5A2BA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
452
structure length
452
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
molecule keywords ANOXYBACILLUS ALPHA-AMYLASE
total genus 167
structure length 452
sequence length 452
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2bA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2bA01
1N82A 3AZTA 4LXFA 3M6DA 2ESCA 2J8FA 1FOBA 1MFVA 3UG5A 5I6SA 1W2PA 1XSJA 4B15A 1BVZA 2PWEA 2YIHA 5F7UA 3AMLA 3B8SA 3NCOA 1CNVA 1FHDA 3HU7A 4CUCA 3T0DA 3L2LA 1ISVA 4MDOA 3HG4A 4F79A 1VB9A 1PBGA 2VZTA 3BCFA 4J27A 1ESWA 1K9FA 2VZUA 5FOOA 3IJ8A 4PTWA 3VD7A 1FHLA 4UQCA 2Y2WA 5E1QA 4GINA 3ARSA 1RP8A 1Y7VA 3ALFA 2J62A 1DHKA 3WY4A 3GNOA 1O7AA 1KBBA 3WBAA 2XM2A 1CENA 4LYPA 3SCSA 1H1NA 3H53A 3OIHA 5D9NA 4GQQA 1GQJA 1PIFA 3VNZA 2YDRA 3WQ6A 3T0AA 1CLXA 2WBKA 3LXBA 1UD5A 4MJ2A 1CGWA 4TX6A 2XG9A 1V3HA 3RILA 1QWUA 1CGYA 1YQ2A 1TVNA 1UD8A 3MUY1 3VDAA 4BCEA 4AMCA 3II1A 4IISA 2EBNA 3CZLA 1D7FA 4FLSA 2GFTA 4BA0A 1SMAA 3OGSA 3TA9A 4FMVA 4R27A 5A6BA 4IM4A 4Y7EA 1R86A 1JIBA 2XPKA 3IJ9A 3LRMA 1B30A 4TVCA 6TAAA 5IHSA 4P7QA 2WCSA 1TCMA 4PTMA 3PN8A 1B31A 3A4WA 3UG3A 1EH9A 1XCXA 5AYBA 1EHNA 1FH8A 5I79A 4GI8A 2UY3A 3W4RA 2GJPA 1DWFM 2DSKA 2Z1KA 3WD4A 1EIBA 2XFRA 1XH1A 2E0PA 4RE2A 2ZXBA 1AQHA 4PRWA 4CU6A 4NZFA 3SUVA 2NT1A 2CITA 1W9XA 1U2YA 4MADA 3VIIA 1W3JA 1E1FA 3W81A 1M04A 1IZJA 1G01A 2CEQA 1CYGA 5A6AA 3WQWA 1AQ0A 1UWQA 2O9OA 2YL6A 2UY2A 1GOOA 4DM1A 4BQ5A 3VTRA 4XB3A 1V08A 1KXHA 1G0CA 2UY5A 5E6ZA 5CGMA 3L4YA 2UWFA 4AYSA 3FHQA 3T2PA 3UR7A 3AHYA 1VFUA 1M01A 5AYIA 3H55A 5E6YA 3J7HA 3TTOA 3VD5A 2VR5A 3GYCA 1H0GA 1NQ6A 3N04A 3TTQA 3JUGA 4W87A 2YLLA 1CBGA 4MB3A 3ARTA 3F5JA 2E9MA 3CHCA 3KLLA 3EDEA 3HZ3A 1ZS2A 1WZKA 5JBEA 4B16A 5A6BD 3PZUA 1W3LA 2VTFA 4JCMA 4ATDA 5M03A 3VIKA 1J18A 1HF6A 1BAGA 1HP5A 2W5FA 2O9PA 2ZUTA 5BROA 1US2A 3L4TA 3M46A 3AZSA 4UQEA 2CETA 1C8XA 1O6IA 4XV0A 2W61A 5AC4A 1JXKA 3LRKA 1TQTA 3CMJA 1HKJA 3DYPA 4AMWA 1MVYA 3I3DA 1LL6A 4D6GA 3CBWA 4HPHA 2WLYA 1WPCA 1JDCA 4AZ7A 1EXPA 2EPNA 3VX1A 2E8ZA 2EXOA 2QF8A 2VZOA 4UCFA 2WCGA 3FHAA 4L4PA 3WEMA 3NDYA 1QI4A 1B90A 4HP5A 3AROA 3WH6A 5EBAA 3LXCA 1B3VA 2E9LA 1C92A 2WPGA 2BNJA 3CZJA 1OBAA 3K4DA 1RP9A 1E0VA 2VMFA 2OSXA 5CGTA 3BUQA 5D9OA 1KGUA 1WDRA 1B1YA 4PCSA 1OD8A 1HKKA 3ZSTA 3DX1A 3WNMA 4HOWA 1CEOA 5D9MA 3VIPA 1CDGA 2XHYA 2YFOA 5CZKA 3AS2A 5LA2A 4PN2A 4UOJA 1KCKA 5CPSA 4M82A 1R33A 1EQCA 4E2OA 1TZ7A 3NDZA 5ABGA 3BGAA 4MJ4A 3T0BA 3U5YA 2CKRA 4GZEA 2D3LA 2DGAA 2BFGA 3GXNA 3EMCA 1BG9A 2G3IA 2BXZA 2YA2A 1JZ3A 2X8RA 4TUFA 2ZIDA 3FN9A 3BXWA 5DT7A 3U57A 5GNXA 1GVYA 4H8HA 4YHGA 1R85A 3L2MA 1NH6A 4NXSA 3ZJ8A 4PMVA 4HZ8A 4LGXA 5FKYA 3CV5A 3FNDA 5I2UA 1E6PA 2BV9A 5I23A 5IFPA 4MNKA 1UASA 4KH2A 3PTKA 1VENA 4OZOA 3VGDA 3OG2A 4AZ6A 3BC9A 1E56A 2FHFA 2CBIA 1M53A 3WL0A 2Y8KA 2WKGA 2EPLX 2VR4A 4JIEA 1HT6A 1QI5A 4B9ZA 1KXQA 1WZAA 1E4IA 1Q6DA 1QNQA 3CMGA 4PMZA 3I3BA 3QGVA 2F7RA 2WWCA 4PMYA 2AAAA 5C70A 2GK1A 2OW7A 2G4FA 2W67A 2VNCA 2XVLA 3OGVA 2XN2A 5ABEA 1V6XA 1PPIA 1E40A 3AIBA 3D51A 3VGFA 3WN6A 1VEOA 2PI6A 1LL7A 1NOUA 1UWIA 4KGJA 1OIFA 4AD3A 5CSUA 5GPRA 1LJYA 2D73A 4X0VA 3IGUA 5GNYA 1ISYA 4W7WA 5D9PA 1TR1A 1HKMA 3NSXA 4H41A 4QAWA 2WMKA 3WF3A 4KWUA 3PBGA 1V3JA 1W9BM 3GXTA 1FH9A 1BPLB 1B3YA 2ZX8A 4GI9A 4W84A 3N13A 4CCEA 2JEPA 1JZ7A 3BMVA 3CPUA 2W92A 2OYLA 4ZFMA 4BQ2A 2JFEX 3EYPA 3UCQA 1JYWA 3WNNA 2XIIA 1EQPA 2D0HA 3WSUA 1VEPA 1JG9A 1CGTA 4N0RA 4MPKA 5CLTA 1V3KA 1UA7A 5BYWA 1XD0A 3SUUA 1CXKA 1X6NA 3MV11 3G6LA 1JNDA 2GK1B 3VILA 3VMOA 1MQRA 3POHA 4D6JA 5E0CA 3PTMA 2CNCA 1VEMA 4CGTA 4ACZB 3WMBA 5A1AA 4P8WA 2D2OA 2ZWYA 2WZEA 2WMIA 4OKDA 5D8WA 4PMXA 4WKFA 1HNYA 3VNYA 3AMDA 3PHAA 3CLWA 5BXSA 4HZ6A 2EPMX 1UUQA 2WB5A 4OIFA 1TQSA 2AOSA 3GDBA 3IK2A 3NSMA 4GPNA 1KB3A 1DWAM 1UZ4A 1GCYA 3SCUA 3WF2A 1WO2A 2ZWZA 3KWXA 1ZU8A 3OB8A 5HBFA 4KMQA 1WAWA 4P7OA 4AEFA 1PAMA 1JZ6A 3THCA 4CVWA 5ABFA 3K1DA 1HJVA 5I78A 1MW0A 5BXPA 3BVTA 2WMFA 3AIQA 2HVMA 1PX4A 2BHYA 2Q8XA 5DT5A 2G3MA 1JYVA 1QHPA 2W66A 3DC0A 4AIEA 2E8YA 1PZ2A 3DX4A 4NF7A 1GUVA 5TD4A 2V3FA 1BLIA 5E09A 1UR4A 4FLOA 4P7LA 3PZOA 5EB8A 2G3JA 2EAEA 4V2XA 2FGLA 1WDPA 1BF2A 1CTNA 1R87A 3EMQA 3PZVA 4W8BA 4DWSB 3EDKA 4UZUA 2VQTA 4ML4A 3SUWA 2PWHA 3K4AA 1UZ1A 4AIUA 4UFMA 4AZ5A 3RM8A 3POCA 2CCRA 1V0LA 1VF8A 4OUEA 2F61A 3B9AA 5CLWA 4D72A 4D71A 5A8QA 4J3XA 1GORA 2WM0A 1Q6GA 3TV8A 3VDCA 2QHAA 3MI6A 3AHXA 4GXPA 2ZUWA 2WSKA 1OSEA 3WH7A 3AHZA 1JF6A 1K9DA 2XSAA 4HMDA 1GONA 1UKQA 1K9EA 3ZSSA 1XRVA 1TVPA 4E8DA 5I0DA 1R7OA 4CD4A 2WVSA 4JHZA 2ZUNA 3SCPA 3WDHA 1V6WA 4ZXOA 3WH5A 3OGRA 4AZCB 2J4GA 3WQ5A 2B31A 3ZQ9A 4B9YA 1UG6A 4LYQA 1UKPA 2WHLA 4JFVA 4W88A 2WMHA 1C8QA 1FH7A 3EJUA 1OB0A 1XH0A 4LQ1A 1OIMA 1CIUA 3VSTA 1UR9A 5HOSA 3WD2A 2FHBA 4QLLA 4JL2A 4GZJA 1EDQA 4Z2GA 4CU8A 3WF4A 2MANA 1QBAA 4OBRA 2JF7A 4FNQA 3WIJA 4ATLA 3ZT6A 1FA2A 1GHRA 2J7GA 2DSZA 1UD2A 1JD9A 2WC7A 1F4HA 3GNPA 2J75A 2GUYA 2VX5A 2D0FA 3EJQA 5A6LA 4JZ5A 4NX0A 1ODUA 1CZ1A 3SCQA 2YL9A 1DWHM 1E4MM 5ABFB 1J0KA 4HOXA 1HVXA 1OGBA 1RD6A 3PZ9A 1KXVA 1W91A 2VZVA 1Q4NX 1QX1A 3DHUA 1E71M 3BAKA 