4ERAA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 113
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eraA00
3LU2A 1O5RA 3WZ0E 4C6PA 4L9XA 4BY3A 2HQAA 3GU9A 2YB1A 1GKPA 4IFRA 2Z24A 3RCMA 5AKQA 4GY1A 3O7UA 2AQVA 4ERAA 1O12A 3GU2A 3MTWA 2G3FA 4KETA 3UBPC 4OFCA 1RK5A 4PCPA 3QY7A 1K1DA 4LALA 1EJWC 1VFLA 4IH3A 2XIOA 4DLFA 3PANA 2Z2BA 3UPMA 4EPDC 5FSEC 2O4QA 2PUZA 1NDVA 2EG7A 4PBFA 5HMEA 2Y1HA 3A3XA 3AU2A 4B92A 3FEQA 3MPGA 3OJGA 2OB3A 1NDZA 3B0YA 3OQEA 3MKVA 4PE8A 4GXWA 4B91A 1GKRA 2Q09A 4C6MA 3LGGA 1NDWA 4C6IA 2HBVA 3GU1A 4CNTA 3SFWA 4B90A 1PTAA 3OU8A 3K2GA 2FFIA 2PAJA 5G4HC 1FWAC 3GTIA 2VC5A 2HBXA 4NG3A 1S3TC 4KQNA 2OODA 4DI8A 3URAA 4LAKA 4DI9A 1V7AA 3IRSA 4F0SA 1EF2A 3GTXA 4QS5A 4RE0A 3NEHA 3GIQA 2FVKA 1NDYA 1EJRC 2WJDA 3LA4A 3N2CA 4AC7C 4C5ZA 3IGHX 4DZHA 4E3TA 1XRTA 4QTGA 4C6CA 4CQDA 4C65A 2UZ9A 1M7JA 4R88A 4KESA 3C86A 2EG8A 4XD5A 4C5YA 1PO9A 3IJ6A 2VHLA 4LH8A 3S2JA 3E0FA 3GIPA 4XAGA 3GTHA 4G2DA 3RN6A 2YB4A 2O4MA 3A3WA 3URNA 4ICMA 4WGXA 4LCSA 2QVNA 2QT3A 3GUWA 4LEFA 1E9ZB 3S4TA 4LAMA 4G7EB 2YZ5A 3LGDA 2BB0A 1ZZMA 4XAYA 1BF6A 1FWBC 2Z28A 2HPIA 1E9YB 3LSCA 4TQTA 3LS9A 3NURA 2ANUA 3MDWA 4XD6A 4XAZA 3SO7A 2Z25A 4KEZA 1P1MA 1A5LC 1K70A 3F2DA 4KF1A 2I9UA 1ITUA 1DPMA 4C6LA 1PB0A 4LANA 1FWFC 5CH9A 2QPXA 3DCPA 4INFA 4JOMA 2OQLA 2D2HA 1XGEA 1YBQA 1POKA 3K5XA 4KEUA 2OGJA 1RJPA 4CQBA 1HZYA 4KIRA 1FKWA 4YIWA 1IE7C 4LCQA 4C6KA 4BJHA 4EPBC 4H9ZA 4IG2B 4NI8A 4GBDA 4PBEA 1EJUC 4GX9A 1UMLA 1FWIC 2W9MA 3BE7A 3GG7A 3HM7A 2P53A 1EJVC 4C6BA 2DVUA 4GC3A 3E3HA 3F4CA 4ZSTA 3IARA 2WJFA 3LY0A 1KRMA 1FWJC 4MUPA 2Z00A 4C6FA 4AQLA 1FWGC 3EGJA 4H9MA 4LCRA 3QGKC 2R1KA 1FWCC 1QW7A 4G7EA 1M65A 1ADDA 3LNPA 4QRNA 3MSRA 2GOKA 2ICSA 4I6KA 4DIAA 2AQOA 3CS2A 1ONXA 1KRBC 1FWDC 3B0XA 4C6QA 3S2NA 4HK5A 4RDVA 4RDZA 1R9XA 1A5NC 4GY7A 2PGRA 2GZXA 3S2MA 4GK8A 1YBQB 3IACA 4Z42C 3CAKA 3F4DA 4GY0A 3EWCA 4CNSA 2R1NA 3E2VA 3RYSA 3MVIA 1A5MC 4D8LA 2A3LA 1RAKA 3QY8A 1JGMA 1R9YA 4LFYA 4IFOA 2GSEA 3PNUA 4UB9A 1ITQA 1NFGA 4C6JA 1ONWA 3OOQA 4IF2A 3IV8A 3HTWA 1WXYA 2AMXA 4V1XA 1RJRA 4IG2A 1V51A 1XWYA 4NP7A 4CNUA 2WJEA 3CJPA 3G77A 4C6DA 2P50A 4HJWA 5LXXA 3PBMA 4QS6A 3ORWA 2D2GA 2IMRA 2Z26A 2F6KA 4H9TA 5FSDC 4R7WA 3F2CA 2VUNA 1P6CA 1RJQA 4M51A 4C6EA 3ITCA 3TNBA 4KEVA 4PCNA 3TN4A 4DLMA 2EG6A 3T1GA 2FTWA 2HNHA 1I0DA 3ID7A 4R85A 5A6TC 5HMDA 3O0FA 4DZIA 3A4JA 4C60A 3AU6A 1RK6A 2ADAA 1RA0A 2UBPC 1EZ2A 3MVTA 4CEXC 1UBPC 2CZVA 4EP8C 1J79A 1RA5A 2ZC1A 3WYZA 2VM8A 1POJA 1KCXA 4HA0A 2PGFA 4IFKA 2Z27A 1YMYA 4IGMA 3QY6A 1A4MA 4GX8A 1V79A 4KERA 3TN3A 4RZBA 5HMFA 1J6PA 3EWDA 3OODA 3GTFA 3URBA 3GRIA 4I6VA 4CQCA 2VR2A 2WM1A 1A5KC 3T81A 1V77A 2FVMA 4ZSUA 3LSBA 2Q01A 1KRAC 2BGNE 4H01A 1I0BA 3K4WA 4J5NA 2FTYA 4WHBA 4J2MA 3E74A 4ERGA 4EPEC 4V1YA 1QXLA 2R1MA 2QS8A 1XRFA 3DUGA 1KRCC 4DNMA 3FDKA 2Z7GA 3R0DA 4H9VA 3AUOA 3MJMA 4LAOA 4IGNA 4RDYA 2I5GA 1FWEC 3OVGA 1R9ZA 3JZEA 4QSFA 1J6OA 2YXOA 4IFKB 1P6BA 1A4LA 1UIPA 4HK7A 3RHGA 2VC7A 1EJTC 1YRRA 2Z29A 4F0RA 3DC8A 2D2JA 3V7PA 4DO7A 4XD3A 1EJXC 1J5SA 4GZ7A 1FKXA 3IPWA 2R1PA 1V4YA 2DVXA 4RDWA 1WXZA 1GKQA 2GWNA 3KM8A 2R1LA 4EPKA 2Z2AA 4UBPC 4C6NA 1PSCA 2E1WA 3TN5A 2Z4GA 3B40A 3UR5A 4C6OA 4P5UA 4H9YA 3UF9A 3FDGA 1K6WA 4XD4A 5E5CA 3TN6A 4DYKA 3PNZA 4J35A 4H9XA 4BKNA 4GOAA 4H00A 2PLMA 3NQBA 4CEUC 3UR2A 3E0LA 4B3ZA 1YNYA 3ICJA 4GYFA 4H9UA 3S2LA 4L6DA 2HPMA 1W1IE 2OOFA 4WVXA 1M68A 1YIXA 1A5OC 4HK6A 4ERIA 3T8LA 1EYWA 2GWGA 1UIOA 2RAGA 3PAOA 3ISIX 2DVTA 3HPAA 2KAUC 1EJSC 2E25A 3WMLA 3D6NA 1FWHC 3MDUA 4IQJA 4F0LA 3F2BA 4QROA 3E38A 4XAFA 3QGAC 3URQA
chains in the Genus database with same CATH superfamily
