3K4WA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF Uncharacterized Tim-Barrel Protein Bb4693 From Bordetella Bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein Bb4693
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3k4wA00
3GIPA 4WGXA 4IFKA 4EPKA 3URBA 5AKQA 1GKPA 1FWAC 1J6OA 2GWGA 2OGJA 2QT3A 1FWEC 2AQVA 2Z24A 4J35A 1EYWA 4LAKA 3TN4A 5G4HC 3CJPA 4C65A 3C86A 4KESA 2ZC1A 4C6QA 4I6KA 3NURA 1R9ZA 4P5UA 4R88A 1FWCC 4TQTA 5FSDC 3IPWA 4RDWA 2EG8A 4I6VA 3GG7A 4C6EA 1M7JA 4XAYA 3O7UA 4XD4A 4H9YA 1PB0A 2DVXA 2QS8A 2D2JA 1P6BA 4LCQA 1FWDC 3S4TA 3T1GA 1UIPA 3GRIA 1JGMA 4KEUA 1NDZA 3MVTA 4BJHA 4M51A 1XWYA 2BB0A 1M65A 4XD5A 4DNMA 2HPMA 1A4LA 4H01A 4GY7A 3HPAA 3RCMA 1YNYA 3E0LA 4KEVA 2Z26A 2GOKA 1KRAC 1EJUC 4C6PA 2VM8A 3IARA 3UPMA 4PCPA 3F2DA 3K5XA 1NDWA 1QXLA 3MVIA 1V51A 3DUGA 1ONWA 2OOFA 4B3ZA 1KRCC 4DZHA 4LFYA 4DYKA 4GOAA 4KETA 4RDZA 4C6JA 4C6IA 1NDVA 4C5ZA 3OJGA 4MUPA 2Z7GA 1UMLA 2PGRA 2W9MA 4EP8C 3B40A 4PCNA 3N2CA 4UB9A 4CQDA 3HM7A 2AQOA 1FWFC 4IGMA 5E5CA 4KF1A 1EJVC 3NEHA 4DLFA 4RE0A 4ZSUA 4UBPC 4IFRA 4LCRA 2GWNA 4IF2A 3OVGA 4AC7C 3O0FA 1A5LC 2FTYA 2HBXA 3AU2A 2O4MA 2Z29A 3T81A 2EG7A 2VC7A 2RAGA 4DIAA 4E3TA 3GU1A 3WMLA 4IG2B 2DVTA 2PLMA 3GTXA 2HBVA 3B0YA 2WM1A 1P1MA 4ICMA 4QRNA 3E38A 1R9XA 1UBPC 3LSCA 3IJ6A 2A3LA 2WJFA 3F4CA 4B90A 4C6FA 2Z2BA 3URAA 1A5KC 4QS6A 4GC3A 1K6WA 3ID7A 4H00A 4KEZA 3V7PA 3GU2A 4V1XA 1GKRA 2YZ5A 4D8LA 2FTWA 3GUWA 3BE7A 4WHBA 4HK7A 2OB3A 3HTWA 3LY0A 4L6DA 4GBDA 3A4JA 1EF2A 3NQBA 3RYSA 2Y1HA 4INFA 4C6OA 4DO7A 4BKNA 4DLMA 1O12A 3MDUA 1V7AA 3PNZA 4B92A 4LEFA 1EZ2A 4GX8A 2UBPC 3LNPA 2CZVA 4H9MA 4R85A 2VR2A 4C6LA 2ANUA 2I5GA 1ITQA 2EG6A 4IFOA 3TN6A 3MSRA 1ZZMA 4HA0A 1V4YA 3SFWA 2XIOA 2YB1A 3KM8A 1FWIC 1O5RA 2ADAA 1RK5A 4LANA 1KCXA 4DI8A 3FDKA 1DPMA 3UF9A 1POKA 1UIOA 4QSFA 4G7EA 4H9VA 5A6TC 1WXZA 2HQAA 3PANA 3E74A 4LCSA 1EJRC 2R1LA 4C6NA 3JZEA 1V77A 4Z42C 1V79A 3SO7A 5FSEC 4EPEC 1FWBC 4ERIA 4OFCA 2Q01A 3TN3A 1EJSC 5HMEA 4J2MA 2Z25A 4XD6A 4ERGA 4DZIA 4QROA 4C6CA 4C60A 3QGKC 1HZYA 2FVKA 4C6MA 3RN6A 2O4QA 4HJWA 4CNUA 4RDVA 3LSBA 3EGJA 3TNBA 4V1YA 2Z4GA 3GIQA 3GTHA 3S2MA 3LGDA 3K2GA 4G2DA 1EJTC 3ITCA 2QVNA 3IRSA 4AQLA 1P6CA 3RHGA 3T8LA 3MKVA 1A4MA 2VUNA 4J5NA 4GZ7A 3ICJA 1W1IE 4RZBA 1RJQA 2D2GA 2Z27A 3A3WA 2HNHA 1E9ZB 3D6NA 2VHLA 5HMFA 2UZ9A 3G77A 2WJEA 3A3XA 1YIXA 4H9TA 4C5YA 2AMXA 1A5MC 4EPDC 2FVMA 4C6KA 1EJXC 1K1DA 1ITUA 1FWJC 4XAFA 3PBMA 2Z2AA 3OU8A 4XD3A 1FKXA 3WZ0E 3IACA 1FWHC 4CEUC 1J79A 3LS9A 3DC8A 4GX9A 4CEXC 4CQBA 4LH8A 3QY6A 4H9ZA 1WXYA 1FKWA 4BY3A 2GZXA 1J5SA 4QS5A 3WYZA 4H9UA 1EJWC 3F4DA 1I0DA 3UR5A 2OODA 3MTWA 3EWCA 2BGNE 2Z28A 3GU9A 1PSCA 4C6BA 3LU2A 3MPGA 4RDYA 2R1PA 4ZSTA 2HPIA 1GKQA 3ORWA 1ONXA 4PBEA 1IE7C 3GTIA 4XAGA 3URQA 1R9YA 2G3FA 2I9UA 1YRRA 1RAKA 2PGFA 1NFGA 3S2NA 1RJRA 3TN5A 4LALA 2PUZA 3FDGA 3MDWA 3B0XA 4GK8A 2OQLA 2E25A 1XRFA 3MJMA 2DVUA 4HK6A 2GSEA 4ERAA 1YBQA 4CNTA 1POJA 2KAUC 4NG3A 1PTAA 3OOQA 3PNUA 3S2LA 1M68A 2VC5A 3QY7A 1S3TC 3F2BA 4B91A 3ISIX 4DI9A 1RA0A 4NI8A 4CNSA 3DCPA 1VFLA 4C6DA 1FWGC 4KQNA 4IH3A 2Z00A 5HMDA 4L9XA 3PAOA 1YBQB 2P53A 1QW7A 3K4WA 4LAOA 5CH9A 4QTGA 3UR2A 3LGGA 4IQJA 3S2JA 1KRBC 3QGAC 3AU6A 1RK6A 4GY1A 1E9YB 4KIRA 1YMYA 1RJPA 3CS2A 1PO9A 3UBPC 4IG2A 2D2HA 4XAZA 1XGEA 3URNA 4PBFA 4GXWA 3E0FA 3EWDA 4GYFA 4WVXA 4F0RA 2YXOA 1XRTA 4LAMA 1RA5A 4PE8A 3OQEA 3OODA 4GY0A 4IGNA 1A5NC 5LXXA 2WJDA 4JOMA 3F2CA 1A5OC 3FEQA 4YIWA 3IV8A 1BF6A 2F6KA 3GTFA 2IMRA 1ADDA 4KERA 4G7EB 2PAJA 2R1NA 3E2VA 4H9XA 3E3HA 4F0SA 3AUOA 2E1WA 4R7WA 4EPBC 2QPXA 4CQCA 1J6PA 3R0DA 2R1MA 4IFKB 1I0BA 2R1KA 3CAKA 3QY8A 2P50A 1KRMA 2ICSA 4HK5A 2FFIA 2Q09A 2YB4A 3LA4A 4NP7A 1NDYA 4F0LA 1K70A 3IGHX
chains in the Genus database with same CATH superfamily
1N8FA 1L0PA 4Y90A 3THQA 2DZSA 4L56A 2NSXA 4X63A 1XLGA 2ZXAA 2H9AA 3AZSA 3PWIA 5J04A 1RPXA 3WDIA 4LUSB 1B3ZA 4IXHA 4LUJA 3MV11 8CGTA 4WCJA 1XIHA 2YA2A 4EKJA 4C7FA 3CLMA 1V3JA 3OGVA 3HG2A 4QLKA 4XQ6A 5EB8A 5D38A 2IS7A 3KHJA 1J4EA 1B9BA 5LYRA 3VC5A 1UD5A 3W81A 4A21A 4DJFC 1TV3A 4AIOA 3GC2A 1TZ7A 3CZKA 1TMQA 5EMJA 3EOOA 3LM3A 3C61A 3GVWA 1EDQA 1VFOA 3KRZA 4EOUA 4HPGA 1JFXA 3KVKA 3VIMA 4JQ2A 2VCCA 3IARA 4L9YA 2VMFA 2W91A 2D3NA 4QXIA 1OVDA 2A5HA 2CHNA 1HKVA 2GPTA 4RXGA 4L1WA 3WUGA 3BJFA 4E4UA 2OVLA 4C6IA 2CU0A 1SYTA 2WVSA 1DKWA 1JCXA 4IJBA 4Z2IA 4E8GA 1VPXA 2IKHA 1GCYA 5JIWA 1UD6A 3I3DA 1QNPA 1XLFA 1UKQA 2CXEA 1VBJA 3PZQA 2DW7A 1TPC1 4RUBA 1I2OA 5D02A 4QE4A 3UEQA 1MWOA 1JF6A 1A49A 3TA9A 3LMYA 4E2BA 1O68A 2BGSA 1W32A 3GU1A 3WMLA 4LS1A 3PPHA 1JYWA 3PSVA 5LA2A 1JR1A 1TYGA 4ICMA 4KRZA 4RE2A 3T40A 1MDLA 2BP1A 2ZUUA 1E4NA 3IJ6A 4C6FA 3LRKA 5M5DA 4I5RA 2PTDA 3DAQA 2QIIA 5A6LA 1V0KA 5FL1A 3TYUA 2V8ZA 1XBYA 2GVEA 4AYSA 3THAA 2HK1A 2BASA 2JBMA 1W3TA 3WNNA 3WELA 4YU1A 4DJED 4RZ6A 4LEFA 2QCLA 1CCWB 3N29A 5C2CA 4OWGA 2EPHA 2ISVA 1UD2A 1TKKA 4D72A 2SFPA 2DSUA 2HSAA 1VRXA 1TZZA 3LRLA 1BRLA 1D3CA 3CWOX 2ADAA 3PZMA 1SO6A 4P61A 1IV8A 4LUSA 3VM5A 2YXGA 3GHUA 1K6AA 1T6MA 4MJMA 5IHSA 1EJRC 2R1LA 1I9CB 2OX4A 2P10A 4GA8A 2V2HA 2ZX6A 3W22A 