3K4WA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
b'LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Bb4693
publication title CRYSTAL STRUCTURE OF Uncharacterized Tim-Barrel Protein Bb4693 From Bordetella Bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics, unknown function
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3k4wA00
1WXYA 1BF6A 1DPMA 1PTAA 2R1LA 3MJMA 1M68A 3TN3A 2F6KA 2R1MA 1ITQA 1KRAC 4H9UA 1R9XA 4C6DA 4B3ZA 4RDVA 3GUWA 1J6PA 1A4LA 2UZ9A 3S4TA 1ONXA 3URAA 4WHBA 4F0SA 2PGFA 1UIOA 3JZEA 4LAKA 4C5YA 4PBFA 3B0XA 3DC8A 4ICMA 4EP8C 3PNUA 4RE0A 5FSDC 1FWBC 5FSEC 1JGMA 2R1PA 3B0YA 2VUNA 3RCMA 5AKQA 3MPGA 1FWEC 2AQVA 3WMLA 4QTGA 2Z7GA 3GTHA 4XD3A 5LXXA 4XAYA 2RAGA 2Y1HA 4LEFA 4ZSTA 4UBPC 2WM1A 4KEZA 2EG7A 4C6KA 1S3TC 2R1NA 4DZHA 1XGEA 2CZVA 3ISIX 2EG6A 3URBA 2YB4A 3CS2A 3SO7A 3LNPA 1RAKA 2Z25A 4HJWA 4IGNA 3URQA 2Z26A 3KM8A 4C6BA 2YZ5A 3EWDA 3PBMA 4IF2A 3TN4A 3QY7A 3DUGA 3ORWA 2E25A 1FKXA 4H9ZA 3IJ6A 2W9MA 3LSBA 1R9YA 3LGDA 2HPMA 4F0RA 2KAUC 1FWIC 3T1GA 3A3WA 1K1DA 4BY3A 4B92A 1R9ZA 2PUZA 2OOFA 2OQLA 3LGGA 3QY8A 2I5GA 3OVGA 3PNZA 1XRTA 4CNUA 1J79A 3E2VA 1PO9A 3F2CA 3MTWA 2VHLA 3F4DA 5CH9A 4H9XA 2BGNE 3OOQA 3TN5A 3PAOA 4GYFA 2GSEA 2YXOA 3QY6A 1KRMA 2P53A 5G4HC 5E5CA 2FTYA 4H9MA 4DO7A 3GU1A 4J2MA 4C6NA 1FWDC 3E38A 2GZXA 3A3XA 4I6VA 5HMEA 4G7EA 4DYKA 1YRRA 4QROA 3UF9A 4D8LA 3E3HA 1RA5A 2D2HA 3FDKA 3E0LA 1GKQA 4GX8A 4AC7C 3GG7A 4R88A 4C6FA 4WGXA 4L9XA 4DI8A 1ITUA 1V4YA 2IMRA 3QGAC 4PCNA 2XIOA 4KEUA 2Z00A 1HZYA 4CQCA 1J6OA 4E3TA 2P50A 2VR2A 1RA0A 1NDVA 1W1IE 1I0BA 4YIWA 3LU2A 3O7UA 3GRIA 2EG8A 4BJHA 1POKA 1KRCC 1A5KC 3GIPA 1FKWA 4RDYA 3OODA 4H9VA 1YIXA 4KQNA 4LAOA 4ERIA 4IG2B 3LS9A 1O12A 4KETA 4C60A 2O4MA 1E9ZB 1QW7A 3RN6A 4CEUC 4GBDA 4R7WA 4IQJA 4GK8A 2VC7A 4IFRA 3PANA 3WYZA 4HK7A 1FWFC 3V7PA 3K4WA 3IRSA 4GC3A 1EJUC 4GOAA 4HK5A 4C6IA 1V7AA 1ONWA 4G7EB 2ANUA 2YB1A 3K2GA 4QSFA 4CQDA 3NURA 4C6EA 4TQTA 3IV8A 1YNYA 4CQBA 4F0LA 1PSCA 3URNA 3S2MA 1NDZA 3IGHX 1M65A 4KF1A 4Z42C 4C6OA 3GTFA 3K5XA 1ZZMA 1UMLA 2Z27A 1XRFA 4C6QA 3S2LA 4IFKA 1EF2A 1FWAC 1UIPA 2VC5A 4PCPA 4XD6A 4GX9A 4HK6A 4R85A 1EJRC 4V1YA 2HPIA 4L6DA 3T81A 4EPEC 2I9UA 2WJFA 1A5MC 2D2GA 5HMFA 1RK5A 3UPMA 1A5NC 2DVTA 3MVTA 4DLFA 4CEXC 4H9TA 1EJWC 1NFGA 3LSCA 2FVKA 4C6PA 1P6CA 1EJXC 4XAFA 2UBPC 2QT3A 5HMDA 2WJDA 2BB0A 1FWHC 3RHGA 1NDWA 3GTXA 1FWCC 4LCQA 4RZBA 2A3LA 1K6WA 1V79A 4J35A 1V51A 3MDUA 1YMYA 1XWYA 3FDGA 3HM7A 3GU9A 2DVXA 4JOMA 4EPDC 2FTWA 4EPKA 3WZ0E 2FVMA 2PLMA 2GWNA 4V1XA 2E1WA 3HTWA 4DNMA 1EJTC 2Q09A 3CJPA 1RJPA 4IFKB 4RDWA 2OGJA 4DIAA 1FWJC 2GWGA 3LA4A 4B90A 1IE7C 3OU8A 5A6TC 4H9YA 1KRBC 4NG3A 4P5UA 4KEVA 4C6LA 4EPBC 3C86A 2WJEA 3NEHA 4GZ7A 4NI8A 1POJA 3MVIA 3QGKC 3HPAA 2HBXA 4KIRA 4IFOA 1M7JA 3AU2A 1UBPC 4ERAA 4QS6A 1WXZA 4GY1A 2ADAA 4C6CA 4XD5A 3UR2A 3IPWA 3S2NA 3AU6A 2Z4GA 3OQEA 1K70A 3OJGA 2ICSA 3F4CA 1E9YB 1P6BA 4LFYA 1PB0A 1A5OC 4C65A 4KERA 4M51A 1YBQA 2QS8A 4C6MA 2DVUA 2Z24A 3O0FA 2PGRA 4LANA 3IACA 2PAJA 3CAKA 3G77A 4J5NA 2OB3A 4LAMA 1RK6A 2OODA 1VFLA 1QXLA 3MSRA 3GTIA 3SFWA 4LH8A 1RJRA 2FFIA 4GXWA 3LY0A 1A4MA 4GY7A 3MKVA 4LALA 4CNSA 4IGMA 2HBVA 2HNHA 4PBEA 4HA0A 1GKRA 4C5ZA 1GKPA 2Z2BA 4INFA 4I6KA 4PE8A 4DZIA 4ERGA 3EGJA 2Z28A 1A5LC 2AMXA 3MDWA 4MUPA 4OFCA 4DLMA 2O4QA 1EJSC 3NQBA 3F2DA 4QRNA 2HQAA 1EYWA 2Z29A 3ICJA 4ZSUA 3RYSA 1EJVC 4LCSA 2Z2AA 4NP7A 3D6NA 3E74A 3A4JA 2QVNA 4C6JA 2QPXA 3UBPC 1RJQA 1J5SA 4H01A 3UR5A 3GU2A 3E0FA 4IH3A 1YBQB 3BE7A 3ID7A 4IG2A 3EWCA 3DCPA 3TNBA 1O5RA 4RDZA 2VM8A 2Q01A 2G3FA 4XAZA 1NDYA 1FWGC 3B40A 3ITCA 2D2JA 3FEQA 3GIQA 1I0DA 3TN6A 2R1KA 4QS5A 4XAGA 3F2BA 1EZ2A 2ZC1A 4AQLA 4GY0A 3R0DA 4BKNA 3S2JA 4KESA 3AUOA 4G2DA 4CNTA 3N2CA 2GOKA 3IARA 3T8LA 4LCRA 4DI9A 1KCXA 4H00A 1ADDA 1V77A 4WVXA 4XD4A 4B91A 1P1MA 2AQOA 4UB9A
chains in the Genus database with same CATH superfamily
2QUVA 1I75A 2GGJA 3TLLA 3WQCA 3TQPA 1NWRA 2VI0A 3VOJA 4H9UA 1TFVA 5LIUX 3GZ3A 3EOOA 1QWGA 4HTBA 3C8NA 2GK1A 1DJZA 3O6AA 1ICSA 1NARA 1M41A 4JTIA 1J0IA 4H2HA 2XH7A 3B0YA 2GDQA 1TTJA 3TLQA 2DIEA 3B9OA 1NEYA 1KM2A 3H2EA 2HDJA 1XW8A 4QNEA 3W85A 4XAYA 4UR7A 4IIEA 2ZE0A 3OVRA 5BRBA 3KOZA 3ZSTA 2X05A 4IPNB 1VEOA 4BI7A 3NPUA 4IXXA 1AH4A 4Q8QA 3VIOA 3G0XA 3EWDA 1Y8BA 3S9ZA 2CBJA 2OYMA 2V5CA 2YDRA 3UXDA 1TJ0A 1WNOA 2W67A 4KFNA 1K8YA 3S6TA 2Z6JA 1JDAA 1G69A 3U2EA 4GI9A 2OO6A 5DX7A 3DFNA 4UQCA 5IOBA 1J0ZA 3N9SA 3WLOA 4XZLX 4IM4A 4H9XA 4MIMA 1KCKA 2G3IA 2VQTA 4LSBA 3UWEA 2P53A 3P82A 1RR2A 1FWDC 2VJXA 1X39A 3LI0A 4GQ0A 4K7VA 3W7IA 1TG7A 1YRRA 1LRTA 3GC4A 5A5WA 3E3HA 2B7OA 4E8CA 2ISFA 3UY8A 1QBAA 3UXLA 4XZHA 1XIDA 4WGXA 5HUOA 4DI8A 1P0BA 1SO4A 3GC2A 1M7XA 4KEUA 5EMKA 1TZ9A 1NDVA 2X41A 1HL8A 3R2GA 2EG8A 4YTRA 3DFHA 4FSAA 4MWAE 1HL9A 4S3JA 3LRMA 4AZCA 1AK5A 2ZZ6A 5D9NA 3GH5A 2V81A 3GHUA 4ZXOA 1KBJA 3L0KA 3NL2A 3PPHA 4F0KA 3SN0A 1NQKA 2P0OA 2Y85A 3CL7A 4A3RA 1TPC1 4XVDA 1YTKA 1PVNA 1PSCA 1T40A 1TO3A 3HGSA 4LPCA 1K7EA 1NDZA 3GH4A 5I3KA 3FA3A 5C9UA 3QQ1A 1V6VA 4UTKA 2Z27A 3E0IA 2NQLA 4OUEA 3UP8A 4FLSA 3Q45A 1OGGA 3QPEA 1FA2A 3WDRA 4EPEC 