4ERAA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 113
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eraA00
3LU2A 1DPMA 4IG2A 1ZZMA 4QRNA 2KAUC 4INFA 1J79A 1A5MC 4J5NA 4C6QA 1QXLA 1W1IE 4GOAA 2QPXA 1NDWA 3MPGA 2PAJA 1YRRA 4C60A 3RN6A 4HJWA 4F0SA 3LNPA 3N2CA 1WXZA 2OQLA 3TN4A 1HZYA 3OJGA 3RCMA 1EJWC 4B92A 2VHLA 1XWYA 3RHGA 3DUGA 2GSEA 1R9YA 4DNMA 1NFGA 3QGKC 3ID7A 3AU2A 2Q09A 2Z4GA 3SFWA 3TN5A 4EPDC 4Z42C 1J6PA 3GIPA 1V77A 2G3FA 2F6KA 2Y1HA 2HBVA 1A5KC 2D2HA 2UZ9A 1RK5A 2YZ5A 4R7WA 3V7PA 3OODA 1FWIC 3G77A 2E1WA 3S2LA 3D6NA 4GBDA 3A4JA 3ORWA 1RA0A 3GTXA 1FKWA 1YBQA 4H9UA 2HPMA 4C6NA 4H00A 1EJUC 4ZSTA 4BY3A 1E9YB 4HK5A 4DLFA 4DI8A 4KESA 4B91A 3ICJA 1POKA 1PSCA 4C5ZA 4C6EA 3UPMA 1YNYA 2R1MA 4DZHA 3HM7A 4B90A 2Z2AA 4EP8C 1FWJC 4EPEC 4CEXC 3LY0A 1RJQA 4PBFA 3MTWA 4EPBC 1EF2A 2ICSA 3ISIX 3GU1A 1M7JA 3EGJA 1ADDA 1P1MA 2ANUA 4IQJA 4QS5A 2BGNE 4DIAA 2PUZA 3E2VA 3PNZA 3JZEA 4I6VA 5G4HC 4B3ZA 3E38A 4M51A 4LCRA 3PAOA 2W9MA 1ITUA 3UF9A 4MUPA 4JOMA 3NEHA 2I5GA 4IFOA 3QY6A 4C6CA 2OB3A 1POJA 2E25A 4C5YA 2HBXA 1RJPA 2GWNA 2Z25A 4KIRA 4DO7A 1WXYA 1FWBC 3PNUA 1J5SA 3C86A 4C6DA 4RDWA 2Q01A 4GY0A 3QY7A 3NQBA 1UBPC 3S2MA 3E0FA 4YIWA 4LCQA 4IH3A 3GUWA 3AUOA 3MSRA 5AKQA 3TNBA 4CNTA 3A3XA 4IFKB 4DLMA 1FWHC 4C65A 3CJPA 3B0YA 4QTGA 4G2DA 1KRMA 5FSDC 2VC7A 1A5LC 1RAKA 3UR2A 4E3TA 4V1XA 3FDGA 2FTWA 3IGHX 4V1YA 3S4TA 2Z27A 3GU2A 1V4YA 1KRAC 2A3LA 4XD3A 4UBPC 2ZC1A 4GX9A 2PLMA 4CQBA 5E5CA 2O4MA 4H9YA 3SO7A 3AU6A 4NP7A 3RYSA 2VM8A 2ADAA 4R85A 1V51A 4C6FA 3K5XA 3A3WA 2HQAA 3O0FA 4LCSA 4C6BA 1ONXA 3MDWA 4ERAA 1S3TC 4XAYA 1K1DA 4CEUC 1A5NC 1NDYA 2VR2A 1FWCC 1FWFC 3S2NA 1FWDC 1NDZA 2Z24A 4GK8A 1EJTC 4P5UA 3BE7A 3K2GA 3EWDA 3F2DA 2AQVA 1FWAC 3F4CA 4PBEA 3WZ0E 4UB9A 4EPKA 4G7EB 1ONWA 3LSBA 4KF1A 1NDVA 1FWGC 4BKNA 2Z7GA 4C6LA 3PANA 4LAMA 2GZXA 5A6TC 4LAOA 1EJVC 3GG7A 4RDVA 5HMFA 4QS6A 2BB0A 1P6CA 4RDZA 4WGXA 3S2JA 3GTHA 1EJSC 4TQTA 2GWGA 2UBPC 3OQEA 3UR5A 4LAKA 2R1PA 2I9UA 2Z00A 3DCPA 3IJ6A 2YXOA 2DVXA 3IARA 2XIOA 1R9ZA 4PCPA 3GIQA 1ITQA 4C6MA 2OOFA 3MKVA 4GX8A 2EG7A 1K70A 4NI8A 4C6OA 3LS9A 4HK7A 1FWEC 4LANA 4F0RA 4GXWA 4C6JA 2PGFA 2IMRA 4GYFA 2EG8A 1KRBC 4RE0A 1V7AA 1I0BA 3E0LA 2Z28A 4CQDA 3O7UA 1GKPA 4GY1A 4AQLA 2AQOA 4IF2A 3OU8A 2P50A 1J6OA 3LSCA 1QW7A 3B0XA 4BJHA 1EYWA 1IE7C 1VFLA 1UIPA 4KEZA 1RK6A 2HNHA 2DVTA 4IGNA 1EZ2A 2QVNA 2YB4A 4IFKA 4I6KA 3NURA 4AC7C 1BF6A 2EG6A 2FTYA 3QY8A 4H9VA 1RJRA 4RDYA 1I0DA 3IPWA 3FDKA 3HTWA 4C6KA 3URAA 2O4QA 3URQA 3MJMA 4KEUA 1R9XA 4R88A 2VC5A 3CS2A 4H9ZA 3CAKA 4H9MA 3GTIA 4ZSUA 3DC8A 4IGMA 4IG2B 1XRFA 1UIOA 2YB1A 3T8LA 4C6IA 4NG3A 3F2BA 4LH8A 3WYZA 4CNUA 4KEVA 1A4MA 4XAGA 4H01A 4IFRA 1V79A 4DI9A 1PO9A 3IV8A 3OOQA 3URBA 2CZVA 3F2CA 4F0LA 3T81A 4GY7A 4WVXA 3E3HA 3R0DA 2P53A 2Z26A 4XAFA 2R1NA 2D2JA 2VUNA 4GC3A 2WM1A 1JGMA 2WJDA 2R1KA 2D2GA 4G7EA 5LXXA 1UMLA 4L9XA 2PGRA 2GOKA 5CH9A 4QROA 1YIXA 3TN6A 3GU9A 1YBQB 3K4WA 3LGDA 3MVIA 5HMDA 2WJFA 2FFIA 4C6PA 4ERIA 2R1LA 4D8LA 1M68A 1YMYA 3T1GA 3E74A 4J2MA 4OFCA 4CQCA 3KM8A 2OODA 3OVGA 3UBPC 3F4DA 1A4LA 4KERA 3URNA 4GZ7A 3LGGA 3ITCA 1PTAA 4XAZA 2FVMA 1K6WA 4LEFA 4PE8A 4WHBA 4KETA 1M65A 4ERGA 3GRIA 1PB0A 4XD5A 1GKRA 2FVKA 1O12A 3EWCA 1A5OC 1RA5A 2HPIA 4LFYA 4HA0A 4CNSA 4H9XA 3PBMA 4DYKA 3MDUA 1EJRC 2Z29A 5FSEC 1KRCC 2QT3A 4KQNA 4XD6A 4DZIA 4ICMA 2WJEA 3TN3A 2OGJA 3IRSA 2AMXA 1O5RA 4LALA 1FKXA 1EJXC 2DVUA 3MVTA 3GTFA 1KCXA 2QS8A 4XD4A 3LA4A 4H9TA 4L6DA 2RAGA 2Z2BA 3HPAA 1GKQA 4PCNA 1P6BA 4QSFA 1XGEA 3FEQA 3IACA 3QGAC 4HK6A 3B40A 4RZBA 5HMEA 1XRTA 4J35A 1E9ZB 3WMLA
chains in the Genus database with same CATH superfamily
3CWHA 3CAVA 4PUJA 1JCTA 3VKDA 4D8AA 4C6QA 3Q67A 3AXXA 1CLKA 2XWDA 4Q4KA 4F0SA 2DZAA 4H2CA 3UJRA 2QPSA 3BCDA 2DH3A 3N2BA 4KWUA 4Z1CA 4OBRA 3RCMA 1R2TA 4HCHA 1GYLA 5IM51 2GSEA 1SFLA 3AIBA 1XKYA 5RUBA 3SFWA 3VNIA 2V3EA 4O28A 1V77A 2NT1A 3M64A 3QMRA 3PSVA 2VEFA 2PTDA 1BPLB 4UOJA 2KZHA 1OF8A 2C1IA 4PMOA 3F4VA 3H4GA 3GW0A 1BVWA 2E1WA 1NWTA 4JHMA 3P67A 3WKZA 2PDHA 4NT0A 3SJNA 2RDWA 3E2RA 3WH7A 4EK7A 3EMZA 4P8WA 5H2ZA 1E0XA 2NXHA 5BW6A 1UJQA 3W1RA 3JVAA 2Z2AA 4IP7A 1EHAA 3WDHA 5DN1A 4CEXC 3LY0A 1PAMA 3FSUA 3GR8A 3QTGA 2MUCA 4OIFA 3M7WA 1VPYA 1BYCA 3SIZA 2X8RA 4I6VA 4P7OA 3VAVA 4US6A 4XIMA 4LF1A 3KRSA 3WL0A 3O6AA 3R94A 3R13A 1HJSA 2OB3A 3W1XA 1B3WA 5DO8A 4R27A 3ONCA 2Z25A 1J5TA 3DN5A 2Y62A 4MAZA 1FWBC 4FF7A 3S1UA 3C86A 2GVEA 5T91A 1VFHA 1Y7VA 4Z2GA 1QWKA 2EKGA 3FW6A 2Y24A 4Q7NA 4DUWA 3OG3A 4QEHA 1B5TA 5DCDA 3DFPA 2GJPA 2PDPA 3W2LA 3QHNA 5C8BB 2ZBTA 4WSKA 3TSBA 5CAHA 3IJQA 1OFBA 1E51A 2GUBA 1U33A 2Q8LA 4CKQA 2PLMA 1XLAA 3GB6A 3MUCA 3PAJA 5TAOA 4YYFA 1TUFA 3MMWA 1TB3A 1QNPA 1V6XA 2GYIA 2XFFA 3N13A 1EZWA 3K5XA 5H91A 3LI0A 4AZ6A 4J40A 2OEMA 4JD4A 4JY9A 3W22A 4GVIA 3LOTA 7CGTA 3EB2A 2VD9A 4G8TA 3TK7A 3THAA 2V3FA 3GXPA 1KXTA 3G0UA 3N25A 2QUTA 3B9OA 3XIMA 3NJ3A 5ABTA 3GC5A 1FWGC 3SRHA 3LGEA 5C2CA 2VZVA 3R5EA 3WMBA 1W8GA 3RU6A 1OT2A 4PEKA 3QKZA 3WEMA 4GZEA 3WSUA 4TVUA 1NQKA 3STPA 3C2RA 3EX3A 1TSIA 2EJ1A 4LAKA 1CPUA 4PCTA 2C13A 