3N2BA 1Z7AA 2CLOA 1Q8AA 4KFPA 5HJYA 2E1DA 4EPEC 3AMDA 1HKJA 1DYSA 3RN6A 4Q8WA 3A9IA 4DNHA 5F4XA 1NP2A 3REQA 3USZA 3EDDA 5FD0A 2V0TA 3H12A 3O9NA 2XISA 4D6HA 3AMLA 3WDPP 2GK1B 4PH6A 1TV2A 4HMCA 4ICNA 1FA2A 1JFHA 1DWFM 2WHJA 1E6QM 1MW1A 1VCGA 2FVMA 5FAGA 5JU6A 4MUZA 4QGCA 4BI7A 6REQB 1DJZA 3SECA 5A6BA 4UTHA 4J3VA 4XKYB 2WANA 1XLHA 3GKFA 1D9EA 5DXYA 3GYCA 1FWHC 1QO2A 1MQQA 4JNMA 1UW9A 3FS2A 5FJTA 2I16A 3DERA 3BV7A 3VIIA 4KIEA 1QNQA 2PZ0A 2J24A 4QS5A 4H9UA 1DOSA 3AIUA 5CZJA 1R2TA 4MY9A 2RFGA 5EKYA 2BGNE 2ABAA 3U5YA 2UY4A 3LU2A 1VQTA 3I6TA 2IXVA 2WZMA 4KRUA 3GK0A 5A1AA 2ZZ5A 3VPLA 3VD5A 2Y8VA 2O7QA 3PULA 4W5UA 1SJDA 1GOXA 1VBUA 3QC3A 3MCNA 4IX2A 5CJNA 3WQCA 4E4FA 4H2CA 4PL2A 4AYGA 1CEOA 4TVUA 3N9RA 2HZGA 3MBFA 2J7EA 3IANA 5H8MA 4QM1A 1QVBA 1AK5A 3UETA 4FK9A 2BXVA 5CC7A 3BANA 1DJYA 2AKZA 1X7FA 4IPLA 4NY2A 3SRFA 2BNJA 2P3EA 5CKSA 1EKOA 4X61A 5K2ZA 2C71A 2DORA 4XZHA 2V5BA 4LVAA 2PCQA 4GVHA 5HNRA 3TYAA 4XIMA 4GO9A 4RE3A 3ZJ6A 2PCEA 4WVXA 3UQNA 2P8BA 1SMAA 1RA5A 4IGNA 4WUIA 2CZFA 1VYPX 4GE8A 4UNLA 3M5VA 1BF6A 3GM8A 3KTXA 3GE7A 4UFKA 2FHCA 4Y9PA 4E2DA 1FX6A 4BI6A 4H9XA 3JZUA 4R7WA 4LXFA 5A2AA 4EPBC 3VDCA 3MO4A 2W27A 3T55A 1GEHA 3B3DA 2F7FA 4YYFA 3CZ8A 3FVDA 4KEMA 3ENLA 4W7WA 1ADSA 3K30A 4AHOA 2P50A 1O5XA 4U33A 4FOUA 1RD6A 3AHXA 4QEHA 2CLLA 1IXPA 1R85A 3LXCA 3UZWA 1JCTA 1BWVA 1KFWA 3ATZA 3UG8A 3C56A 2GJLA 1V6UA 4WDTA 4D2JA 1A53A 4DVOA 1YTEA 5FF2A 1VGAA 2RDUA 3KL0A 1PKNA 4UTIA 1J6OA 2AAAA 2GWGA 5I09A 3AYTA 4AWSA 3FCPA 3T2QA 5REQB 3QHOA 3WD1A 1ISWA 4JX6A 2VX5A 4QNEA 3TQKA 1WZKA 1FDJA 4RK8A 1UA7A 3C86A 2OO0A 4Q6XA 1A3WA 3OYXA 1GW1A 1OX6A 4PMJA 4KFNA 3I3BA 1GTHA 1CDGA 7REQB 2WNNA 4XKYA 1CLVA 2D73A 3O0KA 3H26A 1BHGA 1D3GA 1UKOA 4HMNA 1PDZA 3GZ3A 4I7UA 4GBUA 1VD6A 4JL1A 5D33A 3R89A 1XH0A 4MGGA 1FWWA 1I60A 4K7VA 2C79A 4LYKA 1EQCA 5FEZA 4GUJA 4O14A 3WF3A 4PCPA 4MNJA 3O6AA 4L7ZA 3WBXA 2BY3A 1R38A 4E2VA 1JDDA 2ZUMA 1W1VA 3VFCA 4IPIA 2VZVA 4GI6A 3NPUA 4DYKA 3BCFA 1GHSA 4ALDA 1N7KA 1A5CA 3TROA 1VCFA 9XIMA 1UR1A 2BVDA 2AL2A 4EP8C 1J0YA 4Q4SA 1ZP4A 1HJQA 4N9EA 5BW6A 4ZB2A 3WQ5A 3JUGA 1VF8A 1QNVA 4GCAA 4RPPA 1RCQA 2OR2A 2XSXA 1UWQA 2I14A 2P8CA 3C3NA 3NO3A 4I5UA 1OB0A 4K8HA 3T81A 2WHLA 1AUSL 2EG7A 3EKZA 1PKMA 4W7UA 4NZCA 3UGVA 3VZYA 1KLYA 5BWFA 2VQUA 5D04C 3OYZA 4DUVA 2PDGA 2WM1A 1P1MA 4Q4OA 3CWNA 4B90A 3W86A 3LN3A 1WUFA 4PUKA 3P5YA 2DJLA 1GVOA 5D2XA 3VNZA 4MPQA 3AIVA 4WDWA 1XDJA 3V7PA 4LB4A 3W9ZA 1HN1A 1EP2A 2A85A 4HK7A 3ZSTA 3NO5A 3WMBA 3LY0A 3VUPA 5H2ZA 3SUTA 1PE1A 4E3VA 1P7TA 4YS1A 4MNMA 2Y1HA 1LQ2A 1GJWA 2OEKA 1XQKA 3NIYA 1PVNA 3MYPA 2QMKA 4B92A 3KHDA 4JTJA 2VX4A 4Q7IA 3N4FA 1TX2A 3UP8A 5ABTA 3WQ4A 2QCEA 2WPGA 5M1TA 1GYNA 1ZAHA 2RGMA 2HCVA 2ZZ3A 4Y6GA 3VNDA 1Z48A 3WLRA 1S2WA 1KGXA 3S1VA 3MMTA 2DFAA 1JI1A 1IGWA 4JIQA 5GJPA 2WMJA 2QUUA 1YNPA 3VU2A 4QX4A 1MUMA 1UROA 4ZE5A 5FSEC 1BRLB 2WZTA 1EJSC 4Y8EA 1LLZA 1LQ0A 1TTIA 1RQBA 2JK2A 2QNEA 1AW2A 1DWHM 3I6RA 5TNVA 4CNUA 4GO8A 3WNLA 4JHMA 3LGDA 3RO8A 1C90A 5LXEA 5EPDA 3RHGA 3U4FA 2PDUA 3DFYA 2NUWA 1EDGA 2QJIA 3KDOA 3PBWA 1E73M 3K4AA 3IEBA 5FA5A 2HNHA 3NQ8A 2X1TA 4PBGA 3E5BA 3FYPA 2WC4A 2CBUA 4AZBA 5G1MA 1FH8A 4FS9A 3DYPA 5T9CE 2ZC8A 3F5KA 3VGBA 2CBJA 2X2GA 5KSWA 1TMHA 1XGDA 4KCVA 1JAKA 3HFYA 5LKYA 4YLWA 3W7KA 1LROA 1HGYA 3NVDA 1X1ZA 1GGOA 2BVTA 3RX2A 4ZQRA 4UOZA 4ZSTA 2QMJA 3Q45A 3KE0A 1OINA 1UKTA 3FAXA 5CBBA 3TFXA 4U28A 2G3MA 4TX9A 1R8LA 4GK8A 1ZRQA 2CERA 5ABHA 1POJA 5LIWX 4MZYA 1ECQA 1XPYA 3PHAA 4Q7NA 4NZJA 4FX6M 5BRQA 1UZ1A 3ISIX 6CGTA 4NI8A 5IDIA 5FEXA 1OX4A 1MXDA 3KBVA 3V5OA 1W9XA 4KQNA 4AU0A 3DGBA 4DO5A 1A5UA 3K4WA 4I9AA 4HPNA 1VCVA 2E8ZA 3T05A 3UGRA 1ZBKA 2VWSA 4YWIA 4ES4A 3HA1A 2J4GA 4BA0A 3NPVA 1UKPA 2JGQA 2X7WA 1R3YA 3GQYA 4MHBA 1OFOA 3EWDA 3E2SA 4F0RA 4R9OA 3M5YA 1Q13A 4S3EA 4W8BA 3EBVA 3I7SA 4JOMA 5EMLA 1NWUA 4CLMA 1JL8A 1BXNA 2VDGA 3CPRA 2Z0IA 5CC5A 3HG3A 5HATA 1KBIA 1BFNA 2OXNA 2R1MA 3DESA 3GG1A 4AEOA 5G4EA 3DHUA 1ISZA 2PDBA 1IEVA 1UPPA 3R1ZA 3IGHX 4MWAA 4WDUA 4Q6JA 2J8GA 4LBRA 4KCTA 4ATLA 1UWIA 3GXNA 3URBA 2PLKA 4Q4MA 5AKQA 4W8LA 3AHTA 7TAAA 4Q32A 4GD0A 2E5DA 4AXNA 3VIJA 2J9YA 3MA8A 1LL4A 2OFJA 1ZGDA 4C65A 1BF2A 3N73A 4AWTA 4B4FA 3SB0A 4TTGA 3QGVA 1E3ZA 1O7AA 1J0JA 3ITYA 4JTSA 1MI3A 2GGJA 1JZ7A 2ZX5A 1O4UA 3B8VA 2PRHA 2GUYA 4LCQA 2QYGA 5TIMA 2VFEA 4J3WA 1WO2A 3UWZA 1FWDC 1E6PA 1GPFA 3DFSA 4ZODA 1MSSA 1XYLA 4IMEA 2B31A 2YIHA 1AH0A 1UD3A 3MV01 4PRWA 5A6BD 3O15A 3FNDA 4H01A 2F61A 5A8GA 5CSRA 4JDBA 1QPOA 4QIUA 1H09A 4W84A 4WJEA 3SUVA 1EJUC 1Q4NX 3FKRA 4E8DA 3BLOA 1E4IA 2RDTA 1LUCB 3LCFA 2WV8A 2OZTA 1GT8A 1QAPA 3A12A 3VGFA 2VOTA 3LK6A 5HUOA 3KL3A 5LHEA 4GQGA 2HVOA 4NASA 1OK6A 3A4AA 1IWAA 3GX9A 1WKDA 4O0KA 5AVHA 4LSBA 1PKYA 3R5EA 1GNXA 4AY1A 4NUWA 1H1NA 2YCKX 2B7PA 1CI1A 3LPOA 3QOKA 4W88A 3N18A 1F7BA 4ZE4A 5AHFA 1AD1A 4HYRA 4IIEA 1QK0A 5BZAA 4QFUA 4JIIX 3W01A 1Q6EA 1JYXA 2J78A 3QPYA 1EGVA 1FCUA 4LRSA 2WO5A 3HQNA 4IG2B 3TQVA 1F6PA 4R7OA 3B0YA 2C0HA 3L9CA 3ZMRA 4HCHA 1F3WA 2Y7DA 1TV4A 1AQMA 5D2VA 3G1VA 2DH2A 3FYOA 5FJIA 3T2PA 3SDOA 3EXTA 2FZ8A 3MCMA 3UXIA 1EUAA 3LTYA 