4EE9A 4HPHA 4IX2A 5U7SA 3GG8A 1ITCA 2DORA 3EKGA 1SPQA 5A6JA 5A8QA 4AHQA 3CWNA 2ISSA 3KBNA 5DRIA 3W02A 5D2XA 2G3FA 4LB4A 4H2HA 3OLDA 3VGGA 1YPFA 3V35A 2VZVA 4AD2A 4LVDA 4LWWA 4Q8OA 3UPMA 3G1HA 3DGRA 4D6JA 3MCOA 3AJXA 3L4YA 2CKRA 1LRNA 3BGJA 2Z6IA 4DZ5A 2H3DA 3GM8A 3IUIA 3EDDA 3NVTA 4FXSA 3NTYA 3PPFA 3SAZA 1KD0A 1KFCA 1S3TC 3EX1A 5D2WA 2ZZ3A 3V1PA 3KVKA 3IRSA 1CDGA 4D71A 1AJ2A 3BSHA 2XFRA 3GIQA 3CT2A 3PP7A 3CC1A 1QW9A 4X22A 1LBMA 2E8ZA 1VEMA 1SMDA 3WQPA 4P7LA 1F3TA 4S3JA 4C5ZA 5JU6A 3SGUA 4PULA 1G4TA 5CSRA 3UCDA 3SRFA 1A47A 3AXMA 3QFWA 2DUAA 1M7JA 1XBYA 5D4YA 5TIMA 4AZIA 3LXCA 4GZEA 1E43A 3URNA 1V6XA 3CEUA 1IEWA 3LOTA 7PTDA 1DVJA 3G22A 2D24A 1DEDA 3PTKA 1AJ0A 3E6EA 4L9ZA 2C19A 3M0HA 3GC4A 1K7XA 1J01A 3V0UA 4XAZA 3UR8A 1K70A 1NY1A 3TWAA 3EDFA 1ITUA 1SGJA 1PB0A 4LANA 2JEQA 4XUGA 3WF1A 1O1ZA 2GPTA 4J2PA 1E1CA 1S38A 1ADSA 3CUJA 1GPWA 2DSUA 2OGJA 1P43A 3ZT5A 4TV6A 3HG4A 4BI6A 3T44A 5BXRA 4NT0A 3KOZA 1IIHA 1X8FA 2OKOA 1UMLA 2YCEA 4NRRA 1ZU8A 1OK4A 3OG2A 5DY3A 1EBGA 4DPPA 3CB8A 3MI3A 1BWLA 3CGTA 2AOSA 1B4EA 2CCRA 1MI3A 3WCZA 3NXLA 3GFXA 2Y5EA 2V8ZA 4M7TA 5C54A 5G2HA 2VWTA 3QMTA 2VP8A 4GI8A 3M0YA 3KP1A 3K8LA 3W26A 3MT1A 1KRBC 4ILSA 3AI0A 1HKIA 4B3KA 4POCA 3PZIA 4M19A 3LZ5A 4Z42C 1OD8A 3CQIA 4PSRA 3QY8A 3O15A 1BLIA 1WKEA 4WJ8A 4N0RA 3VD7A 1EC8A 3ZWSA 3BW4A 1D3HA 1ZJHA 2ACSA 3P0XA 4XO6A 1I60A 4KRTA 3M0KA 4KCUA 1MO0A 2ASHA 2W62A 4HJWA 4TR9A 1X1ZA 2Z26A 4JIPA 5FSDC 3ITCA 3LBMA 3P93A 1I6NA 3VINA 5FJJA 1MXDA 1F73A 4JEQA 3T1GA 1P48A 3G0UA 4ZVJA 4DHGA 4A8IA 3C0JA 5T26A 3TZFA 3PULA 2QIWA 4KRUA 3ABZA 3E96A 5LNSA 3T2PA 3FX4A 9XIAA 3W2KA 4EXAA 1V0KA 3N25A 4LUSB 3IIPA 4XKYB 7TIMA 4QG9A 3LLXA 3NQAA 2YIHA 2JGYA 3VGEA 3TSDA 3LEPA 1YPXA 5HINA 3E5PA 3GC5A 4LY4A 5JXQA 3SRHA 4JQ3A 3OODA 4H8NA 4QFUA 3VZXA 4X0VA 4ASTA 3F5LA 4F40A 3L2MA 1CI1A 4Q7NA 4EAMA 1KQYA 5CC6A 4NZ1A 4CCEA 1TREA 1JG9A 5AHMA 3F7JA 3KCOA 3NGFA 2FTYA 2YL6A 4LBUA 3QQWA 3CIXA 4ERGA 3PZGA 1SFSA 1EP3A 4PMYA 4HU3A 2NQ9A 4KWOA 3DUGA 3OBEA 4A2SA 3WQOA 5E0KA 4RW5A 1CBGA 1UR0A 2Z1BA 2ZZ6A 3W73A 3HG2A 1XLMA 3O6AA 3W7IA 4LF2A 3LTYA 1HXJA 3B9DA 3TYUA 2Y24A 3DKLA 2JGQA 4CNNA 2YL5A 1TB3A 3B8SA 3H2EA 1KFWA 5CSYA 1V3KA 4RW3A 4PH6A 4MKVA 1R3YA 3W9ZA 1O7AA 3T4CA 5CG7A 2DZXA 2QKFA 4C6NA 3WLPA 3NQ8A 1PSCA 1DJWA 3TN5A 3B9EA 2HZGA 3N3MA 3UR5A 2HJPA 1ZSXA 5A6LA 2NX3A 2Z1SA 4QSHA 3SURA 3AAMA 4M1BA 3KFTA 1VIWA 3B8UA 4J35A 2QDHA 4CEUC 3E0LA 2DUZA 4GI9A 3VKDA 1FOBA 3CHCA 1UOKA 2E9BA 3WFZA 2ZCGA 2DT1A 1XYMA 2VGGA 4ATLA 3NQEA 2RAGA 3MV01 1HT6A 2E67A 3FA3A 4JTLA 3N4FA 4J4KA 3QGAC 4GVIA 4S3BA 1GEQA 3UZJA 1LORA 3QC0A 2WB5A 2QUTA 4UFMA 5ECUA 3KX6A 3QN3A 1SVDA 2W0UA 1B3WA 1E72M 1M53A 4FX6M 1AA1B 4NNBA 5ABTA 1UROA 1XH1A 4IH3A 4HA4A 2WLYA 3OW1A 4FO4A 4TX8A 4W8AA 2QVHA 3N17A 4BK9A 1EXPA 1GZJA 1PHWA 4PE8A 3E0VA 2NQZA 2FPTA 3MANA 3M44A 1UR2A 1T8QA 2BZNA 3RGTA 4RL3A 3LCIA 3OU8A 1XLIA 1OY0A 2B4GA 1TELA 4DO6A 3NL3A 2PAJA 1SM9A 4C1KA 4YYCA 6ALDA 1I1WA 3FAXA 3CIVA 3ABQA 4AUBA 3C2FA 3UU0A 1RBOB 4REQB 4EXBA 4RJEA 3NPVA 2WKJA 2PC8A 4YTQA 2EF9A 5EL1A 5A8MA 1TE1A 2CLHA 2VEPA 3QHMA 2YYUA 5IDIA 5C2XA 3CQKA 1PKLA 2NV1A 3HGJA 5CZ0A 3UY7A 1Q6OA 2D69A 2WNQA 3PZOA 1H1ZA 1JZ7A 5E0CA 2BY2A 1NQ6A 3EDJA 1XH0A 3FJNA 1KB3A 4G5DA 4QLKA 3PJUA 1C9WA 2GQAA 4X9SA 3GR7A 2ZXAA 3S4TA 3M16A 1H7XA 1VBHA 1TUFA 3WNNA 4A3YA 2PU0A 1E4LA 3LSCA 4JTHA 1AODA 3LBOA 4B5WA 1DWGM 2ESCA 2XZ9A 4LPCA 1G7UA 2EPLX 3CV2A 1DPMA 1QATA 4AVOA 3IIOA 4WR3A 1MSSA 4HMEA 4Q4KA 1E3ZA 5M2FX 1MW1A 1W5PA 4JTQA 1R2RA 4LTSA 3I6RA 5F2MA 3SUTA 2EBNA 3RX2A 1YBQA 2BVTA 1WDPA 2FZMA 1MVYA 4GQRA 4DXXA 4GGBA 3LCHA 2PSNA 1KFLA 5JMUA 3IUDA 3U7VA 4EPBC 3OZMA 3PBUA 1VFUA 4GX9A 1EFZA 2YR1A 3B05A 4MWAA 4NZ5A 4PB4A 2A7RA 3LENA 3OP2A 2BGQA 2Z00A 3FVMA 1BAGA 1FWGC 3M0JA 4ATWA 3APYA 4N2YA 3W1AA 3VX1A 