3RLUA

Crystal structure of the mutant k82a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEAICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rluA00
5DXYA 3I7RA 2J88A 5LHFA 3O8AA 3TFCA 2AGKA 2E6YA 2Q8LA 2CW6A 3GDTA 1KM1A 3NQAA 3GYEA 1OX4B 3QPYA 4DEFA 1SU5A 3HG5A 1F6PA 2VFFA 3G0XA 4GRSA 3IIPA 5CZ0A 1RR2A 1AW2A 5BOOA 1FCVA 1LRQA 1FX6A 1DOSA 3FOKA 1R47A 3LB0A 4TIMA 3R5EA 5BMXA 2Q8ZA 3V75A 4JGDA 4UFHA 3QM3A 3NZ1A 2RDTA 1SQ7A 3A24A 3SJ3A 3OG3A 2JBMA 3T40A 3M1ZA 3W7IA 3M9YA 5AHLA 2ZQ0A 1B3OA 3IIOA 1I45A 5CZTA 1UBSA 3EWBX 2ZTJA 3STGA 2GQ8A 2A6NA 4MUZA 1SO4A 3NQ6A 2DP3A 4GE8A 1GOXA 1OJXA 4ZL1A 3O6YX 1CX9A 1TREA 3PSWA 1SPQA 3NVTA 2BZNA 3W1NA 4KWWA 5G1YA 5DCDA 1ZENA 3W2KA 5A8GA 1EUNA 3LHYA 2J9ZA 5HWNA 1I2PA 3GX9A 1IXNA 1GVSA 1K02A 2PRLA 3FJ6A 3SSJA 3M16A 4MY8A 4WY0B 3C6CA 2ZZ3A 4K7VA 5AYZA 1GT8A 5D30A 1TPDA 3WK2A 5CPNA 3FJLA 4LWWA 4ZQOA 3N2MA 1FY6A 2GPTA 3HJZA 2JKEA 4YL2A 3UD6A 1M5WA 1FXPA 3P80A 3S1XA 1H1ZA 4PC8A 3KRUA 4KFNA 4I9AA 1Z41A 3DH7A 4JY8A 5FF4A 4Y9AA 4TR9A 3B06A 3WFAA 1YYAA 5U7SA 5BMWA 1IIHA 5TQLA 1JQVA 2YXGA 1TPC1 2VFDA 3LCFA 4Z1DA 3UWUA 1YTDA 2NWRA 1FXQA 1W31A 4UTWC 3MI3A 5AC8A 4IMFA 3S5OA 3RU6A 4AF0A 4HIBA 3C56A 3RMJA 3LV5A 5LKYA 2J9YA 5FESA 1WOAA 2VOMA 5EA9A 1YDVA 5KINA 3UZJA 2VFIA 5EMUA 4JTEA 1LYXA 5AN7A 5DN1A 1L6YA 2ZZ2A 4C1LA 3EX4A 1FQ0A 4FF7A 4N6FA 3LDVA 5G4WA 2G96A 2ZFAA 4MPQA 2YYTA 3CC1A 4MVAA 5AHEA 3EKZA 4I7VA 3TMQA 1I2OA 5AFDA 1W5QA 5HINA 3A5FA 4DPPA 2FPVA 3BW3A 4O28A 3TAOA 1W8SA 4N6EA 4IOTA 5LNRA 1VYPX 3HG3A 3BVJA 3B05A 3N3MA 5LZLA 4GUHA 3VE7A 5H2ZA 5CPLA 4QSHA 1JQXA 1H50A 3CIWA 3EWZA 1EX5A 1L9WA 3TV8A 2JGQA 1QAPA 3C52A 1Y0EA 5DCEA 4M6VA 3RK8A 5BRBA 1NF0A 1G4EA 3LM7A 1MXSA 1OHLA 2ZZ1A 4XZ9A 4LU0A 2RFGA 4RJEA 2GOUA 3O16A 1WA3A 2YCEA 4YCOA 4JICA 3LRMA 5U4NA 5DXXA 3F1QA 3QRHA 2QJGA 3L5AA 2J27A 4RKAA 4AWTA 3P8JA 2XN2A 3FYPA 4HNTA 4DF0A 1A5BA 1DJNA 1XKYA 1VYRA 3LCIA 4Z1AA 4PEKA 4FNTA 3LOTA 1LBFA 3W75A 4BI5A 1WDWA 1TRIA 1I8JA 4XQ6A 4B5NA 3MP3A 3B04A 3F4WA 5F4XA 2NUXA 4ZQPA 2V5LA 2KZHA 1IXQA 2FJKA 3LI0A 5L9FA 2F7FA 1DKWA 4O52A 5AHFA 1GWJA 5LNVA 1NSJA 2HMCA 1IF2A 3C4UA 3IGXA 3W9ZA 5EYWA 3W7KA 3NAVA 1WX0A 1H61A 4YCPA 4NUWA 2VENA 3E49A 4CNNA 1XDLA 2X16A 1TJRA 3W72A 4DF1A 1ADOA 3AJXA 3GKAA 1XDMA 1ZCOA 1G7UA 3NOEA 1CW2A 2QDGA 1KTBA 2DZSA 2C1HA 4RZ4A 5LGXA 3E02A 2NWSA 2ATSA 3MHUA 3DI1A 1FWWA 1DQWA 3HGSA 4YWIA 3MBDA 1GEQA 1OX5A 2GQ9A 3GAYA 1ZNNA 4DPQA 4O15A 1H63A 3N34A 4I7UA 1XUZA 3NM3A 2E5CA 1P4CA 1W54A 1QFEA 2OCZA 1Q6OA 2WSYA 1OYBA 2CU0A 3NPWA 3N9RA 3KRZA 4A22A 1EP3A 2C14A 2EGZA 3TSMA 1SO6A 3W7RA 3W1XA 1ALDA 2YPIA 4WXZA 4FXSA 2JGYA 3EWWA 1RVGA 4BR1A 5D03A 4RXFA 3O63A 3W07A 4WX2A 2C15A 1PHQA 4N4QA 3TA6A 1GVOA 3L0NA 3KVJA 3P61A 1VCVA 4RZ5A 3UWQA 2ZZ6A 1TTJA 4OU1A 5FF3A 1C9DA 4C1KA 4DO6A 2ZBTA 2QJHA 4RXGA 4CQAA 4LS0A 3PR2A 4YXGA 1FDYA 3GVGA 1YTKA 2DZXA 4ZQCA 4FNUA 4DXVA 5D2VA 1OK4A 3OIXA 2O7SA 3TXZA 1F73A 4R53A 3SGUA 1W37A 2E5DA 3UYCA 5G4EA 1D3HA 3DFSA 3NL5A 3S1VA 3LGEA 3P5YA 2DZWA 2PRHA 2B7NA 4HNVA 1HFBA 4NJJA 2ZA1A 1OABA 4PH6A 4WY0F 1X6UA 1OYCA 2BXVA 4JTUA 3G1YA 2YYUA 4FX6M 3DENA 1I2QA 4QNEA 3P74A 5D09A 1GJPA 3NPVA 2JKPA 3PAJA 2YW3A 4O12A 1K7FA 3NZRA 1KFKA 2WSRA 5C2XA 3I7QA 2HS6A 3JR2A 1AG1O 4WZHA 3A22A 5D04C 5LNUA 2P10A 1Q6QA 4UTLA 2ISWA 3HO8A 4PA8A 1VJIA 2QCMA 1JRBA 5CPMA 2NUWA 2D73A 4ZVJA 4FNQA 3ZWTA 3GXTA 3I7SA 3LCGA 4LRSA 4NU7A 3RF9A 1TPUA 3EKLA 4RV8A 1H7PA 4O19A 5G1TA 1EPXA 5D05A 1L6SA 5F1VA 3W85A 4K36A 1OK6A 4KFOA 3HQ1A 2OX1A 4XWUA 1Q45A 5KITA 1ZAIA 1KLZA 5K4XA 2A4AA 3WK3A 4X22A 3QSTA 2QCFA 1TV7A 3QMRA 3BLEA 1W3IA 1KBIA 2Y62A 3LHTA 4NQ1A 4FIQA 3LLFA 1LTDA 2NXIA 4M19A 1B9BA 1PHWA 1TQXA 1WOBA 1I2NA 3KXQA 2VC6A 3OEXA 3E0IA 4M7SA 1KTCA 4O16A 5EPDA 1LOSA 4HNNA 3IVTA 3W7DA 2CLHA 2Y7DA 2JK2A 1AW1A 3GK0A 3QSRA 4AVFA 3NR0A 1CI1A 4S2CA 2UV8G 5HWMA 4Z1CA 2DZPA 2QCNA 2V5BA 1R2SA 4UCGA 3IV3A 2YSWA 1P0KA 3TKFA 3LRKA 1SO5A 3A21A 6ALDA 4QM1A 3TW6A 3VE9A 1W1ZA 3B8DA 3FFSA 3OVQA 2CZDA 2E68A 2ISVA 3NXFA 1YXYA 3QW4B 4HKPA 4IMGA 3SIZA 5HR6A 4UR7A 2R91A 2I14A 2Y6ZA 2FTPA 4HHPA 3UWWA 3LERA 1XCFA 5D02A 4IPJA 4RLIA 3T78A 3IIZA 1KV8A 2V2HA 1OX4A 1IXOA 1ZALA 3L66A 1A50A 1X1OA 4HN4A 2OMAA 3VNDA 3L68A 5D33A 1MEHA 1VGAA 1WBHA 4JYDA 4H4IA 3VFLA 5HR7A 4ZQRA 4NJHA 2QCDB 4WOZA 3STEA 4CNOA 1YLVA 3CTLA 3EX6A 3LBMA 2CFFA 2DZTA 1AMKA 1TV8A 3A23A 3GR8A 5CGQA 2CLKA 4XKYB 1SUXA 2EHHA 5G2HA 1L2UA 3B03A 3P82A 3B0UX 2PCQA 3MW7A 4A21A 1OFEA 3QZEA 2QEZA 3O1NA 4AWSA 4JX5A 4DBDA 1HG3A 3DHFA 4ZMGA 2FIQA 2YR1A 4RZ6A 3LI1A 1G67A 1MZHA 1PVNA 3P8IA 3NPXA 1SZNA 3W7CA 4CLMA 1S5TA 1TTPA 2CZEA 4OV4A 1SSGA 3VCRA 1DBTA 1VQTA 1OFAA 2PE4A 4JTLA 4EWND 3T44A 4AXKA 4DO4A 2FLIA 1SZGA 1O95A 2H6RA 3M5VA 3FS2A 2BX7A 4UTIA 1W5NA 2VXNA 3HPSA 3W87A 1QO5A 3RFAA 1DVJA 3L9CA 3I65A 1Z48A 3KX6A 4OT7A 4WY0A 1G4TA 2PURA 2Z2UA 4Q33A 3DZ1A 4GWEA 4ORIA 2VFGA 2Y7FA 3PUOA 3HGOA 3PUEA 4QAIA 4LRTA 2FPTA 1LBMA 3Q58A 3NQFA 3NQDA 1K03A 1AK5A 1OF8A 4MLJA 4ICNA 3DXIA 3PS7A 1AL7A 1ZY9A 1XBXA 3V1PA 3JS3A 1W5PA 1R2RA 3NNTA 3P62A 3R89A 1WBJA 4JTKA 2ZZ5A 