1GYNA 1JD9A 3FW6A 3AYTA 3W7NA 5HMFA 1KXHA 1XRVA 3TV8A 3W24A 2GQ3A 4JZ5A 1Q6QA 3G1AA 3GXIA 1A80A 1UR0A 4HNLA 4PUKA 5HMDA 2ISDA 1E6XM 3BC9A 2J7DA 1Z69A 3IRDA 2QCDA 2BFGA 1J0HA 1FBAA 3RG6A 1A3WA 4IGSA 1FWRA 3DBNA 4LJ3A 1W1A1 1XWYA 3SI9A 4CLMA 1XUZA 3THCA 4JHZA 3N17A 3IK4A 2VC6A 3RMEA 4O1AA 1MEIA 4JN6A 3VOIA 4MB3A 1JYVA 3PFMA 3TNOA 3CUZA 3I6TA 1RJPA 1VEPA 1HJSA 1FXPA 4GZJA 4LXFA 1XFCA 2BX7A 4IMAA 2NV1A 4WDWA 4XTIA 4AHQA 1EC7A 1ME7A 1OT1A 1ZJHA 3UZJA 4NG3A 1DVJA 1PE1A 4DN1A 4M56A 1GW9A 4RV8A 1ISXA 1V02E 2GVEA 2QV5A 3M07A 5F2IA 3BXWA 4X60A 1HGYA 1AQHA 3BZGA 2V5BA 2DFAA 1UW9A 4GYPA 3U4FA 1M5WA 4KH2A 3S2NA 2I14A 1HNYA 3OJGA 3VI2A 4E5TA 4PMNA 2O7SA 3N3TA 3TTOA 4V15A 1SUXA 4KERA 1VRXA 2YCEA 4CCEA 4Y7EA 3PC0A 5C55A 1XLKA 2PGRA 3AICA 2Q3OA 1N82A 5MF5A 3TP4A 3SFWA 5KSWA 2DZXA 5BMXA 4ICCX 3LDVA 2NT0A 5K9XA 1VCFA 4CU8A 4J4KA 1TYGA 4TVCA 3WUFA 4CN1A 1T41A 4CNSA 4LU0A 5J04A 3W70A 4HNTA 3NM3A 3WG6A 3V5CA 1H1YA 2F38A 1K8XA 4QJ5B 4ADSA 3M0LA 2DGAA 3VD9A 4XK2A 3PWIA 1TE6A 4JTCA 1OIFA 4PUEA 3N18A 4J40A 3IJIA 3MUXA 3SIZA 4V33A 3HGJA 1BYDA 1Q85A 3DHFA 2XU2A 2WKGA 3WNNA 3GU2A 1VYPX 1W5NA 4IH3A 1DQXA 1L2UA 4IG2A 1B3ZA 3DCPA 4QE4A 5T26A 1GVQA 2OGYA 5TIMA 4HQVA 4ZQCA 3S5SA 2DH2A 2R1KA 1TRDA 2TAAA 3B0VC 4QS5A 3DDMA 1VAHA 2OWXA 1ITXA 1GTHA 4TUFA 1AW5A 4C7FA 2J9ZA 4BKNA 2G50A 5A1AA 1C3FA 1HUVA 2ZUTA 2Y4SA 1DIOA 4DJDD 3TR2A 3IGUA 3SJNA 2GQAA 5C6MA 1FP9A 1DJGA 1V0LA 5LNVA 3QR0A 3NVDA 4QIUA 3OTRA 1XIEA 3O05A 4LV9A 1UKSA 1XYBA 3WF2A 4ADTA 4P8VA 1QI3A 4LRTA 1XJBA 2GGIA 3LZ5A 4O4WA 3UPBA 4HIBA 2BBFA 1QHPA 1SZNA 4LAKA 3WEZA 1D9EA 2EPKX 4KWOA 3BG5A 5F1UA 4ICMA 1DWJM 3WBAA 3WY1A 2Z1VA 5FSDC 2QYGA 1VR6A 3HOJA 4DVOA 2QPUA 4OV9A 1X1OA 3WENA 3H12A 4XD3A 3CAQA 1WCGA 2A0NA 2WM0A 5AHEA 3CYVA 1R3SA 2NQJA 2PCEA 3OQ8A 4PUJA 1GNXA 1X1ZA 3OA3A 1ZAJA 3TXZA 3UG8A 1DJNA 1ODZA 6XIAA 5EGRA 2OZ3A 4WKAA 4AYGA 1OC6A 4FIRA 4EANA 5AC6A 1OCNA 4FF7A 2J8FA 2FVLA 4FXRA 1E0VA 1K7FA 4BR1A 2REQB 3GX9A 1UA3A 3AHVA 1KKOA 3ZXWA 4GCXA 3U2ZA 2PUZA 1OYBA 3RJYA 4PTDA 3FA4A 4N2YA 4MLJA 2PWUA 2OQYA 4NHVA 1B31A 4Y9OA 2PLJA 4B5WA 4LF1A 3B8SA 3SCRA 4QSHA 2YKKA 2C1IA 2XWDA 3OLEA 3M16A 4LBSA 4GC4A 5E5CA 1HO4A 1F05A 1VBUA 4Z08A 4CU7A 3D5HA 5EA9A 5C8BB 2QHAA 4U33A 3MP5A 3HV9A 4DYKA 3B0PA 2HV5A 3L66A 3UNDA 7ENLA 5D09A 4R33A 5KITA 4AD5A 1G9HA 8XIMA 1CW2A 1H1ZA 4PMOA 4L9XA 4XB3A 4IL2A 1BTMA 4YS1A 4F0HA 1ZSXA 2JEPA 2VR2A 3WK0A 2ZX8A 4ZL1A 3LU2A 4KBXA 4L6HA 1B9ZA 5HMSA 1KRCC 1S38A 1VKFA 3VNLA 1WX0A 3C2VA 3VUPA 5CEWA 2QJJA 1UWIA 4KETA 3MI3A 4UTMA 2JF6A 4HNNA 3W1QA 7CGTA 1EPXA 1EF3A 5JBEA 5I02A 1A53A 1OBAA 1F61A 2ESCA 3G1YA 4R7JA 4FNPA 1FWFC 2EKGA 1VYSX 1ZFJA 5IDIA 1BG9A 3USBA 1AL8A 2WANA 1H49A 4CQBA 2DT1A 4KF1A 4Z42C 1EA9C 4N9CA 3GTFA 3D3FA 2YDQA 2PP3A 1FWAC 3H7UA 5CAKA 5BCAA 3CIXA 3OO2A 4MJZA 3P5ZA 2QGYA 3C0JA 4B5VA 1VJSA 2NQ9A 4W9TA 4AZCB 1SZRA 3MVTA 4BQ5A 2VCBA 2XH2A 1OD8A 1DTUA 2POTA 2I56A 2CLKA 2FTPA 2FH6A 5F4SA 1S1RA 3T0BA 4GHRA 4UTUA 3BICA 3A21A 3UXKA 1XLMA 3HPXA 4H7VA 1PX8A 3GG8A 2F61A 2WMKA 4B5XA 2NLIA 3CPRA 1E0XA 3C8FA 2OLAA 4A2RA 4M80A 1TPUA 3PBVA 1FQ0A 4IUGA 3AWNA 3MYOA 4W7WA 3R13A 2QDEA 4DUOA 3WQOA 2HMCA 5A94A 3A13A 5M1TA 4WKFA 3UJ2A 5HQLA 4L4OA 2NSOA 4P5UA 3MWAA 1EBHA 3NEHA 4Q7BA 3LX9A 5A6JA 3GG0A 5JBDA 5JH1A 4O1DA 3W22A 4JQ1A 4B9ZA 1XCXA 4XUGA 3G1VA 4DJED 3GNRA 4LS0A 2QCDB 1OFAA 4AZGA 4NKCA 3ANYA 2YCLA 4H19A 2FZ8A 1DWHM 1TWDA 1H09A 2FKPA 4JIQA 2C16A 1DEDA 1TVNA 2OSXA 3O0FA 3SQLA 1EGVA 4WUIA 1KW1A 2EJ1A 4FO4A 1ICPA 3DYMA 5DQPA 5FF3A 1J10A 2OPJA 4DAFA 4AZ6A 4MTVA 4GO8A 4I7WA 3CQJA 4D6EA 3TK7A 1OVDA 5A95A 1R86A 4Z2LA 1KB3A 3R5EA 4WJXA 1B54A 1IGWA 3VD7A 2W62A 3ZJKA 2B31A 3WFAA 5RUBA 1H5YA 1YTDA 3L7RA 1IEIA 2J6XA 1OADA 4HZ6A 1XX1A 5CG7A 2GDUA 3SSJA 3NPXA 3NQMA 3NZPA 4ZTXA 3GXPA 1XG4A 3W1MA 2E09A 3D47A 1XLBA 2QVNA 7TIMA 4BHYA 3DKLA 2I5IA 4RZ6A 4DJEC 3PZOA 4ZENA 4BWLA 4JQ4A 3BZJA 2JQXA 3N3MA 2VM8A 2C79A 4YTSA 2OO0A 3UQNA 3QLDA 4MWAA 4DM2A 3EOEA 4G1KA 3E12A 2ACRA 1KFLA 1IZJA 1E1EA 1E51A 1HXJA 2PI6A 1W32A 2J66A 1UD6A 1E4MM 4J2PA 4Q8NA 3I7QA 3CXOA 2DZWA 2QW5A 4MFDA 3PTMA 3K1DA 4MDOA 1GZ1A 4GGBA 2VENA 3HO8A 2RKXA 4Y9AA 3KVJA 3OYZA 2FIQA 4MVAA 3H21A 1RUSA 4UOQA 4HU4A 2D22A 3CNYA 3NSNA 4Z2IA 1UC4A 3SM0A 4PMJA 2AQOA 4Y9PA 1S3HA 1WXYA 1EUNA 1DPMA 4D6JA 2R1LA 2GSHA 2DT3A 2CWNA 3VZXA 3TN3A 1G0CA 1FCVA 2OZ8A 2VEPA 3NYZA 3VO0A 2FZMA 1DXIA 1BKHA 1HP5A 4FOKA 4Z1DA 1CYGA 5HJXA 4UIOA 5HNUA 1AZ2A 1KBBA 3P93A 1AQ0A 4M1RA 3M6YA 1B3VA 4H6EA 5HOSA 4YXGA 3BJFA 4A2SA 3V0TA 1EP3A 3ITVA 1SW7A 1UUQA 1XLGA 3L2IA 4NRSA 4O14A 4QTGA 1WB0A 1HF6A 1MW1A 2Q8XA 3NQ2A 4YJ5A 3SY1A 1K9EA 1ZJBA 3KL0A 5A6LA 2C14A 2R1NA 2H8ZA 2NQZA 4MJ2A 1XGEA 3ISIX 3I4KA 5C2CA 4GXPA 3VINA 1GOMA 1JZ6A 1U22A 4F0MA 1E72M 4HJWA 4L56A 3KM8A 1AJ0A 2YZ5A 3QFEA 2QCCA 3L4YA 2NXGA 5HJYA 4H8VA 1Y5XA 2WNQA 3LGDA 1OCQA 1BEUA 2PWGA 1KM3A 1XLEA 3M46A 4XSMA 1Q63A 1FWSA 3KVMA 1J12A 4EKJA 3OVGA 6CGTA 1J79A 2W66A 3I68A 4AZHA 1XFBA 1W31A 4DHGA 4EX4A 1UQYA 4GYFA 3ARPA 1K4GA 3WLTA 2H3BA 1V02A 3R58A 2VR4A 4FIQA 1WZMA 4CGTA 2C8NA 1EO7A 3ZR4A 5AB3A 3P14A 1OJXA 5H6HA 