 5A8QA 2G3NA 2VQUA 2W62A 1R7OA 4MNJA 3OZOA 3CBWA 4TVDA 2XN1A 1BYDA 4GZJA 4Q22A 1VF8A 3A24A 1V02E 5BCAA 1V0KA 3APGA 3S5ZA 1LF1A 3PZUA 4B9ZA 3DDFA 3BLBA 4GIAA 5CQ1A 1TZ7A 3GNRA 5BXPA 3II1A 7TAAA 1TQSA 3L4TA 2F7PA 1KGUA 1EO7A 1CXKA 3GXMA 1J18A 2WZHA 3CUHA 3NYDA 3SCPA 1V6XA 1W9VA 1XCXA 3K4AA 3IANA 3VD7A 1EQCA 4WLCA 1DWAM 4UFLA 4V27A 3WY1A 3W26A 1JZ2A 2YFNA 4XV0A 3OG2A 1J0JA 9CGTA 3HMCA 1XCWA 3DYMA 3W27A 1ZJBA 1V3KA 2ZX7A 4W93A 1E6ZA 1E4MM 2CHNA 2J62A 2XG9A 1R8LA 1Z32X 5M5DA 3MI6A 3GH5A 2PWDA 3VSTA 4NRRA 2G3JA 5FKYA 1JDCA 1MW0A 1DHKA 1R46A 3UCQA 1F4AA 1HP5A 2O9TA 3TONA 3MMUA 5D4YA 3NDYA 3HG3A 2VC9A 4WJXA 4Z2GA 1OIFA 3WQ6A 2D1ZA 4LGXA 3D50A 3IJ8A
chains in the Genus database with same CATH superfamily
4U1GC 1YDNA 2VR4A 2AQQA 3T65B 4NKDB 3KDMA 4TUOA 4EXPX 5JXAL 2TRSA 2CH8A 4B5ZA 3GG0A 3ZJAA 1V02A 1K7FA 1XF1A 3LENA 2NY7H 2VITA 2BPBA 3RVTC 2XH0A 4P7LA 4DYEA 3MLTA 4MS8D 3I9IA 1I8LA 5A6AA 1NUFA 3U9UB 1H5BC 4RV8A 2AJVL 1OAYH 1PG7H 4K3JL 1SFLA 4NIRA 3O3DA 5KTLA 3QQNA 1WDDA 5INDB 1BXNA 2XZZA 3JWNH 4B15A 5ACMA 1CC3A 2HCZX 1NTHA 4I9XA 4HSAC 4KZEH 4TX6A 5JMRA 3I6GB 1NAMA 4U31A 3HC3L 5MKGB 4LPXA 4Z2KA 4YHKL 3GBLA 1JWSB 2BOLA 1XFCA 2Z25A 4D8OA 3KPQA 4QLRA 4RAVB 4DOHB 2XVPA 3BOFA 4MLJA 5AKSA 3U4BL 5D7JC 5DHVB 2G37A 1O60A 1BBDL 1F42A 3AZTA 2HLFD 1V10A 2X4QB 3QDAA 3RQ3A 5HHMD 3ATDA 4DP0X 1AD4A 2D7TH 5A95A 4NPJA 4YAQA 2ZXDA 1BQKA 3U2CA 1OXYA 2CDEA 2GUYA 1UXLA 2WLYA 2P5NA 1L5GA 4ZO8A 1KIUB 1NSJA 2GDVA 2ATPA 1U58B 1IWPA 2YW3A 4ZVJA 1DBKL 1YZZA 5T1LA 4UWQB 3I9AA 3JWNG 2J8UE 1OP3K 2NX5D 1ICQA 2YB1A 5ABGA 3BURA 3RR4A 4DM2A 3VI4B 2IDSA 2A0LD 2H0FA 3VWKD 5CG0A 3MOAH 4WUKH 5KVEH 3KPNA 1I1XA 3PG9A 5I1EL 4LCYB 3S5LG 2ZPKH 3QJTB 3Q05A 4AEIL 3LD8B 4JO4H 3EYOB 1HHJA 3WIFA 2KERA 1Z42A 1IT7A 3VOGA 4E41A 4C1NB 4WI6A 3MLTB 5CP3H 1R0MA 4L37B 3NPVA 3BRGC 3OVRA 3BZ4A 3PQYE 4RMVA 3MLYH 3WJMB 1QAPA 4PGJA 3U8GA 4AW7A 5FGBA 1M7XA 5TH2A 4MXQD 3UW6A 4KTEH 4LNRB 3QUXC 4C6CA 1U5JA 4S1RH 4QRPD 4M7LT 1GUVA 3U0TB 1MREH 4XHQA 3W1MA 4G7VL 4IJCA 2HROA 5C0AB 2O5NA 2AMGA 3D3VD 5GGVL 4YNYB 4HPGA 1IAOB 1PL3A 3LQAH 2DM3A 4RFNB 1Q0YH 1ALDA 1HOCA 5BZWB 5GRYA 1YECL 4DZ8B 1ADQL 1WBHA 4DM1A 4I88A 3HHSB 2XA3A 1KCSH 3RGVC 5C6PB 4YHML 3RPDA 2VW4A 3FBQA 4ODXB 1CFQB 1IGCL 4J3OC 1OQFA 1HE7A 2BY0A 1O5DT 4B95C 1SMOA 3HC4L 3JRKA 1WD9A 3FU3A 3PWUB 4M8VA 1V54B 3LXUX 4LPTA 3E9UA 2PZNA 4LLWA 3OB0K 3K3QA 4XAWL 4PUWA 1UBPC 4EAMA 3K5XA 3U6WA 3CHPA 3MRPB 4MWAD 5HPCA 2KL6A 3H1ZA 4US6A 2ZWNA 3LKNA 5AW0B 2PF8A 2GT9A 5JOPD 1JVNA 4KQ0A 4IRZL 2HKFL 1UZ8A 4PS7A 4DPRA 2FZMA 3EA3A 3PC0A 1P4IH 1NC4B 3QQ3A 1FH5L 2JTYA 3A4AA 4XO6A 3FA3A 2V17H 4S3GA 5B80A 5LXXA 4OD2A 4GEIA 4I48B 5IM51 4W7WA 1V7ML 4GXVL 4U1MB 1WSST 4DERA 3GDRA 2VXSL 4NNYB 1ISVA 4L6HA 4HJ0D 1I7ZA 1ETZB 5F7LB 1CGSL 1B4JL 3V8CA 1W1IE 2V6HA 4AOFA 3CQJA 3NQFA 4DJEA 3VD4A 4UM8B 1G9NH 2VH5H 5FXCH 1WXYA 2XJ7A 1TJHL 4GX8A 3UL4A 4HZAA 2HV5A 4U6XA 4PTUB 5J6GB 2PBGA 3H3PL 1P84K 1L7TH 1WITA 1U9KA 4BKLA 1D5RA 1FAIL 3CASA 3QQ1A 5HWMA 3LCIA 3LLFA 4XMLL 4HS8L 4ZMYA 5ABEA 2DZWA 5EYWA 3L0GA 2EBNA 1ISWA 3OJMB 4FOKA 1FWRA 1AMXA 4V33A 2XIBA 2YQGA 4PYGA 4Z3HA 5E2VH 2IXUA 2FMOA 3OQEA 3V6OE 2EIEA 4LTSA 2UV3A 1E5UI 2VDML 1QNZH 3CL7A 3VGFA 2VEPA 1OM3L 3CAVA 4AJ0A 4F8XA 5IMOB 5JOPE 3SQLA 3KWUA 2HVNA 2LABA 5B38G 1QHOA 3PR2A 1M2OA 4H04A 1M57B 3PPGA 1BFOB 1S5MA 4RCAA 1SLXA 3DENA 3NPXA 3O6CA 1U8JA 4ZFQA 3T3MB 3VXRA 3L65A 2YMXL 2WPGA 3QIWA 2G3FA 4BHYA 