3RLUA

Crystal structure of the mutant k82a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEAICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rluA00
1LOLA 3T78A 1DQWA 5ABTA 1FCBA 3W7HA 3FKRA 3HQ1A 1EP1A 3NQ2A 1TPUA 3M5YA 4FNSA 3G1YA 1KA9F 5EPDA 4LY8A 3IIOA 3TXVA 3UY7A 1ZAIA 3P84A 2VC6A 5LNVA 4X22A 4MZ8A 2CLEA 4IXHA 2Y63A 3QM3A 1EPXA 1ME9A 3TQ0A 3U8GA 3SR7A 1B57A 4O11A 3EWYA 4UMCA 3W87A 3BVJA 3O6DA 4NJKA 4IQLA 2C6QA 5FI8A 5IM51 3RLVA 5LNWA 3MW7A 3LTYA 5EA9A 1P5BA 4AXKA 1H7RA 4MY9A 1M7OA 2A0NA 1DQXA 3PG8A 1HFBA 2VEIA 3UWVA 5D2VA 3NDOA 4LOCA 2J88A 2VFFA 1TPEA 4JDYA 5D37A 5LKYA 4LS1A 3UWYA 2A2IA 4UR7A 3P61A 4FNUA 3SY5A 2VEPA 3LTSA 3A24A 3GR8A 2X1TA 4RV8A 3LOTA 3LHYA 1SSGA 2UV8G 3G1DA 1OHLA 2EPHA 1HG3A 2QUVA 3Q58A 4MZ1A 4JTEA 5DXYA 3OHIA 4NJHA 4HN4A 2CU0A 3M47A 3WK0A 4LW7A 5AYYA 3C2OA 2QUTA 4MYAA 4HT3A 1A5AA 3W76A 1PVNA 3LRLA 3W7RA 1D9EA 1LBFA 3QZEA 4K6AA 4GBUA 3GDKA 4J9JA 5CPMA 4NX0A 3MHFA 5A8GA 3W74A 4RR4A 3NPVA 5HQEA 5H91A 3KVLA 1O5XA 4TIMA 1JVNA 4QNEA 4EIVA 4JTUA 3G1XA 3W7DA 5LHFA 3G8RA 3E96A 4UTJA 4C1LA 5AHLA 4NJJA 4Y9AA 4JTIA 4XQ6A 2QKFA 4A21A 2JKAA 3B0PA 5AFDA 1WBJA 3EX2A 1TMHA 1XBZA 4UFHA 1H60A 1A50A 3UQNA 2YYUA 1QAPA 4ZQOA 3KVJA 1ZY9A 1XDMA 1ZALA 3NQGA 3R13A 3B0UX 4JTSA 3W7KA 3IV3A 2CW6A 3H54A 3M41A 3GVGA 3UD6A 3CM4A 3S9YA 3I65A 5K2ZA 1GG0A 1TJRA 2XFWA 2ZZ2A 2GVGA 2CZEA 4NNAA 4LTSA 3BG5A 5DY3A 3OVPA 3P62A 1W54A 3LCFA 4NT0A 1WOBA 4O4WA 1SUXA 2Y88A 3TQVA 2VEKA 2H8ZA 4LVDA 5C5YA 3DFQA 1VJIA 3HOJA 1KV5A 3PBWA 3TSMA 1LYXA 1YXDA 3GIYA 4MZYA 1TRDA 1OYAA 3W2JA 3PUOA 1F2JA 1GG1A 1OFDA 3LV5A 5GVJA 3NL2A 3W9ZA 1J5TA 1O5KA 1JQVA 3H55A 1WX0A 5AYZA 1UB3A 3CPRA 4Y8FA 1JRCA 3FA5A 4A22A 1C9DA 4NJGA 4DBEA 4BWLA 3QQ0A 4JIQA 4K7VA 3S1VA 3S1WA 3HIJA 4Y96A 4YLWA 1G69A 4IPIA 3DH7A 3W7EA 3FS2A 1Z48A 1O94A 2ZYFA 4NX5A 1AK5A 1NSJA 4A3UA 1GOXA 4ORMA 5LGXA 1SO5A 1GTEA 3FLUA 1ML1A 1TV5A 4JTFA 1VZWA 3B03A 2B7OA 2HMCA 5BNKA 3ABOA 1HTIA 1KFEA 3W70A 3D0CA 4RZ6A 3CIXA 4L4MA 1IXPA 5C55A 4G1KA 3TC6A 2QAFA 1JR1A 2YZRA 1L9WA 2ABBA 3O63A 4POCA 4UFIA 1FXQA 3BW2A 5E93A 4AEOA 2TYSA 1RV8A 2RDUA 4O1DA 2B4GA 1F74A 3INPA 3UPBA 3W7GA 1PHQA 4QJ1A 2JKPA 2NUWA 3TX9A 1MSSA 4NQ1A 3HGRA 2NXIA 4WZHA 1KM2A 4UCGA 3BW4A 4QM1A 5BOOA 4RXGA 3GYEA 1W5NA 1EUNA 3L65A 3M0ZA 2ZRZA 1WV2A 3QC3A 1LRQA 2PRHA 5D30A 5HULA 2A21A 1MO0A 1Q6QA 3NQMA 4DQWA 3EWZA 3T4CA 1LBLA 4CCCA 4MIMA 4O1BA 4Q32A 5D09A 1Y0EA 3RK8A 3LGEA 4IMEA 1VC4A 2VEMA 3HG4A 1SQ7A 2O7SA 1SO6A 3O8AA 1HO1A 1DJQA 1TPWA 3A5VA 5D2YA 3TC7A 3UWQA 5CGQA 1H5YA 4DF1A 3PBYA 4XBKA 3S6DA 4LV4A 1ZAHA 3UZJA 2Z2UA 3W7LA 4LWWA 4GC4A 1JQXA 2DZSA 2QCDB 2EHHA 3W7NA 4PCFA 1XI3A 3BO9A 5U7SA 1R2SA 5EL1A 4MOZA 3GDLA 2ALDA 3W1QA 1OFRA 3NXFA 1DJNA 1DKWA 4FX6M 3S1UA 3NEVA 2IQTA 4WOZA 2OT0A 3I68A 4DO5A 3NQVA 3GKAA 4UTHA 1F73A 3YPIA 3P8JA 3NO5A 2Y62A 1DHPA 4QIUA 3WJXA 3I7RA 4IMGA 3GXNA 4FXRA 1ME8A 1KM0A 1L6WA 5EBUA 3TUUA 1YADA 4LVGA 2ZFAA 3THQA 3A23A 1J4EA 2WQPA 4Y90A 5HR7A 3LHUA 4QAIA 2VFDA 4R7JA 2PRLA 3TAOA 3ABSA 3W2UA 3BK0A 3G1AA 1FY6A 2C16A 2V5LA 4RCXA 2I14A 3F1QA 3C2FA 1G4PA 1QPRA 1W56A 4HNNA 2FLIA 4HSNA 3OG3A 2G95A 2A7NA 1KBJA 5CPNA 2R8WA 3PWAA 5AC7A 1VCVA 2RH9A 3WJWA 4WY0B 1NF7A 3NPWA 1KFBA 3LBCA 3HG2A 2X1SA 3IIVA 3OVRA 1VYSX 2VOMA 2NUYA 2DZXA 5HUPA 4MJMA 1H51A 2VFEA 4IJBA 1IXNA 3QMTA 5C2XA 4ML9A 3HPXA 1V7YA 1F76A 2V30A 3T55A 4MY1A 3K30A 2C0AA 3QW3A 2ZRWA 4FX7A 3W7OA 1R46A 1K8YA 2HS6A 1FUYA 2WNQA 1F6KA 4N02A 4WOQA 3RMJA 5HWJA 3GZ3A 2KZHA 1Q6LA 3NVTA 3LCWA 2J6XA 4UFMA 3Q37A 1L6YA 3JS3A 4MLRA 3NQCA 5BW6A 1ADOA 1WYIA 3LTPA 4D2JA 1YYAA 5LNUA 3LXBA 1B4EA 2V0TA 5DXXA 3TFCA 2G5WA 2X16A 5G4EA 4BF9A 2R14A 4FIQA 3TDFA 1O95A 3P5ZA 3DBPA 4GFSA 2YPIA 2V2CA 3NA8A 4JXCA 2QJHA 1M7PA 1UCWA 1LRTA 3EX1A 3PR2A 4QISA 4YXGA 1GVRA 3STGA 1SZNA 3G3MA 1UUOA 4LV9A 2ZZ5A 3P81A 2RFGA 1EIXA 1WOAA 1ICSA 2FIQA 2VENA 1JCMP 2I9EA 4DO4A 3KFTA 4EF9A 5G2WA 2JKEA 3MYOA 1I2NA 5D05A 3G1HA 2GQ9A 2WPBA 1G67A 4Z0SA 5CPOA 1TPVA 4UTWC 4EF8A 1FWRA 1YPIA 1ZFJA 4BFAA 4X9SA 3QF0A 2A5HA 4JTGA 2DZUA 3HGJA 3S5YA 1M6JA 3MO7A 4EVZA 2VFHA 3MI3A 4MVAA 5KINA 1S5TA 1H1YA 3MHUA 1RVGA 3BLIA 2C19A 2C14A 3WK2A 1OFEA 5AC8A 2Y85A 4O17A 3PUEA 1W5OA 4IOTA 4ZZ9A 1DBTA 1A53A 3L68A 1LZOA 1MZHA 2XN1A 2DZWA 2Q8ZA 3PVFA 4YL2A 2J9ZA 2J9XA 3TAKA 2DZPA 5H2ZA 2X2GA 2CLLA 5F4XA 1HO4A 2ZZ7A 4UTKA 1UASA 4KWWA 2QDHA 4FHAA 5E0KA 3EEGA 1FWNA 1TV7A 4OV9A 1S5WA 1T0OA 1VYRA 3A5FA 3O07A 1AW1A 1FWTA 2DU2A 4FEZA 3L0GA 1VLWA 4RZ5A 1PE1A 1Q45A 3HF3A 4E0CA 2PURA 1EUAA 1QMLA 3M5VA 4H4IA 3P60A 3GKFA 3NG3A 1FQ0A 4WY0A 1LTDA 4JYDA 1CX9A 3CHVA 1G7UA 4UTMA 1IXOA 1L2UA 4N9BA 4N4QA 4S2CA 1OVDA 4JD4A 3W1XA 3SSJA 1GVSA 2AGKA 2JGYA 2PC4A 3UXAA 3ZWSA 1DVJA 1EA0A 1KM6A 3G18A 5FESA 4CCEA 3LI1A 5HR6A 5HJLA 5MHBA 1PV8A 3CIWA 5I3HA 1SZEA 1ONRA 3W73A 1B3OA 1QDSA 4OT7A 4OGZA 3BGJA 1EB3A 4NZFA 3NYZA 3QMRA 3W75A 1OFQA 3PBUA 4AWUA 3DKJA 3OBKA 1EX5A 1FXPA 2Y7GA 3GDMA 4K8HA 3PAJA 3I7SA 4NNCA 2R91A 3GDRA 3NPXA 5AOUA 3NAVA 3W72A 3QJAA 3GDTA 4MLJA 2OT1A 3L5LA 1H7PA 3ELFA 3TJLA 1GEQA 3NQEA 1KM5A 1OFAA 3MJYA 