3K4WA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Bb4693
publication title CRYSTAL STRUCTURE OF Uncharacterized Tim-Barrel Protein Bb4693 From Bordetella Bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics, unknown function
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3k4wA00
3PANA 2HQAA 2CZVA 4B3ZA 1WXZA 1RK5A 4KETA 4R85A 1UIPA 4EPKA 4C6OA 2HNHA 4EPEC 2GZXA 3LGDA 3ISIX 1I0BA 2A3LA 2OODA 4RE0A 4LCSA 3V7PA 4P5UA 1J5SA 4R88A 1V7AA 1FWAC 4XD4A 4B91A 1W1IE 1P6BA 2EG8A 3LS9A 4V1YA 2P53A 4Z42C 2ANUA 3S2MA 1RAKA 4ICMA 4DIAA 1KRMA 2PGRA 1O5RA 1ITUA 4KEZA 5CH9A 1YMYA 2QPXA 2E1WA 2OQLA 3IPWA 1POKA 1RJRA 4OFCA 3B0XA 3CJPA 3OVGA 4HJWA 3S2NA 3OOQA 2VR2A 1A5MC 4E3TA 3GTFA 1YBQA 3HTWA 1ONXA 2FTYA 2Y1HA 2GWNA 5HMFA 3TNBA 4WHBA 1J79A 4IGNA 4EPBC 3IGHX 4CQCA 4PCPA 4C6BA 2Z2BA 2HPIA 3B0YA 4DI9A 2F6KA 3IV8A 3K2GA 4XAGA 4C6MA 4C6QA 3URBA 4CNUA 4NG3A 4LAKA 5AKQA 3QY8A 4RDWA 4C6PA 1UMLA 1FWIC 1S3TC 3RYSA 1RJQA 3TN4A 2Z29A 3QGAC 1FWBC 3FDKA 2E25A 3LSCA 3E74A 4C5ZA 4C6FA 1ZZMA 1XRTA 2Z28A 3DC8A 3URAA 1EZ2A 3WMLA 1HZYA 3T1GA 3HM7A 3AU2A 4INFA 4C6NA 4AQLA 1FWCC 3MDUA 4LANA 2KAUC 3ICJA 2OGJA 3OODA 4H9MA 1V79A 2R1MA 3IJ6A 3MPGA 3TN6A 4XD5A 2Z00A 4J35A 4WGXA 1GKQA 2Q01A 4H9ZA 2GOKA 3UBPC 4M51A 1E9ZB 2Q09A 1EF2A 3IARA 3QGKC 4NI8A 4UBPC 1FWHC 4GY7A 2ZC1A 2Z27A 4KERA 4GOAA 1PSCA 5FSDC 4GC3A 2HPMA 4KIRA 1YNYA 3SFWA 3EWDA 3LSBA 3GRIA 3A4JA 3RN6A 4QROA 3F2CA 4QSFA 3ORWA 3MDWA 4GXWA 3QY7A 4AC7C 4C6EA 3GG7A 3GTIA 4EP8C 4C6LA 3URNA 1FWDC 3JZEA 4GK8A 1EJRC 4XD3A 2PAJA 3GUWA 4IH3A 2G3FA 1FKXA 2P50A 4LAMA 4IFOA 4B92A 2AQVA 2WJDA 2Z7GA 3PBMA 4XD6A 3G77A 4G7EB 2RAGA 2YB4A 5HMDA 3CS2A 3T81A 3MKVA 4HK6A 1NDWA 3NEHA 3OU8A 3R0DA 2D2GA 2FTWA 4GY1A 2R1LA 1RJPA 4RDZA 4DZIA 1NDVA 1J6PA 4H01A 3BE7A 4DO7A 1XRFA 1M65A 1IE7C 2BB0A 1QW7A 3AUOA 2R1KA 1YIXA 4PCNA 4IF2A 1A5OC 3LNPA 2PUZA 2Z25A 3RCMA 3B40A 1M68A 4DZHA 3PAOA 4PBEA 3A3WA 1J6OA 3HPAA 3OJGA 4ZSTA 3F2BA 1V4YA 2YZ5A 4D8LA 1ONWA 5G4HC 4J5NA 2FVMA 4HA0A 4KEUA 3QY6A 1ADDA 2EG7A 3GTXA 1P1MA 4GYFA 1A4MA 1RK6A 3F4CA 2AQOA 2FFIA 4C5YA 1V77A 1NDYA 3FDGA 3TN3A 1EJSC 5LXXA 4IFKB 1QXLA 1I0DA 4CNSA 4RDYA 1KRAC 2Z2AA 4GZ7A 4C6KA 1V51A 4R7WA 2VHLA 4IGMA 2DVTA 2EG6A 3WZ0E 4C6JA 1P6CA 4BY3A 1EJXC 2YXOA 4XAZA 1PB0A 4KESA 3LY0A 1UIOA 4I6VA 2OB3A 4CEXC 4HK5A 3K5XA 4PBFA 1VFLA 4B90A 1K6WA 1EJVC 3NURA 4BKNA 2QVNA 4F0RA 4KQNA 4DYKA 2I5GA 3IACA 1GKRA 3LGGA 2Z24A 2YB1A 4L9XA 3F2DA 1O12A 3RHGA 3E0LA 4CNTA 2VC5A 1PO9A 3CAKA 3E0FA 1PTAA 1A5KC 4ERIA 2GWGA 1R9XA 2UBPC 2HBXA 3OQEA 1EJWC 3NQBA 4HK7A 4F0LA 2O4MA 4IG2B 4IFRA 4G7EA 3T8LA 3D6NA 3GU9A 1FWGC 1A4LA 4QS5A 4QRNA 3GTHA 4IQJA 3DCPA 3SO7A 4H9XA 4G2DA 2Z26A 4LH8A 3MJMA 3UR2A 3PNZA 2WJEA 3N2CA 4GY0A 2O4QA 4DI8A 1XWYA 2ADAA 2D2JA 4C65A 4C6CA 2XIOA 1A5LC 2R1NA 4ZSUA 1FWFC 1R9ZA 4CEUC 2DVXA 4H9VA 3LU2A 2DVUA 2VC7A 4DNMA 2R1PA 2OOFA 4ERGA 4H9YA 4LEFA 3F4DA 2W9MA 3MSRA 2PGFA 4RDVA 1ITQA 2HBVA 2VUNA 3DUGA 4DLFA 3PNUA 4JOMA 1FKWA 4H9UA 4IFKA 3URQA 4QS6A 1FWEC 4CQBA 3IRSA 1BF6A 3LA4A 4KEVA 4CQDA 2BGNE 2WJFA 3O0FA 1K70A 3GU1A 2VM8A 2QS8A 4YIWA 3EGJA 3UR5A 4RZBA 3ID7A 1UBPC 1RA0A 2AMXA 2UZ9A 4GX8A 4BJHA 1EJUC 2ICSA 3MTWA 4H9TA 1POJA 4EPDC 1YBQB 1NFGA 4PE8A 4H00A 1YRRA 2PLMA 1KCXA 2I9UA 3S4TA 3E38A 1WXYA 3MVIA 3TN5A 3E2VA 4I6KA 4F0SA 2QT3A 4V1XA 4LALA 4NP7A 3S2LA 1M7JA 2D2HA 4QTGA 1K1DA 4IG2A 2IMRA 1FWJC 4MUPA 4L6DA 1DPMA 4WVXA 1R9YA 1EYWA 3A3XA 1KRCC 4GBDA 4LCQA 5HMEA 3C86A 4ERAA 4J2MA 4GX9A 4KF1A 4TQTA 3GIPA 5FSEC 4C60A 5A6TC 2GSEA 3ITCA 3UF9A 3K4WA 1XGEA 4DLMA 1KRBC 1EJTC 4LCRA 2FVKA 4LAOA 1GKPA 1A5NC 3GU2A 3MVTA 3FEQA 4XAYA 3E3HA 4C6DA 1RA5A 3WYZA 1JGMA 3O7UA 1E9YB 3EWCA 4C6IA 3S2JA 4LFYA 3AU6A 1NDZA 5E5CA 2WM1A 4UB9A 3UPMA 3GIQA 2Z4GA 3KM8A 4XAFA
chains in the Genus database with same CATH superfamily
5D30A 3ONBA 2E67A 2V9DA 4HHHA 2JEPA 4L4OA 1GOIA 4EACA 4RNFA 1TPFA 3UXAA 2NVAA 4WKHA 4PGLA 2DZXA 3TA6A 1Z44A 3VIJA 3CASA 2X41A 1VBRA 2BV9A 4WIWA 2QAPA 1RAKA 5AY7A 1N8FA 4AZCB 3TU9A 9RUBA 3MMWA 1UD6A 5ABEA 1XYAA 3N13A 3CPRA 3WX7A 3M0XA 1C29A 4PB5A 1QVBA 1HJXA 1MFUA 4E3TA 1UROA 3THAA 3CQKA 2AMGA 3THQA 1W3KA 2ZX9A 5JBFA 5HMFA 1C9WA 4XBJA 2XFYA 2HVOA 4IGNA 1P5BA 4CQCA 2PDUA 3N73A 4C6BA 3B0YA 3F1QA 3CZKA 4O18A 3KEHA 3GTNA 3PZNA 4AHPA 2BLEA 5AKQA 4LUTB 2GVEA 2QV4A 4P2VA 3OLDA 4W8LA 1GTEA 1O7AA 2AAMA 3VKJA 2GK1A 2CYGA 3OZMA 3GYCA 1Q6FA 4X9SA 3URAA 1UYQA 2PDXA 4H6EA 1R46A 4TMCA 1ITCA 1CXEA 2CC0A 4HZ8A 5GPRA 3RM9A 4F79A 1V0KA 2QCMA 1PIIA 1MWOA 4EK7A 3UEQA 1RVGA 1AJ2A 4WRHA 2VFFA 4RZ6A 1XJBA 4GI6A 4S1FA 1W3NA 2PD5A 5JBDA 1AH4A 2QEZA 3U2ZA 1L6YA 1RQEA 4O8RA 4QJ5B 5I78A 3GNRA 1I1WA 3A21A 5A6LA 1G9HA 1BQCA 2Y63A 4JKMA 1NVMA 3W1QA 3QQWA 1JD9A 2BGSA 4V28A 1HKIA 3M43A 3SJNA 1QHPA 3G2GA 1TELA 1JYNA 4PA8A 4ZODA 4LPCA 1FKXA 3GYEA 2RHGA 2PLKA 2OEMA 4E8DA 4HSNA 3FA3A 1YADA 2ABAA 4RV3A 3UPWA 4DWSD 3E5PA 4S3KA 3OB8A 3BE7A 2FJUB 1CXHA 3BK0A 5T91A 4POCA 5A6SA 3MWAA 2VFHA 3EWZA 3KUMA 3NYZA 4LOCA 4PBEA 3EOOA 2D0HA 4QLJA 5CEWA 4JIQA 1OYAA 1E4LA 5EFFA 2I16A 3KTSA 3LK6A 3UJ2A 4B9YA 1OJXA 1W1A1 