5LGZA 1LRQA 2XGZA 4B4HA 3BLLA 1XG4A 2PU1A 3W7MA 5BXTA 3QYSA 2Y5JA 5D9PA 5BXPA 1LTDA 3CV2A 3HG4A 3EXRA 3UWYA 1VLWA 1XCWA 2GOUA 3PZUA 3MDUA 3H24A 1S2TA 3W1NA 4PSPA 1VRDA 1FHDA 1PWLA 2XFWA 4OIFA 1ITQA 1WDSA 4HTYA 4HPXA 3TWBA 1RSCA 1XG3A 3SFWA 4JXCA 2X2YA 1DWAM 2KX9A 3EYPA 5CSSA 3R11A 2B7QA 3HGJA 6ALDA 1W17A 4TR9A 2DQWA 1EWEA 5AYIA 2D0HA 3GO2A 1KFKA 5CJMA 1BYCA 2PU0A 5C70A 1ZL1A 1EX1A 4REQB 3MHFA 4L65A 2PF8A 5CZ0A 1YLVA 1BKSA 4QROA 1O5QA 2R6OA 2O92A 4RDVA 3BPWA 3UZYA 4NRRA 3AC0A 2Y24A 2QJHA 1GHRA 2CLFA 4G2DA 3GDMA 2PRLA 1ICQA 3DU0A 1DWGM 3AWNA 5I23A 4PA8A 1AMKA 1JDAA 3WD3A 3U7BA 4XBJA 2VFHA 3OBEA 4F0HA 1E9ZB 1EJ7L 4H9TA 3ALGA 4EPDC 2OT1A 1SR9A 5I24A 4DWDA 1QPKA 4N4PA 2D1ZA 3V35A 1SO3A 3ZWTA 4H8NA 3VIOA 3IIPA 3V36A 3MMWA 4Q8NA 3AJXA 5I78A 2V2DA 2WKLA 3VK5A 3GDTA 4M0XA 3TCSA 4R53A 4UTMA 4TMBA 4WX2A 3RCYA 1HKKA 3S1XA 2DT1A 3XIMA 3W88A 3AI0A 4LQ1A 1EH9A 4BHYA 1EJWC 1T7LA 3DKJA 3KWXA 1G0CA 3EWCA 2OKTA 4AZ7A 3NZGA 1KXHA 3W1XA 3BQ5A 3IAQA 2R1PA 4KWOA 5HBFA 3N9KA 1M7XA 5FJJA 1ZU8A 2VD8A 2NVCA 3HG5A 4Q8UA 4TV5A 4PUUA 5LIUX 3UWVA 1FBAA 1YNQA 3B03A 3TJXA 4HNNA 4IIDA 2ZZ4A 2DUXA 2V82A 4IWWA 3L4XA 3VGHA 3MJMA 4ZCWA 1VH7A 4Z2KA 4C1NB 3WD0A 3F5LA 1MO0A 5AOUA 5JBFA 1PHWA 2REQB 2F84A 4IHCA 1GJUA 4E5TA 1XLMA 1WOBA 3BG3A 4YHEA 5HMDA 1FHLA 4L9XA 1FXQA 5EFDA 1M6JA 4MKNA 1F76A 2ZRXA 4ACZA 1H3GA 2Z1VA 3LXBA 5HXMA 1K4HA 2Y61A 5HAOA 3U57A 4KIRA 1C9DA 4OU1A 3FK4A 1RR2A 4Q4RA 3CS2A 2GGGA 2DH3A 2Y63A 2WSYA 4JD4A 3QSRA 2PDIA 5CZTA 3ARVA 1G7UA 3TV8A 1LWJA 1XRTA 2YFNA 3G1YA 1GOKA 4C1KA 1A5NC 3DG6A 3P8JA 2PDNA 4S3JA 3W7QA 1A5OC 5EMKA 4UTLA 3G1XA 2IMRA 3U4AA 1A5SA 3GBEA 2J79A 4ZQOA 1OGGA 2YLAA 4GQBA 4N6FA 3GS6A 2NSOA 2BZNA 3L4ZA 2VO5A 2EEXA 3BOXA 1LOSA 4REQA 2ZUTA 4ICCX 2EF9A 4JFVA 5FF3A 5K4XA 3QQ1A 1BG9A 3O16A 2Y6ZA 3LMZA 1EC7A 3TOYA 1UWAA 3W2NA 3NYDA 2I17A 1RP8A 1FWAC 4NZ3A 2QT3A 3PTDA 2DT2A 4PMDA 2Z24A 1U5HA 2QIWA 2G8ZA 2P0IA 3OIXA 4CN4A 1L6FA 1JAEA 2XIJA 1TPUA 3NURA 2GQ8A 4R88A 2PA6A 1JXKA 4O1EA 1Z9AA 3V1HA 3W70A 1EXPA 3L4UA 4U31A 4OE7A 1PB0A 4EF9A 4HP5A 1K03A 2D2JA 4O15A 3MUIA 4OBRA 3NQ2A 3THCA 2A6NA 2GL5A 4CUCA 5E0CA 3P6LA 5AHNA 4BJHA 2BB0A 3A9BA 4CQ9A 3PBYA 3WLHA 4F66A 1LRNA 3WG6A 4XZWA 2E6DA 4YYCA 4J7RA 4M82A 3NWRA 4GH3A 4TX6A 1I2QA 4RV8A 4F40A 4EACA 3WL0A 3LHYA 3EDKA 3L23A 4HPJA 3RAOA 1X39A 3W37A 4DZHA 2XVNA 1E9LA 3G8RA 3UXLA 1D7FA 2TAAA 3V4BA 3MUCA 1ZALA 9CGTA 3SR7A 4KRTA 2PWUA 4GQRA 3L66A 1VEPA 4JPGA 3AICA 4PR4A 4M5PA 3BVJA 4DLFA 4O28A 2PDFA 3KW3A 4M6QA 3VOJA 2HXTA 3FSTA 4IF2A 2G41A 5A2BA 1HL9A 3LTSA 2ACUA 1AW1A 3H54A 4E3TA 3QR0A 4UFLA 1B57A 2PMQA 1V3MA 5I3GA 4IT1A 5BU6A 5GVJA 4D6EA 5HJXA 1EGZA 5I02A 3MYOA 2Y4SA 4JNYA 4G9PA 1TWSA 1BGAA 1TSIA 3W7GA 5LNRA 4UTWA 1C8XA 1E1CA 1UA3A 4EXQA 4PGLA 3G1DA 4CU7A 3IJ9A 4UTWC 3S83A 3LPGA 1HL8A 5AYZA 3BUVA 4LNCA 2J77A 2D22A 3RXZA 2QCFA 4QQUA 5FEWA 4YN5A 4BKNA 1MW0A 1REQA 3ZR5A 3BG5A 3W75A 1V7AA 4GX8A 4JTRA 1HL2A 1W2PA 4H9MA 4PSRA 2XM2A 3WEOA 2PP1A 4J40A 1PAMA 5A8OA 2O9PA 1KFEA 1C8VA 3FN9A 7TIMA 1N82A 1WV2A 4Y8FA 1US3A 2DGAA 2RDXA 3UVAA 4FIQA 5DBTA 3ZYZA 4B5TA 4OJYA 1AD4A 3H70A 2VNCA 2OZ0A 3RG6A 5CG7A 3TW9A 3SFKA 4OV4A 1QI4A 4IJCA 1KXQA 4QP0A 3EPNA 3HGRA 3MP4A 3AXHA 2ZX9A 2DQXA 4LVFA 3QGKC 1ADOA 4WY0B 3TYBA 4I8YA 5A6SA 3T0AA 3L0KA 4WOZA 2Z6IA 1YTDA 3GIQA 3NZPA 3BAJA 1LP6A 1KTBA 3B0PA 2CBIA 3ZM8A 4M19A 2QVNA 3IRSA 3QV8A 4YCPA 5F1UA 3W87A 1A4MA 2PFHA 4S23A 3EX1A 4N42A 1SSGA 3WFLA 4RZBA 1FFRA 4HU8A 2PDQA 1RPKA 3G77A 2G95A 3FYYA 5EA9A 1XIJA 5AB3A 4Y9AA 1KBKA 3QMRA 2ZYFA 4UR7A 2YYTA 1SVDA 1R2RA 1V0NA 2DW6A 2FZBA 4LC6A 3AS2A 4Q22A 4OTKA 1LOLA 1FH9A 4Z2LA 2WVVB 1I45A 2GDQA 4U2ZA 4GKTA 2J88A 2J62A 2YA0A 2DZBA 3COTA 5G2IA 1K8ZA 3TQ0A 1ZUAX 2ZX7A 4PFMA 5JVLA 2CWNA 3P82A 3AUJA 3VMNA 2O7SA 3N1AA 4RXFA 4ENLA 3LCWA 1W5OA 4TU1A 5F4SA 1M5WA 2PTZA 3GAKA 3UG4A 2G3FA 3V0UA 3G24A 4N4QA 4JTTA 3S2NA 1RJRA 1XV8A 4O4VA 3B0XA 3KS6A 4WOQA 5C8BB 1I75A 4KPLA 4XIAA 3G1RA 1G67A 3L4TA 3PNUA 1VZWA 2ZVRA 4B91A 1SZFA 4MF4A 1ZBWA 1MFUA 3DCPA 3MBDA 1KV8A 1YX1A 1XLDA 2PWEA 2V5LA 3WLNA 1V5XA 4HPHA 1JPHA 4UTTA 3QGAC 1MEWA 2YW3A 1QHPA 1NOUA 4GY1A 3QHMA 2XM1A 4Y2WA 5FF7A 4QDWA 1BVWA 1EUNA 4M1BA 4HKPA 5BRPA 1JYNA 4ACZB 3RU8X 2PP0A 4AVOA 2RJGA 1H7RA 2JKAA 4XZMX 2WJDA 1UUMA 2FH6A 3ZR6A 1HT6A 5JBEA 3NM1A 1H51A 2NZLA 2DUZA 1LBFA 1XGZA 3WKZA 4O52A 5BOFA 3WF4A 4GYPA 4W89A 3W7NA 4WLCA 3RPMA 1HVQA 2VCBA 3GC5A 3S8HA 1W3JA 5IXEA 4JKKA 1GWJA 4MKSA 2V3DA 3LB0A 3OW1A 3CUXA 1VKFA 2VELA 1IEIA 3L5MA 1ONRA 3WENA 4DPQA 1UP0A 1PEZA 3AOFA 1Y65A 1IIGA 2WLYA 4P8VA 2Q8LA 5A6AA 3FW6A 4H6KA 2Y7EA 4YNGA 4GXMA 1GKPA 2XH2A 3MS8A 4LC8A 1QWGA 2CZEA 3AXKA 5IBXC 1KM0A 2ZX8A 1EYWA 4R7JA 1C3FA 2WNQA 5G1YA 3QTPA 3KTSA 1GPWA 5MHBA 3S5YA 1CGTA 2C1IA 3UWWA 2XG9A 1R9ZA 4PTXA 4QLJA 4MG4A 2F2HA 2R8WA 1J93A 2DEPA 3IAPA 3VINA 1CW2A 4L4PA 4V33A 5HQEA 1LOQA 3O7UA 1EDTA 3SIZA 1Y5WA 1V3IA 1XD0A 5I5RA 1X97A 1TQXA 1KR1A 4AB4A 4AG0A 2EPMX 3S4TA 4I9MA 2WW5A 1PZ2A 1CYGA 2XGIA 3DHDA 1M65A 3BL3A 4DNMA 2HPMA 3EMCA 1EHAA 3S1UA 4UTTC 3I65A 4NZ5A 4GCXA 1E51A 3UT0A 3W76A 3RFAA 1EP3A 