3S46A 4W85A 4C90A 1B3XA 3PK7A 1QO2A 2FQIA 1SYTA 1DXFA 4IIHA 3PHAA 3FKRA 3ITGA 3UERA 1PKNA 3G1HA 4R88A 2Y63A 2E6YA 3W02A 4Q8UA 3WIJA 3FNDA 3AMKA 1OSEA 4HZMA 1NFBA 2EF9A 1GVRA 1OZQA 3GRIA 7PTDA 4B4HA 3ARRA 4M82A 4ZTYA 1A5KC 5G2WA 2QDGA 1G67A 5TQLA 3W1LA 5CPQA 1E9ZB 3O6DA 4BQ4A 6XIMA 4FOJA 4PEEA 2A7NA 2Y8UA 4IFRA 1UA7A 5XIAA 2DSWA 5B7YA 4HK7A 3SRKA 4HHPA 3RM9A 2OKOA 2C18A 4JYEA 1W56A 4GOAA 3M64A 5T9CE 4AXNA 1BQGA 3K2GA 4QQUA 3G5EA 1BRLA 4ATWA 1BXNA 4TQTA 2B7QA 3LCIA 3BWWA 1CI1A 2VRKA 2HWGA 1CLXA 2YA0A 2FPVA 4MOZA 3CPGA 1UMLA 4GVGA 3VKAA 1VBRA 3A4WA 5I0DA 2A3EA 4R85A 4S3KA 2WMJA 1OG0A 4KRZA 3LHZA 1VENA 2I9UA 4WOZA 3MV11 5AECA 5M2FX 1A5NC 3CIVA 2ZDSA 4KMQA 2ABAA 3RXZA 1TREA 1TVLA 3MB9A 4K3ZA 4XAFA 1YTEA 3W23A 1E6PA 4QGCA 5T9BG 5G1YA 2JALA 3TMQA 5G2IA 4ZFCA 4WD0A 3PBYA 1KLYA 3STGA 2W6RA 1O68A 1QPRA 3MMWA 3HN3A 2ZKMX 3R25A 3R79A 3LV5A 2DPEA 2ZTKA 3TC6A 1XV8A 9XIMA 3TOYA 4D6IA 4P7QA 1DKWA 3U0HA 2FGBA 3OZYA 4D6DA 4LW7A 1WUFA 4EWJA 4WJ8A 2J78A 4IMCA 4ZQNA 1JPHA 2PDPA 2C19A 3EDFA 3TE9A 4KFOA 1GVIA 1Z48A 1XBVA 4I7UA 2V5LA 1OM0A 3CQ0A 5CXPA 1NOWA 3LUTA 4UZSA 1TE1A 5CC7A 3UXIA 2IPGA 4IOTA 1H7OA 1ZJIA 2G3NA 3AU2A 4Z2KA 5E1QA 3GYCA 1H7RA 4PUNA 4R3UA 3KW3A 4ZZ9A 5D9MA 2H9AA 2ADAA 3A9BA 3OQEA 1OCBA 2ICSA 5FJIA 1R46A 3L23A 1ZNNA 2D0GA 1XYFA 5XINA 1UC5A 3EWYA 1O60A 3GXNA 1K3UA 1VBHA 2PDNA 3EA3A 3H4XA 4H6QA 3SBFA 3WL0A 1O5KA 4LY4A 4JNZA 1WA3A 3E2RA 2W4XA 1FHLA 1ZQ5A 3LLFA 3N2OA 3CZLA 2E1DA 2ZRZA 3B9NA 3MUAA 3T2QA 4XO6A 1NELA 4QXIA 4MUPA 1TA3A 5HA7A 3TU9A 1J0JA 1GWJA 1GK8A 3JW7A 3EAUA 8CGTA 3WFZA 3G0UA 3HF3A 3KVKA 3N2MA 4LBRA 1EHNA 3IWPA 4J7RA 2YCLB 3IAPA 1WAUA 3O1NA 1US3A 3AYRA 2JFEX 5CSRA 5AYYA 1ZL1A 3EX3A 4JAWA 4R9XA 1KM0A 1XI3A 4NX5A 2DIKA 3ZS4A 1F5ZA 4JD4A 4MZ8A 4AW7A 2PDHA 5LZLA 3VGDA 2ZADA 1KBIA 2I57A 1BVNP 3WEMA 2WCAA 3QPYA 4LY8A 3EX2A 1F3TA 2DT2A 2BY3A 1YDOA 2Z7KA 3LCLA 3NDOA 4O53A 1QU4A 3NQ6A 3EMZA 1LM1A 2JK2A 4UTJA 3IV3A 2VDIA 4H00A 4O0QA 1ZY9A 4DF0A 1T8XA 4UTHA 3H8AA 3QM3A 3TC3A 2DZVA 4JN8A 1G01A 1Z44A 4B5NA 4GUJA 1ZBCA 1ITQA 2G95A 4C91A 3ZT6A 3VXGA 4DUVA 3PUDA 3FJLA 4Y90A 1JUBA 2PGWA 4TV5A 3K4AA 4GQBA 4URIA 5FD0A 2NQHA 1V6TA 2E8YA 1JCYA 3A9IA 1HFBA 4OE7A 4WDTA 2XPKA 4MWAB 5BOFA 1EC8A 1GORA 3VX0A 3DGBA 5D9OA 4I8YA 1UD4A 2OYKA 3S1XA 3LNMA 2P3ZA 2AOSA 1V6UA 3OBEA 4JIEA 3Q67A 2WWDA 3GNDA 3VZYA 1WDPA 5C9WA 4CCDA 1GQLA 3CS2A 3T6CA 3S1GA 2YL9A 4TVUA 2WWCA 3HPFA 2Z26A 3BLIA 1Q6DA 3TN4A 1WQ5A 1A5BA 3GAKA 2E25A 1NJJA 2YFNA 4M3PA 3WD1A 5DRIA 3VE7A 1UCWA 2VUYA 2XIJA 1R9ZA 5C0QA 3AMDA 2I5GA 4HN8A 2HROA 3LMZA 1O95A 3W86A 3L2MA 4H6RA 5DFAA 3UR7A 1Q4WA 4DUXA 4JX4A 4QLJA 3HQOA 4JTQA 3KHDA 3OOQA 4LC6A 3M5YA 2J9YA 3BLDA 4QE5A 2VX7A 4CQ9A 4H9MA 3IS4A 2YBVA 4H04A 4AC1X 3EXSA 3QF0A 3WH5A 2Z2UA 3C52A 3BLFA 4G9PA 3G1RA 1XYZA 5BXSA 3UF9A 3TSDA 4JYDA 1V93A 2QJMA 2QCLA 4KCUA 4LQ1A 1W37A 1J5TA 3L2LA 3BL3A 3TJIA 3EX1A 2G41A 3OLIA 3MS8A 4CNNA 1BXCA 1BQCA 4BF5A 1SFLA 2UWFA 1SJBA 2I1OA 3GR4A 1J9YA 4IX0A 4CQCA 4WF7A 1W1IE 1H61A 1R85A 3QHOA 1E9LA 1R30A 4ACZA 1U2YA 4JCMA 1YIXA 3R89A 4UMBA 2YBTA 1QW7A 4U2YA 1E6SM 2P8BA 2DZAA 1ISZA 1RH9A 1ME9A 5DXXA 3DYOA 4JHMA 1KM4A 3AFBA 2VVSA 3K4WA 1MUWA 3MY9A 3NOYA 3VKDA 2Q02A 3WLQA 1LWJA 2CBIA 2ANUA 4GE8A 4JFSA 3ZWSA 1U33A 3LRLA 1AJZA 1YNYA 4HTYA 1ZU8A 3VNZA 3LPFA 3TYDA 3M0IA 1UHVA 3BCDA 5I09A 2W91A 3FHAA 3KWXA 3P60A 4G6CA 4WXYA 3N19B 3MYPA 3VGHA 1DWFM 2HPIA 2D69A 1MVYA 2PDWA 1I6NA 3UA3A 4DO4A 5KZEA 4B5UA 2PDFA 3ALFA 1S1PA 1NFGA 2VCAA 1P6CA 3EXRA 4K2SA 2Y62A 3TJLA 3PUEA 1LBFA 1EJXC 1UKPA 3THUA 2WNZA 3E6EA 1NDWA 4NAFB 1WKEA 3MMUA 2BP1A 4EVZA 2WAGA 2A3LA 3H7VA 3M0VA 4XX6A 5E0FA 3S6OA 5IXEA 2V2DA 1BRLB 1BGAA 4UXDA 1C8YA 1VFMA 3BLPX 3VNJA 4RR4A 3L4ZA 1FDJA 1EJTC 2Q09A 3BSHA 4F9JA 2HNEA 2PC4A 3LHTA 4NT0A 3N2TA 3HV8A 2BOGX 3RCNA 5I3JA 5PTDA 7ODCA 2QV4A 1TV7A 2NXIA 2WKJA 2YX0A 4C6LA 2YW4A 2WVVA 4B15A 3EWXA 2F2KA 4YYFA 5C71A 2QCMA 3DI1A 3TYEA 1YEYA 3LMYA 2HBXA 4TO8A 4Q4MA 2AMGA 4HHMA 2XM2A 3IJ7A 1FH7A 1RCOB 2XGZA 3ZVIA 1W9UA 5XIMA 4DBSA 2OR2A 1P6BA 2EPHA 1CZ1A 4HNCA 1UWAA 2DJLA 2FYMA 2OEKA 3BOLA 3OIHA 1OK6A 2LLEA 3GHTA 2A2IA 1RQBA 3BCFA 4GUHA 2X1RA 1DIDA 4I5RA 3RM8A 2QCGA 3TZNA 1U30A 3T4WA 3B03A 4O13A 3WMSA 2PS2A 5D32A 2ZZ5A 1TVPA 2WHJA 2WMFA 3WF1A 3LCHA 3U8GA 1TWZA 3CBWA 2ZUNA 1VBJA 1EEPA 4DO6A 3G8RA 2ZVIA 4DZIA 3ME3A 3EGJA 3IJQA 4MYAA 2ACUA 4U31A 2P3EA 3AIBA 1UH3A 3W87A 3VD5A 4NX0A 4HU3A 5HNTA 3JU2A 4R27A 2ZE3A 5AYXA 3BE7A 3IIZA 3QQWA 4AZ5A 2AGTA 1QVBA 2VOMA 3C2YA 3KCJA 3Q65A 3R10A 2CKSA 2J62A 1JAEA 1O7AA 1I0DA 1MZHA 1UP0A 5E0CA 2V2HA 1R3TA 3GFXA 5AC5A 1NY1A 1VEMA 2GJXA 1XYLA 4G2DA 3O06A 2FZBA 4PMQA 2EKCA 1D3CA 2PURA 5U4NA 3BLLA 4ASTA 1VD6A 5CZJA 1P1MA 1FY6A 4M29A 3GNXA 1W5OA 2A6LA 4TOQA 5IHRA 4LBUA 3BO9A 1QW9A 1JG9A 3RNDA 2VXNA 1XH2A 2V82A 4PBFA 4Z1BA 4EP8C 1SMDA 2V6AA 4AVFA 4E0CA 2X1IA 3EOLA 1R2SA 3R0KA 4HJFA 1JGIA 4BCEA 1HJXA 3OGRA 2CU0A 4LEFA 4ZSTA 2R82A 3BURA 1BAGA 2CLPA 2VZUA 1AZ1A 3S42A 1RHCA 4JIRA 1IXPA 4FK9A 4DWSB 2E8ZA 3CWHA 1JRBA 3LRKA 1IWBA 3W00A 4I7VA 3BARA 4P7LA 1BXBA 4E6MA 2VOTA 1VCVA 3CQHA 4CD5A 4O17A 