1XCXA 1H0IA 1MUWA 1XHGA 4Z1DA 1BWLA 3WNPA 3LI1A 2C8NA 1WKYA 3ZQ9A 1QI4A 1TUXA 1EC7A 1DJWA 1J4EA 3PFRA 4ACZB 1ZPTA 3GXIA 3GKAA 3VD3A 2VHLA 1GVRA 4Z1CA 4EX4A 2EG6A 2LLEA 1CGYA 4PTNA 3DOPA 2Y5JA 4J3TA 4KQNA 5IBXA 1EA9C 5A2AA 5T9BG 3HJZA 3VM7A 3CUJA 2ZUWA 3GH5A 1LT8A 4FLSA 2VEPA 4UQAA 1HL8A 2YLAA 3MI2A 3UCDA 3BARA 4K38A 4UQCA 1H4PA 1XF0A 1EJWC 4DHGA 1H1ZA 1JFXA 3N25A 1FCQA 1D8CA 3BAJA 3AXIA 1IEXA 1QHOA 4FPSA 1G5AA 1S2TA 2TYSA 4FOJA 4XIMA 4LYKA 4MKNA 5CPTA 4G2DA 1ISZA 2ZKMX 1OIMA 1WNOA 3PPHA 1OVDA 4HYVA 3VD7A 2W91A 3KRBA 4YCPA 1QNSA 3IJ8A 2HISA 2VNCA 4JTEA 1AMYA 3QMSA 2G97A 3SCRA 3IEBA 3SY8A 3B9OA 3QKZA 2WV8A 3OGVA 3MQTA 1JCTA 1JUEA 1EXBA 1FWTA 1R3TA 4B3LA 4QHRA 1UW9A 4LXFA 3CV1A 4RDVA 2ZDSA 2OX4A 4HVXA 2Y8VA 4N9CA 4F9DA 3K46A 5D9NA 1UWUA 4GUJA 4XV0A 3W22A 3TSMA 3S42A 4NZ1A 3PB2A 1RCQA 3RF9A 1Q6DA 1FWEC 2VELA 3OVQA 1VFOA 4FALA 1BF6A 1PKYA 5F4SA 5EB8A 2OSWA 2PC8A 1K70A 3GU1A 2QCEA 3C6CA 2J75A 1OG6A 4CN1A 3WLHA 4FNPA 2DT1A 3U7VA 4W86A 1FX6A 1CBGA 2NXHA 2ATSA 4IMDA 1Z48A 2V69A 1BVNP 4B4FA 3EOLA 1GVFA 1D3HA 1JIBA 4EPDC 1E9IA 3V35A 2ACRA 5JMUA 1KCXA 1RHCA 2X09A 4D6JA 4AISA 3SUWA 3B97A 2QT3A 2WK2A 3AS1A 3W38A 2FQIA 3IJ9A 4GVIA 3DC0A 1EKOA 4K36A 2NLIA 3VNLA 1LCOA 3VC6A 2OG9A 3EA1A 4AD2A 3B8IA 7ODCA 1KKRA 1IGWA 4NJIA 4RW3A 4WJXA 1IWBA 2NV1A 4ZB0A 3S5SA 3AJXA 3NVDA 3MI6A 2P10A 1MW2A 3UY8A 1RR2A 2WMIB 4TQTA 1UZDA 3V4BA 2TODA 1U83A 5KZ6A 1RQBA 1TPVA 1B3WA 5JUVA 1B2YA 1A5SA 1OCJA 5D9MA 1VAHA 2Y8KA 1RBAA 1J5TA 2CLOA 3FEQA 4Q8TA 1PUDA 4JDBA 2OWCA 4C6IA 4DELA 4O4WA 2DORA 4I3GA 3FHAA 5DCBA 2VJXA 2HXUA 1GG0A 3ISIX 3TXZA 3DFNA 4EKJA 1KQZA 5FJTA 3G18A 1OC7A 3PM6A 3M0KA 5T26A 4AD4A 6REQB 2EG8A 1ECEA 4DO6A 4DJDD 5CZKA 4L6HA 3NR0A 4C1NB 3D3FA 4AG0A 4YVXA 3DYPA 3W2KA 3HZ3A 1HJWA 1G69A 2I57A 3UU0A 5XIMA 3FYPA 1VJIA 2BVDA 4B5NA 3FXYA 4QQ3A 1Q6QA 4JFUA 2QJNA 4LGXA 3ENLA 3W29A 3QYSA 5DLCA 4AIEA 3SY5A 1UH3A 2OVLA 2QCCA 1L8PA 4R33A 3Q67A 1JZ7A 4JTSA 5E9AA 4XAGA 4C6QA 4LSBA 5IRPA 4ADSA 3IAPA 1I2NA 3EKLA 1V6WA 2VCBA 3QBUA 2FZDA 4DWSB 5LZLA 4L1WA 1W3IA 1Z89A 2E25A 3CXOA 2J8FA 3W7KA 4JICA 2CKRA 4Q4SA 4RKAA 2WKJA 1ZY9A 5CPMA 2O9PA 4D6EA 3H26A 4AQLA 4O11A 2HCVA 5AHMA 2J7GA 3CLMA 4P8XA 2PWEA 2QMJA 1KXHA 5K3VA 1TTPA 1NOFA 4UBPC 4AIUA 1CXKA 1DYSA 3AIRA 3VGEA 1TX0A 4GOAA 4M6QA 1BXCA 4NXSA 3BLFA 4GZIA 4B5SA 2ODOA 4FR1A 3W71A 4MWAA 1SJDA 1W5MA 3STGA 1VBHA 4XD3A 3HQOA 1EO5A 2L5HA 4WY0B 4H6RA 3MV11 3UGRA 3C0QA 4AH7A 2W61A 4DWDA 3M0IA 3W70A 2FTPA 2CBVA 5EGRA 3W87A 4XVDA 1GPFA 4FOUA 1NDVA 4DO7A 1HN1A 3N11A 1F73A 5L6UA 1YIXA 1CW2A 3NL3A 1XISA 4P61A 1K02A 4MJ2A 4JTFA 3AOFA 3EXTA 1J6OA 1N55A 1WOAA 5CGTA 2GDQA 4UQEA 1UR0A 4Q22A 1TRIA 5IM51 5LGXA 3N9SA 4UR9A 5HNTA 2BHUA 1JYWA 1FH7A 4JBRA 3VINA 4OU1A 2ZXAA 1H7PA 3AYTA 1WX0A 2GUYA 3UW6A 2TRSA 2RGMA 2OYLA 1W9DM 1N82A 2Y61A 2VZTA 4YYFA 2YW3A 1QT1A 3FHQA 4Q6JA 1BPLB 5C9ZA 4DJEC 1EZWA 5D04C 3KDNA 3VNIA 4MLJA 1HF6A 4QG9A 4NUWA 2VGBA 3WQ6A 3NM3A 4N6FA 3W02A 4MTVA 3DG7A 4UZUA 2PDNA 4BKNA 5CQ1A 1XGZA 4ATLA 1TV2A 4EANA 2Z24A 4H6QA 2CLIA 2W92A 1AH3A 1PO9A 2DSWA 1A5KC 4MB3A 2GWGA 4B5VA 2GOUA 2YLLA 4NSBA 1HL2A 1VKFA 3JW7A 2CBJA 4FLRA 2D3LA 2CZDA 6TIMA 3T8LA 1P0DA 2OLHA 5CSYA 3WDHA 4ZB5A 2PGWA 1C93A 1PYFA 1VB9A 2WKGA 5C5YA 3L4XA 4J1OA 3LI0A 2XIJA 4FIQA 4XKMA 4A2RA 2PSNA 3QTGA 3UWEA 1HT6A 4N2YA 4NXKA 1WB0A 5CC6A 3HBLA 5D32A 3DU0A 1X8FA 2CBIA 4J3XA 1WZLA 3O15A 5HQLA 1G94A 1QWGA 5BOEA 2HK0A 4GABA 4IMFA 3FA4A 3AHZA 2VFGA 3LRLA 1JZ2A 3Q45A 4L7ZA 2VL4A 2HMCA 1XPGA 2PDIA 5I7GA 1DJHA 5GQBA 5JVLA 2A3CA 2PP0A 2TSYA 3GH4A 3V5FA 4YNGA 4XVEA 1O5XA 3M0JA 4MJMA 3OYZA 4BF7A 1GEQA 2QDGA 3NOEA 3CGTA 4QBXA 1U2YA 4JFWA 4JFSA 5BXPA 2C1HA 3Q65A 1R3WA 5AC4A 4KRUA 1H5VA 3BAXA 4HN8A 1E6SM 2E9MA 3DG6A 2EKCA 2UZ9A 3GXPA 3MP5A 3W00A 4ZTYA 1E6XM 3S5YA 3AIWA 4H8VA 3PWIA 1Q45A 3SSJA 4PL1A 5CZTA 4V1XA 3SFKA 4RE4A 2VWTA 3H4WA 1FWJC 5K4ZA 3MUCA 3ABZA 5EBAA 1AZ1A 4GBDA 1R6WA 5KETA 2GDVA 2WB5A 4GCAA 5IHSA 3PWAA 3WMCA 4PH6A 1YTDA 1KM0A 2WC4A 1DOSA 1R0MA 5LA0A 3K4WA 1XCFA 4ATDA 3W6MA 3FVDA 3KWXA 2FVKA 7XIMA 3W1UA 1Z7AA 2J7BA 2WC3A 4GNVA 1SPQA 3F5LA 1RA5A 1GHSA 2VR4A 2ATMA 4KCTA 1EEXA 3HGSA 3B8TA 3L4ZA 2QJIA 1FHLA 3MY9A 4JL1A 3UPMA 3VOFA 3KM8A 3PANA 5EMMA 3VGDA 4V15A 3VKBA 5DFAA 3SURA 1C90A 1IHIA 1TZ9A 3G1YA 2VVNA 3R8HA 2XGBA 3BQ5A 2VOTA 4V1YA 2ZZ6A 1CZ1A 2YCLA 2HROA 1TJ1A 4GIYA 1R2SA 4TR9A 3CO8A 2E40A 4J3UA 1XBVA 3VX1A 1EJ7L 1ZENA 4FSAA 3GLCA 3VDBA 3HTWA 2WHMA 5JH1A 2FTYA 3R10A 3TNBA 1JFHA 1XLHA 5I23A 4JDYA 1UP2A 1QCWA 1JPDX 4Q8PA 1DWIM 3N1AA 1TFVA 3PUEA 3F4NA 3ZJ8A 4QDWA 3CU2A 3VOIA 1W9VA 2Q71A 3LHYA 1N8IA 3S47A 2Z29A 2OZ3A 3W0KA 1TZZA 1K8ZA 1QNPA 1T96A 5A8MA 4FLOA 3HM7A 3AU2A 2PA6A 3ABXA 2J6XA 3OVRA 3U2OA 4JTUA 3T0TA 3TC3A 2X8RA 2YYUA 3K30A 4UFMA 4F2UA 3MU7A 4XD5A 2J7EA 4WGXA 3WCZA 3CZJA 3TCSA 5AZ1A 1XH1A 4TIMA 3WNNA 2Z27A 4AXNA 4S3EA 4ILSA 4KIRA 1YNYA 3C2YA 4TX9A 2FGZA 3A13A 4ZEPA 5EL1A 2YFOA 1LT7A 4KKXA 4H8NA 3O6AA 5I00A 2Y4SA 2D73A 2OJPA 2HDJA 3WQCA 3HPFA 4I7VA 3U5UA 3JZEA 3G1FA 2FVLA 1CI1A 3S1VA 1JEZA 3QF0A 5CC7A 1TV5A 4IFOA 1N8WA 3TTSA 3D3AA 1WDRA 