4A3RA 2NW0A 1LUCA 1CGVA 2PBOA 3WBYA 3PF3A 4RCXA 1ZBWA 5JMUA 3NQCA 4LUTA 3MJYA 2VX7A 2IMRA 4TO8A 3NZRA 2XDFA 1AQFA 2XGBA 1OIFA 3VGHA 3WLKX 3UWQA 5KSWA 4CQDA 3O7UA 1XLFA 4IF2A 1Z69A 3D0CA 1KO0A 2EKCA 1QW7A 1KFKA 4BJHA 1WKDA 3BURA 2DJXA 3FCPA 2QCFA 2BGSA 1OBAA 3UXLA 4KFPA 3EOUA 2ZE3A 1E6RA 3QTPA 5LA0A 3G6LA 1SO3A 4AC7C 3NGJA 2YW4A 3VX1A 2ASHA 1XIBA 3M0XA 4NI3A 4LNYA 1HJQA 4F2TA 1YTEA 5FAJA 2AGTA 1WB0A 1XP3A 1DQXA 4H9ZA 1I6NA 4ZSUA 3KOWA 1XRFA 1GG0A 1EC7A 3QFEA 3IUHA 2PF8A 3LI1A 5F2LA 4ZBCA 3U7BA 1TTPA 3HFYA 3IIOA 2CZVA 4O1FA 5CZTA 3M5XA 5G2WA 1KBIA 4YYCA 4HJFA 5EL1A 3UWYA 2OJPA 4KRZA 4GQ0A 3GD6A 2XZ7A 2BTMA 2E3ZA 1ZBKA 4B2DD 3N4EA 4UQDA 3QN3A 3MI2A 1ALDA 4P7QA 3UZJA 3CAQA 4ECLA 3IAPA 1BWVA 1FRBA 4XUGA 5AYZA 3U4FA 1M5WA 1M1BA 4FOKA 4NXKA 1FHUA 1J0JA 3CL8A 3ZR5A 1T0OA 4QROA 3VX0A 3K8KA 4AC1X 2NUYA 3BW3A 1HKWA 4IICA 1GVSA 4C6PA 1H5YA 1S3HA 3UZXA 2Q3OA 5D04C 4RJEA 1UC4A 1A4LA 3URNA 4BCEA 3M47A 1BEUA 2Y5EA 1KV8A 4E8CA 2ZDSA 2DT1A 3ERPA 4JZ5A 1QK0A 3A23A 4GGBA 3SQLA 1ZALA 3GRIA 1SFJA 1KM2A 4IIFA 4PFHA 5TD4A 5L9FA 3WUFA 2NXIA 4JNMA 5ECVA 2PD9A 2QF7A 2YSWA 5J5DA 3FKRA 3FLUA 1X98A 4J2PA 3NDYA 4YTUA 4GCAA 1LL7A 3SCOA 1EJXC 1D7FA 1KR0A 3DFQA 1MUWA 4N6FA 4PMRA 1JZ5A 3TTQA 4AW7A 1O4UA 4YVVA 1T99A 4FZIA 1UD2A 5D09A 4K7VA 3OQ8A 2GDQA 3NQAA 1AA1B 3V5FA 2QPXA 3NCOA 3VZZA 4M3PA 2PWVA 2GVLA 1XIIA 2BXYA 2QJIA 1JUEA 1B3YA 1LWJA 2IQDA 4IXXA 1JF5A 3H24A 3AS0A 1EIXA 5BRBA 1EBHA 3NUKA 1NFGA 2PU1A 3AU2A 2BFGA 1J6PA 3H8AA 3W1MA 5CC6A 2WMGA 3TMQA 4PMVA 5A6SA 2W92A 2F6XA 3VZYA 3EXSA 1Z3NA 4UOQA 1E4NA 2PU0A 3C2VA 2PWUA 2WO5A 4IQDA 1N8WA 3PTMA 3GAYA 4ZEPA 3QLLA 3CPGA 1R2SA 2HPMA 1VBRA 4XO7A 1RP8A 4TMBA 3RAOA 4ZSTA 1SM9A 4CN1A 2OZ0A 3EX4A 3N12A 2XVNA 2FGZA 1LL6A 3UEQA 2V67A 3F5LA 4PTNA 3ITLA 1JCYA 4NHVA 4GCXA 1H7NA 2FKPA 1E4MM 4AUBA 1RJQA 3G0XA 4PBGA 5IFPA 1Q8AA 3N15A 1TR9A 5A3HA 4GISA 3GR7A 4EVZA 4CLMA 3DFOA 3COTA 3UWWA 3PY2A 3FA5A 5FJUA 1AG1O 3OB8A 5AHLA 2QV4A 4M6QA 2Y8VA 3OBEA 3TE9A 4JQ4A 1TPVA 1JCXA 2AQWA 2Z2UA 3BK0A 4XZWA 1TWIA 3STFA 2W0UA 4ML4A 1VS1A 1V0MA 1TV8A 3C4UA 1UR8A 1MFUA 3KDNA 3MWAA 4JICA 3SUTA 4K2SA 4EIVA 4CUCA 4K8EA 1GHRA 1WBJA 1OCBA 1ZJAA 2J4GA 2HE5A 2D2OA 1GCYA 2EEXA 4AY8A 1VFSA 2DW6A 1UWSA 3O07A 4MAVA 1OFRA 1C92A 3EX6A 1RAKA 1OCQA 5FF7A 3GXDA 4S3KA 4NQ1A 2PURA 1QATA 4XD3A 4H8VA 5A6AA 3DI1A 3PP7A 1R3TA 1XSJA 3RG6A 3EOSA 1US2A 2V38A 3BV4A 3NL5A 2PCEA 1CYGA 3P6LA 3WFZA 1UB3A 1OC5A 1GQKA 3UESA 2V81A 3LTSA 3VXGA 2DZUA 1KGUA 4O1CA 2E7FA 1UR4A 2OQHA 1QU4A 3QV7A 2PLCA 1J01A 1W56A 3GNOA 4GVHA 1DV7A 1W32A 1ZBVA 1AW2A 1X6NA 5H8UA 3NXLA 1GTHA 4GI8A 2VJXA 4D72A 3LSBA 5IFTA 1NDVA 5CZJA 5DRIA 1FWTA 4DWSA 3PANA 4LAMA 4O13A 4GQRA 1GJWA 3GG7A 3LENA 5HMFA 3TA6A 1JZ8A 4QS6A 2JIEA 3UVIA 4DVOA 4I5RA 2GWGA 4AX6A 5HA7A 1EFZA 2I1OA 3IIVA 3EYPA 5AC4A 3GIQA 3CHVA 2WK2A 5HULA 4RE3A 3QQ0A 4GXPA 4QBXA 3QW4B 1TJ2A 5IRPA 4A6GA 2I16A 4JEQA 1QVBA 2VUYA 4NX5A 5I2UA 1SJDA 1H7XA 4W84A 1A3XA 4AQLA 1U30A 2FZ9A 3EWWA 2Q8XA 4S39A 1TYGA 1FCUA 3N18A 4NAFB 2HNHA 4OVXA 3G6MA 2X09A 3DYPA 5IDIA 2YXGA 4L4LA 3JRKA 4IMFA 5I79A 3TR9A 2EG6A 3CUZA 3CV6A 4GABA 3HTWA 2V3GA 2DZVA 3F1QA 4NAEA 3QJAA 2IW0A 3GE7A 4HZ6A 4AFYA 1XG3A 2FB2A 4CD5A 3N73A 3BVJA 2YFNA 4NJHA 4S3AA 1OCNA 1XQLA 4MZ1A 2ZZ2A 2G97A 2ZCGA 2Y63A 1LQAA 1P0NA 4RNJA 1S1PA 6REQB 3CIXA 4D6EA 4Q6XA 4AH7A 2GJXA 1XYZA 4GY7A 4O8RA 2UY4A 2ZZ1A 1A53A 4WGHA 2I56A 4JIQA 4JTQA 4AD4A 2DEPA 1TUXA 1QMLA 2R6OA 4IM4A 1D3CA 2Y70A 4EF8A 1PCKA 4HPXA 3VKAA 5HXMA 1REQA 3AXIA 3OA5A 1A3WA 3GM8A 4MJZA 2QCDB 4JCLA 4DYJA 2O0TA 5JUVA 1B0IA 2J78A 3W7HA 3GU9A 3R8RA 1R46A 4XSLA 5T26A 3ZO9A 3ZVHB 2R1LA 2E9MA 2JQXA 1XD1A 3HJZA 2CZFA 3QBUA 1E43A 3H4XA 1KM5A 1TPEA 2J7BA 3DYOA 2WHMA 5M03A 4P7NA 3VKJA 3EWXA 3RX2A 1H63A 3UG4A 2HEJA 3TFCA 5T9BG 5DXYA 4OV4A 4K1GA 1S5MA 3G0SA 3NO1A 1QOQA 1Q6DA 2P8BA 2ZFAA 1MNZA 3RJYA 1J18A 4B5VA 2Z29A 4DRSA 4DZIA 3RPTA 1X8CA 5SWUA 1Q4NX 3WDIA 2GPTA 3BLFA 2E09A 2QR6A 1CLVA 3ATZA 4LTSA 2LLEA 2PGEA 4MUZA 1WV2A 3S5ZA 4TIMA 4PRRA 4WY0B 1JULA 3FOKA 1XG4A 2XVPA 3WY1A 2OFJA 1EP1A 1AQHA 4XQ6A 1JPDX 4IIBA 4FSAA 1E5NA 4QLLA 3SQSA 3MSDA 3B97A 1BRLB 3WDQA 1MEWA 5HWJA 4L56A 4WD0A 3G1VA 4QRNA 4OV9A 3KOFA 4FXRA 4UCFA 1LROA 4GO9A 4JFWA 2PTYA 2VP8A 1HZYA 3DUGA 3NWRA 1OHLA 4RNHA 2VZSA 2V82A 1FHDA 1N2VA 3PSWA 1A5KC 2D2HA 1RK5A 3AZTA 5EMJA 4KCVA 4R7WA 3OODA 3ZQ9A 2EPNA 4IISA 1NM9A 1RA0A 2YYTA 1P1XA 3TYDA 3VFCA 1LP6A 5E0FA 3TC7A 3KS5A 1EJUC 3A5VA 1HO4A 3WF4A 4B91A 5CPMA 3CHEA 1F4AA 3DBNA 3RFAA 2YBVA 2HE8A 1XD0A 3SN0A 3EEZA 4HNLA 1EX5A 1RY8A 3LM3A 3BW2A 4RZ5A 4DWSD 1SR9A 2VRKA 1IEIA 5A6MA 1H62A 1LT8A 3WEOA 2BGNE 1EH9A 1H1YA 1ZY9A 5BRQA 2VQUA 2HS8A 3CTTA 4FPSA 3CIWA 1J10A 3PAOA 2W9MA 3KBVA 5LA1A 1VFUA 5CSYA 4PTVA 2ABAA 4LRTA 1OFPA 6CGTA 4QE1A 2JEPA 5AC7A 1J93A 1JZ6A 3R58A 4CU6A 1UWQA 1W17A 2GSHA 2NQZA 3TKFA 1VBJA 1GUVA 5CSUA 3PG9A 2YFOA 1CT5A 4O18A 3BAXA 3VIMA 5EFDA 4Q7BA 3AUOA 5BROA 5I78A 1PJ9A 4WOZA 3B0YA 3S9IA 3W74A 4N9EA 2AAAA 2YPIA 4A3HA 1F9CA 3ZLHA 4UTUA 2WANA 1JDFA 3S4TA 5IHSA 5BWAA 4S38A 5FEZA 1M41A 3DFHA 