1M65A 3TCEA 1EEXA 4QRNA 2RDTA 1EDGA 1OCJA 2E6DA 2F61A 3UZ5A 3WQ5A 3VOIA 1TYGA 3OA5A 4TVUA 5BRPA 4L1WA 3IS4A 1QMLA 3T9PA 2PGRA 5F4SA 2QCNA 2ZUNA 3W82A 1I9CB 2WQDA 1V6VA 4NQ1A 1LL4A 3KVJA 4FB7A 3G6MA 1Z89A 2A79A 1FDJA 4NASA 4UCFA 2GSEA 1TV8A 1TWDA 3IV8A 5AY7A 5C9ZA 2AMXA 4FNPA 3AOFA 4I8YA 1XWYA 4DJFC 3BLDA 1I45A 3D46A 1QNOA 3GAYA 4C6DA 4QE1A 3UA3A 2VC9A 3PBMA 4M1RA 5KZDA 3STEA 4AD1A 3VC6A 2OLSA 4HHPA 3UQNA 3EEGA 4LC6A 2JQXA 5CXPA 3NZRA 4JNMA 1I0DA 4YMZA 3DBNA 3F4NA 3R7MA 3SCRA 3U57A 2VFHA 5JUVA 1TRDA 4GINA 3LM3A 4RPPA 5XINA 3THUA 5C7VA 4NKCA 1XUUA 2WC4A 4XZLX 4JFWA 4NJGA 4EP8C 2RJGA 3PZNA 1M04A 4O17A 1WE5A 3MU7A 5I06A 1DWJM 4JX4A 2ISFA 5CC5A 3WJZA 1EEPA 3WBYA 5LGXA 2HVMA 2QZRA 2HVOA 5D9OA 4YL2A 2ZKMX 2O9PA 3PVFA 3AMCA 4YHGA 4NNAA 2WAGA 5G1MA 4MIMA 4YWIA 1JI1A 3BLLA 3R1ZA 3UPBA 3CTLA 2EPMX 1CCWB 3R5EA 1EA9C 4FIRA 3DHUA 4EK7A 1FHLA 1Y5WA 2EQDA 4AWTA 1B9BA 1W3KA 2WXDM 1W5OA 1S39A 4LRSA 3IVTA 1NEYA 2YA2A 1UASA 3LZ3A 4IICA 4YN5A 1L6GA 4F4RA 3SY5A 1ZHAA 3NL2A 2X2YA 1ALDA 3AC0A 3C8NA 3RDKA 5KZMA 2XWEA 3BQ6A 3VO0A 4ECLA 1M5WA 1LG1A 4OGZA 4X3ZA 1BWVA 3V4BA 1VQTA 3MP3A 1J10A 5A6BD 1Z48A 3BAXA 4E38A 4IMGA 4PCTA 4ZO9A 1E70M 4EF9A 1NAL1 1H7WA 2OELA 4FF7A 4XB3A 3S3GA 1CLKA 3C4UA 2FKPA 3FOKA 3IWPA 5E5CA 3B9OA 3VYLA 3AZTA 3QRHA 1XLCA 3E02A 1PTGA 2NT0A 1UW9A 1IHIA 4KW2A 4S3EA 3TYZA 3MSYA 1TV7A 1YXDA 1K8ZA 3Q67A 4B16A 1UHVA 1Q85A 1S2VA 3GD6A 2E25A 4YTRA 5CPMA 1VPXA 3G5EA 4JHOA 4EX4A 3DAQA 3BOXA 3UA4A 3LU2A 3SJ3A 4TMCA 3W86A 2W6RA 2BX7A 5DANA 1G4SA 3GNDA 3EA1A 2V2DA 3CZ8A 2CLOA 4NAFA 1CXLA 2WNWA 4ZB2A 2BY0A 3GU2A 1PZ2A 3VNDA 1GZ1A 2DIKA 1E15A 4FLSA 3A64A 1YLVA 2XIOA 3M0MA 1QWKA 1E56A 4EPDC 2PP0A 2NXIA 3OPSA 2AGTA 5GQBA 3BLIA 3GG0A 3POCA 1VCVA 3I65A 3W81A 1VYRA 4E2VA 4B91A 2CZDA 1BYDA 1PCKA 4XX6A 5D33A 4LOCA 1WB0A 2A3AA 3KDOA 3N29A 3MWCA 1V3HA 1SZGA 3SFKA 3WQDA 2GSHA 3GZAA 1SUXA 3VFLA 4G1NA 2OX1A 4ZQPA 3DBPA 1XV8A 4GE8A 4FMVA 3RITA 4DBSA 3LNMA 3WG6A 1OJXA 3MS8A 5FF3A 4K2SA 5FJTA 2J7GA 1TZ9A 3WNOA 1PO9A 3SBFA 4L4MA 4LUTB 1UWTA 4PMZA 1C9DA 2O4MA 5LNRA 4ICMA 4N9CA 2FHBA 4L5ZA 3V1HA 4KEMA 4Q8WA 4U28A 5FJIA 1HW6A 3F1QA 4DWSD 2V9DA 5HUOA 1YDNA 4KPLA 2BB0A 4IPPA 3EWUA 4U3CA 4AWUA 3H23A 3H2AA 1ITXA 4PCSA 1TKKA 2HXUA 1QDSA 5BRQA 4KEZA 5KMYA 4HNOA 1JFXA 3L4WA 4A2RA 1RCOB 3OVRA 5T8GA 3OGSA 5LSMA 2XWDA 1MUCA 4Z17A 3RLUA 1D7FA 3EDEA 3RM4A 3USBA 4BI5A 2WBKA 1FCQA 3S5NA 3PR2A 3OTRA 1IEQA 3AMLA 2D2HA 3W7NA 1X1OA 3VKJA 3TSBA 3LTPA 1SQ7A 3TYEA 4BQ2A 4ZA0A 1D3GA 4KIRA 3VIHA 3A9BA 3TTOA 4YIWA 3BCJA 4LCQA 3R79A 3S1VA 1E6NA 3TIMA 3NQGA 4PBEA 3F5KA 4WJXA 1XLHA 4A05A 1WKFA 1LP6A 2CHNA 2OSXA 2DQWA 4MZ8A 1XFBA 3L4XA 4PUWA 5J5DA 3RPMA 4AIBA 3PUEA 1NARA 4D8ZA 1RP8A 5CKSA 3H2NA 3M5YA 3AHVA 5LHFA 3U2CA 3CHDA 3H4GA 3BURA 3OBKA 1LRQA 4PTVA 2GOKA 5K4XA 1R47A 3ITTA 2NQJA 1JR1A 2YYTA 1FWDC 3MKKA 4HK5A 3TLLA 3KCLA 4JTSA 3DFNA 2XYLA 1Q6DA 4UQCA 3T2QA 4CCDA 4DJDA 4N9EA 3ZR4A 3R8HA 3LCGA 3RYSA 1M7PA 2VFIA 2XN1A 1M9HA 3C6CA 3MVIA 3VDCA 1N8WA 1US0A 2GJXA 3W84A 1DL3A 3LMZA 4GBUA 1LOLA 5HQEA 4E8GA 1L8NA 3HTWA 1P6WA 2GVEA 4GD0A 5A1AA 1JUEA 2AQWA 5C5YA 3VU2A 3TTSA 1JQXA 1OX6A 1QHPA 3AIQA 3LCFA 2F84A 3L0GA 2VI0A 5T9CE 2IKIA 4U5IA 4H8HA 4KEVA 3WMBA 5DCEA 5M5DA 3TONA 2YXGA 4KWWA 4R85A 4FALA 1XKJA 4PMOA 1LJYA 1EB3A 4FAMA 3A4JA 4MDPA 1O5XA 3AU6A 2TODA 5GNXA 3QEZA 1KFBA 4JQAA 4D1JA 4IPNB 1OFRA 3G3DA 1FH8A 5KEZA 2ZYFA 1RALA 4O54A 3VILA 1J0ZA 1RY8A 1JF6A 2W5FA 3CUIA 3KOYA 1W1PA 4F2UA 5AYZA 2YJQA 3W38A 3BLKA 4UMAA 1RLCL 2DSWA 2X40A 3FLUA 4GABA 3AIRA 2X1RA 5LA1A 3PWAA 1CWYA 3NQMA 1Q45A 3G1AA 2Y4SA 1YTEA 3QVQA 3PPCA 3CAVA 3NQVA 1ISYA 1XGDA 3TZNA 3W07A 3GXPA 4GJ1A 3T81A 1BRLA 2BGNE 2VX7A 4HNNA 4J5NA 1FTXA 4IP5A 3RMEA 