5CCZA 4AV5A 4OD2B 1EJRC 3O2WH 5LA2A 1NLBH 3RWDB 5CPNA 3ZT5A 2AVFA 3FEQA 1ZU8A 5LXEA 2DY2A 1KN4H 2EYSA 2A2QT 5FUOH 3NYKA 3S96B 3ZO9A 4KAQH 3RGBA 1A3RL 5F8RC 4A35A 1WFNA 2YSSB 3EBHA 3EYVA 2WM0A 1OAKL 3LHPL 1FH9A 5BXSA 1KIUA 4YXKH 3TN4A 3GKWL 4ELMF 2WVSA 4F3FB 2EDFA 3QZOA 2XINA 5E2WH 1MFDL 4NO0D 1OSEA 2VCCA 5C0DB 2QPDB 4MMYB 4O58L 2FB2A 2IDFA 3CN0A 1CIDA 3MUXA 3KYKL 5AALA 2P1YA 3X1NA 1FWHC 2XN9A 4IXHA 3EGSA 4X3ZA 1A3WA 2JWYA 3RUGE 5A6JA 3DJTA 4OLWH 1VFTA 4NQXA 3UOAB 1AZZC 4DGYL 3TA3D 2COVD 3APYA 2GY7B 4X4ME 5K59E 3S7GA 3N4EA 4C6MA 4HK0B 4Y4HC 3GXDA 4IBTA 1YIXA 3H4FA 3QYSA 5J1SC 4Z1BA 1ED3B 2ZUXA 2ICWI 1U8HB 4GBXA 5IEHA 3UPRB 4IJTA 5F1SA 5D7LD 1RVFH 2XM1A 4KJWD 3H7UA 3Q2WA 1AGEB 3BUYB 3KOXA 1PIGA 2Q8AH 4ZNCD 5DK2A 3FLUA 2KUTA 1FWSA 4D9LH 2V5RA 3BLPX 5AG9A 2CLVA 4CGTA 2Z7GA 4XD6A 3CHFA 3PWUA 1SUJA 2WYTA 4X4XB 3KLAB 1RBOB 2HMID 4TNFA 3CFCH 1RUSA 2J7CA 3ABQA 3W6MA 2PW1B 3KW8A 1MVFA 1TQCB 5EIIG 3SO3C 1H0IA 1SBSL 3FT4B 3QRFM 2NDFA 1G4TA 4IXXA 4M61A 1PS9A 1RUAL 3NFNB 4HD9A 5CP7B 4FO4A 4ZSOA 4LSTL 3KFTA 2CZEA 5C0JA 4IRJD 1IBGL 1BF8A 1Q72L 1OC6A 3R12A 2IPUG 4JFDB 2R39A 1NLBL 4MDJA 3TN0C 4XP9H 3FF7A 5I1GH 3UZVB 3KVDD 3AXMA 4PLJD 4DBDA 4YDKH 1W8OA 2WIMA 2B7DT 3N42B 3LH2H 3MJGX 1ADSA 4MDPA 1FCCA 1OD7A 1E6PA 1QUMA 3UMNA 3BH4A 5DWUH 2OEJA 2CUIA 4BEIA 2H6PB 5GJTH 2PDXA 1EEUA 3X1GA 1ECYA 2GGJA 2BJMH 4JD4A 1Y0LB 4GUCA 5D55A 1JPIA 1SJMA 2IPKB 3MR9A 3E0LA 1DCEA 3W25A 1ZEAL 2FQFA 3A4FA 3BWAB 4Q6KA 1A7QL 1MFEL 2VSKB 4ACPA 5AOKA 4AQ1A 1JR1A 2AGJH 4JCLA 1U30A 3TVMD 4QITA 3SCWA 1ZLVK 4GS7C 3F5WB 2MCG1 3NH7H 3FUDA 4PMFA 1RR2A 5I6SA 3EHBD 4WSKA 3F05A 1LRNA 1ZJIA 1OAZH 3F7QA 1OC5A 2HP4A 3C8FA 4TL4A 4JTJA 1LO3L 2LAGB 3BE1H 4P4RA 3DMMD 4P2OB 3VE0A 2PF6A 4XPAH 3LKOB 1KC5L 4Z78B 2BSLA 2QPEB 4GC4A 3FOLA 1L7TL 1CGTA 1RPQA 3LCWA 3DI1A 3OX8B 1CW2A 4UTTA 2YD3A 1AZVA 3CPLB 3MOBL 3TC9A 4ES9A 3CQIA 3LV6A 3GZ3A 4PP1D 3NQ2A 2F8XC 4E9XA 3DETD 5KANI 2JCWA 2J47A 4XSLA 3HOGA 1TG7A 5BZAA 2FD6L 2I60H 5C97A 5HNNA 5A8MA 3CVDA 4NRYA 5EUOA 5BXRA 1OZMA 3KWXA 3NL6A 1RZ7L 3CVHA 1THAA 5CC3A 2G4FA 5DMGC 3EXLA 4X5QA 4O14A 2D3JA 1CS6A 2YSTA 4H1LB 1XCQA 4JDTL 3DFHA 4ODWA 1R9ZA 4H8NA 4C91A 2R2CA 4QCIA 2FIKA 3GHEH 5M3WA 3LTYA 3WQGA 3S46A 3RTQB 3VXUE 4G8EB 3UZEC 4AZ8A 1SFJA 2WBJC 4KMTL 3CLEL 5A6BD 3I3BA 5JHLH 2YXOA 4X8XA 2EKSA 1X9UA 4PTDA 1IGCH 3DSFH 2ZWLT 3WFLA 4JN8A 2F6UA 4L80A 5GNYA 4A7UA 2NQDA 2QEJA 3SDOA 3TROA 3E1ZA 4MMZB 3VOIA 3QEUB 1FUYA 3BN9D 2QVFB 3MUIA 3CUFA 3AQUA 2HTLD 3RE0A 1BX2A 4DWHA 3EJZD 5AW2B 1TV4A 3L5AA 5FUOL 4PI2A 5F7WC 3L21A 4TX9A 4WCYH 4M7JL 1U3HD 1OGAA 3G5YB 4HXAH 1MJJA 4GJTB 3GJFK 5FM5O 1DHPA 5F7YC 2HG5B 3S4SG 4XZUA 2QCLA 4XMVA 2X4UB 1RZFL 2H2SD 5IXEA 3GRIA 2WHMA 5CPOA 2E8ZA 3DX8A 4XMWA 3DTUB 2OR9L 3C60B 3UPCA 2CJ3A 1MQ8A 3U6RB 3FDKA 3FZUD 4FQXD 2YJQA 1R9FA 3B0XA 3BSHA 4QYOA 4YHZL 4AMXA 4KQ3H 1MWAL 4U7MA 5HPOA 3SE4A 3WXVL 2J5LC 4G6CA 3KHOA 4O13A 3VXOB 3F1QA 3P62A 4D6GA 1WXZA 5CILH 3BLEA 1L9NA 4KOBA 1M9HA 3CQ0A 4F58L 3QYNA 2DV0A 5LXVA 4PJEF 1ZHLA 1I31A 4HCGA 5KSUB 4LSDA 2ACQA 4ZQRA 5DJCA 2DYPD 4P8WA 4RWHA 3A4EA 4KESA 2K4AA 3U9PL 1L9PA 1X1OA 2RJHA 3G5VA 3PV6A 4M5YH 3MMWA 1T66C 1A4KA 2PP9A 3DBSA 4MLSA 3U46A 2Z65C 4BZYA 1OADA 5DD6B 2H26B 5HPMB 3VDCA 4EI6B 1NBYA 1J5OL 4HVXA 4R5VA 3STLA 3TGXA 3WS3A 5HYSG 1XGUA 4PRNA 3L9BA 1KD0A 2XISA 3A9IA 1UH2A 2OT0A 2IGFL 3S47A 2ISDA 5T3ZD 4R33A 3ITYA 1QO3A 1L9RA 3GFUA 4DKFH 2FIQA 4LYPA 5DRZB 1ORQA 5AC5A 