2O4MA 1JG9A 4LS1A 3CUJA 2EPMX 4BEUA 1JFXA 2VT0A 2CWXA 2FZ8A 3GG0A 2CHNA 1SZFA 4FOJA 2ZXQA 1W37A 4LCSA 1RPKA 1HKKA 2V68A 2NQJA 1PIIA 2YGYA 4AWSA 5C7VA 1A5BA 1JI2A 3B03A 1KC7A 4PBEA 3BL3A 3FV9A 3W70A 2Y8KA 3LXAA 4UR9A 2EGZA 4BKNA 4ZVJA 5HDRA 4RKAA 4QXIA 5C2GA 3TYBA 2DW7A 3APYA 1RP9A 3EWZA 4EAYA 3H54A 2I9UA 2BY1A 1QUMA 1PZ0A 4PCPA 3GX9A 3QSTA 4OOUA 4PMNA 4U28A 3S42A 5C9RA 3UFYA 2REQB 1JQVA 2J77A 3OA3A 5CJNA 1Z7AA 3W85A 2FPVA 3S1WA 1PKLA 1VYRA 4AD0A 1LYXA 1KFLA 3GBEA 3BTNA 1TTJA 2C8NA 3GC4A 4DM2A 4NSBA 2WCGA 3B0XA 2PS2A 3INPA 1IE7C 1G5AA 4H8NA 3D46A 3GVWA 4W8BA 3HQPA 4NZFA 3FSTA 3N9SA 1PE1A 4DJEC 1EF3A 3H2MA 1G4SA 3A64A 3CHFA 4FX8A 3THCA 3PZNA 1Q5MA 4B9ZA 4H9VA 4QJ5B 3LLFA 1OEPA 5CSSA 3T0BA 3URAA 3URQA 2WKGA 2OYKA 1X1ZA 1VIZA 2DU2A 2FDMA 3RILA 3WLQA 4R88A 3HMJG 1QAPA 3VOJA 2BV9A 1K3UA 3TSMA 5I5RA 2R14A 4YL2A 8A3HA 4QITA 5CQ1A 1XUZA 5FJRA 4F2BA 3FJLA 3WQCA 2OO6A 2XGIA 2CHRA 3LUTA 4U3CA 3T81A 1M7XA 1JXKA 1WAWA 2BXZA 1QBBA 3V0UA 2QCNA 3P74A 1HIZA 4J3ZA 3EAUA 1Z41A 2WJDA 2DV0A 4L9XA 1C9WA 4XISA 3MVIA 4P2VA 3W7GA 4WDUA 2JF6A 4ERIA 2Y5JA 5FA5A 3ZLFA 3DFSA 4JPGA 1G4TA 2PZNA 3UBPC 4E5TA 4MIMA 2J62A 1F7BA 1U83A 3EKLA 4FF5A 4F48A 3HBLA 1Z42A 5AYIA 1KTCA 4Q8TA 5REQA 2ZZ6A 3WG6A 5I03A 1EGZA 1BWLA 1E0UA 3W4RA 3CXOA 1PDYA 4CNSA 2CKRA 3PBMA 5FF4A 4TX6A 5JVLA 3VD5A 4KQNA 1NH6A 3BUVA 3O0KA 3TN3A 3FHAA 1XFCA 2ZX8A 5C5YA 5TQLA 2QUNA 1LOLA 1MO0A 3NZPA 5AHEA 1RH9A 5HPOA 1JNDA 1WUEA 3B9EA 4C1NA 1V6YA 4HCLA 4Z0SA 3HG3A 2OGYA 1MUMA 1U1HA 3AWOA 2Z2BA 3ZT5A 1AJ2A 3O6YX 2PMQA 1VFFA 2OSYA 4KBXA 1P0BA 3IACA 2HXUA 3VDHA 3WQGA 3RR1A 1PWMA 1E5JA 1RQHA 1W1IE 1KWKA 3MPGA 1CCWB 3F5JA 3EOEA 4IUGA 3CQ0A 3BICA 1ZJHA 2WZHA 3VK5A 4GKTA 4OUEA 3ITTA 3WNPA 3QGKC 3ID7A 1OC7A 3P93A 4KRTA 2QKFA 6TIMA 2F6UA 2F2HA 2UZ9A 1R3YA 1JDEA 1XH2A 4NIRA 1Q66A 2HXTA 3M41A 2DT2A 1PYMA 4H1ZA 2ZUMA 2E4TA 3SUVA 4HNCA 3WFAA 1ML1A 3QKEA 4HSHA 2J7GA 3MUIA 3KL5A 2BDQA 3H2FA 1R3RA 3UP8A 1D3HA 1EEPA 4XZMX 2GOUA 2QXWA 2ALRA 1IF2A 3BLIA 2X1TA 5BWFA 3SUUA 1XRVA 1ZCOA 3SUSA 4I7VA 1FWJC 3W3OA 4QISA 3O6DA 1KA9F 2DSKA 4GH1A 2WC4A 2OX1A 7REQA 3C8NA 3VNMA 3M5ZA 1GQLA 1Q7MA 3MZ2A 3U2EA 4NL1A 1KFJA 1XS2A 3CO4A 3MY9A 2GLKA 3M0HA 1NARA 2PWDA 1XCXA 4W8AA 4MUPA 2QJNA 2AL2A 2F9RA 3NEHA 2NX3A 1Y8BA 1PVNA 1IGSA 2E25A 3M0LA 4NVTA 4IJRA 1RJPA 1GOMA 3EA1A 4CNOA 5CZKA 1I60A 5CAKA 4AMCA 3UA4A 3LERA 1PIGA 8XIAA 4YVPA 2XTKA 3FJ6A 4AZCB 4IH3A 3UYIA 4UFLA 4CGTA 1W54A 2EHHA 2B7QA 4DLMA 5A1AA 1FWHC 1EGVA 5AHNA 4IP4A 3GY1A 3AHXA 1IIHA 1L2QA 2CLPA 2WC3A 3L12A 4FXSA 4XK2A 2X05A 3J7HA 3HO8A 5HNNA 4BF7A 1G01A 2VX4A 3DGBA 3DXIA 3PG8A 5DCEA 3BMVA 4O50A 4R34A 3TQPA 1SJAA 4UBPC 3NDZA 4W5UA 2XISA 1A0DA 5EYWA 1W9XA 3S83A 3RYSA 2WSPA 2GK1A 1FUYA 4R85A 4GZIA 2P0OA 1W1ZA 1XBYA 2QCHA 4FAMA 3QR0A 4AIOA 1V02E 4L6HA 4ENLA 1MW1A 4IL0A 3D3AA 1H0GA 1S5WA 1VIWA 2CLOA 2CEQA 4UTFA 5ENLA 2NV1A 3BSHA 1ONWA 3V0TA 2QULA 4HHPA 4I3GA 4PULA 3G1HA 4HNVA 7PTDA 4QNWA 3WQ8A 5HNRA 5AZ0A 3T78A 4JAWA 2J13A 1EOKA 1P43A 3DCPA 2EPOA 3WCZA 3EDDA 5LXEA 3WLMA 3CMFA 2OOFA 4Z1DA 2V30A 3GFYA 4W87A 3W7MA 4GG9A 2OT1A 2J9XA 4RE0A 3F5KA 4M6UA 2XVGA 4Q4QA 2ZX6A 4F9JA 2Y7GA 1IWBA 2EBNA 1GPWA 1GVOA 1J6OA 4LB4A 1HG3A 3KRUA 1XISA 2W3ZA 3CAWA 4GA8A 2EXOA 3TQKA 2YX0A 3H2OA 5LNWA 5TF0A 3TFXA 2PLKA 1W1PA 3LB0A 5BNKA 4AMAA 4F79A 1KM3A 3FDKA 1XC4A 3CO8A 2INZA 4R7JA 3SCVA 4ZOAA 5D03A 1PIFA 2GL5A 3P5ZA 4XBJA 1Y0EA 4XIAA 3EOOA 3H6OA 3KBSA 1S2WA 2YZRA 1IT8A 2YCEA 1FP8A 4TV6A 3V3WA 4DI9A 3GNRA 3B0VC 3W7DA 4WKFA 1UD8A 3RIKA 1P7TA 2TSYA 2XUCA 2Y88A 3U9IA 1DEDA 5G5IA 3WF3A 4REQB 5IXEA 2F2KA 1YX1A 4XZHA 2V63A 5E1QA 4Z2LA 3SGUA 4JL1A 4YTRA 4H7CA 1OFEA 4ZB0A 3KP0A 3NNTA 3HOJA 1GVFA 2O92A 3HG4A 4CQCA 1R3WA 3W7IA 1OX6A 3PZOA 1A0CA 3UG3A 3F4DA 3LGGA 2G8ZA 4XZNX 2PDUA 4Z1AA 1H0IA 2V5DA 2ZXBA 4GGHA 4WHBA 1TZZA 4UZSA 2V0TA 4AXNA 2X42A 3AHVA 5CC3A 4RNIA 2VZTA 5AYXA 1O12A 1FX6A 3VNJA 4GIAA 2HPIA 4HA0A 1IXPA 3I10A 2GGIA 1JCJA 2TYSA 1DQUA 1E40A 4GYJA 1QR7A 1UA3A 1YYAA 3BAIA 1FP9A 4CN6A 1EDGA 1B3XA 1TWSA 2OYLA 3W2MA 4JDBA 3SY1A 1XLJA 3FN9A 1E1EA 1PL9A 1RZMA 5C9UA 2PB1A 4MPKA 3HGRA 3GH5A 1W3LA 3P60A 2WJZA 1QPQA 1L2UA 1VYSX 4EE9A 3E02A 1Q6FA 1W1TA 3E2SA 4UTTA 4ALDA 3NZGA 1XC6A 4GOAA 1UKQA 2DT0A 1DJQA 2FMOA 5D9NA 1P0KA 3G1DA 3CC1A 3IANA 4D6IA 2G5WA 4MNJA 1TREA 3LCGA 1IXQA 3UNDA 2QZRA 3N2OA 4S3DA 4Z2IA 1MEHA 3L4XA 3GDKA 4N9CA 3O2LA 1W5OA 1YDNA 4DJDA 1OG0A 1UKTA 1ZP4A 3B05A 2PGWA 3W00A 4ZOBA 4Y2WA 2AKMA 1FWIC 3C2YA 5HMSA 2DSWA 4FXJA 1GOWA 4HK5A 1WZKA 1QOXA 3QMSA 3ICJA 2VI0A 5HUPA 1WYIA 4Y96A 3Q4DA 1TPDA 1KQZA 3SCTA 3FY1A 3WD4A 4DZHA 4Y9OA 2X1UA 4IJBA 3ZWSA 1AFSA 3SW6A 1BG4A 3HGJA 1H50A 1DIDA 1HW6A 1ADDA 4HNTA 1WDPA 4J3SA 2J7HA 4MWAC 2HISA 3TEVA 1W5MA 4ATLA 3GQYA 3DDMA 3JZEA 1CGUA 4LCRA 2XFRA 5XIMA 1E1CB 3AROA 4BWLA 3ZZ1A 4B9YA 1T6MA 3W7PA 3MSYA 1YDYA 4HYRA 4AZHA 3CUIA 1FY6A 1MFVA 4WJ8A 3NYDA 3PNUA 3PZVA 4RDWA 1XLBA 3VD4A 4JQ2A 1SFTA 5AHIA 3QPYA 4ZXLA 2C3ZA 2CKSA 4CCEA 3K1DA 5D4YA 2BVDA 1OFDA 4TU1A 4IPIA 3CLMA 1J0YA 2BVYA 5F1VA 3VOFA 5D9PA 1MQPA 2NWSA 4JKMA 3CEPA 