1LWHA 3GNPA 3GHRA 2XIIA 2ZZ1A 3HO8A 4D9PA 4MSSA 1WAUA 5PTDA 2UY3A 2C79A 1IXNA 3KRSA 2OT0A 4DNHA 1UJQA 1R30A 3CUGA 2QAPA 2ZRVA 5DN1A 1GHRA 1W3NA 2PZNA 3TJ4A 4YHEA 4GUFA 1L6FA 5JH2A 3GBEA 4O1AA 3FYOA 2Z29A 4QGCA 4ZE5A 4XKYA 2G4FA 4JIEA 3BGAA 3T42A 1NP0A 1US2A 1Y0EA 1YE4A 3WQEA 5A3HA 1U33A 3WF4A 2PE4A 2NVDA 4JTDA 2D0GA 1E4MM 2QJJA 3WLSA 3W53A 4QAWA 4O8RA 3IJLA 2VZSA 3B40A 4LX4A 4MB3A 3XISA 2PA6A 4U10A 3PUDA 3QPYA 3UF9A 5CPSA 4A29A 2ZDSA 3MKCA 4MM1A 4XD4A 1JXKA 2V5DA 4JFTA 4H9XA 4L80A 4H00A 1QK2A 4NYUA 3RRXA 2YA1A 1HJWA 3CHVA 2OOFA 2Y7EA 3T8LA 5DELA 3Q37A 1CZ1A 3SCVA 2GGGA 3HPAA 3ISIX 1EL3A 4HHLA 3TYAA 2XH4A 2E09A 1AFSA 1OC5A 2VCAA 4X0NA 1M7XA 3RIKA 4NJKA 2P10A 1AH0A 2X1IA 4GXMA 2J27A 4XO7A 1KXVA 3U5YA 1VFSA 9CGTA 4S23A 2UWFA 5JH1A 1HKJA 1MDLA 2AQVA 4Q8UA 2NVCA 3C5QA 5AHEA 1FXQA 1JRCA 4QR6A 3W0KA 3MTWA 4Z1DA 3MHUA 1H5VA 3LN3A 4XSMA 2F6UA 4PEKA 4WUIA 2JK2A 1KWGA 1XYFA 3CL6A 3INPA 3E49A 4P61A 2OZ0A 3ABRA 1NWTA 3H4WA 2O4QA 4XV0A 3WF3A 3GDRA 2WSRA 4IL2A 2Y1HA 3A3XA 4PUJA 4D6FA 3IIVA 4GVGA 3HF3A 3HN3A 1X39A 3UZYA 2P88A 1R7AA 3E9AA 4UTLA 3XIMA 4MWAC 4B90A 2E6AA 3KOXA 1KV8A 2Y5JA 1O94A 2WHLA 2G3MA 2BVYA 4ROQA 4P8VA 3WKZA 1JL8A 4ICCX 1TR9A 4Q33A 4ACZB 3VNLA 1R85A 5IBXA 2FFCA 2P76A 1NTHA 4R5EA 1EF2A 4MWAE 4MVAA 1V3IA 1EWDA 3L7RA 4K8HA 2PTXA 1XRTA 2PU1A 4C6CA 3WLRA 2PGWA 3WLTA 2UZ9A 3AS1A 5FF2A 1QNQA 1NF0A 4KESA 2WMFA 1UD4A 2Y89A 3DN5A 3KRBA 1OFEA 3W7EA 4LCSA 3MSGA 2D20A 4YVPA 4W5ZA 4JTEA 1J0YA 2DEPA 1GQIA 2RGMA 1KM3A 3MMUA 3WUFA 1E0TA 1GOWA 2ATMA 1LBLA 3F03K 3AYRA 3SN4A 1FCUA 1PL9A 1GVIA 4NZ4A 6XIMA 4KF1A 1QI4A 5DBUA 4AW7A 3VUSA 4N02A 2PURA 5CH9A 1XW8A 1G4PA 4XVDA 3MP5A 1XIBA 2QIIA 4MDOA 3G1YA 1P7TB 3LK6A 4PUMA 2OEJA 5IRPA 1D7KA 3P8IA 4H6RA 1IE7C 1W1B1 3VNKA 4K8EA 3U4AA 3A4AA 4B5VA 2DV0A 3VD9A 2CETA 4WXYA 4A3HA 1XC6A 2RH9A 3N6QA 2Q3RA 2ZRWA 5CLWA 4EF8A 1ZJBA 3M5XA 2V30A 4HU0A 1S5VA 2J47A 3AYTA 3ABOA 5K9XA 4TO8A 3R0KA 5FF0A 3P80A 3EEZA 2A3EA 1Z6KA 1RQBA 3PWGA 3QHNA 2DJLA 3LX9A 1KM1A 3TH6A 3T0CA 4S2BA 1QFEA 2G97A 5DLCA 1EP1A 3M9YA 2YLLA 4QNWA 4K1GA 1ONXA 3BICA 3GFYA 3IGSA 3WQVA 1QU4A 4IGHA 3UCCA 4F9JA 1OABA 2R24A 1NOUA 3ECQA 3C2EA 4G6CA 1SYTA 2BASA 2HMCA 1VLWA 4MZ1A 3GZ3A 1N82A 3TJLA 2WK2A 1H1NA 4JIIX 1J96A 3RFAA 3PNUA 2A3BA 4PMVA 4S3DA 3GW0A 4ZTXA 4Z2HA 3BOLA 2FPYA 2C7FA 1LLWA 3U3HA 5IFPA 1V51A 4IX0A 1E0XA 2Y5SA 3E2RA 1JDDA 1Q65A 4K6AA 1KQZA 1QPKA 3BCFA 3ZLFA 2P50A 4M81A 4GACA 3UD6A 1CGVA 3IGUA 4WZHA 1FWWA 1K6AA 3CLWA 3BK0A 4M6PA 1QOPA 1AW2A 5BYWA 2EG6A 1KBIA 1K9EA 1E6XM 2YW3A 4RE3A 2W3ZA 3MUAA 2I56A 1H0IA 3KS5A 1S5WA 5U4NA 3AWNA 1BXNA 1EZ2A 3EXSA 3DERA 4EKJA 4IMDA 1J79A 2O92A 2YL9A 5D8ZA 2H3BA 5GJMA 3UR7A 1K7FA 3MZ2A 3ITYA 2BHZA 2AGKA 4NAEB 4CU6A 4F2BA 1EHAA 4RZBA 3VOCA 1ZAIA 4ZL1A 4UZSA 1UR3M 2WM1A 4GZJA 3E2SA 2Q01A 3VNIA 4N6EA 1P0BA 4H01A 3TDFA 4JFSA 4HNTA 1XLBA 4XK2A 3WEMA 4FR6A 3RLGA 3LRMA 1XYCA 1XUZA 1S2CA 1V02A 2TAAA 1PYMA 1U5JA 1VEPA 3LG3A 4H8UA 3BLOA 3SCOA 5HMSA 3CMFA 4GUHA 4IGNA 1MUWA 5CAKA 3HJEA 1ZP4A 1XKYA 3FSUA 3B97A 1T0OA 2G8ZA 4DF2A 3EMZA 1AZ2A 1H5YA 2VFDA 3N9RA 3VAVA 2QMKA 3C2OA 2OEMA 3MV11 5BXPA 2FHCA 1J5SA 1TIMA 1NOWA 3IJIA 4RNHA 4TOQA 4YTUA 1GKQA 1ZP3A 3DXIA 4AZ7A 5HK4A 3WQGA 3FYPA 1KM6A 3UNDA 1JCXA 4A3UA 2RUSA 3BJFA 2DQXA 5HANA 2FH8A 2QJHA 5DMNA 1RR2A 2D0HA 2ZBTA 4MPKA 1BYBA 3NVDA 1YNYA 4IQEA 1W1IE 4M24A 4PODA 2C18A 3VNYA 4NIRA 1OFDA 4UWMA 3NCOA 4DUWA 3LCLA 2VWSA 5C9UA 1WKYA 4J3ZA 2INZA 1Z42A 3W7MA 3TFXA 2P0IA 3F4WA 3AWOA 3BJTA 4O16A 3FEMA 4M82A 3WZ0E 5FEWA 3VM7A 1XYLA 4G9PA 4B3LA 3ARXA 3ZFHA 5K7JA 2LLEA 2NSOA 3O7UA 3V0SA 3TQKA 5C71A 5HWJA 1RK5A 4UFLA 4I7WA 4HOWA 4GYPA 2XH0A 1Q3NA 3E2QA 3CWHA 1ZGDA 1K03A 4GC4A 4JQ4A 2EG7A 3QXBA 3EBVA 3AU2A 