3IIXA 1ZHAA 1GZGA 2BVTA 1MEHA 3PZIA 4MYAA 2FB3A 3PTQA 1OINA 4M3PA 1L6WA 3NEHA 1QHZA 4S3FA 3B0VC 1SSDA 3UJFA 2VFDA 4K3ZA 3MC5A 2OO6A 4I8YA 3G1RA 1KWGA 3Q37A 1G7UA 1KCKA 2PUZA 4U3AA 4XZ9A 4KFPA 2YBTA 3P5ZA 4F66A 4M29A 3E9AA 3TNOA 1G01A 5EY5A 1CLKA 3W2NA 3W1RA 1DQUA 1ZNNA 1W31A 4AZBA 2JKAA 3DN5A 3WLKX 1P1MA 3LEPA 4AMAA 3VD4A 5E1QA 4HPNA 4GZJA 1EEPA 4WX2A 1SZFA 1E1CA 1LWIA 1EF3A 4DF1A 5DN1A 1HO4A 3KL0A 3Q94A 4QG6A 1IR1A 3T09A 3POHA 3NOYA 3SUUA 1UD8A 3ZVIA 3WF0A 5HNUA 4H04A 4B2DA 1EX1A 1XSJA 4I6VA 4L1XA 3K5XA 4W5UA 1GHRA 1RY0A 3WQ4A 3A4WA 3MO7A 3VUSA 3RLUA 1YYAA 1GKRA 4ML9A 3LDVA 4JGDA 3RHGA 3PF3A 3E0LA 1X6UA 2ZZ3A 2VC5A 1HJSA 2GK1B 4NI3A 1FWRA 3TYAA 4FK9A 2Q8ZA 1KM5A 2P5NA 3UNTA 1LJYA 4G7EA 1RZMA 1J2BA 2RDTA 3NUKA 3WELA 1A0EA 1VJSA 4QS5A 3WMSA 1K8CA 2O55A 3ITVA 5LIYX 1A49A 2DDXA 1OQFA 3MJMA 4MJ4A 3SN0A 2VI0A 4J7RA 5M2FX 5EPDA 3A5FA 1BYDA 2PF8A 4D8AA 3LM3A 1C7TA 4M24A 3ARUA 2CU0A 1CLXA 5MKGA 7PTDA 4H9YA 2W9MA 3MSRA 4HPGA 2VUYA 3S6OA 4BZYA 3TP4A 2J6VA 4PFHA 1H63A 2WSQA 2HBVA 5DMLA 1W1ZA 1MDRA 1B3OA 1G4PA 1KGXA 3P3BA 2WLYA 1EA0A 4GH3A 1W9PA 3GBEA 4E8CA 5C55A 5CLTA 2ACUA 2G37A 4XTDA 3I7QA 4HMCA 4HCDA 2CERA 4YVPA 5TIMA 3PJWA 3I10A 1EP3A 4L1GA 1FDJA 4RZBA 4IIDA 3T78A 2XWEA 3ZJ7A 4UTKA 1Q63A 1EJUC 4JX5A 1GEHA 1QK2A 4PE8A 3MBFA 4MY9A 3TN5A 2GL5A 3GXTA 2PDQA 5CAKA 3W6LA 2DT3A 4JX4A 3R25A 3OGSA 2ZX6A 3KWSA 3N29A 3RG6A 4DEFA 1JZ6A 5B7ZA 1TCDA 3LBOA 1LL4A 4Y8EA 3TW7A 3UVAA 1LUCB 1NFBA 3R6IA 3EWXA 4UFJA 1BHGA 4JHMA 4U3CA 1JZ3A 4FO4A 3OYXA 4PMYA 2VCCA 4MZ8A 3WJXA 2YYTA 3IRDA 2VENA 1VYRA 2ISDA 1KFBA 5AC6A 1PE1A 2F6UA 2AL2B 1NDZA 1XV8A 1BYBA 2CLPA 3B4YA 2ISSA 4A3HA 1EBGA 4Y7EA 1O94A 3VGGA 1XIEA 3C2FA 5JU6A 5FAJA 2J77A 4GGHA 2HNHA 5E09A 2A7NA 3LGDA 2OODA 3C3NA 3LMZA 3AQUA 3L4UA 1N2VA 5JBEA 4J3SA 1EYEA 2W3ZA 3P6LA 3O6CA 3M0LA 1VJZA 1XLAA 4NZJA 4ICMA 4DIAA 1JXKA 1WCGA 1GVSA 2VX4A 3ZVHB 1RLCL 3GG1A 1Q85A 1OYBA 4LWWA 1ZBKA 4UTFA 4GQBA 1S38A 3W7RA 5HR6A 2VGGA 4QNEA 3ZLHA 4Z0SA 2QJHA 2H9AA 4DO5A 3EBVA 3MCMA 3PFMA 2Y1HA 3BSGA 2JIWA 1C7SA 4PCPA 1QBAA 4XZNX 3UR8A 1JZ4A 3KP1A 4JEJA 3W81A 4RE3A 1VFTA 1WUEA 1XYCA 2REQA 4JS3A 5IFTA 2ZYFA 1AW1A 4GJ1A 2QYGA 3PZUA 1FWBC 3W7NA 4LUIA 2YL6A 3LSCA 1KTBA 1LTDA 4LV9A 1MUMA 2BZNA 3WMLA 1UH2A 2OTDA 3M5XA 1E5NA 5DBUA 2ON3A 4I7UA 5ABGA 3S1UA 3KZPA 4HIBA 4OBTA 3V0TA 3DXIA 2FPTA 1V79A 5H6HA 2WHJA 4DUVA 2E0PA 2GLKA 3INPA 1BKHA 1ENUA 1EF2A 3IARA 2XZ7A 2RH9A 3V36A 2ZC1A 1BG4A 1J0KA 2OZ8A 3QKEA 3VZXA 3LSBA 2D24A 3LLXA 2WVVB 3JVAA 3MZNA 1TJ2A 3WQOA 3R8GA 2WPBA 1X1NA 3F5JA 3QM3A 5ECVA 2XWDA 3RU6A 4EAMA 4WDUA 3N4FA 1KFWA 5CCZA 3V1PA 3HV9A 4V2XA 4XD6A 1NARA 2OCZA 4Y6GA 2VO5A 1PDZA 1FWSA 2CZ5A 1ZJHA 2CFFA 2OO0A 1GW1A 2DIJA 3H22A 2C0AA 3SUTA 1H49A 5IHRA 4C90A 1UC5A 4HZ6A 1TZ7A 4MYXA 1M65A 5CJNA 1JYVA 2A79A 2X1RA 4R7JA 3RK8A 4UNKA 3R5EA 3CB3A 4ZSTA 1CGVA 2XVKA 1GONA 4EVZA 1AJZA 3QC3A 1E1FA 4E6MA 5E9XA 3S1WA 3RGTA 3BVJA 3IS4A 5E6YA 2WOQA 3ARYA 1Z69A 3PHAA 3C0LA 5G4EA 3LQLA 3W7IA 3FW6A 5EFDA 2D0GA 1JCYA 4N4PA 1K7XA 1WKFA 3JRKA 1G67A 5REQA 3QFWA 3A4XA 3VIMA 3M5VA 3RIKA 3DZ1A 4YU1A 1VQTA 1JL8A 2EPLX 2UY4A 1G0CA 4MB5A 3ZZ1A 3W53A 2JFEX 1SMAA 1PB0A 2OZTA 2XN1A 3C8NA 1V5XA 3W7OA 3WUBA 3SY1A 4JIPA 3M0HA 1EJVC 3HPXA 3WK0A 4FOKA 4U5IA 3ANUA 4TV5A 1B1YA 4ZENA 1AD4A 3F2DA 3MYPA 4XKYB 1V3HA 2OT1A 5HWMA 3CTTA 3O63A 3BW4A 1R9XA 5D05A 1VS1A 5FACA 3CBWA 1L8NA 2YZRA 4AVFA 4Z17A 2P3EA 1TV3A 2JF7A 3LOTA 4MPKA 2OLSA 5A6JA 3VCNA 4GBUA 3D6NA 3NQMA 1HKVA 4WLCA 3NZRA 1XLFA 4IQJA 1H7RA 2C3ZA 3U0HA 5JXQA 3BAIA 2OPJA 3VOHA 2DZAA 4NNBA 4OGZA 2DUZA 2VFIA 4RX0A 4HNLA 5DO8A 3RU8X 3LGEA 3T0DA 3L68A 3FOKA 3NQCA 2GQ3A 1H11A 3NFUA 5HWNA 1WO2A 4NAEA 4HZMA 3HURA 3NWRA 2PTDA 4CEUC 4FNTA 4PB4A 3WFLA 2VRQA 3QXBA 2YA2A 1K4GA 3L23A 4BEQA 1IZJA 4QE5A 3OPSA 3S1XA 4QQUA 3WDPP 1US2A 2Z1KA 1QNVA 1TB3A 3E6EA 4IPJA 1AK5A 4AHOA 3VZYA 1S1RA 4GYJA 3FJNA 2JF6A 1P1XA 2Q8LA 2QJJA 3LA4A 3AC0A 2NV9A 5A6KA 8TIMA 1NP2A 4MJZA 1EBHA 2B31A 3OG2A 4LC6A 2GGJA 2I5QA 4XZMX 2VDIA 1MVYA 5HJLA 2PDPA 1O68A 3DYOA 4H9TA 2DZSA 2I9UA 4GINA 1Q66A 5DANA 4UOQA 3E2VA 3CUXA 4PMQA 3WLTA 2EF9A 1THFD 5CJMA 4G56A 3B4UA 3GVWA 1A3WA 4PODA 3U9IA 4ERAA 2IQDA 4AU0A 3WD2A 1XLEA 1Z41A 2P8CA 1V3IA 2VEMA 2GSEA 1GWJA 4LYPA 3VGHA 1WUFA 1RY8A 4ZBCA 1TREA 4A21A 3KHJA 1K7EA 3E3HA 3H2EA 1RSCA 4GWEA 1K4HA 2XSAA 4LFYA 4PMOA 3L4TA 5HUPA 2VOMA 3GNNA 4H8UA 3UESA 2P8BA 3V0SA 2HQAA 3WQDA 4AY1A 2X2YA 4CN6A 5KSWA 1VCFA 1IIHA 4EPKA 4EPEC 9XIMA 3NTYA 1EWEA 4LCSA 4CU8A 3MBDA 1U5VA 1KBJA 4DJDC 4R88A 4LV4A 1VLIA 3EWBX 1W1IE 3UCQA 1UOZA 2VTFA 5D38A 5U4NA 2QGHA 3MWCA 1JXJA 4C91A 3T7VA 4EXQA 1B5TA 3T40A 1VIWA 1DBTA 2PGRA 1TWWA 1O5RA 2CLKA 1UD3A 3NL6A 2F7FA 1DQWA 4GD0A 4JXCA 2XGZA 3GG0A 5AYIA 5HWJA 1POKA 3LX9A 3SEPA 3O0KA 4IGHA 2DUAA 4ORIA 4O8AA 2E09A 4UCFA 2V38A 2PP1A 3WQ8A 1EB3A 5FJRA 3UZYA 1ONXA 3ONCA 4RNIA 1H7WA 2JQXA 4Z1BA 4LVFA 5KMYA 4CU7A 2F6XA 4UIOA 1XRSA 2Y6ZA 2VZVA 5HNRA 3D0CA 2ZRXA 4JTIA 1XXXA 4UTHA 1XLMA 3TMQA 3I7RA 2HEJA 4D2JA 1K9FA 4OHQA 2V2DA 3UWWA 4IX0A 3CT7A 4WJEA 3KOFA 1MXSA 3DFQA 1ZAHA 3WNOA 3TH6A 5JH2A 