1GWJA 1XDMA 1HL8A 3FX4A 1EC8A 4GIRA 1FTXA 4OGZA 2Y7EA 4QG9A 3NQMA 1E6PA 4DY1A 1HO1A 1GNXA 4BF5A 1ISVA 2YKKA 2PP0A 4QQ3A 4EWJA 1P0DA 4H7VA 1QO2A 1K7FA 1UH2A 1KQYA 1DJGA 4DNHA 3BW4A 2OMAA 3W1LA 5K9DA 4LXFA 4O15A 2J79A 5TBOA 1SSGA 1XCWA 4DUOA 3CASA 3TZNA 1QI4A 3O0FA 2J47A 2DQWA 4JHOA 4H19A 1OX4A 3U48A 2WHLA 3MYPA 1K8XA 2VR2A 3WQOA 5E70A 3PJXA 1ZUAX 3MO4A 1Q8JA 4JKKA 5LIXX 4WZHA 1V0LA 3F4CA 4PA8A 3M16A 4ADSA 4S3JA 3TCSA 2CESA 2IKHA 1GJUA 1C91A 2BB0A 3E5BA 1P6CA 3W02A 2FJKA 3QZAA 3II1A 2UBPC 3M07A 1YDVA 1CI1A 1SZRA 4ORIA 3QYSA 1ZSXA 3N9RA 5D8ZA 1E15A 1LM1A 3NQ6A 3NVTA 3IVTA 1JD9A 4NI8A 3LS9A 4ZTYA 4WJEA 4O4WA 3E0WA 3RK8A 2OZ3A 2YLAA 3ZVIA 2YL8A 3ARXA 2OELA 1LWIA 3R4IA 1U5HA 2AOSA 3L68A 3M0VA 5A8PA 3VA8A 1CNVA 3N04A 3NOEA 4W8LA 5FKYA 2DGAA 1H11A 4PR4A 2P0IA 1T8QA 4FIQA 1UZ4A 1Y5WA 2YR1A 4KEMA 1RJRA 1Z44A 4I8YA 1I0DA 3IPWA 1H7OA 2Z1XA 5D9MA 3IAQA 3NXFA 2Q6ZA 2XWEA 5LHFA 5CC7A 3ZR6A 4H8UA 2CC0A 1NJJA 1BSLA 2D69A 3DENA 1QPOA 4HB7A 1XLLA 2BY3A 2BG5A 5FOOA 4HMEA 3CNYA 4QJ4B 2WLZA 3FA3A 1B57A 4CQ9A 2BWGA 1UZDA 3WYZA 2RGLA 3CV1A 4JN7A 4PMYA 3LTYA 5A2AA 7A3HA 1FDJA 1NP0A 4MB1A 1VLIA 3V16A 3NQFA 1D2KA 1LG2A 4LUSB 3R8GA 1TKKA 2A0NA 1JUBA 4XUYA 2CIPA 5A8OA 2ZVRA 1W6TA 3S1GA 3GNNA 2ZUVA 3PS7A 2PDNA 1ITXA 1W1A1 1EL3A 1UD5A 2ZA3A 3PZQA 1MDRA 4BS0A 4AZIA 3GTNA 3GS6A 3W6YA 1QNVA 4UNLA 2D2GA 4ZFMA 4DJDD 3MW7A 4MHBA 5KTLA 3AFBA 3BXWA 3I7QA 2PZ0A 1WNOA 2CZDA 3T1GA 1UKOA 4U2ZA 2OODA 3BLKA 1AW1A 4L61A 1GOOA 5KMYA 3OYXA 2QCLA 1ECEA 3LG3A 2NQHA 4QP0A 4PE8A 5G2IA 2PDYA 3NYZA 5DY2A 4AEEA 4H9XA 2B81A 3VOGA 3WLOA 4ICMA 2GJRA 2QNEA 4O8AA 3TR2A 3ZIZA 4LALA 4UC5A 1ZPTA 1W91A 2E77A 1OIMA 1XSKA 3DH7A 5CPOA 2IXUA 1W1VA 1I2PA 1I4NA 2X2YA 2HVMA 3LQLA 4UMAA 3QVQA 2VZOA 4Y9AA 3UD6A 4YWSA 1MMFA 1R7AA 3FNDA 4I9MA 2C16A 2G3MA 1OADA 1C3FA 1KM1A 1U1UA 1G0CA 1YQ2A 3AMCA 3QPZA 2WMIA 1F3EA 4LAZA 4NKCA 3WQVA 1DPMA 4YN5A 5GNXA 2J66A 3FKKA 1TQXA 4INFA 1J79A 3WK1A 2NZLA 1YRRA 3WH6A 4QFUA 1AH0A 4B5NA 1WPCA 2CU0A 3OG2A 4B92A 2CPUA 1CB7B 2WLYA 1Q6LA 3IUDA 4LVAA 4DJEA 1MW0A 2WNZA 2VOMA 3B8UA 2WKLA 2WMHA 4F0HA 2QDGA 2F6KA 5HUOA 3TAOA 1E9IA 2C6QA 3A3HA 3JZUA 3TV8A 4DXVA 4JTFA 2GVJA 1SZNA 3R0KA 4XKMA 2BX7A 2Z6JA 2P3ZA 3MBDA 2J27A 3LZ3A 1PX4A 3DOPA 1E9YB 1XV8A 2WCSA 4DI8A 3MI6A 2XFWA 2WVVB 4MGGA 1O1HA 4Q3MA 3L2MA 3IJ8A 1EB3A 3BQ6A 4LW7A 3W27A 3WH8A 5U4NA 3FGCB 3MHUA 4JYDA 3KZPA 2ICSA 4ZODA 2A3HA 3ZJKA 3RPMA 1X6LA 3SCPA 3S6DA 4TTUA 4MZYA 3DKLA 3DGRA 4QDWA 3EDJA 3UF9A 4HU8A 3IGSA 3K4AA 3QV8A 2UY3A 4GYPA 3Q94A 3KUMA 1TPFA 3IVSA 4PSRA 2NV9A 2QAPA 2QCMA 3P7YA 4DO7A 1W3TA 1B2YA 1L8NA 3CV2A 3VDAA 1EO5A 1XYFA 2BMBA 2DUZA 1AQMA 4HA4A 3LN3A 1UZ1A 3AICA 3PZUA 1JIBA 1F6KA 2B31A 2HV5A 3TTSA 3VE9A 5T9CE 4KWVA 3H70A 4Z2HA 5GJPA 2VELA 4O10A 4OE7A 1PV8A 1BKSA 4FR6A 4IXHA 1NFPA 2PA6A 4GHRA 5D33A 5GQBA 2JGYA 2Z27A 1QHZA 3LNMA 1N7KA 3OVPA 4BI7A 4J3WA 1SR0A 5E5CA 3BQ5A 4DBSA 3AU6A 2CLFA 3DHPA 2IPJA 1NWSA 2VM8A 2ADAA 1A50A 1XJBA 2QIWA 1SW3A 3TYEA 2CHOA 3UWEA 2W67A 1HL2A 2VRQA 1TE6A 5DMYA 2A1YA 1R3QA 1C7TA 3IWPA 1OD8A 5LIWX 1LOQA 1AW5A 1VHNA 1AH3A 1EWEA 2Y8UA 3BDKA 4FLRA 1X1NA 3IK4A 1MQRA 3TQVA 2RGMA 1VBUA 3P81A 4MADA 4WGXA 3EB3A 1JJKA 2DQXA 1Q85A 4U3AA 4AIBA 1LTDA 3IJ6A 2DVXA 1R9ZA 5I3KA 4AD5A 1S38A 3LCLA 3P3BA 1AODA 5E9XA 1LZOA 1S1RA 4HIBA 2D3LA 3MKVA 2H6RA 1P48A 1SW7A 2TODA 3BV7A 2PGFA 4NNBA 4JIRA 2C7FA 3CUGA 4IQEA 3KWSA 1DJXA 4NUWA 3QR1A 4LU0A 2DZTA 3A4XA 4UTIA 4AHPA 4J9JA 1O6IA 3PWAA 2FMNA 3OVQA 3ANYA 3CQIA 1RK6A 3VGFA 1JDDA 2CLMA 4K3ZA 1JDCA 5HK4A 3O06A 3ZS4A 4ZL1A 2SFPA 4IFKA 1XLMA 1W5QA 2FPYA 2V5LA 5G1MA 4MLRA 1LORA 4FNUA 3KFTA 1AJZA 3MJMA 4Z1BA 3PBWA 5CG0A 1YPFA 2ZA1A 3GC2A 4QM1A 3WLJA 3C6CA 1SMDA 3CAKA 3N19B 3DC8A 1KGXA 4IQLA 3A22A 4D6FA 4KS0A 3SURA 3W23A 3PJUA 3M0KA 1SJCA 3OOQA 3AIEA 3MKCA 2XN2A 1F74A 2GGEA 3AS3A 3RX4A 1XRSA 1W3NA 1OX5A 3TW6A 1PXGA 4D1JA 4YU1A 1UJPA 4L80A 1DOSA 4DJED 3POCA 1MZHA 2WHJA 4O57A 3VM5A 2G0WA 4RL3A 1I8JA 4US5A 1F5ZA 1R0MA 5AHMA 2ZUNA 4Y6GA 1DL3A 4GLEA 4PSPA 4MJ2A 2OEKA 4M19A 4H3DA 4RV3A 5BXTA 4Q4RA 1JR1A 4IHCA 3SRDA 3DIPA 2QJMA 4AZBA 5XINA 1PTAA 4X0VA 3P14A 4LEFA 4S3CA 5FI8A 2DUXA 1JUKA 4Q22A 2G3IA 3CGTA 4KCUA 2W91A 1KGWA 3LV5A 1JYXA 5AZ1A 3MS8A 3BWWA 3TDFA 1YW1A 4XG1A 1ZU8A 3W24A 1OJXA 3I68A 5TIMA 1O5RA 3BOLA 3CZKA 4QLJA 4PUEA 2FHCA 3O16A 1VPXA 3UJFA 2W5FA 3BOFA 3RMJA 1LG1A 5CPLA 3P82A 2YL6A 5CC5A 2RH9A 3PZGA 1GKQA 4HU0A 1XYMA 3N14A 1UUQA 4QSFA 1KLYA 2BVTA 2BP1A 3AHTA 4RZBA 4EANA 4QLKA 3LM7A 2E8ZA 3RO6A 1HVXA 4WDXA 4ATDA 3TVAA 1ISYA 2V8ZA 2WC7A 1XIDA 3ARSA 4UOZA 3LNPA 1K9EA 3LPGA 9CGTA 3P84A 2VHLA 2VGFA 3R25A 1R87A 2NVCA 2Z4GA 1D3GA 3IGXA 9XIAA 1RY0A 1H2JA 2I7GA 4HD5A 5CG7A 2OO0A 3THUA 3V7PA 2XIJA 5AOUA 3VCCA 2ISFA 1JFHA 4O17A 3S2LA 3HN3A 1GT8A 4AZ5A 1FKWA 1YBQA 3EA3A 1W9BM 3TC3A 1TG7A 4BY3A 1E6QM 2FPTA 3KTXA 4DPPA 3NQGA 5JIPA 2IS7A 2HDJA 4IIHA 1JPKA 3IVUA 4N6EA 3UPMA 3G1RA 2R1MA 1OVDA 3MUXA 2C1HA 3UXDA 3BG3A 2YDQA 2PDIA 5DX7A 1Q6CA 3STEA 3RGTA 3M0MA 4GNJA 3GFZA 2DDXA 1LUCB 3UZYA 1A5UA 1H49A 1O66A 5DANA 5E6ZA 4D9PA 2B0MA 