4JX5A 2QAPA 3PM6A 3TA6A 4FNTA 1TPDA 3GK0A 3VE7A 2E6DA 4MFEA 3IIZA 1JCNA 4JGDA 4YCOA 1TTQA 1N8FA 1OF8A 4AHOA 2GQ8A 2FFCA 5E1QA 3TE9A 1QOQA 4JDBA 1UBSA 1YTKA 1X7FA 3STFA 4MKNA 1W5PA 2YSWA 5DBUA 3NQ6A 1JUBA 3A22A 3NPUA 2ZZ6A 2JK2A 3W2KA 2VFIA 1CW2A 4RJEA 4ADTA 1GWJA 2GUUA 4OU1A 2B0MA 3O06A 4PODA 3ZFHA 5BMXA 3GX9A 4N9DA 1OFBA 2C13A 1KLYA 5KMYA 3C2VA 4OBTA 3Q94A 2V82A 4BWLC 2QR6A 4H3DA 3M5ZA 3C6CA 2E5DA 3O6YX 4HKPA 4BI5A 1UUMA 4M19A 4M6QA 2ZZ1A 5D33A 1W3TA 3STEA 2C1HA 3R89A 1PS9A 3L21A 3QEZA 3S1XA 1KM3A 2PRMA 4JTTA 4UFKA 1XKYA 5D2WA 5IBXC 1K3UA 3B06A 2V2DA 3G22A 3E49A 4UTIA 4NXKA 3F4NA 3G3DA 5HINA 4LUJA 1F7BA 1SR9A 1VS1A 1XBYA 5G2HA 2Z6IA 4DPPA 3SI9A 2YFOA 1OFPA 2R94A 4N2YA 2YYTA 4N9EA 3NR0A 2QCGA 3THAA 1QNVA 1EWDA 1VR6A 3FJLA 3LV6A 4GNJA 2NXHA 3HG3A 3W7MA 3GLCA 2EGZA 1XBVA 3VNDA 4U4MA 3LCGA 4DEFA 4Z1AA 3E9AA 2ZZ4A 1KFCA 4UTWA 1QCWA 2CZ5A 2DJXA 1W8SA 1H7OA 2CLIA 3WJZA 1MEIA 1YTEA 2C15A 2Y61A 5CZTA 3PY2A 1I8JA 4O28A 1AG1O 1JJKA 5D2XA 3PSWA 4E2DA 1PIIA 2JBMA 3W2LA 1KBIA 2Y89A 1I45A 2ZCGA 3DFPA 1IXQA 3FKKA 3EWWA 4AVFA 1IIHA 3BLFA 5FEZA 2NX3A 3O15A 4I7UA 3R5EA 3SZ8A 5I3KA 2DORA 4DF2A 3TKFA 4Q4KA 4O1AA 1I2QA 1SZGA 3RU6A 3CLMA 4Z08A 3HGSA 3KXQA 2H90A 4K37A 4DPQA 4ZMGA 5G5IA 3UWWA 1XL9A 4HHPA 1FDYA 4CLMA 3TCEA 2QF7A 2YGYA 3M7WA 2FPTA 1W37A 3P5YA 3VI2A 4LT9A 5AC6A 4EWND 1ZHAA 4GE8A 3KVKA 4IUOA 5HUOA 3LRKA 3W1TA 1P0NA 1W1ZA 3HB9A 5KZDA 3FJ6A 3SECA 3SGUA 2QCDA 1M5WA 1R30A 5TQLA 2Q8LA 3U6WA 3NM3A 5FF2A 3S0CA 4OE7A 1BKSA 4UXDA 4PFMA 3PB2A 1SW7A 5D2TA 3U2OA 4ZQMA 4S1FA 2ZTKA 5EKYA 3MP3A 2HS8A 4QITA 1B9BA 2ZZ3A 3NNTA 3RNDA 2Z6JA 3O16A 4JICA 1QO5A 4BK9A 4UMAA 1TTJA 4CNNA 3CEPA 3W85A 3LCXA 2VKZG 3QRHA 4AAJA 1U83A 4UTTA 4YMZA 1U5JA 5EY5A 2WKJA 1SFJA 4YCPA 2V5BA 4LVAA 1TTIA 3CEUA 4ZQRA 3P67A 2NWSA 1R47A 1WA3A 2NUXA 3GNDA 2JGQA 2YFNA 3C4UA 3UY8A 1JCJA 4FO4A 3GAKA 3R8RA 4DELA 1K02A 3M16A 1WBHA 1GPWA 2E6YA 2ZBTA 4I7WA 1P1XA 4IGHA 3BARA 2QCHA 1I2RA 2PE4A 5IBXA 4FXSA 3NM1A 5FF7A 2X30A 3LB0A 2GVLA 4PEKA 5A5WA 2FDSA 3G0SA 1CI1A 1PCWA 5K4XA 4ADSA 1VYPX 3B0VC 3A21A 4XWUA 2J24A 2E09A 3F03K 1LCOA 2CZFA 2RKXA 2O7QA 4JR5A 5LNRA 1K7XA 3WJSA 4IWWA 1QPQA 3GXTA 1EEPA 3KHJA 4HPXA 3DZ1A 3PSVA 1H63A 1RQHA 2F84A 4NJIA 3LHVA 2QCMA 5F2MA 2C3ZA 1Z44A 1W5MA 2X1UA 2BZNA 2A1YA 3DFSA 2E6AA 4GUFA 1XCFA 1MXSA 4QQ3A 3P74A 4M7SA 1P4CA 2QCCA 4S2BA 3S42A 5DCEA 3LHTA 4JY8A 3P8IA 1T8XA 3EX4A 1LM1A 4LU0A 1Q6OA 2YW3A 1TSIA 1TIMA 3BW3A 2A7RA 3N2XA 2VXNA 3NQ8A 2NXGA 3H53A 1H7WA 1KM1A 1JRBA 2DZTA 1TQJA 5CZSA 1EP2A 1KFKA 3HPSA 2J9YA 1QO2A 3RLUA 1O60A 5D03A 3W7CA 4ADUA 5KZEA 1FDZA 4TX9A 3BPWA 4WXZA 4JTKA 4NVTA 4FB7A 1VPXA 1YLVA 2YX0A 1JUKA 2OJPA 4TMCA 2WNNA 1KTNA 4IMCA 1WAUA 2CLKA 4A2SA 4H6KA 2W79A 3OIXA 2TPSA 3ZR4A 1AL8A 1K8ZA 3LCHA 1EP3A 2E77A 4YWIA 1VQTA 3S8HA 1E51A 3W88A 4FF7A 4PL1A 4UTUA 4MJZA 3R12A 2CWNA 1JULA 2WV8A 4TO8A 1TQXA 3VE9A 3KRUA 2Y70A 1JCXA 2Y7EA 1W3IA 2YDAA 2NX1A 2CZDA 3MP4A 1OYBA 1VGAA 1HL2A 1K7EA 3VFLA 1B4KA 2P0OA 3HGOA 1SU5A 5FEPA 3UZ5A 4AF0B 1FX6A 4A29A 4GJ1A 2WJZA 2AQWA 3I6RA 5KITA 1FWSA 4FNRA 4O13A 5AB3A 3HPZA 5AHFA 5C54A 1ZAJA 1FBAA 2PCQA 2ZA2A 1SFLA 8TIMA 4WY0F 3TQKA 5G4WA 4PA8A 3VCRA 3GNNA 1TPC1 2GOUA 3DU0A 2H6RA 2QJGA 3NQDA 3C0JA 1L6SA 3ANYA 1I2OA 1FDJA 1UJPA 2QUUA 2B7QA 3B04A 4HIBA 2H3DA 1YXYA 4UMBA 4IX2A 1TTPA 3EWUA 2TRSA 4Q33A 1YXCA 3W1AA 5K4ZA 5AYXA 1BTMA 5CKSA 1RQEA 1JCYA 4CNOA 5T26A 3GAYA 4JEQA 2H8XA 1DV7A 3P80A 3W1PA 3TFXA 1S3HA 3QMSA 4AH7A 1X1OA 1V5XA 1BEUA 1LP6A 1VH7A 1I4NA 1OK6A 4UC5A 3W1RA 4GXMA 1ICQA 4ZVJA 2YW4A 4HSOA 1VHNA 2BXVA 4M5PA 3CB8A 5I3FA 1SO3A 2FB2A 5J5DA 2E5CA 4JS3A 4XBSA 3L5AA 2GJLA 3V75A 3T44A 2RHGA 3IIXA 3KRZA 5DELA 1SZFA 3W7IA 5AHMA 4Z0JA 1H62A 2HSAA 4UTLA 4LS0A 3M1ZA 3DENA 1XFBA 4PC8A 4RXFA 4WQ6A 3HMJG 5TBOA 3TK7A 4PL2A 4KWVA 4ZQCA 3EXSA 2QCFA 3HBLA 5CG7A 3C2EA 2F7FA 3PG9A 3NQ7A 4CCDA 3W1LA 4E2BA 4M6VA 3LDVA 3DFNA 3QSRA 4LC8A 5LSMA 3N14A 1O4UA 4O57A 4KFPA 4OV4A 3C52A 3KX6A 1YDNA 4LVFA 3TW6A 3PBVA 1KFLA 5FEWA 3G8EA 4R53A 1JUEA 2NLIA 1S5VA 4XUGA 4JTHA 4AF0A 1RZMA 2QCNA 2ZRUA 4L4LA 5KTLA 1GZGA 4P2VA 2BLEA 1DOSA 1Z42A 4Z1CA 2B7PA 3MI6A 1H1ZA 4UFJA 2QDGA 4GRSA 4O50A 3N34A 3STCA 4FNPA 4NXSA 3TIMA 1VHCA 3W23A 1KM4A 3G1VA 5F1VA 1G4SA 1IIGA 5CZJA 5G1TA 1H7NA 2AAMA 1N55A 1J2WA 1W3NA 4JNMA 3NOEA 4UUIA 5SWUA 1MEWA 3LCLA 2ZRVA 5U4NA 2NZLA 1TREA 2J27A 3LX9A 1X1ZA 1K8XA 2ZA1A 1KW1A 4WJEA 1EWEA 1PCKA 4DBDA 4IMDA 5AHIA 3MBDA 3O6CA 3DGRA 3B05A 3TW7A 3M6YA 2NV1A 3A9IA 4M7TA 1TPFA 2YCEA 3LHWA 1W0MA 4O4VA 3C2RA 5DBTA 1H50A 3BLEA 4PTNA 4O14A 5G2IA 5DCBA 1TB3A 4O0KA 3QFEA 4OHQA 1GYLA 2Q3RA 1BWLA 1IGSA 2FPYA 2NX9A 2W0UA 1RQBA 2P10A 3WJYA 3WK3A 2ATMA 3CWOX 1ZCOA 3QH2A 4MUZA 1JCLA 3E02A 3TXZA 2FTPA 3T7VA 4O53A 5DN1A 4XTIA 1LBMA 3L2IA 5EYWA 3BGGA 3OEXA 3SIZA 1SW0A 1TPB1 2WSQA 3G1SA 1GVFA 4UFLA 1AMKA 3N9SA 1GVQA 3TR2A 3JRKA 1H7XA 4X3ZA 2BX7A 5K7JA 4JTJA 2Y7FA 4WD0A 2W6RA 3KOFA 1LOSA 4ALDA 1G4EA 5HMSA 1LOQA 3P7YA 2OX1A 4HNUA 1OX4B 4JIPA 4XTDA 3QYQA 2BWGA 5K9DA 4LUIA 3E0IA 4M6PA 2FQIA 1XXXA 4A2RA 3FIGA 3EWBX 3W2NA 4CNPA 