1EUAA 1LOLA 1KFCA 2ZRVA 4JDBA 1OFRA 1N7KA 2A1YA 3K30A 1XXXA 4UTMA 3GDMA 1FWRA 3PBVA 1EA0A 2WQPA 2RDUA 5K2ZA 3VI2A 3HB9A 4Q32A 1TPB1 4E38A 2NV2A 4N4PA 3SI9A 5K9DA 3BW2A 4XTIA 2Y88A 4NNBA 1EB3A 1UB3A 4O10A 3TC7A 4AWUA 1GTEA 3UNDA 4IJBA 4UTUA 2QR6A 3GZ3A 4W9TA 2X30A 3STCA 2RHGA 1VH7A 2C16A 1SO3A 3NDOA 2WNZA 3MWAA 4NXKA 4S2BA 5AHNA 3RLVA 3EX3A 3W7OA 2R94A 1YDOA 3NM1A 4LNYA 3TNOA 2ZDRA 2RH9A 3UWZA 3NO5A 5HJLA 1JVNA 4GUIA 5DCBA 3SY5A 2WPBA 3FIGA 4MZ8A 1ICQA 2CLIA 3YPIA 4IUOA 3T55A 4NZJA 1RV8A 4UR8A 5G5IA 4N9CA 3THAA 2DJXA 3W1MA 3S42A 3HPZA 3GLCA 4KKXA 1KM2A 2X1RA 4KFPA 3UQNA 3C2RA 3IRDA 2CLEA 5CZSA 2O7QA 5DLCA 4OGZA 2ZRXA 2V2DA 1NVMA 2NLIA 2C13A 1QPQA 1XI3A 3S1UA 2GJNA 4CQ8A 3BO9A 3C0JA 4R7JA 3M5YA 1Q6LA 4UNLA 3GXNA 2QJIA 1RQBA 2WJZA 4XBSA 4K39A 2ZRWA 1XC4A 2YW4A 3TR2A 2GQAA 4JTFA 3M0ZA 3KOFA 2HS8A 2C19A 4U28A 4JXCA 3W22A 4TMCA 1LZOA 2PC4A 5CSSA 2V0TA 3HMJG 3OA3A 1V7YA 4FIRA 3NYZA 4U4MA 3G1SA 1BWKA 1TPVA 1YADA 1MO0A 4OBTA 4N9BA 5MHBA 3F4NA 4O50A 1JCXA 3S1WA 4EF9A 3QW3A 3LTPA 1DJQA 2Y89A 3Q94A 3LCHA 1W0MA 3IEBA 2ZRUA 2ABAA 4JTSA 5F1UA 5D38A 1MSSA 3PM6A 3FA5A 3STFA 4JTJA 4JX4A 5FEXA 1F6KA 1KM5A 1ZHAA 3QF0A 1FWTA 5KTLA 1LBLA 4M6QA 4IXHA 2E6DA 2YFNA 3NQ7A 1NF7A 2BSLA 5D32A 4NZFA 1HTIA 3HG2A 4UFJA 3TQKA 4K7YA 3S6DA 2CLMA 2BTMA 3LCLA 1QPNA 3C2OA 3G3MA 3L67A 2J24A 1GTHA 4LVFA 4O4WA 2A7NA 2V82A 4LOCA 3TQVA 4JR5A 5DBUA 5LGZA 2OZ0A 3PG9A 1DQXA 4AH7A 3G1HA 3IGUA 2GVLA 3W7QA 3A5VA 2QCGA 1M6JA 2R14A 7TIMA 3C3NA 3QMSA 3S5NA 1IGSA 4XUGA 1XBVA 1EP1A 1ZAJA 1M7OA 3ZS4A 2A21A 3MP5A 2A6LA 5F2MA 5CZJA 1YXDA 1TCDA 1AL8A 2VFHA 3QQ0A 5I3KA 2QCEA 3MBFA 4O54A 1TPWA 3BK0A 4UFLA 1KLYA 3T4CA 4MZYA 4ADUA 3CM4A 4ALDA 3C2VA 1G4SA 5K9CA 2QCCA 1W5OA 4L4LA 3SFKA 2Y85A 4A29A 3DFNA 3R12A 1UUMA 3NL3A 2A5HA 5D2TA 5DBTA 3TAKA 1F2JA 4JTHA 4QJ1A 1OFOA 3N2XA 1VLWA 3CIXA 2X1TA 4DBEA 1W5MA 2QUTA 1QOQA 3G8RA 2ATMA 1FCUA 2C6QA 2WSQA 3KRSA 5I3FA 4HNUA 2AQWA 3LLDA 5D2YA 1PV8A 1U83A 4IMCA 4OV9A 4O1DA 1BTMA 3PBUA 3CWOX 3W2MA 3U6WA 5SWUA 1QPOA 1JUBA 2A7RA 4N02A 4HPXA 1I2RA 3BG9A 2YFOA 4CCDA 3KHJA 3N9SA 2G95A 2NXHA 3USBA 4UFMA 4UTHA 3WK1A 5D2WA 2V81A 4JY9A 1ICPA 1S5VA 4Z0SA 1SW3A 4GUFA 4TU1A 1ZJIA 3OVPA 2EF9A 5FF7A 3W70A 1N8FA 4CQ9A 3KAOA 1LCOA 3DFPA 3G1AA 4LT9A 4UXDA 1Z44A 2NX1A 3ABQA 4MIMA 3M7WA 1P1XA 3THQA 1K8ZA 2X1UA 4UC5A 4CNPA 5F2GA 4HPJA 4DELA 3W3OA 4ORMA 4HSOA 1WV2A 5LNWA 4JS3A 2VEKA 4QIUA 1E51A 5AC7A 4XTDA 2C18A 3CHVA 4LS2A 3QC3A 4JN6A 4ONVA 1VHNA 4FXRA 5ABTA 1PCWA 3OHIA 1OG0A 2VFEA 4NVTA 3BGJA 3FKRA 1JUKA 1QCWA 1QNVA 1DL3A 2VEPA 3TUUA 2HTMA 1TYGA 1KTNA 1LRNA 1ME9A 3FEMA 1YXCA 3MI2A 1OFQA 1T0OA 2QUVA 1G69A 5I3JA 1KFJA 1R2TA 2RDWA 4O8RA 5E0KA 1NEYA 1VZWA 3EXTA 2GJLA 3GKFA 4E0CA 1VCFA 3W23A 4IPIA 3KVKA 3UWVA 5HNRA 1GPWA 1H7OA 3TROA 1FDZA 4IX2A 3LCXA 4GUJA 4OE7A 1T96A 5GVJA 1FBAA 2ZCGA 4EIVA 3NQGA 1QR7A 4K37A 4JIPA 3CU2A 3IGSA 3ABRA 2X1SA 1TIMA 4EF8A 1WAUA 1FWNA 3QJAA 5J5DA 2X2GA 3G1FA 3LBCA 4UTTA 1FUYA 1J5TA 4MYXA 2Z6JA 3I68A 3EXSA 3M41A 3WJYA 3P81A 2ZTKA 5C55A 1FCQA 3LXAA 2TSYA 5HMSA 4MJZA 3MUXA 3PB0A 1EEPA 2I9EA 3LCWA 1ME7A 5FEZA 4A3UA 1RQHA 2ISSA 6TIMA 1GG1A 1GZGA 4JTTA 5KZEA 3DFOA 3ZFHA 1X8FA 4M6PA 2YZRA 1I4NA 1YPFA 5BNKA 5I3GA 3DHDA 3D0CA 1XFBA 2H90A 3MHGA 3T7VA 3W74A 3WJZA 2VKZG 4NNAA 1XM3A 1SW0A 2CLLA 3P67A 1U5JA 1LORA 3Q37A 4JTGA 2NXGA 1NFBA 1F05A 3F03K 1PS9A 1QOPA 3NGJA 3W2LA 1YTEA 2J6XA 1OFDA 4A2SA 4P61A 2YGYA 5HWJA 4N2YA 1EWDA 2Y70A 3R2GA 1F74A 1Z42A 4PODA 4XKYA 4WQ6A 1LLZA 5F4SA 2W79A 1A5CA 3TSDA 3BGGA 3IIVA 2FB2A 1G7VA 3SECA 1DV7A 3OVRA 4OHQA 4Y8FA 3M5XA 1FDJA 1KW1A 1R30A 1KA9F 2YDAA 4M5PA 5CG7A 1X1ZA 3SZ8A 3E96A 5C6MA 2OT1A 4LUJA 2IQTA 4OWGA 3GNDA 4BI7A 4X9SA 3MHFA 3CLMA 3DAQA 4UMBA 4K8HA 4X3ZA 3BV4A 3SR7A 3GAKA 2V30A 4PFMA 3B0PA 3TJLA 3M44A 3NEVA 3S0CA 1J4EA 2VEIA 1LROA 3TU9A 1L6WA 2NX9A 4GNJA 3O07A 4FEZA 4FNRA 4RX0A 3ATYA 4UTWA 1H5YA 3NQEA 1YPIA 5F4WA 3W2UA 4NX5A 3NQMA 2Q3OA 3IIXA 1ML1A 4UIOA 4UNKA 2BLEA 4E2DA 3DFQA 3VKJA 4GJ1A 1VR6A 3ZR4A 1H7WA 1TB3A 3W2NA 4O17A 4OQVA 2GVJA 3ABSA 3R8RA 4KWVA 4Y96A 2ZZ4A 3W7GA 5DY2A 3BLFA 3GIYA 4WXYA 3KFTA 1VPXA 4IMDA 1JJKA 3W7JA 3O06A 3W1AA 1H51A 4J9JA 2DORA 3M6YA 3LX9A 3RLUA 3MJYA 1H1YA 4Z0JA 5F2IA 2Z0IA 3PWAA 4MYAA 4MZ1A 4MY1A 2Y7EA 2CWNA 4QNWA 2DZUA 3LXCA 1TTQA 1T99A 4RR4A 2H8XA 4LC6A 2XN0A 3NG3A 3SGZA 1TPFA 4JEQA 3DGRA 3DFTA 5AHIA 4GXMA 1O4UA 2QCLA 4GBUA 4DQWA 2B7QA 3ELFA 3O6DA 4IQLA 3LXBA 3C8FA 5T26A 3E9AA 3TXVA 3W83A 1TPEA 5KSWA 1M7PA 4GUGA 3G8EA 4UTTC 1XBYA 3DI0A 4AB4A 5FEWA 3G22A 3FLUA 1LLWA 5AB3A 3U2OA 3KVMA 1JRCA 4EOUA 4UTJA 1KM4A 1ZAHA 4LW7A 3W7PA 4NNCA 4JYEA 1JCNA 5DELA 1T8XA 3E12A 5EBUA 1H7XA 5AHMA 5K4ZA 3EWYA 3ABOA 3W71A 1A5AA 4IX0A 1OFBA 1EIXA 1QWGA 2H3DA 4NJIA 3S9YA 1PIIA 1H60A 1SFJA 3GDRA 1QDSA 4RK8A 3S8HA 1SZFA 4UMCA 3TSBA 1O94A 2ZA2A 3HIJA 4NJGA 3CT7A 4BK9A 5G2IA 3IVUA 3W76A 4JNMA 2LLEA 1VLIA 2FQIA 4LC8A 4FHAA 4XBKA 4FNSA 5EKYA 1XUUA 1TSIA 1LM1A 2W0UA 1GVRA 3N19B 5AYXA 3U8GA 2E09A 3MP4A 3W86A 4S1FA 2Y7GA 1K3UA 2A2IA 4K8EA 3DKLA 2OJPA 4QQ3A 3ANYA 1GG0A 2W6RA 4LY8A 