4LUTB 2BHYA 3HIJA 3WQDA 2OWXA 2QDHA 4S2BA 4WQ6A 2QEZA 3EA2A 4F40A 4HYWA 4IX0A 4TMCA 3KLKA 3K8LA 2YLLA 2Q01A 3PULA 3E9AA 3QY7A 3LD5A 2VDIA 3N2TA 5DF0A 2IQ0A 3E0FA 3N2MA 4S3EA 5CPNA 1B9BA 1VBHA 1TZ7A 3PWIA 1ODZA 3H21A 3TNBA 4AIEA 3WNOA 4CNTA 1DXFA 5F2GA 1RVKA 2CZEA 2JEQA 3REQA 3I65A 2QCCA 1PS9A 5JH1A 3ANVA 1R2RA 2TAAA 4L4PA 3N17A 4GXMA 3SM0A 5BXPA 4JKLA 2X2GA 3M43A 4AISA 1V6UA 4HU3A 4W88A 2VD8A 2WB5A 1HXJA 3WQ6A 2FGLA 3W88A 4HU4A 4CU8A 3S5OA 4BFAA 3WLNA 2UV8G 3WK2A 1QDSA 1TIMA 3WELA 2HQAA 1ONXA 3P0XA 3UGVA 8XIMA 4GFSA 3TX9A 4YCPA 5A5WA 4H41A 1ICQA 3PPCA 1WP6A 4YNGA 1D8WA 5CJ5A 1NDZA 3MHGA 4EXBA 2INFA 1J11A 4MSSA 1V0NA 3WQFA 1IXOA 3R10A 1O95A 4G1NA 2E40A 1P5BA 3I6TA 1JZ3A 3W01A 4W7UA 4TQTA 1GZ1A 3S8HA 4JEJA 3YPIA 3TOYA 3KLLA 1PKYA 2CETA 1V3KA 2QGYA 3BARA 2NX1A 3PTQA 3L2IA 4L65A 1VD6A 1PKNA 1GEQA 2JKEA 3RCNA 4HK7A 4ACZA 1CZ1A 1EWDA 3P61A 4JXCA 1RBLA 4XKYA 2Y7DA 3ZT6A 4CNNA 2NUXA 1VEMA 4PL1A 2Z28A 4BQ3A 1DE6A 1FWSA 1PTGA 2PRMA 1SMAA 3OU8A 1R85A 1CENA 4G7FA 1TVPA 1W1YA 4DELA 2HZGA 1DJZA 4LV9A 2AKZA 2VEKA 2DIEA 4H83A 4MWAA 4GC4A 1GW1A 3AS2A 3QY8A 4RDYA 3RM9A 3V4BA 4GNKB 1QNSA 2FVLA 3KE0A 4Z08A 4GJJA 1EC9A 3HU7A 2O9TA 1DIEA 5D2TA 4F0KA 4ZE4A 2VDHA 2Y7FA 4IGMA 3W7CA 1RD6A 3GIYA 4WIWA 5LNRA 2V5CA 1KBBA 3G2GA 4DZ5A 1HKIA 4IFRA 2YW3A 4NX0A 2VMFA 3W2KA 1NIUA 2ZZ4A 3AMLA 1ADSA 1XFBA 3VU2A 3W7LA 5IHRA 3LV6A 2BY0A 2HNEA 2XINA 5IBXA 5C7HA 4OECA 6XIAA 2FDSA 4DQWA 1SPQA 1L6SA 3W0KA 4XAFA 4LBSA 3V5OA 2D2JA 3A21A 2OVLA 2WM1A 1WAUA 1IZCA 3R79A 4HN4A 5GNYA 2G3JA 7TAAA 4B3LA 4V33A 3AO0A 3MB9A 1L6FA 2X16A 5BYWA 3RCYA 3KOYA 4XZ9A 1S5VA 5FF2A 3ONBA 1OZMA 4K8HA 1T41A 3QH2A 1YMYA 3HPSA 2GDVA 1Q3NA 2V3DA 3KM8A 1S2AA 1WDQA 2W61A 5CBBA 2INEA 3ZR4A 4TVDA 2H9AB 2W62A 2PDMA 4MYAA 1W3JA 2FVMA 1K6WA 1DWHM 2EF9A 3L23A 2HVNA 2PCQA 2ZZ7A 3MI3A 1BYAA 1QI0A 2C0AA 1OM0A 2AL1A 4Q6JA 3AC0A 3RJXA 4O12A 5JBEA 1VGAA 1RHCA 4AU0A 2QUMA 2HJPA 5ECUA 3NR0A 2AAMA 1GG1A 2NSXA 3KOXA 4RW3A 4ONVA 1FKXA 4NRSA 4M5PA 1KCXA 3M6YA 3W1AA 2ABBA 1KW1A 1C8YA 2CZ5A 5B80A 2FH8A 4HK6A 1Q65A 3NFUA 4B4FA 5K4XA 3L0KA 3S1VA 2W4XA 3GW3A 1ONEA 1GORA 3WD1A 4W85A 1PX3A 4LX4A 3RX3A 1A5MC 1I2QA 2PAJA 1YPIA 3VVGA 1WXZA 5HATA 3B9AA 3BCJA 3O8AA 1UBSA 4GH3A 2Q8ZA 3AJ7A 2JKPA 3WMCA 2WV8A 4DNMA 1XBVA 3VD3A 4A21A 2YYUA 3VOCA 1NF7A 1CXKA 3QF0A 1Q6RA 3WQ5A 1MNSA 4ZFCA 4LC8A 1U2YA 2G96A 5EKYA 4OBTA 1F8MA 2X7VA 3UT0A 3MUAA 1UC5A 2V5KA 1US0A 1HJWA 4KWWA 1E70M 3O3RA 1SO4A 5MKGA 1U5JA 4WDWA 4TR9A 4C5ZA 4DWSB 2B7PA 2OKTA 3W53A 2D22A 1Q7QA 2XPKA 4XAPA 4EPEC 1FH9A 3BCFA 3QSRA 1XR2A 4N9DA 3ARWA 1SGJA 4WKAA 4RZ4A 3WUEA 3K4DA 1H7PA 2PUZA 5ABGA 4KKXA 3VKKA 3G1AA 1QI2A 3GHUA 1O7AA 2XJ7A 2J9ZA 4LNCA 1UKPA 4M1RA 1KB3A 3NPXA 1S39A 1KFCA 1C93A 2FHBA 5FACA 3EDKA 1XYBA 2QMJA 2TMDA 1W9VA 3NQBA 1UBPC 3S2MA 3MMUA 1IEVA 1IHIA 1VJSA 4P61A 1SUXA 1FH7A 3MSRA 3A3XA 1VAHA 1OK4A 2WVUA 2I5QA 4PTWA 3GDTA 1US3A 1ECQA 5FESA 1H51A 2CFFA 1E71M 3QM3A 4O19A 1XBXA 4BI6A 4NAEB 1UWAA 4MWAD 4E3TA 1ZAIA 4IUOA 3GU2A 3S5YA 4IZGA 3FAXA 3CUHA 3H4WA 1S2TA 3QYQA 3BLOA 1AQ0A 2E9LA 4OOZA 4WR3A 5KETA 2RFGA 3L4VA 4HKPA 3NQ8A 4REQA 4M24A 3NQ2A 1J4EA 3EDEA 3MCMA 5KZEA 3NPUA 2E5BA 5EGRA 2GJXB 3PTKA 4ERAA 2PDWA 2E6FA 1NTHA 1UUMA 4U31A 1O94A 3W2NA 3SY8A 4WF7A 1A5NC 3BLLA 1VH7A 3MV01 9XIMA 3S2NA 1REQB 3T2PA 3K2GA 1EIBA 4W86A 3R8HA 1CLXA 4KF1A 3DC0A 2YDSA 2GZXA 1NP2A 4WJXA 4JY8A 1PHQA 1DWGM 4WY0F 2VNCA 2GGJA 4JQ3A 4Q4OA 2WBKA 3OQEA 1TA3A 4DWDA 4IOTA 4HCDA 2A85A 1NVMA 3C2OA 1TWZA 3LTPA 3T0AA 3CB3A 5LYRA 1PWLA 3KEHA 3NM3A 1WXJA 5F2IA 1KRBC 2QCEA 3R2GA 4DM1A 3CHCA 4K39A 5KITA 1Q6EA 3CH9A 4DB7A 3RU8X 3LXCA 4RZ6A 4ZCWA 2VGIA 4HSNA 3UZ5A 1F3WA 4GNVA 4B5TA 4D1IA 3MMDA 3NIYA 2XFYA 3IIPA 2VEGA 1TIWA 1E6XM 1UIPA 2W6RA 2Z7KA 1FA2A 5EMLA 3WDRA 3F7JA 4UTMA 1TE1A 5AC5A 4K8GA 4E38A 2D0HA 2OWCA 4MKNA 4EWND 3W07A 5F4SA 1YTKA 4KCWA 3LLXA 1C8QA 3TSDA 3KL0A 1WDRA 5KZ6A 3T8LA 2VQTA 1NU5A 5AFDA 4CNUA 4KEVA 3UCDA 4M29A 1RQBA 2ZX9A 4QIUA 1O60A 4FA3A 3MUY1 4X0NA 2XH2A 2C0HA 3F2CA 3RLHA 4DYEA 4FXFA 4F0LA 4FALA 3OLGA 2JALA 4WVXA 5K2ZA 1TVLA 3U57A 4MMWA 3WD3A 2PODA 3NSNA 1VJZA 1JGIA 2ESCA 1LBFA 1UPMB 2OLAA 1EO7A 4KGLA 3QZ6A 5DMLA 1SW0A 1IIGA 3LMYA 3LX9A 3T08A 2GOKA 2A3CA 2NT0A 4QG6A 4QX4A 3QOMA 1XSIA 3PBGA 2NUWA 4L64A 3M6DA 4LYQA 4DEFA 3ITYA 3AIVA 4IMEA 3D5HA 1VR6A 4LUJA 3R6IA 2A7NA 2RHGA 3NOYA 1EYEA 3CK5A 5G1TA 1J8VA 4KERA 3GG8A 3LHTA 3ITCA 1FCVA 4ZO8A 1E6ZA 3M0YA 4P7LA 1UD3A 4HA3A 1PB0A 2J6XA 1BGGA 2GVYA 3OIXA 3NEVA 4BEQA 2R94A 4FX7A 3V18A 1R30A 1RA5A 3CPUA 2XHYA 4HHLA 2Y85A 5CEWA 4JIIX 1M7OA 4JFUA 4X61A 1GYMA 5AVNA 1JXJA 3LEPA 4HQVA 1K77A 4WLCA 4JX6A 5LSMA 2NLIA 3VUPA 4B5SA 2QJGA 5K7JA 3N9KA 2J6VA 4PB3A 1V3MA 2CNCA 3I6EA 1BAGA 1ZNNA 5A6KA 2A5HA 3S6TA 4NRRA 4B15A 2ALDA 5IDZA 1UZHA 3JS3A 1GZJA 1IT7A 3LPPA 4RPQA 3OTRA 4YHGA 4K38A 4D2JA 5M2FX 3MQTA 3NQDA 3CYVA 2OSWA 1YE6A 1XUUA 3DBPA 4PMXA 2EJAA 3N6JA 4V28A 5GVJA 1R47A 2OPJA 1MRAA 4DAFA 3A4AA 2Z1SA 4ZE5A 3ARVA 4A22A 4K68A 5AN7A 1MYRA 4H4IA 1XYLA 3NL2A 1HTIA 4FMVA 3JUGA 3H12A 7XIMA 1KBKA 1LJYA 1V6TA 3MA8A 