1CXIA 3ZIZA 1UKOA 1A3HA 2RGLA 2J7BA 3L4ZA 2OW6A 2WW5A 4K68A 3WL1A 3MS8A 4AY1A 4AZIA 5D8ZA 1QVBA 2QPUA 4PBGA 1NARA 3WUBA 4J7RA 2WXDM 3AYSA 4MB1A 2Z1SA 1JZ8A 2XM1A 3MSDA 5HPCA 1CXLA 4HOZA 2X05A 3W27A 4UOQA 1ZJAA 3VO0A 3WFZA 3VPLA 4TVDA 5HNNA 1BHGA 3N12A 1H2JA 2Y8VA 5A2BA 4S3KA 1RH9A 3N1AA 4EAMA 5IDIA 3WF1A 1CWYA 1XC6A 1ISWA 1W32A 4PMOA 3GH4A 2YA1A 3AI0A 3L4VA 2PWDA 1LF1A 3K8LA 2PBGA 2IGTA 4MDPA 2OWXA 3OLDA 3BVUA 3DYMA 3W38A 1QNSA 3ARXA 2EPKX 1DP0A 3CZSA 3VM5A 1FFRA 3DECA 4S3JA 1UD6A 3GXIA 1H4PA 3ARZA 4GO8A 5A2CA 2XN0A 1HKIA 3PZQA 4NSBA 3CUHA 2XWEA 1G94A 4MAZA 4P8XA 2XVKA 1ZBCA 4CCDA 4Z2HA 1OT1A 3A21A 5I3DA 1UQZA 1IV8A 3W37A 3S6TA 3ARRA 1GPFA 1P6WA 1W3KA 3APGA 3LPPA 4AZBA 2XGIA 5E0FA 2J25A 1SR0A 1W9PA 4DO6A 1HIZA 3WELA 1XSIA 4J3UA 4J3VA 5BRQA 3ZO9A 3NYDA 2WVUA 1QOXA 1J9YA 4ACZA 3A6OA 5KEZA 1KXTA 3ZOAA 4W5ZA 2PBOA 1BYDA 1GVIA 4U3CA 4ZXLA 2YBUA 3DX2A 1EHAA 3T2OA 3WDIA 3VM7A 4QCFA 4HA4A 3QHMA 4Z2KA 3FW6A 4WIWA 4EKJA 1VFMA 2VZSA 1JI1A 4M8UA 1UH2A 2NT0A 1BVNP 1BGAA 4L4OA 3SCRA 1G5AA 1JAKA 4H8UA 5E70A 2VVNA 1NWSA 3AIVA 1GJUA 4F9JA 1H5VA 3EJTA 1E6NA 5FL0A 3N17A 4E4PA 1ISXA 4PMQA 1C90A 1TE1A 1WB0A 4UFHA 1NP0A 4UR9A 3VSUA 1EO5A 3RM4A 3GBEA 1XYZA 5BXRA 2BY2A 4DWSD 3CTTA 3WD0A 4AIOA 3AHTA 3CC1A 3SCVA 4PSPA 2OSYA 3W6MA 1CECA 2EACA 5KZ6A 3AMGA 4U3AA 5GNZA 4PUEA 1MYRA 1C8YA 3VVGA 3WDPP 2GDUA 4EE9A 3WDRA 4RL3A 3MANA 5JBFA 4HMCA 1QWNA 3DHPA 4F66A 3HG3A 1V6YA 3W82A 1KTBA 1NOWA 1OCQA 4BQ3A 2VOTA 4JHOA 4HPGA 2WVVA 3S5YA 3BLPX 4UFLA 3B9EA 2F7QA 2WK2A 2E4TA 3MUZ1 1XV8A 1WDQA 2ALWA 3ZJ7A 3IAPA 3RCNA 2CHNA 1HJQA 2WVTA 3WNKA 3EDFA 2BVYA 3FAXA 4C7GA 1JDAA 1KQYA 2A3EA 1WKYA 1RPKA 4NZJA 4ACYA 2DEPA 3LPGA 2WLZA 3FY1A 3A4AA 1HN1A 1QPKA 2DIEA 1W3HA 2IXVA 4D6HA 2XUCA 1NM9A 5BRPA 1JAEA 3AS3A 2DSWA 1C7SA 4GI6A 3VGGA 2C0HA 2QLYA 3WQVA 3W0KA 1KQZA 1UD3A 3IANA 4BQ4A 2DT3A 3ZJ6A 3F5KA 2DSVA 4CD8A 2ZICA 1BYBA 5CPTA 3MUAA 3VUPA 1QHZA 4AD5A 3K8MA 4AZGA 1UWUA 5FIPA 1BQCA 4JFTA 3NUKA 2AMGA 4M1RA 4UQAA 4XZBA 4AD1A 3WNOA 1HP4A 2DSUA 2F7PA 3HG5A 2VJXA 3VDHA 2ZUUA 4H8VA 1XHGA 2OYMA 1QNRA 5I77A 4TTGA 3UESA 1R7AA 1ITXA 4UTFA 5A69A 1BTCA 1OD0A 1CGXA 1WZMA 2J7CA 4QFUA 3B9DA 1J12A 1TA3A 3AICA 3BAIA 2WSPA 2C7FA 4W93A 2D1ZA 2DH3A 1XGZA 2ZX6A 4GZIA 2WHJA 4JKLA 2VX4A 4YHEA 4AD2A 1SYTA 3LPFA 6CGTA 1HX0A 4QLKA 3BLBA 3N11A 1CGUA 3BAWA 2VCAA 3WNLA 1TQUA 3D5HA 4PEEA 2GJXA 1MXGA 4PTVA 3CIVA 1E55A 1G9HA 5IXEA 4UFIA 1H11A 3OLIA 1JFHA 1OGSA 3AISA 2C8NA 1U33A 2CXGA 3PZMA 2VX7A 1V3IA 4YPJA 3SCTA 3MUIA 3VMPA 1ZBKA 1PZ3A 4H2CA 1TA3B 5C71A 3KEHA 5M17A 4PMDA 4X0NA 1BYCA 2JF6A 3VX0A 2W4XA 3GXDA 1H3GA 1AVAA 2UY4A 1E0WA 1PEZA 2J7DA 2F18A 1GOWA 1E4NA 3FAWA 4W8LA 1DTUA 3ZJKA 1MW3A 2CESA 2QV4A 1JYXA 3MKKA 3WD1A 4M80A 1O7DC 1QI0A 3U5UA 3RJXA 2ZX5A 3W24A 2BVTA 4M56A 3BMWA 4DO4A 2WNWA 3EDDA 3DDFA 1G1YA 1W1YA 4P7RA 4UFKA 3PZTA 3WBEA 3A47A 3QOKA 4PTXA 3GZAA 1E72M 4V27A 2VUYA 1K9TA 1EDGA 1V0KA 1I75A 5A2AA 5CSYA 3A4XA 3CUJA 1F4AA 5GQBA 2J47A 4MB5A 4EANA 3BUBA 5BWFA 1GJWA 4JAWA 4HU0A 1V02A 3SURA 2J7EA 1QW8A 2VRQA 2ZXQA 1FP9A 1TG7A 2YA0A 3WF0A 1V3LA 3KL3A 4P7NA 3LRLA 3BAJA 2A3AA 3CZGA 4HTYA 3ZM8A 3ARUA 3CZ8A 1SMDA 3D50A 1B9ZA 2ZX9A 2JEQA 4AW7A 1DEDA 4HA1A 2NW0A 1MQQA 4DM2A 5A8OA 2PWGA 3LX9A 1PX8A 2WAGA 2YFNA 3WH8A 2CBVA 1E5NA 3VOCA 1JZ5A 1E4LA 4IUGA 2CPUA 4J28A 4AD4A 8A3HA 4AD0A 1C93A 1UR0A 3CHEA 3WDQA 3VIFA 4CCCA 1HVQA 2X1IA 2WHKA 1DWIM 3ARVA 1H09A 1W9DM 3L4UA 1UR2A 2XTKA 1C91A 4U2ZA 1HL8A 2V3DA 1JI2A 1LQ0A 4MNLA 2GVYA 1UYQA 1MQPA 3T09A 2DQXA 3S2CA 1BYAA 4KRTA 3CZKA 4NI3A 1W1PA 1WCGA 4YN5A 1AQMA 1ODZA 3VINA 4RE4A 3VIMA 4CKQA 2X0YA 4BS0A 5ECUA 4A3HA 2J7HA 2VCCA 2YLAA 2D0GA 3VGBA 5I5RA 1H41A 1UOKA 1GQKA 3A5VA 3BUIA 4OOZA 3CGTA 4ZE4A 2JIEA 1EOKA 1UHVA 1UH4A 3AXXA 2O92A 3CHFA 4GKLA 3CO4A 5M5DA 4PMNA 1V6VA 4IPNB 1XD1A 4TTUA 2YL8A 3AXHA 2BS9A 4CU7A 2BHZA 1E6RA 4JFSA 3D3AA 4GIAA 3WEOA 4JKMA 4PSRA 2VRJA 1JL8A 2NSXA 2YDQA 3N9KA 4KGLA 4W8AA 4PCTA 1KR0A 1GHSA 2FGZA 1CPUA 3VSVA 1GQIA 4Z2IA 4AWEA 2ZUSA 3RPMA 1W1VA 2J77A 1B0IA 1VJSA 3AIRA 3NSNA 2XFFA 1D3CA 1I1WA 3LXAA 2HISA 1JDDA 1C7TA 4U33A 3VU2A 3VIHA 4B3LA 1PS3A 2ZE0A 2WANA 2EJ1A 2ZUVA 1UD4A 3IJ7A 1JFXA 2V3GA 3MMDA 3VDBA 1Q6FA 5A95A 2EPOA 4U2YA 1QHOA 3NJ3A 4D1IA 3AMCA 4DUXA 5EMYA 2J79A 2G8ZA 3UEQA 1NP2A 4JFWA 2ZOXA 3A3HA 2JE8A 2YDSA 2QMJA 3SCOA 3SCWA 2O9RA 1WP6A 1B3WA 3THDA 3M7SA 1CGVA 1GZJA 3QHOA 1I1XA 1WZLA 4F8XA 3WY1A 3MU7A 1TFVA 2W62A 4ZENA 2PWFA 3MV01 4M81A 2J78A 1J10A 4W7VA 5A6SA 3CH9A 1UR1A 3W53A 3BUDA 2A3BA 3DX0A 3OLGA 3OZPA 2OWCA 4Z2LA 2XFYA 4DO5A 1BGGA 1HTYA 3UR8A 4LX4A 1BSIA 3W6LA 4QP0A 1CLVA 1LLOA 1E6SM 1UWSA 4NXKA 2VURA 3KZSA 3AXIA 2XVGA 4OJYA 4DUWA 2G41A 4W7UA 3O2LA 1B3ZA 1QI2A 3WQ8A 5FD0A 1GQLA 1VBRA 3QOMA 1LG1A 2PB1A 5AC5A 2DT0A 5A8PA 3GXMA 4AZCA 4FNUA 3WMCA 2JALA 4A4AA 4LPCA 1WE5A 3PZNA 1L8NA 3EMZA 3BVWA 1WDSA 3BSHA 4WF7A 2X2HA 3F4VA 4ZE5A 4HA3A 5A8MA 2D3NA 3ZT5A 1KWKA 5DMYA 4JCLA 3CZEA 1T0OA 3WUFA 4CN1A 1J0ZA 3AYRA 1X1NA 1GOMA 4Q22A 3SUTA 3TTYA 2VT0A 5EFFA 1J0YA 5DF0A 2XIBA 1ZL1A 1IT0A 2WMIB 1JXJA 3A22A 5A94A 2BY3A 4JFUA 2X2JA 4HMEA 1FP8A 