1N8WA 1K1DA 4EAMA 3WD4A 3GG1A 1VBGA 3SW6A 2ZVRA 2NV9A 3B8DA 1W6TA 2E0PA 4FF5A 4L7ZA 1XRTA 1ZB5A 4Q8OA 1OF8A 5CSUA 2V63A 2E77A 3S6DA 3UJFA 3TN5A 4J3ZA 3ABXA 3BJTA 4HPHA 1XRSA 1WBJA 4J2MA 5J5RA 1TV4A 3IAQA 1CXHA 1JD7A 1UWSA 4DZAA 4U5IA 3P5YA 3WNLA 3HG3A 3UY7A 4JN7A 3ZZ1A 3RLUA 6PTDA 5FF7A 1SSDA 4RE2A 1RA5A 3L0NA 1GKQA 3KBNA 4WDXA 3UD6A 3AXXA 2DZSA 2C3ZA 1VLWA 3H23A 1A49A 4AWEA 4G1NA 4B5TA 3M7SA 2Z00A 1JCLA 3VIJA 1DE6A 4Y6GA 1OG6A 2VX4A 3JZUA 1KFEA 3AMCA 4GACA 3G1DA 5A6AA 3LXBA 4F3HA 4C60A 4NAEB 4GVFA 3DU0A 5U7SA 4W93A 1LYXA 1RBLA 5TAOA 2VEKA 4E2VA 5FL0A 1EJ7L 1LLWA 4CD8A 1QATA 3IRSA 4GRSA 2RGMA 1TJ2A 4S1FA 4OBRA 3VGEA 1LBLA 4BEUA 5DY3A 4C6EA 2PWFA 4C1NB 3KTXA 2V69A 3HG4A 2Y7EA 1QFEA 4Z2GA 2DQWA 5BWFA 3QMTA 2VEMA 3SRFA 2PDXA 1SO5A 2R8WA 5BZAA 1JNDA 2VC5A 4JNYA 4DXVA 2GJNA 1E9IA 4JTKA 2X42A 1W2PA 5HINA 2PRHA 1A5MC 1JXKA 1MYRA 1RK5A 1TUFA 2OQHA 4ACZB 1SFTA 4U5KA 4A22A 4Z1AA 3LK6A 5ABFB 4AYSA 3WJXA 5GJMA 3EX6A 3ZT7A 4QG6A 3U9IA 3I7RA 2WJDA 2E4TA 3BCJA 2FZ9A 2OJPA 2BTMA 5FJRA 5JXQA 1SSGA 1C8VA 1BKSA 4JY8A 3VKKA 4GBUA 1R0MA 2FTWA 4A3UA 1Q6CA 6TAAA 1MXDA 1WO2A 4NSBA 3JVAA 2CW6A 5TBOA 3GW0A 3AI0A 3W2JA 2BWGA 4IP7A 2YLAA 3EX4A 1ZBWA 1JZ2A 2X0YA 2PTWA 4E3VA 1VFOA 4MMWA 4JNMA 2EPLX 4KWVA 2INEA 3K30A 2PP1A 5A2CA 1MMFA 1XBXA 4WKHA 5BRQA 5A6BA 3GTNA 2BNJA 2QCNA 4EPBC 1BVZA 4IL0A 3W83A 4I9JA 1XC6A 1IEWA 3H2MA 2WZIA 2Q3RA 1TIWA 3EB4A 3H2OA 1K9FA 2E7FA 4J3VA 3P6LA 2BXZA 1WXZA 1JF5A 4I5XA 2PRLA 3IJLA 1U1UA 3F4NA 4DF1A 1TZZA 1AFSA 4RKAA 2WSPA 1PB0A 2FGZA 4YVXA 4M51A 1F3XA 2GVLA 5AC8A 4KGJA 2VURA 1QXLA 1J96A 1TPVA 3CU2A 1DJWA 2CLEA 3CT2A 4YMZA 4NJKA 4HHLA 4Y2WA 3BAYA 1N55A 1YADA 2WVVB 4INFA 3MSYA 5DLCA 1PCWA 4PCSA 4ERGA 3WK2A 3W1RA 3GD6A 1I2OA 3VIMA 4AG0A 1EJSC 3UWYA 3OVPA 4MB5A 4RNFA 1GVOA 1AMYA 4Y96A 3CZ8A 3FYOA 1MUMA 4AX7A 1GOWA 3K8LA 3UFYA 3E0FA 1SU5A 3POCA 3CB3A 4A21A 1A50A 3MU7A 3MHFA 1O5RA 4QLKA 1OB0A 1UR3M 1XYCA 1J0KA 2PDIA 3HG5A 3ITXA 1E73M 2HXTA 2VGFA 1WDDA 3WD0A 2ZC1A 1AJ2A 2WBKA 2IW0A 1AODA 3B8IA 3TW9A 3OGSA 1UZ1A 4KESA 3ZMRA 1W3JA 2FPTA 4HGXA 4WIWA 2GGGA 3T8LA 1OEPA 2G8ZA 2V67A 1VCGA 1EGZA 6A3HA 5HBFA 1IWAA 1XICA 3BQ5A 4S3EA 3WNMA 1D7FA 1JZ3A 2BY0A 3EOSA 3RILA 4AZ7A 5C9RA 1LBMA 2VYOA 3U2OA 4B3ZA 5CZTA 1OFDA 1R7OA 2XN2A 4HPNA 1REQB 1FVPA 3UESA 2HE5A 4ZOEA 3LOTA 5I3DA 1BD0A 4FMVA 3PVFA 3N04A 4JKLA 3SCPA 1PZ2A 3A6OA 4R9OA 3T08A 4KT2A 4S2BA 1X8FA 2NW0A 2YA2A 1JDCA 4J28A 1ZS2A 2BY1A 1KD0A 4JPGA 4KEMA 1E55A 1V6WA 2GJXB 4PRWA 1IZCA 3W1TA 4JR5A 4E4PA 3NA8A 1OX4B 5JQ9A 2B0MA 2DQXA 4AEOA 1WOBA 2VD8A 1EO5A 2VEIA 3O07A 4LUSA 2FB2A 4IF2A 2ZZ4A 3T0AA 4UFLA 4J1OA 4YVVA 4NZ3A 3B04A 1P4CA 2AAAA 3VUSA 4FLOA 4IJCA 4LOCA 5CKSA 2G3MA 4NIRA 4LWWA 4AWTA 4FPSA 5GNXA 1K77A 2D3LA 4KFPA 1BFNA 1QWKA 4MG4A 3CUJA 3ATZA 3W01A 1I2QA 3TFCA 1ISYA 2VHLA 1EZWA 3CMJA 1VJZA 1VS1A 3UCQA 5G4HC 3LPOA 2FTYA 3PS7A 4DO7A 5JVLA 3P62A 3W76A 1E5NA 2GZXA 2W5FA 1TPH1 1WXJA 1HJQA 2C0HA 1P48A 5A69A 3P81A 2V5DA 1IIHA 3W38A 4D8LA 3U7BA 2IQ0A 3N12A 4GX8A 3WLLA 1PHWA 4O1EA 2WZMA 4A4AA 5A8PA 1UD2A 5FJTA 4AEEA 4O19A 3S1WA 3BK0A 5L9FA 1I0BA 3PSWA 4BF7A 3SZ8A 2J88A 4Q32A 1OT2A 3HJZA 1FKWA 4ATDA 2XIMA 3W7LA 4ERIA 5FOOA 3VKJA 5MKGA 3SGUA 3K8KA 3ZLHA 2XH0A 4GFSA 1N2VA 1M1BA 3ABOA 3WQVA 2EBNA 3N11A 2VD9A 4OHQA 1VJIA 2PP0A 3F5JA 2ZYFA 3LQGA 2E9BA 4QDPA 3Q4DA 4MKNA 3AJ7A 2GFTA 3B4YA 3IGHX 4GO9A 1V3HA 1BYBA 2CXEA 1LRQA 4M6UA 3AS2A 2XIQA 3AXMA 5H8UA 4UTTA 4K37A 3A12A 1W9VA 5M3WA 1QNSA 1H62A 3NGJA 3KBVA 3PJTA 2OELA 2ZWZA 1E0TA 1TTQA 5CPOA 4ADUA 1XIFA 3T55A 1JULA 1W9PA 2ON3A 1GW1A 4BQ2A 2BGQA 4OV4A 3KOWA 2C91A 3KBSA 3QC3A 1JCNA 1FHDA 2A79A 2Q71A 3MDUA 2ALDA 1VQTA 3W75A 3KZSA 1OZMA 2ZCGA 2DU2A 3WX7A 1ELSA 3WLRA 2AL2B 4H8NA 4KW2A 1E6NA 2X09A 4D9PA 1LZOA 4ROPA 1VFUA 4RE4A 3TROA 4S2CA 2XGIA 3W1AA 4DIAA 4WR3A 3LA4A 4WY0B 1UWTA 1AW2A 5K4XA 3MT1A 2FZNA 5A8MA 4AH7A 3H26A 1POJA 4CQ8A 5K2ZA 3V18A 4PEKA 2HISA 2QDDA 1YYAA 4J3XA 3TMLA 1I1XA 4MY1A 1NSJA 3BPWA 2NUXA 5GVJA 3N13A 3A47A 3N29A 2GJLA 3LZ3A 2IQDA 3EXTA 1PTDA 5E6YA 4OBTA 1IEXA 5EPDA 2NX9A 1PX3A 3MKCA 2PEVA 3EPOA 4AHPA 5ABGA 3UZYA 2Z24A 2QMJA 3MP4A 1QNRA 5GNZA 3ARVA 3AROA 3SR7A 3TIMA 4TXEA 1E15A 3E0WA 4PMVA 4KPLA 1XGDA 1ALDA 2NVAA 3MKVA 1BVWA 1VB9A 2HNHA 4NJGA 3S47A 4X9YA 4W4QA 1GKPA 3S2CA 4DLMA 4FI4A 3GVGA 3TH6A 4AWUA 2Y7DA 5GPRA 3QKEA 1S2WA 2A21A 4GXMA 1H11A 1PZ3A 5KMYA 3KP0A 4IJBA 2PMQA 3G1XA 3B3DA 4C6JA 5HWNA 2QQ6A 2QPXA 5A3HA 1RJQA 4PGLA 4S3CA 4H01A 2QJGA 3M1ZA 3W7MA 3W7CA 2P0IA 2QF8A 4LS1A 3MW7A 4Z17A 3VDBA 4RDZA 3ITCA 2CZ5A 2ZRWA 2QMKA 3QPZA 2XSXA 2Q8ZA 3EKGA 4L65A 1GGOA 1XD1A 4S39A 4GUIA 2VFHA 1ICQA 4KWUA 2OWWA 5I06A 2GQ9A 3UJRA 2Y5JA 3EMCA 5AZ1A 2BHZA 4H6KA 2Z1KA 4X0NA 5DF0A 1KCXA 4MLRA 3WQ4A 2IKIA 2V68A 1N8FA 1M01A 3GLCA 5I6SA 4MUZA 1P0NA 4Q8TA 2J24A 1TPDA 3N4AA 1Q5MA 3MJMA 4I9MA 3GC5A 1M04A 1XUUA 2R1MA 2WSKA 4JGDA 4RDVA 1A4LA 3SN1A 1U1JA 3O6CA 4WHBA 4H3DA 3S5OA 4UNLA 2WXDM 3N14A 3T0TA 4DEFA 1SW3A 4M81A 4IQEA 1JJKA 3S9IA 2NXHA 1RVGA 2DZUA 3CK5A 1PX4A 3VIPA 4Q4KA 3WMLA 1GOQA 1G5AA 3MC5A 1W1VA 1QNVA 2PWEA 5D02A 3E49A 1G4SA 2WM1A 2EG7A 