1BXBA 3DZ1A 1OABA 5FIPA 3QEZA 2VKZG 3GXNA 4H00A 4PRWA 1ZP3A 1N8IA 4R3UA 3UZWA 3GVVA 3E0VA 4N02A 1PSCA 4D6JA 2GFTA 5ABEA 1UPPA 1EP2A 3GKAA 1E56A 3BAKA 3UR7A 1H60A 4B90A 3B9DA 4H6EA 1CECA 1FBAA 2J25A 4EAMA 3HPXA 1Z9AA 4IQJA 4NZ4A 3FK4A 3E2VA 1RQEA 3M46A 3W7OA 4M51A 2DZBA 4EOUA 4ZA0A 2FB3A 3TP4A 4IFOA 3W1PA 4ZENA 1RLCL 4BZYA 5HJYA 2OX4A 4JNZA 2GWNA 4UTTC 1FCBA 2WZIA 4NZCA 3GHSA 2C14A 1W3IA 3L21A 2ZRYA 1HP5A 1FHLA 3W7NA 3U3HA 3HPFA 2GJNA 1OD0A 1KBLA 3NDOA 3GUWA 3WF1A 4DJFA 3CZ8A 3QQWA 1V6WA 3CJPA 3VUSA 1C9DA 1KKRA 3USBA 4YTTA 3VGGA 2YBUA 4DJDC 4Q8WA 1RR2A 3I6RA 1RALA 5BOFA 3IIZA 4L7ZA 5HQMA 3QR3A 2XSBA 2NVAA 4DO6A 1JD7A 4H9YA 1TMHA 4ZQPA 3QMTA 4G6CA 3AYRA 5EMMA 5BZAA 1I2RA 2DIJA 4A8IA 3STCA 3IUIA 4C6BA 3E12A 3S5NA 2DP3A 3I7SA 1ZBCA 4IJCA 3G18A 1F05A 4I5XA 2VX5A 3SRFA 5LIYX 1XGZA 3ARUA 1FWCC 3PHAA 1K8ZA 2VXNA 2Q3RA 2VFGA 1LLZA 1WE5A 3BLDA 1XCFA 4MY9A 1Q4WA 3T4CA 2PWEA 4GUGA 1B4EA 2J7DA 4UIOA 4HYVA 3H53A 3WL1A 1TCMA 1KD0A 4ILSA 1TMQA 4BWLC 1R3SA 2R9RA 4AWUA 3GFXA 1HJUA 5K3VA 3CZLA 3W1UA 4M1BA 1K8CA 4AF0A 1EJSC 2VURA 4WKHA 3AISA 3VIJA 3IARA 1V08A 3G1SA 2ZX7A 4C6MA 1QT1A 2YCKX 3LHYA 3UY7A 3ZM8A 2VCAA 2ZYFA 5BXRA 4HMDA 5REQB 2J88A 4LEQA 5FEWA 5AVHA 4M82A 4DO5A 1RXOB 1I75A 1HX0A 1OFOA 2I57A 1IZJA 3FA4A 3D47A 1QCWA 2J8GA 2YCLA 1EQPA 2NQLA 3LPOA 1KFBA 1BXCA 1N8FA 3VPLA 1HJVA 1SFSA 2FZNA 3LHUA 3C56A 4GIYA 4KEZA 4XZIA 5CKSA 4C7FA 4O1EA 2QUUA 3SJ3A 7ENLA 1ME9A 4C1NB 5LKYA 3UXKA 4MDOA 3NURA 1BF6A 5K4ZA 1G69A 3ABSA 2FTYA 1E55A 4ZQCA 5A2CA 3BMXA 2ZUWA 3TTEA 1VENA 2MNRA 3IS4A 5FJIA 1E73M 2XN0A 1C90A 1M6JA 3NQ7A 2PDKA 3SDOA 4EKJA 4L1WA 3ITVA 4GUFA 4ZQRA 1C8XA 3TXZA 4GVGA 3AHYA 1WDWA 4ACYA 3FVMA 1A4MA 3WQEA 1XLGA 4A2SA 1XINA 3G22A 1PO9A 4FNTA 4HT3A 2FZDA 1L0PA 4YVXA 4C1KA 3UNTA 3W7JA 1LRTA 4ICCX 3IJIA 3OVRA 2NVDA 1ODUA 4Q8MA 4NNCA 4QE5A 4DBEA 2P53A 3CEUA 5E09A 1IZKA 3EZ4A 1UROA 3MCNA 2XM2A 3WJXA 3T2QA 5ABFA 1GPFA 3Q2DA 6A3HA 1NOUA 3M7SA 3DFNA 3UZZA 3GBDA 4J2MA 4A8NA 2XN1A 4Z2KA 1EOMA 5J5RA 3M4HA 3KCJA 2PTWA 4KWSA 3BGGA 4FK9A 1RBOB 2BASA 2WVSA 4B5WA 4BQ5A 4LUYA 2YDAA 4HNNA 3UR8A 1JPMA 1VLWA 1M65A 4ERGA 7REQB 3KVJA 5EMUA 2BBFA 5EPDA 4ZB5A 2Z0IA 1J0KA 3RM4A 1R86A 4JYFA 1A5OC 3C2EA 3UXAA 4LFYA 1CIUA 3AYTA 3HQOA 1DHKA 5C9ZA 2ZOXA 2AL2B 5BXSA 4MY8A 3WNLA 3HB9A 4M80A 1VZWA 1TRIA 5J04A 3DU0A 2X0HA 3E0IA 1MVYA 2VVNA 2BZNA 3EX1A 5A2BA 3A9BA 4S2CA 5CZ0A 1JAKA 4XZBA 4Y9NA 1X97A 4E4FA 3VFLA 3EOLA 2ZKMX 3W86A 1IEXA 4IMCA 1QFEA 2MANA 3SR7A 1E9ZB 4K7YA 4ZB2A 3WMLA 4AYGA 4MY1A 1KCKA 3WJSA 3CMGA 3E96A 1TV4A 1UR1A 3AYVA 2ZZ5A 5D2YA 4J3UA 4IPNB 5KINA 5TNVA 3RHGA 4BQ4A 2GK1B 1YXCA 3TYZA 5FJPA 1WCGA 4HGXA 1AL7A 5EB8A 3KVMA 2QDDA 5HOSA 1Z48A 4QJ1A 2ODOA 3A6OA 3G77A 4DN1A 1FDYA 1GQNA 2V5JA 1J9YA 4GBDA 5BCAA 3GTXA 1EA9C 4C6NA 4J3VA 3C52A 2WVTA 3RO8A 2ONEA 3PBYA 5DFAA 3W25A 4H6RA 3WMSA 3M0IA 5D05A 1W2VA 3EWBX 3PBVA 4MDPA 2J7CA 3TLLA 3QRHA 3GU1A 2HMCA 4Q4SA 1CTNA 1QW8A 5DBUA 1Q45A 5M17A 2FZBA 1AVAA 4AWEA 2BHUA 3PNZA 1XH1A 4HHMA 3Q58A 3E38A 2PPGA 3CQKA 3O63A 4DX3A 2GQAA 3VGDA 2NWRA 5E93A 2XIBA 2YL9A 3VMPA 2DT3A 3LCWA 3MSGA 1E4LA 3ABOA 4ZQMA 3W71A 2D23A 3L65A 2VYOA 2O9OA 2X30A 3LBCA 4GPNA 2PDBA 3WIJA 3WLTA 1UYQA 2VRJA 4A05A 4ZQNA 4YIWA 3ZMRA 1IGWA 4B5UA 1MWOA 3SEPA 3F4WA 2D73A 4JX5A 3BGAA 4NJJA 3W1QA 4Z0JA 2XIQA 4QTGA 4F9DA 3F03K 5DQPA 3GVGA 3UR2A 1RD5A 2J7FA 3IGHX 2PTXA 2E5CA 2ZA2A 4KIEA 3OEXA 1MDLA 4B2DA 4GX9A 3WDPP 1JEZA 3RUBL 1FVPA 4CD6A 2WOQA 1QI5A 3EPMA 3MWCA 2VDGA 4DF2A 3A3WA 3L7RA 1KM4A 4ZO9A 4MYXA 1SZGA 3MDWA 3VC5A 1P7TB 1UD4A 3N4AA 3C0QA 1W9UA 3TLQA 1NDYA 1QW9A 3CZGA 3TYAA 4GJ1A 2GVGA 3F2DA 3MP4A 4O1DA 2ZIDA 4ZXOA 4Y9MA 3WQWA 1NSJA 3GXTA 4LSBA 4MF4A 4HN8A 3WBEA 1AL8A 1WZLA 1ZS2A 3WLLA 1K7XA 1BWKA 2J75A 3N34A 4UTLA 1EA0A 3GUGA 1HKMA 4UNKA 3KCLA 2ACQA 1G1YA 4GYPC 2JF7A 4J27A 3AZRA 1BVNP 3SI9A 3AIWA 1DVJA 4DBUA 1CBGA 4LBRA 1W3KA 3K30A 2CWNA 3L66A 5I00A 1DWAM 1X96A 3E5PA 1AMKA 4K1WA 4H6QA 3IJDA 2PEVA 1YPXA 3VNDA 2ON3A 1IEWA 2WPBA 1H1ZA 1ELSA 4ROQA 2ISSA 4EF9A 1K70A 3W37A 3UYCA 2WMFA 4HHHA 1ONRA 3HV8A 2A2IA 1GONA 5HPCA 4JFVA 4GY1A 4MTVA 2AQOA 3FYOA 3VIKA 2DSVA 3LSCA 3EKZA 3WD0A 1M3UA 4M8UA 4ML9A 3FVDA 1ISXA 3RMEA 3DAQA 1KM0A 4MB3A 4IGNA 1EZ2A 1M7PA 1TV5A 2YB4A 4I6KA 5AC6A 1PCWA 5H8MA 2IXVA 5AY7A 1V3JA 2PI6A 1AD4A 4I7WA 1V5XA 4KEUA 4DO4A 3FYYA 3ES8A 2O56A 4N4PA 2XIMA 1UASA 2ZXAA 2ISVA 4GQQA 4F66A 4RX0A 5FCZA 3L5MA 4HBKA 4U2YA 4R33A 4UQEA 4HMCA 4E2BA 1V79A 4JFTA 4XZLX 4E8GA 4HMNA 5PTDA 3DHDA 2FFCA 4LYPA 2ZQ0A 4R9OA 1Q13A 2QVHA 4HSOA 5I3HA 5MF5A 3TJ4A 3UG5A 1HP4A 1OG6A 5E0CA 3WLHA 3APTA 1XX1A 1NF0A 3U5YA 1RVGA 2HK0A 2QV5A 3WLSA 2VCBA 1ZGDA 3DFYA 4G7EA 2J9YA 4W7WA 3KVLA 3K13A 3K4WA 1HQTA 4CN4A 4WOQA 4NYYA 3W87A 4F2UA 4OFCA 3R11A 4ATWA 1L8PA 1ZJBA 4O16A 4U10A 3TTOA 1QNQA 4JNYA 3KDOA 3IEBA 3U2ZA 5K9XA 4O0QA 1WKEA 1CDGA 4PMDA 1PKMA 5BU9A 2QF8A 1Q7ZA 3EWCA 1KXVA 3BJTA 4FIRA 3IJLA 3TH6A 5D8WA 4GMEA 3B4YA 4C90A 4XD6A 5I3IA 2WQPA 1E1FA 3HG2A 1F07A 3R7MA 1AD1A 3ELFA 3NO5A 5C2XA 1XIFA 2V9DA 3UGRA 1K4GA 2E6AA 3N3MA 1HUVA 3W84A 4NF7A 