4W85A 4CVUA 1TMQA 1XSKA 4ZEPA 3AQUA 3WDJA 3WNPA 4LYRA 3OZOA 1UH3A 1KTCA 4MNJA 5DEZA 4NRSA 2XGBA 1XYFA 3EJRA 1U30A 3VMNA 1ECEA 1GNXA 3I3EA 2DIJA 3K8KA 3EJSA 1JD7A 1PJ9A 1E3ZA 2FYVA 4AMXA 4JKKA 4N42A 2V5DA 2F1AA 4WSKA 3N18A 3VIJA 2CYGA 5JBDA 1W1TA 3AJ7A 3CUIA 3DYOA 1QNPA 4FF5A 4JL1A 2YBTA 4AZHA 2V38A 1KFWA 3ZT7A 1SZNA 5C8BB 4WKAA 5FL1A 2DH2A 3L4WA 4W86A 3VIGA 3EBVA 3MMWA 2EABA 2IUZA 2XSBA 4UNIA 4DUVA 3TP4A 1VFFA 3VKKA 1L0PA 5AY7A 3CUFA 3GXFA 3TOPA 1QNOA 4QLJA 2FH6A 4CN6A 3HN3A 2EEXA 1E9LA 1CXEA 4FLRA 3HG2A 2VO5A 2D22A 1UWTA 3VIOA 1UWRA 3VD3A 2J7FA 4FK9A 2F7OA 4PMUA 2D20A 1H49A 1E43A 3K46A 2G3NA 4R5EA 4FNTA 4J3WA 4MB4A 1GW1A 5A3HA 4UOZA 3ZMRA 2J74A 2OLHA 1LWJA 5A6MA 1EOMA 4OBSA 1S46A 1ZJBA 4RE3A 4UFJA 1R34A 1BG4A 2F1BA 3GH5A 3D4ZA 3ARWA 3E1F1 5D4YA 4BF7A 1E70M 4UQDA 1US3A 3A23A 1X6LA 4W89A 3BVXA 1A47A 4V28A 1B2YA 2ZX7A 2CBJA 1VJZA 1J0HA 4U5KA 4CD7A 4MNMA 2WWDA 3KLKA 4XUYA 3M07A 3OBAA 4IPLA 5I24A 2OSWA 4CN4A 4WK9A 1DWGM 1AMYA 3AS1A 1V6UA 4D6IA 7CGTA 5A8NA 3LMYA 2PF0A 1JNEA 4NRRA 5A6JA 4UZSA 5CXPA 3KL5A 2GJXB 3TTSA 3WY3A 2CHOA 2FHCA 3FXYA 2E9BA 2X09A 1E0XA 3W28A 4HU8A 2J8GA 1EO7A 3SCNA 3PZIA 2YJQA 3AOFA 1WNOA 3RIKA 5IFTA 3O9NA 1J11A 3PZGA 3GM8A 3RDKA 4X9YA 2WHMA 1KGWA 2WZHA 4WJXA 1HXKA 5DFAA 2RGMA 1JYNA 1E5JA 1ZBWA 5ABHA 3WD3A 3EJPA 3ALGA 3W26A 3RMEA 4D1JA 3GXPA 1E15A 2W91A 3IAQA 1LG2A 3NIYA 4D6EA 1NOFA 2V5CA 4HZ7A 2PC8A 2QMKA 5BXTA 1MW1A 4J3TA 3WMSA 4TX8A 4M24A 3U7BA 5JIWA 3SUSA 3AZRA 2V3EA 4H7VA 1OWQA 3WUGA 5CG0A 2IXUA 1MWOA 4D6DA 2YOCA 1E6QM 3VD9A 2D23A 1VIWA 1MXDA 1GOKA 4UQBA 4A3YA 3UETA 1V02E 1K6AA 4E8CA 1MW2A 2BHUA 1J0IA 2WMGA 5LA0A 2YKKA 1UR8A 2GJRA 1FFQA 2FH8A 3WKZA 1VFOA 3BUPA 1ITCA 4WKHA 3RO8A 3U7VA 1QW9A 2VCBA 2X2IA 4C7FA 1Q6EA 1SFSA 4PYSA 3CZNA 3AFBA 1NWRA 1XCWA 3DDGA 3QR3A 1UQYA 1HJUA 1KBKA 3HMCA 2YL5A 4FNPA 5E9AA 4C7DA 1E73M 1KCLA 1HJSA 3H54A 1OINA 4P8UA 2VRKA 1OGGA 3MMUA 2WVVB 3W29A 2XWDA 2VVSA 4FNSA 3AHVA 4GO9A 2XVNA 4DWSA 1PX3A 2DT1A 1B3XA 4TVUA 2FE0A 2QPSA 5CPQA 3KL0A 2BVDA 1HXJA 6A3HA 1GOQA 1UKSA 1QBBA 1R46A 3PTQA 2OYKA 1NWTA 1CXHA 2W63A 1EA9C 3W25A 2CBUA 2A3HA 3WFLA 3A24A 3WENA 3ZR6A 2ZXAA 3T08A 5LYRA 1YHTA 3LPOA 3ARPA 2TAAA 3T2QA 2E40A 1M7XA 2OWWA 4AYGA 1V03A 2X0HA 4TXEA 4H04A 4UQ9A 3ARQA 1Z32X 4D6CA 1MFUA 1V3MA 2BXYA 3ECQA 1LL4A 4Q7NA 3BH4A 3OLEA 2JIWA 3VGHA 2DT2A 4URIA 1KGXA 1EGZA 1D2KA 3MO4A 1TQVA 5CJ5A 3BAYA 1JZ4A 8CGTA 1OM0A 9CGTA 1EDTA 2D24A 4PUDA 3QHNA 1LWHA 3UG4A 2FDMA 3ZR5A 4CD6A 2DDXA 3WH9A 4OGZA 7TAAA 3OA5A 4QCEA 2VX6A 2VL4A 4TOQA 1E3XA 2WZIA 5LA1A 3AIWA 4XZWA 3VD4A 1OT2A 2Y5EA 2A3CA 3AIEA 4AXNA 3GTNA 4AC1X 1W9UA 1KR1A 1CXFA 1V0NA 2Y24A 2Y4SA 3WEZA 4Z2JA 2XJ7A 4U31A 1TUXA 3KE0A 3TONA 3G6MA 4NZCA 4WLCA 1VRXA 4BZYA 3BCDA 3GH7A 1J0JA 3AMKA 4FLQA 3RJYA 1HJWA 3ARYA 3D4YA 3AS0A 1UKTA 2CERA 4AISA 1R75A 2WC3A 4EK7A 4MAVA 5HXMA 3CUGA 2DPEA 1V0MA 2XYLA 3CHDA 4F9DA 4PMRA 2E3ZA 4P8VA 1VAHA 2CKSA 1UA3A 2X2YA 1DWJM 2GDVA 3SIMA 2WKLA 4CD5A 3DX3A 3WUEA 1TQWA 2BY0A 4QDMA 5FCZA 1NWUA 5A6KA 3N15A 1HWWA 1W9VA 2WCAA 3D52A 5M3WA 3SEPA 1JZ2A 4GQRA 1HJXA 5JIPA 2WYSA 1VBUA 4B3KA 1HL9A 3AIUA 2O9TA 4U5IA 2EQDA 2VC9A 1KWGA 1H0IA 1E6XM 1XH2A 2VI0A 3UERA 2VQUA 1J01A 4FNRA 5HDRA 1JF5A 2WMJA 3RM9A 1GOIA 4ATWA 3MSGA 4DWSC 2ZXDA 1R8LA 5CQ1A 2EO7A 2EADA 2F2HA 2XVPA 2WC4A 3BVVA 4M29A 1W2VA 1E6ZA 2GSJA 4WSJA 4KRUA 3WQ4A 1BFNA 1ZBVA 2BY1A 4J3SA 1IZKA 1PIGA 4AEEA 3L4XA 2CIPA 2WBGA 3EDJA 5IHRA 3BAXA 5JUVA 3F5LA 1ISZA 2XN1A 3O6AA 3BSGA 1ZB5A 3GNRA 3WY2A 3HJEA 5EFDA 1E1EA 1QI3A 1Q6CA 1R47A 5DO8A 3S5ZA 5HPOA 4MTVA 7A3HA 5BCAA 2ZUMA 4D6FA 2F8QA 3BLKA 3VGEA 1JGIA 4W5UA 1C3FA 4XX6A 1M03A 3GBDA 4OOUA
chains in the Genus database with same CATH superfamily
1BM3H 5B38B 5E6IC 4MWAD 1R5VB 3UG5A 3RKPA 1R3TA 3ITOA 1A7NH 2Z9TA 1Q7MA 2DI9A 1XSJA 3O41B 3QCVL 1YX1A 4B15A 5KBDA 1BVZA 1JUKA 4RXGA 5F7UA 1RY7B 3H9SE 1RZPA 1PDZA 3BKMH 3BE7A 3S42A 1RZ8B 2FJKA 1P5UC 1QFOA 3BD4A 2XISA 1WKDA 2DYRB 1Y0EA 5ITBH 1FHDA 3HU7A 4M8VA 7XIMA 1S8DA 1F3WA 2V9QA 3NIFE 5KS9A 3EX2A 3LHPL 2DWTA 1TREA 4MDOA 3IJYB 3HG4A 4HDIA 2VDQB 1AJ0A 1U8CB 2ZSWB 1UC5A 1FGNH 1PBGA 3O16A 3AUVA 1OAJA 4LOFA 1CW2A 3RB7A 3O6KH 1Q72H 3IJ8A 4KJPC 5LCVH 4EZJA 3WKMH 2WNNA 4X99A 2HCVA 3OKKA 4A66A 1SDYA 3W2LA 4XE0A 2JJVA 2EVIA 2W9EH 4LBAA 1I2NA 5CBBA 5HYJE 1SOKA 4JZJB 1PTZA 1J79A 1RP8A 5CEZE 2YAMA 3AM8C 1Y7VA 3MRBA 4Z7VF 3C2VA 4X5QA 3FT0A 5SWZD 5D1XA 2DKUA 1QPXA 4PGEA 4M19A 4EF8A 4LP5A 5MENE 3TUUA 1K2DB 2BMBA 1O7AA 4I5UA 1NCAH 2ZZ1A 3GZ3A 2QPXA 4MIMA 1QJWA 4I5RA 2CJSA 5F96H 5T8IA 3ZDYF 4E9XA 1C8PA 3MNDA 1EAPB 1CENA 5I3JA 4BM7A 1OGTA 5DJYB 3WJJA 4FR1A 5T26A 1U2HA 1PIFA 3FF7A 4RBPK 5DJ2B 5I9QB 5TPWH 4ZMAT 5I6XB 1CDCA 5SWUA 4TQ8A 2VL5A 3CLEL 1JF1A 3IDYC 4MJ2A 5BS0A 3HPZA 2HWZL 1U8LA 4JJ5A 4HQVA 4TX6A 1IE4A 4AJYV 4DGYL 2NX5A 1UP2A 3RDTB 3T8XA 4OD3L 1S5WA 4GNVA 3MI3A 1BMZA 1UD8A 2GTWB 2RJHA 1BJ8A 2CDFA 3TNNB 3U7AA 4WUUA 3O6DA 2XUWA 4LGRB 2Q2EB 3IIOA 3KBWA 4RDZA 2Y5QA 3ZTJG 4EIUA 3EJZD 3LCYA 4Z6AT 3WKQA 3SJVB 1PZSA 3II1A 5F1IA 3TO4A 2EBNA 2LTQB 3C5ZD 4MX7B 3UPRB 1SRDA 3KJ6L 4HG4K 3CZFB 2OFQA 4RSVA 