2Y7GA 5HANA 1B5TA 4EK7A 1TJ1A 3FK4A 3KLLA 4QJ4B 1DV7A 2ZIDA 3BANA 3F5LA 1Q45A 3NQVA 4JYFA 5LKYA 4N9BA 3UWWA 2P8CA 4I5UA 3PZVA 3CZEA 1SVDA 4MDPA 1PDYA 3ECQA 3IJ6A 4NJJA 5LA0A 3N9RA 5FAGA 3ITYA 4AB4A 2G37A 1QOXA 3LGGA 4V2XA 1M03A 2ODOA 1UJPA 3WDIA 1ZRQA 4JICA 1QI4A 3ABRA 2FMNA 4TU1A 3F4DA 3MZ2A 3CC1A 1KBLA 2BGNE 3A64A 4M24A 3R6IA 3LERA 1KXVA 5KEZA 1VHCA 4LV4A 3M0YA 3O8AA 1V3LA 3W53A 4A8LA 4EIVA 1B1YA 4QP0A 2XVNA 1I1WA 4N02A 3P7YA 3G6LA 3SRDA 4G56A 1HKWA 2D2HA 4GI6A 1AQMA 4L4PA 3GQYA 1VGAA 2HS6A 3GG7A 2YL8A 2FPYA 1QNQA 3TWAA 1LRNA 3QTPA 4L9YA 4NJHA 1F3EA 2TODA 4YWSA 1TMQA 3ELFA 3ANVA 3OZMA 3UVIA 1JQXA 3KBJA 4HOWA 3TSMA 2CLMA 2PB1A 4GIYA 4IIFA 3WDPP 3RLVA 5BROA 3FEMA 2O55A 5JIPA 4RE3A 3DHUA 3M6DA 4TV6A 1OX5A 4IQJA 1H5VA 1PZ0A 1YDVA 1SO3A 1VZWA 2VC9A 3WQEA 4I9AA 5ABHA 1CGYA 4HK5A 4EAYA 3TYUA 1XIHA 3G3DA 2WZHA 4UR8A 4UNIA 2OZTA 4ZOCA 3IV8A 4XUYA 3GDMA 3P74A 2RDTA 4TIMA 2CLLA 1A5UA 2QR6A 4LUIA 4IMGA 5T91A 1GOOA 3P0XA 3K5XA 1XRFA 3UW6A 1QOPA 3KZPA 4AUBA 4JTFA 4JS3A 1GT8A 4MM1A 1XLAA 2VEFA 3PWGA 4A6GA 4PCFA 3SIMA 1H7PA 5ABEA 1FUYA 4BQ3A 3WSUA 1XLHA 2RFGA 2XUCA 3UPMA 4QISA 1W54A 3VMNA 2J7EA 1W5MA 4WXZA 3W7EA 4H9TA 1LROA 1VPQA 3ARWA 5MKGB 2WYSA 4XZBA 4GNJA 1KM1A 3GTXA 4LCQA 3FJ4A 4PL1A 2DZTA 3QGVA 1N8IA 2D20A 1AD1A 4H41A 3DN5A 4NZJA 4JOMA 1PZ1A 2JIEA 1ME8A 2Z6IA 2HZGA 2FDMA 5D04C 3DHPA 2E1WA 2A3HA 4K1WA 4DNMA 4K8EA 1JPDX 5FF4A 1OFOA 1A5SA 5G1TA 2CHNA 2ATSA 4DF2A 4Y8FA 3WF3A 4B2DA 3B9EA 3F5KA 1S39A 2O9OA 3H2CA 4Z0JA 3C86A 3REQB 2NWRA 1SFSA 5LNWA 2ACSA 3G1SA 4W89A 1UZHA 2NSXA 1PV8A 2ZUMA 3EPNA 1B57A 2REQA 3CUXA 2JEQA 1C93A 1LQAA 2W79A 2XH4A 3F4CA 1HIZA 3VGFA 1GQJA 3MQTA 1W2VA 2ZZ1A 1PUDA 3BGAA 1L8PA 1FOBA 4Z2HA 1CBGA 4JEQA 3NUKA 3UZZA 1KWGA 3PM6A 2RDXA 1QPQA 2E6AA 1T99A 4UTWA 1FDYA 5KZMA 4LS2A 3A5VA 3EEZA 1WDRA 3BGJA 1WOAA 1QAPA 3B06A 5CLTA 3C2EA 4JX5A 1TSIA 3NO5A 4UCFA 4PR4A 2NX1A 3ZVHA 2QUMA 1ZP4A 5LXEA 4MNLA 4XZWA 3R8HA 1TCDA 3EWUA 1S2VA 1US0A 1JNEA 4XO7A 1GONA 5E0KA 1XSKA 4DBEA 1DWAM 4Q4RA 3RU8X 2E6FA 3LM7A 3CQIA 2X0HA 1EWDA 3AQUA 5AYZA 3TNBA 3BAIA 3I6EA 1YQ2A 1J18A 1YPXA 1FWGC 1XLIA 1KQYA 4CCZA 4FLRA 3PF3A 3XISA 1W5PA 1ODUA 4H7ZA 1HX0A 3LHYA 4ZQPA 4CNPA 4FXSA 1P6WA 2HVMA 3RX2A 3O6YX 4UNKA 4UQDA 4MY9A 2D1ZA 4RXFA 3BLKA 2GJRA 3C2FA 1VC4A 2H90A 1OFBA 4PTXA 4W86A 4F2BA 2C13A 3QW4B 1ZTVA 1O1ZA 1V77A 3KFTA 3TCSA 1PTAA 3QTGA 1B3WA 3NDYA 2R6OA 2VNCA 4JDBA 3TEVA 1R9XA 1J6PA 5TD4A 3L68A 2ZOXA 2DUXA 1IEVA 3S1UA 1TPWA 3GUGA 3JZEA 3ARZA 4ZOAA 4NILA 3IIVA 4HCLA 3B0XA 1FTXA 4JTJA 3DC8A 4A05A 4NYUA 5CPMA 1R2RA 2HK1A 3U5YA 3KCLA 1FWBC 1SFJA 2OX1A 3DXIA 3GWQA 3GVWA 5C2XA 3DG7A 3VIIA 3RLGA 3CL8A 3JRKA 2QCEA 2BVYA 4M0XA 4WY0F 1DIKA 4UBPC 3V4BA 1T0OA 2RUSA 2WSYA 5LNUA 5JU6A 1H0GA 2QEZA 4MHBA 5FACA 4GYPC 2YB4A 3SN4A 2Z25A 1Q8AA 3LI1A 4NZ4A 4V27A 3MZNA 4OJYA 1KCZA 5A2BA 4H9ZA 5I03A 5F4WA 2WHKA 1V3JA 3PP7A 5I00A 2ZBTA 2KAUC 3A3WA 3PY2A 5D05A 1EL3A 4H1ZA 1D8CA 3I6RA 5FESA 2DJXA 2O9RA 3B8TA 2DW7A 3QJAA 2NLYA 3MMTA 1MDRA 4MGGA 2IXVA 2KX9A 3QY6A 1C9WA 1V0MA 2CKRA 4GD0A 2YL5A 3Q94A 4A29A 1BYAA 3QBUA 1SJCA 2VELA 2RDUA 3RITA 3GHRA 2X2YA 5DT7A 1DHKA 2CESA 1JIBA 1BHGA 5F1VA 1RLDA 1XP3A 1TZ7A 4P61A 2O56A 4E38A 1RPKA 3DOPA 5LHFA 4J3SA 1KWKA 3QGAC 2ZZ3A 2OEMA 5GJPA 5HK4A 4JTUA 4E4FA 5HNNA 3R94A 1IT0A 5LHEA 3SSZA 1C29A 5CG0A 4RK8A 2O4MA 3SQSA 1M6JA 4YU1A 1NQ6A 2XM1A 4Y9NA 1ADOA 4M5PA 2OG9A 4ZQMA 1LT7A 3E0VA 3WYZA 2WVTA 7REQB 1CCWB 1NTHA 4HD5A 3R8GA 3AAMA 1EX1A 5DMMA 1ONWA 4ICNA 1HJVA 5M5DA 3PR2A 4CQDA 4F79A 3PJWA 4MZ1A 2X8RA 1DTNA 1V6YA 1KXQA 1JXJA 1XC4A 2WC7A 1M65A 1Q65A 1RP8A 3UG5A 2W0UA 4QITA 2QGHA 4IFKA 2E5DA 3UG3A 3W7GA 2W92A 2CZFA 4MNJA 5HXMA 4D72A 4PFMA 3NXFA 2PTDA 2XG9A 2QUNA 8RUCA 1CXKA 1RD6A 1XIGA 3HJEA 4DLFA 2CZDA 3PZMA 4C6PA 3AMGA 4RL3A 3G2GA 4PN2A 4NNAA 1PL9A 4Q7IA 3RR4A 4UFIA 3FXYA 5HAOA 3W2MA 4PUUA 1E3XA 3EWBX 3T07A 5CC5A 4S3GA 4HOZA 4H7CA 3VGGA 1SQ7A 4FOUA 3VOGA 4V1XA 3QLLA 3W7RA 1MEHA 1XLCA 3H4WA 5C54A 3BW4A 3UYIA 4MFEA 3V5OA 4RPPA 1Q2SA 1FP8A 4DXKA 5D03A 2E40A 5AYBA 4H2CA 1X97A 1F7BA 3IJDA 3BJSA 2ACQA 1Q66A 3GK0A 3QZEA 3W6MA 3SUUA 2PSNA 3RCYA 4LUYA 1W91A 4ES4A 2I5QA 2OKTA 4H4IA 4DXXA 4L5ZA 2V9DA 4NASA 1PKMA 2V5JA 1H50A 4KIRA 3ABQA 1M7JA 3EKLA 4O28A 4OZOA 3AALA 2Y5SA 3KRBA 1WE5A 4FX8A 3WD3A 1DOSA 4BEQA 1LP6A 1G4TA 1U5HA 1IGSA 1E1CB 1W3NA 4BS0A 3CTTA 1B9BA 3QVQA 2Y2WA 4JTHA 1HW6A 2CNCA 2P10A 1K9DA 1JCTA 4JTDA 3K13A 3VKBA 4JKKA 3KBWA 1CGXA 4GY7A 1E3ZA 1TMHA 2QJHA 2AAMA 5I2UA 3EWZA 1VFTA 3PZNA 3T2PA 3NCOA 4PFHA 1LL7A 2WJZA 4LGXA 1XHGA 2XIBA 4PTWA 3S5YA 3F2DA 3W1XA 4L1XA 3NTYA 3I3EA 4RNIA 1EYWA 1GZJA 2GDVA 5CC6A 2P1FA 1D3HA 3QV7A 3WBYA 5LIKX 1W1ZA 3CUIA 3QHMA 3AIRA 3BMVA 2XGBA 1J5SA 3GR8A 1XQLA 1XLFA 1RVKA 1GHSA 4S23A 5A8OA 5D2TA 3BSGA 4XAZA 3BOFA 3CH9A 4MKVA 3N15A 3DKJA 3KOYA 4CVWA 4B3LA 3M5ZA 3VIGA 1HQTA 2BODX 1X8CA 4US5A 4MAVA 3UPWA 2XFRA 2J25A 4O50A 4NY2A 1X1NA 3YPIA 3NAVA 1KTBA 1SZEA 1GQNA 1KQZA 4IMEA 1WDQA 3ZVHB 3SECA 2Z1WA 2CBVA 4Q4OA 4PMUA 4F40A 5FJJA 3MSGA 3L21A 2ISVA 3OIXA 3S4TA 1UR8A 4R7OA 3DZ1A 3SRHA 4QE1A 3NZGA 2AKMA 1EC9A 