3RLUA

Crystal structure of the mutant k82a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEAICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rluA00
4FNSA 4ZMGA 4UUIA 3LI1A 4HNTA 3EX1A 3NPUA 4NX0A 1YXYA 3TQ0A 5K2ZA 4ORMA 4Z1AA 3UZ5A 3A21A 3K30A 4K8EA 3TSMA 2ZA1A 3IIVA 1L2UA 2AAMA 4PTNA 4BFAA 2CZ5A 3H54A 5A8GA 2ZQ0A 4E0CA 3L67A 4JIQA 1C9DA 1HO1A 4BI7A 2G95A 3BARA 2DJLA 5D33A 3L0NA 3FIGA 4Q32A 3NPVA 1XC4A 4X9SA 2ZFAA 3BLFA 3LLFA 2HSAA 4JD4A 2NX9A 4O16A 1TPC1 2VFDA 3SW6A 4IXXA 4CLMA 4UNKA 3S1UA 4HPJA 3M7WA 1SFJA 5AHFA 2PCQA 3KVKA 3TMQA 2NWSA 3WFAA 5G1YA 1H7NA 1MEHA 4FF7A 2X16A 5MHBA 4O14A 4QAIA 4O17A 1R2SA 3OVQA 4KFNA 4GE8A 5HINA 1OG0A 1H51A 3O6CA 1XBXA 1NFBA 2V8ZA 3UD6A 4Y8FA 1Z44A 4UTTC 4UTLA 4UFJA 2QCEA 1P4CA 3MHUA 4NXKA 1W5OA 5LHFA 5CG7A 5F4SA 3EWYA 1ZCOA 5LGXA 1RZMA 3W3OA 2QCNA 3SJ3A 2R94A 4RCXA 3DGRA 5D37A 2FFCA 3C8FA 4ADUA 3M16A 5FF2A 5DLCA 1JRBA 4C1KA 3CIXA 4RZ5A 1WOBA 2ISVA 1OFAA 1AMKA 2DP3A 4MUZA 4MZ1A 3TMLA 3UPBA 5KTLA 3I65A 2Y7FA 4JY9A 1LOSA 1SPQA 3IVSA 4LOCA 2WSQA 4MY8A 5LNRA 1AK5A 3RK8A 4IMCA 2PURA 4K36A 3BG3A 3CT7A 4OBTA 5LNVA 1LM1A 1KFJA 1PCWA 2NXGA 4J9JA 3TW6A 1RV8A 1VCGA 1HUVA 4UTKA 2H6RA 3LCHA 1YXDA 4OE7A 3N2MA 3W2NA 1B4KA 3PC0A 3TU9A 1YTDA 3EB2A 2YX0A 1PCKA 3HO8A 1G4EA 2YW4A 1G7UA 3G18A 1TYGA 2DJXA 1ZAHA 2BX7A 5A5WA 3P82A 1TTJA 4DO4A 2C16A 3M43A 4M7SA 1YDNA 3EX4A 3GR7A 3NOEA 4O50A 4CCDA 1Z41A 3T4CA 2FPYA 3E02A 2OJPA 5LSMA 3W07A 4NX5A 4JN6A 3TX9A 4LVBA 3PSWA 1V7YA 1Y0EA 5SWUA 2ZA2A 2E6AA 2TMDA 5G1TA 2E5DA 4DXVA 3STEA 1X6UA 1A5AA 5C54A 4JTHA 1S5WA 2JGQA 2CZEA 2B0MA 2EKCA 4QNEA 3FOKA 3N9SA 5K4ZA 4A21A 1QCWA 1F5ZA 2C3ZA 1XBVA 3TK7A 4FNPA 3JS3A 3L0GA 4ZL1A 1OFEA 1DHPA 3NQFA 4ZQNA 4RR4A 2AQWA 3B03A 4GC4A 3T55A 4UTJA 2V5BA 2RFGA 3FLUA 1AG1O 3W1TA 1FWRA 1RPXA 1BKSA 3P62A 2QF7A 4O0ZA 4O52A 3TSBA 2A21A 1OHLA 4QJ1A 2PRHA 5CPNA 3CTLA 3NNTA 4JTGA 3TAOA 4PODA 1F6KA 2YSWA 4XZ9A 1X7FA 2XFWA 1VCVA 3LBMA 3LTSA 5U4NA 1BTMA 1LRNA 3HG5A 1H63A 3O6DA 5DXYA 2Y70A 3G0SA 1U5JA 4MZ8A 3M44A 2QAPA 4AWTA 3NDOA 1GEQA 1I2NA 3BLEA 3LCFA 1KM0A 3L2IA 3WJZA 4O19A 1FDJA 3HG3A 3JRKA 3TUUA 1XFBA 3STGA 1KTCA 3DI1A 2X2GA 4S2BA 4NNBA 2ABBA 4UTMA 5GVJA 4H4IA 5G2HA 4JS3A 2EHHA 2QR6A 1QMLA 1SZFA 1AW2A 2UV8G 5DCDA 4ICNA 1TTQA 4JTTA 1OX4B 3O63A 1VYSX 3TV8A 4Y96A 1X1OA 4WOQA 2V2HA 3QJAA 2V2CA 4MY9A 3DBPA 4O10A 2W79A 3L5LA 2Q8ZA 4GUJA 3KAOA 3WJYA 1VYRA 3O06A 3LV5A 1DBTA 2WOQA 4XBKA 1LOQA 2C14A 3OIXA 4IPIA 1YADA 2Z6IA 1TPWA 4UTUA 2HMCA 2FIQA 1T96A 5CZSA 3IIPA 3R89A 3SY5A 4TIMA 4GWEA 4D2JA 1H1YA 2VFGA 4ZZ9A 4JX4A 4NXSA 1TPH1 4N2YA 2ZDRA 3B06A 3PBWA 3NQAA 5I3GA 5IBXA 1H7XA 1P0KA 2E1DA 2VENA 3QMRA 4FIRA 1FWWA 3FYPA 2JKPA 5CKSA 3GDMA 4UFHA 2Z0IA 3INPA 3N9RA 3NQDA 2E6FA 3O6YX 3PBYA 4JTSA 4OV4A 3TJXA 3OBKA 5K7JA 3TXVA 3TQVA 1UUOA 2J6XA 1GG0A 1QNVA 5D2TA 1LCOA 2CLKA 1FCBA 4B5NA 3EXRA 3PWAA 5F1VA 2V30A 1D9EA 4QNWA 3W72A 3B0PA 2JKAA 4DBDA 4NJIA 1TV8A 4GXMA 1QOQA 3UWVA 1MEIA 3QW4B 2R91A 2CLFA 3N34A 3MBDA 3DFOA 4X22A 4A3UA 1G67A 2J88A 1NAL1 4AAJA 2NV2A 3N14A 3W7IA 1L6YA 1XUZA 2B7QA 3EXSA 3LTYA 5CZ0A 3NQMA 3L21A 4RKAA 3LHYA 2CLEA 3W76A 5LNUA 1K02A 3T78A 1KLZA 1ADOA 2QJHA 4XUGA 4EOUA 1I2QA 3QC3A 3GAYA 1TCDA 1L6WA 4I7UA 3GR8A 1W0MA 3R12A 4N4QA 3HB9A 5F2GA 1KFCA 3B05A 2CLLA 1W37A 3TXZA 3A24A 4R34A 5F4XA 3N2XA 3C2OA 3GAKA 2BTMA 3EWZA 3HG4A 3PS7A 4NZFA 3LTPA 3MJYA 3NQ6A 3DXIA 4M7TA 3W1NA 3C3NA 3RNDA 4XBSA 3UWQA 3LHWA 3C2RA 3UQNA 1JUBA 2ZCGA 1LYXA 2W6RA 5LGZA 1KFBA 1VJIA 1OX4A 1EIXA 2I9EA 1Q3NA 2OT0A 3FJLA 3W73A 5D2VA 2ZRUA 3GZ3A 4LWWA 3QSTA 2DZWA 4E2BA 4KWVA 4UFKA 4BWLA 2ALDA 3E12A 5CPLA 4TMBA 1A53A 3E96A 4AF0B 4WD0A 2QUUA 1PIIA 3EX2A 4HSNA 1OF8A 2ABAA 4N6FA 3JR2A 2I14A 1E51A 4LRTA 4E2DA 2ZTJA 1N8FA 4OQVA 2Y7EA 1N7KA 3TFCA 3A23A 4IOTA 3KRSA 3C56A 2G97A 2H8XA 2Z2UA 3P5ZA 1OFBA 1XCFA 3L9CA 2VEIA 4I7VA 1WOAA 4KFPA 4UR8A 3S9YA 4FEZA 2XN1A 2FB3A 1TQXA 1B4EA 4BI6A 4WY0F 4LUJA 3CQ0A 3TROA 3G8RA 2C13A 2Y88A 2EF9A 4LVGA 4QM1A 2BZNA 1O94A 3BW2A 4RV8A 1LROA 4GJ1A 4O8RA 1O5KA 1I8JA 3BVJA 5FF0A 4LTSA 3G3MA 1BEUA 3QMTA 1YPIA 3DFPA 1M5WA 5F4WA 1GWJA 3PUOA 4FO4A 2A7PA 1FCQA 2C0AA 4A29A 4JGDA 1WX0A 4DPPA 5AN7A 2A4AA 1TRIA 1PE1A 4FX7A 1SW3A 3P74A 1NSJA 3FKRA 5AHNA 2DZVA 2JKEA 2LLEA 1YDOA 1YYAA 3NGJA 3W1MA 4IUOA 1GVRA 1GVFA 3DAQA 2B7NA 1PVNA 3FFSA 3T40A 3NL6A 2FLIA 1UJPA 2P0OA 5AHMA 3A9IA 3NQEA 5AFDA 5D2WA 4Z1BA 3GVGA 5AYXA 3IIOA 5AC7A 3NM1A 3IRDA 1KFKA 3O16A 4MFDA 4UTWC 2Q3RA 4IQLA 4DF0A 4UTTA 4LY8A 2IQTA 1OK4A 2R14A 3G8EA 1Q6OA 4O28A 4QITA 3BW4A 3P61A 1T8XA 4Z1DA 4M5PA 2I1OA 2ISWA 3OA3A 3SSJA 4IX0A 2FTPA 3DFNA 5KZDA 2NXIA 1GVSA 4AWSA 5AHEA 3ZWSA 2Y89A 3D0CA 4Y6GA 4IMDA 3KVLA 2Y63A 3NAVA 4GNJA 3I68A 1W8SA 1UBSA 3GLCA 3HGRA 5FF3A 3FJ6A 2VFFA 1KTNA 1FDZA 1LBLA 2ZRVA 1OJXA 4OGZA 1W5PA 3LOTA 5LKYA 3C52A 1M7PA 1RD5A 5EKYA 2OMAA 3SGUA 1OYCA 3N73A 4LC8A 5CZJA 1VHCA 4U28A 4EVZA 5H2ZA 1H7OA 4WZHA 2E68A 3F03K 4HN4A 3RLVA 3ZFHA 2QKFA 4NJJA 4AF0A 2Y6ZA 3LXBA 5AC6A 2VC6A 3EWBX 2A2IA 5KITA 3HGJA 1X1ZA 4NQ1A 1KM3A 3PULA 1K7XA 5E1QA 3EXTA 1LLWA 4JTLA 