3K4WA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein Bb4693
publication title CRYSTAL STRUCTURE OF Uncharacterized Tim-Barrel Protein Bb4693 From Bordetella Bronchiseptica
rcsb
source organism Bordetella bronchiseptica
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3k4wA00
3MSRA 4NG3A 2Y1HA 1K6WA 3F2BA 4L9XA 3GG7A 4EPKA 4C6JA 4PBFA 4ICMA 2QT3A 1PO9A 4AC7C 3D6NA 4INFA 4XD4A 4H00A 4QSFA 1FWHC 2PGRA 3F2CA 2AQOA 1S3TC 3LSCA 2I9UA 4LCRA 3FDGA 4HJWA 1QXLA 4C6NA 2HBXA 4BY3A 4G7EA 4H9MA 1ZZMA 4E3TA 2FTWA 4IFRA 4KERA 3A3XA 4ZSUA 1EJTC 1UIOA 3E2VA 2XIOA 1I0DA 1DPMA 1J6OA 3FEQA 3T81A 3WYZA 5CH9A 1RA0A 4DZIA 4H9ZA 2ICSA 4ERAA 5G4HC 3PANA 2Z26A 1FKWA 4QTGA 1M65A 4C6QA 2VHLA 4IG2A 1FWEC 3MVTA 3SFWA 1YBQB 2GWGA 1UMLA 4C6EA 2O4QA 4GOAA 4XD6A 3WZ0E 1YMYA 2GSEA 4C6KA 2Z24A 2I5GA 4QS6A 3O0FA 4C6IA 3S2JA 4DI9A 1R9YA 1EJVC 1V79A 2YB1A 5HMFA 2Z25A 4UBPC 1A5NC 4HK6A 4CEUC 2YXOA 4J5NA 4TQTA 3UPMA 4LAKA 2P53A 4GY1A 4PCPA 2EG8A 2Z7GA 4Z42C 1EF2A 4V1XA 3B40A 2G3FA 2E25A 4RE0A 1RJRA 3QY7A 1FWDC 3TNBA 3GTXA 4J2MA 5FSDC 3GU9A 2R1LA 2VC7A 2P50A 3F4DA 3UR5A 3PAOA 2OQLA 2PGFA 1PTAA 2ANUA 2HQAA 1POKA 4NP7A 3CJPA 1BF6A 3KM8A 1EJUC 3MKVA 1A4MA 1WXYA 3LA4A 4DZHA 1J5SA 3MDWA 4I6VA 3E74A 1RJPA 1EJXC 2FFIA 3N2CA 4DLFA 2Z29A 4KETA 2Z2AA 2EG7A 3RHGA 3DC8A 4H9TA 4WVXA 4DYKA 1UBPC 2YZ5A 3HPAA 3IRSA 4RZBA 1POJA 3OJGA 2CZVA 4C5YA 1IE7C 3K2GA 4F0LA 3F4CA 4H9XA 4G7EB 1UIPA 3ICJA 1K70A 4EPDC 4R88A 3QGAC 4IGNA 4LCQA 3ORWA 1EJRC 3IPWA 4IGMA 3AU2A 2QS8A 3AU6A 1YIXA 4LAMA 3OOQA 1RAKA 1PB0A 1XWYA 1M68A 1A5KC 2R1PA 3EWDA 3BE7A 4BKNA 4CQBA 4C6BA 3OU8A 1RK6A 4B90A 4IFOA 4XAGA 3DCPA 4XD3A 4I6KA 4IG2B 2UBPC 4XAZA 4H01A 3E0LA 3S2LA 4GXWA 4QRNA 3T8LA 4RDWA 3LGGA 4KQNA 4WGXA 4PCNA 4IF2A 3OQEA 1A5LC 2PUZA 4MUPA 2WM1A 3PNUA 4LEFA 4OFCA 1JGMA 3G77A 3MVIA 4C65A 4F0RA 1FWBC 1E9ZB 1NFGA 1GKQA 4YIWA 2QPXA 4XAYA 1EJWC 3JZEA 2D2JA 3QY8A 1RK5A 1O5RA 5A6TC 4ERIA 1NDYA 3SO7A 3IACA 1PSCA 2R1KA 4H9VA 4B3ZA 3MPGA 5HMEA 1ONWA 3AUOA 2Z27A 4PBEA 3OODA 4C60A 3ISIX 1FWIC 1A5MC 3HM7A 5LXXA 2QVNA 3DUGA 1V77A 1RA5A 4D8LA 3O7UA 3NQBA 3EWCA 4CNTA 1R9XA 2DVTA 1KRCC 3FDKA 3LU2A 3R0DA 3URBA 4R85A 3F2DA 2GOKA 3IV8A 4C6DA 3LS9A 1K1DA 2OGJA 2YB4A 1NDVA 1XRTA 3CAKA 4C6OA 2EG6A 3URNA 3QGKC 3OVGA 1FWCC 1XGEA 1FWAC 2HBVA 4R7WA 4GK8A 1EZ2A 1RJQA 4P5UA 2OB3A 2ADAA 1GKRA 2GWNA 4QS5A 2VM8A 4V1YA 1W1IE 1P6CA 4BJHA 4XD5A 1HZYA 3ITCA 3GTIA 4F0SA 2GZXA 3NURA 4B92A 2FVMA 2DVXA 1FWGC 3CS2A 4HA0A 2A3LA 4J35A 4C6LA 1EYWA 1ONXA 2RAGA 3MJMA 4ERGA 3QY6A 4IH3A 3IJ6A 4CQDA 1I0BA 4KIRA 3URQA 4CNUA 2WJFA 1KRBC 2ZC1A 1V7AA 3E3HA 4HK7A 4IQJA 2F6KA 1ITUA 4CEXC 4LALA 1J6PA 3TN6A 1NDZA 1O12A 4B91A 1QW7A 4LFYA 3ID7A 3S2MA 4CNSA 1A4LA 3RCMA 1R9ZA 4NI8A 1A5OC 3GU2A 3PBMA 3GU1A 3UR2A 4DO7A 1M7JA 4EP8C 2IMRA 1P1MA 3LNPA 4KEUA 1FWFC 2FVKA 1EJSC 4GYFA 4GZ7A 2HPIA 4H9UA 2AMXA 4LH8A 4KESA 3UF9A 3B0YA 2HPMA 3LY0A 1P6BA 2WJEA 4IFKA 2VC5A 4DIAA 4HK5A 4XAFA 1YRRA 1NDWA 3GUWA 4RDYA 3K5XA 3A3WA 3NEHA 4ZSTA 2OOFA 1VFLA 2O4MA 3UBPC 4LANA 4CQCA 3S4TA 3E38A 2WJDA 3IGHX 3GIQA 4EPEC 4KEZA 4UB9A 3TN4A 3K4WA 4C6CA 2R1NA 4M51A 4AQLA 2UZ9A 1WXZA 2VR2A 4KF1A 3S2NA 1ADDA 2PAJA 2VUNA 2Q09A 3IARA 4C5ZA 4RDZA 4QROA 1J79A 3WMLA 1KRMA 4GY7A 2BB0A 3RN6A 2KAUC 5AKQA 1KRAC 4C6MA 3GIPA 4RDVA 3LSBA 3T1GA 1YNYA 3EGJA 4DNMA 4L6DA 1FKXA 1V4YA 2OODA 3PNZA 1ITQA 2PLMA 3GTFA 2E1WA 3TN5A 2Z4GA 3MDUA 4GBDA 2HNHA 2Z2BA 4DLMA 5FSEC 4C6FA 1GKPA 2W9MA 4GC3A 4LAOA 2Q01A 3TN3A 3A4JA 5E5CA 4GX8A 3LGDA 3B0XA 3E0FA 4GY0A 1E9YB 3GRIA 1KCXA 1YBQA 4KEVA 4GX9A 2BGNE 3GTHA 4DI8A 4JOMA 2FTYA 4EPBC 1FWJC 4LCSA 4H9YA 4WHBA 3C86A 1XRFA 2AQVA 5HMDA 2Z00A 4PE8A 4G2DA 3URAA 3HTWA 1V51A 4C6PA 4IFKB 3MTWA 3RYSA 2D2GA 2R1MA 2DVUA 2D2HA 3V7PA 2Z28A
chains in the Genus database with same CATH superfamily
2NVAA 1C8YA 1QK0A 2FB2A 4AEFA 3DFOA 3ARXA 2WJZA 1K6WA 3KOFA 4L9XA 4KMQA 3W2MA 1H0IA 2POZA 3PHAA 3D6NA 1KBLA 3WN6A 1VYSX 1MRQA 4OWGA 1JI2A 4QSFA 5FF4A 2BY2A 4XSMA 3I6RA 1LQ2A 2C7FA 1ODZA 4G7EA 4H9MA 1ZZMA 1JCJA 3N6JA 4DXVA 3Q2DA 4KKXA 4IFRA 2VR5A 4KERA 3OGVA 3ABXA 2B0MA 1S1PA 1OC7A 3O05A 1PWMA 1DEDA 1FXQA 2IQ0A 4O1BA 4M29A 2CLHA 3SUUA 3ARRA 5CPMA 2WXDM 5I2UA 5CZTA 3IAQA 1TA3B 3RIKA 4Y90A 1ZGDA 4UWMA 4F9DA 4M1RA 1TX0A 3D46A 2VOTA 3BG9A 1PYMA 1U1UA 2VVSA 3RM8A 3DEQA 1TJPA 1L6YA 4DXXA 3SIZA 3R12A 3B3DA 3MT1A 1BYAA 4O54A 1UOZA 3CWHA 1MNZA 1OT1A 4UFJA 2YIHA 3APGA 3TSMA 3HGRA 4AZ6A 4WSHA 2QJMA 3AFBA 2P50A 3FGCA 1HJVA 2XH2A 1S2WA 3ZFHA 2CC0A 3WLHA 4I5XA 1A4MA 2DZWA 1V3KA 4FB7A 2OSYA 4JL2A 2GK1B 3KEHA 3GQYA 4L7ZA 3UR7A 1S2CA 1LBMA 1RLCL 1EHAA 1JI1A 4S3CA 3ITGA 4KFPA 4UFLA 3FYYA 1EC9A 4LUIA 3CT7A 2HVMA 2CFFA 2VEKA 2W3ZA 3WMBA 4QHRA 5I3IA 1TRDA 1W1YA 2CLMA 3VDHA 2QDHA 4HOXA 3EAUA 1U2YA 3EOSA 3WLSA 1V6WA 2DQXA 2PTXA 4HTYA 3OVQA 4ZA0A 1I75A 4J27A 3TTSA 1NWTA 2ZUVA 1W2PA 3HN3A 4IGSA 1U22A 1DJZA 3ZQ9A 3S2LA 4H41A 4N42A 1OFOA 4Z1BA 4L80A 3B9OA 4WGXA 1AL7A 3TLLA 4LEFA 4O4VA 2GQAA 3VDCA 4YIWA 4Q7NA 2QV4A 4F0HA 3SB0A 2E9LA 1UP2A 2D2JA 3M07A 3WEOA 5HQLA 3S1VA 1TV2A 2HVNA 4F2UA 3PVFA 3VNJA 