1UG6A 4C5YA 2XN0A 4IZGA 2PTXA 2XTKA 4DJFC 4F2TA 2DSKA 4RE0A 2VZSA 5FSEC 4BK9A 1CNVA 1WDWA 1ZCOA 1QOQA 4YTTA 1SJAA 4ZXLA 3DECA 3C0SA 2VZTA 1Z8AA 2CLIA 3HBLA 4IPIA 4O4VA 2QLYA 1KXTA 1E40A 1FH8A 4ZEPA 4MWAD 3TDFA 1TWSA 3WNKA 4W8BA 3ORWA 3DAQA 3C2OA 2WMGA 3MHGA 4GUGA 3NQ7A 3W1UA 2J7CA 2G5WA 4F0RA 4YN5A 5FIPA 4NQ1A 5C70A 3RMJA 2OQLA 2DEPA 1ZGDA 4B5SA 3NSMA 4DQWA 1RY8A 1F4HA 1TPB1 4S3BA 3SGGA 3PAOA 3RPTA 4XIAA 2HJPA 5LNRA 1E4IA 3GU1A 2YYUA 3MI2A 2R24A 3E38A 4DRSA 3W84A 2OOGA 3E2QA 4KIEA 1HVQA 3RO6A 1KGXA 3TWBA 5HNRA 1R2TA 3W88A 3FCPA 2ZRXA 2TPSA 1AUSL 2IS7A 4OQVA 3FDKA 3WBEA 1K9TA 1YXYA 1Z6KA 3ZJ8A 5BXRA 2TYSA 4P7NA 3BW3A 4BWLC 4GI8A 4C6FA 4WGHA 1V4YA 2IMRA 3BMXA 1XKJA 4MWAC 1YKWA 4PRTA 4DJFA 5D8WA 1HL2A 2ZFAA 5D4YA 4GZIA 3S8HA 1EA0A 4GIAA 4YLWA 2FB3A 3OODA 2INZA 4MAZA 2E3ZA 3C2RA 4N4PA 4X0VA 1W3HA 1R3QA 5A8NA 3L67A 4J3TA 2PDCA 4PYSA 2BZNA 4J3WA 4L61A 2I17A 5LGZA 4U2ZA 4UZUA 1XYAA 1X96A 3DFOA 4GC3A 2R9RA 1VIWA 3BAXA 4YHGA 3CZGA 3UG4A 1G4PA 3R8RA 2V5KA 3MUZ1 1R8LA 1GCYA 3HPSA 4KS0A 3URNA 1ONRA 3D3AA 3ZR6A 1KCLA 1NWUA 3BV7A 1CEOA 3C3UA 1ZZMA 4QJ3B 1ADSA 3IGSA 3S2LA 5I24A 1UR9A 3KS6A 4GX9A 4FZIA 5LIYX 1Q2RA 1UWRA 3IUDA 4L1GA 4D6GA 1HKJA 1JFXA 2WCSA 5CZKA 3NWRA 4QQ3A 4HOXA 4BA0A 2UY4A 3T81A 1UH4A 3WJWA 3AIVA 4JEJA 4WK9A 2G4FA 2HRWA 1F9CA 1LORA 1JI1A 3SCOA 4HA3A 1J4EA 2XIIA 3OHMB 2UBPC 3IIOA 1TV2A 1SMAA 5D9PA 3KLKA 5FEXA 1V51A 2X16A 3NYDA 2PFHA 2HCVA 3NQFA 1NVMA 4EPKA 3NXLA 3WZ0E 3AIQA 2QZRA 3GZAA 1EUAA 1BF2A 1PIFA 4R34A 1LJYA 2XWEA 4IFKB 5B7ZA 2GVGA 3T0DA 3ITLA 3M0XA 5AN7A 2WZTA 4GCAA 1NIUA 3BLEA 3ZOAA 4U28A 2JKPA 3FSUA 4HVXA 3VIHA 4MNMA 1KRBC 1R3VA 1UD5A 1WV2A 4ZO9A 4NJIA 1IT7A 1EBGA 3MKKA 1T7LA 3MVIA 3HPAA 3CHEA 4IUOA 1YW1A 3N73A 4IFOA 2YCJA 4LNCA 4QS6A 4EACA 4A8NA 1GG1A 2PD9A 2BY2A 3VKCA 4HNUA 3VD4A 1L8NA 5F2GA 4NNBA 5I77A 1E6QM 3NVTA 1A5OC 4C65A 1JCXA 5TNVA 1B4EA 1PYMA 3CV6A 1EDQA 4MNKA 2DVUA 1VH7A 5B80A 4PODA 2YDSA 1WP6A 3CIWA 2JE8A 1AG1O 1CXLA 4LH8A 2J7BA 1A4MA 4M7TA 2Y6ZA 2VRQA 1HP4A 4PTNA 3KRSA 1R38A 4GQRA 1OK4A 1GKRA 3TCEA 4I6KA 1S5TA 4LUTB 3EPMA 3M4HA 3MDWA 5F2MA 1W1YA 5F7UA 4QRNA 4WEVX 2DSZA 3QV9A 2VRJA 2NV2A 3RGTA 1S46A 1ZBVA 2YJQA 4DBUA 1MXGA 4WLCA 1SZFA 2Z1XA 1XIIA 2C1GA 1XIMA 4YWIA 3DESA 4ZB2A 4UMAA 3VCNA 1UPMB 1QW8A 4OU1A 2Y89A 4EXAA 4ZO6A 1NDYA 4GYKA 4MY8A 1AVAA 2JKAA 3R11A 4P7OA 3TN6A 1BG4A 1TCMA 5GNYA 4XAGA 2OEJA 1Y5VA 5T8GA 2EPOA 4AZBA 1LG2A 3NL6A 3R0DA 3EKZA 1EDGA 1D8WA 4ZVJA 3LV6A 3MV01 2GUBA 4HKPA 4MZYA 3VX1A 3KAOA 1OABA 2MNRA 4JTSA 4LF2A 4Q4SA 4ZBCA 3T0CA 1CB7B 3CZJA 1UH2A 1OF6A 1TX0A 3WO8A 1KA9F 4DUWA 1RCQA 1ZALA 4PSPA 2VFGA 3VFLA 4FNTA 1V6XA 4RV3A 1KRAC 1BPLB 2J9XA 1CGTA 1CGWA 5CSYA 4O12A 4HCDA 1ONXA 3CHDA 1TJPA 4F0SA 4G5DA 1W3IA 1MW0A 3ZJ7A 4JDYA 2ZA1A 1CLVA 2Z1BA 4EF9A 3VMOA 3LD5A 4WCJA 4HPJA 1M7OA 1QCWA 3POHA 4AY7A 1RQEA 2V3GA 3M0JA 4LC8A 4NAFA 3ARQA 5AKQA 4QJ1A 5BWAA 2DH3A 1TPEA 2Z7GA 2RAGA 1NM9A 2E67A 1EYEA 3BGGA 1PKYA 4DYEA 4B3KA 1OYCA 2PF0A 4HMNA 4GNKB 3P8JA 2CBUA 3AHZA 2EPNA 3URBA 3W71A 3LNPA 3AZTA 1QI0A 1FWNA 2SFPA 3MBFA 3VFCA 3VNDA 3PBMA 4LYPA 2GGHA 2VQUA 3A22A 2TRSA 3GKFA 3OYXA 4EXBA 1BWKA 1THFD 2WMIA 4GGHA 3UNTA 1GUVA 4F66A 2HPMA 1MNZA 7A3HA 1CWYA 2UY3A 2DZPA 3QSRA 2WQDA 4I3GA 5HATA 4WX2A 1TR9A 3NL3A 1E6RA 3QQ0A 2IPJA 3PPCA 5D2VA 2NVDA 2HK0A 4AU0A 1EWEA 3PFRA 4PC8A 2QUUA 4UFMA 2GSEA 1S2UA 2GYIA 4NXSA 4GVHA 5CAHA 1VF8A 4F4RA 4K8HA 4IP5A 2J8TA 3OHIA 1XD0A 4PUMA 1KV5A 4I6VA 1K6AA 4X22A 2PDLA 4WRHA 2WC3A 4N7QA 4EOUA 5I3GA 2DSUA 1S5NA 3UGVA 1XL9A 3VIFA 1CENA 4DBDA 3CZKA 5JMUA 3CV2A 3GDKA 3ZWTA 4CVUA 3VCRA 1WKDA 1O66A 4PCNA 3CWNA 5I5RA 1SPQA 2P50A 4TR9A 5E6ZA 1UJQA 3LXCA 1ZAIA 3J7HA 5CGMA 3FX4A 2X7WA 3SUTA 3HFTA 2YBUA 5LSMA 3RLHA 3UWQA 3H53A 4N42A 1XDLA 1QI5A 2Y70A 2O7QA 1UUMA 1XPYA 3NZRA 2J6VA 4Q8WA 1YPFA 1P7TA 4DWSC 1MQRA 2GSJA 3IGXA 3AIEA 3SGZA 3UCCA 1YLVA 4JTRA 3UVAA 3U3HA 4RNJA 3VDAA 1Q4NX 4NXKA 3W2LA 3TA9A 2CFFA 3RX3A 3HMJG 4M6QA 1QBBA 4IQLA 2ZX5A 1CXIA 2WCGA 3BH4A 3ZT5A 2YR1A 3NQ8A 2HVNA 1C7SA 3SCTA 1XSIA 4QG9A 1V08A 3VNMA 3WBWA 1LF1A 3GDRA 1RSCA 2WW5A 5HULA 2ZX9A 3ZM8A 2AL1A 1C8QA 3FYYA 3W6LA 2D2GA 2D2OA 2J47A 4EWND 2VGBA 4DBWA 3U6WA 3QEZA 3KL5A 2WVUA 3HPZA 2XDFA 2GLKA 3ES7A 4AY1A 1YXDA 1YMYA 5CZSA 2OT1A 2G96A 2G3JA 1OFRA 2WBGA 4XZ9A 1XH0A 2F8QA 4BF9A 2C0AA 3SY8A 1Q7ZA 3VNYA 1O5QA 3W07A 1F73A 3TAKA 4XZMX 5A6MA 2VDGA 1DJHA 3AHTA 2DDXA 3W25A 4ORIA 4CNOA 4DWSA 4H9YA 3OEXA 2P5NA 3M44A 1GPFA 1LUCA 4KEVA 4L4LA 2PDJA 1CX9A 4HN4A 4E2OA 2YPIA 1PIIA 4BFAA 1L0PA 1QMLA 1PBGA 2F9RA 2JKEA 4N9EA 3IK2A 1UBPC 4GPNA 4L1WA 3GVRA 1MO0A 3N4EA 3PBWA 3K1GA 1LDCA 5AZ0A 1B4KA 1QR7A 3VOHA 2J75A 4LAZA 2B7PA 1A5CA 1E0UA 2QULA 4QEEA 3S0CA 3W28A 3IACA 3RF9A 2E9LA 3V0UA 4JFWA 4LAUA 4O8RA 2OODA 3WEOA 3BVJA 1QHOA 2FFIA 2O9TA 4GI4A 3RM4A 3LY0A 3B4UA 5K9CA 3CLWA 5EKYA 2CIPA 5I3HA 3CL6A 3S9YA 1XIBA 4X2PA 1IQ8A 2HBVA 3QYQA 2VGIA 2D73A 5C9XA 2OTDA 3S3GA 1DP0A 2F84A 3WH7A 4GINA 2EEXA 3I3DA 3NQAA 1HKMA 4OOUA 2DW6A 1WBHA 4OFCA 3CUHA 2Y8VA 3QZ6A 3RDKA 1G94A 1F8IA 1QO5A 3USZA 2GUYA 2A5HA 2VTFA 3D46A 3UBPC 4HHHA 2YCIX 