4U2YA 2X1SA 1P0KA 3IK2A 3L5MA 6TAAA 1NDZA 4FLOA 4QJ1A 3N15A 2FZNA 1GKRA 1AH3A 3C2RA 4C6MA 3IVSA 1CXKA 4ZFMA 3QQ0A 1LOQA 3QPZA 3WDRA 1KGUA 4NI3A 3UJEA 3CZJA 1B0IA 2Z1VA 4B9ZA 4NG3A 3S0CA 4AY7A 4Y9AA 1NDYA 2J6XA 3ZS4A 2PDYA 3SGGA 4AH7A 1TPVA 1X7IA 2XH2A 3R89A 2YPIA 4TV5A 5A8OA 1R3WA 3D0CA 4XVEA 1AW1A 3RMJA 2PDIA 1F4AA 2PRHA 4DJDC 4WCJA 3CYVA 2EO7A 1VBJA 1RZMA 2BXZA 3W7GA 5TNVA 3I6EA 1XGZA 1R2TA 5HNNA 2YZ5A 4AB4A 4PFHA 3SCUA 3DOPA 4UNKA 4JYDA 2HTMA 3HG5A 3SEPA 1T6MA 1DJHA 3IEBA 3W28A 2Z25A 1A0DA 2CZFA 3W6MA 4AIOA 4U4MA 1UQYA 1FWFC 4UFJA 1OVDA 3P74A 2IS7A 1DXEA 2HS8A 4YTTA 3NXFA 2PTYA 1MXGA 4DB7A 4PUEA 1POKA 3Q4DA 1XISA 3GNRA 3V5CA 2FYMA 4LBSA 3LI1A 3TQVA 1NF7A 3WQ8A 3NQDA 1Q6EA 5BWFA 1Z8AA 3RM9A 4J3UA 4Y2WA 3CH9A 4IM4A 4OT7A 3WDIA 1AD4A 3E3HA 4NYYA 2CWXA 3W23A 1OC6A 4LUTA 1KRMA 4MKSA 4D6GA 3RAOA 1EQPA 2J75A 1CB7B 1GORA 1P4CA 1IEIA 5DY2A 4LCRA 4DYJA 1FWCC 2J13A 5EPDA 3W7JA 2XGIA 2ZZ5A 3GYCA 1WZMA 3EB4A 2XGZA 1MRAA 2Z1XA 1Q66A 1X97A 1VENA 3B0XA 3MUY1 3BSGA 1RHCA 1HFBA 4NZCA 3W1LA 1QNSA 1ZJAA 5CCZA 3VC5A 1A5MC 5EMLA 3UGVA 4JTCA 3WD1A 1AH4A 4Q32A 4MZYA 4UTIA 1YDYA 1TTIA 1KW1A 4AAJA 3Q65A 4YXGA 2HNEA 4ZEPA 3G8EA 2CITA 2BDQA 4GI6A 1KFEA 1HL9A 4DZAA 3W37A 3W3OA 3R12A 2J9YA 4AF0B 1TG7A 1KBLA 1K8YA 2A0NA 1P6CA 1RJQA 4UCGA 1OFBA 4Q8QA 1KA9F 1SJAA 4KIEA 3AJ7A 2F9RA 1A50A 1CW2A 3W7DA 1T5AA 5HULA 4CQ8A 3GXDA 4WGHA 4FNQA 4P2VA 4OTKA 1W1VA 2ZXQA 1A53A 4XZWA 2UBPC 1EPVA 2B7OA 3AHTA 2ZA1A 5LNWA 1JDFA 2V38A 5HNUA 2G37A 2VENA 2E9LA 3I10A 2Z1WA 4J3VA 1JVNA 1REQB 4CQAA 1X6LA 1YMYA 3OEXA 4OECA 2ZUMA 1N8FA 1BPLB 2GVJA 3URBA 2WSKA 3LERA 3WLJA 5CGQA 3E0WA 3BARA 5G4EA 4A3RA 4FOUA 3W7LA 3FCPA 4DM2A 2GGJA 5A94A 2QPSA 1SFTA 2C8NA 1KR0A 4ZQNA 2VD8A 1H09A 2DZTA 4UR9A 1YYAA 1G9HA 4R7JA 1W5QA 4PRWA 3ES8A 5CJ5A 4NJIA 2W66A 1EUNA 3WH9A 3V75A 5TBOA 1Q63A 1TV3A 2VCBA 4MJMA 4X2PA 4H19A 2VDGA 3SADA 3REQB 1QTWA 1JZ3A 4UTTA 1W1YA 5FESA 4HCHA 1QHOA 1UC4A 3EOUA 2C16A 2D2JA 3VPLA 4JTGA 1XL9A 3EB2A 1V0MA 1OIMA 2A21A 4PMJA 5SWUA 2VX6A 1H11A 1VKFA 1GONA 5C9XA 2FZBA 4Q7BA 1WDSA 3BG3A 2Z2AA 4ML4A 4IIHA 1WNOA 1F74A 5IBXC 4PA8A 1FX6A 4J3WA 1OK6A 4C6OA 2XSXA 3M7SA 2NQHA 1Q5MA 1L6YA 1RUSA 3Q94A 3ZJKA 1XDMA 4J9JA 4AZCA 1PEZA 2QV5A 3S2LA 4L6DA 5A8GA 3MCMA 2V2HA 4S3CA 3C0SA 2VRKA 5GNZA 4ERIA 3HQ1A 2DZVA 4UMBA 2VZUA 4IP4A 1F3XA 2YDAA 2KAUC 2PDXA 3NZGA 4O12A 4CD7A 4IQJA 4O19A 4UQDA 2R9RA 1VFMA 2GQ9A 2WMHA 4KMQA 4WXZA 4E0CA 2QCEA 1ZAHA 1VJIA 2Y61A 2VD9A 3VCCA 3WLHA 3FK4A 1OX5A 4ZOEA 2YB1A 2Z24A 5GJPA 4GY1A 5TD4A 3NG3A 1J2BA 2V3DA 3PZVA 1GVEA 3AXIA 2QXWA 3QY7A 2YA0A 2EJAA 4HZ8A 4P7RA 7REQB 3JU2A 3OA3A 1UWAA 1F6KA 1NH6A 3K8MA 3MKVA 2WSQA 4L64A 3VKAA 3AUJA 2VCCA 1S1PA 5HJXA 2TSYA 4V27A 1KC7A 4UOZA 2GK1B 2EEXA 4I7UA 4GIEA 4Q4SA 2DZWA 5MKGB 4JTKA 4FS9A 1K8CA 3WFLA 5I3FA 3R6IA 4FP1A 3GXNA 4LYRA 3PZTA 1W3LA 1A5BA 1SZNA 1TX2A 2ZWZA 5G2WA 4P8UA 4JFVA 5EMKA 1DJYA 3NEHA 1I2RA 3NPXA 3OG3A 3L65A 3LA4A 3W76A 4DUXA 2CLKA 1KM4A 4AZ5A 1QOXA 4PYSA 4MY9A 3UYCA 4AD3A 4GUGA 1W3IA 2EG8A 1KFKA 4HN8A 2PDMA 2VRJA 4OVXA 4PCFA 4QCFA 3RN6A 4GCXA 4Y9OA 3THDA 1HQTA 1K9TA 4I7VA 1KWKA 4MB5A 3N04A 3UNTA 4QQUA 5IM51 1KGXA 3EOLA 4UUIA 1H61A 2VX4A 3LPPA 3P14A 5JIPA 3GKAA 3EA2A 3CQHA 1UH4A 4NZFA 4O50A 1FWBC 2C91A 1E9YB 3UJRA 4GPNA 4CVWA 3SO7A 4G56A 1GQNA 1A5LC 2GJRA 3AYVA 5B7ZA 3SSJA 3GXIA 5I24A 3H55A 3CHEA 3JZUA 3MCNA 4BS0A 2PDNA 4ACZA 3SCTA 1M7OA 5JBDA 4UTFA 1VFOA 1DQWA 4ZCWA 5BU6A 4H7VA 4CQBA 4N4QA 1FKWA 2ZVIA 2E9MA 4TTGA 4GNJA 3SQMA 4V2XA 2PWUA 1DTNA 2C1HA 3TK7A 3BE7A 3LPFA 5D32A 4D6CA 2DVUA 1AVAA 4RX0A 4XBKA 5C55A 3KEHA 3ZXWA 3IARA 1FQ0A 4ZO6A 5ABHA 2QPUA 3W1MA 1DXFA 3U7BA 3SN1A 1FWJC 3H2MA 3ANVA 3DC0A 3NZPA 1Q6QA 2RHGA 2FZ8A 4IZGA 