4CD7A 3L0GA 5ABGA 5HMEA 3TXVA 1H7NA 3RNDA 1P6WA 2E3ZA 4R9OA 4MSSA 4RV3A 1QATA 5FAJA 3GXMA 3O7UA 4CNTA 3MZ2A 4AB4A 2BNJA 2YXGA 1PKYA 4RNFA 4PB3A 4ZB2A 1GVYA 2CLEA 3CMJA 4PULA 4IXXA 3GYEA 2ADAA 4UQCA 3KTCA 1XLIA 5GQBA 1K7XA 1YDYA 1VHCA 4NIRA 4HMNA 3KWXA 4JTQA 5CEWA 3KBVA 2FYMA 3PFMA 1KM2A 3OQ8A 3CEPA 3HPFA 1BRLA 1HJQA 3UZZA 5CSYA 4MIMA 5DMYA 4AIUA 3MWAA 3GDMA 3KDOA 3JZUA 3BSGA 1W3NA 2W27A 2EEXA 2YXXA 4PTWA 4NQ1A 1G67A 2V0TA 2IPGA 4AD5A 1NTHA 3G8RA 1MNSA 3CL8A 3V1HA 5F1VA 1VPQA 1E6RA 4UQEA 3BTNA 3UCQA 1JYVA 1E3XA 4BI7A 1R9ZA 3PBMA 2FVKA 3CUXA 4IIHA 3NDOA 4H9UA 3S6DA 3BW4A 4GQQA 5GPRA 1TV5A 3CL6A 1DIEA 4B15A 2D1ZA 1EF3A 2YSWA 4ZSTA 2OEKA 5HMSA 2OOFA 4DELA 2OLAA 1DIOA 3JRKA 4Q4QA 3DHPA 5C9XA 4L9ZA 2X0HA 4RW3A 2GSJA 4ZO6A 1US2A 3AMGA 4AMAA 4RDZA 3WQGA 3O9NA 3PM6A 1OYAA 1LTDA 5CZJA 3TFCA 1KRMA 4RDVA 1B30A 1OFDA 4KRZA 4XQ6A 3MI6A 1UH2A 1FKXA 4DJDA 2UY3A 2PI6A 1MXGA 2ZUSA 2PMQA 1OABA 3BZJA 2E1WA 1TE1A 2A6LA 3AIUA 1GKPA 5DQPA 4W86A 1O1HA 5CZ0A 3UESA 4A21A 1P7TA 1Z9AA 4CD8A 1O4UA 2DUZA 1YBQA 1E5NA 2OEMA 3I7SA 2G0WA 3NNTA 1TO3A 4H3DA 4GQBA 4GG9A 3L5MA 1SVDA 4IPNB 3XISA 2XH4A 1AQ0A 2ZA3A 3G1XA 1R3TA 2C16A 4H83A 1KBBA 1QW9A 2AQVA 4JZ5A 5HMDA 1F73A 3TC6A 1KXTA 1GPWA 2BBFA 3EX2A 2Z2UA 1J0ZA 3JS3A 3KL3A 3LTPA 1S39A 4IMFA 1AQMA 1IXNA 4EANA 4AF0A 2AGKA 5K9DA 2VENA 2GDVA 3G1VA 1C8VA 3IIVA 1JUKA 4BI5A 1E73M 2QYGA 4BF7A 2R91A 4CNOA 4WGHA 4A3HA 4QQUA 1AODA 3UZWA 3MANA 3CZGA 1LCOA 5D38A 2W0UA 1KM1A 1RVKA 3WNKA 2O9TA 4GXMA 4RNIA 1N2VA 4NNAA 4BI6A 5G1MA 1YTEA 4UNLA 3CZKA 1ZLPA 1XL9A 4R5EA 3KRSA 4ZENA 1W9UA 3CAWA 2QF7A 4MJ4A 5G4HC 2ZICA 4RE3A 3HFTA 1A5CA 5BXSA 3PS7A 5HOSA 1I2QA 4JIPA 4O52A 2VURA 1GOMA 1XGZA 3DXIA 4CNPA 3GVRA 1SQ7A 1QASA 2IS7A 4MDPA 4CD4A 2X2YA 3NO1A 3BANA 3V75A 4HK6A 3NZGA 3AYTA 4NAEA 2VWTA 3HIJA 5H8UA 1F8MA 2A0NA 1FWDC 4H7CA 3P5YA 2XGZA 1IZCA 2ISSA 4JYFA 1UQZA 4WDTA 4DAIA 1NM9A 1E6XM 1X39A 3KM8A 4PCSA 4MHBA 5A8MA 1PX3A 4E8GA 4B3KA 2X1UA 4IIDA 4KETA 4RZ5A 5FKYA 2QCHA 3L5AA 3WDHA 3MBDA 1XH2A 1EDTA 3TDFA 2BVDA 3THUA 3U57A 3P3BA 3QV9A 1SZNA 1UG6A 1E40A 3K2GA 4ATWA 4LW7A 3V18A 1GZGA 4DY1A 3UP8A 3VI2A 3BPWA 3W1RA 3GXPA 3QGAC 3W6LA 4LCQA 2VCAA 4WZHA 3QMSA 1IEIA 3SCSA 1V6YA 1JDEA 2NX1A 3M0LA 2QUVA 3BE7A 4NL1A 3LM7A 1FFRA 3F1QA 2BOFX 4V15A 4PUEA 4HPXA 3N4FA 1ICPA 3TJXA 1WDRA 1TPVA 3WH5A 4CQ9A 4PH6A 1KBIA 5L9FA 4N2YA 1N8WA 1W5QA 2UY2A 4TX6A 1E9ZB 3AXIA 1W1B1 4XAYA 4Y96A 3VFCA 4U10A 1R46A 3CXOA 3WD1A 2I9EA 5JBDA 2CIPA 4JTAA 4YYCA 5LXXA 2FKPA 3TTOA 1GK8A 2X0SA 2DY3A 2OR2A 1QO5A 1ENUA 2YA0A 3IV8A 3EWXA 3CAKA 4C6OA 4YLWA 5LIWX 3QGKC 2POTA 1IIGA 3GM8A 2B4GA 1BXBA 2ZX7A 3M5YA 1ZAJA 3GD6A 1EZ2A 4MPQA 4J28A 2DSWA 2NX3A 3CV1A 5A8OA 3P0XA 3QV6A 4NJJA 1CT5A 4UR9A 4B92A 4LS2A 4WKHA 4FNQA 2NUYA 4QE5A 1E15A 5FJUA 1F6KA 3RM9A 3ZLGA 5FF0A 3W1AA 1AJ2A 4MWAE 5FI8A 1RPXA 3E2SA 3EB3A 5BWFA 5AC4A 3THDA 3WMCA 3HURA 5E9AA 2DSKA 3TN6A 4FXFA 3MMTA 4CVWA 4B91A 2E7FA 3W53A 2VZOA 4LNCA 4R7OA 1KNWA 3PBUA 3LHUA 1I1WA 3GY1A 1HKIA 3UWUA 1VFFA 3BW2A 4NI8A 3TROA 3EWZA 5EFDA 1NF7A 3LNPA 3WNLA 4I9JA 4UCGA 4GYFA 4RUBA 4LC6A 1S3HA 3ATZA 4IGHA 4XG1A 3WJXA 3M0YA 3W24A 3KS5A 4YXGA 3M1ZA 1V5XA 3S6TA 1PDYA 2HXUA 3WQ4A 3A3WA 3QPZA 4CU7A 4NNCA 2O4MA 1JZ4A 3DX5A 4I5UA 1T7LA 1B3ZA 1AJZA 2MNRA 1VLWA 4Y2WA 3P8IA 4UB9A 3VMPA 7ENLA 4MVAA 3VC6A 4JTJA 4W88A 4UIOA 3BOLA 4LS0A 4MYAA 2VDHA 1OYCA 4CCZA 1J79A 1Q6EA 3WQPA 4DZAA 3UETA 2G4JA 4WSJA 1MUWA 1CCWB 4OECA 4C6MA 4EACA 2A5HA 3MKCA 1F05A 2VXNA 4S3AA 5BU6A 4TVCA 3L4XA 5CPTA 4D6EA 3U4FA 1PWLA 1GTEA 3WLRA 3AUJA 3H53A 3MDUA 3R11A 4GBDA 2GVLA 4PCFA 1OGGA 1UD3A 1J5TA 3M0HA 3N6QA 2WBKA 2GGEA 1O60A 4YVXA 3VIKA 1Q7ZA 2YCEA 1V6XA 5J04A 3PF3A 1EEXA 4FPSA 4NAFB 4DI8A 1E4NA 3PJXA 3PUOA 1QNOA 3GUGA 5CSSA 5DO8A 5HK4A 2FDMA 5AYZA 3LGEA 3WJWA 1KXQA 2ACUA 4HZ8A 4MTVA 1ECQA 3RYSA 2OELA 5BNKA 2NWRA 1NH6A 4KGJA 2D2GA 2Z6IA 3CPRA 1RHCA 5DN1A 1Q2SA 1YKWA 1I2NA 4GUIA 2Y1HA 3TYUA 1XFCA 2E77A 2HISA 1K8YA 3F2BA 3PBGA 2QT3A 4L1WA 1UD8A 1UR9A 4MY1A 1N82A 2PA6A 4GIEA 3SCTA 2WW5A 7PTDA 3CEUA 4LCRA 2ZRYA 4J4KA 4PTDA 5FEXA 3PC0A 3UY7A 3NPVA 1OD8A 4FNRA 5HINA 3LHYA 1QMLA 5DT7A 4HPGA 1GORA 1V3LA 3T44A 4JTSA 4Z0SA 3G0SA 5I3GA 1DPMA 3TQPA 5CH9A 3ABOA 2O56A 3AJXA 5DCDA 3AZRA 4Q8VA 3WLNA 1M65A 1ZHAA 2Q6ZA 4JIEA 2ODOA 4C91A 3FJLA 1AMYA 1JZ8A 4PUJA 1KQZA 3TP4A 1KO0A 3MVTA 1JNEA 1Q7MA 3UG5A 3ATYA 3WZ0E 1BWKA 1NJJA 2WOQA 4C6KA 2I5GA 4C1NA 1TPH1 3HB9A 4C6IA 3J7HA 1UWSA 1IIHA 2A3BA 2QV5A 1V79A 4GKTA 2WNNA 5HMFA 4UFKA 1U5JA 4UR8A 4UTKA 5T9BG 1KXHA 3FW6A 2RUSA 1SJCA 1PX4A 1F76A 2EJ1A 2EPHA 4ZVJA 1JZ2A 1DXFA 4V1XA 4JR5A 3B40A 1F07A 3SAZA 1GNXA 5C71A 4J2MA 5FSDC 2QCCA 2WZMA 3BMWA 3VZZA 3UJ2A 1XH1A 4Q8WA 5IHSA 3RMEA 3LBOA 1L2UA 1LL7A 4REQB 1H5VA 2JK2A 4HNUA 5D04C 2CERA 2Z29A 2BFGA 1A0EA 4NKCA 1F74A 3JR2A 3KE0A 2FDSA 4ZZ9A 4FNSA 1HGWA 1AUSL 5CBBA 1DJXA 2QMJA 2X1RA 1A5UA 4XZLX 5CCZA 4DUWA 2O9OA 2ACRA 4UC5A 2TPSA 5C0QA 3VDGA 3L4VA 1KM4A 2QAFA 4E4UA 3IIZA 2EPKX 5LGXA 1QOQA 4F0KA 1XWYA 3DG7A 1XLEA 1TPC1 1QK2A 1V8EA 2X1IA 3G0UA 1XSKA 4BQ4A 1GYMA 1TJ0A 4N0RA 1U83A 1MW3A 4A29A 