3I7QA 4FIRA 3IIPA 1F5ZA 1YDOA 2CLOA 1LRNA 3C56A 4O1CA 1VRDA 1PHWA 4N6FA 2Y7DA 2Z0IA 2Z1BA 1ME7A 4QNWA 2OCZA 4GUGA 4W9TA 3MUXA 1GTHA 3PF3A 3N2MA 3W86A 3W84A 3HJZA 4O52A 3L9CA 4AWTA 3SGZA 3UNDA 3TV8A 3QSTA 4RK8A 3EWXA 5D02A 5D04C 1KV8A 4NZJA 4GUIA 4JX4A 4AWSA 4JYEA 1KFJA 3NL3A 4MPQA 4Z1BA 1X8FA 2D73A 3EX6A 4IX0A 4JYFA 2XN2A 2DZVA 1G6CA 4ONVA 2E1DA 1AL7A 4O0ZA 1NFBA 4AHQA 4BI6A 3MI2A 1YTDA 1QPNA 2GPTA 1ZENA 1GQNA 3G24A 1VLIA 4KFOA 4Z1DA 5LHEA 2YXGA 4MYXA 3W7QA 1TPH1 2DJLA 1XUUA 3BG3A 4CQ9A 2H3BA 4AB4A 4UIOA 1LORA 3CTLA 4O16A 1DORA 2FPVA 3CC1A 2BSLA 4OQVA 4E38A 2CLHA 4ICNA 1LROA 2WSYA 2ZRYA 5FF4A 1SO4A 4IMFA 3QQ1A 3N9RA 2A6LA 3UXDA 1RPXA 1SSDA 4BR1A 3FEMA 1Q3NA 3EKLA 1QPOA 3EX3A 4KKXA 5CPLA 3NZ1A 4O15A 4XKYB 3N73A 5F2LA 5DY2A 5HWNA 4O19A 1ZNNA 2ABAA 2ZDRA 3F4WA 4DO6A 1F6PA 3DHFA 5C6MA 1TYGA 1IF2A 1DL3A 3NL6A 3TH6A 1W31A 4RKAA 3NQFA 4K7YA 2XN0A 2E6FA 3FOKA 3IGSA 3W71A 5J5RA 4I7VA 4QSHA 3TMQA 3CT7A 4TR9A 3CQ0A 2C18A 3UPWA 2QCLA 2E68A 2RDWA 4WXYA 5CSSA 4LRSA 4BI7A 3DI1A 5D32A 3M43A 3PS7A 3KAOA 3AO0A 1FCVA 5EMUA 3SJ3A 3LERA 3FFSA 3NQAA 4O8RA 4K39A 1OJXA 3T40A 5BMWA 2CLFA 3WK1A 5DLCA 3IEBA 2OZ0A 1GYNA 1R2TA 1Q6RA 2ISSA 1GVOA 4AHPA 3MP5A 3DXIA 3JR2A 3W83A 1RR2A 4Y6GA 4O10A 1LDCA 3ABQA 3L0NA 4NU7A 2V8ZA 1TO3A 2NV2A 3M44A 1TJPA 2FJKA 2LLEA 3R2GA 3TSDA 5AHNA 1I2PA 1RD5A 5TIMA 4U28A 4EOUA 2X1RA 3W2MA 2ZA3A 2A7PA 4K38A 2FB3A 2ISVA 3TNOA 3MHGA 2ZQ0A 3LXAA 2EKCA 1TCDA 3QW4B 2WOQA 4TU1A 1LLZA 3L67A 3UWUA 4ZQNA 3NGJA 1G7VA 2ZRXA 5F2IA 4O12A 1NF0A 1YPFA 4FX8A 4N9CA 1A5BA 3WFAA 1WQ5A 2TMDA 4KFNA 4MY8A 4LS2A 5F4WA 3CU2A 2V81A 3L5MA 3DFOA 3B8DA 3C3NA 1XDLA 1N7KA 3LM7A 3QPZA 5I3GA 5I3JA 3ABRA 1ALDA 2RDTA 1GJPA 3QPYA 1OG0A 3HG5A 5KZMA 3ATYA 1C8VA 2ISWA 1W5QA 1F05A 2VFGA 4LC6A 5FF3A 3O1NA 3LLDA 4JTLA 3S5OA 3W7PA 4RZ4A 3IGXA 2WO5A 1OFOA 4P61A 4DXVA 3N19B 4LVBA 2G97A 2BTMA 3LXCA 3EKZA 3W6YA 4XKYA 4C1KA 5LGZA 3VKJA 2CFFA 1XUZA 4ZL1A 1K7FA 5DCDA 1OK4A 4IPJA 1THFD 2WSRA 4LRTA 2Y6ZA 4JY9A 3W1MA 1QWGA 3C8FA 3FYPA 3MMTA 4NUWA 5CZ0A 5CSRA 1WXJA 2YR1A 1A5SA 3LRMA 4ORIA 3TU9A 4R34A 1OABA 1AW2A 3AJXA 3KRSA 3E12A 3LCIA 4WUIA 3PUDA 4X2RA 3S5NA 3SW6A 4FNQA 4OWGA 3OVQA 1XM3A 1BWKA 1FCQA 3TJXA 1G4TA 1OF6A 1PL9A 5F2GA 3LLFA 2P1FA 4O18A 4PH6A 1KTBA 2WNZA 3ZS4A 3EB2A 3P82A 4B5NA 3L66A 2DP3A 3MWAA 3PB0A 2GVJA 4CQ8A 2GJNA 5AN7A 3PC0A 2ATSA 7TIMA 2OMAA 5LZLA 5I3IA 3HO8A 4TMBA 3OA3A 3S5ZA 5BRBA 5K3VA 3DHDA 1FCUA 1ZJIA 1XBXA 4RLIA 2I1OA 3W1UA 3FYOA 2CLMA 3ZWTA 5D38A 3TSBA 5L6UA 3B4UA 3M9YA 3NZRA 5HWMA 3L0KA 3UWZA 1Z41A 3DAQA 4ZQPA 1NVMA 1OYCA 4HNTA 2QJIA 3GR7A 1GT8A 2A85A 2GQAA 1K03A 4I9AA 3G0XA 1P0KA 3Q2DA 4LNYA 3SFKA 1YDVA 4GWEA 3G0UA 1QOPA 1H61A 1MEHA 4IXXA 3V1PA 5F4SA 2E5BA 3O05A 3NL5A 3IVUA 2QEZA 3MBFA 4R33A 3G1FA 3LBMA 3TROA 2HTMA 5FEXA 6TIMA 5AHEA 1ICPA 4GUHA 3RFAA 1T96A 4N4PA 2VELA 6ALDA 1OX4A 4N6EA 2ZTJA 3W07A 3LI0A 4AMAA 1D3GA 1OX6A 2G96A 1OX5A 3W7JA 1KTCA 1TRIA 1NEYA 4WX2A 2A6NA 4RX0A 5F1UA 2EAWA 3IRDA 1VCFA 2NWRA 3IVSA 5HNRA 4JX6A 2V2HA 4K8EA 4GUJA 5KSWA 3BV4A 3DI0A 3UYCA 1WDWA 3RF9A 5K9XA 3KVMA 3MYPA 4HPJA 1TV8A 3BG9A 1T99A 4CQAA 1SW3A 4UNLA 4MFDA 2TSYA 3N3MA 1FWWA 3USBA 2Q3OA 4K36A 3IVTA 1KLZA 2B7NA 3EXRA 1VCGA 3DFTA 2A4AA 2EF9A 4NNBA 1SPQA 3ATZA 5L9FA 2V9DA 3W1NA 5LNSA 4UTTC 3GXPA 1AW5A 1NAL1 1XC4A 1QR7A 3EXTA 4UNKA 5FF0A 3GB6A 1D3HA 3C61A 4UR8A 4O54A 4DF0A 3IGUA 3LHZA 5K9CA 3W22A 3PULA 3DKLA 1X6UA 4JN6A 3CWNA 1R2RA 3TMLA 1QFEA 1C29A 3M5XA 4XZ9A 1A5CA 3W3OA 1LLWA 5G1YA 4HNVA 2QCEA 1HUVA
chains in the Genus database with same CATH superfamily
1EDGA 1DQWA 1Z3NA 3W82A 3WLRA 1ITXA 5CAHA 1TPUA 3G1YA 2ZVRA 2J77A 1NDVA 3SJNA 3IIOA 3TXVA 4DUVA 1ZAIA 3RLGA 2F38A 4GBDA 6XIAA 3B97A 3QM3A 3UT0A 3U8GA 1EF3A 3B40A 1FHVA 1ISZA 3OA5A 4O11A 4UMCA 3GZAA 2C6QA 5IM51 1W91A 4DM2A 4JHZA 5EA9A 2DVUA 5A2AA 4M56A 4MY9A 1WKDA 5IXEA 4MADA 1J5SA 4UR9A 1HFBA 2XISA 2VEIA 4Z2IA 5D2VA 1U22A 4JDYA 1KB3A 3D47A 3OTRA 2HCVA 4UR7A 4A3QA 3LTSA 2PEVA 2XWEA 2W66A 2YDRA 1JDDA 4G56A 2EPHA 4WIWA 4JTEA 3H4GA 3OHIA 4NJHA 2INFA 5CBJA 1QASA 3M47A 3WQDA 3WQPA 2DT1A 1IV8A 4WDXA 3ZO9A 4MYAA 2DSZA 4QG6A 3IJIA 3W76A 1PVNA 3UR8A 4D6CA 1MVYA 1F8MA 3SCTA 2X09A 3DDMA 1UD2A 3GTXA 3QZEA 3EYPA 3EDJA 3H23A 3T0AA 3R8HA 1J11A 3MHFA 4DZIA 5A8GA 3W74A 5HQEA 1MUCA 3H7UA 3ZM8A 1FWEC 1Q8JA 3N29A 4JQ4A 3EWCA 1JVNA 1VIZA 1XYMA 3AWOA 3G1XA 2PDCA 5LHFA 3G8RA 3PTQA 1GONA 5AHLA 4NJJA 2QKFA 2WC7A 5AFDA 3SRFA 5REQB 4UFHA 4XAGA 3TC3A 4YTRA 4CGTA 1E0VA 2XH0A 1QAPA 1ZY9A 5IRPA 1M53A 1ZALA 2JALA 3FY1A 1RY8A 3R13A 3IV3A 4XO6A 3UD6A 4X60A 5HQLA 5FJRA 3BAXA 1TJRA 2XFWA 2ZZ2A 2GVGA 4GISA 4NNAA 5AC5A 3OVPA 1OQFA 2WM1A 6REQA 3GC4A 3DOPA 1UWQA 4NT0A 4B9YA 4FLQA 2VEKA 1VJIA 4W8AA 1LWIA 4IL2A 3TSMA 1ZQ5A 8XIMA 2D2GA 3STPA 2QMJA 3AZTA 1BYAA 1QI5A 3KOXA 4UOZA 3H55A 1DJXA 1TWWA 3DG6A 5DFAA 1UB3A 4HMCA 3FA5A 1XG3A 4BWLA 3PZMA 1RPKA 3CUIA 2QJNA 3S1VA 4Y96A 4CU8A 4E2VA 3DH7A 3RJYA 8RUCA 1U1UA 1C92A 1Z48A 2YKKA 4WJ8A 4Y8EA 2ZYFA 2VGGA 4F0HA 4Q8OA 4ORMA 1SO5A 4MDPA 5DMMA 3APTA 3A9BA 1W3LA 2MUCA 2HMCA 4G6CA 