1FX6A 3QH2A 3U8GA 4XQ6A 3P8IA 3KOFA 2YPIA 1SZGA 5D03A 2NV1A 3L68A 3GX9A 2CU0A 2JGYA 2QUTA 2WNNA 2HS6A 1CW2A 4R53A 1TPDA 2BLEA 4O0KA 5C55A 1AL7A 3G1XA 5KSWA 1G69A 3DFQA 4LVDA 5H91A 1ZHAA 2C6QA 3ABRA 5I3KA 3USBA 5HMSA 1ZY9A 1KW1A 3LM7A 3LHZA 5HWJA 4O13A 2ZYFA 3FEMA 1JJKA 4N6EA 5D30A 1LZOA 1TPFA 3S5NA 1RR2A 2VEKA 1W3TA 3UXAA 4XWUA 2GQAA 5G2WA 1PV8A 2QJGA 1DVJA 1ME7A 4GBUA 1MZHA 3HPXA 4AHOA 3GDLA 3HMJG 4K39A 3KX6A 2YR1A 3G22A 3NQGA 4LS2A 4Q4KA 2NXHA 1GJPA 4UNLA 5CPOA 4FNRA 5LNSA 4RJEA 3YPIA 1EP3A 3UWZA 1SO6A 3L65A 2PC4A 2EGZA 3NEVA 3ZR4A 2RDTA 1EWEA 1K3UA 3C2EA 1TRDA 1XUUA 1P1XA 4UMCA 1LBMA 4MYXA 3S6DA 2NUYA 1A50A 3LBCA 4DF2A 3W85A 4ZQMA 1V5XA 3WJWA 1WQ5A 1OFDA 3RMJA 4Z08A 4DO6A 4JYFA 3I6RA 3S42A 3SZ8A 3AO0A 3NZ1A 5AYYA 1VS1A 1GQNA 3GIYA 4JX5A 3V75A 2QCMA 3S1XA 2X1UA 1JVNA 3QSRA 1ZENA 2DZSA 2J24A 4CNPA 4HHPA 4RZ6A 1W54A 2PE4A 4ORIA 1KM1A 1AW5A 4WX2A 3W1XA 1MSSA 2E77A 2VXNA 4K38A 1HO4A 2VFHA 4M19A 2QEZA 1RQBA 1R2TA 1PHWA 4EF9A 3G1SA 2XN2A 1ML1A 3RF9A 1LLZA 2QJIA 3Q94A 4IXHA 1T0OA 4P2VA 4N9CA 5F2IA 1JCMP 1JCXA 1FQ0A 2CWNA 4NJHA 1EPXA 3VKJA 1UCWA 1G7VA 2D73A 1QO5A 3MYPA 2QDGA 2RH9A 2YGYA 2ZZ6A 4OHQA 3PB0A 1SUXA 4DBEA 2YFNA 5J5RA 3PF3A 4JTEA 4O11A 4P61A 4O15A 5KINA 4L4LA 3PUEA 4ML9A 1FUYA 5D05A 3M41A 4YCOA 6TIMA 1A5BA 4Z1CA 1ME9A 4JICA 1OYAA 3MW7A 3B8DA 2QCDB 3QF0A 3RU6A 1XI3A 3HG2A 3QPYA 3LX9A 3NL2A 5EPDA 3EEGA 3LGEA 4PH6A 3W1QA 4DO5A 1THFD 1JUKA 1N55A 5IM51 1DJQA 2GVJA 2CFFA 3W1RA 1G4PA 1LDCA 2WSYA 2WPBA 4TX9A 2V81A 4OWGA 3CB8A 1M7OA 3I7RA 4FNTA 4IJBA 4S2CA 4TR9A 1KM4A 3UPWA 4LVFA 4UCGA 3W2UA 3GNNA 2QCLA 1IF2A 3CLMA 4XTIA 5DXXA 3GXNA 3EWXA 5HNRA 3BG5A 3HF3A 4WXYA 3ABOA 3HGSA 3S5ZA 8TIMA 3DU0A 1ZALA 3NL5A 1LRQA 5KZMA 2DZXA 3CHVA 1WV2A 4CNNA 3W7QA 2ZZ3A 2H8ZA 4H3DA 1W1ZA 1DQWA 4LU0A 4DQWA 3CM4A 5I3FA 5FESA 2VELA 1Z42A 3P60A 3FA5A 3WK1A 3DHDA 1R46A 4LT9A 3A5FA 3M5ZA 3O1NA 4DELA 5DCBA 1TTPA 1ZNNA 5HUPA 1YTKA 3BPWA 1JUEA 4JDBA 5LNWA 2E6YA 1DQXA 3W1UA 4JIPA 2PRLA 1QPRA 5HWMA 5AB3A 4N02A 4WJEA 1QPQA 3PG9A 2Y61A 1BWLA 2FPVA 3P67A 3W7LA 1M6JA 3GDTA 1EWDA 3OVPA 1SW0A 6ALDA 5LZLA 1SSGA 2FQIA 3KRUA 1ICSA 5T26A 1OABA 4U4MA 5DN1A 1QAPA 1JRCA 2Q3OA 3IGSA 4RX0A 3WK0A 2GQ8A 3ELFA 4W9TA 5EY5A 3GKAA 2QDHA 5ABTA 1VH7A 1P5BA 3W7GA 3HIJA 3GDKA 2GJLA 5CSRA 4JTJA 1LTDA 1L9WA 3CEUA 1VC4A 4LVAA 1KM6A 2R8WA 2WQPA 3MI3A 3W7HA 4M6PA 4WUIA 3GK0A 1YLVA 2NLIA 3NQVA 3GB6A 2E09A 1S5VA 2A0NA 1JCLA 1TPVA 2CLMA 3PG8A 3ZWTA 5BNKA 2GUUA 2NUXA 3C61A 4BI5A 4LC6A 2DZPA 1ICQA 3W2LA 4N9EA 1FY6A 1J5TA 4YCPA 2F7FA 4CQAA 1IGSA 3CPRA 2ZZ5A 5D2XA 3DFTA 4FIQA 3W87A 3W7PA 3B0UX 2ZRWA 3TIMA 3GNDA 4WOZA 3W7NA 4GUGA 3TNOA 4PL2A 4MVAA 2CZFA 4BF9A 4PCFA 1D3GA 4R33A 4TU1A 3NM3A 5DELA 3MWAA 2WO5A 4AVFA 1R47A 3W7MA 4YLWA 5D38A 1NEYA 4O12A 3TA6A 2ATSA 2P10A 1TIMA 3BW3A 3PUDA 3LHUA 4M6QA 1NVMA 3LERA 2E5CA 3GXTA 3CIWA 1I45A 3TE9A 1I2RA 1OK6A 2X1TA 3UWYA 2YYTA 3W2JA 2DZTA 4TO8A 1IXOA 4GRSA 4EWND 1OVDA 5K3VA 5CPMA 1A5SA 3DENA 3HGOA 3N3MA 2ZZ7A 5DY2A 4EIVA 1XDMA 3C2FA 2C15A 3W75A 3OHIA 2PRMA 3NL3A 3C6CA 1D3HA 1DL3A 2P1FA 3QPZA 1LBFA 2OCZA 4HPXA 4OU1A 4AHPA 4FB7A 3UWUA 2FDSA 3T44A 3QRHA 1XBZA 3W6YA 3LLDA 5K4XA 1T99A 3W71A 4Y90A 7TIMA 5FEPA 2GQ9A 5KMYA 2F84A 4L4MA 1TTIA 3W1LA 3VFLA 4CQ9A 3DZ1A 2CLHA 2EPHA 3G0XA 1R2RA 5HUOA 4QISA 4JTUA 3U2OA 4ZQOA 3VI2A 1AL8A 1QFEA 1O4UA 1TQJA 2E6DA 1SR9A 3LRMA 3PY2A 2AGKA 4JYDA 4UFMA 4NJKA 3NR0A 4UTWA 1W5QA 2VOMA 3L0KA 3P7YA 3ZS4A 3S8HA 1S5TA 3NG3A 3LCXA 1GT8A 3LDVA 2X30A 3IV3A 2QCCA 3M47A 1FCUA 3CEPA 3P81A 4HKPA 4O18A 2HTMA 4ONVA 3BG9A 4FXRA 5C5YA 4UTHA 1F05A 4UR7A 4IMFA 1AW1A 2RDUA 3P84A 3QEZA 1I4NA 3BO9A 4MY1A 3B4UA 3THQA 4UTIA 2RHGA 5DY3A 1IIHA 3W7RA 4NZJA 4A22A 3W7CA 3VE9A 2OX1A 3LXAA 3QQ1A 4HNVA 5F1UA 4JTKA 4O1AA 1F2JA 1KM5A 2V0TA 4N4PA 2VKZG 1TPUA 4NUWA 1J4EA 1OYBA 2ISSA 2WV8A 2CW6A 5HULA 3I7SA 4X3ZA 4FHAA 4HSOA 1DKWA 2GVGA 1EP2A 4ZQPA 3GKFA 1R30A 4ALDA 1EB3A 4GFSA 3DH7A 3QMSA 3G1AA 1GVOA 4GUHA 4M6VA 2O7SA 3A5VA 1O5XA 3EKLA 4IMGA 1SO4A 3SIZA 1O60A 5J5DA 3W70A 1SFLA 3R2GA 3QM3A 1ALDA 3TDFA 2FJKA 3NQ2A 4XKYB 2Q8LA 1QR7A 2B4GA 1FDYA 3G24A 3DI0A 3KVMA 1ME8A 4RXFA 5G4EA 2QCHA 1FCVA 4CQ8A 2NX1A 3MP4A 1W3NA 4OT7A 4FX6M 3TFXA 1FXQA 3SGZA 1XDLA 2QCGA 3PB2A 1QDSA 1H5YA 1QOPA 3GYEA 1TO3A 2YYUA 1ONRA 3NPWA 4WXZA 1PHQA 3P8JA 1GG1A 3PVFA 2G96A 1O95A 1MO0A 3AJXA 1WA3A 4K7VA 5F2LA 1F76A 2VEPA 1SQ7A 3WK3A 2Z6JA 1W5MA 3NYZA 1ZAJA 1KFEA 1UB3A 1JCNA 3BGGA 4LUIA 1VGAA 1P0NA 3W74A 1IXQA 4JTFA 1HTIA 1LRTA 4AH7A 1K8YA 4O54A 3NVTA 2C18A 3QYQA 4ZVJA 4N9DA 5D04C 5G4WA 1FBAA 3IGUA 1OFQA 2A85A 3W7EA 3PM6A 3LXCA 1K7EA 4OV9A 5FEZA 3G3DA 5C6MA 1KLYA 5BRBA 3KRZA 3Q37A 2FB2A 3IIXA 3C2VA 4IMEA 5CGQA 3CWOX 3MP3A 4AHQA 4JY8A 3TSDA 3VCRA 4NU7A 3W7JA 2YDAA 4MJMA 1TMHA 4AB4A 5D02A 2QUVA 3UXDA 4DEFA 1WYIA 2E5BA 1Q6LA 2GVLA 3U6WA 1FXPA 1QO2A 2G5WA 3UYCA 3GDRA 1KA9F 1B3OA 1JCYA 4O4WA 1FWTA 1H50A 1YTEA 2TSYA 3W1PA 4YMZA 4G1KA 3W1AA 5C2XA 3W86A 4FNQA 3G1HA 1SZNA 4WQ6A 1F73A 1H7PA 4LV9A 2BWGA 2C1HA 4JR5A 1TJRA 1G4SA 3KXQA 1XL9A 1TV7A 3TH6A 1GYLA 5I3HA 