3C2VA 4MB3A 4I5XA 3PFRA 3CEUA 4MDOA 1JD7A 1A5AA 4HMEA 3E96A 1ONWA 3WDQA 4B3ZA 2MANA 1KRCC 2F6XA 3WLTA 1CX9A 3TTSA 2PDXA 3RRXA 4IMGA 1WOAA 1WUEA 4AMCA 3R43A 4QG6A 1S2UA 3B40A 3FSUA 3DOPA 1MUWA 2VGBA 4GFIA 4ONVA 1EO7A 2CHOA 3BARA 3VX1A 3GHTA 4S39A 3NQDA 1KM2A 3ZT6A 3LV6A 5JQ9A 3F1QA 2ATSA 4QJ4B 5G1TA 2VFIA 3Q58A 3QVQA 2FTYA 1QDSA 3B8TA 4NX0A 2PDMA 3L2IA 4PUEA 4FXSA 4AFYA 3TOPA 2VYOA 4HQVA 1XYCA 2VEGA 1A5KC 4ZFCA 1TREA 3QRHA 2GJRA 3AIEA 4FLRA 3WK3A 3O6YX 3GUGA 4F48A 3VI2A 5FCZA 2VOMA 1K9TA 3GUWA 1CXKA 2B7NA 4FOKA 1C8YA 3VAVA 4MTVA 1LQAA 3DYOA 4ZO9A 5BRBA 4HNOA 3QH2A 3VOGA 2E6YA 3RYSA 4IZGA 3FJLA 4Q8QA 2XSAA 3GG8A 1JXJA 2A21A 4LF2A 5DEZA 1J2BA 1SMDA 4Z17A 2WCAA 2DZAA 2UBPC 3BAWA 3F4NA 2PDPA 1PKLA 3FFSA 1T99A 3VD3A 1US2A 1B4EA 3ITTA 2CHRA 2WYSA 3NVTA 3R12A 1MYRA 3P14A 4HOWA 4HA4A 4PCFA 5HR6A 1D2KA 4LU0A 4GUGA 5L6UA 4J3XA 2DY3A 3G3DA 3IVUA 3ANYA 3LHTA 3GVRA 4BI5A 1FWBC 2C19A 4DJFD 3RPDA 4JYEA 4B2DA 1TJ0A 1F2JA 3M0MA 4C6CA 5CLWA 5DMNA 4PMOA 5HUPA 4NYYA 2W66A 3EGJA 2Z4GA 5D09A 4WK9A 3CHDA 3W2KA 4YL2A 1H2JA 3CNYA 3MP3A 3W2LA 4FNUA 1UBSA 5HQLA 3OPSA 2VUNA 3QV9A 2EAWA 1VIWA 4IGHA 4S3KA 3UESA 2FDMA 5E0FA 2UZ9A 2ZRZA 3TMLA 2A3HA 4LT9A 1EHNA 3EX3A 2WZHA 3UJFA 3PBMA 5KINA 1KFLA 4UOJA 3BOFA 3G0UA 1X96A 3SCPA 4JAWA 4CD8A 1VYRA 4MJZA 3MTWA 4ZBCA 1SQ7A 2ZUNA 1YQ2A 1US0A 1ISVA 4DJFA 3U2EA 4JGDA 4AX6A 3RX3A 3BW2A 3M5XA 2QUTA 1MNSA 3HGSA 2V69A 4WKAA 3DBNA 3ZXWA 5LIKX 1V08A 2Y88A 3IGXA 1GVQA 1ZNNA 3VDAA 2XHYA 1X38A 4GIAA 4WDXA 3UW6A 6TIMA 1WX0A 2EPKX 2H6RA 3NL2A 1NFPA 1J11A 2VGFA 1W54A 1XPGA 1W1PA 3DG3A 1E0WA 5LNUA 5I7GA 1M1BA 4A05A 2WCGA 2OEMA 3CM4A 4IPPA 4LV4A 2NLIA 4LRTA 4PMVA 3G3MA 1KRBC 4A35A 4JTIA 3AU6A 3CHVA 2OOGA 3BWWA 2PLCA 4CU8A 1QW8A 4NI3A 2OZ8A 3QN3A 2FMOA 3DFHA 2D2HA 2BHZA 3N04A 1T0OA 3GXPA 3N15A 1V02A 3T78A 3W27A 1ZJAA 5CAHA 3DH7A 3LPPA 5XIAA 1AODA 3NPWA 2X7VA 4JTDA 3GZAA 3VOHA 2VGGA 4HU4A 1G6CA 1H1YA 1ZP3A 2PF0A 4AD3A 1F3EA 3CB8A 3R0DA 4JTKA 5KEZA 1BYAA 1E6RA 1I0BA 1HP5A 2QQ6A 3C2FA 5MKGA 4AX7A 3FXGA 3W6YA 1K70A 3PTKA 4XZIA 1Z42A 2ACQA 3W72A 3QF0A 3GH5A 4EPKA 1HG3A 2E5CA 3U9IA 2OGJA 1OFAA 1LZOA 3U5UA 3V0SA 1PUDA 4Q3MA 3PUOA 1PIFA 4J35A 4I9JA 3SY1A 3FA3A 1A0CA 2ZXBA 4RR4A 3SN1A 4ZR8A 5GNZA 4I7WA 5D4YA 1OGSA 3RLHA 1DQWA 1JIBA 1ITXA 3WIJA 3SCOA 2OKOA 3OZOA 3R8GA 3SGZA 3MI6A 3QHNA 4AWUA 3S6DA 1S46A 1CXEA 1JZ8A 3VNLA 3ITGA 3MI2A 5D9MA 3N25A 5EMUA 3PG8A 4A8IA 3RITA 3MW7A 1EBHA 1LUCA 3B04A 1WZAA 1DTNA 4H4IA 4DZAA 1A4LA 3QFEA 4ZOBA 4DELA 3N6HA 4YTSA 3KP0A 4FR6A 3UXDA 3WQEA 1VFTA 3LD5A 1XLKA 4OBSA 1OM0A 1TUFA 3K5XA 4H7ZA 1UH2A 3G1HA 2VEKA 3QYQA 3LQLA 1KCLA 4IGSA 4LFYA 4AXKA 1V3HA 2QCNA 4RDZA 2ODOA 2WSKA 3TAKA 1H1ZA 3ABQA 4UR9A 3GSMA 4CQDA 1AZ1A 2KZHA 2A3AA 1NP0A 2QCHA 1CXIA 2JF7A 3APTA 3V1PA 4RE0A 2Y5SA 5IFTA 3Q65A 4IFRA 3Q4DA 3IK2A 4K1GA 1B4KA 2C0AA 2BBFA 1YDOA 4FAMA 1PCKA 3TDFA 3WBEA 3RLUA 4JTHA 3ITLA 1M03A 3BW4A 3BQ6A 3KWSA 4LX4A 3HB9A 2X40A 1WQ5A 2J6VA 4WQ6A 4ZO8A 4GVIA 1BXCA 4PUJA 1BLIA 3NM3A 2W5FA 2FLIA 4H00A 3SQSA 1KV5A 1E0XA 2WWDA 3T0BA 3VGGA 5AZ1A 3V5FA 4D8LA 3CV7A 1RQEA 3R8HA 3TW7A 5KITA 2EJ1A 1OIMA 2RGLA 4FP1A 1IT0A 3DFTA 1AFSA 3SRDA 4GUHA 2BX7A 3PTQA 5HULA 2ZA3A 3ARWA 4M8UA 1XKYA 1VFFA 4ZOEA 4NAEB 3L2LA 1PXGA 3PZGA 2PZNA 2XH7A 1QBAA 3GVGA 1NWTA 3NL6A 4TOQA 5HJLA 4AD0A 4ZO6A 3RO6A 3PN8A 3PM6A 2PP3A 3UY8A 1C93A 5G2HA 4J9JA 2A0NA 1Y8BA 4DUWA 2EO7A 1TTJA 2ISWA 4AIEA 2Q01A 3WQ8A 3LHWA 4UXDA 2IQ0A 1MRAA 1V3KA 4GJJA 5I03A 5CLTA 4HJWA 4O13A 4YPJA 5CPNA 1VS1A 2HTMA 1EJTC 5CSYA 8XIAA 3BCDA 3AXIA 1PL9A 2A1YA 4L4OA 4YTTA 4BQ2A 2ZIDA 4NZ4A 1UZDA 4X3ZA 2NUYA 4H7VA 2WJEA 3PB0A 3L0NA 4U5KA 2HMCA 1ZY9A 2X1RA 3KOXA 3KBNA 4DWSD 1ITUA 1KW1A 2TRSA 3UJEA 3EWUA 1DJGA 3CTTA 1PJ9A 4CQBA 5IRPA 1X1NA 3KVJA 4LTSA 3MUZ1 3GYEA 2ZUVA 4ZXLA 1AH3A 3K8MA 1I2RA 4O12A 1TV7A 4GGHA 2XFYA 1FWSA 3HGOA 2WMIB 3CB3A 6REQA 5ABEA 3T6CA 4DJEA 4ZENA 3II1A 3MCOA 4R27A 5FL0A 1KBJA 2ZA1A 3MPGA 5AYXA 4F9DA 3W2JA 5HK4A 3AO0A 3W7CA 4XAGA 2CW6A 4WGHA 3WJWA 1FFQA 4XBSA 3OO2A 4DBWA 1PIGA 1NFGA 3TP4A 3RCNA 3TN5A 3FDGA 4PN2A 3IJ7A 1RBLA 3MU7A 2YGYA 4MFDA 3WQ6A 4BQ5A 3ABZA 1L6WA 1P0BA 1HXJA 4A3RA 1XD1A 2IKGA 2J9ZA 3NTYA 3AROA 1R2SA 1EFZA 1H60A 3C0QA 2BFGA 4CNSA 1TWIA 1LF1A 1PWMA 1K9FA 4C6DA 3B05A 1BXBA 3BK0A 4DWSC 3E6EA 3IGUA 1JQVA 5CH9A 4QTGA 3SY5A 3LGGA 4NHVA 1HP4A 4JTFA 1QI3A 3MSGA 7CGTA 1E9YB 1BTCA 3QPZA 4AH7A 3M43A 4LW7A 1HKWA 3OA3A 4CVWA 2E9MA 4IG2A 1V6TA 4KWSA 2OQHA 3GW0A 4A3UA 3ZJ8A 2POZA 2XINA 2YXOA 1E71M 4UTFA 1KM6A 1EX5A 3B4UA 3CQHA 4G1NA 2F6KA 3GTFA 1ADDA 2NX3A 1Q2SA 3OEXA 1JNEA 3PWGA 4Y7EA 4H8VA 1GQJA 1J6PA 5CZSA 3PAJA 4O4WA 2YL9A 1F9CA 1B9ZA 2R1KA 1S39A 1IIHA 3H4WA 3VX0A 5LZLA 3ARRA 5H91A 3WDJA 1K7FA 2QUMA 1WYIA 1PZ0A 4HZ8A 1NDYA 3VABA 1BYDA 2FZNA 1VLIA 4JCMA 1S3HA 1AJZA 4IOTA 4N0RA 3LHVA 2X0YA 3GBDA 1A50A 2VD9A 4QJ5B 2HV5A 1UD8A 1XH2A 2PDYA 3RM9A 3WLSA 3PUGA 5A8NA 4LAKA 4KH2A 4GZEA 3ATYA 3SSJA 3V3WA 3O2LA 2NT1A 1B3YA 1Q8JA 3M46A 4O1DA 2DSVA 3L7RA 3CMJA 2WC3A 1C9WA 1GZGA 3EWBX 2GJPA 2Y0FA 1RP9A 4CCCA 3RF9A 4F2TA 1CNVA 3O07A 1OHLA 4N9BA 3W7LA 