1WYIA 4HSNA 2CZFA 3NQVA 4EVZA 3HGJA 1Q6RA 3CB8A 4LUIA 4Y90A 3G3DA 1KM3A 1TO3A 3RNDA 5FEPA 3NL6A 1B57A 4O1AA 3TW7A 3HF3A 1H7NA 3G1DA 4AAJA 2JKAA 2QF7A 4JTIA 4WUIA 2B4GA 2GVGA 5D37A 4LVDA 3HGRA 2WKJA 4O11A 5KMYA 4M7TA 1VHCA 2FFCA 3G18A 3Q2DA 3UXAA 4AMAA 3TJXA 4WOQA 4PL2A 3EX2A 3CWNA 1V5XA 3M5ZA 1H62A 3IVSA 2TPSA 1SR9A 2A7PA 2J9XA 3O15A 5D2XA 5FI8A 3TH6A 2DJLA 3BW4A 3TMLA 3EXRA 3MYPA 3LTSA 2H3BA 2TMDA 1THFD 3L0KA 4L4MA 3W1PA 3ZWSA 2RKXA 3QFEA 2BWGA 5C54A 1GVFA 2Z1BA 5H91A 2HSAA 2QCHA 3PULA 4LVAA 5LSMA 2ZRYA 5IM51 1DORA 1HUVA 5TIMA 4R34A 3L0GA 4G1KA 5CSRA 1KM6A 4FX8A 1TMHA 4AF0B 4LV4A 4O14A 4P2VA 1TTIA 1UUOA 1VC4A 5EL1A 1X7FA 5HULA 3W73A 4FNPA 3UZ5A 5K7JA 1WXJA 3O05A 2PRMA 3BLIA 1TRDA 1N55A 4IWWA 5DY3A 1W56A 4Z1BA 3MMTA 3UWYA 1GVQA 3C2FA 5IBXA 1G4PA 3CQ0A 1PCKA 4PCFA 1W3NA 1UJPA 3WJXA 1HL2A 3N73A 1KBJA 3WK0A 3L2IA 4MOZA 2Y63A 4O0ZA 4O0KA 3QPZA 4E2BA 2G5WA 4LVBA 3M43A 5I3IA 3GXPA 4FX7A 4MY9A 1DHPA 3B4UA 1JCLA 4JX6A 2ALDA 1O60A 2C3ZA 1F76A 3NQCA 1D9EA 3MYOA 4WD0A 1ME8A 1S5WA 3QYQA 5HQEA 5E93A 1RQEA 2FPYA 1MEIA 3W7NA 1GQNA 3I6RA 1Q3NA 1KFEA 1QMLA 2Q3RA 1HO1A 3PSVA 5AYYA 4K38A 3P60A 3FYOA 1W3TA 3L5LA 3DBPA 1TJPA 2R8WA 3TC6A 3TFXA 1VCGA 2QAPA 1VRDA 1BWLA 4O4VA 1B4EA 3W88A 1LOQA 1TPH1 1ZFJA 1EP2A 3TX9A 4IXXA 3W1LA 3PVFA 3LV6A 3BPWA 1KV5A 3AO0A 4IMEA 4LV9A 5KZMA 1SSDA 1K8YA 4QITA 4BI6A 1RD5A 4NJKA 3FKKA 1R46A 1XL9A 1XBZA 2A85A 1G6CA 3QQ1A 4GC4A 4O1CA 5HUOA 1OFPA 1SW7A 3L65A 3CPRA 3H54A 2V9DA 1KFLA 4I7WA 4UFIA 3LHVA 2NV1A 1P0NA 3A9IA 2Y61A 4ZZ9A 3G1XA 4ML9A 3W6YA 4BFAA 2YX0A 1J2WA 1O5XA 3TE9A 4JIQA 3W7LA 2A0NA 3NL2A 5TBOA 4H3DA 1LP6A 3EEGA 2WNQA 1GYLA 1OF6A 2ZZ7A 3BARA 2ZRZA 3TIMA 4UUIA 4CCEA 1ONRA 3HBLA 3UPWA 3NQ8A 1LDCA 5C5YA 3MI6A 2G97A 3EWXA 3HG4A 1JCJA 5AOUA 5L6UA 3R13A 4GFSA 3QEZA 3W7HA 2AAMA 3TQ0A 2E77A 1TQJA 4MJMA 3EB2A 2I1OA 1IIGA 2P0OA 3W1RA 4ADSA 1WQ5A 1HO4A 3HOJA 1JR1A 2F84A 2V8ZA 3W7MA 3G0SA 5A5WA 4TMBA 1JUEA 4O53A 4WJEA 1OVDA 5BW6A 3PUDA 1TV5A 1B4KA 1ICSA 3OBKA 3CEUA 4Z08A 1VS1A 2TYSA 4O1BA 2B7OA 3LTYA 2QDHA 1JULA 3PBWA 2ZYFA 2VELA 1KFBA 1BKSA 1O5KA 3H55A 3GNNA 3W1TA 3BG5A 3LHUA 5IBXC 3WJWA 4BWLA 1LRTA 3BG3A 2VEMA 4H6KA 1F5ZA 4ZQNA 4LVGA 4N9EA 4BF9A 5E1QA 4RCXA 3PG8A 5K3VA 3NA8A 3W1QA 2CLFA 3MO7A 1FCBA 5FF2A 3W7EA 2NZLA 1YDNA 1RZMA 4DF2A 4DO5A 4MFEA 3DU0A 1FWSA 5CPOA 3W1UA 3L5MA 4ZQMA 1VYSX 4LS1A 1GYNA 4TO8A 1K8XA 2WV8A 3P84A 2WO5A 2XFWA 3TK7A 5FF0A 3W2JA 4AHPA 4Y6GA 3P7YA 4X2RA 4PL1A 4D2JA 2GUUA 3H53A 3PBYA 1EWEA 4O57A 4FO4A 5LHEA 2FB3A 3M47A 3TDFA 3UXDA 2EPHA 3LHZA 1K7EA 1K7XA 5LNSA 3SW6A 5KZDA 4PTNA 3G1VA 2P1FA 2XN1A 3WJSA 2EKCA 3ATZA 4UMAA 3UY7A 2OT0A 4A2RA 3W84A 3S5YA 2E6AA 4MKNA 4UTKA 4CCCA 4O13A 4UFKA 4FB7A 1P5BA 1C29A 4TX9A 4AEOA 1NAL1 4ADTA 2WOQA 2DU2A 3TCEA 3EWUA 3G24A 3NPUA 3CEPA 3KVLA 3GB6A 5F2LA 3JRKA 2B0MA 8TIMA 1A5SA 1UCWA 2B7PA 5CKSA 2NX3A 2TRSA 2E6FA 2QCDA 5J5RA 1H7RA 4HT3A 4LTSA 2NUYA 1SFLA 2WNNA 4IGHA 3GDKA 1PE1A 2CLOA 3QMTA 4NX0A 3UY8A 5AC6A 4AHQA 1D3GA 1JCMP 1QPRA 4AHOA 4Q4KA 3EX1A 2E1DA 1MEWA 3N14A 3GR7A 5EY5A 3B0VC 1UASA 2FDSA 4K6AA 1AW5A 5K9XA 3DKJA 2C0AA 4MLRA 1IXPA 4JD4A 2ZA3A 3L21A 1RPXA 1OX6A 1SZEA 3GDLA 3PF3A 2EAWA 1KM0A 2CZ5A 1C8VA 4QISA 4MFDA 3PC0A 3HPXA 4JYFA 5I3HA 4JDYA 2Z6IA 4NXSA 3NQ2A 1S3HA 3P5ZA 4N9DA 2H8ZA 2QUUA 2V2CA 3C61A 2QKFA 3INPA 1A53A 4YMZA 3LRLA 2DZVA 5HUPA 1PL9A 1F7BA 3UPBA 4NT0A 3LHWA 2E5BA 3G0UA 3O6CA 5G2WA 4BWLC 1JCYA 1OYAA 3QH2A 3PY2A 1BEUA 2QAFA 4POCA 2ABBA 3C2EA 3PB2A 4R33A 4O18A 3S5ZA 4YLWA 1QO2A
chains in the Genus database with same CATH superfamily
3I7RA 5LHFA 4GYFA 3O8AA 1OIFA 2E6YA 3CL6A 2WVUA 3CZLA 1TV4A 4DEFA 1E6RA 1SU5A 1LJYA 4YWSA 1F6PA 2VFFA 2PDWA 1LRQA 1UR1A 4AQLA 4DUWA 1FX6A 1DOSA 3LB0A 3R5EA 5BMXA 4UFHA 3QM3A 3NZ1A 3WD4A 3A3XA 3U5YA 1QNSA 1SQ7A 1W3KA 3WO8A 1PTGA 1JPIA 3NWRA 4FMVA 3W7IA 2ZQ0A 4UZUA 2FZBA 2FZMA 1REQB 4DWSD 4Q8VA 3EWBX 4IIHA 2ZTJA 5E9AA 2XIQA 1RJRA 2GQ8A 2A6NA 4HCHA 2DP3A 3WLJA 1OJXA 3VIKA 4ZL1A 1DTNA 2BXZA 3GH7A 1IT8A 3UR7A 4IQEA 5GJPA 3SRHA 1T6MA 5G1YA 2ANUA 1ZENA 5A8GA 3LHYA 3N2BA 1IZCA 2XPKA 4L9YA 4C6BA 3ARQA 4A3QA 3NSMA 3FJ6A 4L4OA 3M16A 3SQMA 2J74A 2ZZ3A 4U3CA 2OEMA 1DIOA 1Q6FA 5AYZA 5REQB 1FWBC 3VYLA 3FJLA 4ZQOA 5B7ZA 1BFNA 4YL2A 5C8BB 1EO5A 1FXPA 2Q02A 3P80A 2AQVA 4PC8A 1ISWA 4GZEA 1EFZA 4B5VA 1KR1A 4Y9AA 4TR9A 3B06A 3WFAA 4J3WA 5U7SA 1WAWA 2DT2A 1IIHA 3VIHA 1TPC1 2J6VA 3RJYA 4CN4A 4ZCWA 1P48A 1YTDA 1XIEA 1FXQA 2CZVA 1LT8A 3MI3A 3WMSA 2VR5A 4LQ1A 4C6EA 3C56A 4ICMA 3RMJA 1CDGA 5LKYA 1TWZA 4LF1A 3OHMB 3T42A 5KINA 1ZB5A 5FJJA 4P8UA 4E4FA 1L6YA 4C7FA 3S2JA 2RGMA 2ZZ2A 4NYYA 1HQTA 5CJ5A 2HE8A 3Q45A 4N6FA 3LDVA 2C91A 4AUBA 2ZFAA 3CC1A 4NAFB 3W01A 1PKLA 4UCFA 4CNTA 4J35A 2IPGA 1F3TA 3BW3A 2C8NA 5BRPA 5LNRA 3BVJA 4ATLA 5LZLA 2GK1B 5H2ZA 1G01A 2J7DA 1XPYA 3PZGA 4B5TA 2FMNA 3WKZA 2VVSA 3TJIA 5IDIA 1TFVA 3R11A 3BE7A 2JGQA 3ITVA 3FGCB 1QHZA 4F0SA 1FWFC 3C52A 1Y0EA 4A8LA 3WBXA 2NVCA 3H6OA 3UP8A 5BRBA 1NF0A 3LM7A 1D3CA 4P8VA 1MXSA 1N2VA 1OHLA 5D8ZA 2R1LA 3PP7A 3BCDA 1WA3A 3HZ3A 1R38A 4KT2A 3VIJA 4JQ1A 