1DP0A 4L29A 2QLVB 3HJ0A 5D7LE 3H9ZA 5F9OL 3MV9E 4RGND 1LBLA 2HJLA 4XX1E 1BOGB 2V4LA 4Q58C 1FH5H 1UCBL 3URNA 1Y18A 3B37A 4YBLC 1F7BA 1D5ZB 4YHYC 3EMQA 2BOEX 1PG7L 3TCLB 2BHYA 1UXWA 2ZUQB 4IRZH 3BQUB 4QRRD 4PRAB 5CGYD 5FW8A 3DK0A 2Z29A 1WGOA 4TLSA 4F2EA 3DHFA 5LNVA 5IJBC 4GRMB 2OR2A 1CFNA 1DEEA 1MHCA 3BZGA 4FAAB 1ZGLM 4L3EB 2J5WA 1U83A 2AK4D 1OAXH 2AGTA 2FVLA 4LVFA 4P2OA 3TE9A 4IICA 5HQLA 1IIKA 4IJBA 3EYFA 3IK4A 2AERT 3UTTE 3NOEA 4ZODA 1TZOA 1E8ZA 4B5TA 4CKQA 4N8VA 1OAUL 1K77A 5I6NA 1KLZA 3B0PA 2BIIA 2EE2A 3VE0B 4ELME 5CINL 1UCWA 1Y65A 5KOVC 2CJUH 1L2QA 3NJVA 3ULSA 1KEGL 1A47A 1IC7L 1P4LB 4G8FB 1BD0A 4Y1AD 3P8JA 4TV5A 4Z7WF 2R7EB 3I6SA 2V2WB 3UPAA 4LLAA 4MA7L 4R26L 4ZW6A 2JK2A 1HILB 5GXBB 1NOUA 2PCYA 2CR3A 4XXDB 4M1GH 2R6OA 5F7BA 2CLZB 3ZHLA 3F7YA 1N9PA 2IJ0C 3KL0A 4H20H 4KKQA 4LCCB 5IUCA 1MFMA 1JNEA 3AJ7A 3ICJA 1BIHA 4DZBA 1GZHC 3LLXA 2Z31B 4AQ1C 3MRGB 5HD8D 5SWZE 2HJFA 3EH1A 3O8XA 4KVCH 1RVKA 1XJBA 3PHOA 4B9IA 2RAGA 2VC7A 3QORC 1KY6A 2B5IB 4EPBC 3ECWA 4L9YA 5HGGS 2B4CC 4WWNA 4JZNA 4C54A 4HWNA 1LMKA 3R11A 1VF5C 4U6YB 3LOTA 4Z7OF 2HJLB 3S6CA 3TN3A 3QPZA 2X4RA 2A9NL 4PGCA 3V3WA 2IPJA 1PKQA 4JO4L 3T0EC 2FTWA 4MD4B 2KDYA 1TTQA 2X7LA 4QXUL 3BG9A 3RILA 5GS0D 4L2YA 1X5ZA 1LE5B 4MMXA 4U4IA 3PPSA 2DZEA 1QOKA 4N22A 2DL9A 1PX8A 2VXTL 1E6JH 3FRPB 3TJHC 3DX0A 5C0IB 3T3MF 5C0EB 1PX3A 1I8MA 1H0GA 3O63A 5HJXA 3UESA 3VILA 4YWIA 1ZLEA 4MVBD 4UUJA 3Q2NA 4U7SA 2R1PA 3GK0A 4H9UA 4MA1B 3R8HA 4NQDA 2WXJA 3O45A 5HJ3A 1OGSA 4QXTB 1TJGH 3KEDA 2HK0A 2V5KA 3AT8A 2F08A 2QGBA 4AXNA 4U0QB 4DAGL 4W7VA 5SWZB 4FN0A 2CPCA 2PDNA 3EJZC 4ML4A 4PRHA 4AENA 4OU1A 4HJFA 3BRDA 4PTTB 5IBTL 3PY9A 3V9CA 4EZMA 5E8OB 3MI3A 3HC3H 1BIIB 3BUIA 3LEXA 4OUUB 3DXIA 5LNSA 2IGTA 2Q6WA 1AGCB 3MA9L 3S98A 3U6RA 1SYVB 3DKLA 5IV2A 2O30A 1JPST 3F00A 4MYPA 7FABL 4RGNB 2EH8L 4GSDL 2BP8B 4OAWA 3KPPB 5DWPA 1YYLH 1HIML 3CXHK 4PRIB 5HGDA 1BD2D 4AYGA 5F7NC 1G7MB 2CGZA 1EUNA 1E1EA 2OXNA 4YC2B 2WNNA 2G9HA 3PG8A 4JQIH 5CKGA 2WZ0A 5KYWB 3MU3A 3T0ED 5E51A 5SWUA 1CG9A 3DURA 2J5LB 2VXQH 4OZHE 3CNYA 3MJYA 4PJGE 1TR9A 3W73A 4YCPA 1EJ6A 4YDZA 2PCPB 4JQ3A 4B5UA 2FX7L 3TW9A 4X6FA 4X6CE 1HXMB 4EDXB 4EIZC 5AFAA 1NIBA 2H3DA 3F4CA 4G8GA 2R82A 3NQAA 4REQA 5CC6A 4H0HB 1SM3L 1W8NA 1I8MB 4ZAKD 1XGUB 4PRNB 2FYYA 1TJXA 3M1OA 3ZRCC 4JHAH 2BMBA 2GPTA 3Q67A 5I1IH 3KCOA 2Z1PA 1KWGA 4J3BA 3ZLFA 4P06A 3L1EA 5C71A 4IUGA 1HHKA 4URTB 5LBSL 3TEYA 4PUJA 4F9LA 1TJMA 4ODWB 3UJTL 2RH9A 1X5YA 3MC5A 4B5NA 1E6RA 4AGMA 2XSXA 2GI0A 1GVSA 1GYVA 4G43A 1P5VB 4TTUA 4ZPVB 4JNMA 4PRDB 4NL1A 3ABMB 2WMGA 2FECI 3ULVH 2BP1A 1ZT4B 1WBXB 4YXHH 2YZ1A 4IK6A 1FL3B 3IU3A 2YA2A 5GS2D 1BGAA 4IFKB 4LLQA 4A7GF 3RI5K 1I4FB 2PW2A 3BZFB 4O2EA 1S1RA 3V7AG 4Y88A 4Z0BH 4AIOA 2VL4A 4L4TE 4HCRA 4ZX3A 3NWRA 4CD7A 4Y19A 3OEXA 5DSCA 1ZT1B 1OVZA 4L6DA 2UY6A 3CHQA 3SD2A 5JW4M 2FZDA 1GZ1A 2EO9A 3DFSA 5EDXA 1WWCA 1Z3RA 2BNRB 3MRFA 4KHTH 3V4VL 4Q9RL 1VCAA 3VI3B 1WYIA 3GTVA 3M43A 1UM5L 5DURB 1KTDB 3JTTB 4A6GA 1ETA1 2QSCH 3ESNA 3B2VL 1JHKL 3LEVH 2F54D 4IBLT 3FSVA 4JO1L 3WIHA 5KBNC 4LV4A 3W1AA 1EL3A 1QO2A 3IDJB 4I7VA 4F4RA 1DJHA 5D1QB 5HGHB 1H41A 3ZDZB 3MZNA 4FTVB 3GHBL 1EPFA 2NY4C 3P30L 3URQA 1DJWA 1XGTB 2Q5BA 2Y5TB 3SCRA 1VACA 4EKJA 1NMCC 1QBLL 5EB8A 1AKJB 4PJBE 3WNKA 2BBFA 4WEBH 5LGJB 4TOYL 1W32A 2J9XA 1IEBB 2MEJB 1P6WA 2D7OA 2EDDA 2P5EE 1KA9F 5IMMA 3QQ4B 2YLKA 1JQXA 3S5NA 1FRGH 3QEGH 4MY8A 4LV9A 3MI2A 2PPCA 3NQDA 3CXHJ 4G6ML 1IGYB 3BEWB 