3M6YA 1GOXA 4MLJA 1WXJA 1DV7A 2GJNA 3VE7A 1BWKA 4DF1A 3EX6A 2JK2A 1K03A 2BSLA 2B7PA 4R7JA 3MHGA 3ABSA 1K8ZA 2NWRA 3G1VA 2DORA 4MFEA 1VR6A 3HOJA 2Z1BA 3RLUA 3FS2A 3UNDA 2RKXA 2ZZ2A 5DBUA 1OFOA 2BXVA 3N19B 3R13A 2CLOA 2Y62A 3W22A 4CNOA 4JTIA 4XKYA 2H3BA 4S1FA 3MMTA 3LRLA 4C1LA 5FEXA 1C29A 3CWNA 4CCCA 3OEXA 3UY7A 2DZUA 1NF0A 2DU2A 2RDWA 1Z48A 1F74A 1ZFJA 3TAKA 1B9BA 1XM3A 1Q6QA 4QSHA 1KTBA 5K9CA 4AWUA 3CC1A 3DHFA 4RLIA 4RXGA 5I3JA 1F6PA 2NX3A 3Q58A 3MHFA 3QQ0A 1RQEA 3BV4A 1SU5A 1EX5A 3H53A 4AEOA 2YCEA 4LS0A 1LOLA 5F2MA 1UUMA 4IWWA 4UFLA 3E49A 1DORA 1GVQA 3F1QA 3SR7A 5E93A 1C8VA 3MBFA 5FI8A 3SI9A 1ICPA 4ZQCA 4ZQRA 1TV5A 5FF7A 5L6UA 5AYZA 1LP6A 1H60A 3G1FA 4FNUA 4H6KA 1OF6A 1GYNA 4LW7A 3W9ZA 1TSIA 4HT3A 1KBIA 3SFKA 3GXPA 4X2RA 4UMBA 4MKNA 5HWNA 4CCEA 1OFPA 1WBJA 1X8FA 3EKZA 3C0JA 3LB0A 1H61A 3PR2A 2C19A 4KFOA 2J9XA 1FWNA 3LHTA 4PA8A 3O15A 3HQ1A 3VNDA 5BOOA 3NPXA 3MI6A 3HPZA 1SSDA 3TC6A 2WSRA 1HG3A 2NZLA 3DFSA 1G4TA 2V9DA 5D09A 3F4NA 1GTEA 5E0KA 1JQXA 2ZRXA 2NUWA 5BMWA 1HFBA 2YZRA 3EWWA 3EWUA 3RFAA 3MYOA 3NA8A 3THAA 5TBOA 4KKXA 1JCJA 4Q33A 4GUIA 3S5OA 4UC5A 3HJZA 3NQCA 1Q6RA 5D2YA 1MEWA 3E0IA 3STFA 2VEMA 3O05A 1TPB1 2O7QA 1CX9A 3LCGA 3NQ7A 3IIZA 2TYSA 4RZ4A 3UZJA 3LCIA 2Y7DA 2EAWA 4Y9AA 1XXXA 5HJLA 4UMAA 3M1ZA 1TREA 1QPOA 5KZEA 4MIMA 4K7YA 4HNUA 3KFTA 4IX2A 1IIGA 2TPSA 2TRSA 2ZTKA 3IGXA 1MXSA 3IVUA 2A6NA 4Z0JA 3L5AA 3NZRA 2ZA3A 1DJNA 2ZZ4A 5LHEA 5EA9A 5D32A 1NF7A 5AHIA 3TJLA 4UXDA 1VPXA 5TIMA 5K9DA 3G1YA 3M5VA 5EMUA 1RVGA 5AOUA 3B04A 3BGJA 1RQHA 3EX3A 4LV4A 3F4WA 3MI2A 2W0UA 1S3HA 3H55A 4UFIA 1GZGA 3TKFA 3WK2A 3W7OA 1UASA 3TQKA 1VRDA 1CI1A 4PEKA 1GPWA 3CU2A 3TR2A 1KM2A 1WBHA 2XN0A 1KFLA 1Q45A 1VLWA 3W7DA 1PS9A 5FF4A 1B57A 3TC7A 2Y85A 3FKKA 3W7KA 2OZ0A 1H62A 1SO5A 1W31A 5DBTA 1TB3A 5G2IA 1ZJIA 4UIOA 5AC8A 1I2PA 4O1DA 3S1WA 4LRSA 1QWGA 1J2WA 3FYOA 2A6LA 4QIUA 1DOSA 3G1DA 3P5YA 1SZEA 3NQ8A 3W84A 4A2RA 2YFOA 4MYAA 1JQVA 5EYWA 3KVJA 3UWWA 2A1YA 4MJZA 1IXPA 1TJPA 2CZDA 1VLIA 1YDVA 4MZYA 3W2KA 5CZTA 2ATMA 3WJXA 2ZBTA 4WY0B 3I7QA 3B0VC 1I2OA 3LHVA 3W83A 5CSSA 1KBJA 3NXFA 3E9AA 4JX6A 2V5LA 4I9AA 4IGHA 4JEQA 5K9XA 3MP5A 4I7WA 1KV5A 3T7VA 1HL2A 3LV6A 4BK9A 3BLIA 3G0UA 5FEWA 2ZRZA 1GTHA 1K8XA 3W2MA 5IBXC 3V1PA 1FWSA 3M9YA 4MLRA 1KV8A 3PAJA 4K6AA 5I3IA 2WJZA 1EA0A 4JXCA 4JDYA 2A7RA 2QCDA 1XKYA 1H7WA 3A22A 1VYPX 3WJSA 2WNQA 1SW7A 3STCA 5L9FA 3ABQA 4QQ3A 3BK0A 3O8AA 3ATZA 3LCLA 4PL1A 4NNCA 4KWWA 1W5NA 4AMAA 1U83A 4HIBA 2WKJA 3L5MA 1G6CA 3Q2DA 3MO7A 1PL9A 3OG3A 3ANYA 5U7SA 4O1BA 4O1CA 1W56A 2A7NA 3C4UA 2QAFA 2Y7GA 1OX5A 4LS1A 1SO3A 3M0ZA 4O57A 5AHLA 3M5YA 3QW3A 2QCFA 4A2SA 2GOUA 3R8RA 5BW6A 2X1SA 2VFEA 4N9BA 4XTDA 2ZZ1A 3LI0A 3UY8A 4K8HA 3PSVA 4E38A 3S1VA 1OFRA 3PBVA 2HS8A 5BMXA 2OT1A 4FXSA 4PFMA 3TW7A 4ADSA 2H90A 2JBMA 1JR1A 3W23A 5HQEA 3LCWA 2V2DA 4BR1A 4MPQA 1YPFA 4HNNA 2A5HA 3IVTA 2J9ZA 4GUFA 3PBUA 2FPTA 3P80A 3OVRA 4ADTA 2J27A 2KZHA 2VFIA 3W88A 4JYEA 4POCA 4DPQA 5EL1A 1LORA 1F7BA 4NNAA 2B7OA 3O07A 1TPEA 3R5EA 1EUNA 5HR7A 4NJGA 2ZRYA 3ATYA 1VQTA 3TCEA 5DCEA 1ZAIA 1EP1A 3QFEA 4FX8A 4NVTA 4JNMA 4O4VA 1JULA 4RK8A 1A5CA 3DKJA 4NT0A 5HR6A 3HPSA 4BWLC 2WNZA 4YXGA 1VHNA 2V82A 5G5IA 1EEPA 1H1ZA 4LNYA 4WY0A 2X1RA 1VZWA 1OX6A 4EF8A 4YL2A 2YXGA 2GPTA 5EBUA 1YXCA 2YW3A 1WAUA 1EUAA 1IXNA 4K37A 1W3IA 5TQLA 1H7RA 2CLIA 3KHJA 1WDWA 4O53A 2J9YA 4TMCA 1XBYA 4MOZA 4Z0SA 1QPNA 4PC8A 1K7FA 4IPJA 3S5YA 3L66A 1VCFA 3SECA 3IEBA 1L6SA 3DKLA 4YWIA 3HBLA 4AXKA 3NO5A 3QZEA 2H3DA 3LRKA 3S0CA 3MUXA 3M5XA
chains in the Genus database with same CATH superfamily
2YL6A 4AZHA 2Z4GA 2QVHA 4M29A 3B9OA 1A0DA 3EX1A 1W32A 3NPUA 1YXYA 2EO7A 3SQMA 3A21A 2WWDA 4XV0A 1JDEA 3NCOA 2AAMA 4PTNA 3H22A 3VC5A 1PTGA 2ZQ0A 1WB0A 1QK0A 2D20A 1EJWC 3I3DA 3D46A 4Q32A 3JW7A 1IZCA 3NPVA 3BLFA 1J9YA 3LLFA 3WLNA 2HSAA 1VBRA 4JD4A 2BOEX 1XLDA 5LYRA 2G4JA 3M7WA 1MWOA 4G9PA 1QXLA 3WFAA 1GGOA 1UD5A 4FF7A 1KR1A 2CHOA 1A80A 1R2SA 3V4BA 4GE8A 2V3EA 5HINA 1OG0A 3O6CA 4ZENA 4EP8C 1ENUA 1RBLA 3OLGA 4UTTC 2CKSA 4XZWA 4QCFA 5CG7A 4LCRA 4GQ0A 5DMLA 1A5MC 3EWYA 3P14A 4PBEA 2C91A 2OLSA 3XIMA 3MJMA 3GIPA 3FYYA 4RCXA 4B3ZA 4HK5A 3OVGA 2OR2A 1JRBA 1HP5A 3ZJ8A 3UJEA 3CIXA 1XW8A 1OFAA 4PCTA 4MUZA 2DP3A 4AG0A 5BWAA 3BQ6A 1LOSA 1SPQA 2BG5A 1BF2A 1QVBA 2WSQA 3BG3A 1Q7ZA 5BXRA 4OBTA 4HPGA 2PUZA 5LNVA 3U3HA 3LBOA 1G01A 1KFJA 1PCWA 4D1IA 4A05A 3EMCA 4FLQA 2XIMA 3LCHA 1Q2SA 4OE7A 3AMDA 3SCWA 1YTDA 4JFWA 2WMJA 4ZB2A 3QGAC 2YW4A 3GW3A 4QX4A 2FZ8A 3NYDA 4G1NA 4CNUA 2BX7A 5A5WA 3P82A 2C16A 4E8GA 3H6OA 3VGFA 3UR8A 3G5EA 5CQ1A 4O50A 4UQDA 3SUTA 1GKQA 1J11A 3E2VA 1F8IA 4HNLA 2R1LA 3W07A 3DYPA 4NX5A 1W1VA 4JN6A 4Z2KA 3AALA 1ZLPA 2PGRA 1V7YA 4HJWA 1I9CB 3FVDA 4PN2A 4CD4A 2WXDM 3VGBA 4DXVA 1ECEA 1X6UA 3FDGA 3VDAA 1TE6A 4JTHA 2JGQA 2NSXA 4LNCA 4D8LA 1W9UA 4QNEA 5K4ZA 1QCWA 4TX8A 2C3ZA 1NOUA 1UR8A 4H04A 2BY3A 4FSAA 4FNPA 3JS3A 4RR4A 1LWJA 1FH9A 3B03A 2V5BA 2RFGA 2CKRA 1FTXA 3WSUA 1X7IA 4HA1A 3QOMA 4WIWA 1BKSA 2QF7A 2ZUWA 4O0ZA 2E1WA 1OHLA 3CV6A 2PRHA 3CTLA 3KCOA 3RYSA 3GO2A 1PZ0A 1X7FA 4HB7A 5DEZA 