6A3HA 3WLJA 3B97A 1DJIA 4Z2IA 1AZ1A 4KCVA 3W7RA 4GI9A 2QEZA 4WK9A 3CYJA 1FDJA 3GHRA 3STPA 3MPGA 2J13A 1A5BA 3FSTA 4R27A 2J8GA 4AWEA 2FZDA 3N29A 1OQFA 2QVNA 4IOTA 1XP3A 1ME9A 2GGGA 3NQBA 1R9XA 3M0IA 3T09A 4JQ1A 3W1XA 3O1NA 4YVVA 3TFXA 4Z2HA 1LWHA 2GJPA 4NXSA 1E6SM 1TQJA 4DJFC 1O1ZA 2VT0A 4ADTA 3N1AA 2RH9A 2Q3RA 1MSSA 4L4PA 3T05A 2FIQA 4M80A 1GCYA 1XCWA 3WK3A 5CJMA 2DT0A 2E28A 3BAXA 3LCHA 2DZUA 3WDJA 1FWWA 4L9YA 1QR7A 3AAMA 1NQ6A 2X30A 4Y9MA 1T0OA 2RAGA 1VZWA 3K8KA 2J25A 3BURA 4GD0A 1CECA 3HGJA 5BW6A 4ZB5A 4MLRA 1PZ3A 4MWAC 4KCWA 4IQJA 1MW2A 1PS9A 4ASTA 3TX9A 4CVUA 4HPHA 2PDMA 1E0VA 3T78A 3UU0A 2YDAA 1LQ0A 1SZEA 4PMDA 4JEQA 1D7KA 2DJLA 3AJ7A 4Q32A 2WZHA 3NL2A 4PFMA 4GUGA 2V82A 3RU8X 3MWCA 3S2MA 4WSKA 2XGBA 3RCMA 1A5OC 1EUAA 1OM0A 2IPFA 2PBOA 5SWUA 1SGJA 4KEUA 1BF2A 4UTTC 3THAA 3BGGA 1XICA 3R0KA 1Z7AA 1Y0EA 1ZY9A 4TVUA 5AYXA 2Y8VA 2D0GA 3NEVA 3W2JA 3OIXA 5DCBA 4N6FA 2PDFA 4A3RA 3H2EA 1XIGA 3BL3A 4MY9A 2WJDA 1GHSA 3C0JA 3GIQA 4EPEC 1L2QA 2J9XA 3LUTA 6XIAA 5F2IA 5FESA 3CB3A 5CGTA 1KBKA 3LG3A 5GJPA 1ZTVA 1W5MA 1W56A 4JYEA 4KGLA 2A2IA 5GJMA 4D71A 4Z1YA 3MMWA 4GINA 5LIKX 3LB0A 1EXBA 1OJXA 4FXJA 2RKXA 1EGZA 3T42A 2XZ9A 3B8IA 4OTKA 3T1GA 4BA0A 2EHHA 3MI2A 2QGYA 4Y9AA 4N02A 1JR1A 5LA2A 2PWHA 4JICA 3QMRA 3DIPA 4HPNA 4AX7A 4K37A 1MZRA 1YPIA 4JKKA 1TYGA 5B7YA 1EP1A 1QCWA 4LWWA 3BG5A 4GC3A 4RZ4A 5LIXX 2XN1A 2CITA 5E5CA 4ECLA 5ECVA 1E9YB 2FGLA 3UCDA 1WNOA 1K4HA 1FP9A 3AMLA 3DN5A 1G94A 1WAUA 3IUHA 3W02A 3R6IA 1VH7A 1DVJA 2NX9A 4QEHA 4EPBC 4LCSA 3GW0A 1K3UA 4LY8A 3SCPA 3I6TA 3L2LA 5BRQA 2OMAA 2WHLA 1TZZA 3NL3A 4C6PA 4FI4A 1E1FA 5IFTA 3FVMA 1QNVA 4MMWA 5E70A 1X8CA 3CMFA 1NP2A 4C6LA 4YU1A 5HUPA 4QJ1A 1ADOA 4JN7A 4P7NA 1X6LA 3MZNA 1QNPA 2ZRXA 4DBDA 2OWXA 1DJGA 2BY1A 2J8FA 3GZAA 1SFSA 1UWQA 3AXXA 1WZAA 5K9XA 3CZJA 1XGDA 5CPQA 3SY5A 3L2IA 1ZAIA 1ISVA 3W37A 1J9YA 1ZJHA 5MKGB 4O19A 3AHZA 3NR0A 2NLYA 4V33A 3K30A 3UNDA 2DDXA 4W7WA 4ZSUA 5GVJA 4XZHA 4Y9PA 3PTQA 1DQWA 3ARWA 3W76A 3T81A 1P1XA 5BCAA 4ZBCA 3B0VC 3NQFA 3NO5A 3QHOA 2QZRA 4ERAA 1AQFA 3R8GA 1FKWA 3VD4A 2XINA 3QPYA 4H1ZA 1S5NA 5BZAA 3WQ8A 4FK9A 4AISA 1QHPA 1V02E 1H41A 2WMFA 4GZIA 2QAPA 2X7VA 1SZGA 2VELA 4XZ9A 1K8CA 2GSEA 3SQMA 1B2YA 3NQVA 3QR0A 3M0VA 4GQRA 4Z17A 1QBBA 1EYEA 1GHRA 4WDUA 1FVPA 1OCJA 4E2DA 2ZIDA 2ISVA 1UJQA 2IKIA 4Z42C 1JG9A 4PR4A 3SCVA 3WLKX 2R1LA 3AALA 1JULA 3UD6A 1VAHA 1DQXA 2ANUA 5FD0A 2NXHA 3R2GA 3WBYA 2ZCGA 4NHVA 1GUVA 3H12A 3ZVHA 1X98A 3ZLFA 3KCJA 2CNCA 5D37A 4ADSA 1WXYA 1WDSA 2WNZA 1UC5A 4NJHA 3OA3A 1ITCA 4W4QA 3CQHA 3NOEA 2F9RA 4M81A 4K1GA 2VFHA 1TG7A 4AHPA 4RZBA 3DFQA 4NX0A 3DENA 2DV0A 2CZVA 1XPGA 3U2EA 4PSRA 2V6AA 1JZ5A 1AQHA 1F8IA 1B9ZA 4PL2A 1XIJA 3N4EA 1EJRC 3PULA 4IGMA 2XVLA 5EMLA 1VJIA 3GDLA 3SY1A 1GYLA 3FHQA 3R0UA 3M4HA 1JRCA 3TA9A 4CQBA 3GTNA 5EU9A 2DIEA 3CZLA 4UNKA 1Q4WA 2YLLA 4MKSA 1IEWA 1IZKA 5I3FA 4O1DA 2WVVB 3WY1A 1OGBA 4A3QA 2O7QA 5U4NA 3QHMA 3SW6A 3WJZA 2Y7GA 2YW3A 1EO5A 2AKZA 3QY8A 2VC9A 2ATMA 1W1VA 4NJKA 3S1WA 4M6VA 4H9VA 2VWSA 2WCAA 3VIPA 2CLFA 4C60A 1WQ5A 1FHLA 1DORA 3WUEA 3EWCA 2DVTA 5GNYA 5KSWA 3URBA 3VIOA 4CQAA 3W9ZA 5BROA 1LG2A 3LS9A 3GXTA 4IXHA 1MW1A 1Q7QA 1BYCA 1EQCA 4O4WA 3W6YA 1XF0A 3MP4A 1Q6RA 3EEZA 1BVWA 1XLJA 3Q37A 4FEZA 4YTQA 4U3AA 1PZ2A 1IZJA 1LOSA 1SYTA 5A8NA 5BMWA 3IJ9A 3UXKA 3W0KA 3ENLA 1HZYA 1Z8AA 2QCDB 1OHLA 3NURA 3QQ1A 1SFLA 1HJXA 2ZA2A 2QF8A 1E43A 1E6ZA 3WLIA 4H7ZA 4ERGA 3FY1A 4ZFCA 1XYBA 5IBXC 3LLDA 1V7AA 3AIEA 4E2BA 1T41A 3IRDA 2DW7A 1J6PA 1VEOA 1XI3A 2Z6JA 3LI1A 3TCEA 3V0SA 3UNTA 1NDZA 2VEGA 1GZJA 3RR4A 3DYOA 1IR2A 2VFIA 3IIOA 3O63A 3O6DA 4HYVA 4WY0F 5A5WA 1DTUA 3EXRA 1DJQA 3QM3A 1V08A 2WVUA 2Y85A 3AZSA 4J2PA 2XYLA 4LBRA 2NUWA 2VFDA 1AMKA 5CGMA 3VKDA 1PIIA 1CGTA 3RX4A 1KCLA 3K4DA 1JXJA 3VM7A 2NV2A 2PDXA 5M03A 1J96A 3DZ1A 1WA3A 3KCOA 3W84A 3L5LA 3B8DA 3VOFA 1ZJAA 3EEGA 8XIAA 1FX6A 1DHKA 1UR0A 2DZVA 3MB9A 3HPSA 3VKJA 4EE9A 3AHYA 3A4WA 4I7WA 3TWBA 5AYIA 3M0XA 2EBNA 3V16A 4LTSA 3R5EA 3KOWA 4IHCA 3QC3A 2C0HA 3LSBA 5A6BA 3MUCA 1XLMA 1FCQA 2GJXA 3H4XA 1Q8AA 1W31A 4XZIA 3AIRA 4NNBA 1BVZA 1F6YA 3KWSA 3NUKA 1WZKA 3BSHA 3LOTA 5TD4A 5HJLA 1X8FA 5CBJA 3DHDA 4HD5A 1J01A 3TR9A 2OU4A 2BGNE 1H49A 3PWIA 1MXDA 1BHGA 1WYIA 3D5HA 2ON3A 4XO7A 1BPLB 1GTHA 4DBUA 1I45A 5A6JA 3POHA 2QIIA 4I7UA 3MCOA 4E8DA 4Q33A 1UKPA 2PP0A 3BUVA 3WEZA 2R1MA 1UPMB 1SO6A 4MOZA 4TTUA 1WP6A 4X61A 5A6BD 3W2KA 1HW6A 4F4RA 3PPHA 4GIYA 5BOFA 2DU2A 4IUOA 4ZOAA 1CB2A 3ZR6A 2FMOA 2W67A 3ZT5A 3K8LA 5C9UA 3IEBA 1OX4A 5HA7A 4D6GA 4NSBA 3AMDA 3F2CA 2AQOA 9XIAA 5KZEA 5FJPA 3FXYA 2PLCA 3BLIA 1A0DA 1EDQA 2FTWA 1KGWA 1NWUA 3BVJA 3KBNA 5B80A 3H6OA 3MKKA 3QW4B 5EBUA 4H2HA 3VCRA 4ALDA 5JQ9A 2PCQA 4ICCX 3QKEA 3ABRA 3S42A 2VGGA 1SZFA 1RR2A 1JCYA 3N9SA 3SQLA 1XKJA 1UKOA 2OSWA 2PF8A 3ARQA 2WSRA 3ELFA 3MYOA 5A95A 2CZDA 4ZXOA 3BV4A 4S3BA 2NUXA 3N04A 3CV2A 3G1FA 2WVSA 2BVWA 5ENLA 4X0VA 4JNMA 2P8CA 4K6AA 4DN1A 2ALRA 1X7IA 5D4YA 4LBSA 2GJRA 2RJGA 4HTBA 3S5OA 5EL1A 2PB1A 3UVIA 4LXFA 5EBAA 4BWLC 3EDEA 1Q6QA 1EF2A 2G3FA 2E25A 5AB3A 1REQB 2VC7A 1EQPA 4P7RA 5HAOA 1PTAA 3OGRA 1BF6A 