1X7IA 5BOEA 3OZOA 4O52A 4HZ7A 1IWPA 3EA2A 2XJ7A 3EWCA 4O10A 4NAEA 2CERA 4HPGA 3FEQA 5CPLA 4B16A 3WLKX 4PSRA 4E2DA 4D1IA 1EZ2A 4AQLA 3WUBA 5KETA 3GS6A 3QZAA 2PE4A 2GUUA 3R1ZA 3E1F1 4AIEA 2YFOA 5C5YA 4C1NA 3N2CA 1LQ2A 3D0CA 4TX8A 4B9YA 3TR9A 3TJ4A 3F7JA 3NSXA 3UZXA 1FCUA 3GIYA 2W3ZA 4Q4PA 5REQA 4WVXA 3WF0A 1BF6A 4C1LA 3W82A 4ZOBA 3H4GA 1VPXA 4HSOA 3ZR5A 3WJSA 1HJWA 4JKMA 4E8DA 4A3QA 4A8RA 4HA1A 1KM6A 3GUWA 4K38A 2YZRA 4AFYA 3VD3A 1KM5A 3PPFA 2PGFA 2J74A 4ZFMA 5DCBA 2YL6A 4M6VA 2J4GA 3QHNA 1NP2A 5FJOA 5ABFA 1AW1A 4JIHA 5MHBA 3CH0A 2ZQ0A 3LQLA 2CLOA 2FJKA 3NO1A 2VUNA 1KNWA 1W3LA 1GYLA 3B05A 3PZGA 4RLIA 4AHOA 1TELA 3CHVA 4C6KA 3WLSA 3OA5A 4YL2A 2EO7A 2I16A 1W0MA 1KR0A 2HSAA 4Z2JA 4JXCA 4IGNA 1TTIA 4PL2A 5BYWA 3VDHA 3CM4A 4C6BA 3C0QA 3DUGA 5LNSA 3FOKA 1O1HA 8TIMA 3N25A 4HT3A 2XN1A 5BXTA 5LGXA 3GNPA 4PB5A 1V3IA 3ALGA 5EB8A 8XIAA 4PRRA 1XLJA 5CBJA 3B0UX 1KR1A 3SURA 5DMNA 4GG9A 4UMCA 1TKKA 1JYXA 1KFCA 4GABA 4AVOA 3WQ5A 1S2AA 4IPJA 1DE5A 3MCNA 3NPWA 1QK2A 1MDLA 3PSVA 3QV8A 3RJXA 1KRMA 3QYSA 4FR6A 4QDMA 4IIGA 1C9DA 3A3XA 1R3RA 1YX1A 5HMEA 3UETA 1X38A 3NZ1A 2PZ0A 2ZRUA 1UPPA 4UOJA 3VTRA 1R3WA 4WSHA 4QROA 3SCQA 3CHCA 2PD5A 2PLKA 3QMSA 1OGSA 5AC7A 4AC7C 2ZICA 3RPMA 4N6FA 2VVNA 1KV8A 4BI5A 2NX3A 1XF0A 1ITUA 2CHOA 2WMIB 1F4AA 4XAPA 3HURA 5BW6A 3RU6A 4NZCA 1ITCA 4YIWA 1A0DA 3O7UA 3A23A 2V3DA 3TQVA 3AXIA 3VA8A 3WJZA 4PMDA 1O12A 4X9SA 1H7XA 2A3BA 3RN6A 1L9WA 1LCOA 1H41A 5EU9A 2XVPA 3VOCA 4K68A 5FL1A 3VPLA 4JFTA 4WOQA 1EJUC 1R3YA 3IVTA 1V7AA 5HQMA 4FNRA 1P0DA 4DELA 1SR9A 4XQ6A 4CD7A 3W2UA 2J8GA 3V36A 1SR0A 3FAWA 1EPVA 2OCZA 1UIPA 2VZOA 4PCPA 1CGUA 2DSVA 3QV6A 4HK6A 4LEQA 2ZZ7A 4HA4A 4DJDC 4A8IA 4ZO7A 4KWWA 6REQA 3APYA 4AZIA 1S2CA 2WJFA 3VMPA 3LN3A 1XIJA 3CLMA 2QCFA 4FS9A 1CGVA 1UWUA 1EJWC 2GK1B 3E5PA 1EXPA 3GXMA 1P7TB 2RJHA 1MW2A 2QT3A 7XIMA 3W7KA 3DG6A 4QLLA 3G24A 1EIBA 1ZP3A 3L65A 2IKJA 5G2HA 2ZXBA 1REQA 5CQ1A 3TOPA 3PZ9A 3WN6A 1IR2A 1R87A 2ZXAA 4GVIA 3PZTA 3ARYA 3WQWA 3CJPA 2UY2A 3A24A 2OLHA 3U5UA 3ARXA 5G1MA 2GWGA 1JCJA 1JYWA 3V0SA 1I4NA 4L64A 1S5MA 4UQ9A 5IHSA 2V2CA 1EX5A 5HJLA 4L4MA 1OX4A 1U83A 2PTYA 2EGZA 3CASA 5C7VA 1OCJA 1EKOA 3OBKA 3M0HA 3VDCA 2QPSA 3WNPA 4Q4QA 1H0IA 3T42A 1TRIA 3IIPA 2PF8A 1Y5WA 4ERAA 5L6UA 4O8AA 3SDOA 1CXEA 3GFZA 2Z4GA 3WLJA 2PDMA 4RZ5A 2PCQA 4Z1CA 6ALDA 2BSLA 3FSTA 3VNKA 1Q6LA 3UYCA 4DJDA 4F2UA 3DH7A 5A6SA 5D2XA 1Z42A 3AS3A 3GTIA 4OGZA 4UC5A 4RX0A 4XWUA 1MQQA 3C61A 1JZ4A 3HB9A 3ZIZA 3N6QA 3B9DA 1UOZA 1XG3A 1R7AA 4JTEA 3G6MA 4GQQA 2OSYA 3L5LA 2MUCA 3NL5A 1LUCB 3FAXA 2PC8A 1BWLA 2A4AA 5HWJA 2FHFA 3BAJA 2AMXA 3KUMA 7TAAA 2XSAA 2QJIA 1IXNA 3KX6A 4E8GA 3ANUA 1MSSA 1A3HA 3O3RA 4DNHA 5A6BD 1EXBA 5DMYA 5F4XA 4C1KA 1IIGA 3MCMA 3MA8A 2QJNA 2A3CA 3G8EA 4QR6A 2RHGA 2Q01A 2CXGA 4W7UA 1G6CA 3H2NA 3APGA 2BXVA 1YNQA 3A4XA 3P67A 5AHIA 4NRRA 3MMDA 2HTMA 4TVDA 5BMWA 4PMZA 2EJAA 3HGOA 1DORA 3GDBA 2OWCA 1EP2A 3UEQA 2YYTA 5LA2A 5I79A 3IUHA 3OLGA 4LCRA 4FX7A 3AXKA 4XBSA 2NZLA 2MANA 1P5BA 4JY9A 4HBKA 3GKAA 2JBMA 4HYWA 2WV8A 4NNCA 4O11A 3W72A 9CGTA 4NZFA 3HU7A 2WQPA 2O92A 2UZ9A 3URAA 3SB0A 3G0SA 2HVOA 4PMXA 1ZLPA 1TIMA 5AYIA 2ABBA 3AZSA 1XS2A 3RR1A 2PDYA 5EMUA 4YCOA 1I9CB 2IUZA 2EXOA 2Y5EA 4HP5A 4PULA 2A1YA 2R1PA 3RCMA 2QCHA 3GNNA 3KCOA 2VFFA 1H7NA 4FEZA 3GTHA 4ZGYA 3K8MA 2ZUSA 3TC7A 1VRDA 3FS2A 5IRPA 4B4FA 1S3TC 1MEWA 1TR1A 3TYCA 2AL2A 5CJNA 2CWXA 2CCRA 3KE0A 3OLDA 1G1YA 1Z41A 3URQA 3PB2A 5REQB 1YDYA 1F74A 4W87A 3BLOA 3QY7A 5CPNA 3FVMA 4IQDA 1T8QA 3P8IA 5EMJA 5IM51 2JGQA 3LCXA 4WY0A 3HIJA 3O9NA 4Q33A 3N4FA 4I8DA 5G4WA 2W9MA 3ABSA 1P43A 2VGGA 3T1GA 4BY3A 1G4EA 5DMLA 3AYVA 4W8AA 1WAWA 3KVLA 4DPPA 3KL3A 4H8HA 3V16A 4JX6A 4RW3A 1XISA 3I4EA 3W7PA 2VFEA 2QF7A 1Q7QA 3CV7A 3Q2DA 1OFPA 2GOUA 5E93A 1FDZA 5KINA 5D33A 2C71A 1OC7A 4G7EA 1QI2A 3WLNA 4ZE4A 5KZDA 3TTEA 4V28A 3C6CA 3N2BA 1EGMA 3ONCA 3U7VA 4JTAA 5IBXC 3GYEA 2OFJA 3UCDA 2VT0A 4G8TA 4QAIA 1GTEA 3WH6A 2BDQA 1I45A 2XIOA 4PH6A 5CJ5A 4E3TA 2ISWA 4XISA 5BNKA 1IXQA 4P2VA 1POKA 3ZQ9A 2BASA 1UROA 3DBPA 2OU4A 1W9XA 4O0KA 2NUWA 1JPMA 3PULA 1NF0A 4LX4A 4KKXA 3L4VA 4Z1YA 4HNVA 4IG2B 4RZ4A 4ONVA 1JAKA 4E4UA 1UQZA 4GBDA 4UUIA 1L6GA 5H8MA 4IIBA 4S3DA 3V7PA 1T6MA 2DUZA 3W74A 4RXGA 1WKFA 1P1XA 3T05A 1W1TA 2GVYA 1UZDA 3U57A 4N4QA 2HXUA 3L4WA 3FYPA 4XSLA 3QKZA 1T5AA 3FJNA 3SJ3A 2YOCA 2BS9A 3SFKA 2WPGA 3ES8A 4DAIA 4KCVA 4XD6A 2Y88A 1NOUA 9RUBA 4DJEA 1F8MA 3LXAA 1ISVA 4IPPA 2VZVA 1OD0A 3ATYA 2D24A 3WQ8A 3H22A 4M8UA 4L80A 3ZLFA 3DFQA 2JIWA 5CC3A 1GOIA 4JCLA 5CJMA 2QKFA 3W9ZA 2CZEA 3DIPA 3MUIA 3KRUA 3UXAA 3TW6A 1X6LA 3R0UA 1BSIA 3G3MA 3PG8A 5AVNA 3F4VA 4GUFA 4LNYA 1V79A 1J2BA 4OVXA 5IBXA 1OFEA 3CEUA 3K4DA 2PZNA 2A85A 1UKQA 2FDSA 2PLMA 3H54A 1DJXA 2Q6ZA 2RH9A 2PGEA 3BTNA 3ZFHA 2POZA 2VDHA 2BG5A 2G97A 3W7DA 1FCQA 2OYLA 3PJXA 3OU8A 1SGJA 6REQB 3P3BA 1UZ4A 1XGZA 2X1TA 3MO7A 4QX4A 3DERA 1C92A 3AO0A 5FJUA 5EMYA 3BAKA 4GZ7A 1EDTA 3W81A 1GJPA 1MRAA 2NUYA 1U5VA 5I78A 4GJIA 1WPCA 3QGKC 2VCCA 5HPCA 4IT1A 1F76A 4F9DA 4DZ5A 3VCCA 4PBGA 1UD8A 3RX4A 3QSTA 3UZWA 1OWQA 4QAWA 2X0SA 3WJYA 3AISA 1EOKA 1D7KA 3HFYA 3S1VA 