3LSBA 1BTMA 1P7TA 4FP1A 1XG3A 1H63A 4ATLA 4AY7A 3VD7A 3LQGA 5D8ZA 3BLPX 3L4VA 4AWTA 1A49A 4ASTA 1KKOA 2FKPA 3LCFA 5CPQA 5REQB 3ZYZA 3CZ8A 4O19A 4PRWA 2J75A 3WX7A 1XFBA 1B54A 3UZZA 1V03A 3W0KA 2AL2B 3F5KA 1QMLA 7CGTA 1SZFA 5DCDA 4C6CA 2R9RA 2C79A 1MDRA 2DIKA 3TV8A 4J3ZA 3UYIA 2EPLX 4WOQA 2P3ZA 3QJAA 5M17A 3FY1A 2V2CA 2HE5A 4GUJA 1XPGA 3AYRA 1Q4WA 3WJYA 1F4HA 4ROPA 3WMLA 4M8UA 1RBAA 4C6PA 3QXBA 3B0YA 4LAOA 1J10A 4CU7A 4IPIA 2Z6IA 5FAGA 1T96A 3OIHA 1V0MA 5CG0A 3BICA 3VD3A 1R87A 4D2JA 2VFGA 1F8MA 4NXSA 1DXEA 1TPH1 2D2OA 4N2YA 1K70A 3B06A 4XZHA 3RO6A 1GVIA 4IIBA 2ACSA 1YQ2A 4HYRA 3QMRA 2V3GA 5CKSA 1M01A 1EOMA 4UFHA 2Z0IA 3QPEA 2YBTA 3PZOA 4D6DA 2Z27A 3T8QA 2PDPA 1QI0A 1PZ3A 1TV4A 2J6XA 1QNVA 5D2TA 1ONXA 4QG9A 3EOOA 4QNWA 1EHAA 4F9DA 2JKAA 3KS6A 1E56A 2BHZA 1TV8A 2CXEA 3S83A 1U1UA 3TTOA 2J7HA 3PWIA 1H2JA 2KX9A 3ABZA 1J5SA 2OSYA 2WYSA 1NAL1 1I75A 1RP8A 1L6YA 4QLJA 2B7QA 1R3VA 4L4PA 1V6UA 4Y2WA 3DN5A 1XF0A 3ONBA 1C91A 4L9YA 4IIFA 1ADOA 1R7OA 1YKWA 4S3JA 3TC3A 4XUGA 1V7AA 3ANUA 3GAYA 4N4QA 1KFCA 1US3A 2CCRA 1XGEA 5JBFA 4R34A 3CMJA 4H9MA 2P5NA 3LTPA 4FPSA 3DYMA 3W1NA 2WAGA 1HVQA 2PD5A 4YN5A 5LGZA 1SVDA 4S3GA 3NQBA 1M7XA 2OT0A 3FJLA 2DPEA 1R38A 4IIDA 4LWWA 3KTSA 3QSTA 1UR4A 2DZWA 1BYDA 2BY1A 4Q7NA 3RJYA 5EFDA 4BWLA 4FZIA 4DIAA 3AMKA 5CPLA 3GQYA 3LLXA 1A53A 4Y9PA 4AF0B 4F0RA 3EX2A 3PN8A 1CGWA 3LS9A 3C0QA 1E51A 3FDKA 3CMGA 2GL5A 3FGCB 4IOTA 3C56A 3R0DA 2XVPA 3E5PA 3EA3A 2J77A 1IEQA 2FB3A 1RAKA 3VKAA 1B4EA 1UD3A 4BI6A 3MPGA 4WRHA 3A4XA 3TROA 2C13A 1IQ8A 2XISA 1YRRA 2HXUA 1Y8BA 4GBDA 2BZNA 3VMPA 3BW2A 2DZBA 4H83A 2W66A 1LROA 4GJ1A 3WQWA 4DWDA 5I24A 2WMIA 4PMNA 1I8JA 1R85A 3WH7A 4LTSA 1BEUA 1FWFC 4W85A 3DFPA 5T9CE 4GI9A 1GWJA 4NZCA 3CXOA 1R9YA 1WNOA 3KW3A 1PIGA 2A4AA 1E9IA 4OUEA 4HHHA 3FKRA 5AHNA 2JKEA 1DJWA 3B8TA 4H6EA 1XLJA 4RDZA 3UXLA 3FFSA 4P8WA 3NL6A 2WC3A 3QTGA 5AHMA 5AFDA 3GVGA 3PWGA 5AYXA 3H2MA 1VENA 3VD5A 2VMFA 3NM1A 2OOFA 1HKKA 3O16A 4MFDA 3PZUA 1QHZA 3WQ4A 3OGRA 4TQTA 1SZRA 4HMCA 3G8EA 1MI3A 4O28A 3CH0A 1E70M 4GJJA 3BAIA 2ISWA 3OA3A 3SSJA 1W8GA 3ALFA 4MWAA 4MMWA 1RY8A 2F9RA 2EG8A 3KVLA 2Y63A 4GNJA 3I68A 1W8SA 1K8CA 3UR5A 3GLCA 3D47A 3SUSA 3FJ6A 2D2HA 1EF2A 4LQ1A 3BQ5A 3LOTA 4L6DA 3SJNA 1FKXA 4WCJA 2GVEA 5EKYA 1QHOA 2OMAA 4KCUA 1TJ2A 3N73A 5EU9A 1CGUA 4ACZB 2GGEA 4HN4A 3RLVA 4GD0A 3ZFHA 4W7WA 2A2IA 1A3XA 3HGJA 3TWBA 2ZXQA 4NQ1A 3GH5A 1TZZA 2B31A 3RIKA 1LLWA 2NW0A 2WZEA 4XQ6A 3KOFA 4L4OA 2GQ3A 3I4KA 3MY9A 3GG8A 3L68A 4PB5A 4NYYA 4R53A 1EIBA 1JPKA 1TPDA 2BLEA 1OY0A 1XFCA 2ZX8A 2HNHA 1UBPC 3EDDA 5KSWA 5C9WA 4C1NB 2VRJA 5FJRA 4DBUA 3DFQA 2C6QA 3H2OA 3CUGA 3PUGA 1L0PA 5HMSA 3LM7A 4PMXA 3IUDA 1V0LA 2ZICA 3ZXWA 1EEXA 2VEKA 2OEMA 3VKBA 1UWUA 2I5IA 4GBUA 1JZ3A 3VIJA 3QN3A 4AHOA 4HU4A 4U31A 4K39A 1GOIA 3TN5A 4G56A 1FWAC 1UD8A 4HOXA 3NQGA 3N4EA 4LS2A 1BYCA 4TTGA 3TYEA 5CPOA 4EAYA 2BOGX 5DRCA 3BZJA 4LAMA 4TTUA 2QQ6A 4JKMA 3L65A 3RUBL 2HZGA 6ENLA 3CGTA 3WMCA 2XGZA 2RDTA 3AIVA 2YBVA 3WIJA 4OOUA 3S6DA 2NUYA 4DF2A 4ZQMA 1YEYA 1XGDA 1WQ5A 1OFDA 3MV11 3WQPA 4Z08A 4DO6A 5I6SA 2EG7A 4IFKA 3AO0A 3VZYA 1VRXA 3DG7A 1NOFA 3V75A 1W3JA 4HN8A 4MKSA 2X1UA 4O8AA 5CJ5A 5H8PA 2DZSA 2J24A 4GO8A 3M07A 4RZ6A 3VU2A 3ZLHA 5D9NA 3VM7A 1AFSA 2PTDA 4FS9A 1UR0A 2WPGA 1PHWA 3IACA 4YVXA 1EF3A 1ML1A 2QJIA 4JHZA 3I6TA 3AWOA 1T0OA 4N9CA 2DIEA 4FK9A 3SSZA 1G7VA 2FYMA 1QO5A 2NSOA 2E9BA 1CLKA 3S5SA 2PWVA 2ZZ6A 3EDJA 4OHQA 5TD4A 1BXBA 2WMFA 2YFNA 3B8WA 4JTEA 5KINA 4L4LA 3PUEA 3T0CA 1K9EA 3M41A 4WLCA 6TIMA 1QI2A 2IQ0A 4U5KA 3VDBA 4ZOAA 5KETA 4XVEA 4PB4A 2AQOA 5HOSA 3HG2A 3QPYA 4PCNA 3W02A 5EPDA 1N2VA 4W87A 1TZ7A 1SYTA 1Q7QA 2F8QA 2CFFA 3R7MA 1QNOA 3W1RA 1G4PA 2BGQA 3VNIA 2WSYA 3RCNA 3AZRA 3CB8A 2ISDA 1M7OA 3I7RA 5C2GA 4IJBA 1JZ7A 4TR9A 1KM4A 1NM9A 4IP7A 4FAMA 3W2UA 4AY8A 3I4EA 1IF2A 3KBNA 4Q8VA 3HF3A 3HGSA 8TIMA 1ZALA 4DUOA 3CHVA 4IFRA 1WV2A 1FHDA 3A4JA 2ZZ3A 5FSEC 4EACA 3CM4A 2OFJA 5I3FA 2PB1A 5FESA 4Q22A 3FA5A 3ID7A 1RLCL 5CGTA 4IGNA 1JI2A 1TTPA 3QKEA 4CUCA 3R79A 4D72A 1WO2A 3ONCA 5LNWA 3W1UA 2PRLA 2CETA 2XVLA 4N02A 2YLLA 1QPQA 2J62A 4YPJA 2W3ZA 2Y61A 4D6GA 2FPVA 1M6JA 1V02E 3GDTA 3RLGA 1BQCA 1BRLB 4RDWA 5LZLA 4PTDA 2FQIA 5ECUA 3WY1A 1TX2A 2XFRA 2J8GA 2PP1A 4X60A 4U4MA 5DN1A 2Q3OA 1PAMA 4FMVA 4OVXA 3RM9A 4W9TA 4XZIA 3GKAA 1WZKA 3GFXA 3W7GA 4J2PA 5CSRA 1ZGDA 5DX7A 3W53A 4JTJA 4DO7A 2YBUA 1L9WA 1KXTA 3CEUA 4LVAA 3MI3A 2WQPA 1ZJHA 1OT2A 2A0NA 1TPVA 3AIRA 4BI5A 4Y7EA 3C61A 2DZPA 2DW7A 5D2XA 3DFTA 2WBGA 4GVHA 3W87A 1VEPA 5FJTA 2IPGA 4MVAA 4XD3A 3CUHA 1TWWA 3T4WA 2DH3A 3MWAA 4OUIA 4AVFA 1R47A 1X38A 3W24A 4O12A 3TA6A 1DJHA 1RJRA 1X6LA 4JFUA 2UY4A 4Q8MA 1EGZA 4UZSA 1KB3A 3LHUA 1A4MA 4DXXA 5I09A 1FWBC 2WZIA 3TE9A 1GNXA 4TO8A 3WLLA 3GVQA 1OVDA 9XIMA 5GJPA 3UFYA 3HGOA 3N3MA 2ZZ7A 1XDMA 3W75A 1JDCA 3C6CA 4WDWA 4QDPA 1D3HA 1DL3A 2ZKMX 2OCZA 4JBRA 1LQAA 4MGGA 3UWUA 3QRHA 3GNPA 1JZ6A 4V27A 3QOKA 4PUMA 6TAAA 4L4MA 3W1LA 4CQ9A 3BH4A 2CLHA 3DZ1A 4QISA 4J5NA 1H5VA 1MYRA 4NZ3A 1BWVA 4ZQOA 3WH6A 1QATA 1QFEA 1TQJA 4QDMA 3PY2A 2WKGA 4UFMA 3NR0A 4WF7A 