3T1GA 3UA4A 3VIGA 5I3IA 4C6NA 3AISA 3NQEA 1BD0A 2KZHA 1F7BA 2EXOA 4KFOA 4G9PA 1JPKA 1OGSA 3IJ6A 1LYXA 2D0FA 1H60A 3ATZA 3N4EA 4AWUA 2Z00A 3RJYA 5H8UA 5BXTA 1UZ4A 1GVQA 1OB0A 3EDKA 1KGUA 2FYMA 4E4UA 4GC3A 3EWWA 4GJIA 4M82A 3G1VA 4Y96A 4MDPA 3EWDA 1J0IA 1I9CB 2IPGA 2PTXA 3MDWA 3W7MA 1UA7A 2GQ9A 1DXEA 5GJNA 1TV8A 4AZ5A 4J3ZA 2INEA 2Z1WA 3OLIA 2R9RA 1W1YA 1FP9A 5LIKX 1ONEA 1OX6A 3W37A 5HMDA 4ONVA 3RRAA 1PL9A 3QPEA 3FAWA 3MA8A 4Q6XA 1A80A 1VFFA 3V1HA 2E6YA 1W2PA 3CZGA 3VTRA 3B40A 4FZIA 3AMGA 3A3WA 3OJGA 1ICQA 3F2BA 1VFSA 4X2PA 2E4TA 1OX4B 3GDTA 4LQ1A 3TCEA 5DBTA 1JQVA 5D2WA 2HS8A 2EO7A 1S5MA 3HV8A 1BYCA 4U33A 1DP0A 2PTWA 5CJ5A 3K1DA 3PBWA 1W5OA 3RX2A 3NSMA 4PUDA 1NFPA 4JTKA 4NZFA 2XVNA 3TN3A 3OHIA 2E6AA 4O1FA 2JBMA 2XSXA 4HA3A 3H2MA 4TX8A 4C6KA 5HQMA 2Y7GA 3R11A 4IGMA 2DVTA 2PLJA 4GUIA 3QPYA 1EJXC 4HHPA 5CSUA 4H2CA 4WDXA 3NL2A 1GQJA 3EDFA 3VFLA 2CWXA 1GUVA 2NLYA 5KINA 3BPWA 1KBLA 1SR9A 4LVGA 2CLMA 3MHGA 5JIWA 4ZCWA 1GPWA 5A1AA 3F03K 3VMPA 4QFUA 1KTNA 3VYLA 5C71A 4EE9A 3PTDA 4Q4OA 1ZBWA 5J5DA 2BY2A 1SFSA 3Q2DA 3LHZA 3GWQA 4P8VA 1LORA 1EFZA 4OJYA 1EC9A 3A9IA 2PURA 2BP1A 1TA3A 5I3GA 5D8WA 3T0CA 3NJ3A 3T2OA 4RK8A 2PGEA 2BWGA 3PNZA 3N2CA 2DW7A 2VQUA 3ZM8A 3UZZA 4XISA 1PYMA 3DFPA 2V30A 3B8DA 4OBSA 1WYIA 3UZ5A 4H9VA 1QPRA 5LHEA 4ERGA 4PL2A 3N19B 3HG3A 2PGFA 1GQLA 3APGA 1NH6A 2VX5A 3KOWA 3TLQA 3WH9A 2WKLA 4JOMA 1VGAA 1VRXA 1DE5A 3HQNA 4K1WA 2YKKA 1MXDA 4ACZA 3AXKA 3VK5A 2OX1A 4HBKA 4NKCA 2ONEA 3S3GA 1IGSA 2DZWA 2ASHA 4IP5A 4M8UA 1US3A 2BVWA 3PS7A 2OGYA 2WMKA 4AF0B 3NL5A 1RA0A 1UP3A 5EMUA 2G4JA 1DIOA 4NY2A 2ICSA 5CBBA 3PJTA 3PJXA 3SM0A 3SIMA 5C7HA 3EDJA 2PLMA 5DT7A 3I65A 2EHHA 4S38A 4GRSA 4S2BA 5AVHA 3P14A 2YBVA 5XIAA 1RCOB 3KLKA 3W1LA 3BLPX 1S5NA 4GHRA 4N02A 3UETA 3S0CA 2AAAA 3VKDA 3G24A 2PBGA 3VX0A 3LV6A 4BQ4A 4ZXOA 4QM1A 3T2QA 2QJGA 1T40A 1LZOA 2HSAA 2VVSA 1JULA 4G1KA 3QR1A 2VKZG 3PVFA 1P0NA 4TTUA 3GNDA 5F2GA 1M7XA 4A22A 1TWSA 3H7UA 3SIZA 4UFKA 3A4AA 1GVOA 5AFDA 3OQ8A 1KCLA 1TPH1 3LHWA 3FIGA 1QRQA 1PKMA 3AZSA 1GORA 1XIFA 1TVLA 3M07A 1YDVA 1KV8A 4HA1A 2VRKA 3BL3A 1R47A 2GJRA 4KFNA 3TK7A 4KS0A 2FMOA 8XIAA 4DNHA 1V7AA 4P7LA 4XD4A 4B91A 3N2OA 1RLDA 1XQKA 1FCVA 3WO8A 3GS6A 4KWUA 1WQ5A 1Y5XA 1QAPA 4H2HA 3VD9A 1GCYA 1ZRQA 1DWGM 1UWTA 1SR0A 2QMKA 3B0XA 3CJPA 4LNCA 4R5EA 1SZRA 4JCMA 1PZ3A 2V5BA 4KWOA 2GGIA 2BHYA 4WHBA 4LUSA 3W3OA 4HCLA 4FNRA 3CUFA 4GCXA 2HPIA 1JNEA 4JTJA 5LA2A 2BXYA 3I3BA 3ME3A 4B4HA 4ZO6A 7CGTA 3L65A 3VIFA 3VIHA 1B4KA 3M46A 1TJ0A 4C6PA 4IGSA 1OD8A 4E2VA 4S3GA 1FWIC 3CM4A 3ARXA 3RM4A 2E5DA 2ZUVA 1CB7B 3AIEA 2FIQA 3QOKA 4BHYA 1I2OA 3BMVA 4D8ZA 1MO0A 3KP0A 2FGLA 2Y85A 5A95A 3LNMA 4DJED 4X2RA 3C2EA 2AGKA 4O17A 5I02A 4DXXA 4MNJA 1AFSA 3B8VA 3HGOA 1VBUA 4Z08A 5CPOA 2Q01A 4R9XA 4Z2KA 4GY7A 4JTGA 4JQ1A 4B9ZA 1ICPA 4JKLA 1PSCA 4XZLX 5G4WA 4NJJA 4DJFA 1YDOA 5E6ZA 2G0WA 1K9EA 6XIAA 1XW8A 2WNNA 4OOUA 6REQA 5CPNA 1V0MA 3FFSA 3UJRA 3UG5A 3W7EA 4C1NA 1VH7A 1V8EA 3GR4A 2PDHA 3NO1A 3WNMA 2WJDA 3P8JA 3PBMA 4UMBA 1A0CA 1NEYA 3EAUA 3MUZ1 2G50A 3VNKA 2RAGA 2WLZA 3HGJA 1SW0A 2D2GA 1RJPA 3P61A 4DN1A 3FV9A 4BWLC 5A69A 3EZ4A 5TBOA 3PB0A 3G8RA 1WAUA 2D20A 4GVHA 2DU2A 3NXLA 3VCRA 4E4PA 4Q7NA 4K8HA 4PFMA 3WMBA 4GYPC 5M5DA 1E51A 4L65A 1QTWA 3PZTA 9CGTA 1W5NA 1JI2A 4FI4A 1O1HA 4ZO8A 1YNQA 3WLRA 2QJMA 5HULA 4PCSA 4DWSA 2YL5A 4OIFA 4LRSA 4CD5A 3IIZA 3U6WA 3NEVA 2XU2A 3MSDA 3AZRA 4GYFA 4U28A 3B05A 1V02E 4X22A 2WZMA 2WSYA 3YPIA 3N17A 3G1SA 3W24A 1UR3M 3N4AA 3SSZA 1LRNA 3UP8A 1CLVA 3ELFA 3WZ0E 1E43A 2H9AB 2VEFA 1JRBA 4OVXA 4KESA 4K7VA 5KZMA 2KX9A 1K8XA 1XYLA 1UG6A 2E77A 3NURA 3IIOA 1US0A 3IACA 3LLFA 4NZ5A 4R9OA 1O66A 4QEHA 3TA9A 4LBRA 3M5YA 1GJUA 5D9PA 2CCRA 4PR4A 2QIIA 3GC5A 2YSWA 1W56A 2DSZA 1HGYA 4F0LA 5FF2A 3VO0A 3WL1A 4CLMA 3F5KA 3GHSA 3QH2A 2B4GA 2XTKA 1S2CA 4YTUA 4AMCA 3DKJA 4K8EA 4FXSA 1YTKA 3K4AA 4H9XA 4YTSA 4KWVA 3W85A 3BGAA 4O54A 4H7ZA 3CYJA 4W4QA 4D6IA 1Q13A 3FNDA 4YTQA 1NWUA 3WF3A 1XWYA 2PF0A 4C6CA 5BXSA 3EB2A 3AXMA 1UZ1A 1DQXA 2QQ6A 3O1NA 1C92A 1D3CA 3PAJA 1DJNA 1FHVA 4DY1A 3Q4DA 3DKLA 4GI4A 2JKPA 4A05A 4HNNA 2WC7A 4TVCA 2VUNA 3F4WA 2HK1A 3DUGA 1FHDA 2VWSA 4RCXA 3PNUA 1UR1A 3TX9A 4H9UA 4K39A 5LNUA 1W5PA 3AMKA 2ZTJA 5A6BD 2BGNE 4KRTA 3KFTA 2DH3A 3UG3A 4I9JA 2G96A 2Z2UA 1AL7A 3W72A 3HJEA 2OSXA 2PU0A 1UBPC 3S6DA 4BJHA 4J27A 3AROA 2PRHA 1QR7A 2WJZA 4WZHA 1RD6A 1YBQB 3FYOA 5BWFA 4AX6A 1KXQA 1GOOA 1WXYA 1DTUA 4YHGA 2C16A 4EF8A 1TPUA 3V18A 1K1DA 1C8VA 3CMGA 3N2BA 3NSXA 4UTWC 3MV01 3CWOX 3H53A 1EYWA 1GQNA 2W4XA 2WXDM 4J2MA 2V5DA 3BURA 4IPPA 3UT0A 3ZOAA 2GJXB 2XIBA 1TPDA 2PTZA 1KRBC 3WJYA 4ZFMA 2FKPA 1A5NC 3WLJA 5HANA 4DO4A 4MADA 1GOKA 4ROQA 3S2JA 4CNNA 3EMCA 4DB7A 2WM1A 1L6FA 2EKGA 1TTIA 2V3DA 5F2MA 1XINA 2OWXA 2GVYA 2DY3A 4B15A 2A3LA 1LP6A 3NNTA 1DJQA 2ZRZA 1O5QA 5ENLA 3G1XA 1UOKA 1UJQA 3FJ4A 1NELA 1F4HA 3AIVA 4M81A 2XVLA 1JDFA 4ICCX 4O53A 3ZJKA 4FXRA 3QMTA 1L6SA 5I0DA 3STFA 1T6MA 4KGLA 5CBJA 5FF0A 1FHUA 4HJWA 1NQKA 2VR2A 2YCJA 3ARQA 2QUUA 2F38A 4GKTA 5BRQA 2J7HA 4YWIA 4DJDA 2DZTA 5I3KA 3WD4A 1DIKA 1TPC1 4TVUA 2G3MA 1BWKA 5FD0A 