3GS6A 3L5AA 2J27A 3SY1A 4AWTA 3P8JA 2BY0A 4H9XA 3TP4A 3A12A 4DBUA 1I0BA 3LCIA 3MCNA 4KCWA 4P5UA 2F9RA 4FNTA 2YCLB 3APYA 4AMCA 4BI5A 1TRIA 3MP3A 3F4WA 1EXPA 4AEEA 2V5LA 3ARYA 2F8QA 4GIEA 3G77A 1X96A 3GVQA 2NT1A 5CZKA 3WNKA 3IGXA 2HJPA 3GNPA 2AQOA 3W7KA 3N4FA 4LUYA 4GYKA 2CETA 3KRBA 1H61A 4YCPA 2PB1A 4IQDA 1XDLA 3FAXA 1W1PA 3W72A 4C6MA 4A05A 4R5EA 1HL8A 2BY2A 5I7GA 2Z2AA 1XDMA 3VOFA 1ZCOA 2Z7KA 1JZ4A 3BSHA 1L8PA 3T2OA 1XLIA 2ISFA 3M07A 3UA4A 1N8IA 2IXUA 2C1HA 1Q2SA 4KH2A 1J5SA 2WVTA 2NWSA 4JTDA 2YL5A 1PXGA 3V35A 3HGSA 3NURA 1CXFA 4BS0A 2IMRA 2ZX7A 3SIMA 1ZNNA 4O8AA 3HM7A 3SM0A 1XUZA 4Z2GA 2OCZA 2PC8A 1Y5XA 5CCZA 1BVWA 1ONWA 1VFMA 3N9RA 3KRZA 2OQYA 5CLTA 1SO6A 3W7RA 5BWAA 3TTYA 1US2A 1ALDA 2YPIA 4ZBCA 1XLAA 4GGBA 3RX3A 1XRSA 2JGYA 1W1VA 4DJFD 3QR0A 4BR1A 5D03A 3D46A 4DYJA 2C15A 4R88A 3L0NA 2ASHA 3P61A 1TV2A 2ZZ6A 1EIBA 3LPPA 1C9DA 2CESA 1EJWC 2WMJA 3ZR5A 4RXGA 3TLLA 4LS0A 1E9YB 2VGGA 2YCJA 3H22A 3OIXA 5A69A 3TXZA 5CSUA 2ZXDA 5I3DA 2PWHA 1AH3A 2D2OA 3MQTA 3UYCA 5CH9A 1D3HA 4US6A 5E09A 3NL5A 2ZUTA 3S1VA 3P5YA 2DZWA 2OYLA 1VAHA 7ENLA 9XIMA 4HHLA 2ZA1A 4DI9A 1OABA 4FOKA 2O4MA 4WY0F 4M81A 2QS8A 1GKQA 4AYSA 3NGFA 3WDIA 1VBRA 2PEVA 3P74A 4B90A 3PZ9A 2JKPA 5I07A 2YW3A 4O12A 1K7FA 3D3FA 3NZRA 2WSRA 3CZGA 1OCBA 3ID7A 4WZHA 3A22A 2YJQA 4Q6JA 5A8QA 2P10A 4PA8A 2FVLA 2XGZA 2XM2A 2HBXA 4N7QA 3M0HA 4LY4A 1QHPA 4HSHA 4ZVJA 3TZNA 4RE0A 3LCGA 4LRSA 4QAWA 1TPUA 3WF3A 1HVQA 3CHDA 4RV8A 3TQPA 2Y8VA 3CMGA 4K36A 1UKTA 4MJ4A 1BG4A 4XWUA 3WNLA 5KITA 1S2AA 3QMRA 3F5JA 1OC6A 3FCPA 3GTXA 1W3IA 1KBIA 2Y62A 1HF6A 4O0QA 2NXIA 1B9BA 1PHWA 2VOTA 1BVZA 3RLHA 3BH4A 1WB0A 4BEUA 3VM7A 2VC6A 3E0IA 4O16A 4AD4A 3P6LA 2JK2A 4IPPA 4AVFA 3QSRA 1CI1A 4WJXA 4O1FA 5HWMA 4Z1CA 3M0IA 3CAVA 3IV3A 2YSWA 3TKFA 3LRKA 1SO5A 4B5SA 3TNBA 2XZ9A 1VFHA 3UR8A 4QM1A 3CUXA 3VE9A 1N82A 1RJPA 3OVQA 2E68A 4AY1A 4HK5A 1I1XA 1L0PA 3SIZA 4UR7A 1QK2A 1E6NA 1UWQA 3GVRA 2O55A 3PK7A 2NQJA 1XISA 3QGKC 3UJ2A 3UWWA 3LERA 3NZQA 3G5EA 5IHRA 2WMIA 1OX4A 1IXOA 1A50A 1X1OA 2HDJA 3L68A 1EO7A 1MEHA 1HP5A 2FGZA 4WDUA 4WVXA 4JYDA 5HR7A 1LT7A 2F6UA 3CT2A 5ABFB 3EX6A 4OOZA 4XKYB 3TZFA 1MI3A 1L2UA 3ARTA 3P82A 3MW7A 3XIMA 4JX5A 2YA2A 1PVNA 3P8IA 2WHJA 1T40A 3TCSA 1SSGA 4QRNA 4H19A 1J12A 3VCRA 1DBTA 1RJQA 4KCVA 1J0HA 4J1OA 3BGAA 4YTSA 3UBPC 2J7BA 2FLIA 1U2YA 1UG6A 4Q8PA 4X0NA 1AQHA 3M5VA 3KS5A 2NQ5A 3AXHA 1CLVA 3KCJA 1M1BA 2VXNA 1K70A 1Y7VA 1DVJA 3AS1A 3FJ4A 3I65A 3L9CA 1VPQA 1Z48A 5JQ9A 2R82A 3UCDA 2PURA 2Z2UA 3L7RA 4MF4A 3H23A 4ORIA 2VFGA 3PWGA 2Y7FA 3XISA 1FP9A 4QAIA 5EGRA 3Q58A 3NQFA 3NQDA 1K03A 4M1RA 3KOXA 4MLJA 4ICNA 1ISXA 2WMGA 1ZY9A 1XBXA 2V67A 3V1PA 4X63A 1DWAM 5FJOA 4CEUC 3RPTA 1KFCA 2A1YA 1FWRA 1RA0A 3FEQA 3RGTA 4KIRA 1LUCB 5K9DA 3SRFA 4HYVA 3NUKA 4DAIA 3SUVA 4O10A 4TOQA 3TC7A 1GTEA 3UNDA 2ON3A 4UTUA 3GZ3A 4W9TA 2X30A 9CGTA 2RHGA 1VH7A 1J9YA 1SO3A 1KQZA 3MWAA 3C0QA 4S2BA 3SFWA 3EX3A 1OD8A 3RX4A 3B9EA 2PGWA 1ITUA 2GSEA 3A13A 1JVNA 5DCBA 3FIGA 4MZ8A 3RCMA 1ITXA 1IEXA 3L12A 4IUOA 4P7QA 5EMLA 1JZ7A 4NAEA 5CBIA 3THAA 1UOKA 3S42A 3HPZA 3GLCA 3VZXA 3UQNA 1BQCA 2XG9A 3IRDA 2O7QA 5DLCA 1GONA 4XUYA 3CHCA 1XIBA 2NLIA 1CGVA 3AWNA 3K8LA 2GJNA 1RP8A 2FGBA 2QJIA 1W91A 1TV3A 3AIWA 3G1RA 2AAAA 4XBSA 1M7JA 2PTYA 2ZRWA 1XC4A 4HBKA 4L5ZA 1JD7A 3TR2A 2PZ0A 3ZSTA 1MNZA 2OXNA 3CASA 3HMJG 4FIRA 3NYZA 3F4NA 2FH8A 4FS9A 4GIRA 4JFWA 4O50A 1MUMA 2EJAA 1JCXA 3S1WA 4FI4A 3LTPA 3EOOA 4AD5A 3GTNA 2ZRUA 4JTSA 3WQEA 1MSSA 3W27A 1NDYA 3FA5A 3STFA 3ZJKA 4JX4A 1NDZA 2ZC1A 5FEXA 3OQEA 3QTGA 1ZHAA 1NWSA 1CGTA 1BYCA 1FWTA 4AD3A 1V03A 4M6QA 5BOEA 1A5UA 2BASA 1WZKA 3TQKA 4K7YA 1H41A 4QX4A 1C8QA 3UJRA 2J24A 2FHFA 3USZA 4D72A 3BTNA 1TZ9A 5E70A 4WLCA 2J25A 3RR1A 3PG9A 2ZXBA 2GJXB 2WHKA 3G1HA 3IGUA 1XH1A 2GVLA 3A5VA 1OB0A 2QDDA 4FP1A 7TIMA 3ZOAA 5DMNA 3QMSA 4ROPA 3UCCA 4B5WA 4W7UA 3VCCA 1XBVA 3ZT5A 5BU9A 3OBAA 3QR1A 4QDMA 1EGVA 1UBPC 3ZS4A 3MP5A 4AVOA 1AA1B 2ZWZA 5CZJA 2GZXA 1JYNA 1XINA 4NI3A 3QQ0A 5I3KA 2ISDA 2WBKA 4DWSA 3ES8A 2WMHA 3BK0A 2WVSA 1HNYA 4J28A 2PDNA 3T4CA 4JEJA 2PU0A 3C2VA 1G4SA 4YTRA 1C92A 1BRLA 1QWKA 2YB1A 3CHEA 4L4LA 1W1B1 1XSKA 2V3EA 2Y85A 3AYTA 1UUMA 2VTFA 5DFAA 1CBGA 4I5XA 4JTHA 3WLLA 4QJ1A 2BNJA 2PP0A 4E6MA 1UQYA 4W86A 4JQ2A 4TX6A 3ALGA 5CGMA 3NDYA 1W2PA 4ROQA 2YL6A 1VFLA 3QGVA 2AQWA 2WC4A 3MKKA 1F6YA 1U83A 4GQQA 4C91A 3W2MA 5SWUA 1QPOA 1XLKA 1JUBA 3OU8A 4HMEA 4IIGA 5HPCA 3RM4A 4AZ6A 2WJEA 3QY7A 3CJPA 4YNGA 4UFMA 4UTHA 4A6GA 2V81A 1UMYA 1WDRA 4ZXOA 1ICPA 1S5VA 4US5D 1SW3A 1YNQA 3VABA 5HPOA 3BAKA 3W70A 5ENLA 4AIOA 1GK8A 1WE5A 2V5KA 4UXDA 1Z44A 2DVUA 3MJMA 1J6OA 1PX8A 5EB8A 3H21A 2EPNA 4CNPA 1R6WA 4HSOA 1XIGA 5D9OA 1LQAA 1SMDA 4XTDA 2C18A 3CHVA 1EL3A 4ONVA 2XZ7A 4QQUA 4QLKA 4Q22A 3OHIA 1G0CA 4NVTA 1JUKA 4C5YA 1QNVA 3CH9A 3MUY1 3TUUA 2HTMA 1GKRA 2POZA 3U4FA 3WDHA 3F2CA 2PP1A 1TVNA 4X61A 5AYBA 1V6TA 3MV11 1KFJA 3W53A 1TVLA 3K4DA 2BHUA 1QW7A 2GUYA 5E0KA 3QYSA 3EXTA 3SCVA 1GEHA 4AVNA 3W23A 5TNVA 1GPWA 4MSSA 3TROA 3LCXA 1T96A 3LBOA 2ZCGA 1QR7A 1W3LA 4JIPA 2PAJA 1TIMA 1WZMA 3UXKA 2OG9A 