3LCXA 3RXZA 3M47A 3CEPA 1GVYA 4MPKA 4BA0A 1TMLA 4PUJA 5C5YA 4YYFA 2CZVA 1I4NA 3BO9A 4MY1A 1V79A 1X8CA 5BXSA 1E0WA 3B4UA 2I7GA 5DY3A 1PEZA 5D9PA 4A22A 2XH4A 2UBPC 2OX1A 1H49A 4O1AA 1KM5A 5A6LA 2V0TA 4N4PA 4NUWA 1GZ1A 1J4EA 3SUWA 2CW6A 3HPFA 3UCCA 4X3ZA 4FHAA 3OBEA 1VFTA 2PWHA 1EP2A 4H01A 4ALDA 3FAWA 2PSNA 1E4IA 1TIWA 3G1AA 4GUHA 2CHRA 3A5VA 3PTQA 1OGGA 3SIZA 3DBNA 3BJTA 1KCLA 3WQCA 3M0IA 4KWSA 2PF0A 4B92A 1ALDA 3DHUA 4U5IA 3TDFA 1QBBA 1FDYA 4ATWA 3DI0A 3KVMA 1ME8A 4RXFA 2QCHA 1FCVA 3PPCA 1K4GA 3Q65A 1UUQA 5C9RA 1FXQA 3QV6A 2AOSA 2DEPA 1QDSA 3PB2A 4FXJA 4MKVA 1QOPA 3HMCA 3GYEA 1ONRA 4XSLA 4PUDA 4HZ6A 1XRFA 3ZIZA 1QBAA 4PTVA 1W2PA 4IFOA 3UESA 3AJXA 3UPMA 4KRZA 1CXKA 4K7VA 3A47A 5F2LA 1SQ7A 3FV9A 3WK3A 3REQA 3ZZ1A 3HTWA 1ZAJA 1KFEA 3BGGA 4DI9A 1IXQA 3A3WA 4JTFA 3VNJA 2NQ9A 1HTIA 1LRTA 4AH7A 4O54A 2HEJA 4PFHA 1JZ4A 7REQB 3QYQA 4ZVJA 4N9DA 1XQKA 5D04C 1DXFA 1OWQA 3IGUA 3WQGA 5ABEA 4US5D 4DVOA 4WDTA 3VD9A 4OV9A 1UPPA 3G3DA 1I60A 5C6MA 1J18A 5EMLA 1ECQA 3MP3A 1ONEA 4AHQA 4JY8A 4DJEA 1J0IA 4DBSA 1MQPA 2Y1HA 1TMHA 1EZ2A 4C5ZA 2QUVA 2XYLA 4HK6A 1Q6LA 3U6WA 1QO2A 2G5WA 3UYCA 1LL7A 1M1BA 1Z7AA 1Z89A 5C9ZA 3CZKA 1L6FA 1BKHA 4JFSA 5HNTA 3W86A 1EJTC 1BG4A 4AZCB 4F0HA 1H7PA 4G7FA 4LUSB 4GKTA 4GQGA 1TJRA 3KXQA 3WLQA 2PDFA 2DQWA 3TH6A 3UU0A 4XD6A 1U2YA 3WD4A 1T40A 1CIUA 4HSHA 2PWFA 1M68A 4AX6A 3EX6A 4X63A 1KCKA 1I1WA 1EDGA 1HZYA 4R7JA 1IYXA 3MHGA 1JNDA 3P93A 1K8ZA 4H7CA 3ZR5A 4KGJA 3AYSA 5EGRA 5IHRA 4IM4A 1MRAA 3L2MA 4IJCA 3M0KA 3UNDA 2RKXA 2ZZ2A 3N18A 4GG9A 2PDCA 3LD5A 2BXVA 1XRVA 3GTXA 2Y62A 4JTIA 2H3BA 3UJSA 3LRLA 4EK7A 2I17A 3MTWA 1ZP3A 1XCWA 1TZ9A 4CCCA 4WGXA 3UY7A 2DZUA 2QPUA 3V1HA 2VDIA 1JI1A 4NG3A 3SCPA 2OG9A 1ITXA 1F74A 1ZFJA 3TAKA 1SJDA 4DM1A 5KEZA 4J27A 3H70A 5K9CA 3RGTA 1BXCA 2O9TA 1US2A 4RXGA 2A3LA 3PJWA 2WLYA 3BV4A 3H4WA 1SU5A 3H53A 1BGGA 3IJ8A 3VFCA 3L4WA 3HM7A 1H09A 5IRPA 1UUMA 4IWWA 3K4WA 3T08A 1JDAA 5FI8A 2PDQA 4ZQRA 3T0BA 1TV5A 6XIMA 4F2UA 2ZX9A 4H6KA 1GYNA 2R6OA 4LW7A 3WF4A 1TSIA 1JAEA 1PWLA 2X41A 3SFKA 4LBSA 1QASA 4X2RA 3OOQA 3RDKA 1WZAA 2ACQA 1E9LA 3GTHA 4UMBA 4MKNA 2WK2A 1WBJA 4PUKA 1E72M 1W1PA 3PR2A 4J1OA 2C19A 4H1ZA 1FVPA 2Z25A 3O7UA 2BBFA 3HZ3A 3WLMA 3MI6A 3HPZA 4L6HA 1QNRA 2OWWA 4QS6A 2V9DA 3F4NA 4XG1A 1GTEA 2GGGA 5E0KA 3S9IA 2ZRXA 1MMFA 3THAA 3OHMB 4GUIA 3WH5A 3SN0A 3SAZA 3DYOA 3HJZA 4P7RA 1ZZMA 3STFA 4DAFA 3LCGA 5IDZA 3N04A 1HP4A 3UZJA 2Y7DA 4Y9AA 2CERA 4JZ5A 2C1IA 5KZEA 4DUWA 3KLLA 3VNMA 4HNUA 3USZA 4DJFD 2TPSA 5HANA 3L4TA 3KZSA 3SCQA 4GIEA 1TVLA 4S3FA 1UIOA 2ZE3A 1AUSL 4H8UA 4D6EA 1PWMA 3TA9A 1YNYA 3N9KA 1NF7A 4LAZA 5AHIA 4UXDA 2CHNA 5EMUA 4CKQA 4IQEA 3B04A 3GVVA 4QHRA 3MI2A 5LIKX 3IJ6A 1GZGA 3EWCA 1Q6FA 2EJAA 3OP2A 3TKFA 3W7OA 1RXOB 2OO0A 4UQAA 4R9OA 1AZ1A 2GWGA 2BV9A 4PEKA 2OQHA 1MFUA 2ZVRA 4WVXA 3TR2A 1KM2A 1EJVC 3BTNA 1Q45A 1REQA 2OQLA 2CC0A 2Q01A 1VLWA 3W7DA 1PS9A 5FF4A 2Y85A 1ZJIA 4UIOA 4DX3A 1I2PA 4O1DA 3S1WA 1QWGA 1XSJA 3G1DA 4IZGA 1TJ0A 4MYAA 2A1YA 2D24A 2P88A 1IXPA 1TJPA 4L5ZA 1YDVA 3W2KA 4W7UA 5CZTA 2ZBTA 3PZTA 2Z1WA 3GSMA 1I2OA 5LIWX 4QEEA 3NXFA 3E9AA 2DGAA 4I9AA 1ZSXA 1B2YA 3AMCA 2G0WA 1HGWA 1GW1A 4PTWA 1HL2A 2G3JA 4BK9A 2ZRZA 1GTHA 2RDXA 1ITQA 4B5TA 3WNPA 1BGAA 2PTWA 1KV8A 2NVDA 1TWZA 5I3IA 3NDZA 3O0FA 3EYPA 3OLEA 1CXFA 3N29A 4Y9OA 2ZXAA 1H7WA 3A22A 2UY3A 2PZ0A 5TNVA 5L9FA 4MG4A 4TX6A 1PKNA 3NGFA 4QQ3A 3BK0A 3O8AA 3ATZA 4KF1A 3CTTA 2D3NA 4AZ7A 1W5NA 1EQCA 3QLDA 1U83A 2D0HA 3NIYA 3UBPC 2WKJA 4GZJA 3R4IA 3BOFA 4GVGA 3BLOA 1PL9A 3M0MA 5U7SA 1JPHA 4O1CA 1W56A 3MSDA 1XIMA 4LS1A 3M0ZA 1GEHA 3S2MA 2QCFA 2GOUA 4F3HA 2DDXA 3GE7A 1HJSA 3N12A 2EXOA 3PBGA 2VP8A 4CNTA 5C7HA 4E38A 1BVNP 1XX1A 2J7BA 2HS8A 2E67A 2VT0A 1FH7A 3TW7A 1XC6A 1XYBA 4YHEA 1CECA 3LCWA 1E1EA 1ZU8A 1CB7B 4W7VA 1O1HA 8CGTA 2J9ZA 2PGFA 3ITVA 4L56A 1Y5VA 3KUMA 3W26A 3F4DA 4CGTA 1UH3A 3S2JA 4XAGA 4ECLA 2XSXA 1RY0A 3DG6A 4JYEA 2BP1A 2YDQA 2QNEA 4GC3A 4E4PA 1GUVA 2Z28A 1EUNA 4NJGA 3ATYA 1B3YA 3TCEA 5DCEA 1EP1A 2F6XA 4M6UA 4O4VA 3C3UA 3AC0A 4R27A 2Z29A 3WNMA 4BWLC 1LLOA 1HQTA 1IHIA 2WNZA 4HA4A 1VHNA 5G5IA 2CBVA 2V67A 3EDFA 2QJJA 1HIZA 4MNKA 4YL2A 3S3GA 5A2CA 1E55A 4K37A 1W3IA 5TQLA 5AVHA 1H7RA 2AMGA 4C7GA 4O53A 1XBYA 4W8AA 2VDGA 4GVIA 3DFYA 2IPJA 5DANA 3M46A 3EDEA 3S5YA 4XAFA 1J0ZA 4GH1A 3MZNA 1E43A 3DUGA 4YWIA 4LX4A 3HBLA 4AXKA 3ZT7A 1XRSA 2VGBA 4ZMGA 2CXGA 5E6YA 4NX0A 5D9MA 3TQ0A 1IZJA 4GO9A 4PMVA 4A3HA 4ZOEA 9CGTA 3V5FA 3KM8A 4K8EA 3CWHA 4ZR8A 3TSMA 4C6EA 4GYFA 2REQB 2PFHA 4U33A 4BFAA 4LBRA 4MB1A 2PC8A 3H54A 1JPMA 2VC7A 4E0CA 1AQFA 4JIQA 3E74A 3OZMA 3BARA 4TV6A 4AC7C 1DPMA 4US6A 1XC4A 4X9SA 3B8UA 2NX9A 1F3WA 4O16A 1F61A 1OEPA 4Q6JA 3RPMA 4DLMA 4V28A 4WR3A 3CHEA 4YVPA 3NO1A 3E1F1 3S1UA 5AHFA 3KVKA 4GCXA 3TMQA 2Y24A 3FCPA 1PTAA 5DRIA 1RCQA 4QS5A 1J0JA 3OVQA 2D22A 4KFNA 3LZ5A 1E4MM 1CGVA 4RL3A 4LXFA 2V8ZA 3UD6A 4HQVA 2YL8A 2PP3A 1Z44A 4UFJA 2QCEA 1V0KA 2WJFA 3SCUA 3MANA 4Q8TA 5LHFA 1PKLA 4JCLA 2W63A 4MWAC 2QCNA 1ZBWA 2PMQA 2FFCA 3C8FA 1QT1A 4ADUA 3M16A 1S1PA 4KPLA 4PB3A 4C1KA 2RJGA 2ISVA 1TVNA 3PJUA 4MZ1A 