1QI3A 4Q8OA 3LRLA 1UP3A 1IV8A 3B06A 5HMEA 3PK7A 5BMWA 1DYSA 3LU2A 4LYKA 4PH6A 4IG2A 3PPHA 4HTBA 4XB3A 2IUZA 4OTKA 2FZMA 4QJ3B 1A47A 2PDGA 3VO0A 1VFOA 2OSXA 4Y8EA 3KL3A 4PODA 3VD9A 5B7YA 1S2UA 1V7YA 1B4KA 4UFMA 4PTXA 1S2CA 2WPGA 3GIPA 4MKVA 4S23A 5I3FA 2G3FA 4AXKA 2TRSA 3U2OA 2NLYA 1JF6A 5AECA 3SCSA 1OX4B 1WBHA 3D6NA 3UJ2A 4WCJA 5CGMA 3ORWA 3HF3A 3DFTA 3IGUA 3H7UA 3MKKA 2R24A 1AUSL 1YHTA 3QOKA 4LRSA 5A8GA 4MZ8A 3TROA 4Y90A 3HG5A 1QJWA 3JU2A 1EKOA 6TAAA 3SSJA 3GVRA 4M81A 4JTHA 3DECA 4EP8C 1ZLPA 4GJIA 3TTYA 2GJLA 2C15A 4CD4A 1EF2A 1I9CB 1M7JA 3VCRA 1P1MA 1IYXA 3GVQA 2WNQA 4RXFA 2IKIA 1IWPA 5G4HC 1F4HA 4AY7A 7ODCA 2I9EA 1B3VA 2DY3A 1UH4A 1POJA 1U1JA 4CU7A 5D30A 3JR2A 4D6GA 5C9WA 1OGGA 3CHDA 2H90A 4DBDA 3N29A 4GKLA 1JZ4A 4FP1A 1I2OA 4PTMA 5CPQA 3GSMA 1UR0A 3GH4A 1ICSA 1TPWA 4GUHA 5CPSA 4N42A 2NV2A 3AMKA 1XL9A 2QDEA 3PM6A 2FIQA 4C65A 1Y5VA 2CBIA 4A3YA 3AS1A 4LGXA 9RUBA 3CZJA 1A5LC 3QHMA 4DPQA 3PZIA 1V4YA 3MO7A 1KRAC 2A3LA 4HNOA 3HZ3A 1T8XA 4CQBA 5T8GA 1HF6A 4J4KA 4AHOA 1V51A 2R8WA 4LWWA 2Y4SA 3I4KA 4XTIA 1GOKA 1FFRA 1NAL1 3KHDA 3GZ3A 4W5ZA 2YA2A 5I23A 2ZWZA 3PN8A 3TMLA 3VNKA 3T07A 1S3TC 3CH0A 1GVIA 2E67A 1K1DA 4I9JA 4P7RA 3I7RA 3KXQA 3EXTA 4JTUA 3WF0A 3JW7A 4NU7A 1MXSA 1ZB5A 1FWDC 1EDTA 4XWUA 1KTNA 3SSZA 2AQVA 1OT1A 1GOQA 1VEOA 4ORMA 5A8QA 1JCMP 5C6MA 2QLYA 2ZRVA 4IIEA 3NZQA 3Q37A 3QV6A 4XBSA 3RRXA 3KX6A 2E8YA 2H9AA 1EJVC 4YS1A 4MNMA 2F7FA 5CBJA 1MXGA 3SGZA 2R1PA 4IL2A 4MG4A 5XIAA 2B4GA 3VIFA 3GHRA 3CUFA 2B7NA 1H41A 3A5FA 5DELA 2VC9A 2EQDA 3KRZA 4F0RA 3QW3A 4C6JA 5D37A 3S9YA 5DCBA 1OK6A 3FEMA 5A6LA 1VJIA 4LVDA 5GPRA 1B54A 1K8YA 3EXRA 4I9TA 2P50A 1L6GA 2PTZA 2BS9A 1DP0A 4L1XA 1B30A 2OEJA 4Q33A 3GXIA 2J24A 2O9PA 4KCTA 4OWGA 1WZMA 3WK3A 1UWRA 2XU2A 4HPNA 4I7UA 2WCAA 2E0PA 2QJHA 3VMNA 4PN2A 1VRDA 3G24A 2WMIB 1W3HA 2A3EA 3NSXA 5HAOA 3T0TA 4S3GA 4OBSA 1G7UA 1ZJIA 2ZUUA 2YOCA 3WJYA 2FGBA 4FB7A 2BOEX 5DRCA 4AEOA 5MHBA 4AVOA 4QAWA 2WM0A 2YL5A 4W93A 1KFEA 4JYEA 1W8SA 3TCEA 3RF9A 3BZGA 4AD3A 1HGWA 4LVBA 1CXLA 3GDLA 1J2WA 1FWNA 3S47A 3BJFA 1ZHAA 3BGJA 4HP5A 3TN6A 4D8ZA 1LCOA 4AX7A 5I3GA 4HPHA 1KLZA 5GJMA 1THFD 2RKXA 1WKFA 3AIRA 2OR2A 3E74A 5F4WA 4MNLA 1JYVA 1TX0A 1GOXA 4Q8NA 4QNEA 3MANA 3WN6A 1LRQA 3E49A 1OF6A 4R5EA 4XAZA 1I1WA 3XINA 4UMCA 2C91A 2WBGA 4N2YA 2OLHA 4TTGA 3H55A 1P6WA 4RNFA 3CT2A 5CSRA 3ARTA 3WBXA 4FI4A 1JYWA 4UFJA 1TFVA 3M44A 4M7SA 3OP2A 5M1TA 3W6LA 3ZJ7A 1KRCC 5BOOA 1Q2SA 4GIEA 1C29A 2OGJA 3H2AA 3PR2A 1EBGA 2AMXA 1YKWA 1VB9A 1R8LA 1N55A 3B0PA 3AQUA 4ZOEA 1EUAA 3RLGA 3H23A 1KFWA 3NAVA 3K46A 3AXHA 4O14A 4XD4A 4PUWA 1YNPA 3LA4A 3OLIA 4H9TA 3PPFA 3VZXA 2VO5A 5I07A 3PUDA 3UY8A 2RAGA 4YTQA 3PC0A 3P8JA 1E9LA 3B40A 2X0YA 1UQYA 1D8CA 5LIUX 3VCNA 4TVCA 5HR7A 3QC0A 5IBXC 1S5NA 2X40A 3UPBA 4JIPA 4CQ8A 4PMUA 4JTDA 3UXIA 3EEGA 1OY0A 2I14A 3GDBA 3N4FA 1H5VA 3L2LA 3KZSA 4LVGA 4UCGA 2XZ9A 3CL6A 4NASA 2ISDA 3OJGA 3U5UA 1B90A 3QPEA 3WK0A 1KCZA 1XWYA 2WWDA 3LMZA 4UMBA 5CLWA 4OUIA 1P0EA 3TN5A 3FHQA 3I3EA 4KMQA 3S6OA 3USZA 3W1NA 4X3ZA 4J3TA 4W4QA 3VGEA 2HBVA 1XLHA 3B4UA 1E4IA 2YZ5A 4A29A 3AMDA 5I02A 1XICA 2UY2A 3AYSA 2GQ3A 1XLEA 3KW3A 1F73A 1R3VA 1U22A 3W73A 4ZMGA 3N11A 3PFRA 2AGKA 3CV7A 2HRWA 2VWTA 4W89A 1W9PA 3SB0A 1HKJA 1YNYA 1GK8A 2FTPA 1IR1A 2WZEA 2J8FA 2C71A 4PBFA 4KFOA 5D32A 2XIIA 3MT1A 1HKVA 4PL2A 4LY4A 1X39A 3NGFA 2Y0FA 4QS5A 5BMXA 3ZLGA 3B8WA 1TVNA 1HFBA 2WSQA 1MXDA 4B3ZA 5DMNA 2O9RA 1GGOA 1OGSA 2VFFA 5B7ZA 1J0ZA 3ZWTA 1H09A 4C6CA 1J0HA 2ACSA 1VQTA 1F6YA 4KGJA 1A0EA 4KIRA 4MJMA 1AH4A 1D7KA 3SGGA 4B3KA 3C5QA 4YXGA 2PWGA 4U4MA 2X7WA 3TAKA 3WLPA 4IFKB 1QASA 1W2PA 3MYOA 4K6AA 4KPLA 2QJJA 3WFLA 4AEFA 1SZEA 4GUJA 1AZ1A 3PWGA 3GDMA 3T8QA 1ITCA 3ZXWA 2VZUA 2RJHA 3EMCA 1KR1A 2VEPA 3CWNA 4V1YA 5CCZA 5AHFA 4QGCA 4PCSA 3V5CA 4NP7A 1A80A 4E4PA 4V15A 2Y5SA 1VCVA 4AAJA 3I3BA 2RUSA 4HOZA 5G4EA 2PDQA 4GVFA 2POZA 3UJSA 4C91A 4ZO7A 3U8GA 4KT2A 3NQEA 3CB8A 3BC9A 4QR6A 3PJTA 2CERA 1C7SA 2WZTA 3ABQA 3UG8A 2AMGA 3MHFA 4GRSA 3TOPA 4UQAA 1LOSA 3OGRA 3SRKA 3GWQA 4Z2JA 2Z7GA 3LQGA 1YNQA 4LVFA 1K03A 2WMKA 3B3DA 4RDVA 3EMQA 4NILA 5LGZA 1UWIA 4Q4MA 1UOKA 3OLEA 4M6PA 5F7UA 5HINA 1BXNA 4GFIA 2F61A 4AVNA 3SCRA 1ZTVA 2ATSA 2VOTA 4IX2A 4WSJA 3SQMA 2WNWA 2Y61A 4C6OA 4FEZA 5C71A 4GXWA 5I77A 2HROA 2EG8A 2VC6A 1EXPA 3G1XA 2CXEA 2XH7A 1PZ1A 4IMAA 1JI1A 2A7PA 1YXYA 3L4TA 1TJPA 5M5DA 2O7SA 1XF0A 1O1ZA 1T5AA 3AMGA 1E0WA 4JGDA 1EYWA 4I8DA 1HGYA 3POHA 5G1YA 2QVNA 4P8VA 4FNRA 1GW9A 3KBNA 3OW1A 1Z8AA 3PVFA 4ICNA 4QDMA 5ABHA 2QUVA 1TWDA 1EEXA 4E3VA 4JTAA 4FNQA 5JH2A 2DJLA 3QV9A 2PP1A 1K9DA 4UTHA 1W31A 2WSKA 4JBRA 2YB1A 2Y2WA 2YBTA 4FX6M 2IPWA 1VFMA 4LH8A 5HNTA 1EUNA 2HSAA 5I09A 1FCQA 3UJEA 1M9HA 2WSRA 1GHSA 4OKDA 1E3XA 4BA0A 1OYCA 4GD0A 3AXMA 1BG9A 4FO4A 2QQ6A 3WX7A 2BHZA 3WUGA 2Q02A 2X41A 3P80A 4X9SA 2W79A 3S3GA 1MI3A 1LQ0A 4UTWC 4E2OA 5J8LA 2R1NA 1JVNA 5DT7A 5HWMA 4L6OA 4LJ3A 2IPFA 4X63A 1TV7A 5JBFA 4ES4A 1BFNA 2NQ5A 2W27A 5JU6A 1LLOA 2CLKA 4M56A 3AUJA 3MC5A 3ARPA 4Y7EA 1YBQB 3LGDA 3DHFA 2ISWA 1L6YA 2NXGA 3MBFA 2BY2A 3VE7A 1Y65A 4Q8UA 