4RE2A 3EDEA 2X2GA 1IQ8A 1M41A 3IV8A 3GNXA 4CD8A 3QHNA 4MYXA 1GOWA 3P81A 3NIYA 1FCQA 3LXAA 2TSYA 5HMSA 1FHLA 4ES4A 3WBWA 4PSRA 3PB0A 3GDBA 4OBRA 1FWHC 3DDMA 3GG7A 6TIMA 3CO8A 1GZGA 3BJTA 3ICJA 1BD0A 5BNKA 3DHDA 1R5YA 1VB9A 2H90A 2HISA 2YDSA 1B3ZA 1SW0A 3O7UA 1LORA 4LB3A 3Q37A 4B2DD 1NFBA 2PDPA 4LCSA 5M03A 3OZPA 3NGJA 3KBJA 4XIAA 2PDLA 1KR0A 1P7TA 2VWTA 4PODA 3W37A 2Y1HA 4C6QA 2PLCA 3BGGA 4CNSA 2FB2A 3BAIA 3IJ6A 2WANA 2XFYA 3MANA 3RM8A 3M5XA 1KA9F 5DMMA 3VNYA 5C6MA 6A3HA 2OT1A 4LUJA 3VXGA 3UA3A 4Q8OA 4QXIA 4X9SA 3GVWA 3MHFA 3PFMA 4X3ZA 1QI0A 3GAKA 1RD6A 3NEVA 4R9OA 1LROA 4XD3A 1ZRQA 1L6WA 4FEZA 1H5YA 4JPGA 2YOCA 3VIOA 2TODA 1XF0A 3SQLA 1ML1A 4UNKA 1A0DA 2BLEA 1POJA 1NFGA 4GJ1A 2DSKA 3ZR4A 3VX0A 4O17A 5AKQA 1B1YA 4G1NA 2GVJA 1KNWA 3BURA 3R8RA 1KO0A 2ZZ4A 3AMLA 5DY2A 2XDFA 3W7JA 3O06A 2PDGA 1H51A 4E8CA 3OB8A 3RLUA 1CGXA 4XVDA 3CH0A 2VP8A 5EMKA 4MYAA 5TF0A 1H09A 1XIJA 2CWNA 3U2ZA 2DZUA 3LXCA 1TTQA 4G8TA 3KP1A 1JZ6A 4YPJA 4LC6A 3AIRA 1TPFA 1ZP3A 3DGRA 2OLHA 3QZ6A 5DANA 4GXMA 1O4UA 3CTTA 3P93A 3W02A 4ILSA 5HATA 2OB3A 4IQLA 3WQ8A 5T26A 1J0YA 3VOGA 4UTTC 1Q4WA 1V79A 3POHA 3G22A 3FLUA 2PLJA 1JXKA 5T91A 3KVMA 1GVEA 4EOUA 3GU2A 3W7PA 1XG4A 2PDBA 3NDZA 4HA3A 5F7UA 2YDQA 4NNCA 1JCNA 5DELA 1E3XA 1EF2A 1VEPA 2OZTA 5K4ZA 4H8UA 3EPOA 2JEPA 1E9LA 2A3AA 4S3DA 1EIXA 3N18A 4LYQA 4IICA 1CPUA 1SFJA 4YYCA 1UR3M 4RK8A 3OLGA 4UMCA 4WSJA 1WNOA 1P0EA 3GY1A 2PGFA 1FH7A 3ITLA 1CWYA 1C7SA 4XBKA 2DH3A 1XUUA 4ZB0A 1TSIA 3WQ5A 2E09A 1E71M 4S1FA 2DPEA 3KEHA 3DKLA 5A94A 2OJPA 4HK7A 1GG0A 1PYFA 1O7AA 4LY8A 1XQKA 3Q4DA 2CZFA 3NQVA 3HGJA 4W84A 1Q6RA 1OBAA 1DP0A 4PE8A 3G3DA 3PTDA 3RNDA 3NL6A 3VGBA 4JN7A 1SFSA 1H7NA 4YVVA 3LPOA 2QF7A 1VEOA 1QNQA 3ZVHA 5E6YA 4J3UA 3TYEA 4LVDA 2WKJA 3ISIX 4GVIA 4NF7A 4KGLA 2FFCA 1KD0A 5FOOA 4HTYA 5I03A 4BF7A 4Q4OA 4D1IA 3EX2A 3CWNA 1V5XA 1RP9A 4NHVA 1H62A 1KRCC 4BQ3A 1XCWA 4HVXA 3OVGA 3BLKA 4IFRA 3CV6A 3GG0A 2DJLA 3BW4A 3TMLA 1ZBCA 3LEPA 1A49A 1CXHA 1OD0A 1V0KA 2XIMA 1THFD 3CV7A 3IJDA 1OINA 3ZZ1A 3W1PA 3PZVA 3MUIA 2WZEA 1SJAA 1GVFA 2F61A 1ZPTA 5RUBA 3OZOA 4IH3A 2HSAA 5CJNA 2ZRYA 3B8IA 1DORA 1WDPA 1Y8BA 5CSRA 1KM6A 3QZAA 4D6IA 4P2VA 5HJYA 1UUOA 1VC4A 2P50A 1UW9A 5HULA 3WF2A 5K7JA 2PRMA 3BLIA 4IWWA 4GZJA 5DY3A 3THCA 1QK0A 1PIGA 2I7GA 2WSPA 3UWYA 3C2FA 1G4PA 3WENA 3TONA 5IRPA 1B3YA 1UJPA 3UZWA 1R7AA 3APTA 4GK8A 4Y9NA 4E2VA 1A0CA 3M4HA 5HAOA 5I02A 3QPZA 1NOFA 4U31A 2V6AA 4AY8A 3M43A 3NZGA 2CNCA 5I3IA 4MY9A 1IR2A 1GQKA 3NQCA 2PDCA 2Y8KA 1XR2A 3MYOA 5HOSA 2OKTA 7ODCA 1S5WA 2ZVRA 1JPDX 5E93A 2FPYA 1R3QA 5XINA 4IG2A 3W7NA 5HBFA 3GO2A 3BICA 3SDOA 3W25A 2QYGA 3B9OA 3PSVA 4CQCA 3FYOA 1J2BA 3TC6A 4K1GA 1ODZA 5EBAA 1VRDA 1DXEA 2D23A 1LOQA 3OLIA 2CBUA 4J3VA 5MKGA 5IFPA 3GFYA 3PVFA 4PUNA 3W38A 5JBDA 3AO0A 4IMEA 1K8YA 3B9NA 4H9YA 3MDUA 4BI6A 1RD5A 4NJKA 2DT3A 1WKEA 4O1CA 5HUOA 4CQBA 2PD9A 1DE6A 5LA1A 4I7WA 3JVAA 4E2OA 4UFIA 1EBGA 4PTMA 2OR2A 1P0NA 2V5JA 3SN4A 2Y61A 3U7BA 4LEQA 1BHGA 5FJIA 2GLKA 2DVTA 1B9ZA 3E2RA 3S9IA 4DUVA 3TYZA 1O5XA 1OGGA 2A0NA 3NL2A 4DXKA 4H3DA 2VEGA 4LALA 1GYLA 5EMJA 3BARA 1MFVA 1V3IA 3TIMA 3N04A 4CCEA 3HBLA 4V27A 3UGVA 1VPYA 2VDHA 1E4NA 1S5MA 5JBFA 4RZBA 4CVUA 2GJRA 2G97A 1XDJA 2AMGA 3HG4A 5JH2A 5L6UA 3R13A 1K6WA 1UMLA 5DQPA 3SCWA 3H7RA 2GWGA 3QLLA 3W1RA 1HO4A 3S3GA 3AXMA 3HOJA 2F84A 4D8AA 3G0SA 4TMBA 4FLSA 2I5GA 5BW6A 3JU2A 1UD8A 1W9VA 5M3WA 4K1WA 3A6OA 1PKMA 4H2HA 3UEQA 4ZENA 4ENLA 2B7OA 4MMWA 1J0JA 3B8TA 3PBWA 2YA0A 2VELA 4CUCA 1KFBA 3SJNA 3GNNA 3LHUA 1E73M 1KXTA 1GCYA 2VEMA 1F5ZA 4LVGA 1AJ0A 4N9EA 4C6CA 5E1QA 1DWFM 2O4QA 1XIDA 4RCXA 5E6ZA 1UD6A 5K3VA 5C9UA 2YKKA 1KCKA 4RDZA 1JF5A 3GC2A 4RW5A 2WKGA 4MAVA 1PEZA 3L5MA 3ZLFA 4OIFA 3CUFA 1X8CA 3BQ5A 4TO8A 3P84A 2XFWA 4AZIA 1W6TA 3P2VA 4PULA 4Y6GA 2XISA 4L1XA 4ZO6A 3VU2A 1ELSA 1ZJBA 1H0IA 1L2QA 1V51A 3PJWA 4EXAA 1UHVA 1XRVA 5HA7A 3WX7A 3LHZA 1SZRA 1VJSA 4JZ5A 4HZ8A 5LNSA 3SW6A 4D8LA 4PTNA 4ZR8A 1FKWA 2P1FA 4MB1A 3MC5A 1B5TA 3LUTA 3W84A 2HZGA 2PDQA 4UTKA 3VIPA 3OGVA 3VDHA 4IHCA 1LF1A 4ADTA 3OW1A 2DSWA 2WOQA 4I8DA 4PUMA 3NJ3A 4QDWA 1DWGM 5F2LA 3WFZA 3KS6A 2W67A 8TIMA 3ZIZA 1UCWA 2WC7A 2B7PA 5CKSA 2E6FA 2QCDA 1H7RA 4ZA0A 4U5IA 2NUYA 2EG6A 2PTZA 2WNNA 5DO8A 4QGCA 3OO2A 3AI0A 3UG5A 1D3GA 1DJGA 2YXXA 1QPRA 2WQDA 2E1DA 3N14A 5I09A 3AIVA 4B9YA 3DKJA 2CHNA 4MLRA 4JD4A 3L21A 4NIRA 1WO2A 1JD9A 3N9KA 3GDLA 3WQ4A 3ABXA 4HU4A 4GYPC 4QISA 5BYWA 4KWOA 3PC0A 2UY5A 1S3HA 3EPNA 4PUWA 3P5ZA 5A6TC 2QUUA 4DO7A 2V2CA 2C79A 3D3AA 3C61A 1ADDA 1A53A 1E0UA 3LRLA 1I75A 2DZVA 1MVYA 3DYOA 1UP3A 1BWVA 3EDDA 4NT0A 4FAMA 2WYSA 3AIBA 5G2WA 4C6FA 4BWLC 1OYAA 1Q8AA 2AGTA 3EA2A 4US5A 1SJCA 4PB4A 1OGBA 4POCA 1E9ZB 1EJTC 3KL0A 1JL8A 3PB2A 4O18A 2W27A 2E25A 2XVGA 3APGA 1Q6EA 4CVWA 3TFCA 3UW6A 2HXUA 1KRAC 2OO6A 3NQAA 1GQLA 3GYEA 2WMIB 1OX4B 3QPYA 4GD0A 3UG8A 3HG5A 4GRSA 2Z25A 5GPRA 1RR2A 4MM1A 3SURA 1A47A 1ONXA 1X1NA 3FOKA 1J79A 3KBWA 4H9MA 3TC3A 2VUYA 1C8XA 3BZGA 3ZT7A 2HWGA 3QHOA 6ENLA 1V08A 3OG3A 2JBMA 3RRAA 3T40A 1NELA 4KETA 1F3WA 2HVNA 3WUGA 5CEWA 4UQBA 1CGUA 2X05A 3IIOA 