3UPBA 4E8CA 5JIWA 4GVFA 3SN4A 5LNRA 3RK8A 2V69A 4K36A 5XINA 3CO4A 1RV8A 3U9IA 2H6RA 2IQDA 1YXDA 3N2MA 3W2NA 1ZJBA 2XZ7A 3EB2A 3FJ4A 3HO8A 1G4EA 1TYGA 5A1AA 1ZAHA 1TTJA 4M7SA 3GR7A 1X96A 3AMGA 3NOEA 3ANVA 4DUVA 1TVPA 2DQXA 3E02A 2OJPA 1DWJM 1VPYA 3ZM8A 1U30A 2ZX7A 2SFPA 3PSWA 3M64A 5HDRA 4G2DA 4I8YA 1L8NA 5SWUA 2E6AA 2TMDA 5G1TA 2Q71A 3STEA 4WGHA 3G6LA 4HYVA 3GHSA 3N3TA 5D4YA 3N9SA 4OFCA 6A3HA 1F5ZA 1J8VA 1XBVA 4DZHA 3UZXA 3TK7A 4PMZA 2V5DA 4ZL1A 1OFEA 1DHPA 2R1KA 2AQWA 2ONEA 2J79A 1UKOA 4IUGA 4U2ZA 4X61A 4UTJA 3T55A 4B3LA 2X8RA 3FLUA 5BZAA 3W1TA 4K3ZA 1DTNA 1FWRA 1RPXA 3N11A 2MANA 2G3IA 4O52A 2CYGA 4QJ1A 3RCYA 5EB8A 4PTXA 1UD6A 2BHYA 4KGLA 4AY1A 2PTZA 1F6KA 2YSWA 2CESA 2XFWA 4XZ9A 1VCVA 5E9XA 1BVZA 3LTSA 1EGMA 3HG5A 2VI0A 3RLHA 3BSHA 5DXYA 2YOCA 3VGHA 4MZ8A 3M44A 5CLWA 1EC8A 2PDUA 1AQMA 3SDOA 4CD7A 1FDJA 1JZ8A 1TA3B 3TUUA 1C93A 3WNLA 5JUVA 1LUCB 3MV01 1S39A 5H1WA 3M0LA 3WD2A 2YLAA 1HKVA 2VD8A 4B5SA 5GVJA 4S39A 2UV8G 2YL5A 3VNLA 1QNPA 5D9OA 2JE8A 4JTTA 1X1OA 4S3CA 1UWQA 4MY9A 2FZDA 2W79A 2DSUA 3L5LA 2Q8ZA 4BQ4A 3FNDA 1VYRA 1QRQA 1DBTA 2GJXA 1V51A 2WOQA 2C14A 3OIXA 1YADA 1TPWA 1XWYA 2HMCA 3K13A 3WNKA 4IJRA 1ZCCA 3B97A 3EMZA 4C7FA 3ITGA 2X40A 1AZ2A 1HJQA 4CEUC 3A6OA 1W1IE 1VFFA 3AIUA 1XIIA 3QHNA 4ZZ9A 4LB4A 4B3KA 3LUTA 3NQAA 3CUXA 1H7XA 2AAAA 3KOYA 3B40A 1XD0A 1XYLA 4FIRA 4LUTA 1FWGC 1XLFA 5XIAA 4TXEA 4M0XA 3INPA 4UOJA 3R8HA 2E6FA 4F0SA 3O6YX 3URBA 4JTSA 3FA4A 1BXNA 3TJXA 3OBKA 1LWIA 3TXVA 4A3RA 1BSIA 1FCBA 4B5NA 3EXRA 1B3WA 3PWAA 1NELA 2V68A 3CASA 2V30A 3C0LA 1PO9A 1V3KA 4GJIA 4DBDA 4NJIA 2VZSA 4W93A 3OZYA 1K9TA 4KRTA 4CCZA 2R91A 5GNXA 2CLFA 3BJSA 3V0TA 4A3UA 3C2YA 1G67A 2J88A 2NV2A 3W7IA 1YW1A 1M04A 1C92A 3GG0A 3HU7A 1AVAA 1XUZA 5FOOA 1K77A 3EXSA 3RX3A 1T8QA 2X42A 4E2OA 2Z24A 4UQCA 3LHYA 5GJMA 4G7EA 1K02A 1ELSA 1KLZA 1JYXA 3IJ7A 1E4LA 3RG6A 1I2QA 4D9PA 3VABA 1Z69A 3C8NA 3V35A 2XJ7A 1VIWA 3OGSA 3GR8A 1W0MA 3HB9A 3B05A 2CLLA 1QNQA 4D6FA 4RE2A 8XIAA 3C2OA 1UPMB 3GAKA 3HG4A 3PS7A 4BS0A 2PZNA 4NZFA 4OKDA 3DXIA 4M7TA 1K1DA 3RNDA 5A2AA 4D6HA 3LHWA 3C2RA 2I56A 3UQNA 1JUBA 2P0IA 1VJIA 1OG6A 1OX4A 2POZA 1ZJAA 4JQ2A 3WF3A 2ZRUA 2DW6A 3V18A 2YXXA 4ATDA 4E2BA 2I9UA 2ALDA 4TMBA 4FR1A 2QUUA 1DJIA 1PIIA 3NVDA 1DJZA 4ZB0A 4ERGA 4I3GA 2ABAA 2UY5A 5RUBA 4N6FA 4LRTA 2C0HA 1O6IA 4OQVA 1A5LC 4JIEA 3BSMA 2F61A 4KT2A 1N7KA 3ZLFA 3A12A 3A23A 3CUIA 1U1HA 1V6XA 1NQ6A 4PGLA 4XIAA 2YCJA 3WLJA 4KCWA 1OGSA 1OFBA 4QLLA 4Z2JA 3ISIX 4Q8QA 4KFPA 4UR8A 3S9YA 3AS3A 4WY0F 4LUJA 2INZA 4MWAE 1RH9A 3G8RA 2Y88A 1O94A 4MHBA 4RV8A 1W1YA 2AMXA 2G41A 3VNKA 1O5KA 1DWHM 1CB2A 3IWPA 1YPIA 5F4WA 3GNOA 2PTYA 4FO4A 1E71M 2A7PA 1FCQA 1NY1A 5I78A 3WL0A 4HYWA 4DPPA 5AN7A 4FX7A 4MNJA 3VINA 1NSJA 2DZVA 3H24A 4PRRA 1Q6DA 1YYAA 3NGJA 3W1MA 4IUOA 3DAQA 3L4YA 4X2PA 2FLIA 2NQLA 4CQBA 1UJPA 6REQA 1FWDC 3WEOA 3A9IA 4Z1BA 3FX4A 5AC7A 1AA1B 4GKLA 1RD6A 4MDOA 3IRDA 1HF6A 2Q3RA 2CBIA 2WHLA 2C7FA 5CGMA 5MF5A 3ZOAA 3VGGA 1OIFA 3KBMA 2GK1A 3ARZA 2F2HA 4QITA 5A3HA 5LA1A 1T8XA 2HV5A 2VX7A 5HA7A 3H2NA 3UJ2A 2FTPA 3QV9A 3DFNA 4IFKB 2NXIA 5KZDA 3SQSA 3TQPA 4JQ3A 5AHEA 3NAVA 1UBSA 2R82A 3HGRA 4ILSA 5FF3A 2VFFA 4KWOA 1LBLA 1OJXA 2BY2A 4IHCA 1PX3A 2INEA 3HV8A 4H2CA 4B2DD 3SGUA 1OYCA 3S47A 1H7OA 2E68A 5BOEA 1EGVA 1Y5WA 2B81A 1R0MA 3QYSA 3A64A 3W4RA 3KBJA 2QKFA 4NJJA 2FTYA 3EOLA 5HNUA 2EPMX 3EWBX 1C7TA 7ODCA 3UJFA 3BMXA 1K7XA 4JPGA 3U8GA 3I3EA 1LF1A 4ZODA 3LYEA 4XZLX 2YPIA 1SZGA 3ENLA 1QJWA 1XICA 3QV7A 2FGLA 2CU0A 1JF5A 3GH7A 3ZVIA 1HN1A 2XSAA 5AZ0A 3G1XA 3HA1A 1MVYA 4OECA 4LVDA 3T2OA 2OWXA 3ABRA 5I3KA 3GUGA 7TAAA 1NDZA 2FZ9A 2NT0A 3LHZA 1XIJA 5BYWA 4O13A 2ZYFA 3FEMA 1L6GA 2UWFA 3K8MA 1A3HA 1J79A 1LZOA 1TPFA 3AFBA 2OZTA 3S5NA 1RR2A 1KXHA 4XWUA 1PV8A 3IANA 5G4HC 1ME7A 3MB9A 4QE5A 3KX6A 1I0DA 3G22A 5ABFB 1BD0A 5CAHA 1RHCA 2G4FA 2WSKA 2WMGA 4HMDA 4DJEC 3LGDA 1VF8A 1XLHA 3PANA 1EP3A 2Y0FA 4BEQA 2WJDA 2EGZA 1L8PA 2VQUA 3NJ3A 2BODX 2VDHA 1DHKA 1BPLB 1EPVA 1WDPA 1A50A 3LBCA 3RX4A 3WLIA 4HCLA 3W85A 3GC5A 3IJIA 4ZO9A 3RX2A 4JYFA 3S42A 1EJ7L 1XSKA 2JIWA 4MB3A 5AYYA 1VS1A 2CITA 7XIMA 3S1XA 3QSRA 1ZENA 3WQ5A 2BOFX 4R9XA 4CNPA 4LYKA 5A6KA 4QG8A 4HHPA 3L4UA 5A8MA 2PE4A 1N8WA 1M53A 1RSCA 4K2SA 1AW5A 1AJ2A 2GGIA 2GOKA 2E77A 4PMJA 3VX1A 1HO4A 2VFHA 4M19A 2QEZA 2VZTA 4YYCA 1RQBA 4EF9A 3S2LA 5AYBA 4YIWA 5HMDA 3DHPA 3LGGA 3Q94A 2PDXA 4N0RA 2JEPA 4HA0A 1EQPA 5F2IA 4RW5A 1JCMP 1C3FA 3MZ2A 1EPXA 1UCWA 1NP0A 2PODA 3MYPA 2O9OA 3IPWA 1GPFA 1W91A 4A4AA 2J25A 1SUXA 2X05A 2VC9A 1AH4A 1HNYA 3PF3A 3UA3A 4O11A 6PTDA 1ZTVA 4O15A 2Y8UA 1ZUAX 4MAZA 3IUIA 4ML9A 5D05A 1A5BA 2P8BA 2OODA 1ME9A 4QDWA 1OYAA 1IEXA 3MKCA 3QF0A 3SGGA 2FJUB 3AOFA 3NUKA 3AAMA 1HJXA 4P8VA 1NJJA 3ARSA 3LGEA 3QGVA 5FSDC 5A6TC 2ZUMA 1XLBA 2PDMA 5EMMA 1N55A 4QAWA 2GUYA 3WQEA 1TG7A 1R3SA 1XLGA 5M5DA 3QY8A 4FNTA 4WSJA 3WUGA 1IE7C 4LVFA 4UCGA 1QW7A 1W17A 4FALA 3FVMA 5DXXA 4C5YA 3GXNA 2EPOA 4WKAA 3CHCA 1LRQA 5KZMA 2DZXA 2H8ZA 4H3DA 1W1ZA 1AQ0A 1DQWA 4LU0A 4QFUA 1DJGA 4FR6A 3FSUA 3DHDA 1R46A 3XINA 1BAGA 1B3VA 1F9CA 3M5ZA 4O1EA 