2E40A 1W9PA 2V5CA 3CASA 4U3AA 3W6MA 3LLXA 3APGA 4WSJA 4PUWA 2GSJA 7REQA 4M51A 4NNBA 5FKYA 4XD5A 1TIMA 2IQTA 2ZBTA 3KZSA 1KGUA 3LOTA 1X1OA 4JTLA 3ERPA 5FIPA 3KOZA 4WRHA 3R2GA 1J12A 3SUSA 1KBLA 3LCGA 1ELSA 3PK7A 2AL1A 1AW5A 4AVFA 2JIWA 1H5VA 1SFSA 3N9SA 4JN7A 4DQWA 5H1WA 4C6JA 1TTQA 2IW0A 3QKEA 4UCGA 4RCXA 3W4RA 3GNPA 1XSIA 2V3GA 5H8UA 3WUFA 1ZAIA 4B5SA 2WMKA 2RDWA 3EB3A 3EA3A 4HSNA 5D30A 3O6DA 1S5VA 3LNMA 5I0DA 1HQTA 4PYSA 4GINA 4R9XA 4HZ6A 3B9NA 4XG1A 2NQ9A 2PLMA 4NILA 5TF0A 1E1CB 2HBVA 3TYCA 3P81A 3G0SA 3N13A 3NNTA 5G2WA 1BYBA 1OGBA 3ZO9A 4NVTA 2QV4A 2A3LA 2ZTJA 4FF5A 1LBLA 1IEQA 1K6WA 1DBTA 2VWTA 1EA0A 5DX7A 3PZVA 2Y62A 3KLLA 3T2OA 1J8VA 3SURA 1MXSA 4U5IA 5BOOA 1R3QA 4L6OA 1NEYA 2OB3A 2G97A 3UG5A 5HMSA 1JUBA 4V2XA 1G4EA 4NYUA 1TO3A 4AZCA 1V6YA 1HUVA 3CQIA 3NQ6A 1GVSA 2R9RA 2WLZA 2CZVA 2X0SA 1HJUA 3PZOA 3TLLA 1E72M 3SCRA 3TN6A 1U2YA 3QQ0A 2YB1A 3PJTA 5DFAA 1E40A 3CU2A 4LANA 5AECA 5LNVA 3NFUA 4G7EA 5A6TC 2PDCA 3P67A 3RMEA 4LCSA 2XYLA 3VIPA 1XLEA 2VT0A 2E4TA 4A29A 4HYVA 3PBUA 1FHVA 5HMEA 3HZ3A 3DX5A 4JTEA 4BK9A 4FNSA 3CL8A 1P1XA 5D9NA 3SRKA 1WA3A 1XDLA 3S46A 1IHIA 4LY8A 2WAGA 3C3UA 1DEDA 1HF6A 3RDKA 1FWNA 4LGXA 2FB2A 5AC5A 1XM3A 1EQPA 1GOWA 2WZEA 5ENLA 3GR4A 3HU7A 1XL9A 2Z27A 3H2MA 4CNPA 3BLIA 1LORA 1V6VA 1G4TA 3NO1A 2JIEA 4C5YA 2WVVA 2CZDA 4TMCA 3CO8A 3MWAA 4FNRA 4XD3A 1Q6DA 1DXEA 2GLKA 2BV9A 2W62A 4P7RA 3WZ0E 3NUKA 2W6RA 2DP3A 1EP1A 1KTCA 3KBWA 1OT1A 2D3LA 4FNQA 5CJ5A 4FX8A 1JCYA 3LLFA 1G5AA 4GNVA 3A4WA 4F79A 3IJLA 4TVCA 4N02A 4ECLA 1XLJA 3N2TA 4IQEA 3EWWA 3SEPA 1LM1A 2QCMA 2OTDA 3UA4A 3RILA 1E0UA 2Z1SA 3VD4A 3CUIA 4NJJA 1PPIA 2E68A 3GTIA 1F3XA 1Q5MA 3BW3A 2XDFA 2YX0A 1GQNA 3GR7A 4F0MA 4I7VA 2I9UA 3CIXA 2O9TA 1KXTA 1TJRA 2FPYA 3KEHA 2KAUC 1W37A 1ZBCA 5E6ZA 1PTAA 1H41A 2BXZA 2QUVA 2CPUA 4FEZA 3BLFA 2FHFA 1SW0A 4O17A 3VD7A 2NWSA 4IH3A 5A6MA 1VBHA 4HNCA 4FALA 3CQ0A 1TRDA 3CT7A 2OX1A 1ECEA 3NL3A 4QJ1A 3LCLA 3IIVA 4K68A 4TUFA 1F61A 3WEMA 5B80A 4CCDA 1XIEA 3TTYA 1PO9A 4NU7A 4K1WA 4QITA 1OX4B 1D8CA 4EE9A 1XGEA 1CGWA 4BEUA 1NTHA 1G7VA 1E15A 4GY0A 4GQ0A 1KLZA 1DE5A 2QDDA 1VC4A 4MM1A 4US5D 3TC6A 1WPCA 2I5QA 4GH1A 3E3HA 4QR6A 4UFHA 4ADUA 2ALRA 2QPXA 1UASA 3ZT7A 1OZMA 4JCLA 2G50A 2YL5A 2YPIA 3STGA 5AC4A 1X7IA 3NDOA 2ICSA 4TO8A 1EF3A 1BVZA 2JEQA 2PEVA 4HOXA 4JTUA 3QMTA 1IF2A 3BJSA 3NEVA 5E93A 4FIRA 1LYXA 1QRQA 1X6LA 4PEKA 3W02A 2YCLB 3ALFA 1EEXA 1HKIA 3BLKA 3S9ZA 3CIVA 5EGRA 3BMXA 4LOCA 2FGZA 1G9HA 3WBAA 2BVWA 3KBMA 4MWAB 2CZ5A 2WQPA 1R3WA 2HS6A 3P74A 4YTUA 5I77A 4TQTA 4CQ8A 4AF0B 1ISXA 5F1VA 3IPWA 3ZOAA 4KGLA 4L9ZA 4NL1A 5ECUA 2WNZA 2V3FA 1RZMA 2QS8A 1BSIA 1C7TA 3FV9A 5EBUA 1P6BA 5A2CA 3PF3A 1I2PA 2P5NA 1RALA 1JPIA 2NWRA 3USBA 4D1JA 3GRIA 2TYSA 4ADTA 1Z3NA 3LI1A 1YYAA 4GY7A 3LDVA 4HOZA 1FCBA 5CAKA 3PC0A 1D8WA 2WOQA 3AXXA 3TYEA 4FXRA 5LGXA 3WLMA 3FIGA 3C0SA 4KEVA 4LF1A 1JUEA 2INZA 4HCLA 5PTDA 5DCDA 1W9VA 1B1YA 5A5WA 1XFBA 1XRVA 1NH6A 3N34A 4JFSA 4WJXA 1QCWA 3GNDA 5FESA 2YDRA 1QI5A 4GJIA 1E70M 2Z7GA 1JF5A 1PX4A 3DI1A 1SJCA 4PCNA 2A3CA 4YVPA 3W73A 4CN6A 4J27A 1XLCA 4MADA 2G3JA 1W3KA 2FZ9A 2YCJA 4IMCA 1EJVC 3TSBA 4L64A 1RD5A 4UBPC 5AC7A 4PCTA 3LBMA 2OLHA 3OVGA 3GDKA 3P93A 1A5LC 4FXFA 4TTUA 3T0CA 3OA5A 4E38A 5I00A 2A4AA 2V5KA 1MRQA 3VKKA 4CNNA 3F4CA 4EIVA 1FP9A 5CC6A 2BOFX 3MY9A 2FB3A 2IXUA 3URAA 4IL0A 2XIBA 1J2WA 1RBAA 4GC3A 2L5HA 1XP3A 1QBBA 4KEZA 3CC1A 3TSMA 4B9ZA 4JY8A 2E6AA 1Z69A 3BE7A 3VMPA 2ZCGA 3M64A 1H7WA 3VDHA 3BV4A 3HTWA 2DT3A 3H21A 4HA1A 4GJ1A 3PB2A 4GBDA 2GQ3A 2C6QA 4DO7A 4LVDA 4AHQA 1JRCA 1R46A 2F2KA 1O12A 4IP5A 1JZ4A 3H23A 3KOFA 4C6LA 1L8NA 3WMSA 4IFOA 3AAMA 1W5PA 3B8IA 2W92A 3LEPA 5I07A 5BMWA 1FWIC 4UTJA 2QLYA 3VIGA 4J2PA 1POKA 2B0MA 3P80A 4IIGA 1ZQ5A 4UFIA 4JQ3A 3W07A 1ICSA 3MSDA 5CGTA 4NXKA 3C52A 3A23A 2QGYA 3BOLA 5DRIA 5C9UA 4JFTA 3UJRA 4D71A 1W3NA 2NW0A 4M1RA 4JX5A 1B5TA 4DAIA 3BG9A 2NXGA 4GLEA 4DBSA 4JFUA 3UPBA 1GG0A 1HTIA 2HEJA 4IMFA 2YSWA 3ITCA 4W7VA 5I3KA 3B9EA 4AD4A 5HANA 3NSMA 1MW3A 4DJDD 1E5JA 2FYMA 2O55A 3BSGA 1RJQA 3VOCA 1MNZA 3A3WA 5A8QA 3D6NA 2AMXA 3W38A 5A8PA 4PB4A 4WKFA 1FWJC 2ZUWA 4O19A 4EXAA 1VFSA 3IACA 3P8IA 2YJQA 5LIYX 1Z8AA 2VEFA 1L6GA 3EOLA 4DF2A 4XO7A 4LH8A 2O9OA 3CMFA 3ONCA 3PSWA 1GW9A 1J5SA 2GZXA 1UP3A 3B97A 1TVLA 1JCMP 1FQ0A 4GHRA 3UWUA 1KD0A 5CGMA 3AS3A 3GU9A 3VDGA 1QPQA 3APYA 1OYAA 1DV7A 5CPLA 3QJAA 1XF0A 4QHRA 4EK7A 4CD6A 3RLGA 2ZXDA 1QOXA 5HR7A 3ELFA 4PMXA 1YRRA 2JGYA 3THUA 2X09A 1CXHA 4DAFA 3VZZA 1IZCA 4AIBA 3WH7A 3LXAA 2QAFA 3VE9A 1TV8A 1V3LA 2DVUA 1F8IA 4X0NA 1EEPA 1YBQA 2J8TA 1R3TA 4J4KA 1DJNA 2WMHA 1M68A 5AHIA 4ZTYA 3WQPA 5HDRA 1J96A 3G1FA 5LA0A 1LLOA 3CZJA 5C9RA 5M03A 1FWGC 1RCOB 3PAOA 3C2OA 3IIOA 1BPLB 3EMZA 3UA3A 3LM7A 4ZQNA 5E9XA 4WXYA 2FH8A 2FKPA 3WJXA 2G4FA 1JZ6A 2BOGX 4PL1A 3DBPA 1XIMA 1KA9F 1K7XA 3M47A 4GXWA 3UYCA 2XSBA 2GDUA 1B3OA 4ML4A 3XISA 3BGGA 4A3QA 2W79A 2WVTA 3OODA 5FI8A 4O54A 1QJWA 1PYMA 4QG8A 1IT7A 5LXXA 1TUXA 4AZGA 2AGKA 5C9WA 4RL3A 4AMAA 1ZS2A 3KVLA 2VFGA 2A6LA 3STFA 3R10A 3NAVA 2PAJA 2PD9A 1DXIA 5C0QA 1B0IA 4OV9A 5C9ZA 3PZ9A 1JCLA 3AYRA 