1UBSA 2FH6A 4D1JA 1EJRC 1US3A 3LGGA 1XLJA 5GNZA 1SO4A 3MMUA 4GE8A 1J93A 3B40A 4UOZA 1MNSA 5EFDA 3A4AA 3NVTA 2BZNA 1XYBA 4MGGA 1WDQA 4Z2HA 4XD5A 3L4XA 3TLQA 2J9ZA 1TCMA 5HWNA 3WQ6A 3F2DA 2PRLA 3SSJA 1Q4NX 4K7VA 1I1WA 1TR1A 1TPDA 3WK2A 4LWWA 3IANA 3EKGA 2PDIA 1RBOB 1XLLA 1QBBA 3RITA 3HV9A 3UFYA 3S1XA 1TKKA 3FY1A 1H1ZA 1D8CA 2DGAA 3KRUA 4KFNA 2FZ9A 4I9AA 2DQWA 1AODA 1YE4A 4IPLA 4HHMA 3AXKA 3KBSA 5TQLA 4MWAC 2YXGA 2VFDA 4B2DA 3LCFA 4LCRA 1RBAA 4H6RA 1Q2RA 3S5OA 3RU6A 4HIBA 4QR6A 2FZ8A 3MTWA 3LV5A 5FESA 5EA9A 1YDVA 1MXGA 3UZJA 2VFIA 5AN7A 3MB9A 1U5VA 2XJ7A 3WF1A 4FF7A 2EG8A 4Z2LA 4MPQA 1ZBWA 4A8RA 3TN3A 2FTYA 1W5QA 3MKVA 2FPVA 4O28A 3TAOA 4N6EA 1VYPX 3B05A 1UP2A 1QT1A 3N3MA 3HFTA 4IUGA 2P8CA 2UBPC 1JQXA 4Y9MA 2ZXQA 1EX5A 1ZS2A 4LBSA 4Y9PA 4ECLA 3TV8A 2PDMA 2ZE3A 5ECVA 2OEKA 4WSKA 1BVNP 4H6EA 3DUGA 3EYPA 1E0WA 1G4EA 3M0KA 4GX8A 1UR9A 4KGJA 1K6AA 1LL6A 2ZZ1A 3EA3A 2VCBA 2RFGA 4RJEA 2GOUA 3O16A 4YCOA 4IIDA 3ZT6A 3SCUA 2ZUSA 3F1QA 4DLFA 2AL1A 4AD2A 4HNTA 2OODA 1VYRA 1EKOA 3OGRA 1LBFA 4RE3A 2W91A 3CZKA 1WDWA 2AL2A 2DSZA 2NUXA 3L23A 3LI0A 5L9FA 4PZVA 4CQDA 7PTDA 4O52A 4AIBA 5AHFA 5LNVA 1HIZA 5HNTA 4GYJA 1O68A 3MDWA 1IF2A 4AX7A 5BXPA 3CUHA 1E40A 2Q71A 3ME3A 2QGHA 3RO8A 3ZMRA 2QHAA 2OELA 3GE7A 4LNCA 4NUWA 1PDYA 3MCOA 4CNNA 3TVAA 4IF2A 1E4LA 1TJRA 3BXWA 2GL5A 3KP0A 3GUWA 5EU9A 4U5KA 3NOEA 1RLDA 2G3IA 3SQSA 2PF8A 3GC5A 1JZ5A 2DZSA 3Q67A 4LEFA 3K5XA 4R7OA 3BAWA 3MHUA 1DQWA 4I6KA 3VDCA 3MBDA 5T9CE 5A1AA 3O0KA 1NP2A 1OX5A 3RO6A 4A4AA 3V7PA 4YHEA 3UJFA 3HJEA 1XQLA 4I7UA 1MFUA 5IOBA 3A4WA 1OADA 4MWAD 5I00A 1Q6OA 2WSYA 2C1GA 3NPWA 3LPFA 2Q6ZA 1BSLA 3R8HA 4WXZA 2WZIA 3LNMA 4Y9OA 3EWWA 1RVGA 1BRLB 4L56A 4RXFA 3MA8A 2VR4A 4WX2A 5LYRA 1NWRA 3WLNA 1PHQA 4N4QA 3TA6A 1GOMA 1R3SA 2EG7A 1X6NA 1ECEA 1PB0A 3KVJA 4PB3A 2WKLA 3I3DA 1Z32X 3KDNA 3GH5A 3WEZA 4LBUA 2XIBA 1DJWA 2PLKA 4YXGA 1FDYA 1J10A 2DZXA 3H2FA 3THUA 5D2VA 4QJ5B 2O7SA 1UZ4A 4GCXA 2YXOA 2FZDA 4LPCA 3R10A 1A3XA 4RDVA 5M2FX 4U33A 2F6KA 4GACA 4NJJA 2WZTA 1JZ2A 3OOQA 1OYCA 4C6NA 3PZUA 4DM2A 4R9XA 4I5UA 3S6TA 3DENA 3ZXWA 1I2QA 4QNEA 2OKOA 1AQMA 2RUSA 3PAJA 2QV4A 3PAOA 3VGDA 1IT7A 2CHRA 4LXFA 3I7QA 2O56A 1YBQA 3LLXA 1AJZA 1V02A 5LNUA 3BCFA 4JCLA 1Q6QA 4GQBA 2UZ9A 3WSUA 4TTGA 2WNWA 1RPKA 1BAGA 2QCMA 1JRBA 1PX3A 3H7UA 4NZ4A 3BL3A 2NUWA 3W6LA 1UZ1A 2D73A 4A8NA 3V16A 3GXTA 3I7SA 2FZNA 3NZPA 3GSMA 1J18A 3EKLA 4O19A 5HANA 1EPXA 2OLSA 5D05A 1TZZA 2Z27A 1FTXA 2GVYA 5C7VA 5K4XA 2EKGA 1ZP4A 1P6BA 4M80A 4IIBA 2X0HA 1TZ7A 4XD4A 4BQ2A 3FYYA 1WOBA 1I2NA 3R58A 3HQPA 3TW9A 1HJVA 1CB7B 1LG1A 1LOSA 1Q6CA 1M7XA 4HNNA 2D20A 3WLHA 2Y7DA 3GNRA 3AWOA 4AY7A 3NR0A 5EMMA 2F6XA 5E0CA 1WCGA 3LY0A 3WH6A 2SFPA 2QXWA 2V5BA 4UCGA 3E6EA 4EE9A 3ANUA 1W1IE 3A21A 1JDCA 1A3WA 3UG4A 3PPHA 1EGZA 2ZUUA 3FFSA 3OZYA 3DFHA 4OFCA 3EGJA 2PTWA 2NV9A 4YN5A 5HR6A 2R91A 1Y5WA 3IJ8A 4Y8EA 2FTPA 3BLOA 3R79A 1UPPA 4RLIA 3GWQA 4DZ5A 1KV8A 2V2HA 1ZALA 4IP7A 1JYXA 2PSNA 2WAGA 5FJRA 4H4IA 3VFLA 4ZQRA 4NJHA 4CNOA 1YLVA 3CTLA 3ITXA 1AMKA 1TV8A 2FKPA 5CGQA 3WF0A 1UR4A 4G5DA 2XFFA 5G2HA 5JBEA 1V3MA 4I6VA 3B03A 3AXIA 4JIEA 4A21A 3EBVA 1F8IA 4JHOA 3T6CA 1HG3A 2FIQA 2PODA 4N42A 1KGUA 1G67A 5DF0A 3ZJ7A 1AJ2A 3NPXA 1SZNA 2BS9A 2G3JA 2QPSA 1TTPA 4OV4A 1OFAA 2PE4A 3ORWA 1ZCCA 4JTLA 4V15A 3LQGA 1IV8A 3T44A 4AXKA 4DO4A 2PS2A 5A2CA 1A5OC 2P3ZA 3PJTA 2XWEA 2BODX 3KX6A 1UJQA 3N15A 1G4TA 4FXJA 4GWEA 4QCEA 2IKHA 2E9MA 3PUOA 3PUEA 1UR2A 1UWTA 4QE5A 4XISA 2NSXA 4PEEA 5C2CA 3DXIA 3PS7A 2HBVA 3JS3A 1W5PA 3T0CA 2ZUMA 4H83A 4JTKA 2J7FA 1N7KA 1XXXA 4UTMA 2ACSA 3URNA 3CUZA 4PTXA 2WQPA 2A79A 3VNLA 4FLQA 3BQ6A 3W0KA 2WW5A 1PYMA 3CGTA 1W9UA 3HTWA 4XTIA 2JQXA 1UB3A 4KMQA 2D2GA 3MVTA 3VKCA 3RRXA 1KKOA 1VENA 1U30A 1B31A 4NXKA 1W9XA 4J2MA 3PBMA 4LNYA 2YIHA 2BFGA 2ZDRA 3UWZA 2MNRA 3DN5A 2IS7A 1D7FA 4YTQA 2WPBA 3DFYA 2GYIA 2HPMA 3T09A 4NRSA 3LENA 2INZA 4MTVA 1VFSA 2DQXA 5G5IA 1UA3A 3VIMA 3RCYA 5FIPA 4JQ4A 4KKXA 1KM2A 3T8QA 5CZSA 5XIAA 4BKNA 2ZOXA 3B4YA 1QPQA 1XI3A 1V6XA 3BO9A 3C0JA 4R7JA 1HKWA 2PF0A 3GXNA 1M53A 4WSHA 1EJXC 1RQBA 2WJZA 3BMWA 3GRIA 4M3PA 4PMVA 4K39A 1DPMA 2XVNA 2QVHA 3SAZA 1ZLPA 1AFSA 5I5RA 3DEQA 2HS8A 2C19A 1ZL1A 2D1ZA 4TMCA 4AZ7A 3KE0A 1LZOA 1L6FA 3SCTA 5CSSA 3OA3A 1WUEA 3SUSA 3S2MA 3OIHA 1J0ZA 3C5QA 4JHMA 5HMDA 1TPVA 3CYVA 8RUCA 1YADA 1O5QA 2ONEA 1S38A 2VURA 1U1UA 3QW3A 3LS9A 3EB3A 1NFPA 3ZVHB 1DJQA 1GW9A 2Y89A 3FDGA 4DX3A 3N13A 4EPKA 3LCHA 5F1UA 3WLPA 3C0LA 1YNPA 2OQLA 3EOEA 1T8QA 3WMCA 4JTJA 3T8LA 2Y4SA 4JKMA 1KBLA 3PBGA 2YFNA 3NQ7A 1NF7A 4OJYA 2GVEA 4NZFA 3TTEA 3H70A 3HG2A 1S1RA 2CLMA 1XCXA 3S6DA 1EJSC 3LCLA 1QPNA 3G3MA 2BVTA 1GTHA 4LVFA 2V82A 3S5SA 2IXVA 5LIXX 4JR5A 5DBUA 1B90A 4QSFA 2MUCA 3HA1A 1DQXA 4IFOA 3W7QA 1TX0A 1M6JA 4PB5A 4BZYA 2BGQA 3C3NA 3VIIA 4PMNA 2CBVA 1EP1A 1QU4A 5B80A 1ISZA 1ITCA 2A21A 2A6LA 2POTA 3WQFA 1X97A 4XG1A 4V28A 4BQ4A 3AIEA 3HQNA 4IISA 2GGHA 3WNNA 4GLEA 1TVPA 4WGHA 1NOWA 4O54A 2VYOA 3VDAA 2Z2BA 3P0XA 3S83A 5H8UA 1K9EA 5K9CA 2QCCA 4ZE5A 1Z9AA 3SSZA 1OWQA 3R12A 5D2TA 1OFOA 3N2XA 1VLWA 3CIXA 3BCJA 4ZTYA 