4BA0A 1OGTB 1SLWA 1LRQA 2PYEE 3WK0A 4NUMA 1BFVL 2KH2B 3HE6D 5I1HH 3RHWK 2VD8A 3F12B 4BH7A 3LRMA 2JKAA 2XPKA 2X9WA 1BZOA 1E7UA 3TCTA 5I1CL 1JQVA 4F2MA 3UZJA 4FMFA 2ICWB 1UB6B 1JGUL 3PXHA 1MUJA 1BECA 3QT2A 4P7QA 1A5UA 2JJUA 4BA8A 3ZKNC 1B31A 1P0SE 2O72A 1PDKB 4Q2ZB 3KTCA 3PDGA 1EH9A 1XCXA 2NNAB 1OFPA 1UM4H 4PJ7E 4GG8A 1FH8A 5I79A 2GJPA 1AZZC 4LALA 5DJZB 2DSKA 5E9DD 2PA6A 3JWNG 5IHUL 1PMYA 1EIBA 4FZ8L 5GZNA 1A5SA 1XH1A 2DWDB 2UZIL 1S7RA 3HNTH 2E0PA 4XBMA 1DQJB 5E4OA 2ZXBA 5BW7C 1MCWM 3LN5B 2YC1A 1AQHA 5FKAB 4NZFA 3C5QA 3F6IA 4C55A 4DZIA 1H7RA 3PL6B 4HJ0D 3GUGA 2NT1A 1WLHA 3QDGA 1D5XA 5F7BA 2OJPA 2GC4C 1EQWA 5I8EB 4BFKA 1W3JA 5AZ0A 2YHGA 3TWBA 3QEGL 2JIXB 4OZHA 25C8H 2VC6A 3LERA 4IP7A 1U93A 1MDRA 3H6AA 1G01A 3WJSA 3MXWL 4L4JA 5F4XA 3SE8H 1I9EA 3BZ5A 3Q13A 5D1QA 3CPLB 4NQEB 4PW4A 2VFEA 3IV3A 4O57A 1U91B 2C3WA 2F0CA 3EEGA 3RE0A 2FLIA 1DLHA 1PU0A 3QO1B 1YC8A 1GOOA 1S5IH 4DM1A 1JGVH 3IGAA 5BO1L 2DZWA 3FFCA 2P26A 4P5TA 2VP8A 3GDTA 3IIPA 3SY0A 1V08A 3SADA 3F00A 4HBCL 4A8RA 4N2GA 5IQOA 2R0ZH 3PIQA 4L8BB 4HUMB 2BMKB 4FG6D 4O02B 4XNQB 4ZUVB 4AYSA 4ZRGA 3B3IA 3GJEB 3LS5L 4O2CA 1H3VA 3AHYA 4JPGA 4XZUB 5I30H 5G2WA 4H26B 2EICA 4Z7WE 4XP9L 1X39A 3BHBB 3BD3A 5EO0B 1PZUB 5E6YA 5AYIA 3J7HA 2VENA 3NO3A 2AJ3A 2DQDH 3EB3A 3EZJB 5FV1L 1LORA 3QZNA 3H9SB 1YPZB 4E9QA 3R8RA 2LTQC 4H9VA 2NOYA 3PWPE 1P43A 4RZ4A 4JTUA 3GVRA 2YCIX 3PP3K 3UAAA 1CBGA 2VM9A 1P4BH 2J5WA 3MUHL 5FO8A 1S9WB 4PS4H 1RBAA 3F5JA 3TZFA 3N4EA 3MV7A 1DQTA 4P07A 1ZS2A 1RV6X 5JA8B 2HX7A 1YBQB 4GKOA 3E49A 3ZS4A 1NQKA 1DVFB 5DD1H 1O5DT 4BUGA 5DHYA 5KVMC 2ZUYA 5FO9B 2GIYA 2HBXA 3PZUA 4K9EL 4U1GC 2QKFA 4JUTA 4AGOA 1BAWA 1PG7H 3ZRFC 4TVPE 5M03A 2AL2B 5DK0B 3MLRL 1P7KB 1AH0A 1HP5A 4U4IA 3G1YA 4KO5A 2ZUTA 3OKNB 4Y8FA 1G9MC 5D70L 4NQED 4Z5RB 3DV4B 1US2A 4K9EH 1F8TL 1J9RA 4QYOA 4NZUH 5I9QC 4F2ME 4HBQA 3THMH 1NIBA 1NDWA 3D3VD 1C8XA 1O6IA 3HBLA 5AC4A 4KQ3H 5LO7A 3PQYB 2FX7H 2HMIC 4JTIA 4LVGA 3WLQA 2OAAA 5F96L 2WSRA 4UAOB 2R2EB 4E42B 3GIYA 3I3DA 3WTUA 1I3VA 3WS6C 1B4TA 2CO6B 4PGZA 1DORA 4K55A 2CR3A 5DVNA 3CEUA 5MEQA 1Q63A 2MFNA 2CLHA 2WLYA 3LKRB 4MJIB 1EEYB 4HJWA 4RK8A 3PABB 3JV5A 2P76A 1A3XA 3NCFB 4TPRH 1NIDA 3RVUD 4AENB 3N4AA 3WKYA 1UACH 2FX9H 2GT9B 3M17B 4BZ2A 2EPNA 2N56A 4UMAA 3V5FA 3OF6D 2PWVA 3HJ0A 1ES0A 3KX6A 4A29A 3UZWA 1XH3A 3DVGB 3MLUH 4YVXA 1OE3A 5DRXB 1GVFA 4OIIL 1XGYH 1F7BA 2J6EA 5DDHB 3BO8B 4GRMA 4MS8C 3QH3B 5EBAA 2DL2A 3LXCA 3P82A 3HPLB 4LVBA 5F44A 5FYJU 5IB3A 1ZGLB 1NDTA 4XQ6A 2WJZA 4BWTA 1RJYB 3BYYA 1IAIH 2B59A 4PP1C 4G2AA 2NV2A 4WSHA 4QS5A 3URBA 3MRIB 5HVHC 3CZJA 3K4DA 2IAND 3ABSA 4HGXA 4F1SA 2YR3A 4WNSA 5CGTA 4I9MA 5GJMA 3W0WE 2PF8A 2NYZA 2H3NB 3OPZL 1QFHA 5D9OA 4JDVB 3NAVA 3UGEA 2WO5A 4PS3A 4OLVL 4PCSA 4EDWH 2RJGA 1N12A 5HJYA 3DX1A 3H9ZA 4M4RB 4RZBA 3G6JB 2BNUB 4OTXL 3WNMA 4L9LA 4X7TB 4QXVA 1CEOA 3N5AA 4PH6A 1BWWA 5HVFB 2YD7A 3GS7A 8XIAA 2BCKB 1TZOA 3AS2A 3CFBA 3MYOA 1CYWA 3L6FB 4WI3A 2V2HA 4PN2A 4LF3A 4JTTA 3RX9A 1RQ5A 2R4RH 2L5HA 1XR9B 4M82A 4TSCH 5CGQA 4LEXL 5E6SB 3UWUA 1DYZA 3V4PB 1LO0L 1Q1PA 1XB8A 1BZ7B 4I1RA 3VFOA 2IPGA 4Q6YA 2EIEA 3AY2A 5JQHC 3NDZA 4Q6JA 3UT0A 1R17A 3C5ZA 4DO7A 2ZC8A 4U28A 4FFTA 5DJDA 2DGAA 2HT3D 4MS6A 1OYAA 3ZFHA 2H6RA 1EVUA 1DSFL 2E75C 3EMCA 5FOBB 3JTSB 2BXZA 4UWMA 3R5EA 4WDTA 2QQQA 1KJMA 4Y2DB 1A8ZA 4OLVH 2DQGH 4GUPB 3BXWA 2IV8A 3CK5A 1G7IA 3MP3A 3NPUA 3QW4B 5EKYA 4EIBA 3Q0HA 5HQEA 3U57A 1M57B 1UJ3B 2OSLA 3X1BA 3G0UA 3LM7A 3L2MA 1NH6A 2LLLA 4NXSA 1L0XA 4KRZA 2YK1H 3DG6A 4PMVA 4PWHA 4OQTH 1NDGB 3OW1A 3IARA 4LGXA 3PUCA 1E6JL 1BEXA 1FIEA 4HHWA 3FQ2A 4KRPD 1S78C 1YY8A 1WFTA 1KC7A 3FOKA 2A0LD 4UTKA 4NIKB 1UASA 3SQOH 1L6YA 4EXQA 3DXAB 1XF2B 1X96A 5CJOL 2WXNA 4WFED 5SWZA 3OG2A 3CIAA 4AZ6A 3BC9A 4K3EH 5EC2B 1ORQA 2BP8B 5KUMA 2CBIA 2Z64C 3DHDA 5MHSD 1BW8A 1NFDA 5AAMC 1HUVA 2A7NA 5HWMA 2AJUH 1SN0A 4M6PA 5CJXC 1G69A 1W8SA 2VR4A 2EPLX 1HT6A 4BFOA 4HUKB 4B5UA 1QI5A 2GY7B 1MWAL 5DD6B 2ICWA 4NBZB 3V5DA 3WLBA 3ZE0B 3LGGA 1KXQA 1WZAA 3R79A 5IVNA 1E4IA 2ZCGA 1WK0A 5CF3A 2VW6A 2W3ZA 2MCG1 3TK7A 3FQ4A 3RRQA 3VRJB 1BXVA 3D05A 3DGDA 1HCVA 2BOCA 2RKXA 3K1GA 3I3BA 2VRAA 4A7VA 1EA0A 2F7RA 3W3BA 4N1CA 2VLLA 3NQEA 2QCFA 1HINH 1MFCL 4I0PC 3UO1H 4MUZA 2J5LC 3W9EB 4CEXC 2AAAA 4XVSH 5C70A 1GVOA 1LO3L 4N0UE 1PD6A 1JXFA 2G4FA 1FWFC 2PDUA 3OGVA 2XN2A 5TGBA 1ILSA 1Q6OA 4CNOA 1YAIA 2EO9A 2ESVA 3FQ1A 1NM4A 4H8WL 1BQHG 3OKLA 4EDWL 4N8CH 3COOA 3FN0H 4PVLA 4WWKC 1PPIA 1E40A 1M05A 2H1XA 2OR8A 3THML 3VGFA 4WKZB 3IMSA 3GMLA 1I8MA 2O4MA 4GY7A 4RV3A 4XD6A 4K9EC 1M2VA 5IJDC 1LL7A 4R3SB 4M43H 1BDYA 4KGJA 1IAKA 4FI4A 3NQVA 3EG9A 5T3ZH 1DN2A 4EPBC 3IGUA 1O5RA 3DSFL 2IPTL 4ENEC 1HOEA 3H7BA 1ISYA 1V10A 2IANE 1EUTA 2Q2LA 3DMMD 3ILQD 4AQEA 4GRWE 4ETQA 2ZE3A 3MVTA 3QVQA 4HXBH 1AJ2A 3CYJA 3BRDA 2V37A 1F3EA 4RFOH 4D2NA 1WBXB 3TS8A 2HTMA 5BNKA 4QAWA 2WMKA 2CKBA 5D1XB 3U0WL 1JE6A 2IBZX 4D9LL 1O60A 4JRFA 2EEFA 4KWUA 5DJCB 1WBYA 4EUPA 1H6EA 2PGWA 2EILB 2A1YA 5E2VH 4PRRA 4ZW8A 4MDJB 1FH9A 4Y2NA 2DWXA 1Q0YL 2B1HL 2BDNL 2IDCA 2R0WL 3GHPA 3P9MB 4EQ3A 4OZIE 2ZX8A 4UBPC 4GI9A 4W84A 3GSWB 5TDOA 4ABQA 2JKXA 