3G1DA 4HNTA 4JTCA 3TSBA 3DH7A 3K2GA 3VFCA 4UOZA 2BGQA 1YPXA 3D5HA 4IL2A 4E38A 2ZXQA 1E71M 4LF1A 4F0MA 2XSBA 3NQ8A 2ZZ4A 3W76A 3HG2A 4O0KA 5A6MA 1PDYA 5ABFB 1OG0A 1SW7A 3XINA 5AB3A 2ZADA 4UR8A 4INFA 1PIFA 3W84A 3GDKA 5GNXA 1XDJA 3SDOA 4DUXA 4Q8NA 1J10A 4EWND 2BSLA 3SW6A 3WLLA 3W25A 5BU6A 3FA5A 1E6QM 4NI8A 1IXNA 4LY4A 1B4EA 3P8IA 4HNUA 1MQRA 3E0IA 2J9XA 3F2CA 4QSFA 3PY2A 3PBYA 2X2GA 4AC7C 1IWAA 2HS6A 3BG3A 3KOXA 4GK8A 2RUSA 4PULA 4JTDA 1NF7A 3M6YA 1OFAA 2NWSA 1TQXA 1W5QA 2J7DA 3S9ZA 3DHDA 4IQDA 2QLYA 3G77A 4LW7A 1ZALA 8RUCA 1PAMA 3CS2A 3WLPA 3TR9A 5IDZA 3T0BA 4GY1A 3IJ7A 4G1NA 5HQEA 3OP2A 1EDTA 1FXPA 2A6LA 3OHMB 4B5TA 5CKSA 3HGRA 3ITOA 4A8NA 2PWDA 1EP2A 6PTDA 2B7NA 2J88A 4TO8A 4ZQOA 4JN7A 1Y5WA 3U4FA 1XG3A 4GUFA 2CXEA 1Z32X 1V4YA 3I68A 1ONWA 4CVUA 4O15A 1OX5A 3E5BA 3MUY1 3AXHA 1LM1A 1E0VA 4KEUA 3KOYA 2RKXA 1LLWA 3W4RA 3N2TA 3LCFA 1VHCA 3F4CA 1IV8A 1LWHA 3J7HA 1JCMP 4UFIA 4AXKA 3WN6A 4YWSA 1EJSC 4IFKB 2QR6A 4RLIA 3SCNA 1FY6A 1UP0A 4R7WA 2VD9A 1M6JA 3LRKA 3CL7A 1PCKA 5AVNA 3TC6A 5J04A 4MB1A 3CWNA 1QU4A 2SFPA 3LY0A 1UIOA 1Q6CA 4CEXC 1K6WA 2I7GA 4Q33A 3H4GA 4NASA 3QQ0A 3P82A 4NX5A 3QTPA 4PMVA 3VNMA 4C7DA 4PTXA 2YB1A 3MSGA 3D46A 4UFLA 1VC4A 1X38A 4UMAA 2WMJA 2XH2A 4CNTA 1XD1A 5I3FA 4DBWA 2QAFA 2PDKA 3VDHA 4HKPA 3OW1A 5ECUA 2J78A 3BW3A 4HK7A 3CUGA 3AS0A 1ZP3A 3DBNA 4OV4A 3VGFA 1D2KA 3KTXA 4WF7A 2EEXA 3SQMA 4ZE5A 3WY1A 1OIFA 3G0SA 1E0XA 3SUSA 2WHKA 3UR2A 1REQB 3BLLA 5KZDA 4Q4QA 3C5QA 3CZEA 3TEVA 1LROA 2VRJA 3AUJA 4JTLA 1JAEA 2X1UA 1PX8A 1SGJA 2DVUA 1DJYA 3WFAA 3U57A 3QZAA 3TYEA 3I3EA 3RLGA 3WLQA 1E3XA 3APTA 4DXKA 3ZFHA 3SN1A 3H2CA 2C1GA 3S2CA 2X7VA 2V6AA 4MOZA 3EPMA 4JYDA 4L9YA 1DWAM 1BRLA 4DLFA 4BK9A 4W5ZA 3KCJA 1J8VA 3LQGA 4QS6A 4W87A 4BEUA 4MY8A 1UUQA 4PZVA 1TIWA 3ARRA 4MZYA 4QJ3B 2ZA2A 4O14A 4GO9A 3CIWA 2HVNA 5FOOA 3IUHA 1DIEA 2W66A 2ZRVA 4N42A 2VT0A 4ZGYA 1W3LA 1H09A 1JQXA 4X0NA 2FMNA 1NY1A 3S83A 1EIBA 4Q3MA 1MYRA 2Q3RA 3LM7A 5HINA 1B3VA 4QDMA 1YRRA 4L9ZA 1J0HA 1J96A 3C3UA 4GJJA 3FAXA 4LC8A 3QJAA 1HJQA 3MS8A 3UJEA 3V75A 1TPB1 4NILA 1TPEA 4IMEA 1DPMA 3ABRA 4WVXA 2J74A 3C61A 1QW9A 1T41A 5DMYA 1CECA 3VD5A 4GX9A 2XFWA 2ZRYA 1HFBA 4K37A 4IQLA 1RUSA 3W7LA 3B9NA 2PWFA 2OZ0A 4LAOA 4G5DA 1Q6LA 2BDQA 4Q8VA 2VZUA 4JL2A 3EPNA 3WYZA 2QF8A 3EWCA 4Q32A 3N3MA 4E2DA 3XISA 2GJLA 2DZBA 3C2RA 4LYQA 3OLEA 4M0XA 1XGDA 4LTSA 3MO4A 2RJGA 1JCJA 1BQGA 4HB7A 4NNAA 3V7PA 4FR6A 2X16A 3JS3A 1H7XA 4W85A 4ZOCA 3SCTA 2XH7A 2VDGA 1NQ6A 2F61A 3DERA 4QJ1A 1LBFA 4S23A 7A3HA 1KFKA 4Y2WA 1TA3B 4RZ5A 3C52A 4Y9PA 5EA9A 3BW2A 2A6NA 2OXNA 3DENA 4KEZA 3EOEA 2E1WA 3BG5A 4UTJA 4S3AA 1UPMB 3MSYA 3OVGA 3NZGA 1DEDA 1WDWA 2WWDA 3EOUA 4OT7A 3I3DA 4BA0A 1UASA 3RMJA 2WSKA 3ZSSA 1E55A 5K7JA 1WDSA 2Z6JA 4DI9A 1E6PA 3GNPA 3LUTA 4W88A 1IT0A 4L64A 2IPJA 1ML1A 5EMLA 1UMLA 4J3WA 2UY2A 4WDWA 3O9NA 3RYSA 1Z6KA 3UWUA 1GG1A 4BI7A 2PBOA 1LUCA 4FNUA 3UZXA 2J9ZA 3SQSA 2BXVA 1OFQA 5FEWA 4B5WA 1QW8A 2D69A 3VDGA 3I6RA 2A7RA 3BSMA 1B3YA 3FXGA 4MHBA 4IJRA 1B9ZA 1HVQA 3Q58A 3MDUA 1U1UA 3FVMA 1FXQA 1TCMA 1HGWA 3FCPA 4LANA 5CZSA 3REQA 2OGJA 1XUZA 2AL2A 2OQYA 1LRQA 3W7CA 2X42A 1MRAA 1NP0A 1LOLA 3NQAA 3L9CA 3ANYA 4H9ZA 2XINA 4GVFA 2MANA 3OBEA 1XYMA 5FEPA 3S1GA 3L0NA 3U4AA 3KBSA 2WZIA 1T8QA 3C4UA 1NJJA 2QUNA 3UWQA 5AC7A 5HR7A 3W86A 1OYCA 3QY7A 1Q8AA 3IV3A 4AWEA 4DRSA 1FWDC 3AIQA 1G4TA 1FWNA 3AS2A 4UNIA 1R38A 3ZVHA 4FB7A 3R94A 1DWHM 3VCCA 1JRCA 1L9WA 1E0UA 1Q6EA 1QPQA 2O7QA 3MT1A 1Q7MA 3WKZA 1LQ2A 3O05A 3FSUA 2BY3A 3WSUA 1FDYA 4IPLA 3SZ8A 4GIAA 3R13A 1XI3A 2CPUA 3EKGA 4PC8A 3QLLA 2PEVA 1A5OC 3LNPA 4AY7A 4XZBA 3MB9A 3ZT7A 4M80A 1HL9A 2WQDA 2X30A 3KRZA 1FWWA 4ASTA 4AZ7A 2XM1A 4W7UA 1ADDA 3LN3A 3C8FA 4BS0A 3N2XA 2OELA 3CB8A 2G3JA 1HJUA 3MZ2A 5CPLA 4YMZA 4OQVA 2W6RA 1OSEA 2Z2AA 1FH9A 3EB3A 4QISA 4PRRA 5LNWA 4W7VA 1F8MA 1F3WA 1E3ZA 3N34A 3FGCA 4KBXA 4Q8QA 4LUSB 2YDSA 1ZGDA 3ZLGA 4MGGA 4E3VA 2R82A 1ICSA 5D4YA 4AZIA 4ZTXA 4WXYA 4Q4PA 3CO4A 1UWIA 2WVVA 1XSIA 3KBJA 2DJLA 4U2YA 4XZIA 1BEUA 2NQLA 1FFQA 1V6UA 3LXCA 3C2OA 2O4MA 5MHBA 1SSGA 1Q8JA 2CLEA 1RALA 3V16A 1CB2A 1ZBCA 3O16A 4RV8A 1V6TA 2O0TA 5A8PA 1RVKA 5CGQA 4MZ1A 3LCWA 3W2JA 2FHFA 1JDDA 4HU4A 2W0UA 4GY0A 2ZZ5A 4DI8A 3GO2A 2NWRA 5GNZA 2V2HA 2Z0IA 2NW0A 3H7VA 1XBZA 3KXQA 1H7NA 2R8WA 8XIMA 2PCEA 5FJIA 1IR2A 2QPUA 3F4DA 3L5AA 3NPWA 5I6SA 2HJPA 4DZ5A 4KWSA 1OT2A 1ITQA 5EMYA 4U5KA 4F9JA 3ZMRA 1KR0A 3TW6A 3TLLA 3CUIA 1W91A 3MANA 4MAZA 4O50A 4PTWA 5XINA 2WO5A 1V02A 5IBXC 3QRHA 3ITLA 3BAKA 2FZMA 4XK2A 4BCEA 3EMZA 1E6RA 4YIWA 3W7PA 4YL2A 1TVNA 1OK4A 3CPGA 1J12A 4TXEA 1XBYA 5F1UA 1HW6A 2WVTA 2JIEA 1QI2A 2IXUA 4DPQA 3UXKA 3T07A 4JHOA 4XKYA 2C14A 2WW5A 2NX3A 1W9BM 1XLJA 2QCHA 3PZOA 2XH0A 4MPQA 1PTGA 4H1ZA 3QZ6A 3VAVA 4ECLA 3TC7A 1KRCC 4K2SA 2WNQA 2CIPA 3WF1A 4BQ5A 1WP6A 4WXZA 2IQ0A 1XIGA 1VF8A 1GVIA 3AYSA 3LCLA 5A6TC 5CXPA 3ZJ6A 5EKYA 2WYSA 2F84A 1TMHA 2XH4A 3KBVA 2EAWA 4F4RA 2QIWA 4KW2A 4PRWA 3W82A 1E9YB 4LVDA 4IWWA 4F8XA 2BBFA 3E2RA 5A8QA 1PVNA 2W79A 1OHLA 2CZVA 3RXZA 1WXZA 4B3ZA 1U30A 1CIUA 4S3JA 1XFCA 1UKOA 3B9DA 2NQZA 2O92A 4FA3A 4E2OA 3WLNA 