5DCBA 1ZNNA 1YTKA 3BPWA 1QW9A 4JDBA 1DQXA 1QPRA 4HNOA 5AB3A 4NILA 4KMQA 2F38A 4DXKA 4WJEA 4W89A 1XIGA 1UOZA 4I8DA 3UXKA 3W7LA 6ALDA 3RJXA 3ZT6A 5CC3A 3CUFA 1SSGA 1OBAA 4GZIA 4QR6A 4MAVA 2VYOA 3FEQA 3T1GA 3UERA 3PZIA 3ZR6A 1JRCA 1WXYA 3IGSA 3CUZA 3GBEA 4RX0A 3ELFA 4ZSUA 1P5BA 2VRKA 1KXQA 3HIJA 3GDKA 1UD2A 3WLTA 3W6LA 5JVLA 1VC4A 3ZT5A 2R8WA 4LB3A 3XISA 4WUIA 3GK0A 4MUPA 3GB6A 1S5VA 1JCLA 3SUUA 2CLMA 3PG8A 2OEJA 1ICQA 2PF8A 3W25A 4A3QA 3S2CA 1HJUA 1IGSA 3K4AA 1J0KA 3ITYA 1V3JA 2OXNA 3GNDA 1PJ9A 3F2BA 3APTA 4GUGA 2CZFA 4BF9A 3C5QA 1J96A 3WQVA 3NM3A 4PMUA 3CV7A 7A3HA 3R25A 3O9NA 1K9DA 2AKMA 3EEZA 4OOZA 2ATSA 3FHQA 4HP5A 4NF7A 4M6QA 2AL2A 2JFEX 3FN9A 5DMYA 2WQDA 4GH3A 1I2RA 1UJQA 1OK6A 3REQB 3SY1A 1TFVA 2YYTA 1TR1A 3OPSA 2DZTA 1B90A 1Q6CA 4GRSA 4EWND 5K3VA 1GOMA 3DENA 1ZS2A 2YA0A 3H8AA 1O5RA 3OHIA 5GJNA 4WKHA 4IIEA 3NL3A 2ESCA 3MSGA 4B5XA 2P1FA 1LBFA 4HPXA 4OU1A 1R8LA 3VX0A 3KDNA 4NZ1A 1O68A 1FP8A 5CAKA 2GDUA 3DCPA 4OBSA 3I6EA 4B5VA 5K4XA 3W71A 3A3HA 2GQ9A 4NSBA 2O4QA 1SM9A 2J7EA 3U2OA 1KWKA 2PS2A 4ZFCA 3VOFA 2XH0A 3LRMA 2AGKA 4C65A 3PAOA 2XG9A 1W5QA 2VOMA 3P7YA 1C7SA 4LGXA 2X30A 4DHGA 3T0TA 3P81A 4O18A 2WWCA 4YJ5A 3BG9A 4L9XA 1O66A 4UTHA 1F05A 1R3RA 3THCA 1UMLA 3P84A 3ECQA 3ZJKA 3FXYA 1A0EA 1NFGA 1HKMA 3LXAA 3N6JA 4RDYA 4HNVA 4FLSA 5C0QA 5CJNA 2WV8A 2ISSA 4R5EA 3Q4DA 3VUSA 8XIMA 2GVGA 4ZQPA 1S38A 3D3AA 3GKFA 4I5XA 1V93A 3B9AA 4AIUA 4BF5A 1E73M 3QMSA 3B0XA 4QEHA 3TR9A 5HQLA 4M6VA 2QIWA 4KH2A 4AEFA 1PZ2A 3CQIA 3EKLA 4IMGA 4RDVA 5BCAA 4Q4RA 2NVCA 3MDWA 3R2GA 3QM3A 2IMRA 2FJKA 2VL4A 4KIEA 3DECA 2C71A 2FHFA 2PBOA 1W3NA 4OT7A 4J3VA 4DWSB 4FX6M 3G6MA 2QCGA 3URAA 1D8WA 1W2VA 2I57A 3TYDA 2YCLB 2YIHA 2D2GA 4WXZA 3ITOA 5C2CA 1HJVA 3H2FA 3PVFA 2G96A 1O95A 3IJ9A 4LFYA 2VGIA 2Z6JA 1W5MA 1V4YA 1T41A 1TR9A 1EDTA 5BU6A 1W3KA 3VO0A 4DN1A 1K8YA 3NVTA 2C18A 1DXIA 3W00A 3CZLA 2OLAA 3RPTA 4CU6A 2HK0A 3W7EA 1HJWA 3PM6A 4UQEA 5IFPA 5FEZA 1U5HA 1CBGA 3T05A 3H2AA 5BRBA 2G8ZA 3Q37A 4TVCA 4KWUA 2FB2A 2YJQA 3FGCA 3IIXA 5CGQA 3TSDA 4NU7A 4GZEA 3W7JA 1VP5A 3HURA 3LPPA 5M3WA 2ZUUA 3UXDA 1WYIA 3ZSSA 1AH0A 1J93A 1B5TA 3UZWA 3GDRA 4U3CA 1B3OA 4O4WA 1FWTA 1YTEA 3W1PA 1IEVA 3KZPA 4YMZA 3GHRA 5C2XA 4A8RA 1H3GA 3UWEA 2VM8A 1OADA 1SZNA 5A6AA 4AZ6A 3GIQA 2C1HA 4JR5A 4US5A 1TV7A 1GYLA 4IGMA 3M6YA 3QHOA 1GOXA 4MLJA 4GPNA 5LXXA 4PYSA 1DV7A 1BWKA 4BQ2A 3APGA 1EO5A 1ZBVA 1WXZA 2BSLA 2B7PA 4L1WA 1P6WA 3OW1A 4L7ZA 1VFSA 2XZ9A 1IWPA 1VR6A 3V5OA 1V6WA 3HOJA 3UGVA 2Z1BA 3RLUA 2GJPA 4ZOBA 3N17A 1OFOA 4DBWA 3R13A 4G6CA 3W22A 4CNOA 5TAOA 1HL9A 3I3BA 1NDWA 1KC7A 3VVGA 3K1GA 3OYXA 5CC7A 1NF0A 3T42A 1JZ2A 2RDWA 3OQ8A 2GSJA 4BY3A 3MS8A 1Z48A 1ZQ5A 1DWIM 1XM3A 1Q6QA 3HPAA 3IJQA 4ZCWA 4AWUA 4H6RA 3M4HA 5I3JA 3VIKA 2NX3A 5CJMA 5LA2A 3U5UA 4YNGA 1REQB 4AD4A 1RQEA 1EX5A 2YCEA 2OQYA 1R9ZA 4LS0A 1B31A 5E6ZA 1EDQA 1PBGA 4UFLA 3MU7A 3F1QA 3SR7A 1PDZA 1EA9C 5FACA 4DAIA 4ACZA 4IP5A 5L6UA 3LA4A 3TOYA 1G1YA 1H60A 4FNUA 2H9AA 3LK6A 3WBWA 4HT3A 1SMDA 1RK5A 1KBIA 2J66A 1V3HA 1EJSC 4TOQA 2J78A 2F6UA 4UCFA 3ZLGA 5HWNA 1WKFA 4CCEA 2PLJA 1WKEA 1X8FA 3GDBA 3THDA 3LB0A 4GX9A 3LHTA 2IKJA 2P76A 3P0WA 5BOOA 1BLIA 4Y8EA 1LT7A 1US0A 3GRIA 3VZXA 2WSRA 1HG3A 2EG6A 5D09A 3JVAA 1KR0A 1CDGA 4AD5A 1JQXA 4NHVA 2XIQA 3J7HA 3T0AA 3MMDA 2A3CA 3EWWA 3RFAA 1SJBA 2MNRA 2PU1A 4Q33A 3RHGA 3S5OA 2X7VA 1IWAA 1UR3M 1IT0A 2V6AA 3W6MA 4O1FA 3VGEA 1MEWA 1OCBA 3KCLA 2CNCA 1AODA 3O05A 1TPB1 1CX9A 2HROA 3T2QA 4CEXC 3SRFA 3GNXA 4RZ4A 3TYCA 2Y4SA 3SIMA 4NL1A 5HJLA 2JEQA 1QPOA 2XM1A 2VQTA 4PMDA 4G8TA 4B16A 4QRNA 3ZVHB 3KFTA 4EXBA 2TRSA 3AISA 1FRBA 1XIDA 1E6NA 2A6NA 4M81A 3L5AA 3QZ6A 1SGJA 1GKPA 4RE3A 1AQHA 1UR9A 2I16A 1VPXA 5K9DA 4LYQA 3W37A 4LV4A 1TUXA 4UFIA 2QYGA 3IAPA 3W82A 1IR2A 4GX8A 4JTRA 3APYA 3TQKA 1E0VA 1GPWA 4W88A 3IGHX 3TVAA 3K5XA 4GIRA 1W9VA 3S9ZA 3CU2A 4GIYA 4F9JA 3NDYA 4DJFA 1B57A 3N13A 1H1NA 3GS6A 3RRAA 2PDKA 3W7KA 4FXFA 1W31A 4JIHA 5G2IA 1E6SM 1MW0A 5AC8A 2DY3A 2IXUA 1PYMA 3KTXA 1WKDA 3NZGA 1E3ZA 2DVTA 1SZEA 2E0PA 5DT5A 4A2RA 1B0IA 5EYWA 3AUOA 1Q66A 1DWFM 4H7ZA 4ZO8A 1EZWA 1VLIA 4MZYA 1FP9A 2DSWA 2XGBA 3A9BA 4QBXA 3TYAA 4B5UA 1BTCA 2OOGA 5FJUA 3W83A 1W1A1 4HMEA 1P48A 3WYZA 3CJPA 1UZ4A 1YDYA 2W27A 5LIYX 4IIHA 2YB1A 1MUCA 3ES7A 3T7VA 3LV6A 4LJ3A 1VFOA 4CD5A 1GOKA 5FEWA 3GU2A 1K8XA 3TYUA 4UOZA 3VM5A 3EB4A 3LMYA 3M9YA 4MLRA 2WM0A 4C6LA 4AD3A 4QTGA 1EA0A 3GG1A 4XD4A 2IPFA 1TKKA 5JIPA 3RPDA 1SW7A 2WM1A 5HATA 3ABQA 3EDKA 4GFIA 4GIAA 2HE8A 2OO6A 4AMAA 3L5MA 3Q2DA 1LWHA 3STPA 3SCOA 5M03A 2A7NA 1P0EA 3MSRA 1CTNA 3C4UA 1IV8A 1OX5A 2Z1SA 2VUNA 4KQNA 3QQWA 4A2SA 4B15A 3BURA 4X0NA 8RUCA 1XR2A 4F40A 4XTDA 3UY8A 1B1YA 4K8HA 3SN1A 3VGDA 3PSVA 1OQFA 4ERAA 2OT1A 2J7CA 4FXSA 4PFMA 4UNIA 3P0XA 2JBMA 3NO3A 5HQEA 2V2DA 3VTRA 4PSRA 1Q5MA 5DMMA 1SR0A 3OVRA 4AIEA 3GXFA 2KZHA 3QFWA 1VB9A 5IDIA 4POCA 3W88A 4DPQA 3SBFA 3VKCA 1T6MA 4C6FA 3GD6A 1F7BA 4NNAA 1TPEA 1X6NA 3R5EA 3G1RA 1RCXB 3OU8A 2WMKA 1HX0A 4JNMA 5CBJA 1W9DM 3ZQ9A 3WH8A 3GW0A 3VIMA 1A5CA 4JTAA 1EX1A 2YCKX 4B4FA 3RRXA 2QPXA 4EPEC 3R6IA 4PR4A 4KS0A 