3GDRA 2ZICA 4NXSA 1C92A 4UWMA 4FSAA 3ARQA 1JUKA 4JN6A 3LI0A 2VC6A 3BLDA 4S3DA 4WY0A 3CWHA 3IJDA 3W26A 2OEJA 4O11A 3LCHA 1EYEA 4J3SA 1VIZA 4WGXA 1WNOA 3WNKA 4OQVA 4JTQA 1U22A 3L5AA 3PVFA 4KWUA 3CQJA 4H7CA 1E6SM 2WHMA 2WHKA 4US5A 2PTXA 2ESCA 1YDVA 4AZ6A 1LG2A 4R33A 2OWWA 2PC8A 3O6CA 1VEOA 2XVKA 4MVAA 1OJXA 1WZLA 1TFVA 4HZMA 1MEHA 4P5UA 2V5DA 4BWLC 4I6VA 1NOWA 1RCXB 4WKHA 4H9YA 2DVXA 1A0DA 3QOMA 4F3HA 4BWLA 2VEPA 3IGSA 5TD4A 3FA4A 3VIHA 4IMDA 1WAWA 1YPIA 2CLKA 1OCJA 3VYLA 1I8JA 2NQLA 2QPSA 4TV6A 3ARXA 3GVQA 4YXGA 2ACRA 2I56A 1SW7A 3IWPA 7A3HA 3UPMA 1OFBA 2QCGA 4PTWA 2NX9A 3EOEA 3N6QA 1R7AA 3HURA 4MNLA 1UJQA 4V27A 5AHEA 5BYWA 5BCAA 1TE1A 4FOJA 1A5BA 1NAL1 5GJNA 3S5OA 3CHEA 4KKXA 2CLHA 1T5AA 1TPH1 1SPQA 1W9BM 3M0YA 3S5ZA 4LVGA 4L4LA 3GC4A 4IQDA 3N2CA 4UB9A 1SM9A 3IK4A 1F05A 3I68A 1AA1B 3INPA 1M41A 3OG3A 1CBGA 5E5CA 3GH7A 3F5JA 1KR0A 2G0WA 4AD5A 4K3ZA 3ABOA 2VEIA 1H61A 5GJMA 3HFTA 1G94A 3PBGA 3WF1A 2VFDA 4X60A 3ABSA 4OZOA 4YVVA 3WQFA 2VR4A 5K9XA 5JUVA 1R9XA 4XX6A 3IRDA 3RLVA 4BZYA 2QR6A 4GIYA 4K8GA 2W61A 3NGFA 1NVMA 3OZYA 1UR4A 3MHGA 4C1LA 3W2MA 2QUNA 1X6UA 4OOZA 2RHGA 2XN0A 3W7OA 1ODZA 3A4JA 1HIZA 4PODA 3BAYA 1D3HA 3PPCA 4R85A 3SW6A 4GACA 2EG6A 2ALDA 3WUEA 2C16A 2DV0A 3ZT5A 5DY3A 3W1QA 4RE4A 2Q3RA 4GZIA 5D8WA 4JKLA 2B7OA 1OFRA 5CG0A 2VUYA 3R8RA 3AS0A 3M7SA 2V81A 1CPUA 4L4MA 4S1FA 4MWAE 4O0ZA 2D69A 5A6JA 2CETA 3UPWA 3WNMA 1M7PA 4CD7A 5JMUA 3WJYA 4PMNA 5LA1A 4HB7A 2FVKA 3NPXA 4H83A 3AALA 5CXPA 4WD0A 4F0KA 3WY1A 4AQLA 3T8LA 3L4WA 4ZB0A 3EWYA 3GXTA 2I7GA 1TG7A 4S2BA 4E4PA 2QCCA 2HNEA 4LYRA 2ZRVA 4HMDA 2X1UA 3IVSA 1OFPA 2XFRA 2D20A 4X9YA 3UZZA 1K1DA 2RUSA 2VJXA 1JDFA 1IWBA 3NOEA 3NL5A 3GDLA 1U5JA 3BMVA 1FKXA 4ADSA 1VFMA 3NZ1A 6XIAA 3LS9A 4LBUA 3WLIA 4V15A 3WMCA 4NAFB 3S6OA 1J0ZA 4Z1YA 4L6HA 3CL7A 1ONEA 1ME9A 2E3ZA 3UWEA 1LL7A 3KBSA 3QPEA 4Q33A 1PSCA 3GNNA 1XLAA 4A2RA 2HPIA 3MO7A 4H1ZA 3K13A 4DXKA 2JF6A 3F4WA 4JHOA 4UIOA 3OGSA 4GI9A 3BGAA 4AD2A 1UR9A 3JW7A 4DYEA 1I4NA 3KS5A 5C55A 5AVNA 1OD8A 2IKIA 2PLJA 2X0HA 3A6OA 4HK6A 2H8XA 5ABGA 2E77A 4HN8A 2DZVA 1KBBA 3CL6A 4UCFA 3PG9A 1H62A 4BR1A 1O1ZA 3F2BA 2AL2B 1K9EA 4WJ8A 1E3XA 4G1KA 3V5CA 4X2PA 1OFEA 1EIXA 3C0JA 1Q63A 1QNOA 1BQGA 2HWGA 1Q6FA 2NQJA 1YBQB 2C15A 2GQAA 2Y5EA 4MNKA 1TWDA 1ENUA 3UR2A 4JEJA 1E6NA 3ZIZA 1OFDA 1QOQA 1KM3A 4M80A 4A3HA 1EB3A 1XISA 4QE5A 1CTNA 1RJPA 4HT3A 3CAQA 4ORIA 4FR1A 1VFHA 3E0FA 4JYDA 1O95A 3C5QA 4UZSA 4HHLA 1W3IA 3T4WA 3XINA 2QAPA 1EWDA 3NQEA 3AWOA 4DPPA 1FDZA 3T42A 1G4PA 1LBMA 4KERA 3TTOA 3E2VA 1YPXA 3W71A 4UOQA 2E1WA 1OF8A 3M44A 1TCMA 2IUZA 2D2OA 3N4EA 4QJ3B 4AY7A 4IFKB 1UKSA 3VNMA 3ZZ1A 1EC9A 3KDNA 4Q4QA 5J5RA 1S5TA 4HK5A 1YKWA 1Q66A 2YB4A 4DO4A 2DPEA 3FVMA 2GVLA 1MDRA 3M5ZA 1EO5A 1ZJBA 1JNDA 3L12A 3HQPA 5CQ1A 1XYBA 2XZ9A 3LCXA 2Q02A 3TH6A 2HS8A 1EOMA 1C91A 5GQBA 4O0QA 1XYZA 5T91A 4MMWA 1MEIA 4W86A 5FOOA 4UQAA 2YR1A 1Q6GA 2YL8A 3MMUA 4KESA 5D03A 1VPQA 4PC8A 2UWFA 3B4YA 3UCCA 1ZCCA 2VZTA 2VZSA 5F2LA 3SUUA 1FWCC 5FSDC 1SU5A 3GAYA 2EG8A 1ZBVA 3H2CA 3SCUA 3DFNA 3ZVHA 3H2EA 1TWZA 3HOJA 1FH7A 3VCCA 1JPMA 1WDWA 1B3XA 1WE5A 3PR2A 3E12A 3NQAA 1RLCL 3GFXA 1N2VA 4D6FA 1JGMA 2QEZA 3DENA 4H2HA 1NDZA 1OYBA 2TODA 1JJKA 1TMLA 3S5SA 5EBAA 5DQPA 1YNYA 2ZDRA 2GGIA 2CLEA 3M6DA 1PX8A 4FI4A 1JCNA 2B81A 1RBOB 1XCFA 3STEA 4RV3A 3HMJG 4DBEA 3L0GA 4DY1A 5ABFB 1DP0A 4HHMA 1V6XA 4MWAC 3OJGA 2PGRA 2WQDA 2W9MA 1HJWA 1ZTVA 1XYAA 3FX4A 1W1YA 3MI3A 2ZWYA 3K1GA 5CC3A 5K9DA 3NDYA 1SW3A 3IJ8A 3N2XA 3M16A 2FMNA 3EEGA 4US6A 3H2NA 4M3PA 3BZJA 1UQYA 3GXDA 4R34A 4HJFA 4GYKA 1Q7ZA 4LYPA 4WSKA 5BU9A 1NQ6A 1J01A 1MVYA 1OG0A 4DIAA 1FWRA 4MAVA 4GABA 3VC6A 1FUYA 4D6GA 3E38A 3WK0A 1XBZA 4L80A 3A3HA 1UYQA 4AZCB 4MZ8A 3AIBA 3E9AA 4QG9A 4J3UA 3AYVA 1TQJA 1TJ1A 2P88A 3WEZA 1OIFA 4EX4A 3WQVA 1AVAA 4WHBA 3UXAA 3S0CA 3MUAA 2XFFA 1R86A 1S2VA 4XBKA 1BKHA 1Q6RA 1ISYA 3NA8A 3IJQA 4C6OA 5MKGB 2QJGA 4N9DA 4MWAD 3LZ5A 1VFUA 2J7FA 3B9DA 5LHFA 3TA6A 3ARSA 2ANUA 1QOPA 1G01A 4OUEA 1XSJA 4JR5A 5IM51 1V4YA 4OGZA 1W56A 3POHA 3NQVA 4GISA 3E49A 3A21A 4LUIA 1RK5A 4DX3A 2BS9A 2VGIA 4MJ2A 4NJGA 3UF9A 4O1BA 1WKEA 1KC7A 3W1RA 1GOQA 3E74A 5H8PA 4M56A 2C1GA 1K02A 4JNZA 3TTEA 3JZEA 3ZLFA 5BXSA 4ML9A 1TPWA 3M0IA 3SO7A 4IICA 2PDJA 2F6UA 2YDQA 4XD6A 5LNWA 1E4MM 4FNTA 4C60A 4MY1A 2P1FA 1MW2A 4UMAA 3LSBA 4HHHA 1K7EA 4GUFA 1CGUA 1UZHA 3TONA 5IHRA 1OCQA 3M9YA 4JN8A 4KCWA 5H6HA 3KVMA 1TPFA 1KQYA 1RXOB 1H11A 2X1SA 4J5NA 2FTPA 2A7NA 4O8RA 1KM5A 2F9RA 2J13A 4C6KA 4O1FA 5DMLA 1AQHA 4IIHA 1Y0EA 3IJIA 5G4WA 3QV6A 4B5NA 5D8ZA 2H3BA 3DC8A 3EXSA 2V30A 1ZJIA 5ABFA 3S3GA 4M24A 4Z1AA 5D37A 1A80A 3ECQA 4HNVA 3QZEA 4AIUA 4ZO7A 4DWSB 4WIWA 2C91A 2R91A 3IIXA 2J27A 3BTNA 3TR9A 4XTIA 4F2UA 3MJYA 1EC8A 1WDRA 3EDFA 1GKQA 2P76A 2LLEA 1B30A 4ZTXA 1KO0A 1H49A 1OT2A 4PB3A 3P62A 4EWND 1KXVA 2RKXA 2PGFA 2W0UA 1R7OA 4LALA 4U3CA 4XSLA 2DJXA 9RUBA 2ZVIA 1T40A 4I8DA 4ROQA 3LLDA 2X30A 1XIIA 3PPGA 1TA3B 4YMZA 3AHZA 4I3GA 2HJPA 2YLLA 4QSHA 2UY2A 2OYKA 1U1JA 4M6VA 4HYWA 3TCEA 3RR4A 1NIUA 1VFLA 3WNOA 3GNXA 2DIJA 4B5XA 1W3HA 2PBOA 1WKFA 4PFHA 4XWUA 