1XH2A 4IM4A 2ACQA 1FH8A 4IUGA 4GGBA 3TVAA 1J0ZA 1M7OA 2QXWA 5D02A 1M04A 1F76A 2VX7A 1BTMA 4S3CA 4QAIA 4LYRA 2X0YA 3LMYA 4PRTA 5CH9A 4XWUA 3CAVA 1KCZA 1WKDA 3CQHA 4AZHA 4GVGA 1RJRA 4M1RA 4WSHA 1I1XA 3PN8A 5CAHA 1LF1A 4M6PA 3S2NA 4FP1A 4MNKA 1Y0EA 2OSYA 3COTA 1Q4WA 4XZHA 2PC4A 4ES4A 1S46A 4AZ6A 3RO6A 2NXIA 1K6AA 4G6CA 1KWKA 4CNUA 2ABBA 3ECQA 2DFAA 3QY8A 1MEWA 1F05A 3QSRA 3GH7A 4CNPA 2V81A 4WD0A 3TTYA 4A2SA 3QGAC 4NL1A 5D2XA 3JZUA 1F6PA 4C5ZA 5C9RA 1XRTA 3W27A 4LAUA 2GUUA 4BQ2A 3OIHA 4LBUA 2J13A 3BDKA 3SRKA 3RCYA 5C2GA 3IGXA 3OLGA 3VKCA 1WZKA 2KAUC 4GNJA 3OODA 3ES7A 1MW1A 3BGGA 4GZEA 1FVPA 4I5XA 4ZOEA 4HHLA 1MQPA 2A7PA 2Q09A 1E70M 1P7TA 1DE6A 4XUGA 3PUOA 4HPJA 3RX3A 3GXNA 4QROA 1YDYA 2A3AA 4RNJA 2XVGA 3K8MA 3WDQA 2CESA 4P8UA 3HG4A 3L5LA 2H3BA 1PX4A 1SJAA 3PR2A 1T5AA 3DFYA 3GR8A 2AQVA 1B3XA 4P7QA 4A8IA 3T44A 1EDQA 3VIOA 1NOUA 4PMZA 4U31A 1MMFA 4DAIA 3CNYA 4HK6A 1KM4A 3WQWA 4XZWA 4IUOA 3HMCA 2CLHA 3PZVA 3E2SA 2CITA 4H01A 4IZGA 4L4PA 3MMDA 3UD6A 3HMJG 3RILA 1YPIA 4MY1A 5LNSA 4P7NA 3FKRA 4ZO7A 5A8OA 4UTTA 2JK2A 4UTLA 3NG3A 1YDNA 1DWFM 2X40A 4MSSA 2IKJA 2B7QA 3VU2A 2DH2A 2POTA 4Q8MA 5I03A 4CQAA 4JPGA 1E15A 4AW7A 5D33A 3M7SA 4D1IA 3RMEA 3QOMA 4RDYA 2QDDA 1KRAC 2J8TA 3OBKA 1V03A 2QDHA 1X6LA 3VDCA 4MWAC 2GPTA 4C6JA 1R2TA 3SCUA 2GQ8A 4OV9A 3LHTA 2XG9A 1W0MA 4IIGA 5L9FA 3GFXA 3R43A 1V6YA 4JIIX 3B0UX 1M41A 3PTKA 4GISA 1AQMA 4NJGA 1PTAA 2NQ9A 3IK4A 5I09A 1TSIA 2NSXA 4IG2B 2XIQA 2BVYA 3HFTA 1MDLA 3ARWA 1CEOA 3ARTA 1YX1A 3GZAA 4HMNA 3DFHA 4HNOA 2WNZA 2OT0A 2O4QA 4IJCA 4ZOBA 2Q6ZA 2NZLA 2PDMA 2CZEA 5LIUX 4NZ4A 3M6DA 3LRMA 3L7RA 3HPSA 1ZB5A 2VEKA 1V0LA 2GFTA 2VC7A 2V63A 1OX4A 1SM9A 2EJ1A 1HG3A 3AFBA 3GUGA 3SCWA 2OYMA 4AEOA 1S2VA 4US6A 3WEMA 3K1GA 1CGTA 2BS9A 2Y70A 4MIMA 2AKZA 2WMFA 1FKWA 5K2ZA 2XUCA 4UZSA 5MF5A 1P43A 2F8QA 1TE6A 4QEEA 1XIMA 1I2QA 3ARZA 2FH8A 3WBAA 3WD3A 3W7HA 4GC4A 1ECQA 4Q7IA 1X6NA 4FX6M 2Y7FA 4K6AA 3EGJA 3QQ1A 4AWTA 1RBLA 3ABQA 1CYGA 1KKOA 3UG4A 1EO7A 1G6CA 1UZHA 1RQHA 2DIEA 5DCDA 2C71A 4ACYA 1X1OA 1W3HA 2GVGA 1OC6A 5BWAA 4UMCA 3WH7A 1M53A 3SGGA 1I6NA 1MFVA 1TTQA 1N7KA 3TDFA 1UMYA 3AZTA 4Y8FA 3T8QA 4QNWA 4QTGA 4JTQA 1ZLPA 5CBIA 4CD7A 5C7VA 4ORMA 5HMEA 1Q4NX 1C9DA 4BR1A 4M7TA 2A21A 1VYPX 2OU4A 1NWRA 1KR1A 1B57A 2BOGX 2V3EA 1A50A 2ZA3A 3CWHA 3TV8A 4C60A 3VM5A 1RCXB 1G4EA 2VFEA 3TTEA 1HKJA 4HOZA 5H8MA 3BLEA 3MVTA 3A12A 5CG7A 4FIRA 2IS7A 4PMDA 3BG9A 3ZR5A 3AU6A 3VGBA 2YDRA 4WR3A 3GIQA 1OZQA 3BCFA 3GB6A 3ZXWA 1QI0A 3OVPA 2ZRUA 1ISXA 2OR2A 3LG3A 4KETA 1UIPA 3H21A 4NF7A 1W54A 1X8CA 1KA9F 1SVDA 4IIFA 1IT7A 5IXEA 3NDZA 4P5UA 1F3TA 1ADOA 1CTNA 3JU2A 3L0KA 4KCWA 3U3HA 1SZGA 3LPOA 2H8ZA 2JALA 1G7VA 3VA8A 1W6TA 3E0VA 3RX4A 3WLSA 4O1DA 4JN8A 4LUYA 1YMYA 1GYNA 4AF0A 3IPWA 4GLEA 3UYCA 1SW3A 4J28A 3EX1A 4GXMA 4FX8A 1CGUA 3OOQA 3WDIA 4WK9A 1QUMA 4S3BA 1FCBA 3E49A 2ZIDA 2PRLA 3MP4A 4AVNA 5E0CA 1ADSA 5ABHA 5DCEA 5CLWA 1S3HA 3NPVA 5K9CA 2ZA1A 3IV8A 1JZ5A 4MUZA 3R0UA 1BRLB 3S6TA 1X98A 3GAYA 1RJQA 4AUBA 3VUPA 3GVGA 3TONA 1VCGA 1CXFA 4C6FA 1ZZMA 4NZCA 1F4AA 1QOXA 1XS2A 3M64A 2WPGA 3ALGA 1KBIA 2OWWA 3WQGA 1NAL1 4JEQA 1TJPA 1IQ8A 3HB9A 3TJIA 4H83A 3VILA 3TN6A 1EX5A 1J93A 2QCGA 4CN4A 2CW6A 5E93A 1E9ZB 2Y24A 3QGKC 3ZLFA 3ZO9A 4QLKA 3AXXA 2C15A 4ML4A 3G6MA 3S5NA 5LIWX 4KERA 2ZUUA 1Q2SA 5FSDC 3W7DA 1R7AA 1XYZA 4NJHA 5C9UA 3JUGA 1W9UA 1BSIA 1HKMA 3GRIA 3TYUA 3RN6A 1FUYA 3L21A 2AGTA 3DI0A 3PUGA 3W23A 3ORWA 3LENA 2ZDRA 3GTIA 1W8GA 1I75A 3NGFA 3S5ZA 3WG6A 1ELSA 1J9YA 4Z1AA 3WUGA 1ZTVA 4I9MA 3QV6A 1QI3A 2Z7GA 4WOZA 4X63A 4FEZA 3BJSA 3CUHA 2OEJA 5PTDA 3W7JA 3FKKA 1UUOA 4CQ8A 1JCNA 1EUAA 1JI1A 1ISWA 1YNPA 4PMUA 3OU8A 1EL3A 3ZWTA 2BY0A 1CGXA 1JDEA 4QG8A 4DZIA 3M4HA 1VPYA 3DEQA 1XRFA 1YPFA 2BB0A 2R91A 2UWFA 8CGTA 3AUOA 2VX6A 5C70A 4HOWA 1R87A 4AHQA 2Z25A 4W8AA 4DZHA 3UWVA 1YXCA 3HIJA 2YZ5A 1ZBVA 2IPFA 1V3MA 3TSDA 2QVHA 2V5KA 3BV4A 4HA0A 3WJZA 3GHTA 3P67A 3VIIA 2YA1A 4YVVA 1S5TA 4M19A 4ZZ9A 1FFRA 1A4MA 3QZEA 3GX9A 3EXSA 4C5YA 4WKAA 4HCHA 1VR6A 2GGHA 1T99A 2DZPA 5IFPA 3L12A 4D9PA 5I06A 4J3VA 1M7PA 1XL9A 4HYRA 4I9TA 4JFTA 3SAZA 1UWRA 4MDOA 4DJFD 4JIHA 4PBFA 4NT0A 4NZ3A 1EGZA 1PWMA 2DIKA 3BLKA 4F0RA 1WDQA 2AKMA 1CXIA 5HPOA 2NUXA 1JZ8A 3PP7A 3THUA 1CT5A 4AYSA 5I77A 1W32A 3UA3A 1H1NA 1JPMA 3OA3A 3BICA 4GNKB 3W2UA 4GUHA 3UY7A 2PFHA 5B7YA 1KM6A 2WCAA 4PUEA 2CBUA 1QBBA 4HNVA 3RNDA 1V3KA 1ZUAX 4U4MA 2JGQA 4C1KA 3DCPA 2VR5A 2XIIA 3NQFA 4IMGA 4L4MA 5EMJA 2H6RA 4LH8A 1W8SA 3REQB 4PUUA 4AY8A 2NSOA 2E68A 3BAWA 3V0UA 5J5RA 5A3HA 1MNSA 2I56A 3P60A 1FWFC 3GW0A 1VHNA 3VZZA 3U2EA 4LEFA 4QAWA 2TPSA 3STEA 3W9ZA 3SRFA 1X7IA 1TR9A 2FZBA 3DI1A 2ZFAA 3UXDA 1F07A 1WZAA 4AIBA 2FHCA 2YDAA 1K9TA 1MSSA 4NHVA 4L80A 3V5OA 5HPCA 3VMNA 2Q02A 3E96A 2ACSA 2C79A 2QGYA 4P7RA 4U2ZA 3UYIA 1H62A 1FTXA 1ONRA 2O9RA 1DXIA 3I6EA 2ZWZA 2QCNA 3CTLA 4GI8A 2HNEA 2C1IA 2GQAA 5FF7A 2YIHA 1GZ1A 1OZMA 3BLIA 4JTAA 4XO6A 3IVTA 3W7QA 1BXNA 4N9DA 4A8RA 1F5ZA 2P0OA 1R86A 4X60A 3VKKA 3AICA 1FA2A 3GVQA 1H41A 3H24A 2IMRA 3PJUA 3CEUA 2OKTA 2FZ8A 3A3XA 2YFNA 1GK8A 5C0QA 1TRDA 2WMGA 4R27A 5AHNA 2A3HA 1R3SA 