3CYJA 1KFEA 4MG4A 1TFVA 1GQLA 5BXRA 2DUAA 3CUFA 1LJYA 1ZBVA 4G1KA 4E8GA 3TC6A 2EG8A 3S2CA 1JR1A 1MQQA 2ABBA 3QKZA 1E4MM 2HE5A 2CEQA 4O1DA 3QZ6A 4DUXA 1N2VA 3UPBA 1B54A 1PHQA 5GNZA 3QV7A 4QJ4B 3NEHA 4NQ1A 1OZMA 3AFBA 4UCGA 5A3HA 2VZVA 5BOOA 4RXGA 1W2VA 3BMVA 3BAIA 3L65A 3WDJA 5CSUA 4TVUA 3QC3A 3SBFA 2PRHA 5D30A 3A3HA 4GX9A 4DQWA 2OSYA 3CMFA 4U5IA 3VINA 2ZWZA 5DF0A 1Y0EA 4GX8A 1KQZA 3RK8A 4ACZB 2PTXA 1VC4A 1EJVC 3TC7A 4E5TA 4IFKA 1BGGA 3WX7A 5KEZA 3F2BA 1DHKA 1HVXA 3UZJA 3W7LA 4LWWA 2QCDB 2EHHA 2A79A 3KDNA 3BO9A 5U7SA 1OGGA 5H8PA 2PD5A 2WAGA 5EL1A 1NQKA 3W1QA 3M07A 3NXFA 4XZLX 3M0KA 3F4VA 4DO5A 1QHZA 3NQVA 2OZTA 1F73A 3P8JA 1EEXA 4WCJA 2IKGA 4IMGA 5FJJA 5I3DA 1CXLA 5EBUA 1M9HA 4LVGA 2ZFAA 3TEVA 3C8NA 3WLHA 1J4EA 3VD7A 2WQPA 5FJTA 5HR7A 4LUSA 4R7JA 2PRLA 2GDVA 4GACA 1DXFA 2V5LA 4RCXA 2G3IA 1G4PA 1W56A 4YYFA 1W9PA 2VX4A 1US0A 1XIGA 1Q4NX 3QFWA 1K9EA 3PWAA 1JDEA 3URAA 3LBCA 3HG2A 2X1SA 3IIVA 2XIIA 1BYBA 3OVRA 1VYSX 1UJQA 2DZXA 4DNMA 1H51A 3DGBA 4IJBA 2AL2B 3QMTA 1E9IA 4ML9A 3HPXA 2V30A 4MY1A 4AD0A 3VM7A 2I57A 3USZA 3A3WA 1K8YA 1R46A 2HS6A 1DXIA 4WDTA 1PZ2A 1XYAA 3RMJA 4KMQA 3FXGA 4JQ2A 2P53A 3PK7A 4DJDA 1L6YA 1S2TA 1ADOA 1WYIA 2FHFA 3U7VA 1FWDC 4GQGA 1BHGA 3F5LA 3GDBA 1A3HA 4FIQA 3P5ZA 4AXNA 2FVKA 2QJJA 4GFSA 2YPIA 1W9UA 3NA8A 3EWDA 4AIBA 1UCWA 1LRTA 4PUJA 3STGA 1VPYA 3H4WA 3G3MA 1J0HA 2PDLA 4LV9A 3P81A 2RFGA 1WOAA 3B8SA 1JCMP 3K4AA 5FJIA 2JKEA 2EPLX 3NYDA 4Q8QA 3G1HA 2WWDA 2WPBA 4GYJA 1G67A 1TPVA 3WD0A 1FWRA 4RDVA 1CTNA 3B0YA 1S5TA 2D20A 3ARTA 1MFUA 3FA4A 3HURA 5AC8A 3PPGA 2NQLA 2OZ3A 3L68A 1MZHA 2VWSA 3PVFA 1KRMA 1K1DA 5EFFA 4KWOA 4MKSA 2D1ZA 2JIEA 5BU9A 2OELA 4FHAA 1IZKA 4NI3A 3CJPA 1VYRA 3O07A 4FEZA 2PDIA 3KOYA 1JD9A 3L0GA 2WMIB 4QBXA 1PE1A 3RO8A 2B81A 3ARPA 4E0CA 1QMLA 4H4IA 1BQCA 3BAYA 3GKFA 2OGYA 4Q8VA 1LTDA 1LG1A 1CX9A 3QC0A 4N9BA 4N4QA 4L6OA 1O68A 1OVDA 4PTMA 1VAHA 1PKMA 1XRSA 2Z7KA 3L23A 1GVSA 1HJQA 3UXAA 2PDMA 3ZWSA 3KTCA 4L1GA 1K70A 4CCEA 5C7VA 1GYMA 4CU7A 2G4FA 1SZEA 3ABXA 4ECLA 1JZ5A 1C9WA 1ONRA 3W0KA 3ZJ7A 4EPKA 1WXYA 3CQJA 4JIHA 1GNXA 1F07A 2EKGA 3DIPA 3PNZA 3UWEA 3NYZA 3QMRA 3T05A 4OJYA 1XGEA 3N4AA 4LYPA 2DUXA 4K8HA 3PAJA 3FV9A 3NAVA 2J8GA 1U1JA 4G1NA 3NQEA 4QROA 1X6NA 2IS7A 4GNKB 2Z1SA 3G77A 1DTNA 1JCNA 2ZC1A 4BQ2A 2BS9A 2E9LA 2VX7A 1N8FA 3SCNA 3A4WA 2DDXA 1CGUA 1FH9A 1GOIA 3I10A 3AWNA 3FJNA 4EACA 4JIIX 3FJ4A 3STFA 3QOMA 2HK0A 3VNKA 4DBWA 2REQA 4Q7IA 4ADTA 4C6BA 5HOSA 4LAKA 3LQGA 5T9CE 3GW0A 1EH9A 5B80A 2XSBA 4L4PA 2QR6A 4IIHA 3M5ZA 1HGWA 3O6YX 3S5SA 4LYRA 1XH2A 4LALA 1JPKA 1HJVA 3RCYA 3DEQA 3U2CA 3R89A 4JTTA 3S9ZA 4YTQA 1A3WA 3L4XA 3T4WA 1K3UA 4LEFA 3D3AA 4FF5A 1NWRA 3CASA 4HOXA 3HZ3A 2V67A 1Z8AA 1VS1A 1C3FA 3OGSA 4PB3A 4G2DA 2R94A 4HVXA 4ZODA 3EB3A 3NR0A 5I02A 4ZSTA 5I79A 2ZADA 1E72M 4H8VA 4HPGA 1X7IA 3FJLA 2NXHA 3HG3A 1XG4A 3VOGA 1W1IE 5KZ6A 3AISA 1FKXA 2DJXA 1B3YA 3O6AA 2GSEA 4X0VA 2Y61A 3PY2A 3BMXA 4HQVA 1EFZA 3AHTA 1JNDA 5D2XA 2W27A 4E2DA 5E70A 3W2LA 4AIUA 4HPHA 1I45A 1BSLA 5DX7A 3EWWA 4AVFA 3EMCA 2EG7A 3OGVA 5I3KA 3NDZA 4L9YA 2XJ7A 1KD0A 2WNWA 1GOMA 4PFHA 1QATA 1J0IA 4LFYA 4MNLA 4BF7A 3K46A 3UWWA 1XL9A 2PU1A 3M7WA 2YL6A 3PZVA 1XSJA 2FPTA 4FR1A 1YBQA 3P5YA 3CYVA 4XZHA 4LT9A 5AC6A 3S2NA 4EWND 5ABFA 2P3EA 2YDQA 3MMWA 3WLJA 1ZHAA 4GE8A 3QYSA 3FW6A 3LRKA 3SRKA 3SECA 2RJGA 2ZDSA 1M5WA 1R30A 3U6WA 5FF2A 2IKJA 1DJYA 3AYVA 4GZJA 5D2TA 4R88A 4XD6A 3P6LA 4S1FA 3WDIA 3E74A 5C7HA 2XUCA 1OCNA 3S2LA 1UUQA 2UWFA 4B91A 3T81A 4CNNA 3AU6A 3LLXA 2GFTA 1PX8A 3ALFA 1UD4A 2D22A 5I5RA 3WLOA 1U5JA 1LQAA 1E5JA 2WQDA 2Y8UA 4LVAA 5TF0A 3RPTA 3W6MA 1HJSA 2NWSA 3WLIA 2NUXA 2PCEA 4H2HA 4LBRA 3RMEA 4RE0A 2J62A 1WBHA 3BARA 2ESCA 1I2RA 2QCHA 2PE4A 3GC2A 2PWUA 3IS4A 2FDSA 1PCWA 2ZX9A 1VYPX 1LCOA 2CZFA 2WPGA 1Q2SA 2ZWYA 3GXTA 4JKKA 4RNHA 1D8WA 4DB7A 3PSVA 1RQHA 2F84A 4NJIA 3LHVA 2V5CA 1PBGA 1W5MA 4XD3A 2E6AA 2WKGA 2HISA 1QNQA 1TWIA 4S2BA 3UA4A 1EQPA 4U5KA 5DCEA 1YMYA 3B9OA 1UZ1A 4EXQA 4MPKA 4LANA 4LU0A 4KCWA 1E3ZA 4H7CA 4I90A 2A7RA 3EDDA 3N2XA 1H7WA 3VIOA 1KFKA 1V0MA 3ITCA 4I6KA 5A2BA 2BNJA 1QO2A 4B9ZA 3UEQA 3HFYA 3BPWA 4L64A 2PDGA 4QCEA 2AKZA 1VPXA 1LG2A 4TMCA 4IMCA 1WAUA 1OSEA 1NU5A 1K8ZA 4YWIA 1PXGA 3VABA 4IGMA 1E40A 1CENA 3IV8A 4UTUA 5G4HC 2WV8A 2YIHA 5CZKA 3PBGA 1Q6FA 1MDRA 2DVXA 3CZEA 1WPCA 2YDAA 4RW5A 3O9NA 3WSUA 1SU5A 2VDGA 2WMJA 3BQ6A 3BE7A 3FEQA 2AQWA 4NL1A 2JEPA 5KITA 1NH6A 4JNYA 3WF4A 3TNBA 3ANUA 3IAQA 1AZ2A 3WQ8A 4IT1A 3HPZA 5AHFA 1ZAJA 4Z2JA 2FTYA 3GFZA 3GNNA 3U9IA 1TPC1 4R5EA 3V5FA 2H6RA 2QJGA 1L6SA 1TJ1A 3LD5A 2QUUA 2H3DA 1YXYA 4JIEA 1CLVA 3ZT5A 3QGKC 2VC5A 4GYFA 3THUA 1ELSA 4YHEA 3KL0A 1A80A 5K4ZA 3RIKA 5JU6A 1CEOA 4NAFA 5T26A 4ATLA 3W1PA 3UXLA 3MTWA 3GBDA 1X1OA 3I3DA 2L5HA 2E9BA 1VH7A 1I4NA 1CT5A 1VIWA 5A1AA 3GYCA 1T40A 4ZB2A 2DY3A 4QE5A 4YYCA 3RUBL 1VHNA 5I3FA 4M80A 1Y65A 2E5CA 1CNVA 6A3HA 1MFVA 3V1HA 5A6AA 1YIXA 2GJLA 3NVDA 2RHGA 3IIXA 5DELA 5D4YA 1GKPA 2NT1A 4ZB0A 1H62A 4J3UA 3DENA 3NJ3A 4WQ6A 2JIWA 1EC8A 4A8LA 2VZSA 1F6YA 4CVUA 1CXEA 4X0NA 3URBA 4B5WA 2I56A 5D9OA 3H8AA 