1WAAA 4YDKH 4CCEA 1IIGA 1V93A 1KZYA 1U58B 3THUA 3FN3A 1B0GB 2VDLB 4HFWB 3DUSB 3RFRA 3T1FB 5AKTA 1KN2L 4YTTA 1GH7A 3CPUA 3BWUC 2W92A 3AT0A 2IPUG 2J1ZA 2UXFA 5EV7A 3SYQA 4BHUI 5I73B 5K69A 2JFEX 3EYPA 1Q94B 4RDYA 4Z3JA 2J4WH 2ZOOA 1QAPA 4FB7A 1VACA 2PYEB 4JQAA 3EF7A 2NQCA 2XIIA 3VXQB 1MNZA 1OGAA 3GF8A 2NY6C 4YAQB 4EOWH 1VEPA 1DVFA 3B4NA 3NCYS 4AGQA 1CGTA 1QATA 4IOIA 3WLPA 2PNDA 5T1KA 5KINA 3WKNA 3MREA 3N2XA 2OZ0A 1W3NA 3RZCC 3CDZA 1EC7A 1THAA 1JJUA 4FYSA 4MSWA 4PJ5A 3VA8A 3DG3A 2BOBA 1G5GA 5C0CA 1SGJA 4P5TC 3X1GA 4L9YA 3VUSA 1V3KA 2QJNA 5BYWA 3LLDA 2NY5L 3FSOA 3VXMA 4IKIA 4L3ED 3ZE1B 3RPTA 5KYUB 3MV11 3QORB 5C9JB 2PDXA 4JJ5B 4NN7B 3MUGA 5DHVH 2GI0A 5F7WC 1MQRA 2PXYB 4WJ5A 2V0AA 1GGCL 3SGKA 4MXVF 2V5YA 3KM8A 4XVTL 2KQNA 3CVDA 4R26H 1ZHBA 1OXYA 1FH5H 5M94B 1F05A 1NCCH 5AB1A 4GIOA 4PS4L 1WKEA 2IKJA 1JMZA 1E4XI 1WUEA 3FO1B 4G6ML 4A8IA 2LU4A 4OKDA 4UT9L 4AE1A 2VB5A 3W2JA 3VNYA 3AMDA 3GBML 3PHAA 1VD6A 1W0VA 2Z31C 3CLWA 2HVKB 5CD5C 3K81A 4BK5A 1J5DA 2EXTA 4U6HA 3U2CA 3QMTA 4OIFA 1VF5C 3GDBA 2PCPA 3SDCC 1BTMA 1JGMA 3WKPA 3FCPA 3LBCA 3GHSA 4NPYA 4GPNA 1KB3A 2H2PD 3IJ6A 8XIMA 1ZP3A 3SCUA 3P3UA 4E9WA 1WO2A 2ZVIA 4F4RA 1BFVH 3T3PF 5C0BE 1DVSA 2WWNA 2PGFA 1URIA 3UXDA 3OB8A 3QS2A 4NQCB 1XQKA 3L3KB 1Q66A 2PF6A 4WK0B 5GXBB 3K2UH 1F6AB 4TUUA 5DURD 3OJMB 3OQ8A 1TR7A 3K80A 4PJGF 4PREA 4B9JA 5GGSB 4CVWA 3U4EB 3FSUA 3KVJA 1WOAA 4U10A 3CT7A 1F4YL 3K1DA 3DH7A 2H8PB 1KKRA 2F1EA 3ALWA 3KBPA 1EJTC 1MW0A 1KBJA 3TU9A 3WNJA 2PTDA 2K3TA 3BVTA 4MQ7B 3AIQA 1E8ZA 3VYPA 5LNVA 1RZKH 3LDBC 5HI3C 2BHYA 4JFQA 2R0WH 3CV2A 4HHHA 4ORZC 5CC6A 3MX0A 4N68A 4HJFA 2X4OB 2H0JA 2WBJB 2IWKA 1RZFL 4Y8DC 5XINA 3DC0A 3UYPA 2E8YA 2CHRA 4PGLA 2UZIH 3OC8A 4GFXA 4OGXH 3CAKA 3GG8A 2OZ4L 1BZ9B 3EOTH 4OCRL 3A67L 8PAZA 1UWXK 3THCA 5HGGS 1A7BA 3OB0H 5E09A 4L3CA 4N4QA 1TYJA 3PJSB 3WEAA 4ZQMA 4IHOA 4P7LA 5LIWX 3NCWA 1DLFH 1JGLH 3LN4A 4F93B 3N14A 4EWJA 3VVVA 4CNUA 2J3SA 4FFZA 5EB8A 2IOMA 2E5CA 4GD0A 2M1KA 1T2QH 1JV2A 4G8AC 3QUYD 5BZZA 4ZSTA 3H42H 4M43L 2GWGA 4R2GD 4YSQA 3NDOA 3SQLA 1MDLA 1BZDA 4V1DA 3PQYD 1T2JA 3GX9A 4XMPH 2QCDB 3OZYA 2FK9A 4PR4A 5SX5H 3WLJA 3F05A 5TFSH 1RXLA 4G9FB 5E9NA 3MUCA 3S96A 3QQ9C 1HILB 3FOLB 4JGJA 3DMMC 3ILQC 1MEWA 1FC1A 4U1JA 2R59A 5G4OA 4BUQA 4ML4A 3GB7B 4I9AA 3TJ4A 4WI0A 5D5MF 4AIUA 4UFMA 5F1NA 2FGBA 1PLGL 2Z4QB 5DA0B 2DQMA 3JW7A 2AERT 4I18C 4MMZB 4WU5B 2VAAB 1DBBH 5GIRB 1V0LA 3AALA 1YG9A 4MWAE 2YKLH 5JXAL 3GSXA 5F7EL 4YBLB 1YDVA 4J23A 3T1FA 3WO3B 3PPEA 1HG3A 4X5WA 4OWGA 3QZWB 5C0IA 3PS7A 2VC2B 3UTPE 4W9LC 1RD5A 1EDHA 1Z2KA 2WM0A 3HE7D 4PJFE 4JMXA 4XCFL 1Q6GA 2WBJD 1T5AA 4LNVA 3MI6A 5CFAA 3ENEA 3AHXA 3UTTA 1VFAA 4GXPA 3G5WA 3NJHA 2QDHA 2OPJA 1EFZA 3VH8G 2WSKA 4P2RB 4OGAC 4XX1E 3M1ZA 4MGGA 3L3KA 4OZFG 3ZYOA 3WH7A 3C2SA 2Z1WA 3AHZA 4I87A 3NEVA 3P4NB 2BODX 2ACUA 1MUMA 1K6WA 3A9BA 5HYSG 2QF7A 2FEDD 5DMLA 3GVQA 5J7CC 1OARH 4PCFA 4ZJ9A 3ICJA 1G7JA 4GSXA 3N42F 3QUMB 1XUZA 2R29H 1TVPA 5EBMB 5I0DA 1KIQB 4I48B 3LOTA 3ZHDA 4L8CB 4MY9A 5GGTA 2L7QA 3QZWA 3N50A 5C0IB 3TBSA 4ZXOA 2EUVA 4AEHH 3IJEB 4UYQA 2NTFA 1GWJA 1H7XA 4JNYA 4EMZA 3DVIA 3E6FA 3VE7A 1J1PL 2UXGA 3DKJA 4M1DL 4JOMA 4YHNA 3QQ0A 3PFQA 1XR8B 2O55A 1ZD6A 4NRZB 3BGJA 4LYQA 1BIIB 1JZHA 1LK3L 1XCTB 5AWNL 4FA6A 1JZEA 1FTXA 1UKPA 4WFGD 2D7PA 4FQQA 4JFVA 2UZXA 4W88A 3UPRA 1FH7A 1O5KA 3W74A 4Z42C 4JFDA 4PB4A 1TETH 1H8LA 1NANI 3UXFA 4F20A 2JMRA 3TNBA 4DJEC 4PLNC 3WD2A 2FHBA 2V2CA 1A21A 1BD2D 2G2RA 2DBJA 1JMXA 5JORA 4GZJA 1JGLL 1VRSA 4U3SB 4XMUA 3RWJB 3B0XA 4L6HA 3QUGA 1NIAA 5FJJA 3IRPX 2IS7A 1GC1C 4HJGA 3WF4A 2JB5H 1FDZA 4XZHA 1E2ZA 3MO7A 1TO5A 1FPTH 1L7TH 3G6JF 5CD3A 1A7OL 4DPQA 4BWLC 2HXAA 2EE0A 2VLKA 4D0BB 5CEZL 3WIJA 5C0BB 2DQUL 4HCLA 3UPWA 3W1PA 1KBLA 5DEGA 3LD8C 3H9SA 1OCCB 4GRWF 3O7UA 4L1WA 1R0MA 3QWOB 2A99A 4IWWA 4H5SA 3HS0A 1M1XB 1FFNB 3LDBB 1QKZH 3BWUF 1GZGA 2J24A 1AL8A 2DSZA 2FVMA 4KQNA 5HUPA 5I1JL 4YSDA 5LNUA 5AG9A 1JD9A 5K1VA 1PBYA 5ERWA 5TE4L 1SYSB 4HUVA 1L6SA 3OAUL 4YE0A 1X6UA 2NZ9C 1GJPA 3T07A 1YEHL 3KNBA 5MERB 3B7TA 3WOVA 1SJHA 2GUYA 3V4PH 4CILA 2DZBA 2INFA 2PDYA 3VJ6A 2YWZA 2OK0L 3PL6C 1SQ7A 2VX5A 4D3CL 2D0FA 3VOFA 4OUOA 4OZIF 1WAPA 1I9CB 1TSHA 5ICXA 2DBLH 2Z7UA 4FXFA 4BEIA 4WUIA 1OADA 4F7CA 4JZ5A 4BI6A 4U7SA 1CZ1A 4LB4A 1NEYA 2G4EA 3O6MH 1U91A 2ANUA 4YUEL 4IP4A 4V2CB 3QRGH 4NFBA 4S2SB 4HZAA 4ZPVB 5E2JA 3VYOA 3UJRA 1E4MM 1ZT7B 2A73B 1J0KA 4APQA 3HLKA 4HOXA 5GJTL 4EZKA 2GWNA 4PFHA 2ZWSA 1DVYA 4ODTL 2GYSA 4FI6A 4AQ1C 1TVDA 4JGNA 1I2OA 1B88A 1TJIH 3Q65A 1PCXA 2AJZB 4XBPB 4IICA 1P2CA 4WDIB 4OF0A 2DQTH 4L4VD 1CXIA 3FOMB 2Q6WA 3ZIZA 1EJFA 1DVZA 1UKOA 4AYFA 1KYOJ 3OZKA 4FO4A 4LS2A 4YWSA 5EBWA 5BS0E 3KYKH 3T2NL 2W9DL 4X4XB 1CLOL 4DWHA 3WUZA 2C9VA 5RUBA 2X87A 3L4ZA 2V5TA 4FJ6A 1JGEB 4K68A 4LNRB 5B4MD 3PP7A 1EZWA 3MBWA 1TMHA 2ZA3A 1HHHB 3W83A 1JWMB 2AZUA 4Q2ZA 5L88L 1URZA 2K78A 4XZ9A 4GAFB 2G50A 4O1CA 4F0RA 1KCVH 3GRIA 4IG2B 3IFOA 1A25A 3L9RA 4LOCA 3V4BA 3WUBA 2IQDA 2VLRD 4HPYH 5J1AA 5I1AB 3QNZB 4QKXB 3SRDA 4NO0B 1C5CH 3FUIA 3F7VB 4MA7H 3N19B 4OT7A 4MKNA 4Y5YA 2HPTA 4QRTB 4XN5A 2DN7A 1ADQH 3HZYB 4HIXH 