3P80A 1TG7A 3GK0A 4YCOA 3GC4A 1XGEA 3FJ6A 2P3ZA 3GU2A 1BKSA 1GTHA 3FGCB 2WBKA 3N15A 3FJLA 1XH0A 1SFJA 3A23A 3IUIA 4Z2IA 1PX3A 4AVOA 1OCBA 4F0KA 5LNRA 5F1VA 4RE0A 3CIVA 3FEMA 5H8PA 1FP8A 2YBUA 3IVSA 3MYOA 1Z8AA 3AAMA 4G7FA 4UQBA 5FJPA 4UR7A 2C6QA 5F2IA 4IOTA 1P0BA 4TX6A 4WKFA 2NQ5A 1Y65A 2ANUA 2NVCA 3EOSA 1OFEA 3PBGA 2WCSA 1XDLA 3N6QA 3ERPA 2YX0A 2CHRA 1J2WA 4H8HA 4O1CA 5C8BB 1UKPA 3LERA 1YBQA 3DGRA 3GZ3A 5FJJA 3BXWA 1XD0A 7TAAA 1J18A 3NDYA 3NQ7A 2OKOA 4OUIA 3MCOA 3A3HA 2ZXDA 2DT2A 2FB2A 1AG1O 4HYWA 5TD4A 5D03A 1UCWA 4W7WA 1XBXA 5F2LA 3ITYA 5E0FA 2JKEA 4O0QA 4O57A 3BTNA 1VFMA 3KCOA 3THDA 4CU6A 2QUVA 3FDKA 3PSVA 3A47A 1OFDA 1VPXA 4PTDA 2E3ZA 2GJXA 2UV8G 2NX9A 4ZVJA 2OFJA 4Z2LA 5BMWA 4REQB 1XLGA 3GY1A 1CX9A 5LIXX 2I14A 2NT1A 3P7YA 3TQPA 2WVSA 4DM1A 1RD5A 1V0NA 2R1MA 3TAOA 2FH6A 2PS2A 2YCKX 1WAWA 4JZ5A 1C8YA 3CHEA 2QF7A 2BNJA 1EHNA 5LSMA 4AB4A 3EWUA 1PWLA 1OFOA 2X1IA 1X97A 3QV9A 3GAKA 2WMHA 1IXOA 3A4JA 4DJEA 1Q2RA 4JD4A 1BG9A 3KL3A 4F2TA 1B30A 4UCGA 2PAJA 4PEEA 4KPLA 1AODA 3P0WA 2G3FA 3N2MA 4B5XA 3KDOA 3KOZA 4LAMA 1OD0A 2VC9A 4AEFA 1JF5A 1TWIA 4PMXA 1M03A 3SJ3A 1H3GA 3NO5A 4OOZA 1ZAJA 3T4WA 3T81A 4MM1A 3QW4B 3GXFA 5SWUA 5FESA 2CNCA 2BX7A 2ZRWA 5I3JA 3AHTA 1WE5A 3WQ5A 2V5CA 5C9XA 3VMOA 1OT1A 1UBSA 3GDRA 2ALRA 5JQ9A 4PYSA 4TOQA 3CV2A 2EQDA 1I2RA 5G4HC 1Q65A 3UVIA 3O6DA 4J5NA 2FVMA 2I1OA 5ABFA 3TOPA 1YEYA 3WEZA 3WIJA 4FHAA 4DXVA 3UXIA 5GJMA 2DZUA 3GTXA 3P2VA 4EOUA 3TJLA 3DAQA 2HE8A 4I90A 4QCEA 4Y9NA 4BF5A 1V77A 3WBYA 3DECA 4N6EA 3WEOA 4YXGA 3NGJA 1M3UA 2VC6A 3TFXA 2ZBTA 2ZOXA 2D1ZA 4O4VA 1IXQA 2PB1A 1VFLA 4N9BA 5HNNA 2OYKA 2QVNA 1ZCCA 2V67A 2ZXBA 4TVDA 5KTLA 6ENLA 4UQDA 3E1F1 3VABA 1EDGA 3SBFA 3TYDA 1KV5A 2QZRA 3PG9A 5FA5A 3QHMA 3GC2A 4AAJA 2PTYA 3R12A 3CAKA 2CLLA 2WSRA 5FEXA 3QC0A 4A8LA 4ZFCA 1KXTA 1F74A 4NAFB 1KFLA 3ABOA 3OQEA 3ZT5A 4CGTA 3UPBA 4JQ2A 1K3UA 4RUBA 3H7RA 5I2UA 2DT0A 2O9TA 3HPZA 1KD0A 1UC4A 1FWGC 1PHQA 3ARVA 3KZSA 4QRNA 3CHDA 1VZWA 1OABA 3RUBL 3LZ3A 3R4IA 4DBUA 1UB3A 2E9BA 3XIMA 1K77A 2CHNA 4US5D 1H50A 3DDMA 2WJEA 5FL1A 1TV4A 3WBXA 5DXYA 4C65A 1S1PA 4NNCA 1A5LC 2R1NA 1P7TB 4NYUA 4PUMA 2DVXA 4GUGA 4F48A 2J79A 2V5JA 1O5KA 1OM0A 5KZEA 4ZR8A 3U48A 3G6LA 1JGIA 2NT0A 3TOYA 1IZCA 1VD6A 3GNOA 4PTVA 4CCDA 5AHFA 2CXGA 1BWVA 4GPNA 2QUMA 1OFBA 4IFKA 2VGIA 4UQ9A 1AVAA 3H8AA 1H2JA 2HVMA 4UTMA 2IUZA 1DV7A 1S5VA 3G8EA 2PDLA 2E5BA 3AO0A 1CGWA 5M1TA 4YHEA 2A85A 3VE9A 1W3TA 3NSNA 3MCNA 2VD8A 4PUKA 3WH6A 2BOEX 2RDXA 1HIZA 5K9XA 4WDTA 4H00A 2J24A 3WD0A 4ATWA 5A6BA 3MKCA 2E6FA 3SCOA 3PG8A 4P8WA 3W07A 2V2CA 3CAQA 3CAWA 4CQ9A 3CLWA 4ZL1A 1E4MM 2Y2WA 2A4AA 2RGLA 1AMKA 4LX4A 4MVAA 1F6YA 3C86A 3ABSA 3UNDA 2XFRA 2PRMA 4CKQA 4RJEA 1VEPA 1REQA 5DELA 2PWVA 1YHTA 3PULA 3ITCA 5RUBA 3WK2A 2B7PA 4DLMA 3N18A 4NX0A 1E1EA 2J4GA 4FF5A 3WQPA 1GKPA 3QR0A 3T05A 1E6ZA 3H54A 4O12A 3WNLA 2YJQA 3BGJA 3P0XA 4IPNB 4JX6A 2Z4GA 5A6AA 4CD4A 2WBGA 1MRQA 1RV8A 2XM2A 2GZXA 3VDAA 2Z1BA 2MUCA 2ZX7A 2FPVA 3EDDA 5G1YA 3HO8A 4J2PA 4PUJA 3R89A 4ZXLA 3CV7A 1ZP4A 4DF0A 1GYMA 1B90A 1ZJAA 3B04A 1R85A 3DHFA 4GKLA 3EDEA 4HA4A 3WF2A 4GMEA 1BTCA 1IYXA 1NIUA 2YPIA 3U5YA 4OFCA 4QX4A 3H2OA 2NVDA 4ADTA 4OTKA 2AQWA 3W1NA 1AUSL 4CCZA 5AOUA 3TIMA 1DHPA 3UXLA 1VP5A 3PBUA 3WLOA 2R14A 3BZGA 1PZ2A 1DHKA 4JY8A 1XICA 5DX7A 3UQNA 3MI3A 4I5RA 3IGHX 4AFYA 3W75A 3FK4A 4LRTA 4YTTA 3B3DA 2DGAA 1G4SA 1PTDA 2QUTA 3W26A 1GOMA 4XUYA 5I07A 3WJWA 3VIKA 2D22A 4LY8A 5CG0A 1R3VA 2QV5A 3OG3A 2B7OA 2P88A 1D8WA 1W17A 5LNVA 4KWWA 5FIPA 2Z28A 3DC8A 1EZ2A 3BLOA 3DYMA 4JIEA 1P6WA 5FEZA 3QV8A 2GSHA 3RJXA 3GFYA 7REQB 5EYWA 2Y0FA 1LBLA 3PPCA 2YDQA 3MPGA 4ALDA 4QIUA 1O6IA 3O07A 3L4WA 2JGYA 1VYSX 3UBPC 2DZVA 3VOCA 3AMLA 1UWSA 1UD4A 4YS1A 4QE4A 3KHDA 2D3NA 1Q7ZA 3CH9A 4D6GA 3OTRA 5D09A 3EX6A 4A35A 2YL8A 3KW3A 2WM0A 5G2WA 3U2CA 3I6TA 3GW3A 1E0WA 3M41A 1W1TA 3SQLA 3TTOA 2O7SA 1TV7A 1U5HA 4RPPA 3P81A 3RLVA 1PKLA 1MUCA 2YCIX 1LL7A 2CEQA 3UR7A 2PI6A 2Y62A 3M0YA 2WHLA 4O1EA 1V93A 4A3RA 2YB4A 1KM2A 1S2AA 3PUDA 3NZQA 4HU3A 1BGGA 2R1KA 2FPYA 4F40A 1KM1A 3NIYA 5D37A 1DVJA 3LTYA 1YTEA 3W1AA 2IXVA 1W9XA 2V5LA 2YXGA 4FX7A 3QW3A 1UKSA 3I4EA 3HPAA 3T6CA 3DG3A 1A0DA 3NQDA 1QOQA 3GFZA 4HMDA 1B9BA 4D71A 3E0WA 1Z3NA 1NDYA 4A4AA 4E8GA 2J27A 1DJIA 2O9OA 4CNSA 2XYLA 5A2BA 4GZ7A 1XRVA 3GDBA 2W27A 3BO9A 5IOBA 3QMRA 4FXJA 3VE7A 1H1YA 1KBKA 4LT9A 2OB3A 1UR2A 1SJCA 1O95A 3RAOA 4D6CA 3H2NA 1V6VA 5BYWA 1U22A 2W62A 4MF4A 1A5CA 3C2VA 2Y7DA 3MHFA 3LCXA 3S8HA 4ERIA 5DT5A 2QCLA 5BMXA 2G4FA 2DEPA 3EEZA 3S9IA 4Z0JA 4XBKA 2I5IA 1LRTA 2QPSA 2G8ZA 1Z42A 2Z1XA 4B16A 1BLIA 3ATYA 2A1YA 4HT3A 4O0ZA 3GTHA 1ZL1A 1H5YA 3LCIA 4XX6A 2FLIA 4NIRA 3IWPA 3DIPA 4Q4MA 3KAOA 1UR8A 2TMDA 3QEZA 7ENLA 9XIAA 2ADAA 4LS2A 3CQJA 4PSRA 5LYRA 1KGWA 2P0IA 1ISYA 4Q8OA 1AA1B 3T4CA 4O1BA 4DNMA 1IT8A 1PCWA 4GXPA 3STPA 2Y8UA 5AYXA 5AC8A 1QO5A 2A3BA 5D2VA 1P4CA 4RXFA 1OF6A 1AW5A 4DUWA 4MB4A 5K9DA 2ZZ7A 3CIXA 5BNKA 4URIA 3EMQA 3R7MA 1SU5A 3PZGA 3ARPA 1SYTA 1XKJA 1SO5A 4NU7A 3UFYA 3RITA 3MUXA 4CQBA 4TTGA 2IW0A 3BMXA 1PJ9A 4E4FA 3BV7A 4M1BA 2XISA 3M9YA 4QCFA 1VRDA 5BCAA 