3W1LA 4E2BA 4M6VA 3DFNA 3VGHA 1UKOA 3SCOA 4YIWA 4KFPA 6PTDA 2QDDA 1IWBA 3KX6A 1XRVA 4LVFA 3TW6A 3GXFA 1UZHA 1KFLA 4XZWA 2NLIA 1S5VA 3DCPA 4AF0A 3AS3A 3FSUA 2ZRUA 4PBEA 2X0SA 4P2VA 1Z42A 4O1EA 1W1TA 4NRSA 2B7PA 3MI6A 1H1ZA 4AZCB 3TYEA 3REQA 2XWDA 1KGWA 4O50A 3N34A 1V08A 4KETA 3OHMB 4FNPA 4NXSA 4MJ2A 3TTEA 1BQGA 1NFPA 1KM4A 2QS8A 1FWHC 3MJMA 2QYGA 3PZGA 5G1TA 3T0CA 1V3LA 3DECA 3AYTA 1N55A 1OIMA 3VKBA 1W3NA 4JNMA 1UD5A 1M41A 1XLGA 2ZRVA 1I0DA 1TREA 3EA1A 5A6KA 5H8MA 2CWXA 1KW1A 4C6PA 3T8QA 4IMDA 3CS2A 3HPAA 3PZ9A 1XD1A 4UQEA 1M65A 2WVVA 3GSMA 5HJYA 4RW3A 1ZU8A 1CB2A 2YCEA 3LHWA 5JMUA 1GVEA 2BG5A 1H50A 4O14A 3WNPA 1J0KA 1RQBA 3PWGA 1XLHA 3WJYA 4PRWA 4UCFA 2ATMA 4MUZA 5E0CA 4FLRA 1EOMA 1JCLA 2FTPA 1I6NA 4XTIA 5EYWA 3BGGA 3ZJKA 1TPB1 2MANA 3ISIX 4UFLA 5REQA 2D3NA 1AMKA 3T6CA 4X3ZA 5TD4A 2P8BA 5K7JA 3N2CA 3KOFA 1LOSA 3RPDA 2JF6A 3FDKA 4WR3A 4D72A 1AA1B 2ZX7A 3M0MA 4HNUA 2FQIA 3DFYA 1XXXA 4A2RA 3FIGA 3NSMA 1UZDA 2GL5A 1WKYA 2PLJA 2AL2A 4CNPA 3MY9A 2P50A 3C56A 3VNZA 1PHWA 3DBNA 2YCJA 2Z0IA 4J3SA 2Z1BA 1ME7A 5XIAA 3DERA 3EOEA 5LIKX 1XCWA 1H11A 3VFCA 1QW9A 3U5UA 4TV6A 3HJZA 3L9CA 4KWUA 3TV8A 3EWXA 4GUIA 1KFJA 3UR7A 4MPQA 4KS0A 4JYFA 4GH1A 5G1MA 2XN2A 1W1B1 4PTDA 3WQ4A 1AL7A 1EGMA 2YL5A 3MI2A 1YTDA 2GPTA 3BURA 1UMLA 2VQUA 3D46A 4KFOA 4LUYA 4WEVX 5EMYA 4LUTB 1XUUA 4DWDA 4AB4A 1LORA 5A8OA 4O16A 4C60A 1DORA 2P8CA 3VMPA 4DX3A 4B5UA 4MJ4A 2WSYA 2RUSA 1RPXA 4UTFA 3QY7A 3K2GA 1AQFA 1OADA 1EHAA 2PPGA 3L4UA 4XKYB 2YCIX 3W4RA 5HWNA 1X97A 4O19A 2EPNA 1ZNNA 2J25A 4AC7C 4DO6A 3F4WA 3WQ6A 5C6MA 1IF2A 3WNLA 4HCLA 3ARYA 2XN0A 2E6FA 3IGSA 5J5RA 1FFRA 3P3BA 1WDPA 3MUCA 1WCGA 4ASTA 2E68A 2YBVA 2ZXAA 3IUDA 5CSSA 3DI1A 1MYRA 3SQLA 4CQDA 4IIGA 3KAOA 4J3XA 3AO0A 1B3XA 2V3GA 4HGXA 3SJ3A 1KQYA 4YPJA 4O8RA 1OJXA 1UMYA 2O9OA 2X7VA 3N04A 3MP5A 5DANA 4Y6GA 5TNVA 4M82A 1C93A 1NTHA 3WDHA 4RNJA 1FWBC 3R2GA 1OB0A 1E4NA 5AHNA 3E0LA 5TIMA 1DJWA 1DYSA 2C8NA 3N3TA 4EOUA 1HJWA 4J3WA 4L6DA 1KRBC 1VBGA 2ISVA 5D9NA 4L56A 3WQ5A 3ZLHA 2HVOA 4ROQA 4D6HA 1R86A 3L67A 3M0VA 4XSMA 1G7VA 2POTA 3AXIA 1YPFA 3HTWA 3SQMA 4N9CA 4REQB 2E25A 3CU2A 2AQVA 3C3NA 1XDLA 5FA5A 2X0HA 3ABRA 4RZBA 4WSJA 1ALDA 4YS1A 2INZA 5KZMA 1JDAA 1C8VA 2ISWA 2XVNA 4LC6A 1W9BM 4QEEA 3CV7A 4KWSA 4GQ0A 1REQB 4RZ4A 3IGXA 1TCMA 3CZLA 2WO5A 1DE5A 1IHIA 3DG3A 1ITCA 3NURA 5BWAA 2QV4A 1P0EA 1W3JA 2DVTA 1RUSA 5DCDA 4IIEA 1OK4A 4BHYA 3HN3A 4Q8NA 2OO0A 1CGWA 4ENLA 3C8FA 3KOWA 3CH9A 5BCAA 4NUWA 4QJ5B 1V0NA 1CXFA 1GOOA 1JYWA 3O0KA 3GXDA 1GGOA 1OABA 3KRSA 3S5NA 3E12A 4DBSA 4C90A 2BOFX 2YXOA 3WLPA 2DUZA 2PGRA 1U30A 1VFHA 1KWKA 1MNZA 4YTTA 4DXXA 1G0CA 2PP3A 1X38A 1RA5A 2J79A 1Q6DA 1W1A1 4H6EA 1B3VA 3PC0A 4PBFA 4WDWA 1DPMA 2RDXA 1R0MA 4TMBA 1XBXA 3VO0A 1XLAA 2I1OA 1WDDA 3AOFA 2CLMA 4HZ6A 3TSBA 1X6LA 2BGNE 1J6PA 3MV11 3B4UA 3BAKA 5HWMA 3UWZA 1Z41A 3JVAA 1OYCA 1PO9A 4HNTA 1GT8A 4TQTA 2XIQA 3PNUA 1AJ0A 5CJ5A 3VTRA 2HWGA 2OLAA 3T9PA 2Y4SA 4LNYA 3SFKA 4GWEA 1C8QA 2D3LA 1R38A 3BDKA 3WNMA 1MEHA 4IXXA 2EEXA 3IANA 3NL5A 3G1FA 5HJXA 1V03A 1ICPA 3ES7A 4GUHA 1QXLA 3S46A 2PDXA 1PKYA 1RJQA 1YNYA 2Y8VA 2ZTJA 3TOYA 1OX6A 2FH8A 1M04A 1KTCA 4MAZA 3B9DA 1C8XA 2EAWA 1RCXB 4PMRA 1F9CA 2W61A 4B92A 4CQBA 5HNRA 3VOCA 3WBEA 5KSWA 1J8VA 1ZTVA 2PGFA 3DI0A 3UYCA 2Z28A 1F4AA 4DN1A 4Q8WA 4H9XA 4HA3A 1JCTA 3KVMA 4KQNA 4HPJA 1XFCA 2HNHA 3WUFA 4CQAA 1SW3A 4UNLA 1CZ1A 4MFDA 3FHQA 3AUJA 1LL4A 1FWWA 3FAWA 1HJXA 5BOFA 3JW7A 2J13A 3KE0A 5CC5A 3WLKX 4MWAD 3VD5A 2VI0A 1UWUA 3SQSA 3TLLA 1NAL1 4NIRA 3S6OA 3M0IA 4F79A 3LNMA 3MS8A 3OZPA 3OW1A 3C61A 4IL0A 3GG1A 1TUXA 3CWNA 1NDZA 1XIJA 2PD9A 3L4WA 1S1RA 3ABZA 1FWCC 3R6IA 3E38A 3M5XA 3MMDA 2OODA 1A5CA 4HPNA 4HNVA 5HXMA 5ABTA 1GUVA 4NZ1A 1EP1A 3NQ2A 3DC0A 3M5YA 3N4FA 4FNSA 4ZOBA 5AVHA 5EPDA 3UY7A 3IJ6A 2VC6A 4MZ8A 2CLEA 2TODA 3EPNA 5AVNA 2NQZA 2Y63A 1EPXA 3TQ0A 5IFTA 2HEJA 5DT7A 3SR7A 1A0CA 3GHRA 3EWYA 4IQLA 2Z7GA 5FI8A 3MW7A 3VCNA 1ZGDA 4QS6A 2ZUWA 1AH4A 4AXKA 2DW7A 2V5KA 3NDOA 4LOCA 5A2CA 2VFFA 4IP5A 1TPEA 5D37A 4KIEA 3SUVA 2F2KA 3E3HA 4AEFA 1UBPC 4DO7A 2PAJA 2ODOA 2VEPA 4DRSA 3QGVA 2CYGA 2VCAA 2FYMA 3LHYA 2XGIA 1TVNA 5DXYA 1Z9AA 3ZR6A 1E0XA 1NDWA 4HN4A 4TV5A 3WK0A 1V7AA 4IH3A 4EXAA 4LW7A 2QUTA 3M4HA 3MSRA 1L6GA 2P88A 1CLKA 3VOHA 3BICA 4JN7A 1LBFA 3PWIA 4PUEA 3O2LA 4GYPA 5BROA 1MZRA 2WSPA 4NX0A 1XWYA 2O92A 3P93A 4RR4A 3NPVA 3OLIA 1UR1A 5H91A 1DIOA 4GY1A 7XIMA 3KVLA 2FGBA 1TR9A 2GJPA 5EMMA 4EIVA 4GZ7A 2NVDA 4YU1A 4NZ4A 3SEPA 3S2JA 5A6MA 2NV9A 4Y9AA 4JTIA 1WAWA 2Q8XA 3OB8A 3BANA 2OEJA 3SUWA 1XBZA 2I16A 1XIDA 5I2UA 2YYUA 4ZQOA 3KLKA 4MB3A 4AIOA 5B7YA 2WJFA 3QHNA 3B0UX 1BAGA 4GKLA 2CW6A 3H54A 3M41A 2ZUUA 1L8PA 3GVGA 3CM4A 2DIKA 5K2ZA 2CZEA 2VOTA 2CCRA 4UWMA 3CUXA 3MSDA 5DY3A 4KRUA 3QR3A 3BJTA 1JAEA 3WF0A 3P62A 1W54A 1NJJA 1OBAA 1WOBA 1YKWA 3TQVA 4LVDA 3U0HA 2ZUMA 2DSWA 3DFQA 4R7OA 3HOJA 3WD2A 3PBWA 1LYXA 1J93A 4GXWA 3UCQA 4E2OA 3ONBA 2QHAA 3LV5A 5GVJA 5D9MA 3NL2A 4NG3A 2G37A 3KUMA 1WUFA 1O12A 1WX0A 3WQGA 5A8QA 5AYZA 3PZTA 2J74A 4Y8FA 3JZUA 4A22A 4NJGA 3U57A 3W24A 3QQ0A 4K7VA 4NILA 1OEPA 