4ERGA 3VAVA 2UY2A 4DBEA 1F4AA 3SN0A 4W5ZA 2BBFA 1M04A 1Q13A 1FCUA 2C6QA 1JAKA 2CEQA 3LLDA 3WQDA 3WMBA 2FJUB 3RAOA 5MKGB 4N02A 4HPXA 4LYPA 2YFOA 1GOIA 2G4FA 3KHJA 3EDKA 2G95A 3PZOA 2ICSA 3WK1A 5D2WA 2WZHA 4MB5A 4Q8TA 1MW3A 4GUFA 4J3SA 3OVPA 4DZHA 5FF7A 1AZ2A 1SMAA 3QGAC 3NSNA 4CQ9A 1YW1A 2EJ1A 3G1AA 5I0DA 1EJUC 2CERA 2NX1A 3DC0A 4H7ZA 3MS8A 4Y2WA 1KB3A 1JFHA 4GKLA 4UC5A 2OGJA 4B3KA 2Y5JA 3MZ2A 3H8AA 4DELA 3T0BA 4C6KA 5LNWA 4JS3A 3WQPA 1WKFA 2ZE0A 2EEXA 4B16A 2VEKA 1E51A 3VGGA 5AC7A 3R25A 4EANA 1XPGA 3QC3A 2VM8A 4MAZA 5EMYA 4EXBA 3OP2A 3PWIA 1PCWA 2NVDA 1OG0A 2VFEA 3FKRA 3DOPA 1DL3A 2VEPA 3VDGA 1LRNA 1ME9A 3FEMA 5CXPA 1YXCA 1T0OA 3VNZA 1G69A 5I3JA 3BLPX 2CKSA 4NP7A 3U5UA 2BVYA 4IPIA 3KVKA 5HNRA 4HOXA 4GIYA 3WD0A 4OE7A 1FKXA 3WLSA 5GVJA 6XIAA 2CHOA 3NQGA 2Z1SA 5I06A 4K37A 1EDTA 1EHAA 3CU2A 3ABRA 1WAUA 3KZSA 3CZJA 3QJAA 4DWSC 4DXXA 1HGYA 3OZMA 5J5DA 4AEFA 1H0GA 2JIEA 4UOJA 1D7KA 2DSVA 2ZADA 1FUYA 4CCZA 3I68A 4ZB5A 2PMQA 3M41A 4EXQA 3Q65A 2ZTKA 5C55A 3IWPA 1UC4A 2E3ZA 1IZKA 2KAUC 5ABGA 5FEZA 4MKSA 3WZ0E 4BCEA 5KZEA 4EAYA 3UJSA 3WDQA 3ZFHA 4PUKA 4M6PA 2YZRA 2VDIA 2TAAA 1I4NA 5I3GA 3K2GA 2GFTA 1XFBA 4IGSA 2PU1A 3W74A 3KWXA 3WJZA 3N2CA 1XM3A 2CLLA 5J04A 2I16A 3P67A 1TJ1A 4JTGA 3VKKA 2NXGA 1F05A 4G9PA 3LQLA 3EMQA 2JF6A 4U10A 2G3FA 5AZ1A 4NL1A 4QEEA 3W2LA 1OFDA 4A3YA 4P61A 3TN5A 4D6GA 1F74A 1Z42A 1LLZA 4KW2A 5F4SA 3TYAA 3TSDA 2RAGA 1G7VA 3SECA 1DV7A 3W82A 3TYCA 1CCWB 1IEVA 4D6DA 5LA2A 1VFUA 1KW1A 1R30A 5LIUX 2QLYA 5AECA 3SZ8A 2VT0A 3M0YA 2WMFA 1QI2A 1Z69A 1SJDA 2J4GA 1R85A 3BOLA 4Q8QA 5M17A 3DAQA 4K8HA 3ANVA 4MWAA 3EOSA 3SR7A 4JTCA 4PFMA 1KFWA 4MNJA 3B0PA 3M44A 1J4EA 3IS4A 3FA3A 3V0TA 4GNJA 4N0RA 3O07A 4FNRA 3NQEA 4DVOA 3EA1A 2Q3OA 4HOWA 3IIXA 1A5NC 2VNCA 3QOKA 1NOUA 3DERA 5C9WA 3DFQA 1B3WA 3VKJA 1VR6A 2IKJA 3L4UA 4ZTXA 3IJQA 3OLDA 3W2NA 4OQVA 3ZJ6A 3VNKA 3MSRA 3MUCA 3W7GA 3GIYA 4WXYA 4E8DA 3KFTA 1VPXA 3VOIA 2EO7A 3W1AA 5IHSA 2DORA 1NP0A 3EWCA 1NQ6A 4Z0JA 3WFLA 5F2IA 1MYRA 4F8XA 2Y7EA 4HK6A 2E7FA 4FSAA 3EOUA 3AYRA 3VX1A 3SGZA 4L6OA 4DJDD 4JEQA 3BV7A 5AHIA 1V7AA 4GBUA 2E8ZA 2ADAA 4O1EA 1ZTVA 3O6DA 3R1ZA 4DNHA 1QTWA 2CYGA 3TXVA 5KSWA 4PMUA 3G8EA 2J7CA 3SCSA 1R3WA 2AKMA 1LLWA 4UTJA 3HPAA 3FSTA 3N12A 3VD5A 3WEOA 1T7LA 1EDQA 1T8XA 1H7XA 3ABOA 4WKAA 1XLEA 1UWSA 2H3DA 1EQPA 2JFEX 4XSMA 3UF9A 4J5NA 2RJGA 4NJIA 1GVIA 3QC0A 6XIMA 3DG7A 4Q7IA 1H60A 3GDRA 4S3GA 1SFTA 3S8HA 1J8VA 4PMDA 1O94A 5FJPA 5JVLA 1EF3A 4LB4A 2FQIA 1QPKA 5EKYA 5AYXA 1GVRA 3MP4A 4NAFA 1FRBA 2Y7GA 2VWSA 3WD1A 4XK2A 1HJXA 4K8EA 4Z2JA 3FX4A 4G7EA 2W6RA 1ZZMA 2YL8A 4HSNA 2W66A 1JF6A 2GK1A 4Y90A 3CB8A 3GM8A 3UZZA 1KM3A 1TO3A 3P14A 3G1DA 2JKAA 4JTIA 4K2SA 1QI5A 4WUIA 5AVHA 3FGCA 2DT1A 3CHFA 4E3VA 4O11A 3G18A 2QGYA 3Q2DA 3UXAA 4XB3A 3F2BA 1VP5A 4DJFC 3CQJA 4PL2A 1IT0A 4ZOBA 2VMFA 3M5ZA 3IVSA 3O15A 5D2XA 4X60A 1KXHA 3PPGA 3EOLA 1E6QM 2WVVB 3EDFA 3I6TA 2Z1BA 1CEOA 1HL9A 2CKRA 4PFHA 2PTDA 2PDUA 2YCLA 4LVAA 3ARPA 4DZIA 4UWMA 1HUVA 2WB5A 3BOXA 4QS5A 1TMHA 4O14A 2G37A 4QDPA 1X7FA 1TR9A 3R0KA 4BJHA 1XGEA 1FWIC 3VA8A 1WXJA 3O05A 4KEUA 1W56A 3CMFA 1GVQA 4WR3A 4K68A 3SCPA 1FWCC 1W3NA 3QV8A 3WJXA 1HL2A 3N73A 3AMCA 2E1WA 4GVFA 3SBFA 4PRRA 3WK0A 3WD3A 1HJQA 4F66A 3L2IA 5LIYX 3H4XA 4O0KA 3DBNA 3MT1A 3KHDA 2G5WA 3GXPA 3A47A 3PUGA 1X38A 4HMCA 3RJXA 4ML4A 1W9PA 1XLBA 3N6QA 1JNEA 3WL1A 1T5AA 3SCRA 5IXEA 2EXOA 2Z1XA 2ZWYA 1KFEA 1HO1A 2XFRA 4XAYA 4GMEA 2W61A 1W3TA 3DBPA 4FF5A 1CT5A 3TFXA 3FW6A 1VCGA 1ONEA 1BWLA 3BSGA 1XYCA 2CBIA 3W4RA 3MZNA 1EP2A 4IT1A 1UD3A 1JIBA 3W1LA 3BPWA 4AFYA 3CYJA 3B8VA 4M24A 2YCKX 4QITA 4HCLA 4X0VA 1BYDA 1XL9A 1XBZA 2A85A 2DDXA 4W85A 2AL2B 4GC4A 1OFPA 3CL7A 1KFLA 1U5HA 2NV1A 4W5UA 5BOFA 2VRJA 3E74A 4L4PA 3W6YA 1B2YA 1RK6A 4DI8A 1W9DM 2I9UA 8XIMA 3TE9A 4KPLA 3EEGA 1ESWA 3GXFA 3NTYA 1P1MA 2WNQA 4EPDC 4UOQA 3FJNA 2ZRZA 3VUSA 1KRMA 1E4MM 3D6NA 3GVVA 4UUIA 4MNLA 3WY1A 2V3DA 1WKDA 3MI6A 3VUPA 3CQHA 1PTDA 3PHAA 5KZ6A 1GOOA 3QEZA 3W7HA 1KBBA 2AAMA 1XWYA 2E77A 4QG8A 4MJMA 3EB2A 2I1OA 2P0OA 4GABA 1EJVC 3W7MA 6PTDA 1HGWA 1QOXA 4YJ5A 1ICSA 3OBKA 4FLRA 2VL4A 4HZMA 1D2KA 4Z08A 1VS1A 4MDPA 1K8CA 3LD5A 4NG3A 2QDHA 4D6EA 1JULA 3STPA 2CLPA 3CQKA 1O5KA 3W1TA 4I9TA 5D8WA 4C7GA 5AC5A 2UY3A 3BG3A 4H6KA 1H5VA 4DAFA 3LA4A 3JZUA 4BF9A 4QLLA 3OGSA 3NA8A 2J77A 2X42A 3W1QA 2CLFA 5FJUA 3U7VA 1EH9A 4DO5A 1FWSA 3RLGA 5I77A 3AQUA 4LS1A 1GQJA 1IWBA 1GYNA 2WV8A 3PTQA 2WO5A 1AH4A 3TK7A 3LN3A 3O6AA 3R4IA 2DIJA 4B3LA 5G1MA 4AHPA 3P7YA 4PL1A 1PSCA 4IGMA 4PUEA 1NTHA 4D2JA 2HK0A 1S2CA 4FPSA 3U9IA 3N25A 1DJXA 5LHEA 2FB3A 1SR0A 3TDFA 3UXDA 3VOHA 2EPHA 1EA9C 2PDFA 1K7XA 3AMDA 3WQWA 4XZWA 1O6IA 3G1VA 1M68A 4LYKA 2OEJA 1WDDA 1YQ2A 3TTOA 2I17A 2E6AA 4MKNA 1YBQB 2D69A 3RCNA 3KTCA 4CCCA 1E5NA 4FB7A 1P5BA 1C29A 1DIEA 1UD2A 4TX9A 3H2OA 2GOKA 1NAL1 2PA6A 2VQTA 2P0IA 1V8EA 5D9MA 2DU2A 2VVNA 1XLCA 3EWUA 1R3TA 3G24A 2INFA 3UVAA 4A35A 3PNUA 1A5SA 2ESCA 2GGIA 3MU7A 4OZOA 2WMKA 8CGTA 3T08A 5J5RA 4LTSA 5HJXA 4IGHA 1PE1A 3UY8A 5AC6A 4WJ8A 4AHQA 3FSUA 1JCMP 1X98A 2WCAA 4AHOA 4GX9A 4Q4KA 