5D6CA 5GGTH 4HOZA 2X05A 4DGUA 5JORB 2PKDA 3IGKA 4LESA 1XBRA 4P2AA 4XXWA 1LROA 1CS6A 3ISWA 2BVOB 2IG2L 5DD6A 4Q4PA 4RIRA 3RX3A 1ZJAA 5B80A 3B1TA 3P54A 3C2RA 2PO6B 5HNNA 1ET5A 1ZEAL 5ANME 3T4AC 1SSDA 3DI0A 3OVPA 4PUBL 4O5LL 4WY7H 1JWMA 3KAAA 5ENLA 5IG7A 1GGTA 3D6GA 3M1BA 1B5TA 3N12A 4B5XA 2Y8VA 2R1NA 1M6OA 4F8QA 1ZANH 1CFSB 4PJ7A 2EDJA 1X8CA 3T3PE 2BFVL 1FQ9C 4H4NA 4Y1TA 3TBVB 1KFJA 3WF1A 2AANA 4WX2A 5AUMB 2JCCF 3H3KA 1W6WA 1XC6A 3WSQH 4BQ6A 2P5WA 1DL3A 4DLMA 1IC4L 4G70B 4WDIA 1KIQA 4NN6B 3E38A 3TJEH 1M71A 5EB9A 1A4JB 2JELL 3AQZA 4AJVA 4PMOA 3TL5A 2CK0H 4BV1A 2WLJA 2YA1A 3GH4A 4Q7IA 4A3RA 5IGXH 3IUHA 1WBHA 3P67A 5C8JA 4MD5A 5E00A 4TUOA 4FQ1H 3UR2A 2YCEA 5J9PA 3QFGA 1D7KA 4TLKA 3S4SB 1WWCA 5D1QE 1RJZA 3FYPA 1T22B 2VLMD 3W38A 3TQVA 4M6AA 3U46A 3VM5A 4JAMA 1ZT7A 1AI1L 1A7RH 4LSUH 4NJHA 2H3XC 2GCYA 1XIGA 1E6JH 3OKYA 3LTSA 2FQDA 4ZPTA 3HA0A 3V5OA 3EOOA 5JU6A 6ALDA 2XWEA 5HHOE 3DJ9A 6FABL 5I8OH 4P8XA 2HE5A 5L6UA 4ONGL 3N29A 1NLBL 2QPDB 2IBZY 2YQ3A 1OT1A 3GTTA 3GSUB 4HUNB 4R4FL 1CICD 4IS6B 1VCVA 4YZFE 3MLTA 2YPVL 4CJ1A 3L48A 1T8XA 1P6WA 1DHPA 1W3KA 2NV1A 3N41F 1E4WL 1EPFA 5DFVD 1Y1DA 1MFAL 2ADIB 3LIZH 4JDZB 4TSAL 4D8PB 4QQUA 4AZ5A 4UM9A 3NGBB 3ZVIA 1PDKA 5J8LA 4LCWE 2B8OT 1IIHA 4Y16C 4C6NA 3UBGA 3P11H 1EHLL 3LS4L 4OLZL 3DFNA 5CAKA 1M1XA 5BZXA 2E9IA 3B43A 3FRPB 1B4RA 1BKHA 3Q2VA 5DWUH 1TV2A 1VJIA 3D0AA 3L3DB 3OKEA 1YNQA 4FX7A 3SGZA 2E67A 4J3VA 5BRQA 4DN3L 2X1TA 4Q7BA 3ITLA 5D04C 1PW3A 1S3KH 5CJBA 3MWCA 4RETB 2WVUA 3IBOA 4KH9A 3SJVD 2GGHA 2INZA 3PP4H 3WFEH 1NGPH 3FCTA 4PY8J 5IQ9B 5HDOA 2DM4A 2WWKO 3A6OA 5FGBC 3GR7A 3PJTA 4EACA 3NFSL 1H5BA 2CRMA 2WQVA 5KAQG 1BYDA 3HZYA 1GVIA 3DRTA 3MLVH 2XIJA 2DJMA 1ZLDA 2DQFB 4J3OH 4Y88A 3M64A 4NIYE 4PV9A 4E2BA 5GSRA 3VXSE 3NSNA 4QRRB 4IJBA 4A6YL 3H23A 1EHAA 5GGRY 2VELA 2IO5A 1CL7H 4UV7H 3O3DB 1H3PH 2VDKB 3N42B 5CEZD 2XNAA 4HLZH 5EZIH 2VWEE 3VB9A 3WDIA 4P57A 3VM7A 2CCVA 3AREA 1R5YA 3GNXA 3DI2B 3WUWA 4Z2KA 4EPSA 3QI9D 3VFVB 3BO8A 1SHSA 1REIA 2VZSA 2MQCA 1GYWA 4PVNA 4W9ZA 3BWZA 1FDLH 1NBZA 5G5IA 1H0DA 4X8JB 4Y2DC 4FAAB 4AYFB 3QF0A 3LA4A 1MY5A 4H0GA 3L5JA 4JPKL 4IHCA 3EJCA 3RNKA 4LU0A 1FORH 3AGWA 3QORD 4QJ5B 4K7VA 1FAKT 1NAKL 4HV8B 5CIPA 4Z76A 3HOGA 5ABAA 5PCYA 4JTFA 4YGVB 1UXMA 3DUSA 4JKWA 3K4ZA 4UU9A 3N40F 3MKCA 4RNFA 4FIRA 4LSDA 3RI5K 4AKPA 2VVNA 3SFKA 4BKNA 4EF9A 5EU4A 1GCFA 1FWTA 2C4FU 3CX2A 5IM7B 3MLZL 2WZ6A 4D9QE 4Z7NE 4JG0H 3FNKA 2RHGA 4A37A 4JTGA 4DXVA 2DORA 4PRHA 4N9GA 2X53A 1CWVA 1F1AA 1QOKA 3EJTA 5FL0A 2EP6A 3AY4C 3VWJA 1R0AL 4I6VA 4E4PA 3BDYL 1VS1A 2XWTA 2OXGA 4UFHA 3ETTA 1NP0A 3TX9A 3WHE1 2WUCL 4PGDB 2PLKA 4QF1B 3RM4A 5KZDA 5L8LB 3RZCA 3DEQA 5J4MA 2JK5B 3QHFL 2YD2A 4EIVA 3O6KL 5BXRA 5MEPA 4I9WD 1AHWC 2YAFA 4IRJB 2VIRA 2OL3B 4Z76B 1RUKH 1XR9A 2QPFA 3HI5H 3AHTA 3QIBA 4XPBL 2WZPD 4XN8A 3CC1A 5ALCL 3L7EB 4Z3HA 5EEVA 4PC8A 4GQPH 1FVPA 4QGCA 2JVUA 2XETA 4Q56A 1O1HA 4PP2B 3W6MA 2EACA 4RAVA 3L08A 4X8CA 4IU2A 4IQDA 3DK0A 3DURA 1X4YA 4FG0A 5CCJA 1TO3A 5GNZA 1MRDL 1VLIA 4LNCA 2CQVA 1FL6A 3VVGA 1DBBL 1HAWA 3WO4B 3UAJA 3KBVA 1T5KA 4WRHA 2WQ8A 4EE9A 4PRBA 3NJNA 3ARDC 1KYAA 2X9ZA 4CNIB 1IVTA 2RAMA 4WRLA 2IXQA 1SFHA 3MANA 5JBFA 1IBGH 1A3WA 1QWNA 1KFKA 1FNFA 5LXEA 1JVNA 3HG3A 1AS8A 4R90L 3LZFH 2GGEA 4ZMXA 1SJMA 4ORGB 1LP6A 4C4UA 1N68A 1HCZA 2ROXA 2NVCA 4MRBA 4NQEE 3UX9B 1OM9A 1PG7W 1NOWA 4JY6A 3BN9C 4JHOA 3OTTA 3QULB 5FUZH 2MQ0A 3NZHH 1OYBA 1I7RA 2HH0L 2WVVA 2PWUA 1J1XH 3A0OA 4KRLB 3B5HA 4N5UA 3I68A 2QJDA 3E0IA 4A7GF 3OKDA 4G8IA 4X2RA 1G7PB 3MPCA 4OLEA 3D08A 2E4TA 4OQTA 1REQA 1XV8A 3NFNB 4PLJD 5EC2A 5HGHB 5ITFB 3ZU8A 3LBMA 1KIRB 3U6RA 2GZXA 3QUYB 4WXYA 3EKGA 3BH8B 3MRNB 3MRBB 3IAPA 3TNOA 1MCCA 2CHNA 1GHFH 2WVTA 3SD2A 3WNKA 1HJQA 3ROLA 1KN4L 5FW6A 3BCJA 4ISVA 2CLMA 2DMBA 1J5HA 1AH4A 4DIAA 4C7GA 3ERXA 1WTLA 3EOTL 4JDZA 5M7QA 2QVMA 2V7NA 3S8WA 4RDQG 1WISA 1KELH 3VRLE 1R6WA 4S3BA 1IHIA 5E99H 3F5WB 5F7FA 3LPGA 2WLZA 4ETYA 3GHBH 3A4AA 2W95A 2BS71 1XGPB 3QKEA 1QPKA 1AGCA 3MLPA 4X6CE 5D2NB 4GW1A 4F0KA 3NEXA 1XIWD 1R24B 3TA3B 1U1UA 2MKWA 4NKIL 1KJVA 2DYPD 2WXOA 1JTTA 1NM9A 4F3FA 3I2CL 1AA1B 1JAEA 1W5MA 4F8PA 1VFAB 4FXGC 1FVEB 5K1NA 4ZMGA 1ZGLP 3STPA 3W6LA 1C7SA 2R8WA 4P2RA 5DMNA 5IV2A 3LG3A 1QTWA 4OECA 1QFEA 1COBA 3G0SA 3V0TA 2K70A 4KV5F 1A4KB 1IFHH 4YO0B 4PL1A 3U4AA 1IT8A 3KR3L 3UGXA 3S46A 3QPQD 1T20B 2FT8A 1N18A 3DPDA 4X6BB 2NY6D 1KQZA 4QPEA 4ZMTA 2Y6ZA 4LH8A 2DT3A 3RLUA 1II4E 3V95A 3MU3A 3F5KA 1ERNA 1SUHA 5K39B 4CD8A 1E8YA 4IIQC 3A4JA 3L2IA 3RGTA 5IBTL 5IG7B 2ZICA 1K3UA 3C6SB 3VI3B 5FW7A 5D7JD 3S3JA 2DL9A 3KS6A 4IOFD 1TJPA 1MF2H 2X7WA 5IFHH 1YDPB 4HA0A 4AZGA 1TB3A 4RMSA 3RIFF 2H6OA 5FHBL 3L68A 4G7FA 4BK4A 4Z08A 3RMJA 1XG3A 4YCPA 4HPYL 1NCNA 4N9CA 5JLZA 1XXXA 1WOBA 1WZ1H 4M5SA 3S6OA 3T9WA 1O75A 5DHVB 4ELMA 1RV8A 5HGBB 1AAJA 2G3XA 4RWYL 1NMCC 2F7PA 2VJXA 4W9HC 5HDLA 2MCMA 3V4VB 3JUYA 1LILA 2ZUUA 4H8VA 4IQHA 1XHGA 3MXVH 1SDDA 4N2DA 4M5ZL 1YRRA 4M6VA 5I77A 2VE6B 4CMHC 4ILSA 3K72B 1G7UA 2VFDA 3KBMA 1INDL 4GVIA 3T0WA 3TTEA 3E2HC 4X0KA 5LHDA 1AH3A 5DYOB 2J8TA 4GG6B 3QWQB 5GGQL 1R6VA 3EXTA 1ELSA 2FPTA 3TH2T 