3KWSA 3JW7A 1DWAM 3R94A 3WMCA 4E8CA 3HQNA 3S2NA 1WOAA 4QIUA 1UD5A 1QW8A 1SW3A 4BEQA 2HEJA 1OX4B 4MLJA 2QF7A 2UY4A 4PMRA 2CEQA 1X1NA 3W1UA 2GJPA 1VFFA 3CT7A 2Z6JA 3MWAA 1JGMA 4MG4A 1JYWA 1P7TA 3CAWA 4XBJA 1O95A 4XZIA 2CIPA 4O1DA 3O2LA 4DXKA 3PSWA 3WL1A 3IAQA 1TA3B 3T0BA 5T9BG 2Z1KA 3EWWA 2ZTJA 4PZVA 2CC0A 1H2JA 3A13A 2R94A 2V81A 5LXXA 1SU5A 5C9RA 2NWRA 4ZGYA 1V02E 4C6EA 2PDFA 3SM0A 2VT0A 4HHMA 3W85A 1BXBA 1Z9AA 1KBBA 2FTWA 4GGHA 4O0QA 3WSUA 5M1TA 3QLDA 4E2OA 1S1RA 4C60A 3NQ2A 2C1IA 4CNPA 2PF8A 3APGA 3MVTA 1PDZA 1H3GA 4WY0B 2VRQA 4GISA 3W1QA 4ONVA 3SCNA 4ZXOA 2VM8A 1C90A 4LYQA 3KLKA 2X05A 4IFKA 2XPKA 3VI2A 3BOFA 1A5AA 1ONRA 3QY6A 4GHRA 3G1FA 3APTA 3L4VA 4Z1BA 5HMFA 2P8CA 2DSKA 1R5YA 5LIXX 2NT1A 5KETA 2V5LA 4PB3A 3NAVA 3BG9A 2XVPA 1C93A 4Y8FA 3HA1A 1F8IA 4UNIA 3GG1A 2DH3A 2QS8A 4PTDA 5FL0A 5G2IA 2CLEA 2Z7GA 3WEOA 4GH1A 4GYPC 5BW6A 4XUYA 4KCTA 4RDYA 1UKSA 1XIJA 3WK0A 4V28A 1RQEA 4DAIA 3C0LA 3GKFA 1XIHA 3LB0A 1IYXA 4S39A 1WQ5A 2D3LA 2VC7A 2IXUA 2WMGA 1VS1A 2V0TA 2YW4A 3M4HA 3BLFA 4I90A 4RE4A 1NIUA 4Y8EA 3IPWA 4C90A 5A6MA 4OOZA 3GLCA 3L23A 1LL6A 2DSZA 1NWRA 3VDGA 1WBJA 3GVGA 1BF2A 2WVVB 3UT0A 2F2HA 3BUVA 3VM5A 5TF0A 3O6YX 4IGSA 4H9YA 3TR9A 1XC4A 5LHEA 4YCPA 1DOSA 3HMCA 3HIJA 1SW7A 5I78A 1HX0A 4BKNA 3NOEA 3TC7A 3UR2A 3OO2A 2YCLB 3GH7A 4GYFA 4H9UA 4HN4A 3TROA 3QKZA 1Q8JA 4P8WA 4P7OA 4XTDA 3IV3A 1U1HA 5FACA 3CZKA 4AIEA 2F7FA 4NZ3A 1WA3A 3VGDA 3QOKA 1MUMA 2VC6A 1FWHC 3CASA 1V3JA 1IR2A 3WQFA 1Q8AA 1O5RA 3DFQA 1Q4NX 4EOUA 1VLIA 2HQAA 5EMUA 4C7GA 1NVMA 2XM2A 2X0SA 3NDZA 3G1RA 1ODZA 1O4UA 2Q3OA 4HPNA 5AZ0A 2JF6A 4XQ6A 1FHUA 2A6LA 1ISXA 1I4NA 4R9XA 3GTNA 4JKLA 2QCGA 3KVMA 3E0IA 5LGZA 2DIJA 3PZMA 4JGDA 4B92A 2GQ8A 2OXNA 2XVNA 3FEQA 2ZRYA 4JPGA 1YNQA 1XD1A 2NLIA 2DW6A 1GG1A 3WLQA 4GCAA 4AIUA 4JCMA 3M5VA 4HBKA 3CWOX 5E0FA 3ES7A 3ZM8A 4LAUA 5DXXA 2DU2A 2X1TA 3PM6A 5A2BA 1BKSA 1XDJA 4JN6A 5K4ZA 2WPGA 3HFYA 2OSWA 3T05A 4AEOA 3NM3A 1QWGA 1WX0A 4LAKA 1PV8A 3RX3A 3R25A 3G1SA 4F0SA 4RE0A 3GC2A 1EJRC 3ZIZA 4S3FA 5FIPA 2YBUA 1X6NA 5CPNA 1GOKA 1CXFA 1E0VA 3MHGA 3M0LA 4FLQA 2J25A 4BWLC 1XS2A 3AICA 2X7WA 1DE6A 4HYWA 2GGHA 4JEJA 3P81A 1X38A 1WDQA 1TWIA 2F6XA 3C86A 4AVNA 3TMLA 1TJPA 5A8PA 5I3JA 2YB4A 3ALGA 5T91A 2VGBA 3GYEA 1JYNA 3U2ZA 4LAMA 4LVGA 3WJWA 4HT3A 3EWYA 1TQXA 3QV7A 2HPIA 3TEVA 3ZJ7A 2AL2B 4H6QA 1XPYA 1EGVA 2G41A 1JCJA 3BWWA 5H91A 1FRBA 1SSDA 4NJHA 4S2CA 3W7OA 1U83A 4GIRA 3H2CA 2YX0A 3TCSA 1TTQA 3UJFA 1MEWA 1VBRA 5DMYA 4KFNA 1E1EA 3BGGA 3R10A 4LY8A 1KCZA 4EIVA 4M56A 1QPNA 3H54A 5ABFA 5HR7A 2ZUUA 1EJUC 3DHFA 1VAHA 1DIEA 1E6QM 1DV7A 3HM7A 1EUAA 1HJUA 4D6IA 3TOYA 4I5UA 5HAOA 1KBJA 3EX2A 4QITA 3GVQA 2ZQ0A 4B4FA 1Z3NA 1ECEA 1LDCA 2Q8LA 3EX4A 1OFPA 3VIIA 2G50A 1UP3A 4DIAA 3UVAA 3KWXA 1IXQA 1JNDA 3GVWA 4TU1A 3XINA 6REQA 1MW0A 2UY5A 3IACA 2ZZ2A 4QEHA 3P5ZA 3F4DA 2OWXA 1VH7A 3FN9A 3W01A 1E0WA 5EB8A 3MUXA 2WPBA 1W32A 3HGOA 2IQDA 4KWSA 4Y96A 1R9YA 4LXFA 4LFYA 1TVLA 2QHAA 3OZYA 4UB9A 2D2OA 2PWGA 3N19B 4F2TA 5G5IA 5D9MA 3NYDA 1JIBA 1Q13A 1C7TA 1ICSA 5AHFA 5CSUA 3BO9A 2ZA2A 3PY2A 3NFUA 4GKLA 3WY1A 4Q8TA 1L0PA 3TR2A 4E5TA 1TRIA 1THFD 4GA8A 4NX5A 3CO4A 2X2GA 5REQA 1W91A 1DWIM 3W27A 3R8RA 3NSMA 4WSHA 1L9WA 5HQLA 4DLMA 5CBJA 1IIGA 2I14A 2OOGA 3RO8A 3UZXA 5HMDA 1KLYA 2PB1A 3NL6A 3O0FA 2QCDB 3PN8A 3SIZA 4BR1A 4UQAA 1CIUA 2QUNA 1SW0A 1D8CA 4W87A 3N6JA 3PJXA 1UBPC 1W6TA 2X09A 5K3VA 5A69A 1DBTA 5L9FA 3DX5A 1B54A 1ZB5A 2ATSA 2Y7FA 2XVGA 3V16A 3ZT6A 1TPFA 2P5NA 5D2TA 2I1OA 3WLLA 4EVZA 3VK5A 3AISA 1IZCA 3H70A 1F3WA 1W9VA 1PKNA 1J6PA 3GB6A 1XLLA 3GTFA 2E6FA 3KS6A 1AL8A 3RU6A 1K77A 3UEQA 3I7RA 4JICA 3MUZ1 2C15A 3CK5A 1EBHA 2VEMA 4HMNA 4MLRA 1KLZA 3NDYA 3FHAA 3LD5A 3P2VA 3E74A 3QZ6A 5GJNA 