2OLHA 3B8IA 5I0DA 4WY0A 2X1RA 2G3NA 3WBEA 1VD6A 3EOEA 3I10A 1OX6A 3CL7A 4EF8A 1XINA 3MMWA 3EOSA 2D2JA 1A5OC 4M1BA 2AQVA 2WVSA 3NZQA 1SJCA 1YXCA 5CZKA 1IXNA 3KHJA 1WDWA 1NWSA 2INFA 4LANA 1M03A 2IW0A 2X0YA 3MO4A 1VCFA 3IEBA 1XH2A 4A8NA 4EPBC 3DKLA 3POHA 3E2RA 3VOIA 3S0CA 4IISA 4FNSA 4JTCA 3LPFA 3MDUA 4UUIA 5HNNA 3LI1A 2GGJA 2CBUA 2W91A 1JFHA 4RE4A 1C8YA 2ZC1A 4ORMA 4Z1AA 3K30A 1J12A 2EKGA 2ZA1A 3MT1A 2DSZA 3VZZA 1L2UA 1R86A 8A3HA 5A6JA 3AZSA 4FLOA 2CZ5A 5A8GA 3L67A 5HAOA 2VVNA 4K1GA 2DJLA 5D33A 2CEQA 1CCWB 3FIGA 1O7AA 2GDQA 4HCHA 4DB7A 1TPC1 2PLKA 3SW6A 3UVIA 3T07A 2VTFA 4IXXA 4CLMA 3NFUA 2JQXA 1C9WA 1SFJA 3ZO9A 2NWSA 1HL8A 1MEHA 2PGEA 3PJXA 3L4ZA 3MVTA 1BQGA 1FWJC 4O14A 5I7GA 4O17A 5DQPA 3OZOA 4CVWA 1H51A 1KRMA 1XBXA 1NFBA 3MKKA 4ZE4A 2DVXA 4Y8FA 3U7VA 3N2TA 1P4CA 3UCDA 1W5OA 2CPUA 4KCTA 4M3PA 2X2YA 1ZCOA 5LGXA 4LEQA 1MRQA 2X0HA 3W3OA 2R1MA 2JIEA 3SJ3A 2R94A 3DGRA 4AD2A 3TEVA 2QMKA 3LSCA 3MSYA 5FF2A 5DLCA 4KW2A 1WOBA 4ZE5A 3WBYA 1AMKA 4XKMA 3TMLA 4F0MA 4HPNA 5KTLA 5FAJA 3RCMA 1R3TA 4J3WA 2J7DA 3IVSA 3NOYA 4JQ4A 4MY8A 1KO0A 1WP6A 4IMCA 3WH9A 5IFTA 4JIRA 3RO8A 4E3TA 4J9JA 1VCGA 3BE7A 2GJXB 3IRSA 2QT3A 1NDYA 4UTKA 1RA5A 1D3CA 3BLKA 1XLMA 1YNPA 2E8ZA 1R6WA 2PEVA 3TU9A 2YX0A 1PCKA 1S5NA 3NSNA 1G7UA 2DJXA 1QI3A 4GMEA 3KWSA 4BEUA 3M43A 1YDNA 3EX4A 2PBGA 1IEWA 4AYGA 2PCEA 1PKMA 4DZ5A 1OCJA 4CCDA 1OB0A 1Z41A 3T4CA 2FPYA 3PNUA 5CLTA 1B3ZA 4GY1A 4AIBA 3TX9A 4LVBA 4HGXA 4GHRA 2BHUA 2F6KA 4KBXA 1YBQA 4S23A 1P6BA 4GQQA 4GYJA 2GUBA 4R7OA 5FL1A 3VCCA 3FOKA 4YU1A 3CMFA 7REQA 4WJ8A 4ZQNA 1CXIA 1WDDA 5CEWA 4H9UA 1X98A 4HZ7A 4Q4MA 2IS7A 2L5HA 2W92A 1AG1O 2C1GA 1OM0A 3FXGA 1X39A 4JEJA 4M82A 5CXPA 1DTUA 3GYCA 4NAEA 3PZQA 3TSBA 2A21A 1EO7A 2QDDA 4JTGA 1ISWA 4PODA 2G3FA 2ICSA 4F79A 2Y5EA 4UBPC 4G7EB 5U4NA 1S2VA 2BVTA 4HZMA 3G0SA 5E09A 1VEOA 3M7SA 1A5UA 3AXMA 4IPLA 4AZCA 1GEQA 2PP0A 1P0BA 4LBUA 4LUSA 3WJZA 3U48A 1UZDA 4F48A 3HG3A 3RR1A 3JRKA 1GCYA 3DI1A 1KGXA 2Z00A 4S2BA 4NNBA 2ZWZA 4F0LA 4Z2IA 3N1AA 1E6ZA 4M24A 5G2HA 2VX4A 2EHHA 2QR6A 9XIAA 2QIIA 4QCEA 3ARQA 1AW2A 1WE5A 2HCVA 2QV4A 1TTQA 2Y5SA 1NDVA 3WQFA 4D1JA 1OX4B 1MDLA 2PDIA 4Y96A 1WAWA 5AKQA 4XO6A 2OPJA 4O10A 3QBUA 4E2VA 3O06A 2YXOA 2FTWA 4XBKA 1LOQA 1A5KC 1E6PA 1LL6A 2FIQA 5CZSA 3R89A 3RR4A 4OTKA 4TIMA 3LZ3A 1JD7A 3WMSA 2V3FA 1XQLA 4JX4A 1F6YA 2Q02A 2ZDRA 3PBWA 4DUXA 5CC5A 5C7VA 4W4QA 3UG8A 2OZ3A 4XAZA 3QY7A 3FYPA 4N7QA 2PAJA 2PDLA 3N9RA 3NQDA 3UXIA 5CBBA 4I5UA 3PBYA 4I9TA 5CBIA 1UUOA 1XS2A 5BRQA 1LQ2A 5F1VA 3BDKA 2FGBA 2R24A 3N4FA 2ODOA 1D9EA 1CT5A 1DIDA 3W72A 4EXQA 3OB8A 2VURA 4MTVA 1MEIA 4YHGA 3AS2A 4MM1A 2OSWA 3BLDA 1PSCA 3UETA 1XISA 5ECVA 2E3ZA 1D2KA 2QV5A 2Y5JA 3WD0A 3BAWA 3HFTA 3UA4A 5I5RA 3L21A 4RKAA 2P8CA 4JIIX 4Q4SA 2O0TA 3W76A 5LNUA 2FDMA 4LF1A 3LM3A 1E0XA 2QJHA 4DJDD 4EOUA 3DGBA 1DIOA 3N6HA 1TCDA 2BXZA 4I7UA 4I90A 2QUNA 2GK1B 3CH9A 3R12A 3CT2A 3BSGA 5F2GA 2AL1A 3TXZA 1XIHA 2DT2A 5F4XA 3N2XA 4HHLA 4URIA 3TJIA 2J8FA 2GDVA 2BTMA 3EWZA 3KOZA 4WDXA 5I2UA 3MJYA 1AMYA 2W5FA 3C3NA 3UWQA 2P53A 2W6RA 3SCRA 1KFBA 3AIQA 1EIXA 2I9EA 1Q3NA 2OTDA 1H11A 1ZPTA 3GZ3A 3WQDA 5GPRA 4UFKA 3VXGA 3WQOA 4BKNA 4F66A 1GQJA 4NI3A 1WDRA 1JCTA 4AQLA 4XX6A 4RV3A 2I14A 2QDEA 4C6KA 5A8OA 4E2DA 3QR1A 1CGYA 1N8FA 1R9XA 3R0KA 2PD9A 2IXVA 3TFCA 1R3QA 2PDJA 5FJPA 3H26A 2G97A 4GOAA 2H8XA 4QGCA 3D3FA 2Z2UA 4P8UA 4WSKA 1IZKA 1XCFA 1OCQA 4I7VA 1WOAA 4X0VA 4JKKA 1E40A 2XN1A 1YE6A 1TQXA 2BXYA 4GA8A 1JAKA 3DDMA 4YTUA 4C6QA 3TLLA 4P5UA 4P7QA 1NU5A 4AZ5A 3BVJA 5FF0A 3WLSA 3SRHA 1E6QM 3QMTA 1BVWA 1VBUA 2VR5A 3DIPA 1B30A 4PSPA 4A29A 1P1MA 2V38A 1VJSA 1TRIA 1PE1A 4XAYA 1KKRA 3P74A 4EANA 3WELA 2LLEA 2OSXA 3FAXA 3BOLA 1YDOA 1UOKA 1CXHA 1NWTA 1GVFA 4NRRA 2B7NA 4KEUA 3SCSA 1E4NA 4BQ3A 4DZIA 2P0OA 3NQEA 5D2WA 3WLOA 4PUWA 3IIOA 4IPPA 1KFKA 3AUJA 4IQLA 4DF0A 5B80A 4Q7IA 4LY8A 2IQTA 1MUWA 1QW8A 5JXQA 1OK4A 4CNSA 4NY2A 2PLCA 1V6VA 3BW4A 4Z1DA 2I1OA 3IV8A 4UB9A 1RVKA 4IX0A 4O0QA 1O5QA 1GVSA 4AWSA 3ZWSA 2Y89A 4IMDA 3S6OA 4E6MA 1WDQA 1FDZA 2ZRVA 1MZRA 3DFHA 4HK7A 4OGZA 4L1XA 4TVDA 7PTDA 5LKYA 3C52A 1M7PA 5FL0A 1RD5A 1FWCC 4JTQA 1FHLA 3WBXA 5CZJA 5BXTA 1VHCA 4U28A 4WZHA 4H8NA 5AC5A 1NH6A 3LXBA 5KITA 2QHAA 1E1CA 3BJFA 1X1ZA 3K46A 1KM3A 1MQRA 3PULA 3EWDA 5BROA 1ZRQA 2QMJA 1EOKA 2WVUA 4JTLA 1FX6A 3QH2A 4I6KA 3V0UA 3PZMA 1EC9A 4W5ZA 4GGBA 3P8IA 2ZX6A 1NWRA 4R88A 2NV1A 1W9BM 2JGYA 2WNNA 2HS6A 3ARPA 4GZ7A 2GLKA 5C55A 4B2DA 2WB5A 3O2LA 3O0KA 1G69A 2NVAA 5H91A 4BQ5A 1ZHAA 4JFVA 3ARXA 3VAVA 1NOWA 1ODUA 1ZY9A 4GINA 2CIPA 4J4KA 3RM4A 1NFPA 1JJKA 2X0SA 2YL9A 3MUCA 4K8GA 3L23A 3UXAA 2GQAA 4Q8NA 5G2WA 1K6AA 2ZXDA 3HMJG 5DO8A 3JU2A 4ZTXA 3WEMA 4Q8OA 1Y7VA 4Q4KA 3JZUA 1GJPA 4A8IA 3HJEA 2HQAA 2HDJA 1OZMA 4RJEA 3YPIA 4A6GA 3H4XA 4Q8WA 3ZR4A 2HWGA 1K3UA 3C2EA 1SFTA 5M1TA 1TRDA 4UTFA 1QOXA 1P1XA 4UMCA 4MYXA 5M2FX 1CENA 5I00A 3KDOA 4RUBA 4ZA0A 5H8UA 1ITUA 1V5XA 3BOXA 3WJWA 3CZJA 1JG9A 2G37A 3SADA 3SZ8A 2DUAA 3DOPA 3NZ1A 2REQA 1ONWA 2P3EA 3N2CA 3GIYA 3ALGA 4JX5A 5MKGA 1CGTA 1JVNA 4S3EA 4FOKA 3UF9A 2DFAA 3GWQA 2OZ8A 4W5U