1QRQA 3C6CA 1IMHC 3JVAA 4LVAA 5M2FX 5HJGA 2NY6D 4NQUA 2M2DA 1F5WA 5CPQA 2F2KA 2V0TA 4U05A 5TF0A 4URKA 1V77A 4ONGL 1EJWC 4JFEB 1OK4A 3DDGA 4Q6YA 2FWOB 1P9MC 4KKCC 4L3CB 3S4SB 1NA8A 2MOGA 3STLB 1VKXA 2JCCA 1LZOA 4HU4A 3OKLA 4A38A 4DPAX 5JBFA 3FQNA 1KGYE 4YHEA 3VXPB 3O45B 1R5IB 5HJ3B 2G75A 5HHVH 2M26A 4D0DB 4KPHL 5C0CD 1JTPA 3PWPE 2QCGA 4JHOA 3HJZA 3HZMB 3BYTA 4L7ZA 1KLUB 3LNHA 4WWPA 4FXKA 3ASWA 5LG6A 3VIMA 3F12B 5DANA 5BYWA 1CYXA 3FO9B 3VXSA 3WFBL 1EC7A 2R1XA 4S3FA 2SEBB 2ORBH 4UTKA 2JSFA 3LU2A 2O5XH 3HFFA 4LOEA 4R7LA 5F1UA 3HF3A 3VFSB 1JNDA 3WH6A 3L3IB 4M7ZB 3E0VA 3IV3A 3TZVD 3U7BA 3BQUC 5ANHA 1LT8A 1G7LB 2XQYG 3ID7A 4K7FA 3L4UA 3GUTB 5E5RB 3CWNA 2DD8L 1E0OB 3BSGA 1WAAE 4OIIL 1HN1A 2XN9B 1MOEA 2X8RA 3ABXA 5EO1A 5AOUA 1XSJA 3WQ4A 4OFVA 2GSEA 4OTXL 3NESA 1OE3A 3OF6A 4V2CB 4X60A 1EP3A 4XAKE 1DXIA 2FHFA 1HYRC 3GFYA 1D5BA 4PJEA 5TFSL 3RVUC 4N5UA 1PJ9A 3FF8A 4P4KB 2KBGA 3MHGA 3VNYA 3Q2DA 2O0TA 1Q8AA 5K4ZA 4GRLD 2VZ1A 1T99A 1F4YH 4Y7MA 1M56B 4QXIA 5AZ0A 2E7LC 5C6WH 1UJQA 4GO6B 1JWSA 1D3GA 3TC3A 1JJKA 1LLWA 4NRZA 3QQWA 2VWEC 1SHWA 4H19A 3OHXA 2PS2A 5ABAA 2ZAHA 5HQMA 1Q4NX 3KJ6L 3JXAA 2ON3A 3NL3A 4XWUA 3GKAA 3GMPA 2PU0A 1HGWA 2YD2A 4K9EL 1XXXA 2YBRB 3VFGL 1YC8A 3QWRD 3IETA 4BZ2L 4N9GB 1NFKA 3OQ3B 4JNXA 4JOMA 4E41E 4JGUA 4MWAE 1QFWL 5JQHC 1QI2A 4F2FA 3INPA 2J66A 2AJZB 1RCQA 4MNHB 1RBLA 3GXTA 3QULB 1MFBH 1QRNE 3ENLA 1C5DA 1C7TA 4B4FA 1P0NA 1FOBA 1U41A 2D4DA 1DSYA 1AZ2A 5C1MB 2KLTA 4UMGA 4AXWB 2OQYA 3EGXB 1S2UA 4NC0B 1IFRA 3ATYA 3MANA 4BFKA 4MAYC 5DCEA 1NCBL 5AC7A 3ZE0E 4MDJB 4TTDC 4WJ5A 2PO6C 1NAMH 1SBBA 2CBPA 1QKZL 4LLVB 3AJXA 5BOFA 3FTUA 3NFPB 2Q86A 3V0VB 3ZMEA 3CFBA 1XQ4A 5AB9A 2BVYA 3CWGA 1XL6A 1OPGH 3E80A 4CNIB 4DSYA 2JGQA 4P5SA 3CIXA 4XQ6A 3S3CB 2LOEA 3FZUC 1WICA 3E7JA 1R19A 1IV8A 4Y5YB 5EOCJ 5GRZA 3UG3A 3V4VH 1AKPA 3PPHA 2OGJA 2OL3H 1Y6MR 2KS0A 5FYJH 3P4NB 1QACA 2GSJA 4B96A 4XKYB 5E8DH 1VFAB 4HP5A 4WSJA 3I6TA 4QXUH 4D6JA 2HPMA 3BVNA 1LE9A 2HKHL 3BPCA 2N0MA 3VFMB 3SCMC 1NIDA 1BPVA 3BIKA 3W7QA 3GC2A 3EDDA 4IYKA 4FERA 2F19L 4PCPA 4PMDA 4WIWA 2VLJD 4ZTOH 4BFIA 1ESWA 3UWWA 1V0NA 5LGHH 5L7XH 2WQUA 3BPLC 2F74A 3QIUC 4WKXA 2PLMA 3CM4A 2X6MA 2YPKB 3H9SD 1K70A 2ZG3A 3A5VA 4J3OH 5AYUL 4F93B 4X61A 4GQ9L 3WJLA 3MC0A 1EBAA 4EPSA 1OFBA 4CQCA 2R2EA 4KMLB 4FULA 3TV3L 3K2UL 3N41B 3G0SA 3HHRB 2WQDA 2PCFA 3VIIA 3UACA 1FXQA 7PTDA 3LHVA 4QUOA 2V2XA 3OZ9L 1OGPA 2WBGA 1S9YA 2BOGX 4DJED 1E3XA 1HI6A 2ARJA 3SE9L 3TFBA 5IFHH 4HKXB 3CQKA 3GBDA 3ZXWA 3QXDA 4KX9A 2KQMA 4ZD3H 3HS8A 1C8QA 1A7RH 3QEQE 3KDOA 1AXTH 1QLRB 3MJ6A 3LHTA 4ACZA 5KZ6A 5DYOB 4OWGA 1LP9F 3EYQD 3KBEA 3UPWA 1KRAC 1U93B 1OE1A 4G8EA 3HUJB 5DRNA 3ITCA 4CW1A 1AFVL 3PUOA 5FIEA 4NZJA 4B9CA 2B9AA 2CJTA 4EI5C 2CWNA 2W63A 4MTVA 3STZA 1N5YH 4MNGA 4LB4A 2Y25A 1O7SA 3RPBA 3KPLA 4OZ4A 5L8JB 4AZUA 1A5UA 1SZFA 1WJ3A 3F7JA 4NQCD 5JUEL 4YSEA 4UU9B 3VE9A 1ZTXL 3S48A 4C1NA 4DIAA 3NOIA 1GQIA 3HA1A 3FGCA 3ZKXC 5E24E 3S1UA 3B5TA 4DAGH 3Q13A 1CLZH 4Z7NF 3W7GA 1QRNA 4R5TA 4N0UB 5KTEH 4WW1B 3AABA 3WMSA 2W80C 3QVAA 1XXDC 1LG1A 1POJA 4KRPB 4JJHA 3ARDB 2V5TA 4NBZB 4GKZA 1LK2B 1BKHA 4AYFA 2ZDSA 4YTRA 3AU2A 3FQTA 2WVVA 1KBJA 4OZFA 5LYRA 3FL7A 3OR6B 4U6VH 3TZVB 1F6AB 1KT2A 1KJVB 1WRFA 3CFEA 2ICEB 2VABA 3BAEH 5FO9A 3SOBL 4AG0A 5KSAB 4MHBA 2BM3A 4UOW1 1M7PA 4M48L 4UFHA 2K3HA 4AWUA 4L4OA 4P5KA 4YXGA 2GK2A 3MOQA 1QEWB 2H1LM 3N12A 3UZ5A 3OB0H 1J8HE 4GP5B 3W72A 3AXXA 2VEKA 4I2XE 3LI0A 2K6WA 5D05A 