3S1WA 3HIJA 4TUFA 4YLWA 1G69A 4ZTYA 3TN4A 1TWDA 2CERA 1H49A 1RHCA 4QDWA 1AK5A 1YE6A 3VIMA 3ITOA 4DAIA 5LGXA 4LEQA 1GTEA 2XPKA 4XAZA 3T09A 1TV5A 3D5HA 4MWAE 4HZ7A 4QTGA 3SRHA 4QQUA 2A3BA 1HTIA 3W70A 2PTWA 4NYYA 4RZ6A 1E6QM 4A3RA 2IPJA 5FL1A 4L9ZA 4X2PA 1IXPA 2GDQA 3WEOA 1HVQA 2AAAA 3O63A 4MF4A 4UFIA 3BW2A 1WDQA 4AEOA 2TYSA 2RDUA 1EBGA 1CLXA 1F74A 1R3SA 4AC1X 1ZBKA 1ENUA 2JKPA 1T5AA 1O5RA 3TX9A 1MSSA 2NXIA 2R1PA 2VDHA 1DTUA 1KM2A 3BW4A 1JYNA 3DC8A 1BVWA 3WQCA 4AZHA 4F40A 4MAVA 2ZRZA 1TZ9A 2OEKA 2IKHA 2AL1A 5HULA 4EXBA 1MO0A 3NQMA 1G5AA 3S4TA 5LIYX 4CCCA 5DMYA 1SJCA 5D09A 2IKIA 4F4RA 1IEXA 2Z1VA 4L9XA 2O7SA 1E4LA 3WLTA 4XAYA 1TPWA 3BOLA 3TVAA 5CGQA 4F3HA 5HNNA 2UY3A 3PBYA 1EO7A 4XBKA 1SJAA 4XVEA 4IQJA 2Z2UA 4I6VA 4JNZA 3W7NA 4PCFA 2XIOA 3IARA 3KBMA 3R4IA 4S3EA 4E8DA 4MOZA 3GDLA 5H6HA 4L5ZA 3FAXA 4FX6M 3S1UA 3I68A 3GKAA 4MNMA 4UTHA 3MKCA 1SMAA 3LBOA 2YDSA 3W81A 3LSBA 4GG9A 3ZXWA 3I7RA 1RSCA 1GVIA 3H7RA 3GXNA 3TUUA 2GJRA 1YADA 3HJEA 2XIJA 6XIMA 3PJUA 4Y90A 1A3XA 3VDAA 1V3IA 1LLOA 3TAOA 3CIVA 3ABSA 3W2UA 3BK0A 3G1AA 1S39A 1NM9A 2WHMA 2JFEX 5JUVA 1XLFA 3UETA 2X7WA 3M0JA 4HNNA 2HNEA 1XH0A 3OG3A 2A7NA 1KBKA 2ACSA 1KBJA 2WCSA 5CQ1A 5FD0A 1CXIA 4C5ZA 1CYGA 3DFHA 1KR1A 2RH9A 4AW7A 4KESA 1NF7A 3NPWA 1KFBA 3VDCA 1A5UA 2VOMA 2NUYA 4XZNX 1UH4A 2PODA 4W85A 5HUPA 4MJMA 3DHUA 1V7YA 3T55A 5HATA 4G9PA 3K30A 1XD0A 2C0AA 3B9AA 3K8LA 1Y8BA 4WRHA 3W7OA 2J8FA 1FUYA 3RM8A 1EOKA 4IQEA 2XH7A 4H41A 4N02A 5ABGA 3VGEA 2CIPA 4Y9NA 1IWAA 3IACA 4UFMA 4HSHA 1XR2A 5H1WA 1NOFA 3JS3A 5BW6A 5LNUA 3LXBA 3UNTA 5JXQA 4EAMA 3C3UA 3TFCA 3P0XA 4BF9A 3DYPA 4Q8TA 3UP8A 1O95A 3MZ2A 1W3HA 3WMCA 4GINA 1K6WA 2QJHA 1G9HA 2W62A 1GVRA 3ZLFA 3GFXA 1TV4A 1SZNA 1ZZMA 2OKOA 3MUIA 3C5QA 2E4TA 1EIXA 2HZGA 1ICSA 1UP2A 2VENA 5C9XA 2CHNA 2I9EA 4DO4A 4EF9A 3E2RA 2J7HA 1VFMA 1F3TA 2NQ9A 1FP8A 4AZIA 2A5HA 2FZBA 4JTGA 3HGJA 3T1GA 2VFHA 3WG6A 3OYXA 1DWHM 3MHUA 1GCYA 2C19A 2C14A 1R9XA 4US6A 3CUZA 1W5OA 4IOTA 1VBJA 2NQ5A 3KCLA 2XN1A 5LA1A 2OGJA 2Q8ZA 3MWCA 4YL2A 2J9ZA 3REQB 4HBKA 5A94A 1HO4A 1E0WA 2XVLA 4UTKA 1UASA 3WBYA 1Q6GA 1JPHA 2Q01A 2VC7A 1NP2A 5CAKA 4O8AA 3A5FA 3LA4A 1AW1A 1UC5A 1W6TA 1YNQA 4J3ZA 4RZ5A 3PPCA 3TYZA 1WZKA 4HHHA 2HROA 1V79A 5HPOA 3NG3A 1ONEA 2VZUA 2POZA 4TTUA 3BWWA 1L2UA 3WLMA 3UESA 3SO7A 5FIPA 3W38A 1KRCC 4S23A 1EA0A 1KM6A 4B15A 2IW0A 5HR6A 2DZBA 1PV8A 3BAWA 3CIWA 2NQHA 1B0IA 4E8CA 3XINA 2ASHA 2J75A 1E1FA 5AY7A 3WBAA 4NAEA 3GIPA 3W75A 3FHAA 2PA6A 3M64A 1OFQA 3W53A 1JF6A 4C1NB 3R79A 4D8AA 1FXPA 3GBEA 1E9YB 4YJ5A 3HM7A 4YVVA 4HYVA 2R91A 3NPXA 3W72A 4PMJA 4CD8A 3CQIA 2O56A 4KRTA 3SCUA 1S2UA 1GEQA 1JZ8A 3VCCA 4J5NA 4S39A 4AYSA 4FNTA 1TPDA 3GK0A 3VE7A 4W88A 3WL0A 3RXZA 4YCOA 1TTQA 1UW9A 1X8CA 1OF8A 4AHOA 4HYRA 3TE9A 2J6VA 5HMFA 4I9TA 1Q66A 1UBSA 3VK5A 1X7FA 1PUDA 4MKNA 1CECA 4PUNA 5DBUA 3NPUA 3GC5A 3M0XA 3W2KA 4YNGA 1J96A 1J0YA 3VDBA 1GWJA 4J2MA 4PODA 1TMQA 3ZFHA 5BMXA 3WD1A 3ZYZA 2C13A 1KRAC 3FK4A 5KMYA 3GNRA 3BOXA 2V82A 1V0KA 2W91A 4BWLC 1EYEA 3C6CA 2E5DA 4HKPA 4BI5A 1UUMA 4M19A 4M6QA 4ML4A 1XRTA 5D33A 1AVAA 3IUIA 3FN9A 4GZEA 3STEA 2EJAA 4O1FA 4W84A 1KM3A 2PRMA 1EJWC 3G2GA 3VX1A 1O1ZA 2D0FA 4NZ3A 4H9UA 2V2DA 2PLCA 3E49A 3GH7A 1E1EA 2V38A 4QHRA 5PTDA 5HINA 3B3DA 1TWSA 1SR9A 1XBYA 5G2HA 2Z6IA 1EJRC 5ENLA 3BL3A 1QW8A 1Q7MA 1OFPA 4N2YA 1QRQA 4GI6A 1FWIC 1ISXA 1VENA 3H6OA 1QNVA 5LXXA 1EWDA 1VR6A 1D8CA 2OYMA 1LUCA 3LZ3A 2BMBA 2R82A 1L2QA 4Q4RA 3VNDA 4U4MA 4PTWA 4ES4A 3LCGA 4F0RA 4DM1A 1N8IA 4PYSA 4KGJA 1QCWA 2CZ5A 5DO8A 4KRZA 1UR9A 1W8SA 1H7OA 1B3WA 5CZTA 1AZ1A 1EJTC 2WC4A 4I5RA 3IRSA 4O28A 1AG1O 4KBXA 1W1PA 4LX4A 4EE9A 2Z1KA 1JDCA 2WWCA 4FK9A 4ZTXA 3UVAA 3K13A 3UR2A 2GUBA 2X40A 3DFPA 5IOBA 5JQ9A 1K6AA 3WMBA 4B3ZA 5FEZA 4QP0A 2J7DA 3O15A 3P0WA 4I7UA 3CK5A 1E5NA 4ZFMA 4DF2A 3EOUA 4DXKA 3CLMA 1TX0A 4HJFA 3HGSA 3CV2A 2PB1A 3KXQA 4DPQA 4ZMGA 2C0HA 3R58A 1RP8A 3TCEA 2YGYA 2R1LA 3GH4A 3U4AA 4HP5A 4JQ3A 1FWFC 2WVSA 3JZEA 3WKZA 3MMUA 3KS6A 4RL3A 3HV8A 3O0FA 5HUOA 3HB9A 4Q4PA 3W37A 3SGUA 1EXBA 2IQDA 2OO6A 4KCUA 5HMEA 3OOQA 1BKSA 3VNJA 4ZQMA 2FMNA 4F0KA 1U2YA 1QNPA 1R9ZA 1UWAA 1CGTA 1TTJA 3CEPA 2ZICA 5CSYA 4EKJA 1IWPA 4OOZA 1QW7A 3CH0A 4RDYA 1RD6A 7REQB 1Z32X 1TTIA 1Z69A 1TJ0A 3CL8A 3WQOA 1WA3A 1L0PA 4JFUA 4H9VA 3UY8A 3GAKA 2NW0A 3R8RA 4DELA 1K02A 2W4XA 2ZBTA 4IGHA 1P1XA 2DH2A 1J10A 5IBXA 4FXSA 2X30A 3LB0A 3UJ2A 4ADSA 2PS2A 1E1CB 3EGJA 2RKXA 2OKTA 1V3MA 3WJSA 1EEPA 3KHJA 3GO2A 2X1UA 2BZNA 1UR3M 1MXSA 4ZOAA 4QQ3A 3P74A 2AMXA 2ZVIA 3MCMA 3BSGA 3S42A 2BY0A 3EX4A 2XVGA 1LM1A 2D24A 1TSIA 1HNYA 1PTAA 2A3LA 3ZVHB 3BW3A 4TXEA 1OC7A 2DZTA 2Z25A 2OR2A 3FVDA 5CZSA 3HPSA 2J9YA 1E71M 4PUDA 4S3KA 3XISA 5D03A 3W7CA 1FDZA 4TX9A 4WXZA 4JTKA 1UC4A 4NVTA 1YLVA 5C9RA 5LYRA 1JUKA 1MDLA 3TW9A 4CEUC 3RCMA 4DJED 4PMNA 2CLKA 4A2SA 4M1RA 4L80A 3ZR4A 2TPSA 1AL8A 1EP3A 2E77A 1TUFA 2VRQA 1E51A 3W88A 4XSLA 4PL1A 2HBVA 2CWNA 1JULA 3N13A 2NT0A 4DJFA 2BGQA 1XV8A 3RG6A 3LN3A 2Y7EA 1W3IA 1EQCA 1VGAA 3F2DA 3VFLA 1K7EA 2G41A 2Z24A 4GJIA 3VVGA 1JAKA 4P7QA 2CBJA 2XH2A 4A29A 5CPSA 1KXQA 