4NRSA 4XZ9A 3AZTA 4IQJA 3S2JA 3EDJA 3U8GA 3OBAA 4LS0A 1Q2RA 5F2MA 4LVBA 3E2RA 4YHGA 2ZFAA 4XAZA 3VILA 1VHCA 4ZL1A 2ISDA 2PI6A 3W74A 3OQEA 2XVLA 1V02E 2WWCA 3OVPA 4N6EA 4AD1A 2ZADA 1QT1A 4LAUA 5HPCA 4XAPA 4NX5A 2VVNA 3VMOA 1THFD 4F0SA 3AUOA 4KWWA 1P0EA 3UFYA 2X16A 4Q8VA 2QULA 1JEZA 3QLLA 3GVVA 1FCVA 3L68A 3W83A 4RW3A 3SBFA 3SAZA 2QV5A 3OVQA 2PWHA 2HE5A 3HPXA 1HKMA 2C7FA 4G7FA 4Y96A 3B0VC 3M0KA 3W1PA 1UQZA 4GMEA 4H6RA 2HVMA 1ME7A 3T44A 4IFKA 2OO6A 1BWLA 3TSDA 3EAUA 4ZQCA 1QU4A 1HJSA 4K6AA 4N9CA 3ZLHA 4PEEA 4LUYA 4F8XA 2FPTA 1N8IA 1L6YA 3TN4A 6XIMA 5G4HC 2OELA 3CH9A 4I6KA 3CPUA 4FLSA 3QBUA 2BHUA 1W3LA 2AAMA 3LHZA 3FY1A 4Z2JA 3H8AA 3WQDA 4X0VA 3T0TA 4GUIA 3GY1A 3WLPA 3GXFA 3H2FA 1UB3A 4HCDA 4MFEA 1XC4A 3M0HA 2ZRWA 5J8LA 3T1GA 3SY8A 2WMIA 5RUBA 4XTDA 2Q8XA 3UJ2A 5D2YA 4KEUA 3UCQA 2O9RA 3MVTA 1NQKA 1J0HA 3EZ4A 3KCJA 4JIHA 5M2FX 2OT0A 3ZVHB 3I10A 1AQ0A 1ZHAA 2DDXA 4JL2A 3E0LA 1XYFA 2Y2WA 4ORMA 4C6PA 1E6ZA 5I3HA 4BF5A 4D8AA 3W23A 2Z2UA 3QV7A 1SGJA 4MAZA 5CPSA 2Z6JA 3LPFA 4A8RA 4ROPA 2OJPA 4JTAA 3G1SA 1UOKA 4C5ZA 2VVSA 1FCQA 5AYBA 4IP4A 2ZA2A 4YWSA 3G5EA 5FJPA 3L2MA 4PMZA 3EA1A 1QI2A 2W63A 1UWRA 3KP1A 5FJRA 4YCOA 2V5JA 4PRTA 3W3OA 4AC7C 2Y89A 3OB8A 2DT0A 1E55A 3W85A 1IQ8A 2HBXA 3AU2A 3R94A 2CWXA 2X42A 3GNOA 4CNOA 5C2GA 4L1GA 3U2ZA 1UBPC 3AFBA 3CH0A 4C1NA 3C8NA 2R82A 3E2QA 1CLXA 4QS6A 1UZ4A 2PDLA 3ID7A 4DXVA 3GD6A 4LYQA 4TVDA 1IZJA 3GU2A 4PTVA 3WQWA 3BXWA 1GKRA 5I06A 1H7NA 3TUUA 4XV0A 1HJXA 1FTXA 4Z2HA 1WBJA 1WDPA 8TIMA 4RLIA 3ARZA 3TU9A 1VENA 3OLGA 4GI8A 5IBXA 6A3HA 2O0TA 5EMMA 2XIMA 1SFLA 2EPLX 1TVNA 3TWAA 2XH4A 1SFTA 2C3ZA 4AISA 3LNPA 4Z1DA 1Z6KA 3M41A 4KW2A 2HRWA 5DELA 4BF7A 1WKYA 3EPOA 1DWJM 5B7YA 2DSZA 3MSRA 4JZ5A 1CENA 1QNRA 3CLWA 4WSHA 2A3BA 3CHFA 3ME3A 1O5KA 4DI8A 4O18A 2DU2A 4UQ9A 4F9JA 1M01A 2HQAA 3PANA 1Q4WA 4Z1BA 4ILSA 1NOFA 5E1QA 3EWXA 3T0DA 2ZUSA 1H5YA 7PTDA 4AZIA 2CCRA 2YBVA 3PBVA 1XCXA 3QM3A 3TN3A 4NJKA 8XIMA 4K7YA 1Q6QA 4ERGA 4DZIA 4BEQA 2QDEA 2ZZ6A 2DZUA 3IS4A 5DLCA 1E43A 3Q37A 4LS2A 4B3KA 3N19B 2C1HA 1HNYA 3S2MA 1QK2A 3L4VA 3H2AA 4OECA 3CGTA 3K8LA 1GVEA 1TIWA 4IUOA 1TPDA 4DJDC 1CZ1A 3W24A 1NU5A 1T96A 4LUTB 2EHHA 5K7JA 3UR7A 2PD5A 1KFBA 2FHBA 1XYMA 1DJIA 5AC8A 1P0DA 3WBYA 2FQIA 3SQMA 3SZ8A 4C91A 3U0HA 3BLEA 1IGSA 4CEUC 2WM0A 4EXBA 2DZWA 4FB7A 2BLEA 4GX9A 1PCWA 1KKOA 2UY3A 3N6JA 4PRRA 4BY3A 3R25A 2FZDA 4H6EA 3CXOA 3SQLA 3ZJKA 4CKQA 2EKGA 2OODA 1E0VA 3DKLA 3UR8A 4U4MA 2OYLA 8A3HA 4RDYA 3M0XA 3QR3A 1QFEA 2VI0A 1TWWA 4UNKA 4CCZA 1O66A 4BS0A 3URQA 4ZQMA 1R9YA 1AQFA 2QGHA 4AWEA 1CWYA 1RAKA 4IPJA 2HE8A 1R6WA 3Q94A 1LT8A 4DWSA 3AZRA 3MDWA 1UC5A 4JKMA 4AUBA 1VJZA 1VB9A 1TJPA 1L9WA 2GUUA 3WFZA 3QY7A 2E5BA 3VKDA 1ZFJA 3QZAA 2CIPA 3MP5A 4KGJA 2EKCA 1PTGA 2YA1A 3QLDA 1VJIA 2Z00A 3KCOA 1H0IA 3VUSA 3NJ3A 1TB3A 4A22A 4ZXOA 2MNRA 3Q2DA 3A22A 4JFWA 1XS2A 2GFTA 1FOBA 3GG0A 2OWCA 3S47A 1QASA 3SSZA 2GGHA 3A4XA 1IR1A 4UTKA 2YZRA 4GYFA 3PPFA 3QW3A 4UQBA 3H7UA 2W4XA 4Q7BA 1ODUA 1E9IA 1GYLA 3RK8A 2GGEA 4YIWA 3AIQA 3IV8A 3W7EA 5M3WA 4G7EB 4GVGA 1DL3A 5BROA 2PWFA 7XIMA 1S2CA 3WQGA 3R7MA 5A94A 3T8QA 3GHRA 4A8NA 3B9AA 4DM2A 5K3VA 2BDQA 1YE4A 2FFIA 3KRUA 2WC7A 3LQGA 1AL7A 1EGMA 3GKAA 1XLLA 1XDMA 1DQUA 2HXUA 2VC9A 4RNFA 1Q6LA 3MKCA 2VURA 1ZAJA 2GQ9A 4PUMA 2BSLA 4P8XA 1FWEC 1CLKA 2WMGA 3CUHA 3CMGA 3I3EA 4UUIA 4KWVA 5A8MA 3CJPA 3N17A 3PS7A 5BNKA 3RX4A 3VOIA 2FJKA 3V75A 3AXMA 5T8GA 3U48A 4PB5A 4KMQA 1M9HA 2ZZ7A 4LJ3A 1SSDA 4M7SA 4RDWA 1NSJA 5AZ0A 4XAYA 2GYIA 3WFAA 4DEFA 4UQEA 4D6DA 3NSNA 2VX6A 2CFFA 3LV5A 1KM4A 3UJSA 5DXXA 3W7IA 3S9YA 2G3IA 1FXPA 1NWSA 1OG6A 1R87A 3VCNA 1YPFA 1D7KA 1H7XA 3DFPA 1PYFA 4MZ1A 3S42A 1EPXA 1S38A 1KRAC 3KXQA 5FEPA 4MB4A 1UR0A 3GH4A 4MOZA 4DO6A 2PDKA 3MVIA 1TRIA 3DUGA 4BF9A 3TNOA 1UH4A 2WKGA 2BMBA 2JEPA 5C5YA 1OY0A 4YTRA 2OSWA 1VBRA 4JTCA 1DORA 4QAIA 1UMLA 1UH3A 1DE6A 2IQDA 3UNTA 2J47A 3R0KA 5TAOA 3RMJA 5K4ZA 1JZ3A 2J7HA 3MC5A 5IFPA 1SZEA 2NXIA 3TYZA 4ZSUA 1XINA 1IXNA 4X2RA 4NIRA 2OSXA 1RLDA 4S38A 1IT8A 4XUGA 2VC7A 1TELA 2WCSA 4K38A 1CXFA 1K3UA 3LG3A 5CBJA 2E09A 1CECA 4NZFA 5D9OA 1H7PA 1RHCA 2V3EA 3H4GA 5F7UA 2Z2BA 1KFJA 1PIIA 1PBGA 2ZE0A 4IX0A 2CESA 3P61A 5M17A 2AQWA 4QEEA 1E5NA 4V1XA 1KWGA 1CXLA 1TPVA 3M6YA 3M4HA 1J18A 4S3AA 4RNJA 3K8KA 3LRMA 3MZ2A 2ZKMX 1EIBA 1TJ2A 3OBKA 4GQQA 3DYMA 4O1CA 1R47A 3SN4A 4DBUA 2NXHA 4INFA 3VGDA 3OVRA 3NXFA 1TX0A 2OPJA 4HA3A 2BY2A 3CUGA 1H0GA 1FWTA 5KZ6A 1XLIA 3MKKA 3FHAA 1TTPA 1ZZMA 1X98A 3KM8A 2FDSA 1ZENA 2GDVA 4QSFA 1UIOA 1E4LA 3LBOA 4O10A 4XKMA 2QW5A 3CEPA 4O53A 1XBVA 2PWVA 1NWRA 1JDCA 4E2OA 1OZQA 4IP7A 1SJAA 2VTFA 5JXQA 1XIDA 4J2MA 1UWTA 1GYMA 2WSPA 3SIMA 5ECVA 2NX1A 3TKFA 2QJJA 3WUBA 4DM1A 1E56A 1XSKA 3GTHA 5K9CA 4P7NA 4H8HA 3OGRA 4A8LA 1JG9A 2WK2A 1X6NA 4Y9NA 4W93A 3V16A 3ICJA 4ZFMA 4XO6A 3P0WA 3T07A 4ATWA 2MUCA 4GXPA 1E0TA 5HMFA 1NY1A 4N7QA 3A3XA 4ZEPA 4I90A 4ATDA 2D0FA 1UUOA 1W91A 5AN7A 1R3SA 1K8CA 4EAMA 4XAFA 1OCBA 2PSNA 3OU8A 4WZHA 3RU6A 1LL6A 2NLYA 4TIMA 2GVYA 1UMYA 1WZMA 3CIWA 3CZGA 1I1WA 1DJQA 1GQKA 4CEXC 3V18A 2Q6ZA 4HNUA 2WMFA 1WXYA 3M1ZA 1RY8A 