5I71B 4NAEB 3H7BB 4LL4A 2JCCF 2GSGB 1GXEA 2UXFA 1DE6A 4YUEL 5LWYH 5T5FH 3T6WA 1ZHNB 2A7BA 3GLEA 2HFGL 2BVWA 2FATL 2FX8H 1JUFA 1KELH 5KBDA 2NYZA 3IJ9A 4NYYA 1OV8A 3KEHA 4AMAA 4QLWA 1E1CB 1KXQA 1YHTA 1KM4A 1NQBA 3CH1B 5HGAB 3KBWA 2FAUA 5DRZA 2ZZ3A 4G5AA 4AQEA 2JKPA 4Q9BA 5FD0A 3TAKA 2EDQA 3EUDA 4KJQD 4EZKA 1DLHA 2CNCA 2AV7B 4BQ3A 1TVNA 2C9SA 2OJZL 4NQSA 1LORA 2BSRA 4GXUM 3RDKA 3W3OA 3O9WA 5DK2B 2AXFA 1R3HA 3KP0A 1YY8A 4ZJ9A 5LKYA 2PC8A 2AOSA 3F4NA 3NNTA 2FNWA 1I8KA 4DO5A 2V9TA 3P4MA 1TUXA 4RMBA 5DJZB 3ESVF 5T1KB 4A2HA 1MFAL 1N6QL 4CN6A 5I1EH 1WDAA 3GSNA 4GOAA 1E0TA 3CFMA 2ICWA 4NUJB 3PV7A 1U0QA 3C61A 3IPEA 4KEUA 3ZTCC 3Q8EA 5HYSA 1GPWA 4M1BA 3C5JB 1AC0A 3MLWL 5I06A 2AJUH 3MKVA 5F7DB 2FD6H 2I60L 3X1BA 5H35B 4Y2OA 3CEUA 1OP5K 1H6TA 4LOFA 1HHHA 4NZFA 3KLLA 5D8JH 1F05A 4QS5A 3DVNA 3PTQA 3PQYA 1JE6A 5DMNA 1S9YB 3FQ4A 5KVDL 4PUEA 4NAJA 4A7TA 1EJUC 1NGYB 3Q8CA 3T0TA 3OAZK 3JVGC 1GOMA 2VR5A 3TLQA 4UV7L 3CMOL 5ABDE 2E68A 2QKFA 2VR2A 5JUEH 2XFRA 3HGRA 3KXFD 4B0MM 5H8DA 3R5EA 2VZUA 1GGBL 3SDYH 1WA0X 2BSDA 2QQNH 1EUTA 1M7IA 1TSIA 3VOFA 5DJ6B 4DHGA 1ZLUH 1BGGA 2IVFC 3MLRL 3PJUA 5FYKU 1KNOA 2D8KA 3DN5A 5D37A 3BP7B 3RCMA 1A4JA 2V5MA 1OF6A 4W9DC 5JW4R 5D1XB 1ZSHA 3LOWA 2XV0A 4OQTL 5E9DB 4DEPC 3QGKC 1MQKL 4WO4C 4Z7NE 4MB1A 4XCEA 5CO1A 5DZNA 3L4WA 2BTMA 3CGTA 5CJOL 5I3DA 5GS0C 5EHFA 3GSXA 5ID1B 3QZWB 1RIVL 4X6CA 3HB9A 4E8DA 3ZHKA 1TITA 4IKLA 4OZGB 4WW2B 1L0QA 4P9HL 1UR2A 1IILE 2QUMA 4DWSC 2VFIA 3CIAA 2YXFA 5ENWA 1XH0A 3WJJA 2ZE0A 2V7NB 2FTPA 4N87A 1NMAL 3S3GA 4UM8A 4AEOA 3N6HA 2CDFA 3LSOB 3QBUA 2FJGB 1N64H 3TW6A 4L9LA 1MCIA 1S5IH 4A67A 4K3ZA 4R27A 2W60B 2J88H 3VFNB 2X1OA 5EU7E 4OFDA 2B1AH 5I15H 4APXA 4U1GB 1M1XA 4OFQA 2P8PA 4MCNA 3VGHA 4TUJA 5LGHL 2F53E 3RZCA 3TOYA 4RE3A 1KJ2B 1K7XA 1GYAA 2F38A 4TQEL 5B4MD 1OT4A 2H2PC 2YJLA 3KYOA 3CPGA 4OJYA 1AC6A 3BVWA 2HNEA 3NCFB 4YO0B 4H8HA 2ZA1A 3QKEA 4U3CA 4HS3B 1UACH 1JF5A 5D6DC 2OFQA 5L8KB 2CHXA 3M1BA 3W53A 1P84J 4QEGA 4CQ9A 5LCVL 2YCIX 1Y6NR 2DDXA 1PBYA 1EOKA 2B4CH 2NVCA 2IAMB 1JPGB 4GIOA 4X5WB 3TH2T 3KLQA 5I2UA 5J11B 2CLPA 2TSBA 4L3EE 4XPGL 3KBJA 3N14A 1NIUA 2D69A 1UFGA 2OMVA 3RWJA 1VRXA 1PSKL 2O55A 2YL8A 5AWNH 3LG3A 4OLWL 4GUOA 2ZOOA 4C83B 5FESA 4UCGA 4ORZC 1VPOH 2BZNA 2GVJA 4YN3A 4IGSA 3P0WA 4NT0A 2CGRL 3NSJA 1RJCA 3ULUE 5T91A 1MO0A 3GDTA 5JOFB 4O58H 2IPTL 2FBJL 4GAGL 4MGGA 2C3GA 3WNMA 1USZA 1OSZA 3P73B 4YHLH 1F1GA 5I1JL 3U2ZA 5CCGE 5FF3A 3SBQA 4BKTC 2A6KB 2ED8A 3LHPH 2AXFB 2VFGA 4BUQA 2E9JA 2VR8A 3FA4A 3R89A 1DOSA 2BXVA 5JUVA 3B56A 5BVPH 3REQA 1F3JB 2XICA 4IQJA 4NO3B 1HQ4A 2C7FA 2PO6B 3MO1B 2BG5A 1KFKA 2PGWA 5JO5B 3GWQA 2YPVA 2W5PA 1N64L 3FTSA 3THAA 5EU5A 3D05A 4UU9A 3U7WL 3BZEB 2WQVA 4RCXA 1UH3A 3PWLB 4ICXA 4GCXA 4WKFA 3O2VL 1W1VA 1ZLPA 1KPRB 2LFEA 1R17A 2ZYHA 4ERSH 1MEWA 2WV8A 4JLRB 5TDOB 2XFXB 4FQIH 5DMGD 4AY7A 4YHIA 5F9WC 2CYGA 2W67A 1VERA 3ET9F 4XWGL 5U4NA 3WLWC 3NCCB 4K5NA 1MCLA 3SQRA 4GY1A 1RXOB 1AJ7H 2JJSC 2IANA 2L0DA 4FCAA 4GSUA 4OI9A 1WT5A 3L2MA 2BZDA 4Z7VA 3Q2LA 1BBJA 4EF8A 1IM9D 3RUGA 5HJYA 3E49A 1UKSA 2W9EL 2E7HA 3FH7A 4YHYB 2VSDA 1W9XA 5E4IA 1IBGH 3SW6A 4POCA 3MJ9L 4JKPH 2GSHA 3M7SA 4JIEA 3EPMA 2NQ3A 5IM7B 3TDFA 1D5MB 4NENA 5KSAA 5EEXA 3QQDB 3ALFA 1IGJA 4WOZA 2HMIC 1KN2H 3HW7A 1SDYA 4W70A 1HJXA 3C6SB 1NU5A 4JDVA 2AQ1A 1C8VA 1FG9C 2PURA 3BFWA 1GG1A 4F27A 1H7WA 4OJDH 2WTPA 1T1YB 4FABL 1R3IL 1J48A 2GY5A 5ECJE 3ATEA 4R9XA 1OFOA 1MH5B 5FECB 1KO0A 4WU7B 1G6CA 