3TSBA 3MV01 4Q22A 4NY2A 3LA4A 3AS1A 4LUSB 2PEVA 4MGGA 4JTCA 3ARYA 3PZUA 1XYCA 3ZXWA 4A8RA 2C79A 1BWLA 2GPTA 2IXVA 3KL5A 3E02A 4L6OA 1YTDA 3LCIA 1OC5A 1X38A 3VOCA 4JL1A 2OT0A 4ONVA 1UHVA 3HO8A 1HG3A 3NQ6A 1I2RA 1KFJA 1MUMA 2FJUB 1TFVA 2QUUA 5AOUA 2ZYFA 1UH4A 5LKYA 2ZVRA 1GVOA 2XDFA 3M44A 4E8CA 5JU6A 3ARUA 1Y5VA 2V3EA 2OWWA 1E72M 3MHFA 1L6SA 2R94A 3P5ZA 3EWBX 4DJEC 4UTWC 3QLDA 3TU9A 3VGFA 4KQNA 1LL6A 4GUFA 1W37A 3M6YA 3AHXA 2EAWA 1DE5A 1GKQA 1Q85A 1D7FA 1OG0A 1XIEA 2IUZA 1JCMP 3VC5A 3DFPA 3B9NA 4JTIA 2NV1A 1NWSA 2QDEA 3LK6A 5A6TC 4I8DA 5AN7A 3W3OA 1UUOA 2VGIA 5EPDA 2DZXA 1S2AA 3OODA 1ZFJA 2GVYA 4WJXA 1KLYA 3LI0A 5CG7A 1LBLA 1PVNA 2J7GA 4KFNA 1H62A 1G5AA 4N9CA 1WO2A 4D1IA 3IANA 1LL4A 2OGJA 4JN8A 2H6RA 3FS2A 1XRVA 1UQYA 3QYQA 4PFHA 4Q4SA 4RKAA 2PDYA 3RM4A 4DF0A 2GJLA 1HXJA 1OT2A 3G1SA 4LX4A 3KW3A 3DC0A 4TMCA 1JAKA 1JPMA 2X09A 3L4YA 3UG3A 4Z0JA 1EWDA 3RLUA 1EYWA 3WH6A 4OBSA 2BV9A 1GONA 1N7KA 3ZT6A 3H2FA 4RJEA 4CNUA 1OY0A 4LVGA 1Q8JA 3CQJA 4J3ZA 4EXAA 5A2AA 2PDNA 4W93A 3WBAA 3QTPA 1B3OA 4S2BA 4YTUA 2Y63A 3F5LA 1C9DA 3N9RA 3VXGA 3KS6A 3A9BA 4BR1A 1UB3A 1NY1A 2HRWA 3TV8A 2DIKA 3UCCA 2FQIA 2G50A 1OIFA 5M2FX 1M7JA 2A3AA 1GEQA 2HTMA 3RX3A 1H7PA 1GEHA 3M64A 4MPKA 5GJNA 2NVCA 3NGFA 3NDYA 1RD6A 3B4YA 4O28A 1K03A 1M6JA 3T2OA 3I7QA 4HNNA 1UR3M 2CKSA 3ABQA 4W8BA 4GCXA 2V5BA 1JD9A 3WJYA 3QHNA 4LJ3A 2O55A 3CUJA 2C13A 4IUGA 3ZJ8A 1WXZA 4JCMA 1VCGA 4KFOA 3DFNA 4B5SA 1S2VA 3NL6A 4ROQA 1KWGA 1RUSA 4UFIA 3OZMA 3RN6A 2XFRA 2VD8A 3GYCA 5C9ZA 3EGJA 3W7PA 3EPMA 1ISWA 5L6UA 2FZ8A 3D0CA 3VCNA 1PE1A 1BGGA 3S0CA 3W82A 3ITOA 4W9TA 3GTFA 1O94A 5T9CE 4GJIA 4PEEA 2BWGA 2V5JA 2IKGA 2F84A 4FIQA 1DWGM 2HMCA 3QZ6A 4DJFA 2GLKA 4S2CA 1KR1A 1JCXA 1JJKA 1CIUA 2QIWA 1CGYA 2VD9A 3F4WA 4H9YA 2W5FA 4HOZA 1CZ1A 3UWYA 5I5RA 4PC8A 3PG8A 1W9XA 3JW7A 2EO7A 1SW0A 4M19A 2VZUA 1RP8A 3URAA 2OZTA 3B9EA 2FH8A 4LEQA 1GOOA 3DG3A 1U1HA 4N4PA 4NRSA 4MWAA 1KTCA 2D2HA 2GGJA 3W72A 3SI9A 1VBGA 2PRMA 5I24A 1Y5XA 2W4XA 3MUXA 4K1WA 2QJIA 1G9HA 1IXQA 4HIBA 1PO9A 3GX9A 3MP5A 2AL2A 3GXIA 4I9MA 1LROA 4M3PA 3BOXA 3BOFA 3UG8A 4V27A 4UTTA 2PGRA 8A3HA 4FX6M 3H2OA 3LD5A 4XBJA 5J5RA 2HBXA 2GDQA 4DJFD 4F8XA 4MNJA 4I3GA 5G5IA 4R33A 5I7GA 4ZQCA 3TE9A 4J1OA 1I0DA 4ZFMA 5CZSA 1P0NA 3QXBA 1LORA 1PKMA 4GNJA 4LUYA 2FGBA 4HJFA 3KHDA 5KTLA 2WCSA 4JIRA 3P8JA 3PWAA 3KFTA 1P0KA 4MWAD 2PDBA 4TR9A 4B2DA 2WSKA 5DMNA 3FK4A 1HJSA 3PZ9A 1VYPX 1FH8A 2WVTA 3H55A 4R34A 2ZWZA 2V9DA 4RE4A 3MHUA 5REQB 1HVQA 3VFLA 1CENA 8XIMA 5LNRA 4BK9A 4CEUC 4H6EA 2IW0A 4PCPA 3QYSA 5KETA 1DQUA 4P7OA 3F4DA 1JUBA 2HVOA 4AC1X 4A2RA 4NP7A 2DUAA 2Y6ZA 1EJUC 2F2HA 3FEMA 1RCOB 4DZHA 2D20A 1HN1A 4IP4A 3GAKA 3VTRA 3N2CA 3FIGA 1V6TA 3QJAA 4GZEA 2XIJA 4Q8QA 4RL3A 3OW1A 3GKAA 1TRIA 3R10A 3TOYA 4BQ5A 4EVZA 3WENA 4F0LA 4PSPA 1UP3A 2E6FA 4W85A 4L4LA 2VEFA 3CGTA 3RJYA 4EPDC 3CZ8A 4D2JA 1MRAA 4DO5A 2CZEA 2XTKA 3REQA 1MEWA 1HP4A 3HG5A 3H2MA 4Q4KA 1JZ6A 2WAGA 2ZVIA 3E49A 5DEZA 1UA3A 5E0CA 1RAKA 3ARTA 3MI3A 2R1PA 3CIXA 4MZ1A 3RX2A 4XTIA 5CZKA 2ZE3A 2ZZ6A 3L21A 1EO7A 4GH3A 1NEYA 4UNIA 3VPLA 2UBPC 5DBTA 2F8QA 3A5VA 4KH2A 4L65A 2VRJA 4JHMA 1R85A 1WCGA 2WM1A 3UVAA 1CYGA 1DV7A 3QR1A 4E3VA 3E96A 3GXNA 3OZPA 1JNDA 2NLIA 4Q8MA 4F66A 2XN2A 3I4EA 3UFYA 4H8HA 1IGWA 4PTNA 2VEPA 2HWGA 1G0CA 3SIMA 3KCLA 1MQPA 1W9BM 4M6UA 3R0DA 4CD5A 4K38A 3OO2A 3F2DA 2GOKA 4WY0B 5KINA 3B4UA 4GK8A 4M7SA 4EOUA 3KTSA 2NQHA 2P1FA 3UZ5A 1J4EA 3WH8A 3BG3A 4GVHA 3WNPA 3IIPA 3DAQA 2Y7FA 4KPLA 1DWFM 3P93A 5CC3A 1FDYA 3ZO9A 4F9JA 2QCGA 4ACZB 3OBEA 3O06A 1JPKA 1WE5A 3CS2A 1GQLA 4Z08A 3NQGA 3NZ1A 3ONCA 1B5TA 4MB1A 2I17A 4JQ4A 1YTKA 1G4EA 2FPYA 3URQA 1KRBC 1F6PA 1NAL1 3TQ0A 3E3HA 1QPKA 1CGVA 1TTQA 4DM2A 1TVNA 5I23A 4GBUA 3UYIA 3DECA 4JTEA 1A4LA 3TH6A 4AMCA 2E09A 4ZQOA 4RR4A 3L4UA 1BKSA 1W6TA 1ZBWA 1A5SA 4NZ3A 1ZPTA 3EOEA 1TIWA 4AD2A 5AHFA 4NI3A 3S5ZA 3H21A 4G9PA 1GQNA 4QAWA 1XX1A 3TJIA 5K4ZA 4FNUA 4NXKA 2DZBA 2VDIA 4EAYA 4V2XA 3S6OA 1VFLA 3R1ZA 3ZR5A 5D9MA 2CLLA 3A47A 4UTMA 1N8IA 3YPIA 1F7BA 4QCFA 5FJRA 3CAQA 4YTTA 4H6RA 1XDMA 3C2VA 1M1BA 3N3MA 3M0KA 1RP9A 2ZTJA 3KUMA 2VYOA 3KP0A 3BC9A 5JIWA 4JQAA 2V38A 3M0ZA 1EIXA 1RY0A 1GW9A 4FAMA 4GNVA 3ZWTA 1KRAC 2YYTA 1JPHA 3NGJA 1EKOA 1BVNP 3MHGA 1Y8BA 1Q6CA 3GR8A 3QC0A 5A8PA 2J7EA 1QT1A 3SN4A 4WF7A 4KWVA 1EA0A 3CO4A 3LV5A 3EMZA 3UGRA 1TSIA 2DT3A 4OJYA 3S1GA 4AD3A 4WJ8A 4UQDA 2A1YA 2YCLB 3BO9A 1H7WA 5HPCA 4GX8A 3H2CA 5M1TA 1UWTA 2CBUA 2QUNA 4IMCA 2FLIA 5FJJA 3IGUA 4JOMA 4OQVA 1WXJA 3KX6A 1K9TA 3P2VA 4LS1A 2PDCA 4W7VA 2QUMA 4ZGYA 3ANVA 2IKJA 2Z00A 4NRRA 5D30A 5F2GA 1ALDA 3HTWA 1V51A 4IFKB 2JGQA 2CBIA 1HVXA 1UD2A 3B9DA 3ZZ1A 3DKLA 5IBXA 4U2YA 1F3WA 2KX9A 3MCNA 3L4WA 3NAVA 5AC8A 2DVUA 3IVUA 3MW7A 3HJZA 4OGZA 3EMCA 2XH0A 4JHZA 3MSRA 4JFWA 1AW2A 4EWJA 2GGHA 1LRNA 4ML9A 4EPKA 1XYZA 3DHUA 2ZADA 4Z2LA 3CIWA 4HSNA 3B06A 2ZZ1A 2HCVA 1XD0A 4QJ4B 4HNOA 3G3MA 4QNWA 4D6CA 2QPSA 4QDMA 3ZSSA 4MB3A 1TZ7A 3LLXA 4ZTXA 3CASA 2BTMA 2P8BA 3ZR4A 5C5YA 3GK0A 4X9SA 4DF1A 3SGZA 5AC7A 5C9RA 3LPGA 4LV4A 1VIWA 4JS3A 5EMJA 4RE2A 3RU6A 4PMXA 2A4AA 3KBWA 1SJBA 1HQTA 4CU8A 