1M68A 1RSCA 2Y6ZA 4I90A 1UOZA 3WBAA 2DSZA 5DY3A 2POTA 4PUMA 4PC8A 4URIA 2X0SA 2BGQA 5D02A 1JZ2A 1W0MA 2CLEA 4KETA 3DESA 3HQ1A 3TJIA 3DHUA 3AALA 1CGWA 3IJ7A 3CLWA 3B8DA 3VNZA 5EBAA 4PB4A 3P62A 4QEEA 4K36A 2CBVA 2D0GA 1EJRC 5CPTA 3ES7A 1FXPA 1SSDA 5LGXA 4ADTA 3UWZA 1K9FA 3SUWA 4EACA 3L5AA 3CT7A 8CGTA 2WSYA 3BANA 2P1FA 4D6HA 2JE8A 4HZ8A 4NAFA 1IWAA 3O9NA 1S46A 1TELA 1GJPA 3PB2A 2QHAA 1BSIA 2RDXA 1IQ8A 3VDBA 1MW3A 1EQCA 1F61A 2PLJA 1I1XA 1XRTA 2DZSA 3UWUA 5E6YA 3REQB 5JIWA 2FH6A 4Y9PA 1FWRA 4J5NA 4P8XA 1YDOA 2WXDM 4HPJA 4F4RA 4C60A 1NDWA 3RN6A 3ABZA 3ITOA 3N2CA 4BI5A 3TN4A 1QWGA 6REQA 2C18A 3FS2A 1K02A 1WDDA 3M0ZA 4MWAE 3R43A 4POCA 4UR8A 1R7OA 3UA3A 1ISZA 1R5YA 1UWUA 4UFKA 4PRTA 1K7EA 3OBAA 1G9HA 3U4AA 1H1NA 1OYBA 2BNJA 3W2JA 5EY5A 4Q32A 2QCDA 4LB3A 2Z1KA 3B04A 2DPEA 5KZDA 2PDFA 3Q65A 1MZRA 3LRKA 3E1F1 1KWGA 4H7ZA 3ZVHA 4H6KA 4KESA 3A24A 4X9YA 3FJNA 2OXNA 1ME8A 3HM7A 1M53A 5HJXA 1BLIA 4HZ7A 2BXVA 1M01A 3MMTA 1WDSA 2VGBA 3EGJA 4L9YA 3GK0A 2ANUA 2D24A 3DG7A 3THQA 1TMLA 2QW5A 3MU7A 3QGVA 2OU4A 3GHTA 4XTDA 4AZGA 1NQ6A 4A8LA 3NVDA 4ACZB 1NWRA 4XV0A 4UTKA 3VNYA 4O0ZA 4XKYB 2HBXA 4Q4PA 3TYCA 2ZTKA 2W63A 1OWQA 1S5TA 1SJBA 2OOGA 1JCNA 4G5DA 4C6DA 1WX0A 2GSJA 4WY0A 3GDRA 3W76A 1UP2A 3LBOA 1AMYA 3LYEA 1KCLA 3ZJ8A 5GNZA 3T2OA 4PMZA 1RV8A 7TIMA 1XDLA 1XH0A 1XIHA 3BG9A 4QQUA 1Q6QA 1ESWA 4LCQA 3VOHA 1N82A 4MWAB 3TUUA 3C8FA 3EX2A 1BRLA 4DF0A 4YPJA 3T42A 1AJ0A 1X6UA 1BGAA 2IPGA 3QFWA 5FSDC 2VC7A 3GNPA 4F8XA 2ZTJA 3SZ8A 1JL8A 1PEZA 2JGQA 3A12A 3OPSA 1XXXA 6ALDA 3OIHA 3RNDA 4Q8PA 5DBTA 4WEVX 3PZ9A 3WBWA 5FL1A 4F0MA 3KRBA 2ZC8A 1VRXA 2P88A 2BOGX 3UQNA 1F3XA 5LNUA 4C6FA 3WH5A 3GR4A 4FLOA 2OZTA 4J3XA 3MCOA 3W81A 3RR4A 2D0FA 3AJXA 1PX8A 4X2PA 3RLUA 1TPH1 2Z24A 3C0LA 4P5UA 4OJYA 4AZ7A 4UB9A 2ACUA 2ZUTA 4EPKA 2UWFA 4FHAA 2E6DA 1V93A 5KZMA 1PPIA 4Q8QA 1CXHA 2X1SA 1DTNA 4UZUA 3QHOA 3R12A 1XYCA 1UKSA 2PWHA 4LPCA 3CPRA 2D3NA 2XGZA 4AD2A 3LHZA 2C79A 2YXOA 3FXYA 4KH2A 3GXFA 1FWWA 4GX8A 4QDPA 2G4JA 2HVOA 3R0UA 4QHRA 3OGSA 2D1ZA 1VKFA 4M7TA 1TJ0A 3CIVA 4DJFC 2WQDA 3R1ZA 1K6AA 1V7AA 3DG6A 3RPDA 4E8DA 3TW7A 1QTWA 4NZ5A 3VTRA 5C0QA 2PDCA 3IK2A 4JTRA 4J7RA 4UFIA 1PDZA 4S1FA 1HN1A 3HJEA 3BLEA 5LNSA 2Z1WA 3SCWA 3PPGA 2V5BA 1E6NA 2FLIA 3G3DA 1XDJA 5CBIA 4IIDA 3SIMA 2OZ8A 4N9BA 3KCOA 2DVTA 4XBKA 3T0DA 1I2NA 1TO3A 3O15A 4ZOCA 1TR1A 4GQBA 4LT9A 3T0CA 2JK2A 4MJ4A 3EBVA 3CWOX 3K8MA 5FJOA 1XW8A 3DG3A 4PMJA 1G4EA 3NPWA 4OZOA 3PBUA 3BH4A 3CS2A 1SO6A 5C54A 4PUUA 4Q8VA 3WH9A 4H9MA 3V0SA 1UUOA 1EHNA 1KXQA 1XIEA 3FIGA 4E2DA 1QOPA 1EXBA 3H2CA 3URBA 3U0HA 2DZWA 3B0UX 1OGBA 5FL0A 1UWTA 4CD7A 1O68A 3E3HA 2KX9A 1TJRA 5I3JA 2WHKA 2FYMA 2VFDA 1OQFA 4JQAA 4OQVA 4O4VA 1G4PA 3TU9A 4MB5A 5LXXA 1TX2A 1D9EA 3EKGA 3L9CA 3W82A 1SU5A 1W1B1 5L6UA 1EPVA 1UD6A 2YA1A 5MKGB 2OCZA 4PGLA 3WQPA 4L1GA 5A8MA 1FH8A 3VABA 1LL4A 3W7EA 4LAUA 1J12A 2CCRA 1GQJA 4G56A 2R91A 1F3TA 2REQA 2PWFA 3T05A 2P10A 4OHQA 1BYBA 4A8RA 3AAMA 1J96A 3APGA 4F3HA 3KTSA 2VVSA 3CQJA 3ECQA 2GDUA 4JTJA 3KBJA 3W28A 5H1WA 3EWUA 5F2MA 3TONA 5CJMA 4E2VA 3I3DA 1RLDA 3GTFA 4S3FA 5D38A 1Q6OA 2QS8A 2PDXA 1P4CA 1YTDA 2XM1A 3ZSTA 1PBGA 3OLDA 1UR3M 4O1BA 3NL6A 3T6CA 3FEQA 5AYYA 4HTYA 4GINA 3U7VA 1WOAA 3T55A 4LY8A 1DIOA 2EO7A 5F1UA 3GO2A 1YADA 1EGMA 3A13A 3GG1A 5BRPA 4O54A 3KVKA 2VENA 1LBMA 4HJWA 3G8EA 4PB5A 3ZFHA 3GNXA 2OQLA 1CXIA 2VEIA 4A3QA 2QGHA 4PTDA 3GNDA 4UTJA 3CQHA 1L6WA 4FNPA 2WNNA 1DWJM 4G9PA 3HPZA 4Q7IA 1G7VA 1QPRA 3OHIA 1IT0A 2E6YA 3ATYA 4GO8A 2XG9A 3A47A 5CGTA 1XLDA 3B8SA 1XGDA 1H7RA 3A4JA 3VD7A 4ZTXA 2PD5A 3CZEA 2HK1A 3IIXA 2I5IA 4JTIA 1SQ7A 5U7SA 3T44A 4PMQA 3ALFA 4IT1A 1EPXA 3E6EA 1ZQ5A 4JX4A 2A4AA 1KXHA 1GVYA 1JPHA 3SADA 3AIQA 2QMKA 4US5D 1TA3B 2C19A 2IKJA 2JFEX 2G3NA 3HA1A 4DIAA 5E9AA 2IKGA 3TWAA 2V6AA 4LV4A 1TZ9A 4RK8A 3W7QA 1X8FA 3C3NA 4LYRA 4JOMA 1GVQA 1O5KA 1Q6GA 3UETA 4C5YA 4UQ9A 2BLEA 3ALGA 3WNKA 3SCNA 3PZTA 1J5SA 1G94A 4FNSA 3GZAA 1Z32X 2DH2A 3MP3A 1RCQA 2A6NA 2PE4A 3L4UA 4QSHA 5A95A 1FFQA 4UR7A 4E0CA 1G6CA 5AKQA 2PC4A 1WO2A 1YEYA 3V36A 3PUOA 1CX9A 4KRUA 4R9XA 4O1AA 1JPIA 5M3WA 5CXPA 4V1XA 1JZ7A 3FDGA 3S5SA 4JQ1A 1HL9A 2YA0A 3QQ1A 1X38A 4NJIA 4X22A 2ZC1A 1YLVA 4WUIA 4W9TA 3TQ0A 1E3ZA 5D2VA 2CXGA 3OYZA 3STGA 4CCZA 1DJWA 3CTLA 4RXGA 3ME3A 3SBFA 3W72A 1MRQA 3MZNA 4ZR8A 4XAYA 1BD0A 3WF2A 1DJHA 1UQZA 2JBMA 3B8VA 3PZMA 4GK8A 3M0JA 5LA2A 3ITXA 1FWAC 2C1GA 2GGHA 4WK9A 3S1XA 2E9BA 4P8UA 4C6LA 2EAWA 4RUBA 4DUVA 1DBTA 1QNOA 3IJ9A 3ABXA 4XSMA 1M03A 2H3BA 4YTSA 4LBUA 4PEEA 3T7VA 3C2FA 3GTHA 1DHPA 3UR5A 3WD2A 1GQIA 4HNUA 3O05A 4XO6A 2BOFX 1F6PA 3W9ZA 4LOCA 1DJNA 4N7QA 5HNUA 4JCMA 2EG7A 4D71A 1ZAHA 1X7IA 3TWBA 4GYFA 4E6MA 3QLDA 1X7FA 1ME7A 1ISWA 3P2VA 4Z1YA 1ZAJA 1CGXA 1GKPA 2YCJA 1OB0A 1DJYA 2CLHA 4NNAA 2VFIA 2P8CA 2TPSA 2GQ8A 4FLSA 1A5CA 1EX1A 4MNKA 4AZCA 4C1LA 2WMJA 4PUDA 4WXYA 3LCXA 3AI0A 4AVFA 1KNWA 1VC4A 1V03A 1OZQA 4MM1A 1TCDA 3GAKA 5E0KA 4O11A 2A79A 1PHWA 1YE4A 2ZICA 2OYMA 2DORA 4X2RA 3HV9A 3UU0A 3ZJ6A 4IPPA 4OT7A 3AXKA 2PRHA 1ZRQA 2PFHA 4H01A 4MVAA 1UP0A 3R89A 3VIIA 1T7LA 1F2JA