2FQIA 1FHLA 2GGEA 2Q76A 4FDWA 2R29A 4ZB5A 1MQQA 2WB5A 4N2BA 4OFPA 5AB1A 3M0HA 2V2TB 3G1XA 4PJGB 2XQBL 3N85H 2EPMX 5GGUB 3UT0A 2HVBA 4TUUA 4IMCA 2E75C 3A64A 1TPUA 2W0PA 3PE9A 4A6YA 1Z1WA 1LBMA 4LSPL 4IPJA 2EDNA 4NZ4A 1OCQA 4P7OA 4EI0A 5IDZA 2BIMA 1A1NB 3CMFA 4WTXA 4GJJA 2NLYA 3AS2A 4Z0XB 3ELQA 1YPIA 2ZD0A 4MJID 3QHZH 3L67A 2SEBA 3O2DA 3TA4D 3I74A 3WF1A 1NF0A 2ZJSL 2Y1HA 3BT2H 3K5SA 2QJMA 4AMWA 2XQ0A 2FZ3A 4AJYV 2P0OA 3IV8A 1NWTA 2WXKA 4IIDA 1JI2A 3MZTA 3L81A 3AQXA 1TVBA 5F72S 4LOVA 4BWWA 3TFCA 2AK4E 3UPBA 1FNFA 3ECQA 4WDTA 5BWFA 2DIJA 1GQKA 3PY2A 5AY7A 3B4NA 3BDYL 4LSSH 4AY0A 1U3YA 4X6DE 4TVSa 4UMAA 4PUMA 4Y4FA 3LNFA 3DUSA 3TAOA 5D7JA 2YMXH 1JZGA 4PJEB 1YN6A 4JQVA 1U1JA 3VUPA 5TTRA 5HJLA 1UZGA 3T08A 4P59H 1QAWA 2EDEA 3SE4C 2MPAH 4HKBB 2LR4A 3GKZA 3UZQB 4F7MA 3MUUA 4AAJA 3D0AA 1JHKH 3T4WA 2PP8A 3QJQB 4U3AA 5CNHA 1NCIA 4LASL 4Y2DA 3A3HA 3WD3A 2W81C 1BZDA 3HS0B 3GBEA 3RIAK 3S36X 3FO1A 3UTZB 1OK6A 1IFGA 2ODOA 1K8DB 3EOAA 5A6TC 2WLIB 1WZKA 3GC5A 4O51B 3FKUS 3GWJA 2E56A 4ZMNA 3KPMB 3ULVC 3M0KA 1YN7A 2VRAA 4LIQE 3RI5F 1PXGA 2VCBA 3P74A 4U28A 5A6IA 3EZ8A 2O92A 2RDXA 4HHHA 1C90A 1YPZB 4NO5B 5AHEA 3ZKSD 1Z9AA 3FBKA 1ZVSA 4XCFH 2VM8A 1TG8A 2F7RA 3CK0L 2J8OA 1T0MA 5D02A 4WY0A 4JTDA 1NCWH 1JZJA 1MNNA 4U1IA 4Z9KB 1NCUA 1G9NL 4Z3JA 2VX7A 3VFRA 3C4UA 4G9FD 1XYZA 4XVTH 3K4WA 3T71A 3SJ3A 1F9CA 4JS3A 4POUB 4WJ5B 1S5WA 2XKSA 3TEVA 3UP1A 4RZBA 4IWWA 1MRFH 1QSED 2R1WB 3VFOA 4YLCA 1MRAA 2F6AA 4GRWB 4PJIF 5E2TH 3B8IA 3G1AA 3X13A 4DNLA 4GUHA 4IBSA 3V4PA 1PY9A 1OGAE 1RSFA 4YSOA 4KNTA 1FNHA 4GUGA 1UOKA 3HKFA 1GORA 2Q7YA 5FW7A 1H8SA 4O0KA 1IKFL 3OYZA 1MVUB 5KZCB 3WD2A 3RTLA 2IALA 3UBXA 1FE8H 4DZBB 5FYLE 1GG0A 4PTWA 5HUOA 2FX7H 5TE7H 1TT6A 4QXGH 2GJZA 3LJ3A 4I89A 2XV3A 5BRPA 1IEWA 3VWJA 2GDUA 2QW5A 3O0KA 2W5FA 3WF4A 1ZGLA 2JFEX 1WKEA 2NY6B 2P8MB 4JNYA 4OF3A 4P5TA 5D9SB 3QUYB 4HHGA 1XR8A 1RZMA 2P8BA 5F2GA 4KY1H 5KSWA 3TBSB 4MKSA 2CZNA 1OF2B 3OGVA 3U0HA 2IPUK 2X7LB 5D96B 5C0BD 3W7JA 2OMZA 3Q4DA 3IMSA 2XZAH 1K03A 2B9BA 1VEPA 3FT2B 5G5DA 4DVRH 5ACZA 1W1TA 2FPYA 5BWAA 5JW3H 2Z7WA 3JWOL 1LJYA 3FT0A 4N6RB 5TDNB 5GVJA 5GISL 4X2PA 1G87A 4OZHF 1QSFD 4G42A 4JO8A 2DQWA 4KTEL 4JM2B 4PJGA 2DW6A 4JZOB 4R7XA 3VTTA 1FY6A 5LIWX 3T1WA 5EU4B 4Z76B 2BNUA 4JKNA 2DJLA 1CCZA 4JRWA 4H9YA 2RH0A 4R7NB 1B0GA 4YCOA 3CAKA 2XUCA 3L3GB 1XDJA 4JY9A 2EC8A 4A3RA 4BWTA 3ZZ1A 3X3GL 5A43C 3T6CA 1JZFA 2FIRT 2NW2B 1OZQA 1QDSA 3DG3A 3HI5L 3L3DA 4CVZB 1XGTA 3QZMA 1F4WH 3L6FB 3GTNA 1HJVA 4HBQA 1G1CA 3MV8B 5KVEL 2RBLA 4H9XA 4XNMA 1DQTA 43C9B 4WW2C 5I8KH 1CTNA 2VR3A 3QRGL 2Y7OA 2EIDA 4N8VB 4K7PY 3MBEB 3EFDH 4AE1A 1F41A 3C6LB 1TIUA 4JE0A 2R9RA 2F68X 4DVBA 1OLZA 2MIZA 1TZ9A 4GIEA 3VIKA 2LGNA 2MQ3A 1XX1A 4S3AA 4NKIH 3QNXB 3QUYA 1ESOA 3VXNA 3OVPA 4J12A 4TO8A 4HPYH 1MRQA 3E6HB 4P2QB 5GIRA 4NKCA 2VKWA 4GINA 3O7UA 3STCA 4Y16D 5IW1B 3UBPC 5DC4B 4ZMGA 4NNCA 4F9JA 4X6FB 4Z7VB 5IROA 4EDXA 1DBJL 2CHOA 4KETA 5F3HB 4MRBA 5AW8B 3CX5J 4MD4A 3DG6A 2DQHL 5AQ0A 1A22B 4GW4B 5DJAA 5AZ2H 2YQBA 1SXSA 4NO2A 5DZJA 5C0BE 1E4IA 1SXBA 1N5AA 4X9FA 1HP4A 1HH6B 1OLLA 3FT3B 4HN8A 1TWSA 5CXPA 3MFFB 3QFJD 1NDTA 5AVSB 1GAFL 5FO7A 2RAMA 5BXFB 1JGLL 3GVRA 5F71A 1MCNA 4UM9D 1T96A 4WNSA 4JW3A 3TN0B 1OX5A 4AVJA 5A3IC 3VUAA 1ACZA 3RO8A 3ZY7A 2B0MA 5E94A 1FZOA 3L1OL 1GGYA 3QS2A 4B4HA 1ZP4A 3BW9B 2PE4A 5DQPA 4NEHB 1J9YA 5GRXG 1IAMA 3FAXA 4UINH 4JR9H 3D0CA 1PQZB 2DBLH 3V55A 1CB7B 1J1PL 3GBNH 2OL3A 1W1YA 3J27A 