3NOYA 4DXKA 1E9IA 4C7DA 1U5HA 5FA5A 2EQDA 5A8QA 3ZIZA 2ZWYA 1P0EA 4RLIA 1O5KA 3TXZA 2AQWA 2ZZ7A 3NYDA 1CW2A 3LPFA 4C6EA 2MANA 4GVIA 3EA3A 4WDXA 3BAJA 4RCXA 5G1YA 4DI9A 1R9YA 1US3A 1JF6A 4BEQA 1ONRA 3IJ7A 4Q8UA 4POCA 3UPBA 4LAKA 1E6PA 2ABAA 4RE0A 4QP0A 3WNNA 1G4TA 3TQVA 2BY3A 1HL8A 2ZXQA 1M9HA 2JALA 2WMIA 2VFGA 4W8LA 4C90A 3DH7A 2GL5A 1EL3A 2DH3A 1JCLA 2DIJA 3B0PA 3W7GA 1J5SA 3TAKA 1DJYA 1JYNA 2PCEA 4PUKA 2EG7A 1VKFA 6PTDA 1TREA 1MW0A 3DHFA 4P8UA 4TUFA 4XSLA 3QZAA 3QEZA 4QBXA 4TIMA 5HNTA 1GG1A 1LYXA 3ANUA 5E93A 4G7EB 1UIPA 1ISXA 1YXDA 3LMYA 4BQ2A 4RK8A 4OOUA 2PPGA 3WQDA 3CTTA 1R8LA 1GOWA 2J77A 3RPTA 1JDAA 1ZB5A 3LCXA 4UTFA 3AU6A 3WCZA 1UWUA 2Q8ZA 1PB0A 4GUJA 1XIMA 1FA2A 2OX4A 4C7GA 1E3ZA 1DHPA 3B03A 4D8AA 1OX5A 3ALFA 4XKYA 4XAZA 1HKWA 4F40A 4QLKA 4XVEA 3VNKA 2Z0IA 1RXOB 2QPUA 1A5LC 3CL7A 4MUPA 4PRTA 2PE4A 3H7UA 4JBRA 4F48A 2J7CA 4KRUA 3RGTA 4UOJA 3EOLA 1A0CA 3MO7A 3VVGA 1V3MA 5C55A 2OLHA 3TTYA 3VA8A 1UP0A 5A6KA 3W6MA 3FGCB 3DUGA 3CM4A 3FDKA 3LU2A 5GNZA 1ZAHA 3KBSA 4HPJA 2TMDA 2WZTA 2VCCA 3E6EA 1NDVA 1V6UA 4R7WA 5LXEA 5CPSA 1XUZA 5F4WA 1XG4A 3CHEA 1O6IA 1OK4A 4B5VA 1TMQA 3QQ0A 2H3BA 4YL2A 1TE6A 3L12A 4QM1A 1PKNA 1LLWA 4ILSA 4BWLA 5KITA 5LYRA 2OWCA 4UR7A 2I16A 3HA1A 4IM4A 3R94A 3JU2A 3DESA 1EEPA 2ZC1A 3CUGA 3PG9A 5U7SA 2PTZA 2F6KA 3AYRA 2VGFA 5A6MA 3AWNA 3EDKA 1U33A 3CV7A 1RZMA 1VBHA 4TV6A 4LFYA 3TW9A 3BICA 3PUDA 3DERA 4O12A 4QCEA 2J7DA 1PZ1A 1P1MA 3LZ3A 4O13A 1FWFC 4GO8A 4FSAA 3LNMA 3C3UA 1HKKA 1TKKA 1CTNA 1FDZA 5EA9A 1TUXA 3HZ3A 3VUPA 1HGYA 1W9VA 4I9TA 2WYSA 5IRPA 1XLHA 1VQTA 2EPLX 3I6EA 3QSTA 2GSHA 1JYWA 2XIBA 3VIJA 3NPXA 1TWIA 1NSJA 4DJEA 1XCXA 2DT1A 4UTWA 1D8CA 2WZEA 2HJPA 4QFUA 2PTWA 1ADDA 1B3WA 4ZQNA 3EDJA 3A64A 4ZOCA 1FHDA 3W85A 4FLRA 1GT8A 1NARA 4HQVA 4LAUA 5CLWA 5HJYA 4OE7A 2YFOA 1BRLB 4S3GA 1TCMA 4ZO7A 1IR1A 3VD7A 3VIMA 2ONEA 3RFAA 4LYKA 5H2ZA 2LLEA 2Z4GA 2EXOA 3A21A 4C6FA 4HNVA 1R3WA 4H04A 4XZBA 1XLAA 5I3JA 3C61A 1W91A 2RDXA 3C0QA 1KCXA 1EB3A 2PP3A 3GTHA 3OBAA 1Q3NA 2WWDA 3THQA 3QH2A 3N2OA 1EZWA 3PWGA 4G56A 5EKYA 1PAMA 4B9YA 1ZNNA 3EXSA 3N2MA 3N17A 3FAXA 4Q4PA 2HEJA 3A12A 1ZENA 3CUHA 2Z28A 4J5NA 2Y7DA 1GYNA 1S2TA 3EPNA 4AUBA 5D03A 2C1GA 3K1GA 2X42A 4O14A 2PLKA 2D0HA 3LPOA 4A4AA 3V3WA 3NO3A 2O9RA 2QDDA 4XD4A 2QXWA 2E6DA 3LMZA 3VILA 4BF9A 1FWHC 4NYYA 5DX7A 1Q6LA 1B90A 3WQOA 4DWSC 4C6NA 4ICNA 2ZQ0A 2RDUA 5EMYA 3U5YA 3LX9A 1XIHA 1YYAA 3WBXA 3MQTA 1UIOA 4PMZA 4GVFA 3FJNA 3N11A 3AS0A 5H91A 3HG4A 1EA9C 5AYBA 4IQLA 1ODUA 2XISA 3RK8A 4GZJA 1DXIA 4U4MA 1P7TB 3SCRA 3UJRA 3R7MA 3MC5A 3WF2A 4PMOA 3FSUA 4EK7A 1YBQB 3Q67A 3GHUA 3ITVA 1UMLA 2O4QA 3ZOAA 1EPXA 2D69A 2Z24A 4K7VA 4NUWA 3O0FA 4GI6A 2B7PA 4P7LA 1XG3A 3R8RA 4GJ1A 5AC5A 2Z25A 3L9CA 1GVQA 2AMGA 4BQ3A 1DOSA 1LRQA 2RHGA 5XIMA 4O8RA 5CLTA 3MUY1 4Q7IA 3CWOX 3GR7A 3PPFA 4AF0B 4QISA 1XYFA 2PDGA 4O53A 1JZ7A 4YTSA 1XUUA 1HIZA 1AW5A 3E74A 3VDAA 4JFVA 1RV8A 4ORMA 4QEEA 3RHGA 3T08A 4DYKA 4N7QA 3BSMA 3HPAA 2JIEA 5E0KA 4HOWA 4XUGA 4C5YA 3COTA 1F9CA 2WMKA 5FAGA 5I0DA 3RITA 2Y0FA 1A80A 4MUZA 2J88A 1EOKA 3PUEA 2C6QA 1V0KA 3U7VA 3JVAA 5C7HA 3RO8A 2X40A 4E2VA 3OU8A 1LT8A 2P0OA 1KFLA 3O6AA 2C1IA 3DCPA 1ZBKA 2ZXDA 3SSJA 4IIGA 1PL9A 2CLIA 4QE4A 4RDWA 4CCDA 4EIVA 5HULA 4IF2A 4AH7A 4HU4A 3BARA 3RMJA 1J0YA 5D05A 4ZL1A 1JGMA 3N34A 3L0NA 1YPFA 4GGHA 1WKEA 2J4GA 4O1CA 3WK1A 3KP1A 3W23A 2YCIX 3U48A 4NAEB 1PSCA 2J66A 3N18A 3B8WA 3T0DA 3TW7A 2YCJA 1FWIC 2CW6A 3HM7A 2R82A 1RA5A 3H24A 1KRCC 3MSDA 4YCOA 4O8AA 1UD4A 1W3IA 3VYLA 5C7VA 2I5QA 3DU0A 2WK2A 3LENA 1FWCC 1QAPA 1XXXA 1FWAC 2VZVA 5LIUX 1VYRA 3WF1A 2OB3A 4OBTA 2C71A 1PIFA 2GWNA 4FS9A 1I1XA 3N2TA 8RUCA 4IL2A 3BLDA 1FBAA 2E5CA 2FVLA 3WDPP 3LRLA 1MQQA 3V35A 1KQYA 3T0TA 3A3HA 3EDFA 4DPPA 2VNCA 1AJ0A 1ONXA 1ZP4A 4KIEA 5FJIA 5H6HA 3U2OA 3V5CA 1MDLA 4UQBA 1RSCA 2OFJA 4QLLA 2PDHA 1Q45A 1BQGA 2INEA 3F7JA 5BOEA 1AVAA 1RBAA 2R6OA 1O12A 1M01A 3L68A 3PTDA 3W27A 5C2XA 2CZ5A 5K4XA 4E6MA 4LT9A 1R3RA 3MSYA 2H8XA 2OKTA 3W7EA 2JE8A 2WC4A 3H22A 5CAKA 4GZ7A 4DJDD 3HGSA 3W7HA 2H8ZA 3WD0A 4JTGA 3QSRA 5HNUA 1JVNA 1TTIA 3FXGA 3DG6A 3LCLA 1VPXA 1EFZA 1TX2A 2QCNA 2D3LA 3W7QA 2QNEA 3H54A 3SUVA 3VX0A 2B7QA 2ZXBA 1R6WA 3PJUA 4LANA 3S4TA 2H3DA 3BGAA 4AZHA 2PRHA 3FA5A 5FEWA 2W92A 3F4VA 3PBWA 5LNUA 2R1NA 3G1HA 1FCUA 1PTDA 1XHGA 1H7RA 4KF1A 3PJTA 2VUNA 1UYQA 4BCEA 5RUBA 4QROA 3CMGA 4CN4A 1WDWA 1TELA 3G5EA 4L56A 1PCWA 5AKQA 4YYFA 3EDDA 1J2BA 4PGLA 3S5SA 1YNYA 1HO4A 3GFYA 4ACYA 2BX7A 4QNEA 5H8PA 2PLMA 1THFD 5FJOA 1GVFA 1GQKA 2W6RA 4CLMA 2CBVA 4GVGA 3EB4A 2JIWA 2L5HA 3UGVA 2NQZA 5CAHA 3T40A 1BEUA 2XGIA 4H8VA 1JL8A 4PUUA 1TV3A 4Q8NA 2VX5A 1IWBA 1HF6A 2ATSA 2OZ3A 4H8NA 5CPLA 2VFFA 4B5WA 3NFUA 2QMKA 2Y8KA 2BY0A 1VIZA 2PP1A 2WQDA 2C15A 1OB0A 1K02A 3BQ5A 2PURA 4PE8A 4LYQA 4UOZA 3BLKA 3QOMA 3PZOA 3HQNA 3P0WA 3DFTA 3KBMA 3FX4A 1ZBVA 1F4AA 4U5KA 4J3VA 4S38A 1IEXA 1XLBA 1RALA 1XIFA 3VNLA 3ERPA 1UD6A 4I9AA 3WQEA 1JRBA 2JKPA 4AC7C 3H2NA 1EHNA 4RV8A 1OC6A 1EX1A 1A3WA 1MQRA 4B4HA 4W7UA 2CXEA 1W9PA 4Z2GA 2WPBA 1F3XA 2TAAA 3R58A 3BJTA 3A3XA 1SJAA 4JIIX 1MMFA 4GYKA 4G6CA 4EXBA 