5LIUX 2V6AA 1XLAA 3K4AA 1PWMA 2O7SA 2R82A 4QJ3B 4AZGA 3FY1A 1GHSA 1WDRA 5D30A 1WKDA 1RVKA 4U2ZA 2XHYA 4C1LA 3R0UA 3THCA 2A6NA 2PDCA 4QISA 4FOJA 4W88A 4GG9A 3SY1A 3VKBA 2WMKA 1OBAA 3NO3A 5LZLA 3DGBA 3AS3A 2Y8VA 3CPUA 2X8RA 3FA4A 1YRRA 4GI4A 4F0RA 1REQA 4N7QA 4P7QA 5CPOA 4JN8A 4AEFA 4PEEA 3A21A 3LLDA 4H3DA 4ZB5A 3S5YA 4BZYA 2FB2A 4EPKA 2OFJA 3D3FA 4WDTA 2BXYA 4UBPC 2E1WA 4G1KA 3KL5A 4L4PA 3RPTA 5FJPA 1W9PA 4JHZA 3UWVA 5I77A 3OQ8A 4YJ5A 4LEQA 3L21A 5G1TA 4GLEA 2V68A 3NNTA 2WSPA 4GOAA 3WLOA 3QYSA 4IMEA 2NXGA 3M0IA 1I2NA 1Q7QA 1K02A 4LRTA 8TIMA 1GOIA 4PUDA 3G0XA 4IJCA 3TV8A 3VA8A 1PKMA 1JDAA 1Q6RA 1QT1A 2INFA 3GAKA 4LUIA 1AZ1A 2PDLA 5EGRA 3TXVA 5BZAA 3REQA 2H9AA 4RUBA 2QMJA 4E4UA 4AG0A 3I3DA 3P62A 4B15A 5C70A 3HPZA 1F7BA 1BGAA 1NJJA 4GQGA 3LXBA 1JJKA 2OKTA 5AKQA 1HKWA 4ERAA 4IMAA 1IV8A 1Y5XA 4NVTA 5GVJA 4TVDA 4PCPA 4OOUA 5CJMA 3CU2A 5I09A 3MMWA 1BSLA 1SZEA 2Z2BA 2PTZA 2QULA 3W4RA 1QJWA 1XPGA 5LIYX 3OYXA 5LIKX 5HMEA 3D5HA 2PTDA 2XSAA 5KITA 1OFAA 2FH6A 5FKYA 3OQEA 4IUGA 4YPJA 1GVRA 1D8WA 2AKZA 4UQ9A 3JS3A 1OZMA 1EO5A 1IEXA 2DT3A 3OGVA 5G4HC 3P7YA 3M6DA 4AWSA 3UZZA 1JZ6A 2WVUA 1HGWA 2OQHA 2WWCA 1HNYA 5D2VA 1PX4A 2GDUA 3HQPA 3EPMA 3FW6A 8CGTA 1VB9A 3KHDA 4RKAA 3WLIA 2A7NA 3LQLA 3CL7A 4DELA 3FXYA 1K3UA 1L6SA 2NXHA 3N4EA 4TMBA 1EGZA 4PBGA 4QTGA 1CGXA 2GL5A 3VMPA 1BTMA 1VP5A 2CXEA 2CBJA 4R9OA 4I9MA 4DPQA 2X0HA 2X41A 4L4OA 3NO5A 2OWCA 3ZQ9A 2J66A 4PN2A 2ZE0A 1HO1A 2HVNA 2R14A 1ICPA 1BVWA 2GVLA 4HTYA 3SUSA 3TE9A 2Y88A 4XAYA 4F8XA 6TIMA 4QJ4B 3R13A 3MDWA 5B80A 1Z32X 5I7GA 4ZBCA 4JAWA 2R8WA 5A6BA 5MKGA 3TYBA 1PX8A 2A5HA 2GVYA 3B8DA 3LLFA 3W6LA 3WLMA 3D47A 3PF3A 3CAQA 2CPUA 3WUEA 3G24A 2BOGX 4O0ZA 1SFJA 5LA2A 1RLDA 2EAWA 3GNNA 1KR1A 1VRDA 3DHDA 3RJYA 3I4EA 4C6KA 3TW9A 1E9IA 4ORIA 1C3FA 4GO8A 1H51A 3GG7A 2FTPA 4PTWA 3W87A 2WNZA 3W71A 1QPOA 3U8GA 7ENLA 1E55A 4QLJA 3C61A 1UPMB 3MI6A 2OGYA 4AMAA 5AVHA 1TX0A 3KBWA 4HA1A 1KKRA 2DJXA 1RXOB 4HPXA 1KCKA 1FA2A 1E5NA 3B0VC 3IJ7A 1BVNP 2GDQA 3DG3A 3EOEA 1H63A 4GY7A 1UR1A 4RE2A 1JD7A 1XYBA 3TP4A 2REQB 3NDOA 1OEPA 2YCIX 5E9AA 1VHNA 2OQYA 3DIPA 3KZPA 4PC8A 3NPUA 3JUGA 1A0EA 4IFOA 1E6RA 2CW6A 2WANA 4GQQA 1GVYA 1VR6A 2J7EA 2V67A 1YDVA 1RSCA 1TO3A 2PD5A 3S5ZA 3UERA 3BJSA 5H8MA 1LM1A 1ZS2A 4NP7A 4B9YA 1TVPA 3OVPA 4IQDA 4CCCA 3CJPA 1QBAA 3F2CA 4B5XA 1UYQA 1US3A 1OT1A 4PCNA 3TN4A 4HU4A 3ATZA 3UJ2A 1NP2A 2XISA 4O52A 4DZIA 4HNUA 1OGSA 3DH7A 3T40A 2C14A 1OQFA 5CPQA 1AMKA 1CPUA 4JDYA 4NNCA 1OX4A 3VIOA 5D9PA 2KX9A 2ZXDA 4AY1A 3RK8A 5HWNA 4DWSA 3H7UA 2PGFA 3HURA 3RCNA 1JPHA 1JDCA 3LHZA 1IF2A 4O1FA 2R6OA 1NM9A 5C2GA 3GO2A 1X6UA 3S1UA 2H6RA 2RDXA 1KRAC 4E2DA 2WHJA 1GZGA 2WZMA 1SR0A 4WHBA 2UV8G 1QASA 4S38A 3BAWA 4CN6A 1TJRA 2VELA 1VHCA 1QXLA 3BW3A 2Y70A 4LUYA 1AMYA 3O1NA 1ZBKA 1XF0A 3B04A 3RILA 1FWNA 1BVZA 4QDPA 1UR4A 1J6OA 1ZENA 3CIWA 4WY0A 3MI2A 1B30A 3IJQA 2OYKA 4E4FA 1PIGA 2OMAA 1FKXA 3GXMA 3T0DA 2DVXA 1QUMA 3KBJA 5LNUA 1OB0A 4FNRA 5J5RA 5E70A 4DRSA 1EA0A 3AIBA 3UY8A 3EOOA 1V08A 4ZQRA 4O10A 4Q8MA 4AU0A 1QAPA 3WD0A 1H49A 5CG0A 3TN6A 6PTDA 9RUBA 4E8DA 3USZA 3NQBA 3W1PA 4LW7A 1I2OA 1F6YA 4AYGA 4QAIA 4L1GA 3H4XA 1GJWA 1EH9A 3VFCA 4B5NA 1BD0A 5XIMA 1KXHA 2VMFA 1EYWA 2IPFA 3BQ5A 4WDXA 1EJSC 2PD9A 3ELFA 4MUZA 4ZE4A 1W5MA 2NWSA 4XSLA 2ZDRA 4HNCA 2QNEA 3CMJA 3AIVA 4Q7IA 5I0DA 4MYXA 1M3UA 4J3SA 2YLAA 2E1DA 4I9JA 4OU1A 1O12A 5C0QA 2YCJA 1XQKA 5TAOA 1CLVA 3UBPC 4E6MA 3NO1A 1FFQA 1ECQA 3IGXA 3A4WA 4QHRA 4O8AA 2WVVA 1F05A 5HNTA 3B4YA 1TE6A 3BZGA 2HS6A 3I3BA 5JBFA 1RD5A 3KUMA 2G3IA 2CLLA 4IIBA 3LGGA 4PFMA 1P0EA 1Q6CA 2DPEA 4D6DA 1HP5A 5AC6A 4QNEA 3WNPA 1FWAC 4XIAA 3UWQA 2PWEA 4DI8A 1A5UA 1FY6A 1XD0A 3W88A 1VFTA 3B8TA 2FVKA 4ZQMA 1IXOA 2I57A 2J62A 4QCEA 