3EX1A 3SCOA 1SJBA 4QE1A 2W9MA 3GR7A 5FD0A 4K6AA 1AW5A 2C0AA 1XLGA 4C6JA 3FV9A 1JDAA 1SZEA 3N6HA 1VBUA 3GXIA 9RUBA 2OWCA 1YMYA 3TYBA 1TWDA 3HPXA 2G4JA 2DVXA 5I3HA 1PJ9A 4AC7C 2YCIX 4NXSA 3N4EA 3PZIA 4X9YA 3B8SA 3VVGA 3GHUA 3BAJA 2PWVA 1MW2A 3IJLA 1ZJHA 2E5BA 3O6CA 2HQAA 1JCYA 4L1GA 1IWAA 3UZXA 4PTVA 1BEUA 4F2UA 3LK6A 5CJMA 1HP4A 2R6OA 5FA5A 1J11A 3NFUA 1QO2A 1X6LA 1EHNA 3L4VA 2AGKA 2Q8LA 2CW6A 1WDSA 4I90A 3WEMA 1KM1A 5CBJA 4DIAA 1V0NA 5I79A 1C91A 1EC9A 2ZUWA 4WKHA 1R86A 3F4DA 1PUDA 1AW2A 5CPQA 3ARSA 1R47A 3A64A 2Q8ZA 3V75A 2PGRA 3M1ZA 4G56A 2D2JA 3M9YA 4QG6A 1B3OA 2RJHA 3DHUA 1VIZA 1HJSA 3KLLA 4QS6A 4ZGYA 4XIMA 2VZTA 4TVUA 2P5NA 3ZJ8A 1GOXA 4B5UA 4L6DA 1CX9A 1R7OA 3EEZA 1TREA 3CB3A 2Z1VA 3ARVA 3W1NA 3N11A 3SN1A 1LG2A 5DCDA 5FKYA 1I2PA 3AHXA 2CXGA 1FH9A 1IXNA 4Q8WA 2P76A 3GW3A 2GSHA 4MY8A 1GZJA 5CC6A 1RAKA 3UNTA 1IEWA 4F0HA 5CPNA 4DHGA 3T2QA 4S23A 1FY6A 2GPTA 3HJZA 3S2NA 3C0SA 3AC0A 3G6MA 3UD6A 1FWJC 1E1FA 2HPIA 2E0PA 4CN6A 2AOSA 1Z41A 5FL0A 4JY8A 5FF4A 1FVPA 4PTWA 4PYSA 5AYIA 1XLFA 1IE7C 2CXEA 4Z1DA 2NWRA 4C6OA 1W31A 6TAAA 4IMFA 4QCFA 2GDVA 4AF0A 2X7WA 3WUEA 2E40A 1WOAA 2VOMA 1J01A 2VC7A 4GNVA 4JTEA 5EMUA 1LYXA 5DN1A 3GHSA 4LH8A 3EX4A 1FQ0A 3VO0A 1W1A1 2C0HA 2G96A 2GUBA 2OU4A 1ZQ5A 2YYTA 5AHEA 4WF7A 3EKZA 4I7VA 3TMQA 1I2OA 2ZUNA 5HINA 2BB0A 1QUMA 1W8SA 4IIFA 2J62A 5E5CA 2CCRA 2X7VA 2J7HA 1S5NA 5A6JA 1V0LA 4JNYA 4L61A 1XHGA 4KEMA 5CPLA 3TN6A 5AY7A 1TJ0A 4QSHA 2NSOA 2HVMA 1H50A 4W8LA 3CIWA 4D6FA 1L9WA 1PDZA 1PAMA 5DMLA 4ZB2A 1QAPA 2DUXA 4PMZA 5CSYA 2PDHA 5DCEA 4M6VA 1OC5A 3FHAA 3WNMA 4NZ3A 4GVHA 1U22A 2J13A 1TMLA 1V6WA 3MWCA 4LU0A 2J8FA 3E0LA 2FDMA 3H26A 3KWSA 4JICA 2CPUA 3LRMA 5U4NA 1R3VA 4KCUA 5DXXA 2QJGA 2J7GA 4H01A 1Q5MA 4RKAA 3WDPP 4PMXA 3FYPA 4B5XA 3K8MA 1DJNA 1XKYA 2BOFX 4PEKA 3EPMA 3LOTA 3B9AA 3W75A 4C7DA 1V3JA 1LL7A 4GJJA 4IJCA 5F4XA 4DJDA 4DJEC 1YPXA 3GYCA 2KZHA 2FJKA 3UVIA 2WWDA 1UIOA 2PLMA 1GWJA 2HMCA 2IQDA 4RW3A 1VBJA 3NAVA 4GGHA 1WX0A 2FVKA 3AHTA 4GO8A 3SO7A 5HDRA 3GG1A 4DF1A 1ADOA 1E0VA 3AJXA 2ACUA 2OZ8A 1F9CA 1GVYA 1ZUAX 3UGRA 1CW2A 2J8TA 2GJPA 2QDGA 2E67A 1KTBA 4B4FA 1QW8A 4RZ4A 4F48A 4QG9A 3E02A 1I60A 2PDYA 3PJUA 2PDJA 1XIHA 1MZRA 3DI1A 1FWWA 4YWIA 2ZIDA 3WIJA 1GEQA 3GAYA 2X40A 1B3XA 3N34A 1FFRA 5CLWA 3NM3A 4C60A 2E5CA 1P4CA 1Q66A 1W54A 4M1BA 4H8VA 4A22A 2CU0A 1EP3A 1E70M 2C14A 2EGZA 3VM5A 3W1XA 2OGYA 2Y24A 1XRTA 4P7LA 3RUBL 2Z4GA 3VTRA 3P3BA 3NO3A 1BLIA 5BXTA 1UKQA 3W07A 4RZ5A 3TTQA 2VEFA 1TTJA 3VGEA 4OU1A 2WBGA 4D8ZA 1AVAA 3SRDA 3E1F1 2ZBTA 3AU6A 7A3HA 4V33A 4GH1A 3VGFA 4ZQCA 1UC5A 3HQOA 2PD5A 4PMRA 1EYEA 2OLAA 3WYZA 3HMCA 1X39A 2J79A 3AXXA 3WG6A 3SGUA 2E5DA 5G4EA 3VMOA 2D3NA 4S3FA 4JFVA 5GNYA 3L4ZA 2PRHA 2XSAA 2HROA 1HFBA 1CECA 3AMGA 2PFHA 2IW0A 1NY1A 3SUWA 2YYUA 3WUFA 4FX6M 2QW5A 4H9UA 2VX6A 2ZXAA 1GJPA 3NPVA 2WJDA 2WZMA 5JIPA 4FK9A 1RALA 1KFKA 2PWGA 3VOCA 5C2XA 3JR2A 1AG1O 4AXNA 2WJFA 1V3KA 4JTQA 4UTLA 2ISWA 1V0MA 3HO8A 4UBPC 4DZAA 1VJIA 1SM9A 2RGLA 1XYLA 4JTAA 5CPMA 3EAUA 4C1NA 4FNQA 3ZWTA 4NU7A 2HCVA 4GY1A 4H8NA 3RF9A 1H7PA 4DJED 4IP4A 9XIAA 2WM1A 3OG2A 3IRSA 3DX5A 1Q8JA 1L6SA 2W62A 4KEZA 3HQ1A 1WKYA 3WK3A 3QSTA 2QCFA 1TV7A 4F4RA 5FSEC 1CXIA 2WLZA 4FIQA 4AISA 1LTDA 2FVMA 5FJTA 3ITCA 1TQXA 3D47A 1W32A 2IPJA 4PRTA 3A9BA 3OEXA 1KTCA 5EPDA 5BZAA 3IVTA 1OM0A 2EPMX 3AROA 2J78A 5KEZA 1AW1A 3PANA 1PPIA 2G41A 5JU6A 3MSDA 2DZPA 3KM8A 1R2SA 1JYVA 1E0XA 1UOZA 1TWWA 4IIEA 4GISA 3TW6A 2X1IA 1IR1A 2X0YA 3IUIA 2XGBA 1EZ2A 3B8DA 3TA9A 4KRZA 2ISVA 3IK4A 3BANA 3QW4B 2VZSA 4HKPA 4ZSUA 4UB9A 3TYDA 3IACA 4GHRA 3TWAA 2I14A 2Y6ZA 4XZIA 4RNHA 1OT1A 1V02E 5A8NA 4Q8MA 4U2YA 1KCZA 4HN4A 5D33A 2ZICA 3L4WA 3WBAA 1V6VA 3STEA 4YS1A 1WZLA 4W89A 3GR8A 4GQ0A 1TG7A 4DJFA 3B0UX 3N2TA 7XIMA 3WH7A 1E1CB 2QEZA 3O1NA 3AUOA 4AWSA 4IM4A 3DHFA 4ZMGA 3I10A 1P43A 3GH4A 2YR1A 4RZ6A 3LI1A 1UZHA 4HU8A 1C3FA 3RX2A 4CLMA 1S5TA 3F4VA 2CZEA 4WGXA 1FH8A 4MWAB 1IGWA 4HNLA 1EDGA 2BOGX 4EWND 3L2MA 3FS2A 1JDEA 2BX7A 1W5NA 2PBOA 1SVDA 2OYKA 3HPSA 3MMDA 3GBEA 3W87A 1K77A 1K9FA 3DG3A 2NLYA 2IPFA 2NVAA 4WY0A 1GJWA 3DZ1A 3V5OA 4RPQA 3KOYA 3HGOA 3EWDA 2F2HA 1RY8A 2FPTA 1Q65A 8A3HA 1ISVA 2C71A 4B3ZA 4GXPA 1UA7A 1R2RA 3GFZA 3MSYA 3P62A 3R89A 3HU7A 4HA1A 1EUAA 1OQFA 4ATWA 1VEMA 1EYWA 4IFKA 3GDMA 3PBVA 4I9JA 2O9PA 1EA0A 5K2ZA 3VI2A 4Q32A 1H49A 5LIKX 4E38A 4YHGA 3UERA 2XVLA 3M0LA 4TUFA 4F0KA 3BW2A 2Y88A 4NNBA 4PGLA 1CIUA 4IJBA 5CG0A 2QR6A 1Q85A 3NDOA 1XIFA 1E15A 5AHNA 2X0SA 1ISYA 3RLVA 2FHBA 4RV3A 1ZGDA 1YDOA 4BY3A 4D71A 5HXMA 3NM1A 2HK1A 5H6HA 1RH9A 1J0IA 4GUIA 3U3HA 1UQZA 3VOJA 3AZRA 2OO0A 4Z2IA 1ICQA 3T55A 3WH9A 4NZJA 1RV8A 1PKYA 1ZSXA 1JG9A 2DJXA 4H6QA 4KFPA 3C2RA 2CLEA 1TELA 4H1ZA 1MMFA 2ZRXA 4PUUA 2V2DA 1BGGA 4PMYA 2C13A 3S1UA 4CQ8A 2OVLA 4HHHA 3M5YA 1UYQA 2D2HA 4V2XA 2V69A 4C6LA 1YIXA 4L7ZA 4JTFA 2WK2A 3M0ZA 4Q8UA 3W22A 4G7EB 3WLTA 2PC4A 2NQHA 1TWIA 2XM1A 1V7YA 4JQAA 4U4MA 1HKVA 3L4TA 1BWKA 2DV0A 4REQA 3ZVIA 1MO0A 4OBTA 4N9BA 4HMDA 4XV0A 1ECQA 4ZO9A 3PN8A 4Q4SA 3BMVA 3Q94A 3OPSA 4GC3A 4Q7BA 5FAJA 3ZR6A 3N1AA 1EQCA 3QF0A