1CXHA 3U7BA 3MSGA 2GLKA 1GZ1A 4GH3A 1T6MA 3MKKA 1FBAA 2PDKA 2PCQA 2BP1A 5BRQA 3TQKA 1VFTA 5M17A 3SCRA 3VCRA 3OJGA 1J01A 3NQDA 3N6QA 3BGAA 4HIBA 3VC6A 2PBGA 1Q8AA 1VFFA 3N2OA 3GU9A 1G1YA 2BXYA 2YCKX 4Q33A 3CO4A 3NZPA 2D2JA 3K5XA 3EMZA 5FKYA 4X61A 2NVAA 4IJRA 1JCYA 4GC3A 2WANA 3GAYA 1EPVA 5A8MA 7CGTA 1ITUA 4A05A 3B8VA 1VBRA 1S3HA 2QUMA 2VCCA 4AH7A 1V5XA 1TV2A 1OK6A 3BJSA 1ICQA 4ZVJA 3TYDA 3L2MA 2I5IA 4M5PA 3CB8A 1SO3A 1XLCA 2YZ5A 4B90A 1LF1A 3SIMA 5JBEA 4XBSA 1KR0A 3L5AA 3C86A 1PPIA 3KRZA 4KPLA 4Z0JA 2WMKA 1YE4A 1XSIA 4UTLA 1FVPA 1XFBA 3UXKA 1HL9A 3GG7A 3CMGA 3AHVA 3N6HA 2FVLA 3CAQA 5CG7A 3VIIA 3C2EA 2F7FA 4CCDA 1KGUA 1UHVA 4FA3A 3QSRA 5LIXX 4KCTA 5LIWX 2Z27A 4O57A 3C52A 2PLKA 2VDIA 2PGEA 5FEWA 3A3XA 4AWEA 4R53A 1NFGA 4JTHA 2ZUSA 4IG2B 4L4LA 5KTLA 4Z2KA 2BLEA 1VEMA 3P2VA 3V0SA 1UR0A 3QV6A 5FAJA 3QVQA 2ZXDA 3CUGA 1WZMA 2QDGA 4GRSA 3FXYA 4HOZA 3VM5A 3WEZA 3STCA 2HE8A 4LQ1A 3QTPA 4E3VA 3W23A 3TN6A 2UZ9A 3G1VA 4LGXA 1G4SA 4GD0A 4JIRA 1IIGA 4U3AA 2A3EA 2BVYA 1M1BA 4L6HA 2EXOA 1P0BA 2EPOA 4M6UA 1J2WA 3GHTA 3NOEA 1Y5VA 3KWSA 1X1ZA 3GG8A 4B5XA 1K8XA 2ZA1A 3QKEA 4WJEA 2PWVA 1EWEA 3O6CA 3VNYA 4QE4A 5CGMA 2QPXA 4LCQA 4OVXA 1D3CA 4O4VA 3C2RA 4N7QA 5DCBA 1TB3A 4O0KA 3QFEA 1PSCA 4OHQA 1BWLA 2OG9A 2E3ZA 4L4OA 3L2LA 1EKOA 2NX9A 2G3JA 4CD5A 4L1WA 3WK3A 2IPGA 3CWOX 3QH2A 1ZLPA 3HFTA 4XVDA 3SIZA 2WSQA 3G1SA 1GVFA 4FP1A 4GIAA 3W01A 2NLYA 4GVFA 3KZSA 2H9AA 1Q4WA 3N9SA 3JUGA 2GUYA 4A8IA 5AYBA 3IJ9A 1XGZA 4JTJA 2Y7FA 2HBXA 4WD0A 2QMKA 4CKQA 1G4EA 5EMLA 2FZMA 1LOQA 2WHKA 1M7XA 4YN5A 1VB9A 3K1GA 1QNRA 1OX4B 5JIWA 4W5ZA 3QYQA 5K9DA 1IEIA 5A6BD 1UYQA 5M2FX 2YA2A 4ZXLA 3I7QA 1F5ZA 2CLOA 3R94A 1VRDA 2BXZA 2GWGA 4N6FA 5MF5A 2Y7DA 1KCLA 4W86A 3VXGA 4QNWA 4GUGA 3MUXA 1C8YA 4HZMA 1QK0A 2ANUA 4WKFA 2I9UA 3W84A 4HJWA 3KDOA 4LJ3A 4O52A 1CGXA 3I3BA 3C2YA 4NZJA 4AWSA 4Q4OA 3EX6A 4IX0A 3OLDA 3OIHA 3UZXA 2E1DA 1NOUA 1NFBA 3V5OA 4BI6A 1R7OA 1QPNA 5EB8A 4ZSUA 1AQHA 3G24A 1VLIA 4Z1DA 4N0RA 3NIYA 2YXGA 4MNKA 4H1ZA 1TPH1 5M3WA 2BY3A 3BG3A 1RA0A 2H3BA 4UIOA 1V6UA 3WNKA 4Q6XA 2OLHA 2FPVA 6REQB 4XV0A 2BSLA 3V0UA 3GVWA 4HYWA 2GGJA 3LSCA 1HF6A 4E38A 2CLHA 1LROA 3GNPA 1JXJA 3N9RA 4DIAA 2A6LA 4AZCA 1SJDA 1SSDA 4BR1A 3FEMA 3ZT6A 1Q3NA 2J7GA 1QPOA 3EX3A 1MXGA 4KKXA 4MUPA 3AIBA 3N73A 5DY2A 4ZO9A 2F9RA 1GJUA 3R11A 2ZX6A 1FH8A 2DSKA 4RKAA 4Y2WA 4YHGA 2EQDA 3W71A 3NDYA 4I7VA 4QSHA 1GQKA 4JFVA 2PDWA 2XIMA 4V33A 2Y2WA 2VQTA 1M03A 4FLSA 3ZSSA 3CQ0A 4HK6A 3UPWA 1HP5A 2QCLA 4HHLA 5D32A 3ID7A 2ACUA 4PN2A 1MWOA 2ISDA 4JKMA 3VOFA 1E6NA 3T40A 3MU7A 4IHCA 4XD4A 1I0BA 3WK1A 4ZENA 3JR2A 3SUSA 1RR2A 3L12A 3L0NA 1I1XA 4HMNA 4NU7A 2V8ZA 1IQ8A 5DQPA 1P1MA 3H2FA 4UZUA 2G50A 2FJKA 3RX3A 2LLEA 3WNOA 4GY0A 4ACYA 3TSDA 1I2PA 1FWAC 1M3UA 1XJBA 5CXPA 2YLAA 3W2MA 1WP6A 4K38A 4DI9A 3N25A 4JFWA 2ZQ0A 2EG6A 3CNYA 1C90A 4J28A 3ECQA 1XIHA 4DZ5A 3AC0A 2DGAA 3QHOA 4ZQNA 1LQ2A 3CAWA 4K3ZA 4RDWA 5F2IA 4O12A 1NF0A 4FX8A 4ERGA 1A5BA 2TMDA 4NASA 4MY8A 4LS2A 2V81A 4U31A 1N7KA 4XUYA 5I3JA 4KF1A 5XINA 1XYFA 3GW3A 4J40A 2WZMA 1W5QA 5FF3A 1XYLA 4HU3A 1KO0A 4DJFC 4IPLA 2ZC8A 3LXCA 2E40A 3U3HA 3SGGA 4JQ1A 4H9MA 2J8TA 5C2GA 5LGZA 3RM9A 3HQOA 1IEQA 1RJRA 3SAZA 1XUZA 4ZL1A 1TR1A 3QHMA 3IGHX 1W1YA 3FGCA 1ZS2A 4PCNA 2WSRA 2Y5JA 4JY9A 5RUBA 3UERA 2PP0A 1CCWB 4AZGA 1WXJA 3DYOA 4GMEA 3TU9A 4QR6A 3LPOA 3AJXA 4X2RA 3PUDA 3SW6A 2OQYA 1BWKA 3AMKA 4GCXA 1FCQA 1ZBCA 5A6JA 4GQRA 5F2GA 1JPDX 1D7KA 5HBFA 3VOJA 1KTBA 1CGYA 2ICSA 4CUCA 3EB2A 3P82A 4NKCA 4B5NA 4IG2A 4MNJA 4PBGA 3TYUA 4D6EA 4JOMA 1DEDA 3NSXA 3WDRA 5AN7A 1EYWA 4EPBC 4CN6A 4GI4A 1Q13A 4P8XA 3RCNA 3HO8A 3S5ZA 4C5YA 1TZZA 3KP1A 4MB1A 2QQ6A 4RLIA 1VJSA 4LF2A 4CQCA 1K9FA 3GU1A 1KKRA 2ACRA 3BCJA 1DIDA 3AZSA 3M9YA 3NZRA 4C65A 3KWXA 4ZQPA 2QJIA 3GR7A 2PF0A 2GQAA 4CNUA 4FS9A 4K1WA 3DUGA 1K03A 3E2SA 1IT0A 4X63A 1P0KA 2CKSA 2UY2A 3ARQA 5CCZA 4LB3A 4UBPC 3NFUA 1MW1A 3G1RA 3ME3A 5F4SA 1JL8A 1IYXA 6TAAA 2QEZA 3LBMA 1LWJA 1R7AA 2J7EA 5FEXA 6TIMA 2ZUNA 3DN5A 2YBTA 1RP9A 2XFRA 4GYKA 2FJUB 2VELA 1OX4A 4N6EA 2XVKA 3LI0A 3W07A 2E1WA 3ZVIA 4WX2A 5F1UA 2NWRA 1H0GA 3IVSA 5JBFA 4J35A 4U3CA 3N2TA 2V2HA 4WJXA 4K8EA 4GUJA 3ZLGA 2D0GA 3PZIA 3PPHA 1NP0A 1I1WA 1WDWA 2FHBA 3Q4DA 4DWSA 3RF9A 2PDJA 3DG7A 3POHA 1YEYA 1DJIA 3BG9A 3ORWA 1T99A 4QAWA 1J0JA 3N3MA 5DT5A 4B5SA 1EDTA 2C71A 2Q3OA 4K36A 5FCZA 4WK9A 5AZ0A 3IVTA 4J1OA 3GNXA 1KLZA 1HP4A 1SPQA 5L9FA 2V9DA 3W1NA 5LNSA 1MQPA 4UTTC 3GXPA 3BCDA 2XFFA 1XC4A 1QR7A 2PDNA 1D3HA 4O54A 2BVDA 3W22A 5CG0A 1IT7A 4PUKA 3EDEA 2ZE0A 3AIQA 2G8ZA 3IWPA 1DIEA 1MW3A 3CAKA 1R2RA 4BY3A 1JG9A 3AXKA 2E0PA 4MGGA 1UR4A 3SSZA 1HUVA 1RCOB 1HZYA 4B2DA 1LOLA 4QLJA 3T78A 2VP8A 1FCBA 4H6RA 1PIFA 3FKRA 3HQ1A 4QFUA 3UFYA 4D6FA 4IZGA 1KA9F 4LAZA 1CPUA 3B9NA 2R1KA 3P84A 5LNVA 3TTYA 3FGCB 4Q8MA 3U2EA 4F8XA 4KEZA 3PP7A 1GOQA 4URIA 1B57A 3W87A 3O6DA 2XFYA 3RPMA 3RX2A 2XSAA 3RLVA 5LNWA 3LTYA 2OQHA 2R9RA 4REQA 4DJDD 1M7OA 3PG8A 4M0XA 3SCPA 3FYYA 3RRAA 2J88A 3CZGA 4LS1A 2A2IA 2XGBA 2YBUA 4OKDA 4AX7A 3WUGA 1YQ2A 3SY5A 1P6BA 3BOFA 3VYLA 2QPSA 2EO7A 4MWAC 