3LK6A 1Q94A 3B9DA 4TQHA 1U9KA 3T0XA 3HURA 2Z1VA 1QRNB 1IUZA 4ODUB 3FK3A 1ZHAA 3MA8A 1OP3K 2HVNA 3EEZA 4H2HA 4FQXA 5GGVH 2WSPA 2C7FA 2R39A 4OD3H 4LUSB 5LIXX 1ITQA 3QO1A 5GGQH 1IAIL 4MXWL 3RZCB 3FT3A 4ANXA 3O6LL 3FH7A 2PP1A 2XZ7A 4K37A 4DNLA 4KK9C 2ZBTA 4CC4A 1ROWA 4Z7VE 2QGYA 1TVHB 4FQIL 2VX4A 2Y61A 3PC0A 4LRIC 1SYTA 1PL3A 2VN4A 4I48A 5MHSE 2G60H 3R0NA 4O51A 4RGMB 1J6OA 3OAWA 1HX0A 4QLKA 2LVEA 4IYKA 4G7SB 1TF4A 3EYVA 4WCYH 4X7EC 2YSSA 5KG9B 3EWBX 3KXFD 5LBSL 5F2MA 3QY7A 1YEHH 3S48A 1MFBH 1YNKH 3E5BA 3X14B 1RLCL 1TQUA 4JMNA 4P2YA 1S7VB 4HGWB 4CEUC 1FGVH 4BH8B 1PZ5A 3GD1C 2RTTA 1CVRA 4RMTA 4D0DB 2XDFA 3CFJA 1N9PA 4LUSA 1MXGA 3ZKSD 4PTVA 4W9KC 1NDVA 2OCFD 4WFHD 2YAOA 4E9SA 3CIVA 2YD4A 3RY4A 1BKSA 2P8BA 3CSTA 1UBSA 3GDMA 5IXEA 1R3JA 3T4AA 3QQNA 4ZSOA 5DSCB 1F73A 4YNGA 1A14H 1BFOA 1IAKB 3IM1A 2YS4A 4FL4C 1BFSA 1ID5I 4YEEA 2KDGA 5EF0A 3AISA 3ARFD 4GRLC 5C3LD 5L6YL 4EPEC 1R5VA 4KUZL 4BR1A 1KLUB 4FS0A 2FBOJ 2VX7A 2UY7B 3F7RA 5TK4A 1VGEH 2LT9A 2VLKB 3MUIA 4LTSA 3VOJA 1O6TA 1TRDA 4PUUA 1PZ3A 2M2DA 1ZJHA 2XFWA 3WBXA 4O4YH 4R9OA 4H2CA 5CLZA 3QUZC 3UVAA 2D8KA 3AG4B 3OHXB 1I3RB 5C07A 4KJYB 1AD9B 4M93C 4NNPL 4ERGA 2KLTA 3DETC 4N24A 4B3ZA 1G84A 2IQAA 5HHMB 1XF4A 1UEMA 3VFTB 4EZMA 4CMHB 5I1AA 1E0WA 2UY4A 2XWRA 1ETZB 5D2NC 5CAHA 3M7FB 4W8LA 4XPBH 2E68A 5ESQA 1N7MH 3F85A 2ZYFA 2I60H 1JYXA 2EIZA 4HVBA 5C08D 4ZTPH 5IZ7A 4N6RB 3W02A 1QI0A 4FS9A 3CDYA 3HV9A 3L3GA 2DMGA 4GCXA 4ZFOL 4C65A 1MZZA 1A6WL 3ABQA 1SVBA 2KQMA 1KCWA 4IGNA 2KPWA 4S2BA 1KPUB 4AIZA 5F6HJ 1PXGA 3BMWA 2PYEA 2WNWA 3U0TA 2EF9A 3DDFA 3LKPA 4APQC 1WUFA 4P7RA 1BZ9A 4Z7NF 1UZ6F 4LSRH 4YAQA 1ZY9A 1AQDB 3BJSA 3PZTA 2JF7A 4AWUA 4DEUA 1UATA 4Q6KA 1YY8B 4OZFH 5H4YA 4XD5A 4OJFL 2NLIA 4ZMZA 1DR9A 1FGNL 4FYQA 4QEGA 4JN2B 1ND0A 1V0KA 3NWRA 5ESQB 1P7BA 1L9MA 1I75A 3PDOB 3A4XA 1NSNH 3MO1A 3SGJC 3CUJA 1FWNA 3STGA 3IVSA 2GSGB 2FEDC 4G7EA 4YEFA 3QPXL 2FECI 2X38A 2ZWNA 4MB5A 4XX1G 1ITBB 3NA9L 4ZXBA 1F3RB 1ZV2A 2YXWA 4OFYD 5DUPH 4NNXA 1NTDA 1CDHA 5C09A 4N26A 2JGYA 4PCPA 3TJLA 1A3ZA 3VG0H 2J7EA 3L3JB 3B2UC 1XL6A 1QW8A 1S3TC 3HUJB 3BGFC 2TODA 2VRQA 2ZXQA 1EFXA 5EBUA 5L9FA 3GLZA 1BOGB 1A6AB 2A9NL 4I18B 4MMZC 2IQ9L 5DZJA 4MJ5B 4FD0A 4K5MA 5IB5B 4C56B 5JQ6L 1P0EA 1JHKL 1T21B 3M6YA 3QZMA 1D9KC 4A2FA 4ZOAA 4L3EE 1U22A 3MXVL 4GQ0A 2FEEL 2LW3A 5L8KB 3HLAB 4JY6B 3LRLA 3L6FA 1TWWA 2A3AA 4BIKA 1KY6A 3JWDH 4BXSV 3L5IA 4HZLB 1AW5A 3ZM8A 4GJ1A 5EOCL 3ARUA 1X5MA 4X9SA 2B7QA 2FT7A 2GUOB 3ZL4H 1O0VA 4GUHA 3OGCA 3KCPB 2G0KA 1XF0A 1RQBA 2K0RA 4GMEA 2JEQA 2AQNA 2PLJA 5KN5A 1BJ1J 1K4CA 1BCIA 2QR0A 2XFXA 3GSOB 3KPPA 4JQIL 5GZNC 4AXKA 4JTJA 3XINA 4LT9A 2V67A 1JNJA 3QEQA 4DM2A 3AQDA 3EIFA 4M3HA 1XF4B 3VFTA 3HOJA 1QQDB 1KY7A 4O2FA 5GNXA 2DLEA 3DGBA 5BO1H 1UOVA 3TA3C 2XKUA 5B3NA 2VOMA 4JANA 3CXDL 2QFPA 2WAGA 4JPWH 4BFAA 2A9NH 3UAJC 3OVRA 1IM3B 4RAUB 1FWAC 4DWDA 2E47A 3B06A 2CBVA 5KYYB 3IMTA 2YD8A 4DVRH 3IJEA 2C7UB 1NELA 2CHZA 3TBWB 3NQAA 5D1QC 6REQB 2A6KB 3LHVA 2Q76B 4YYCA 1IGCH 4LSBA 1G9NC 2CPUA 3L9YA 1KENH 3LKSA 4HT1L 3UIYA 2FIQA 1OAYL 4NAQA 4TNGA 5DUPL 1IYXA 1FCCA 2Q3XA 5JW3L 2WHKA 3WN5C 5F1SA 3HHRB 3CBWA 2AV7A 1G6RB 1LHZA 1A6AA 2L0DA 3FT4B 5BOZG 5JUEH 4WJKB 3SZ6A 1YXYA 1JOIA 2AJZA 3HNTL 4XBPA 2RB8A 1RR2A 5JHLL 4IBTA 4DEPC 1VDGA 3FOMA 2PSNA 2UWEF 3QUZB 5DUBB 4BYHA 3MLUL 5ESAA 4QKTA 3F4DA 5CC5A 2CO6A 4WI5A 1K7XA 3TDFA 5PTDA 5I15H 3FU0A 3Q3GB 5D71L 2JKEA 1W80A 4MJJA 3BZGA 5MKGB 3PAVA 4WW1B 3LIUA 4MA3A 2CG9X 4KX7A 5IVOA 5T1MB 1BYAA 3TNMB 4OCXH 3SDYH 4GBUA 3T4WA 2IWEA 1NCUA 3FQRB 4I2XE 4PRNA 3QRHA 2EKSA 5AKQA 4NI3A 4ZFOA 4J3OF 5I6NA 1W1PA 1WCGA 2EE3A 5IHZB 3K0WA 2X2UA 5KSAA 3HM7A 3VINA 1EL3A 1P4IL 3PG8A 1JK8B 4M4PA 4CKQA 3M47A 1QSFB 3OPUA 3S83A 1RK6A 3MA7B 4BS0A 1D5MA 1FLRL 3FTVA 5CR1A 5LGKA 1FYTE 3F12A 2OMTA 3FMGH 5I5RA 1SJHB 1GAFL 3DETD 3Q8AA 1H41A 1R3RA 2YO3A 3ORJA 4L3FA 3BV4A 4C6EA 1DIEA 4ASTA 1M2VB 4ONGH 4KOBA 2PD9A 3CGTA 3QZWG 4K94C 4W9TA 2R69A 3GMLB 4MX7A 3TT1L 4LLUB 1L9SA 1UH4A 4RGNE 5EFIB 2JIEA 1W2KT 2A6KA 3CHFA 3GNPA 3NQDA 1IGML 1LL1A 1RPUA 4PMNA 3UR5A 4HKZA 4X9HA 1AGBB 2BNRB 3L7FB 5DR5H 4ALAC 5I71B 4IPNB 4TTUA 5E56A 4FPSA 4ZZFA 1G43A 1NGQL 2RQ8A 2XTJD 2YAPA 3JQOB 2AEQH 1OLLA 1TENA 3QJVB 1RUQH 1KCUH 2LLEA 1OZTG 1D5ZA 2CLVB 2FUQA 5ALCH 1YXCA 2IEPA 1JL8A 2GIMA 3E1ZA 2Z6FA 3HI5L 5TQ2H 1DCEA 4LS1A 4JDTH 2MOQA 1YTEA 3GFZA 3BSZH 2E3VA 2DV0A 4J5VA 3FS2A 3CIWA 3MYJA 5DJ6B 2OQHA 2PLMA 2TMDA 4DZBB 3W71A 5EMJA 3G5VB 4A8NA 5ESVB 3CQPA 2FD6H 3MV8D 1T1XA 2PTYA 4RPPA 1GQIA 4ODXB 3ZE2E 1CG9A 2QGCA 4Z2IA 1NJJA 3ZDXF 3DBXA 1TV5A 1HKLH 3K6IA 2CM5A 4NRZA 2VQ1B 2Y5TB 3V8OA 4N8VA 3RPMA 1XH3B 3PLYA 1U58A 3MJ9A 2IPJA 4PJCF 2J77A 4PJDB 1F3XA 4TIMA 4QTGA 1LXMA 3RWCB 4YHZL 3OJDB 1VJSA 1S5TA 3W7RA 2I85A 1JV5A 2AJYH 5ELIA 2NZ9D 3P74A 1JNHA 4ADGA 5FGRA 2IQ0A 1DQDL 5AVTB 4JTCA 3CIQA 2HISA 4ZNEA 2ZAHA 3PL6D 5GS1A 2AJSH 4WHDA 4FKHA 1CDBA 1JDDA 1C7TA 4IDLA 3KGTA 6XIMA 1X7TA 3PWGA 1VADB 1H62A 2OSLB 3F83A 4JFEB 5JHBA 3T8MA 2HG0A 3O0RL 1P0DA 4G1EB 3NNTA 3SDDB 2XXCB 1IFGA 2HZHA 2NY7L 2V7NB 3V0WH 5JPNC 3MBED 2ZUVA 1UD4A 5KSWA 1VBGA 3LTYA 4ZZKA 1JFXA 