1GQKA 3G5EA 1KM3A 3ID7A 1CENA 1Q6RA 4GX8A 3O3RA 1RXOB 2PE4A 1KXVA 5CZ0A 2XZ9A 1POJA 4L61A 5J8LA 3AYRA 4V33A 1V3LA 5T8GA 2CLFA 3G1HA 5AZ0A 4DYEA 4I8DA 4LALA 2WANA 3EX4A 2W67A 1XYBA 4ZMGA 1R3RA 5TF0A 1KTCA 4XSMA 3N9RA 1GZJA 3WBEA 4BI5A 2Z1VA 5TAOA 4M5PA 3T08A 3DFSA 1XP3A 4LB3A 2TAAA 2Q3OA 3P5YA 3V3WA 1TKKA 3KRUA 3NZ1A 2H8XA 4GACA 1CWYA 4PB3A 1Z9AA 2YW4A 4FLQA 1WOBA 3CC1A 4PCTA 1WDPA 4D6FA 2J8GA 2G95A 3I4KA 5AHEA 4Z2HA 3NYDA 5LXEA 5IDIA 4WCJA 2GGEA 3MUAA 4H4IA 3SGZA 2BXZA 4PUWA 3SR7A 5A5WA 1E9LA 5H91A 1E4IA 2OLAA 3QYQA 1QNOA 4GIRA 3TXVA 1LQAA 2GJNA 1J5SA 1JCXA 4D6DA 2V3FA 1AW2A 3A24A 1U1JA 3UWYA 3NPXA 2ZE3A 1R2RA 3S2MA 4B3KA 1JNDA 1B0IA 2PWGA 1MEIA 1F9CA 2QPXA 2OQLA 2Y88A 4O13A 3WENA 3TFCA 2ZVRA 1EUNA 2P1FA 3CL6A 2BHZA 3NQVA 5A2CA 1HP4A 3LBCA 5HUOA 2J7FA 1ZSXA 4BQ3A 1ME9A 4HQVA 5AYBA 4MKVA 5DRCA 1J0YA 2WVUA 1E0TA 4JY9A 3G0XA 1V3JA 4C6MA 3AIBA 4HU8A 4LU0A 1VEOA 3MMTA 1LQ0A 3MP3A 1J11A 1S3TC 1SMDA 3E12A 2X1TA 3TN4A 2VCAA 3BOLA 5D9OA 3GKFA 3TZFA 5BZAA 3IANA 4YYCA 4IL0A 3NO3A 2YL9A 1EOKA 3WD1A 3RDKA 4MWAD 3RPDA 1TX2A 4DUOA 3NDOA 1UUMA 4NJKA 2RDUA 4Q7BA 3DBPA 1KLYA 1GKQA 1PKNA 5BW6A 3W6YA 2ZE0A 2E7FA 1VBJA 3SECA 3TZNA 3TYBA 5G1TA 2UY3A 2IQTA 1V6XA 1TE1A 5I5RA 4JQAA 4QGCA 3HU7A 3GG7A 4EP8C 3ITXA 3URNA 3ZSTA 1L0PA 2VMFA 3ZR4A 2FZNA 4KCVA 4D1JA 1XIHA 1ISVA 1GJPA 3RFAA 2DW6A 5FI8A 3TYCA 1SO4A 1QMLA 4S39A 2EBNA 2DJXA 2Y5SA 3WQEA 1I45A 2FTWA 2R1LA 4UOJA 2QCFA 5AYZA 3II1A 5KEZA 1IE7C 2WZEA 4UNLA 4M6UA 5CSRA 5HOSA 1VEMA 4U10A 4RNHA 4BFAA 1HUVA 2G5WA 4NQ1A 1EWDA 6A3HA 1AL8A 1ZJBA 3PZ9A 3PAOA 5CC5A 3FN9A 3GG8A 4N7QA 3NQGA 1NM9A 2V68A 3FX4A 1SFTA 2PDGA 3F4VA 4PEKA 4LNYA 3TMLA 4DAFA 3TQ0A 5F4WA 2EPKX 3OA5A 1XQLA 2VZOA 3F7JA 3DFOA 2E6DA 4IISA 1JJKA 2AQOA 1LLZA 4N4QA 1V08A 2FFIA 4L56A 1W37A 2MNRA 3CHVA 2ZUMA 2ESCA 4H41A 1QXLA 3RRXA 5LKYA 1NWTA 3QHNA 1W1VA 5DY3A 4DJFC 1UR4A 4JHZA 3GHUA 3OBAA 5D2TA 4GA8A 4W93A 1BF2A 1Q3NA 3G22A 3L0GA 4QDPA 4XAZA 2EPNA 1IEIA 2G41A 1LOQA 4HPXA 4PMRA 1Q5MA 4B90A 1OCQA 4RR4A 4DBSA 1X7FA 3AHVA 4DPPA 1A3XA 4N0RA 4R53A 4ZOAA 3LGGA 2ISWA 2X0HA 2XVPA 2DSUA 3ZT6A 5LHFA 1W1PA 5E0KA 3GIYA 1S5WA 4K8GA 3QR3A 5A94A 6XIMA 1BGAA 1XIJA 3KS5A 4IP4A 2XN2A 3BJTA 5DMMA 3W7GA 4E2BA 3T9PA 3W1XA 3TR2A 1Y8BA 2G3IA 3SO7A 1QO2A 4A3YA 3L4YA 1XC4A 5D2YA 1NWSA 3ES8A 2AOSA 4DWSC 1WKEA 1GW9A 4HNCA 1RPKA 1YXYA 3WH5A 2XIOA 3T2PA 3OO2A 3IJIA 1JR1A 2AL1A 2Z7KA 3DESA 1MZHA 4PCFA 2VEIA 3LU2A 4QP0A 3W1MA 1UHVA 2OOFA 1XPYA 1UQYA 2IKHA 3WLIA 3M16A 5DXXA 3CH0A 1EHAA 5G5IA 1W1B1 3OGRA 6ALDA 1UA3A 4F0HA 4XAPA 1E56A 1NU5A 3SUVA 1OGBA 2C7FA 2DUXA 2YR1A 4LVBA 1TPWA 1UWQA 1EPVA 4RW5A 2PU1A 3O0FA 3ZS4A 1RPXA 3WH8A 1QI5A 1MQQA 4Z2JA 1FOBA 4GYKA 3U8GA 3KE0A 4WQ6A 4DF2A 3G1AA 2C13A 1L2QA 1K03A 1HTIA 2PDCA 2BASA 4A3QA 2ZUNA 3WL0A 1X1ZA 3MTWA 1I4NA 3MHUA 1NTHA 1PZ0A 1DL3A 3CQIA 2VP8A 1C3FA 1WZMA 3E38A 3GDMA 4AYGA 3B8UA 2C91A 3M7WA 4Q4KA 3SGUA 4F0SA 1HKKA 3WUFA 4NP7A 2J47A 3CHCA 1HQTA 3AALA 4IG2A 2HTMA 2BMBA 2ZVIA 1SO6A 5C54A 2PODA 1FBAA 1GVEA 4PBGA 3JR2A 4D6HA 2FFCA 1P0EA 3CMJA 3O06A 3QPZA 3BLDA 1TWZA 3SCVA 2HXTA 1Y5VA 2E8ZA 1E4NA 3BOXA 3GXMA 1LOSA 3H12A 4XAYA 4RE2A 1PS9A 3RR4A 1FCUA 3FSTA 1JGMA 1OADA 3L2IA 2PWHA 5E5CA 4KT2A 1LDCA 3IIPA 3LB0A 3L66A 1BYAA 2QCDA 4QITA 4CUCA 4UTIA 4X61A 3LD5A 4MMWA 4YJ5A 3TAKA 4ADUA 4WSKA 2ISFA 3IGSA 1XR2A 2QNEA 4UTUA 4R3UA 5C2XA 4A3UA 3KBNA 1PV8A 4MWAB 1VCVA 2YXXA 1D3GA 2B0MA 2A2IA 3SRDA 1IWPA 3TQKA 1QPKA 1ITUA 2ALDA 3WNKA 4PSPA 1EQCA 2R24A 3OZPA 3A9BA 2WQPA 1UQZA 5H2ZA 3ANVA 4L5ZA 2DPEA 1AH0A 4PUNA 1A5MC 4H7VA 3GTFA 4PMNA 3C0JA 3EEGA 3H2AA 3IVUA 4DBDA 4GIEA 4XG1A 5G2HA 4EF9A 1FQ0A 3IJQA 1J79A 3NAVA 4IX2A 3TROA 1RH9A 1KBBA 3KVLA 5HXMA 2B81A 1WBJA 2WCGA 1XLKA 4Z1YA 8A3HA 4QE1A 1MW0A 4LAKA 1QPOA 3B8WA 2CKSA 1TR1A 1ZS2A 4JTHA 2ZWYA 4AC1X 4RL3A 4W9TA 5U7SA 3ALFA 2PPGA 2INFA 3QSTA 3RPMA 1TVPA 4TV6A 4JQ4A 3UG8A 4GH1A 2J7CA 1GT8A 4CNOA 1FWCC 2XJ7A 5HJYA 4C1LA 1JG9A 5JIPA 3EKZA 4H9MA 3NVTA 3FYYA 3LPGA 3W2MA 1QATA 4IPIA 3TE9A 2GOKA 3ITTA 1ALDA 4ZQRA 3PZMA 3WDJA 3PK7A 3B8SA 1UKTA 4IIBA 1VFHA 1PPIA 2NXGA 5HBFA 3PPFA 3KX6A 1AJ0A 1U33A 4P7OA 4GXWA 1E40A 5HDRA 4C6LA 4OKDA 4RPQA 3CT2A 4ZA0A 3GUWA 4MNLA 3EYPA 2P50A 1OC5A 1R30A 2GYIA 1A5BA 3TJ4A 3O6YX 4XIAA 4JCLA 3NPUA 2J66A 2OEKA 3AMDA 2FJKA 3PC0A 2ZQ0A 1J6PA 4JAWA 4BF9A 2QW5A 4LVAA 3WLMA 1QW7A 2DSVA 4PCNA 3G3MA 3VOJA 1KFEA 4JNYA 4ENLA 3RCMA 4A6GA 1UD2A 2BOFX 1J0JA 4AWSA 2DQWA 1JAKA 5KITA 1KFCA 3KRSA 5BOOA 4UC5A 4LJ3A 3M1ZA 4B2DD 3FS2A 4YPJA 1BSLA 3WK1A 1RP9A 2D2OA 4R34A 3MMUA 1RK6A 1PZ1A 1GOQA 1QNQA 5F4XA 5CZJA 2NX1A 2XPKA 1I0DA 1HX0A 4LS0A 4MAVA 1IXPA 5CC3A 4GE8A 4OZOA 4H19A 3PBVA 5FKYA 1OBAA 3CHFA 4LEQA 5CGMA 1BVWA 2V8ZA 1XLDA 4NRSA 3HA1A 5A8GA 1RBOB 2J25A 3GDLA 1A3HA 1KFJA 3GVRA 3POCA 1W3JA 1Q6GA 3M44A 3CQ0A 1ODZA 3RM8A 4CCCA 1JUKA 1O12A 5DEZA 1PIGA 3E0FA 3CEPA 4Q8UA 5DQPA 4ZB2A 1TTJA 4JKKA 2PZNA 2UBPC 1H7OA 3VVGA 5HAOA 3TUUA 5HK4A 1ESWA 2A5HA 4IFRA 2XDFA 2PDWA 3CMFA 3AI0A 2JEQA 1XM3A 3GU9A 1DXFA 2DV0A 2BTMA 4IIHA 2EPHA 4EXBA 2V0TA 4FS9A 4CCEA 1HP5A 4OBRA 4AZCA 2ZZ1A 3B9EA