1XC6A 4DZIA 4OZOA 2J9YA 3RPDA 1F5ZA 5EFFA 3UXDA 1S5TA 3GW3A 3W00A 3W86A 2PU0A 3ITLA 2PWFA 2P10A 1PUDA 1NOWA 1DWJM 4BEUA 4KWOA 4HA3A 3W29A 2Z1WA 1HX0A 3DYPA 4JEJA 2OYMA 4I7VA 1P4CA 2XVNA 3S2JA 3P61A 3NVDA 5E6ZA 2XG9A 5M17A 1ZCCA 3CNYA 3BWWA 1TPB1 3A4XA 2B31A 3LXAA 3W07A 3CLMA 2VI0A 3SM0A 3E0VA 2PGEA 3GNPA 3AS2A 1H3GA 3GVQA 2CEQA 2WSPA 3VGEA 1W3LA 1ML1A 2YKKA 3GFXA 4K3ZA 1XBZA 1ZS2A 5E09A 3AIWA 2BVYA 3ZJ6A 5IOBA 5CC5A 4UFHA 2XIMA 3UWEA 1OIMA 4DUXA 2NT0A 1EJXC 3P67A 4FALA 1Z41A 1OFAA 4WVXA 1QFEA 2ZC8A 4HMDA 1UBPC 4AZ5A 1Y65A 2QJJA 3IRSA 1IV8A 1POJA 2FZBA 3G8EA 4GMEA 3JUGA 3VZYA 2VZSA 2NW0A 4HNTA 1JZ3A 1G4SA 1QO2A 3IPWA 3PR2A 3NSMA 3OBKA 4MAZA 2XIIA 2JEPA 2QS8A 4B16A 5ABFA 1H51A 1ZRQA 3TCSA 2VMFA 3SGGA 1B1YA 3E9AA 1UPPA 2P5NA 3R25A 2P76A 2UWFA 3H7RA 2QCLA 3EX4A 5CBIA 2PUZA 4S23A 4C1NB 4F2BA 1FWBC 2OX1A 1NFGA 3UWWA 1YE6A 2QPXA 1GZ1A 2OO0A 3RRAA 3PZNA 3MMDA 1DL3A 4H8UA 5A6SA 3E2QA 1QRQA 3T7VA 1US0A 2X1SA 1CXEA 6REQA 1KD0A 3KOYA 1UC4A 1C7TA 2PSNA 1YNPA 3ISIX 4LUTA 1LLZA 5DRCA 1C8XA 3S3GA 2CU0A 4MFEA 1SO4A 3VOGA 4QG8A 4Q3MA 3GDRA 1ZUAX 1JQVA 3KAOA 4K8EA 4QGCA 5A69A 2YB4A 4IT1A 1UBSA 4ZXLA 4IP5A 4WUIA 3WBEA 3F4NA 4R3UA 2OPJA 4LOCA 1QPRA 3WK2A 3UY8A 3PY2A 4X63A 5A6LA 1RVGA 3W88A 3U0HA 1P6CA 4K8HA 2Y24A 4HYWA 5CGQA 3W87A 2E68A 4S1FA 3VK5A 4OVXA 2G5WA 3STGA 2I14A 2F6XA 3VKKA 5C2GA 5BU9A 4GWEA 5JH2A 1EBGA 3MJMA 4JIHA 2QUTA 3S5NA 4JQ2A 2QDGA 3GZ3A 2NXGA 2XHYA 3RF9A 3U2CA 2IKHA 1NP0A 3G24A 4L4MA 1VLIA 3SCWA 2ZDSA 1E71M 4ACZA 3UWQA 1H61A 1VFUA 4JGDA 1QW7A 5I3HA 2AOSA 3M46A 3NXLA 4KEMA 1CGXA 4AEEA 5EGRA 4AIBA 4CNSA 4Q7BA 4K36A 4CD6A 3K8MA 1UD5A 2R8WA 3VX1A 4WIWA 1LZOA 3WUFA 1KM6A 1CXLA 1KCZA 1GQIA 1J12A 3VOJA 1KFEA 3S47A 3UF9A 2YA2A 5I3KA 5D9NA 3RLGA 2DZTA 1HL2A 3EKLA 4OKDA 1WBJA 2OTDA 2F7FA 2FTPA 3NQMA 3U9IA 4L64A 4IJRA 4LVFA 3UR8A 2YL8A 2MUCA 2PWUA 3CH0A 1SMAA 3KBJA 3OLIA 3TNOA 3SFKA 4XX6A 2G8ZA 4TX9A 1X7FA 2D3NA 2CLKA 1TMLA 4L1XA 4UTHA 4UCFA 3W7JA 3NQDA 5DCEA 1SM9A 3WFAA 4URIA 4WJEA 1LOLA 4K2SA 1SR0A 1SSDA 1XLFA 4EKJA 4GRSA 1IT8A 1QI4A 1G7UA 3R79A 3NCOA 4FLSA 2YFNA 3A4AA 4NJIA 2KAUC 3GIPA 4KRTA 3GNXA 1MVYA 3USZA 4TU1A 4DO6A 2OODA 4YPJA 6CGTA 3PNZA 2HNEA 3EA2A 3GBDA 1WBHA 3TC7A 1QNSA 4DX3A 1NELA 2QJNA 3U7BA 2GQ3A 4WOQA 3W1UA 3M9YA 1UH3A 4DF2A 3B0XA 2Y62A 1TB3A 5I3DA 4GX9A 2OG9A 2GFTA 3EYPA 3LHVA 4U3CA 1E0UA 2HE8A 2A3EA 5CSUA 2A3HA 4J7RA 2BXZA 4IIEA 5I78A 2G95A 2J78A 1EIBA 4O11A 1E4IA 1LUCA 3CYVA 4DBEA 4UTLA 1VPYA 3GAYA 3GH4A 1YHTA 2BMBA 1CDGA 4EF8A 4NILA 2E4TA 3W7OA 1AH0A 1YDVA 2CESA 3HPXA 3V7PA 3M5XA 3GE7A 1CLKA 5FACA 4ATDA 1UZ4A 2ZUTA 1DE6A 1VFHA 2PWGA 2RGLA 5BXRA 2ZX8A 4MZ8A 2CETA 5K7JA 1PJ9A 3AIVA 5F1UA 4Y8EA 3GVGA 5A2BA 4P8VA 3C56A 2DZPA 1C29A 1UR2A 1J0KA 4INFA 5A8GA 2FGZA 2AAMA 4O17A 5C9WA 3W1QA 3VOIA 4LRSA 2OQHA 3APYA 4AZCA 5G4EA 4YJ5A 1W1A1 5EYWA 1O5XA 1A3XA 4WXZA 4LRTA 4ZODA 1VRDA 2WV8A 4LPCA 1JXKA 4F3HA 1XINA 3O2LA 1HJWA 1CI1A 3C0LA 3PANA 3S83A 3TSDA 1UW9A 5G4WA 4TTGA 1UROA 4IG2A 3MBFA 3H4WA 4GC4A 3W74A 2ALDA 1OCNA 4E38A 4XV0A 4XD6A 1Z48A 2PDPA 2WSYA 2HXTA 1EC7A 3WD4A 1EJVC 4GCAA 1E1CA 2A21A 3NYZA 2QLYA 3LPPA 4C7FA 2REQB 1U1JA 2YXOA 2J9ZA 2P53A 4H4IA 3CQIA 1DKWA 4JIQA 4IISA 1QOXA 3UR5A 2OQLA 1L6WA 1POKA 3HQPA 3OTRA 1XYLA 2Q3OA 2V67A 4PB5A 1CEOA 3NM3A 5HQEA 5JIPA 4LGXA 3W22A 3MDWA 4JTTA 2EGZA 1VENA 3M41A 3UXAA 2OGYA 5AY7A 4LNYA 1GOKA 1TV8A 3BCFA 3GDKA 4IX0A 2ZRUA 5T8GA 1ICSA 4Q4OA 2XM2A 3AWOA 4AG0A 1Y7VA 2CLPA 2DPEA 4DYJA 1G4PA 4MJMA 1I9CB 2H9AA 2PTDA 4DVOA 1Q6DA 3EWDA 3S5YA 1X6NA 3TZNA 1XRSA 1Q6FA 3M47A 4AIOA 5BXPA 1GOIA 1E1EA 4E0CA 4IFOA 1AA1B 3MO4A 3T0BA 2D22A 4I6KA 2DORA 1DJHA 4JFSA 1RLDA 1BG4A 1R7AA 3PNUA 2YPIA 3OYZA 4ZO8A 4DWSA 1C90A 4RXGA 1KGXA 4DBSA 3N15A 3BQ6A 3HV9A 4HU0A 1V93A 1O5RA 3TQKA 4IMGA 3QN3A 2Z27A 1TWWA 2HSAA 4NZCA 4G8TA 5F7UA 1YPXA 2B7OA 2VQUA 3SGUA 2J75A 1JDDA 1I2PA 4ATLA 3NZQA 1TTJA 3QV7A 3ZVHB 3VIGA 3DI0A 3EA1A 2YL5A 3SJ3A 1A49A 3UWZA 1DWIM 2J47A 2HBVA 1M04A 2WANA 1YADA 1PIGA 1IYXA 3A6OA 1ZU8A 1W1IE 4ZB0A 5LHEA 4AWTA 1H2JA 1OVDA 5AHEA 3GTIA 2DVXA 4GQGA 3LYEA 1QI3A 2HDJA 3W1MA 4PRRA 2OO6A 4QG6A 4ZO9A 2QQ6A 4JPGA 3W01A 4P8WA 4DWSD 3IJ6A 5FJTA 4CQDA 5CXPA 2I5IA 3KOXA 1MFVA 7TIMA 1ELSA 1UWAA 4LALA 3S46A 3EX1A 1LWIA 3HOJA 4WXYA 2E8ZA 4UUIA 1UJPA 5IDZA 2YZRA 4RXFA 7XIMA 3GU2A 3SN0A 1D9EA 3FJ4A 3P84A 5AVNA 3B04A 4OBRA 1H4PA 2HPIA 2IPJA 2QJHA 3WL0A 3HQ1A 2O92A 4FNTA 3SCQA 4JYDA 3A24A 4MF4A 4HK5A 3W25A 3BJSA 3V5FA 3GLCA 3K4AA 4LUJA 1KV8A 3K5XA 6TAAA 3PP7A 2HV5A 3UBPC 3V5OA 1IXOA 1GWJA 4XZWA 3CBWA 2UV8G 3UZYA 2BOEX 4UFMA 2TRSA 4YHGA 3VCCA 4M51A 5HR7A 1TJRA 4JNZA 5ECUA 4FZIA 4AXNA 5K2ZA 4FOJA 2DQWA 4WKFA 1XDJA 3GHTA 3FCPA 4G7FA 3TKFA 2VL4A 1LLOA 3VUSA 4FLOA 1PCKA 3UT0A 3EOOA 2WC7A 5HJXA 4JY8A 5TQLA 1QU4A 3ME3A 4XVDA 3QRHA 3BLEA 2A85A 1Z69A 3LRKA 4AVFA 3H70A 2NSXA 4B3LA 3STFA 1B4KA 2OZ8A 2ACQA 5A6AA 3HBLA 1TA3A 1RD5A 4JFTA 3U2ZA 3TN3A 3OPSA 3A4JA 3A9IA 4KCTA 2W62A 3FYPA 3D3FA 3E0FA 4GGBA 3S2CA 5DMLA 3GRIA 4KEVA 1U30A 4AY8A 4N9BA 1OCQA 3H2AA 3B8TA 3UXLA 1JPIA 2EKCA 4XKMA 2CKRA 4KWWA 4G2DA 1HP5A 