3VDBA 1MDAA 2V3GA 3MMDA 4YHPB 3P0VH 5A95A 3BT2H 2EPOA 4JTRA 3S1GA 2V9DA 1QHOA 3JV6A 3LQMA 4FEIA 4FEMA 4PJDA 1T6BX 4XAKD 3MBEB 1KBGH 3NVQA 1UZ8A 2YXXA 4D1IA 1IL1B 2VDML 4NC1C 4B97A 3DU0A 3TYDA 3LRHA 2OMYB 2E5DA 1JPTL 5DK2B 4FTVE 1ZV5A 1VZHA 3C87A 2TRHA 5MERA 1P4IH 1HCFX 3ULVD 1OJXA 4JQIH 2PP7A 5T5FH 4U1JB 2VFFA 4DF2A 1E50A 1FV1A 1WP6A 3RFZB 1F6YA 5I3FA 1EO8H 3M7SA 2WV3A 5DJ8A 5CPOA 3ITVA 5IB4B 5K7JA 3KDMA 1XLAA 1W8OA 2VITB 1XIWB 2O1AA 1R3KA 3TA3D 2B2XH 5DHDA 4HK5A 1K8XA 4FXLA 3RZCD 1GKEA 3JWOL 4ZTOH 4XHJC 4U6VL 3VFGH 2BOCB 3L7RA 4I9TA 1FWCC 2J8UB 5KVGH 3LSOA 3SDXB 2QEZA 3HRZA 3MU7A 3DUHA 4F8XA 5I1CH 3GKZA 1AXTH 4CC4C 3N1MC 3MV01 1YECH 3QXAA 1DJZA 2MEJB 1KLGA 1Q13A 1ADWA 4X5PA 4M81A 2HFFB 4F37F 1FL6B 1O94A 5LNRA 4W7VA 1E27B 2UZ9A 4TVPL 3IRSA 3SN0A 2J72A 3BUDA 2A3BA 3IJQA 3FB7A 4QE5A 2Q86A 1ORSB 2Y06H 4GKZA 4LSSH 2PDWA 3PBYA 4O15A 3CUZA 5GISH 1JCKA 5I8CB 2OK0H 3NH7L 3EYUH 4IIHA 1BWVA 2AQ3A 5HNTA 4UTBL 3ES7A 2ZNWA 3MLTB 1CLVA 2R69H 4IGBD 1LLOA 3L21A 1DQQA 4GQBA 1IBHA 3I50L 1DJQA 1GKPA 2XIMA 4OJYA 4DUWA 1AH1A 2G41A 2GJ6E 4L8SB 4QXUH 3O2LA 3RBGA 3IMWA 3L3JA 4C6IA 3TVAA 1A4BA 4LSUL 1VBRA 4IIBA 3VXRA 1GS8A 4HJTA 1GGBL 5DRXA 5I17A 2FBJH 2YMTA 5AC5A 3FZUC 1QSFA 3O1NA 4Y1AD 4FNUA 2I32A 1DSFH 1WICA 5F89B 3WTYA 1I8UA 4OM0L 1JUFB 1KTRL 1I1AA 3V0VA 1LD9A 5IVXB 1T1ZB 5IV2B 3KS5A 3BE1H 4NL1A 1ED3A 5F3HB 1ODAA 2NZLA 3QPYA 3FQUA 5I8CA 3EMZA 4OLYH 3BVWA 3IUDA 2D4FA 5DLML 4RFEA 4Q4EA 1WDSA 2MIZA 3CH1A 4HCGA 1MAMH 3ILEA 4JPSA 4E41A 3QEQD 2V5MA 4K3JH 4IRJC 4NBXB 3CNYA 2LOEA 4JN7A 3RFAA 4WR3A 4CQ9A 3BLFA 1CFNB 3QRLA 4LSQH 1T83C 2D3NA 2BNRE 3SI9A 2CDGB 3EOUA 3MJ9H 3CZEA 3LHWA 4JKPL 4JM2C 3PPFA 4CN1A 2A74C 2ARWA 2CLKA 1YEEL 2DRUA 1SLVA 3AG1B 1EVTC 1GOMA 4S1QH 3B04A 1YPFA 2X3CA 3NL6A 2FPYA 2BSDA 2DFAA 4HNVA 2G97A 2BVPA 3Q1EA 5KS9F 3BP5A 5I1GH 1BIHA 3GZQA 5DHEA 2Y5SA 1UWXH 1RIVH 2ZXEB 2DZSA 3ASWA 3ARDB 3B4UA 4ZMVA 1CICC 3GMMA 4UM9D 1IM3A 2A9AA 3KWWB 4DBDA 2AGJL 2HFEB 2WMIB 4UNVA 4KO6A 5I8OL 2YZRA 3ZTNH 3ARDD 1KJ2L 1QLEL 1UA6L 2BY3A 2LLNA 2ZG3A 3EOYG 4FFYA 5DQ9B 3S37H 3U9WA 3VXSA 3GS0A 5FLUA 1H9DA 1FP8A 1KEMH 5AYTA 1EJ8A 3NIDB 3KCWA 3K4WA 1SMOA 1XSKA 3U46B 1H5YA 3KPOA 3Q4DA 1KC5L 5D2YA 4HH8A 4URKA 2HPOA 3E8UH 1UH3A 4KQ0A 1FYHB 4QLRA 3RQ3A 3VXUA 2DU2A 4PUNA 4Z1DA 3STZB 5DEZA 3GMNA 4WO4D 2DOCA 2HFFA 5C0CE 3RWDB 1NUGA 3IGXA 4MNJA 3KLSA 4G1MB 3FQYA 4PJEF 3C75A 1XYFA 2XGBA 5IUCA 4G6KH 1U30A 3T2NH 3VMNA 1ECEA 3PJWA 1AHWB 1NKRA 3I3EA 3WFBH 2VM8A 2BSTB 3EJSA 2NQ5A 1PJ9A 1E3ZA 3U2IA 3GU2A 4AMXA 2Y36H 3W86A 1KJ2B 2F1AA 4Y9NA 3ORWA 4YC2B 4KFMA 5FV2A 3CHPA 2DZTA 3CUIA 3CAFA 4PJGE 3PWUA 4TQEL 2YX0A 1UZDA 4JL1A 1N2VA 3CB8A 3DXIA 1ZANL 4F27A 4WOQA 2V38A 1KFWA 3ZT7A 1CQYA 1KFLA 3UYPB 4KVCL 1M6UA 3LN9A 1JK8A 3L4WA 4W86A 3P69A 3QNYB 3EBVA 4YHNB 3QEHB 2XSBA 2CW6A 1BXAA 2ZYSA 1UJTA 3W2DL 3DBSA 1GG1A 4DVBB 4DUVA 1XIBA 3TP4A 3R1ZA 4JRXD 2J8UE 3L65A 1K4DA 2EVHA 3QXDB 2ZDRA 2Y0FA 5D70H 1L0PA 4WNJA 1EZUA 2H8PA 4PJ9D 1LZOA 3APTA 3MV8A 1H3UA 3B2DC 2NX3A 3SUUA 3MRQB 4KF1A 2VLRB 3EHBB 4QHMB 4CN6A 1UOLA 2QDEA 3T0TA 3SY8A 3QNZA 5SWQA 2EEXA 4AKQA 3V4PA 1DLFL 3C6EA 1K5WA 1W8GA 2LR4A 2Y23A 4FLRA 4JPIA 4XRCB 3GNML 4LGPB 1E51A 2OR2A 1ZHNA 4ZAKC 1UJPA 4E6MA 4CW1B 3E9UA 2W6RA 1ZTVA 3BUYB 5GS0H 4P61A 3UO8B 1XGUA 3L54A 1HHIA 12E8H 1TIUA 4AG4L 4O0ZA 3VAVA 1NCCL 2NUPA 1UC4A 4XBJA 3KHQA 5CEZH 1H60A 3L1EA 1T5XB 5D4HA 3UJJH 3D39A 1QR7A 4MVBD 2J7FA 2YSWA 3LCWA 2JB5L 4FK9A 3OKNA 5F8RC 2D20A 4R3SA 1H49A 3OAZH 4ZUUB 4GMSL 2OMBA 3LXUX 5B22A 3ZHNA 5EIIG 2X0UA 5A3HA 3ELQA 4FFVD 2FQIA 1XLJA 5CN2A 4MS8D 3TLQA 3ASOB 1HS6A 3UBHA 4F8OA 2XG4A 5BQ7B 5JOPD 4MLSA 4Y19E 4RE3A 1VFLA 3ZE2F 2EDEA 4MA8H 4HIEA 1BG4A 5A3ID 4N22A 4EOWL 5FO2A 3ARWA 3DIFA 1OTSD 5D4YA 4QNPE 3T1WA 1RSYA 3T2LA 2AMUA 2P47B 4D3CH 1X6LA 1EF2A 4GK8A 2IIJA 3HC2A 1F61A 3P40A 3O6YX 3MNMA 4S1DD 2CBJA 2I69A 5JNYB 3JYCA 1P7HL 3B2VH 4KTYA 2DM7A 3FU7B 3LYEA 2A9MH 1DCLA 2ZJSL 3RIAF 3S1UA 4L8CA 3EYSL 3OBAA 3KHJA 4IPLA 2E7HA 1HKFA 4WD0A 5DJYA 4CN4A 3R0MA 5EZIL 2WQAA 3V9EA 1DWGM 1HXMB 1Y18A 1UFUA 4KQ4H 3PGFL 1R9XA 1CICB 1KYOK 2YUVA 2R1XB 2N7AA 2INEA 1EXUB 1PNCA 2ID5A 3BEWB 2Z27A 4EZLA 3K2GA 4NRRA 4XIMA 1UFGA 5IEKB 1A2YA 2JCWA 3KL5A 5KSAB 2GJXB 1VIZA 2FHCA 1E5UI 1SBSL 2NY2C 2E5BA 1M9HA 4ONHB 1Y8BA 3FXYA 3RJOA 2H32A 1GGUA 4RGNB 4DN4L 1FNLA 3TCLB 2ZG1A 2J56A 3T5WA 2G2RB 4DF1A 2GBTA 4LHUA 1ETB1 4IKJA 1R3KB 5F9DC 4ZUSA 2XTJB 4LOEA 2EGZA 1QLEH 3NEHA 1EO7A 4RZ6A 1IC5H 4XMWA 1YN7A 3VE9A 4IUOA 3TW9A 4NQDE 2AGJH 1I8AA 4DFHA 1AZCA 4M5YL 1OOAA 4FQ2H 3WIHL 4KMTL 3ZZQA 1OK0A 3AOFA 4N1EA 3FYEB 2YGPA 4XNYH 5HYSB 3QXVA 4G5ZL 1PV8A 2DZPA 3QB7C 3CCHB 3H3PH 1N70A 4JFHD 4LL1A 4XC3H 5IP4A 1P0BA 4OGYH 2PO6C 2QQ6A 3C8NA 3KVLA 3P2VA 4QG9A 3I6GA 5CZXC 4JICA 4X9YA 3APNA 2J55A 1V7YA 2WHMA 4PJAB 2WZHA 4I5BB 2A6IA 1JYNA 1F6KA 2V6HA 3FYIB 1E5JA 1Z0NA 4N2MA 3ZLHA 1MSPA 2ZZ5A 1L2QA 4DYJA 3EJPA 1UJQA 2NY0D 3FQTA 5GRUL 2ICES 2J1WA 1XB3A 5DZLA 1B4LA 1EJUC 2DZEA 4AYMC 4RDVA 4YL4A 2NNRA 1E15A 4GW1B 2NY0B 3AXMA 3CC5B 5GRVK 1ZA6A 3IAQA 4OZ4B 1MCWW 5C6PB 1LG2A 3KVMA 3W88A 3A67H 4GO6B