1RBAA 3CAWA 3EWWA 4P8WA 1Z3NA 4GKLA 4LVGA 5E9XA 3CAKA 1ECEA 3CYJA 1NH6A 5GJNA 1YE6A 4GXWA 1FWWA 4ORMA 2R14A 4QCEA 1AL7A 3NR0A 1XBZA 4UOZA 1OX6A 2OX4A 3DHDA 1HG3A 4HA0A 5EFDA 1E71M 1DJIA 4OIFA 1B2YA 4PE8A 2E6DA 2ZRVA 4AX6A 2BVTA 4HSHA 3DFYA 3ITTA 1LWHA 2HEJA 1DYSA 2E68A 1LOSA 3VU2A 3CGTA 1UBSA 2XZ9A 3KDNA 4UTTC 3GAYA 1UR1A 4MB4A 5EL1A 3ID7A 1HKIA 3JR2A 1PJ9A 4EE9A 1RP9A 4YNGA 2D2JA 1LLZA 2CEQA 3WDHA 1O6IA 3WQFA 4WQ6A 4H83A 4IHCA 3BV4A 4GY0A 3KS5A 1ECQA 4LVFA 3VIKA 4UQBA 2GOKA 3IARA 3NFUA 4DI9A 4CUCA 4I90A 2RGLA 3MSDA 3P2VA 4UB9A 2Y24A 1OYAA 1V0NA 3VABA 4EXQA 2UY5A 1HGWA 3OW1A 3PWAA 4X2RA 1M9HA 1CIUA 2E5BA 4HPXA 5EYWA 3PTDA 1DJYA 1E56A 4D6CA 5I7GA 3W27A 3SCUA 2WOQA 5FI8A 5ECUA 4MJMA 1JR1A 1R6WA 1JL8A 4RPQA 3PTQA 4AISA 3VYLA 3AJXA 2FHBA 3HMCA 1IV8A 4AF0A 1FWEC 3QR3A 5LXXA 3WFLA 2Y1HA 3MP3A 4M1BA 3H6OA 3EDDA 1IHIA 2GVJA 1MZRA 1AMKA 2CZVA 4REQA 4FP1A 4U3CA 3SO7A 4ENLA 4ZB0A 3KP1A 2BV9A 3OB8A 3SCNA 1YE4A 4F8XA 4XTDA 3M5XA 3DYPA 4JTTA 4MF4A 1WZAA 2XYLA 4IPLA 3GB6A 1B90A 4O54A 4UQAA 3W6YA 3W0KA 4OWGA 4XBKA 1VYRA 1W5QA 4B92A 2PRMA 2FGLA 3TSBA 3VE9A 3REQA 3FA5A 1Z32X 5EBUA 1G7UA 2IPFA 1Y0EA 3F2CA 3ARTA 3GBDA 5I3FA 1P0EA 1XINA 2WB5A 2WVSA 1W3KA 4OUIA 2YXOA 5TF0A 1ONEA 2C7FA 3SUWA 4QBXA 3VC6A 3BDKA 4GZEA 4DX3A 4TX9A 3LENA 4JIPA 3BMWA 2OZ0A 2WPBA 3GE7A 4U10A 1EFZA 4Y8EA 3TQ0A 4DB7A 1ZENA 3E0LA 2BOEX 2QUTA 3CO8A 1L6FA 1U5JA 3W3OA 4Q22A 3C5QA 1PWMA 3LGEA 5AVHA 5H91A 3C3NA 1TTPA 3CUGA 4E2BA 3GW3A 2WKLA 1XCWA 3P80A 3H7RA 3W7OA 3LG3A 1E1FA 3BW2A 3MHUA 2DV0A 5I07A 4BJHA 1LLOA 4J9JA 2YLLA 3QN3A 3PZQA 3ARSA 3WQ6A 1NU5A 4H9VA 4PB4A 3LS9A 5BRPA 6TIMA 3OGVA 4ZODA 3W2NA 3TTQA 1OFQA 2QXWA 4GK8A 1Y7VA 1W8GA 4QM1A 3M47A 4FR1A 2Y0FA 2VL4A 3CPUA 1XQKA 3KOXA 1PEZA 5G4EA 5J8LA 1V7YA 5JUVA 3LCGA 4W7VA 4G7EB 4QSFA 1FWTA 3LLDA 1J8VA 3ITOA 1H4PA 3KDOA 2PU0A 5FKYA 3QMRA 1E4NA 1VIZA 3H2AA 1TWWA 2C15A 4C6OA 3FY1A 3CB8A 3UJSA 4ZQOA 2QAFA 4HNOA 5D2YA 1KBKA 1TQJA 3GFYA 4L6DA 1IXOA 4IIDA 2XZ7A 1LOLA 1P0KA 3MWCA 5FAJA 3L4XA 1HKVA 2IKHA 4DWDA 3GDTA 1K03A 3O16A 4D1JA 3LSCA 2QNEA 2FVKA 3AIWA 1KTNA 1WZLA 2DZBA 4Q6XA 1V0KA 2BB0A 2Y7FA 4K8GA 3VGBA 3IUIA 3TYZA 3STPA 4J35A 1K6WA 2CPUA 1RV8A 1OIMA 2QIWA 2J79A 4EPDC 3LBCA 2WNNA 3V1PA 1PTGA 3VILA 2VFDA 2V3FA 3TUUA 2A7PA 4Q8PA 4X61A 4KRTA 1EH9A 4ZCWA 4YTQA 3V75A 1JUEA 4LT9A 4RDWA 4AIOA 2FZDA 3IJ9A 1TV8A 3GVVA 2ZUVA 4GH3A 4Q7NA 2C1HA 4IJRA 4BI6A 2W27A 3GVQA 2V8ZA 4AD2A 1OQFA 3MI6A 3XINA 3V1HA 3LPGA 2V30A 4CN6A 1GVYA 3L0GA 1BLIA 1I8JA 5LA1A 3C0LA 4JBRA 3JUGA 3LHWA 3AHXA 3THAA 3WQPA 1EP1A 5CPSA 3VM7A 4S3AA 2F6XA 2VR5A 3A4AA 1W17A 2EHHA 4C6CA 1V3MA 4XD5A 4GISA 3SCVA 2TSYA 2A6NA 3XIMA 1K70A 4O57A 2O0TA 5GQBA 5HUPA 3GH7A 1UR4A 2XHYA 3HGRA 1IZKA 3FKKA 2AGKA 3KRZA 4O18A 2XFFA 3GXTA 2PAJA 3PJUA 3G77A 4J5NA 1T96A 4FB7A 5IFTA 4QNWA 2ISSA 2WLZA 2BGSA 2TMDA 3KTSA 1PDZA 4LYQA 3TTSA 4UQEA 1XLLA 1UASA 5IFPA 4NZ5A 4C5ZA 2WSQA 1OY0A 4GQGA 4OECA 3HQPA 3NQBA 1QJWA 1AA1B 3WMBA 4K1GA 4FLQA 3GSMA 3H2FA 2Z29A 3ICJA 5CZ0A 3I3BA 4XKYA 4B2DD 3GDLA 4LCSA 5EBAA 3D6NA 3A4JA 1Z9AA 2WSRA 1QPKA 3Q58A 3RIKA 3UR5A 2ZX7A 1E6ZA 5EY5A 1GHRA 3RRAA 4PZVA 2D0HA 5DBTA 4ZQRA 3MANA 5A2AA 2J13A 5K4ZA 1OINA 3TA6A 1FFQA 1K4HA 4A35A 2J7HA 3O0KA 4TTUA 1H51A 1X7FA 3PUGA 4UTLA 4TMCA 2VO5A 3LB0A 4N0RA 7REQA 3F2BA 4N6EA 1XBYA 1VPYA 1PCKA 4TMBA 1V8EA 1H60A 1Z7AA 3DFPA 1VP5A 2W63A 2CHRA 3SEPA 1E5JA 4GKTA 1JI2A 1FHUA 1MI3A 1WUEA 3E02A 1ADDA 1PYFA 4XD4A 3AUJA 5CCZA 3B9AA 1GPWA 1XXXA 4F48A 3PG9A 4UFHA 2F6KA 3RPDA 5LIXX 2CC0A 1B3OA 2CYGA 3I65A 3THQA 4C6DA 3NGFA 1CLKA 1FHVA 4M7SA 3NO3A 4D2JA 2ZWYA 3SCSA 5H8PA 5AY7A 3DI0A 5AOUA 4UFKA 3E5BA 1XH1A 4FALA 3PNUA 1RY0A 2OMAA 1UKTA 1CECA 2FLIA 3L5AA 3MPGA 2ZUWA 4ZE5A 1EHAA 2PLCA 2VWTA 2OSWA 1J93A 2ZC8A 4GNVA 4KEZA 4DO5A 4PA8A 4DZHA 1QK0A 3L4TA 3CMGA 1DHPA 1NF7A 3CO4A 3B8VA 1TWIA 2PU1A 3OP2A 3M5VA 1KGWA 4O1CA 1I2PA 2HS8A 4GJJA 1MFUA 2ZTJA 3NQDA 3BG9A 3C4UA 1FKXA 1W3TA 4X3ZA 1JUKA 2ZA3A 1BTCA 2KZHA 2CLHA 1FXQA 1R9YA 3EB2A 1QPNA 3QXBA 4OT7A 1NWTA 1KFJA 2H9AB 1U1HA 3QY8A 5M03A 3QC0A 3UT0A 3E2VA 4AEFA 5DANA 3WELA 2CITA 3N1AA 4UTWC 5FEZA 3MTWA 2PBGA 2GQ8A 3B97A 3OG2A 3I7SA 1J0YA 2D23A 1PS9A 1WYIA 3SQMA 4AF0B 4KRUA 1PXGA 3NNTA 1UYQA 2ALRA 1SZGA 3NQEA 4LB3A 4RCXA 3IVSA 3NDZA 4FXJA 1W9DM 2Z1SA 3OG3A 1E1CA 4REQB 1W9BM 2B7NA 3L12A 2XINA 2QAPA 1US2A 3PUOA 3COTA 4U3AA 4PUWA 2OLSA 4LVBA 2PBOA 4AD1A 1OHLA 1TA3B 2V38A 4W88A 2XFYA 4P7RA 1HZYA 1J6OA 1GG0A 1I2NA 3AYSA 3CWOX 2WNWA 2X1UA 1Q6FA 3LM3A 3GIPA 2OT0A 4PTVA 1Q6RA 4LAOA 3WLHA 3AWOA 3K46A 2XVKA 3W7QA 3OVQA 3WDQA 3CV1A 4JQ2A 4M19A 4GA8A 1JPKA 1F6KA 1L6YA 2H6RA 3BQ6A 4WZHA 2YB1A 3TYBA 1Q6GA 3IEBA 4ATLA 3NURA 1LQ0A 4HMEA 1E70M 3S2MA 3SCWA 1JZ8A 4IP4A 3H24A 1Q7MA 5DXYA 2CETA 4UFJA 4P8XA 4C6QA 1JPIA 4XZNX 4CU6A 4MSSA 2VWSA 4V1YA 1FFRA 4WDUA 3T44A 1MXSA 1Q8JA 2BVDA 4OOZA 3JS3A 1TMLA 5BXPA 4IMDA 3GXDA 1TV3A 1XPGA 2DVTA 4GIEA 1JFHA 9XIAA 3STFA 1XDMA 1DWIM 2Q8LA 1FWHC 3RHGA 3QRHA 1FWCC 3R4IA 4N9DA 4XG1A 1CTNA 3IJ8A 3WDJA 1KLZA 2R91A 1TV5A 2H3DA 1IF2A 3S83A 3CHFA 3W37A 2XSBA 3HM7A 3GU9A 5DBUA 1JYNA