4PP2A 4GCAA 2XWXA 1ZAJA 1UOWA 1HZHH 2J2ZA 3QC5X 4WKHA 5JXEC 5C6TH 3CG8A 4A2GA 3FCGA 4ZXBC 4A6YH 1R4XA 5F9OH 1F6LL 4MHHG 1HVXA 5C0BB 4MJIE 3VX1A 1UOZA 4LT7A 3LZ5A 5HY9B 4HJ1A 2PDJA 3MHFA 2JI2A 3BI9X 2V3GA 2ITCB 1ETB1 1JAKA 1GGTA 1KTDA 4H4IA 1FFTB 3MAWA 2Y61A 3QEQB 1D6VH 1MY5A 4MSSA 5GGSB 4GG6B 2IQAB 3QZAA 4ENLA 1V3JA 1BECA 1GHFL 2XZ7A 4UOJA 2IALB 1KM1A 1BYPA 2B77A 4D6FA 1U6AL 3S36L 2H9GB 5DFVC 5FJJA 2I5IA 2D2OA 4HUNB 3OKKA 2DQFA 4M5YL 4P8QA 2W8CA 2YPVL 2XQYA 3GTTA 3O3EA 5D1ZD 5HHOB 2ATAA 3B05A 4LAJH 4YWGH 4MQ7B 1PWMA 1QOXA 2DZTA 3S88L 3BOXA 4EPKA 2VMDA 5K2ZA 1AG1O 3ES6A 3CXDH 4OUIA 1EX1A 3W76A 4XHJC 2H32B 3GXUB 4WK9A 3MYJA 3RU8H 2HLAA 2YAEA 2C3WA 2J79A 1AG6A 4HIXH 1OPGL 1T4KB 3SADA 1NGQL 1CLYH 3CZNA 5CN3A 1CFSB 1HEJC 1I2RA 3D09A 4P5UA 3LCFA 2C9VA 3FXYA 4EANA 4L0YA 4P59L 5B22A 4I8YA 3L48A 4BFGA 3VYPA 4HZLA 3AXLB 2J6EA 1RAKA 1TSRA 4FZIA 1IC4H 2Y7QB 2Y24A 2BODX 1US3A 1QLEH 4OF0A 5ALBL 5KANG 3S2CA 1NM4A 4ZQKB 3VXSE 3VD0A 4L8SA 5AHNA 4BRVA 3CDFA 5I74B 4G7RB 3RUBL 3G1SA 5HDBE 2Q0ZX 2X40A 4OI7A 3BVUA 4KX7A 3GKFA 2JQZA 2X42A 1HKLH 1EUUA 2AF2A 2NW2A 1OB1A 2K3TA 5EU4A 1QW7A 3CB8A 3P82A 3N2BA 4WEBL 4YZWA 1W91A 4JN2B 4JM2C 4LBRA 4I18B 1AE6H 2RQEA 1JZ6A 1H3VA 2D0GA 2NV1A 3KZPA 4X9IA 2ZX6A 1X9LA 5E6SB 5DMIH 2NLIA 4GVHA 3VKKA 1YYML 3BP7A 5DD1H 2A3AA 3BFOA 3VGEA 5T8IA 2ZWYA 2X16A 2XH4A 5LA0A 2RDWA 4XZUB 2EJ1A 3OP2A 1CDCA 1RUPH 1IGMH 3QDGD 1G7LA 1KIRA 1MJUL 1PAZA 3CLEH 4P5MB 1OGGA 1DCLA 2Y7MA 5I23A 4KVPA 1C1EL 1R5WB 2CLRB 2DQUH 2IH9A 3T3PF 1XF0A 4LT9A 4QSHA 3O6FD 2DIBA 3RY4A 1LWIA 1ZPTA 2W3ZA 4GUPB 7REQB 3FULA 3CUZA 3PTDA 4JFFB 3RHGA 4AY8A 2V9QA 3B8SA 3I4EA 4LUYA 4K71B 3WLBB 4FQ2H 4HZ1A 3MUGA 1YPXA 3HAEA 1JF6A 1IAOA 3HG4A 5I3GA 4HIIA 4NO2B 2Q10A 5DJ0B 4XBPB 4WSHA 3MZ2A 5DMMA 1R3JA 1YJDH 1QA9A 3QJZA 1ZLWH 3RGTA 4DKDC 5DHVH 4BCYA 2V81A 1GVIA 1XBDA 4LCWD 2G9KA 4OSUL 3T0AA 4APQB 1HKWA 3UWEA 3NUKA 4JG9A 4L4VB 4O4VA 2A7NA 3JWNC 2AAVA 3HNSH 4FIRA 4P2VA 4C6IA 5AZUA 3QGVA 3T3PB 2XG5B 3DMMC 1MSPA 5D7KE 5C9XA 1XF3A 4OZIE 3N1PC 2VDOB 2G75B 2QKIC 4CNTA 1EERB 4N2GA 2QHRL 2VUOA 3LTSA 1MCJA 2QVIA 4XO8A 1TCMA 4KIRA 4P7QA 1ACXA 2R0WL 2NY6C 3TYGH 4B6ZA 3IKCA 5B4MC 2A5HA 1XP3A 1I8JA 1BZ8A 3ZDXB 3RCYA 2BSEA 1BFVL 1TNNA 2NMSA 1K5NB 3IDNA 3OMIB 3PP7A 1IO4C 7XIMA 1LGVA 2CRZA 3QG7H 1U92B 2W9EH 4PBDA 4PJXE 1IXNA 4EUPA 4FK9A 4A4AA 5BOEA 1SY6A 1YNTA 3LKSB 2INFA 3GRGA 4PWJA 3TEWA 1DQDH 2FX9H 2VWSA 1FZJB 5ADOL 2EG6A 3V18A 2E5CA 1T0NA 3OODA 1EHKB 1WFTA 1FO0L 3WEMA 1ZK5A 3ZPDA 3UZJA 5XIAA 3B0UX 2AJSL 2OV0A 2NY1B 1BSIA 2QQKH 3F83A 4X4KA 3WLBA 1ZTVA 4XISA 1KFLA 1OP5H 3SIKA 4AVNA 2QVTA 4MRCA 3SQBA 1H7XA 1L6YA 1Z9LA 1GOIA 3LHZA 4MD5A 4R88A 1KXTA 3WI9A 1SVDA 3CTLA 1OTSC 1T7WA 5GGRA 5FYLL 4J1UB 1MHCB 2WK2A 3LXCA 4LIQL 4YHPB 2OYLA 1OT1A 2H1PH 3ATBA 1GTFA 2I69A 4PJ9C 4Z7VF 4GRWH 3VRLF 4PJIA 4HEMA 1JAEA 5GPRA 3BO9A 3A4WA 1RA0A 4FI7A 3T4YB 3SQMA 1XYMA 4E4FA 4W68A 5B39A 1SO3A 3H4XA 3K71A 2GGGA 1CXHA 3NP3A 3G22A 3IUIA 4IF2A 4WWKA 5I6LA 4GJIA 3QUZC 2FJFA 1KPRA 5IHSA 4IQDA 1F6FB 2Q8AL 4BFFA 2KZBA 3WE6B 1TA3A 2QLYA 4ODHH 5IQ9B 3GW0A 2Z27A 3MQTA 4YR6A 3BHBA 4A39A 4HT3A 4OV5A 3PVFA 4D71A 2LE9A 4X8CA 1E6NA 3MFGB 2UY2A 2EYSB 3B9VA 3CFUA 4ZQNA 4HHAB 1LO0L 1L9WA 4L9XA 3EYQC 5BW6A 2P52A 5CAKA 5IFJB 3G5VB 3PV6B 1JPMA 2DW7A 4K2SA 1EWEA 1GGIH 3G7TA 5CPLA 1UJ3B 5DD6A 5F9DC 4JFXA 4UT7L 1OX4A 3KYKH 4P0DA 1DQIA 1Z66A 3EB3A 5C08E 1WS7A 1ONWA 2X70A 4EXAA 5D96C 4OFIA 4B7IA 