1TV4A 3LQLA 4MKNA 1C7SA 3ES7A 1UR4A 5EMKA 1QWGA 4QR6A 3SUTA 1W5PA 2P88A 4NG3A 1YEYA 3SUWA 1KB3A 4JTFA 1W17A 4PBFA 4NZ5A 3TOPA 4ICMA 2GK1A 3Q94A 2C8NA 5BXTA 1WOBA 2YOCA 4DHGA 3CUFA 1YDNA 2W91A 4S39A 2PF0A 5HBFA 3OA5A 3P14A 5C70A 3L4TA 4TOQA 3FDGA 1E6NA 2QJGA 1L6GA 2X8RA 4A3UA 4E3TA 3WELA 3W28A 5FIPA 2SFPA 4N9EA 1SZRA 3G1YA 1GGOA 3SCUA 3VE9A 2GJXB 2DW6A 1FWRA 3TJ4A 2Y5SA 1D3GA 2VVNA 2WKJA 4IPPA 4IIBA 3PB2A 1BKHA 3S1XA 4H9ZA 1KGUA 2BXYA 4KT2A 2W61A 2FPTA 3UJSA 3N73A 1H1YA 1YW1A 4JX5A 4C6QA 1F3TA 2GQ8A 3NQAA 2BOGX 1R3YA 5T26A 3I3DA 1LJYA 5I77A 4GA8A 1AH3A 3GSMA 3C4UA 2A79A 1HKJA 2VX4A 5FL0A 1J10A 2FHFA 3IVSA 4QS6A 5JUVA 4AVNA 4OHQA 2YB1A 1Z32X 1JDCA 4UBPC 1OYBA 3UWVA 1R87A 3TYAA 4A8IA 4TQTA 3QFWA 2HS8A 1G69A 4P2VA 4UQ9A 2AAAA 1H1NA 4D6IA 3RCNA 3AMKA 5HNRA 4HZ7A 4D8ZA 3CK5A 1B4EA 5TAOA 3KLLA 3PAOA 1TVLA 1TPUA 1E5JA 3CJPA 3FJ6A 5TBOA 1LBFA 1TWDA 1T5AA 1OEPA 3N14A 3QGVA 1X6UA 1HFBA 2V3DA 3WH9A 1RJPA 1Q63A 2V8ZA 1M7XA 2VJXA 1T8XA 1LRTA 5BRBA 2V5KA 1FHUA 4CCCA 4CCEA 6TIMA 3O3RA 1OX4B 3OVRA 1WZMA 1B3XA 1CXFA 3WQCA 1IE7C 3ZSTA 3FYOA 3F4CA 4HKPA 5LZLA 1K70A 5HXMA 5JXQA 3EZ4A 3ORWA 1OBAA 1AK5A 4IMAA 2C0AA 2Q8XA 1WKFA 4Z1DA 2I1OA 2WMGA 1KFKA 1XBYA 2Y7EA 1XLKA 1L8NA 3N12A 2BHYA 3ZM8A 3ZJKA 3NJ3A 5LHFA 1HNYA 5D2XA 4KS0A 4I90A 2F6UA 2CXGA 1TJ2A 2ZUMA 2DT2A 2WZIA 4MNKA 1W1ZA 7REQB 2AL1A 2XFWA 1AZ2A 4EWND 4ENLA 4YWIA 5LNVA 1F4HA 5JBFA 4OFCA 1EH9A 1WUFA 3CUIA 3TW6A 1MZHA 2VGBA 1W9DM 2X7WA 2ZOXA 4WRHA 1EJWC 2Z1KA 1UR1A 3SECA 2XFFA 3IACA 1B57A 1ONWA 3AUOA 3HJEA 5FF3A 4PBEA 1T96A 3QMTA 4OOZA 1NU5A 1D3CA 1CB7B 1FRBA 1VHNA 2YLAA 1GVEA 3HG2A 3ZMRA 7TAAA 4S3JA 2XIQA 3H7VA 2PDWA 2VCBA 2ZUWA 4S3KA 3EPOA 2OZ0A 2E5DA 1J2WA 3IJLA 1BTCA 4GISA 4QJ5B 2RDWA 4P5UA 4ZMGA 5E1QA 1GKRA 3L67A 1VFMA 3MMUA 1AD4A 1H11A 2W79A 3BAIA 3RXZA 1BQCA 3WEMA 4NZ1A 2XVGA 4HU8A 4JY9A 1DBTA 3F03K 3P81A 2ESCA 2V5DA 2VTFA 1PTGA 4F2TA 5I02A 3HF3A 1QUMA 1NOFA 1QPNA 4HK7A 4IPJA 1SFTA 1H7XA 4Y8FA 4AEOA 1R3VA 1DYSA 1E6QM 3WF4A 2VKZG 4K7YA 4XK2A 1JCNA 5AZ1A 3C52A 2DGAA 2YGYA 1M5WA 1MO0A 5PTDA 1JDFA 2INFA 3AZTA 1YXYA 2XVKA 4AAJA 2WHMA 2R9RA 1N55A 1K8XA 3P62A 4GUHA 3GXFA 5D2VA 2E0PA 1P6BA 4HMCA 2FH6A 4HNLA 1W0MA 3GUWA 4RDYA 4IJCA 4ZEPA 2FJKA 3L2MA 5DY3A 3GDTA 4M6PA 1KC7A 4CQCA 1VD6A 1XS2A 2X2GA 3E38A 4GIRA 1JAEA 3HGOA 4YTRA 1OFQA 3A23A 4PEKA 4DUVA 4IQEA 4N6EA 3ALGA 2J74A 1SPQA 2YCKX 3AXMA 2YYUA 3G2GA 2Q02A 1XQKA 1Q6GA 2UZ9A 2VR2A 4H6KA 3VGGA 1ISZA 3WQWA 3DFSA 3IARA 3WMLA 3KVMA 1WDQA 4FXSA 2BB0A 1V0NA 1QBAA 4PZVA 3QTGA 3SURA 2CPUA 4OUEA 3UZXA 1H1ZA 1K7EA 2WB5A 1H63A 5CKSA 3G22A 1OZMA 4P61A 3W4RA 1X1NA 1E9LA 1QNRA 3WF3A 1I6NA 4L6HA 1TV7A 1HKVA 3VAVA 4PTXA 4FNPA 2EJAA 1UA7A 2HNHA 4MNMA 2JFEX 1BYBA 3CLWA 2ISDA 5DMMA 3QV8A 4Q4RA 2BHUA 2OSXA 4NU7A 2ISFA 3MUIA 1OFPA 5IFPA 3CUZA 4ZQRA 2Y89A 2F2KA 4IX2A 1RBOB 3KZSA 4GHRA 4GIAA 2YDQA 3IGXA 1R38A 3C86A 5FF7A 1XRFA 4Y9OA 1CLXA 4ORIA 1K7FA 3PN8A 2V68A 5G2IA 2CHRA 1J8VA 2FMNA 5D33A 4O15A 3ITYA 4AZBA 3IK4A 1I2OA 4D72A 2ZX5A 3KOZA 1WX0A 3HG3A 3B05A 2E5BA 5JH1A 4MJ2A 3V4BA 2OCZA 3FKKA 3I3BA 4QDPA 3E2RA 2Y88A 5LSMA 2NQ9A 1R86A 1FFQA 1A3HA 2HK1A 3WUBA 3UG4A 3LHWA 1VEPA 3AISA 3W7CA 1XIIA 2PC8A 2V81A 3INPA 1OG6A 3P80A 3LBMA 1WKDA 3WQ5A 3LRMA 1BSLA 2V3FA 2B7NA 4PTVA 3Q58A 4GYPC 4XZMX 1NFPA 4YMZA 4K39A 2XN0A 4JTHA 3D3AA 3RDKA 2E6AA 3SDOA 1QXLA 1PEZA 4JKMA 2IQTA 4IP7A 5EMMA 3KDNA 2G3IA 1XLDA 3E2VA 1B31A 2WQPA 1XW8A 1AW1A 1J6OA 3FEQA 3KVKA 2F61A 1RA0A 2WMJA 3OHIA 5BRPA 1OFRA 1J18A 1S38A 3E1F1 1MWOA 2CWNA 3ITTA 2CWXA 4WR3A 3WQ6A 3PZGA 5C2CA 1FWEC 1H50A 2IXUA 3WKZA 5CJ5A 3SFWA 3E0WA 2WNWA 3ARVA 4GOAA 4O1AA 1TR1A 4ZTYA 3N25A 1IXPA 3T55A 5D8WA 1MXSA 1FCVA 3KLKA 4QIUA 4DYEA 4IIFA 4A05A 2G3MA 3CQKA 3CPUA 3KTXA 1EC8A 1GVSA 1X97A 1X1ZA 1PV8A 1PX8A 3GHSA 1NFBA 3CHVA 2BODX 2FHBA 2Y5JA 1Z6KA 3LCWA 4PYSA 3OYXA 4MWAB 1YXCA 2I57A 2PGFA 4YVPA 5E9XA 4GLEA 1GOQA 1Q65A 3CIVA 1BG9A 1EGMA 4WKAA 3B8VA 3OLGA 4MYXA 3T2QA 4LSBA 5JBEA 2CCRA 2NT1A 4IPIA 2FFIA 1FY6A 3K1DA 2AL2B 4MB5A 3DC8A 3FVDA 2X1TA 1K77A 1Q4NX 2ZUNA 4O0KA 2C18A 3VIFA 2BDQA 1E4MM 4OU1A 4XUYA 1ECEA 2DZSA 4PMYA 3VMOA 4D6JA 3TZFA 4HGXA 1ZQ5A 3TMLA 4X0NA 1EP3A 4NASA 1CPUA 4PL1A 2V3GA 1MEHA 4LVDA 3NQ8A 1RQBA 4C6BA 4RNHA 4B90A 3AROA 4U5IA 1W2VA 3H8AA 4C1LA 5JVLA 3IWPA 1V3JA 4JKLA 2BZNA 4LF1A 2ZA1A 2J7FA 2PWEA 2BLEA 4UMCA 3UA4A 4R53A 4GXWA 3WLMA 4QJ3B 4C65A 2GJNA 3ARZA 3TUUA 1QDSA 2YBVA 1JFHA 2ABBA 2P0IA 3VGDA 3PZMA 1UOKA 5KZMA 3LHTA 1UKTA 1ME7A 3VOHA 2V2CA 4EF9A 3FV9A 4NZ4A 2YDSA 1XBXA 1KTNA 2XZ7A 1LF1A 3VKCA 4IJBA 2X0YA 1VS1A 2EG6A 2QCFA 2YR1A 3DKJA 2R14A 3ZS4A 1W54A 1VBRA 2VX6A 2ZFAA 4GJJA 2OJPA 4PMUA 5EB8A 5ABTA 4XD5A 2INZA 3F5JA 1OK6A 4XTDA 2VDGA 1LM1A 2FVMA 2BGQA 3W1NA 4J35A 5HATA 3REQB 4O0ZA 4AVOA 1C91A 4QX4A 3VD3A 2G3NA 5DY2A 1Z3NA 3LHZA 1GW1A 2OT1A 1ITUA 3QZEA 3SSZA 1Z44A 2NXIA 4MLJA 3MA8A 5TIMA 3S9YA 1S5MA 1S2UA 3EKZA 4AZIA 3TYEA 1HJUA 2G96A 3OB8A 1ZL1A 3TWAA 3OZYA 4J9JA 4NAFA 3W7MA 3QPEA 3AS3A 4GABA 3TC3A 4DO7A 4EP8C 5LGZA 5AHIA 5CQ1A 3I3EA 1L0PA 3TONA 2G3JA 1RCQA 1KCKA 1QPQA 2AMXA 3GFZA 3ZYZA 