3GR8A 4F9DA 4FPSA 1IE7C 3LOTA 4GGBA 3OBAA 3PJXA 1SSGA 4CEXC 1P0DA 2IQ0A 3G1DA 1OHLA 4TVDA 1HG3A 2Z2AA 4GCAA 1JD7A 3AMCA 2CU0A 2OB3A 1NDYA 3V7PA 5D8WA 4BCEA 2WZEA 3THCA 2DV0A 3UG8A 2Q6ZA 3TTSA 2HVMA 2R6OA 4U10A 1CXKA 3LRLA 3V18A 3W7RA 4V1XA 1XPYA 4K6AA 3AMLA 4GBUA 1ISWA 1Q65A 4A6GA 2WZHA 2WXDM 3GUWA 3E2VA 3W29A 1ZP3A 2YOCA 3UJEA 4XK2A 3H7VA 2OEMA 4D6JA 2CZVA 1SJBA 1XLDA 1A0EA 1GKRA 3UJSA 4JTUA 3RR1A 3W7DA 1TV3A 4RNFA 4J4KA 3BH4A 4LSBA 3TYBA 1WBJA 4IISA 4KEUA 3EX2A 4HTYA 1TMHA 1A50A 5BYWA 3UQNA 1UR8A 1FA2A 3KBVA 4AMCA 3WF1A 3VKAA 7PTDA 4J3TA 5I7GA 1T7LA 3M6DA 3KVJA 1Q6EA 1XF0A 2XINA 4E3TA 4JTSA 3V16A 2NVCA 4GXPA 2YLLA 1S5NA 1WKEA 2Z1XA 3I65A 2HPIA 4Q7NA 2VZOA 5A8PA 4W8BA 4V2XA 5GQBA 1NARA 3KOZA 5JH2A 1QK2A 3QR1A 3LCFA 1DWFM 5HK4A 4O4WA 1SUXA 5C5YA 1O1HA 1KV5A 3GIYA 1NOWA 4MZYA 1AMYA 1TRDA 1OYAA 5A6LA 2DZAA 1GG1A 3W9ZA 3GG0A 4D6DA 3OLEA 1O5KA 4XZBA 2VVSA 4BA0A 3BCFA 4AU0A 2UBPC 4ROPA 3MDWA 2FMOA 3ZVHA 3VIHA 1TZ7A 2ZXQA 3W7EA 3FS2A 2GK1B 3KBWA 4NP7A 3VOIA 3GVVA 1GOXA 3TOPA 3PJWA 3AALA 1ML1A 4JTFA 2B7OA 5BNKA 3CZ8A 2J66A 3D0CA 1IEWA 4ZO8A 1OGSA 4H2CA 3TCSA 4L4MA 3CZJA 4MKVA 1HGYA 4ICMA 4PZVA 2VZTA 5C55A 1BG9A 2VM8A 1QNOA 3LMYA 1I60A 2Z26A 1FXQA 4FXFA 5E93A 2J4GA 2B4GA 3INPA 3W7GA 4IGSA 2JF7A 3EA3A 1S2VA 4WZHA 5EGRA 1YPXA 4K8GA 3GYEA 1W5NA 1EUNA 3M0ZA 1WV2A 1JYXA 1LRQA 1T41A 1JF5A 3UVIA 1Q6QA 5CJNA 3EWZA 1PIGA 3T4CA 3WH6A 1OC6A 2VUYA 4R9OA 4DYJA 5D9PA 4G7FA 4IMEA 2VEMA 1Q63A 2BOGX 5M03A 5IHSA 1HO1A 5C9WA 1Y5XA 1VJZA 1KBBA 4DF1A 5H8UA 3R1ZA 4LV4A 1ZAHA 3VNIA 4GC4A 1JZ4A 1XI3A 5DRCA 1R2SA 3URQA 2ALDA 1OFRA 1V93A 1WDRA 3FNDA 4AUBA 4XAPA 3ES8A 1DJNA 3JU2A 4LF1A 3NEVA 2IQTA 4WOZA 2OT0A 4HMDA 4PTXA 4HA0A 2Y62A 4UQCA 1UP3A 1ME8A 1VPQA 5BZAA 3SDOA 3THQA 3APYA 2QULA 2FGLA 3LHUA 2BV9A 4JFSA 2VFDA 4ZR8A 3GTHA 3IJLA 2HDJA 3P14A 4R85A 1FY6A 2C16A 3F1QA 3A4JA 2I5QA 3C2FA 4YVXA 2FLIA 1MI3A 3W25A 1FOBA 1VFSA 1FHLA 3UYIA 1YRRA 1E43A 3ICJA 2O9PA 3NQBA 1VFOA 5AC7A 1VCVA 2PP1A 4WY0B 5A95A 1L8NA 2JEQA 2VL4A 1T8QA 1GW1A 3W27A 1A49A 2VFEA 3UA3A 3R43A 5I78A 2ZRWA 4FX7A 1RBOB 2C7FA 5CLTA 5C9ZA 1F6KA 1S2WA 4WOQA 5T91A 1XX1A 2KZHA 3GZ3A 1Q85A 2E8YA 3H4XA 3LCWA 2JQXA 2D69A 2J6XA 4F2BA 5C2CA 3Q37A 3VIPA 4JTDA 4F2UA 1N82A 2WZIA 3NQCA 4UQAA 3LTPA 1BXCA 3IAPA 1YYAA 1B4EA 1QOXA 2J7FA 1FHUA 1EX1A 3K4DA 3KL5A 2R14A 3TDFA 4WLCA 3MT1A 2PWFA 3CXOA 3ARRA 4PRRA 5I03A 4JXCA 3AIWA 1C7SA 3H2NA 4WGXA 1HXJA 4B2DD 1SR0A 4PTVA 1UUOA 4C6MA 4GIRA 4GVIA 3AROA 1H3GA 2VRKA 2OU4A 3EOOA 5AC4A 3M7SA 5G2WA 3MYOA 4H8NA 1TA3A 2PI6A 1UR2A 2GQ9A 4ACZA 5CPOA 4UTWC 1QNSA 4EF8A 1PWLA 4PMVA 1BXBA 3ITTA 1ZFJA 4BFAA 2X0YA 4RE3A 5FSDC 2DZUA 3MO7A 4EVZA 3NTYA 4IPNB 1JGMA 4MVAA 2WBGA 1J6OA 5KINA 1L6FA 4OBRA 1RVGA 3BLIA 5FJOA 3WK2A 3KZPA 1OFEA 4HNCA 5CBIA 2A3AA 4O17A 3PUEA 1XIFA 1DBTA 1A53A 2PC8A 4B16A 1LZOA 2XYLA 3TAKA 2GJXA 5H2ZA 4K68A 2X2GA 1SZRA 4TX8A 4WF7A 5ABFB 3SCVA 2OWXA 1ZUAX 5BXTA 2MNRA 2GSHA 3KCJA 4R9XA 1UKTA 4EK7A 2F8QA 3QR0A 3LPGA 3HQPA 2EBNA 2PDPA 1TV7A 4OV9A 2JE8A 3ITXA 4NSBA 3NSNA 2CBIA 1M7JA 2OXNA 3HF3A 3LYEA 1EUAA 2B31A 2PF8A 1TJ2A 4F0MA 2OSXA 4FZIA 4JYDA 1G7UA 3TTOA 1UKPA 4I3GA 4TX6A 3W1XA 4BQ4A 4C1NA 1REQA 3IJDA 1YNPA 2PC4A 1E70M 1DVJA 3OODA 5HJLA 5A6BA 1UWTA 5MHBA 4LAMA 4AZ7A 1DXEA 4FMVA 3W73A 4P7OA 3QV9A 1B3OA 3R0UA 1ADSA 4OT7A 4OGZA 3KBSA 3MDUA 4QRNA 3PBUA 3DKJA 1Y5WA 3OBKA 4RE4A 1KGXA 3GDMA 2F61A 4AD2A 3I7SA 2R1MA 3AS1A 3GDRA 4JTAA 5AOUA 4RPPA 4D1IA 3QJAA 2OVLA 2PUZA 3L5LA 2CKRA 3TJLA 1E3XA 4PCSA 5GJPA 1SGJA 1I75A 4AVNA 3MJYA 5BU6A 2QAPA 3CTTA 4F2TA 1V6WA 4MMWA 3TA6A 4UOQA 1FWJC 1EZ2A 4C7DA 1TELA 1B90A 1GZJA 2EPKX 4MFEA 4JGDA 2SFPA 1A4LA 4MDOA 1NELA 2FFCA 5E1QA 2HK1A 1ZJBA 1PEZA 2WHJA 1GQIA 1ZL1A 4JKLA 3WBXA 1W5PA 4HB7A 2YSWA 3VZYA 3QY8A 1JUBA 2GGEA 3CB3A 2ZZ6A 2JK2A 3O7UA 1ADDA 1XLLA 2VFIA 1CW2A 2ZKMX 4P8WA 2VT0A 2GUUA 4XAFA 1Q2RA 3GU2A 2B0MA 3O06A 3TJ4A 3GX9A 1XLBA 4N9DA 3NUKA 3BZGA 1VF8A 2WJEA 4H3DA 2IMRA 1IT8A 3KW3A 5JVLA 4DLMA 2ZZ1A 1W3TA 3AMGA 5I07A 2C1HA 4S3GA 1PS9A 3GR4A 1R87A 3QEZA 5D2WA 3HMCA 3B06A 4XB3A 3G22A 4UTIA 1FP9A 1F7BA 4YTUA 3OZMA 3PTDA 2CNCA 4QS5A 2YFOA 1B3ZA 2YYTA 2V3EA 4N9EA 3THAA 2CETA 5AECA 3GHSA 4H6QA 4C6KA 2XSXA 3LV6A 1E6PA 3N6JA 4D6IA 3MO4A 3RN6A 5ECVA 3W7MA 3H70A 3VILA 4M8UA 4I8YA 3PUGA 4C6NA 1GEHA 4JHMA 4DEFA 4Z1AA 3WCZA 4UTWA 4Y9OA 1XDJA 2CLIA 1AJZA 1MEIA 1YTEA 4PB4A 4GHRA 2FHCA 5A6SA 1JJKA 3PSWA 1PIIA 3TJIA 2GK1A 1KBIA 2I17A 4HU0A 4MWAA 3W26A 1X39A 2WLYA 4H7ZA 1IXQA 3KLLA 2XM2A 4Q4QA 3BZJA 4Q4MA 5DMNA 4ERIA 2Z00A 3BLFA 2NX3A 1HKMA 4C6LA 2A3HA 2WMHA 4OECA 2DORA 3G5EA 4Q4KA 3HQNA 1I2QA 1SZGA 1VD6A 4WHBA 4Z08A 2WM0A 2ZOXA 3TP4A 5G5IA 3S6TA 3MANA 4HHPA 4CLMA 3ENLA 3O3RA 2QF7A 4DJDC 1DIKA 1LUCB 4LUTA 2OQLA 1HQTA 3VI2A 5EMKA 2QUNA 1ZRQA 1OT1A 4JQAA 3GWQA 2FDMA 3W1TA 3WLSA 3RGTA 1P0NA 1W1ZA 5JBDA 4Q8UA 3VPLA 3H2OA 2VX6A 3FJ6A 1DJHA 4MTVA 2QCDA 1CIUA 1XHGA 5TQLA 1RXOB 3NM3A 1J79A 3WH9A 1EBHA 2VEGA 4OE7A 3VMNA 3PB2A 4DYEA 4JN8A 3U2OA 3MP3A 2QW5A 3VZZA 3AAMA 1FFQA 3RNDA 4LBSA 4JICA 1U5VA 4KEMA 3UR5A 4BK9A 3NOYA