2I9EA 3HO8A 3UR5A 3ES7A 1H63A 2Z28A 1V0LA 1GVYA 1XI3A 2OQYA 2UY5A 4DUXA 3SUWA 3TIMA 3W00A 5A3HA 1IE7C 5EMYA 1RVKA 4CU6A 3W7DA 3AMGA 4ZZ9A 3NYZA 4U10A 4XISA 2QCDA 3W7RA 3ZWSA 2XWDA 2C18A 3G0XA 3WLKX 5BWAA 1KWKA 4Z0SA 2FPVA 4RX0A 4URIA 2DIEA 3WH6A 3VO0A 3ANUA 5FF0A 4UQDA 2XN1A 1P0KA 5GNYA 4C7DA 3S1GA 2ACSA 3CQKA 4POCA 2JE8A 2J7BA 1ZLPA 3P0XA 5HWNA 2YBTA 3BJTA 4OUIA 4O16A 3P3BA 4UZUA 2EGZA 1JDEA 1GORA 2ATMA 1RK6A 4O8AA 1GEQA 5KETA 3B06A 3LCIA 2OLAA 4DB7A 1NFBA 1SUXA 3V0TA 1HVXA 2BOEX 3WSUA 1UR8A 5IDZA 3GXIA 1WDDA 1F74A 3L4YA 4O57A 3WDRA 1PDYA 3HJZA 3G22A 1VYSX 5EU9A 4HNLA 2A79A 1YEYA 2IPGA 3N12A 3IVTA 4XB3A 3KFTA 2J8FA 1EOKA 2QPUA 1P43A 2QVHA 3CAKA 1DJWA 5D2TA 1Q6OA 3AMCA 1OC5A 5I3JA 3U7VA 3OZMA 3VNJA 3B8UA 1A47A 1SR0A 4CN1A 5EL1A 3RM4A 3QFWA 4LAZA 1ME8A 2WZIA 4GZJA 2BODX 2A7RA 1RUSA 3UCDA 3ZSSA 2G96A 2E0PA 4UNIA 2DSKA 1DXFA 3IIZA 4FX7A 2AQVA 1GVFA 1N8WA 5KMYA 4EAYA 2PDHA 3DECA 1E1FA 4GGBA 4IM4A 3O06A 1NELA 2YCLA 4DJEC 1FVPA 3OLIA 2JFEX 4FXJA 1JZ5A 3R0UA 1S2AA 1M7JA 4XD4A 3ZLGA 4AZHA 5E0KA 3CHCA 1MZHA 3I6EA 5TQLA 3N11A 3G2GA 4KFOA 2ONEA 5T26A 3GDBA 3VE7A 5C2XA 3DFQA 1MZRA 4XZBA 5BOEA 3MB9A 4HU0A 2GUBA 3WLQA 1F6KA 3AHYA 3DG7A 4GWEA 4Q8PA 5DY2A 1XC6A 2VP8A 4YVXA 1FHUA 3WD4A 1ZPTA 3F2DA 1IEWA 3T09A 1R3RA 3EOUA 1B90A 3FLUA 4LNYA 1R5YA 4G6CA 1Q7MA 1ICPA 4R5EA 5DCBA 7ENLA 2CKRA 1NDVA 4NAFA 3FJ6A 3E02A 1KCZA 5I79A 3DHFA 3A5VA 5CSUA 3SJ3A 4JQAA 4X9SA 4LEQA 3HM7A 2D0GA 1Y5VA 2A7PA 2ZWZA 4HTBA 4LPCA 2HROA 1U30A 1F4HA 1JPKA 4LCRA 4GYPC 4AEFA 1LWHA 3D47A 3DFOA 1XIFA 3OLEA 3O0FA 5F2IA 1RQHA 2NV2A 3NG3A 4G56A 4WXZA 2W3ZA 1XX1A 2DVTA 4CD5A 1YXDA 3EKGA 1UJPA 1VPYA 4QRNA 1DQXA 2E67A 1YADA 3DXIA 2WJFA 1A3HA 5FAJA 4V28A 3QQWA 4UQCA 2D24A 5HQMA 3TQPA 1PZ1A 3JS3A 3SCVA 1YDNA 2YDSA 4HSOA 4D6CA 2YZ5A 3H6OA 3KOYA 4BQ3A 4GYJA 3LENA 3H53A 5D2WA 3AMKA 2OGYA 1OC7A 3VA8A 1HW6A 3UY7A 1Q45A 1X8CA 2AKMA 5HOSA 1W1A1 4HU3A 3FXYA 2V68A 1B3VA 2ZRUA 3PNZA 3JRKA 3TTQA 3SN0A 1Y5XA 4IPNB 3RUBL 1GVIA 4AC1X 4QBXA 1V03A 3B8WA 4IIBA 3VKBA 3G6MA 2Y8KA 2H9AB 1ESWA 3VD9A 1A0EA 3DZ1A 4OVXA 1GK8A 1RY0A 1DPMA 1UR3M 3FEMA 3NSXA 5C7HA 1N55A 1MUCA 4H9VA 3BH4A 3VOFA 1KCKA 2VDHA 4C6NA 3DC0A 2PE4A 3CYVA 1C8QA 5EY5A 1LRTA 2PDWA 1Z44A 1C7SA 2CBVA 4OFCA 4YJ5A 5E70A 4S3CA 2POTA 4WY0F 1QR7A 3AISA 1HX0A 3RR1A 3HPSA 3I7QA 2PWDA 1W5QA 1YHTA 2NQZA 3C2RA 1T41A 3TNBA 4ZB5A 3P60A 3PZTA 4FMVA 1O1HA 1PZ3A 2DZXA 2C14A 3M0JA 4XSMA 2JKPA 1P6CA 4S3FA 2WPBA 4DUOA 4GZ7A 2J74A 1B54A 3VDBA 4IUGA 4M81A 4JY9A 1R0MA 4DF1A 4K39A 4S2CA 3W53A 4M29A 3N4AA 3FHQA 4D6IA 4AEEA 3EKLA 2J7CA 3GR8A 4E6MA 3NXLA 2HVNA 4W85A 1XJBA 4B5VA 3ITXA 1Q3NA 4ZOCA 4D6JA 4W4QA 4H9ZA 1DTUA 3WX7A 1JD9A 3F4DA 3ABXA 4D9PA 2PPGA 4H8UA 1W2VA 3GFZA 3VNKA 4LBSA 3H4XA 4NKCA 3ZR4A 1NF7A 3ARYA 3W0KA 1YE6A 4ZGYA 3W6LA 4FO4A 1U1HA 3AJ7A 1H4PA 5AYYA 1S1PA 1QATA 1OC6A 3NR0A 1HO4A 3CUJA 1GZ1A 2W67A 4GI4A 3KUMA 3Q67A 1TR9A 1J0KA 1M3UA 1QO5A 1QWKA 2GSEA 4RW5A 3EB2A 3O1NA 3E0IA 3EX6A 3A24A 3SM0A 1GOOA 3J7HA 3OOQA 3EWZA 3UNDA 3T7VA 4CGTA 3S2LA 1BD0A 2XN2A 4Y9OA 2BXYA 3T9PA 5MF5A 3FAWA 3MSYA 4RKAA 4W5ZA 4D1IA 1T8QA 1A3XA 2H3DA 2OG9A 1HO1A 2VCAA 2P53A 2WBGA 4OHQA 2VRQA 4BCEA 1E1EA 3C4UA 2PGEA 5KZMA 4QISA 3OIHA 3CK5A 3DIPA 3B0UX 4IIFA 1NARA 3W1TA 2JALA 5FACA 3KAOA 3ZFHA 3SRHA 1I1XA 3AIWA 3URNA 4PBFA 3IUIA 1H50A 1W5NA 4PE8A 3DHPA 4MJ4A 3BAXA 1EZWA 5FJUA 3LTPA 1F8MA 2DSWA 4X22A 4UR8A 2WXDM 2R1NA 1YXYA 4U2YA 4JICA 3BSMA 1W9DM 5LSMA 3W29A 5A69A 3QSTA 3QTGA 2ZRYA 2Q09A 3LA4A 5HNNA 4HVXA 5HWMA 4LY4A 4NAEA 3TYDA 3VIKA 2BTMA 3GIPA 4NJIA 3CAVA 3M0ZA 1UP2A 2E9BA 3WH9A 1VEMA 2UV8G 4H41A 3ARTA 2R14A 3TZFA 3KRBA 4PMYA 3STCA 4PMUA 3NZRA 2QDGA 3G1AA 1GQIA 4YTQA 2E9LA 4HIBA 3G8EA 1EL3A 3R6IA 2D23A 1XLBA 2OZ3A 4PUDA 5KTLA 4I9TA 3TJ4A 5EYWA 3N14A 4PMRA 5D05A 2IKJA 2Y7FA 4B15A 1MFVA 2ASHA 4QDPA 3NQCA 4C6EA 3UZJA 2EJAA 3WF2A 3SCNA 1JYVA 2XIIA 4OT7A 1SZRA 2P3ZA 3E5PA 2Z1BA 2WVUA 3K4DA 3VTRA 1OSEA 2E6FA 3OLDA 1ZB5A 4CCEA 1XWYA 1UG6A 3HJEA 5I3IA 3HPAA 1UPMB 3PTMA 1XQLA 3PJXA 1WCGA 2Z26A 3MZNA 3NDZA 1BGGA 5CZKA 2E7FA 3F7JA 4HHPA 1OF6A 1EXBA 1V51A 2Q8ZA 6PTDA 3JU2A 1UHVA 5C71A 2YKKA 4Z0JA 1PX3A 4GOAA 1ALDA 4KETA 3GW3A 2CC0A 3C2YA 1XKJA 4Q4PA 3W84A 1V6WA 3TX9A 4H04A 2FGBA 4QDMA 1J0IA 3ARPA 2QDHA 1IEXA 5DT7A 1CGXA 5L9FA 2XGBA 4ACYA 3HQOA 3OZPA 1VHNA 3S1WA 2FGLA 1HJVA 2PTWA 2O4MA 3TC7A 1TPEA 1BSLA 1BWKA 3CPGA 1AG1O 3YPIA 3QW4B 2G5WA 2J75A 3LSCA 1TA3A 4A4AA 2NVAA 1U83A 5XINA 2XWEA 3I7RA 5E09A 4JQ1A 4NQ1A 1OWQA 2X41A 2VFFA 4GIRA 3EDEA 3C8FA 3UG3A 1DWIM 3NQ7A 4HD5A 2ON3A 3NQBA 3NCOA 3SI9A 2WB5A 3BC9A 4B3LA 2QZRA 3AQUA 3WK1A 3TXZA 5LNSA 3DN5A 2XJ7A 3FJNA 3TMQA 4FLQA 2I5GA 2X1IA 4WF7A 5FF4A 4XUYA 2BHYA 1KFCA 2I1OA 3PZIA 2WNWA 4J1OA 1O5RA 2VX7A 2NVDA 2GVGA 1NJJA 4DRSA 3QXBA 4MIMA 1WXZA 3E1F1 3NGJA 4H3DA 3ABRA 2Y8UA 4R3UA 1LJYA 2WSRA 3C2EA 2IPFA 1F07A 2R94A 4B16A 1ITCA 1JRBA 3R79A 1F6YA 2JQXA 4XZLX 4C6MA 4MLJA 1JZ2A 4MYXA 4KT2A 3HV8A 4M6PA 3THDA 2VR5A 1Q6CA 3O8AA 4MPKA 4Q8MA 4A2SA 1OYCA 1G4SA 2NV1A 3W82A 4ZQPA 2XZ7A 4AAJA 1GUVA 3BSHA 3GTNA 1W1ZA 3QZ6A 4PCSA