1E15A 1GIGH 4YBLB 5DXYA 3K4ZA 2UZ9A 4QAMB 1VGEL 1QR1B 2BCMA 4X9GA 1ETZA 4FQPA 2PDFA 3OGSA 1XCTA 2WO2B 1CLKA 1RKRA 5F6HI 3ITOA 3OJVC 1XYFA 4FC3E 4U1MA 1MH5A 2OWCA 3GG1A 4UCFA 4XP1L 5FO8B 4Y1TA 4G59C 1M68A 4NJIA 3BGJA 3EO1B 2GK0B 3E6FA 5IMKB 1HZHL 3IXAA 4I3SH 1NWSA 3BSZA 3BCDA 3L9RB 3N2JA 1GVEA 4WKZB 5IV2B 4F91B 3TWCL 3PXLA 3G6JF 4AZIA 2VLRE 3RLUA 1V8HA 1UZDA 3BLLA 1QPNA 4K9EC 1IGSA 5FO2A 1XIEA 2AQ2A 35C8H 4M6OL 1X5XA 1MDTA 2FH8A 1Z2KA 3BWZA 1TSHA 5ECUA 5IF0B 5AOIA 2DJMA 4OCXH 1T6VN 4XNUL 5JPMB 4PCSA 3EO9L 2NWSA 2WBJD 2I5QA 4NO0B 4C6PA 5HMFA 2HT3D 5AOMA 5C08D 2Z2AA 4KI5D 2J72A 3MA9H 3HE6D 2Z7KA 2ENYA 4MCZA 1G4SA 5D2WA 3ARED 5JIDA 4JPQA 2EG8A 1BXCA 2QZQA 4PUKA 4B5SA 1PKOA 4JX6A 3FHAA 2VC6A 4IGMA 1R3LA 2PR4L 2ZKHH 5DJXB 4Z2IA 5L4JA 3FPXA 4JZNB 2XZQH 3B1UA 1QEWA 5AL0A 5GS3A 3KOZA 3U0PA 3RYSA 1OGAD 1SHXA 1TTAA 3O2LA 2FGWH 3NCMA 3VCRA 2D9QB 3RVUD 2YLHA 4P3DB 1CGSH 1EANA 4GLRH 4H5SB 1HC1A 4QHKI 3F2DA 1T5WA 4XVUD 1FL6B 1S2CA 1HSAA 3EFOA 4KT2A 1MCRA 3NCXA 1C92A 3BW3A 3TQVA 1FUNA 4FQXA 4WFFD 5F3BA 3WUBA 4AJWA 4BV1A 2PDUA 4DXKA 2JK5B 1GJWA 4WZHA 5IESL 2NY0D 4NT6A 3PSVA 2WUCL 4HUXB 2NVAA 3TR9A 4NO5A 4P4RB 2VLLB 1WFOA 2ITEA 4L4VE 2E6JA 1T2JA 4POZD 3VAEA 3HE7A 3KNBB 5I2IB 1I1AB 3LKRA 3TH3T 2NXGA 4HYWA 3IRPX 4ODBD 1K3IA 1AI1L 3US9A 2YEQA 1C08B 1IAIM 3KPMA 3TCXA 4EZJA 1QPQA 2PZ0A 2MPAL 4D8ZA 2DW5A 1RJLA 3FRUB 4YGVB 5GGRB 1R2RA 2FZ9A 3SGKC 2UBPC 1ZTMA 4DESA 3U1SH 1ZE3H 3O4LB 4U1NB 4QYAA 2HLEB 1U21A 5EPMB 5IOBA 1JPHA 5FAAA 1S2AA 5CFHA 5CM1A 4AC2A 4XNYL 3I6GA 3WSUA 2W9DL 1I9CB 1FLTX 3D4GA 1EAJA 1UCTA 2Y70A 5G1TA 3GIVB 4R26H 4G1NA 3UFYA 3WZ0E 4PCYA 1MCEA 3LQAL 1W8SA 3E02A 4UFMA 1L6FA 4ODSL 3DRTA 5CIPB 3GTHA 3BAYA 2CA3A 1F4XH 2XWEA 2FATH 2FX8L 1OQOA 2PO6D 3SN4A 3B9KB 2CNYA 4NX5A 3D9AH 4QTIL 1V55B 2WNXA 4IGBC 5I9QB 4V1DD 4FXRA 3WAJA 2JKNA 1RZ8A 1R24B 2YZ5A 5EC2B 2OCJA 4DNHA 4E5TA 2G60L 4QAIA 3TBBA 4NOBA 4P9MH 5JNYA 2R24A 3ARBC 4LDCA 1R5VA 4M6NH 2RUSA 3LLDA 5EMJA 1EAPB 2XFGB 1AGFA 3QDMB 5CD5C 5L88L 1WCBA 2DZUA 4M48H 3B0YA 3NFNA 5CP7A 2IXQA 5FDYA 1X96A 4POZC 4HIBA 4PBFA 1C93A 1HQRA 4BY3A 1MJ8H 2C9PA 3W2DH 2J7LA 5I5MA 1TZGL 4N2OA 5DDHB 3VB8A 5GRVL 5AVRB 4LCQA 1A14L 4CL7A 3QJFB 1X38A 3BVVA 4H88L 4LBAA 3PGDB 5ESVA 3FO2A 3D7PA 2VEIA 3L4YA 3QZWA 4ZUTA 5DXWA 1UJ3C 1FG2B 4JVWA 4P23A 4S11A 3RLSA 3M47A 3T4AA 4PW9A 1V3LA 3W7OA 1R87A 1I7RA 3H4HA 4LNRA 1Q63A 3P1VA 2YPIA 5A2BA 4XTIA 3F12A 4ZUUB 1I2NA 3QG6B 2J4GA 3KBNA 4F7EA 2QNEA 3PZGA 2FJHB 4EDWH 3PWLA 1V6UA 2FZ8A 4HCFA 4HT1L 5D9OA 1QOPA 3NOYA 3MXWL 5IQMA 4IKJA 1INEL 1MI5B 2JLLA 2UVFA 5SX4I 3FYPA 2NQHA 4PJXB 1ZIAA 1BZ7A 2K7PA 4FPSA 3NGBB 2WZPA 2ZX9A 5IP4A 5DK0A 3BCJA 1S3RA 1WOBA 1O9ZA 3JS3A 3N2XA 4FS9A 3FX4A 4WY7H 4ODXA 4RBPH 1DSFL 3RFZA 1FWBC 2VZVA 2EZ0C 4I1RA 4NP4L 2YDSA 3QGAC 2Y23A 4KIEA 2GJJA 4U0RC 1W72B 2C34A 4P57A 4HX1A 4UT9L 4F7CB 2PN5A 5EBUA 2JBMA 4M6OH 4K3DH 2XGZA 3KPSA 2Y5SA 1DVFA 2DMCA 3HUJF 4YO0A 4I3GA 2ACUA 5CU9A 1AGDA 4OIBA 4AYMC 2ZXBA 5BZDA 4F66A 3MJWA 4AYDC 1HINL 1UKTA 4XNZB 3RKDC 3P6LA 3SJVE 3WS6C 3BW2A 2GYSA 1GGCH 1T66D 1X5LA 1IX2A 4H1LA 3C0SA 3W1PA 1UWTA 2JIXA 2W4XA 1JPGA 4X5WA 5JIIA 1T7ZA 2YGOA 3GQFA 3NURA 1EEXA 1NSNL 2QKIA 4WFHE 2QVNA 2J27A 2K9UA 3LDBC 1YEJL 4NKDA 3U9UA 5FUZH 3SZKC 3L45A 1S5HA 3IFOB 3SO3B 1FFPA 3WUZA 1A0QH 2O5ZH 4GQQA 5K9CA 5E95B 4TNVF 3LKQB 2YXGA 3S8HA 2IV8A 4KXCA 1TE6A 3UYPA 4QOKA 5HYFA 3NBNA 3SUVA 4FQXB 1Z3GL 4UMBA 2UWEA 3RIKA 4BSVB 4MPKA