4L61A 3IK2A 1SJDA 1D3HA 4XAFA 1UMYA 4QDWA 5HNNA 1HTIA 3BCDA 3VKAA 5D2TA 1EOMA 3VM5A 4HHHA 1YDOA 4TMBA 2J24A 1O68A 4PMJA 1IQ8A 2VC6A 4KEZA 4HHLA 1W3TA 3STCA 1VFOA 4AD4A 5F2LA 3SRFA 3QFEA 5LNSA 4U33A 2PAJA 3NXFA 5J8LA 1R30A 3PUGA 3EXTA 4G5DA 4AWUA 1G1YA 3WG6A 3EWUA 3MU7A 1Q2RA 4MNLA 3E12A 2HE5A 4IICA 3NPWA 3KRUA 3R43A 5HWMA 2A7RA 1YQ2A 4TO8A 4JQ3A 4B5TA 4W87A 2OXNA 3TN5A 4B9ZA 1TTPA 3L0KA 1LP6A 2NQ5A 1R7OA 3FLUA 4BZYA 4TX8A 2W9MA 3C2RA 3M6DA 3W1TA 4GPNA 1YNQA 4Q6XA 4XB3A 4CQ8A 4M82A 3NA8A 3FNDA 2WBGA 2AGTA 1GOXA 4JTKA 5CC7A 3A5FA 5KMYA 2YJQA 4QQ3A 1OFBA 5DXXA 5DANA 1HKMA 4WQ6A 3HV8A 3LZ5A 3MTWA 1ADSA 5D2WA 4IZGA 1TZ9A 4US6A 4FX7A 4O16A 4JNYA 3UEQA 1TUFA 3O0KA 5FF2A 3Q45A 3LCFA 4DO4A 3BK0A 5D2YA 4REQA 4B2DD 4MJZA 1A5AA 1XJBA 3GG7A 4AWSA 1S1RA 1K9EA 2YL6A 3Q4DA 3HFYA 2PTYA 4H00A 5I6SA 3PTKA 2VZTA 4W5UA 1MDRA 3PB0A 1S3TC 2I9UA 9RUBA 4HJWA 3M5VA 1B9BA 3PZTA 3PTMA 1OFEA 4AXKA 2PZNA 1O66A 1P5BA 2ASHA 5XIAA 2JBMA 2XM1A 3MV11 3GNOA 3IGSA 4RW5A 2P3EA 3IAPA 2PFHA 4GACA 3ABZA 1TIMA 3TTEA 4PUDA 3KXQA 2GUUA 3QLLA 5HWJA 3W1PA 2G97A 4E2OA 1QOPA 4PMQA 3WNMA 3G3DA 3G1DA 4ES4A 4YHEA 3MS8A 5FCZA 2VHLA 4J40A 3LCGA 4UMAA 1ONEA 3NZPA 4MDOA 2PRLA 5DBUA 4IL0A 2PGWA 3K46A 4JD4A 4EXQA 1R2SA 3IJDA 3TYCA 5A94A 3NQ7A 3UPMA 1NWRA 2Q71A 5AHLA 1M7PA 4GY1A 2EG8A 3BJFA 3E5BA 3QY7A 2JF7A 2QR6A 3GU9A 2BGSA 3MP3A 1UWRA 2BHZA 3P82A 1VRXA 5CPNA 4N4QA 1J0HA 3I4KA 4X9YA 1E56A 4Q8TA 1UASA 3U5UA 2REQA 4B5NA 4GH1A 4I6VA 3WF0A 3CHCA 3WX7A 4AYGA 3CWNA 3T9PA 1XC4A 4ZE5A 4DLFA 3VE7A 2Z2AA 1CBGA 5EMUA 5IDIA 2AKMA 4QG9A 3GG1A 3BZGA 1C3FA 1FTXA 3SRHA 1VCFA 1UR8A 4U28A 3AHVA 4R88A 1TWZA 2QKFA 5I03A 4IGNA 1UUQA 3VIIA 4E5TA 1XKYA 3AU2A 1K9FA 3WBWA 1M68A 1BXCA 4P8XA 8CGTA 1RK6A 3GC2A 2DSVA 2G37A 4TVDA 1I60A 4H01A 3WNOA 2ZX9A 4DBWA 1IGSA 4LQ1A 3RCYA 3T8LA 4HB7A 3OQEA 4ZCWA 1UUMA 3SY8A 2GDUA 3CAVA 3M16A 4TXEA 4F0RA 3ZWSA 4R9XA 3T0CA 3RR1A 5HANA 4V28A 1NQKA 4M7TA 4XWUA 2BASA 1NDYA 1X96A 5K9CA 3BLLA 5ABEA 1YLVA 1Y5WA 3O6YX 6ENLA 1BSIA 1MUCA 3GH5A 3N4AA 3C6CA 2WMIB 2XWEA 1JPDX 4UTIA 3RO6A 5D9PA 5E0FA 4C6DA 2WPGA 3ABSA 1IWAA 1ZJBA 2BG5A 4ROPA 2GUYA 4HHPA 4XIMA 5FOOA 3GXDA 1RJQA 4PBGA 5A1AA 3ARSA 2XSXA 2VEIA 4AYSA 2VM8A 1ITXA 1HT6A 1BAGA 3A22A 1M03A 3ITCA 3W2NA 4F0SA 1TPWA 2GZXA 4MM1A 1K8ZA 3PZIA 4DM1A 5HUOA 3LBCA 2PWVA 1R2TA 3W7LA 3BAKA 1BFNA 1KM3A 4Q4MA 4HZMA 1NF0A 1I0BA 3EBVA 4KIRA 3M0JA 1CLVA 4LVAA 3SUSA 1KW1A 2QW5A 1BGAA 1CXIA 4JN6A 3TTQA 4S3EA 3APTA 5M3WA 4XKYB 3ID7A 4Y7EA 1F61A 1JF5A 3AQUA 4MADA 1W5NA 1SFJA 3QW3A 3GU1A 4HSOA 4AY7A 2FB3A 3AMCA 2ISWA 3ANYA 1VBUA 4MZYA 4MB4A 3B0YA 2HPMA 4HN4A 1V0LA 2WJEA 3CU2A 3VO0A 1R3SA 1RPKA 2ZZ3A 4XBSA 1NDWA 3PJWA 3SBFA 1DTNA 3KHJA 1XCFA 3NIYA 5LA0A 1RQEA 1SUXA 3T4WA 1SR9A 3BAWA 3KRBA 2E8YA 1I8JA 5AHMA 4CNNA 4G1NA 2VRQA 1KWKA 1WZLA 4YNGA 2VQTA 4IMDA 3S2NA 3U3HA 1BTMA 2Q09A 3IV3A 3NSNA 4Q6JA 2PD9A 4PRWA 1H0GA 2PDLA 4D1JA 4HP5A 5MKGA 5CJNA 1V3IA 1PBGA 3NM1A 1KR0A 2Q8LA 4HMEA 1ITQA 3WL1A 1C9WA 1R3QA 1EPVA 1D8WA 5F4SA 2WNQA 1SW3A 3R89A 4A35A 1OWQA 3R13A 3I10A 4DLMA 5FSEC 3UERA 1GQJA 1HL9A 5TNVA 1KA9F 2GUBA 5MHBA 3VNIA 1W3JA 2GYIA 1V03A 3H4GA 3V0TA 3LGDA 4O10A 3OG2A 5AVHA 3P60A 3VGHA 1V3HA 7A3HA 1RH9A 1ME8A 3T0AA 5XINA 2Y8UA 3FHAA 1T99A 4UOQA 3GC5A 3NQ2A 1TWSA 2RDTA 5BOOA 2Y5EA 4U31A 4DQWA 5DXYA 5FEZA 4FO4A 5F4XA 2YBTA 4AZGA 2BSLA 2V63A 3WQFA 2PU1A 4C6JA 4MKVA 3WK0A 3LM3A 1DIKA 1MI3A 4DPQA 1EP2A 2PODA 3DFHA 2H90A 1R2RA 4H6QA 3UJEA 4A22A 1M41A 3G6MA 5KZDA 1EGVA 3N6HA 3WDIA 1V7YA 4E4PA 1EJTC 3DDMA 3CB8A 2GQ9A 1SW7A 2A3CA 4JHOA 3MUZ1 3GR4A 2DP3A 1BXNA 3H23A 4JXCA 3G18A 1R0MA 1RBLA 1W1PA 2YDRA 1LT7A 2PLJA 3XIMA 3SRDA 3W75A 3NPUA 4LB3A 1FXPA 2PDQA 1UKQA 2OQYA 2GWGA 3WDQA 3S9IA 4Z1CA 1YMYA 2WVVA 2QCEA 4TV5A 3WDRA 1Q13A 3LXCA 4K8GA 3WJSA 1E0TA 5DELA 2NSOA 3W83A 2OEJA 2ZZ2A 5LNWA 1A5NC 4MAVA 4PN2A 3VKBA 4EX4A 4NVTA 1T40A 4US5A 1C92A 1FP8A 1CGUA 1UZ1A 2Z7KA 2Z7GA 4G1KA 3LERA 3RPMA 3G1RA 4GFIA 2CHNA 3T8QA 3FN9A 3BLPX 4O1EA 4FHAA 2W66A 3ZVIA 3MKVA 4F79A 1KFCA 4UZSA 3V0UA 3RJXA 3WMSA 1VR6A 3DI1A 3VU2A 4E4FA 3VNDA 2VO5A 1JD7A 3GVVA 2ZE0A 4S3FA 4M5PA 3DBNA 3OJGA 2XJ7A 5AECA 2QCDA 2YBUA 2RGMA 2FZNA 4H9XA 3LEPA 1O7AA 2FZMA 3AHTA 2CYGA 3TA6A 3CTLA 1YIXA 3M7SA 4J3XA 4LAMA 1QI0A 3IS4A 5FEPA 1AL8A 8TIMA 2D2OA 5K3VA 5BMXA 2FFCA 4QXIA 3VNMA 4US5D 2XVPA 1OINA 1E55A 2PZ0A 3PZVA 4XD3A 3ZJ7A 5KEZA 3WO8A 3ES8A 4QRNA 5BYWA 1JGIA 2FHCA 2EF9A 3LGGA 4GYPA 2RFGA 3M7WA 5I07A 3UYCA 2Y70A 1NIUA 3G77A 1M3UA 3GO2A 1YE4A 5D02A 2IQDA 3DFYA 3JZEA 2WMHA 1RK5A 3SO7A 4RPPA 4B4FA 3R8HA 4B3ZA 2XSBA 3W73A 7REQA 3SADA 2OYLA 1WUEA 3PAJA 2I7GA 5C54A 1BYDA 4R85A 1P43A 1JIBA 1FWNA 1VGAA 1OZQA 1XRTA 2O9PA 1IHIA 1QPOA 4AU0A 1VJSA 1XSIA 4NF7A 1GVRA 3EMQA 3KVJA 3O07A 3P7YA 3SZ8A 2D0FA 4QS5A 3VGBA 4BJHA 2NQLA 4W5ZA 5GNXA 2E40A 2J7BA 4HNCA 5D8ZA 5A2CA 4LF2A 1KM5A 4DRSA 2GVJA 4Q8PA 4IH3A 2J79A 3UW6A 4AZ7A 3SJNA 2WJFA 4D6HA 1XLGA 1GG0A 5J5DA 4DJED 2JEQA 2BP1A 3UJFA 1XV8A 1P0BA 3LXBA 4A6GA 4X2RA 1VF8A 1AH4A 3NTYA 4L4OA 2JQXA 5HR6A 2Y61A 1QHOA 3UR2A 1WAWA 1PZ0A 4JTDA 3CZEA 3H26A 4PUNA <