4JX6A 5HJYA 3M5ZA 3W25A 1MW2A 1RD6A 5JBEA 3BXWA 4ZO8A 4JHMA 1V6WA 3WBWA 1PHQA 3IGHX 3PPGA 1UUMA 4DAFA 3IIXA 3ONCA 1DE5A 1XRVA 2QEZA 3SQSA 2IPWA 1E71M 1RBAA 4G2DA 3G1DA 3PBWA 1H4PA 4A22A 4PMQA 2XH7A 3LCWA 4JTUA 3S83A 1ZBWA 3MC5A 5CZKA 3S6OA 1BF6A 3NSXA 5F4WA 3GDLA 4XG1A 4XD6A 3ZYZA 1YADA 3F2DA 2OWWA 1DP0A 2J8TA 3FSTA 1H50A 4EANA 4C6LA 2C0HA 3LHTA 4AZBA 1GTEA 4OIFA 1EDQA 4IPLA 1XJBA 3WDHA 3UP8A 2J4GA 4K1WA 2BOFX 1JCNA 1JZ4A 1JCYA 2PRMA 2FIQA 3K1GA 5I3DA 4WKAA 1PBGA 2BSLA 4B2DD 1XIGA 5AN7A 1EOKA 2VUYA 3E1F1 4LBRA 1A80A 3PG8A 4ZSTA 1VPYA 2WMIB 5DCDA 2V63A 1G7VA 2ZVRA 1J2WA 4LYPA 1B3OA 5EYWA 5KZEA 3MSRA 2F8QA 4W9TA 2PRLA 1XH2A 4PTXA 1YW1A 1TMLA 2IKGA 3GUGA 1KTBA 4JKKA 3W2UA 3M41A 3A23A 3QSTA 2GZXA 1XX1A 2P0OA 4RZ6A 1YBQB 1S46A 2TYSA 2CLFA 3EYPA 2A3LA 3VXGA 1V0NA 1W9DM 1PIIA 2H8ZA 4MWAB 3SI9A 1HKKA 1Y5VA 4IF2A 4V1XA 1BGGA 1RJRA 4DUOA 1HJQA 4FXJA 3H26A 3OGRA 4QBXA 3VZZA 5F2LA 5FOOA 2WJEA 2QJMA 3B9NA 4IT1A 7ODCA 3GDBA 4QS6A 3L4UA 3UWYA 2RFGA 5AECA 1EC7A 1J11A 1QNRA 1F76A 2Y8UA 1EO7A 4PSPA 1GUVA 3GNXA 2QUVA 1TSIA 4FOKA 4Z2GA 2W91A 2YXXA 3ZO9A 3PBYA 4D8AA 3UXAA 5FJUA 1H62A 2H90A 1RK6A 3STGA 3TTYA 1EF3A 2PF0A 1ZBVA 2YDRA 3QZEA 4MMWA 3MMTA 2PI6A 2ZXBA 3C3NA 4CGTA 3TX9A 2G4JA 4XKMA 3S1XA 1A4MA 1GOOA 1F6PA 1GYNA 3TN3A 1CGTA 4K37A 7CGTA 3GHTA 4DBDA 1ZQ5A 2D1ZA 3VOJA 5EFFA 1FWRA 4MKNA 4O57A 5FF4A 1G1YA 2NV9A 3CTTA 4GVHA 5AC5A 2XINA 4HZ6A 4AHPA 3QV8A 3KDNA 4NU7A 2VZOA 4EPEC 1AW5A 1GOXA 4V1YA 3W00A 3NM1A 1XYAA 1TPEA 1JYVA 3AFBA 4ATDA 3FIGA 4GYKA 1YKWA 3MJMA 1S2AA 4RXGA 3H24A 1TPUA 3WJSA 5EU9A 3BDKA 1XBVA 1GVFA 1LUCB 4WJEA 3JZEA 1ISZA 1J0IA 1V8EA 2VNCA 3N14A 5A6KA 3SR7A 4Z2LA 2YXOA 1CB2A 3TQ0A 5FJOA 3RHGA 3GE7A 1C8XA 4FEZA 2CWNA 1QO5A 3DYOA 5AYBA 1JRBA 1VJZA 1UUQA 3BCDA 1GTHA 2E8YA 4MB1A 3GX9A 1GK8A 1FP8A 3EWXA 1ME8A 1EOMA 2ALRA 2R1LA 4UMCA 1W2VA 4GFSA 5BXSA 1RVGA 2BODX 2Z4GA 1RCXB 5A95A 3B06A 5CZJA 3O3RA 3KZSA 3UXLA 1ZUAX 1RH9A 4OBRA 1S2WA 2VOTA 1ZALA 3AHYA 3NPWA 4P7NA 2EPOA 4I5RA 3L0NA 2W4XA 4L9YA 4M0XA 2TMDA 5FF7A 3PNZA 2B0MA 2VOMA 1RQHA 2ZA3A 4FNUA 3ICJA 1A49A 5H1WA 1H1YA 1DORA 3NA8A 3VD5A 1A0CA 3W83A 4Q3MA 1QO2A 1OYAA 3O0KA 1MMFA 1L6WA 2BOEX 2YCKX 2DVTA 2OTDA 2IKJA 4YVVA 3D6NA 3VGFA 3QM3A 3PSVA 4IISA 3KBMA 1PKYA 2P3EA 2PCEA 3QTPA 1GKPA 2PDUA 3NZQA 4CD4A 2MNRA 4OKDA 1CXIA 3ARYA 4C7FA 2X0YA 2NW0A 4U31A 1E4NA 3EWBX 3N2MA 3TAOA 2JEPA 4ZB0A 5C9WA 2D3NA 1H60A 4RK8A 5K9DA 1NDWA 1XI3A 2JBMA 4KCVA 3SCQA 3ZOAA 2ZX8A 4DXVA 1ELSA 2O9OA 4DJFA 3E5BA 4JS3A 1XR2A 1EX5A 3ARTA 4Z1AA 3LYEA 4NRSA 3LHYA 1TUXA 1XIMA 1HVQA 4KQNA 2CNCA 3URAA 1W8GA 3GHUA 4DI9A 3AZRA 3GTXA 3VCNA 5TQLA 2Y6ZA 2QF8A 4YCOA 2VX5A 3C0QA 2FPVA 1G0CA 3UXKA 1NWSA 3N2CA 2PTWA 2WV8A 3PBGA 4HSHA 3R58A 4GRSA 3K46A 4ADUA 2VR4A 3FJLA 1OADA 3WUBA 2X1UA 3TTQA 3QFEA 4WGXA 2J8FA 3Q45A 3UW6A 4FXFA 2QT3A 5HXMA 2ISVA 2ZX7A 3PTQA 2Y2WA 1U2YA 2PDQA 1GJUA 3WIJA 5CSSA 4WQ6A 3F4VA 3LS9A 4KFPA 2IQ0A 4ZQOA 1M03A 1EWEA 2JKEA 1EIBA 2BY1A 4LV9A 1QR7A 1OFOA 3N2XA 1C91A 1FXPA 4R27A 3G1XA 2PWDA 1N2VA 1S2TA 5AB3A 3S1GA 1XGEA 3G1VA 2B7NA 1OC7A 1UWUA 2E7FA 1DIOA 3VMNA 4PMXA 3ZJ6A 1JPMA 1HKVA 5DT5A 2P53A 1TWSA 3VKCA 2ABBA 3PC0A 4DWSC 2NQ5A 3LY0A 3TNOA 1TV4A 4ZODA 3W29A 4BQ3A 4MUPA 2FGBA 2D22A 4ES4A 3EDKA 2SFPA 1QW7A 3BV4A 4TX9A 2NX9A 2CLIA 3MUCA 5AC4A 2A7PA 2VEIA 2QGYA 1V6TA 3R43A 2P1FA 3MA8A 8XIAA 4RDZA 1R9XA 3TKFA 3CZEA 1C92A 4W85A 5C8BB 5BRBA 3VNJA 3EWCA 2XM1A 3N9SA 4Q8NA 4WIWA 3JVAA 1FBAA 2XSBA 4NL1A 4W86A 2BGSA 4LUSA 3BV7A 4HYRA 2OLHA 3TXZA 1ITQA 4C7DA 2VQUA 2IQTA 1ONWA 3TC6A 3WQ6A 4A21A 2PBOA 4DO4A 3GNOA 5CGTA 4CNUA 1QCWA 2GDVA 3KOWA 3AZSA 1PTDA 2XIMA 1FHDA 4QG6A 3UETA 3MYOA 4M51A 2POZA 2BS9A 1B3ZA 3STCA 3WDJA 3PK7A 2NSXA 4D6HA 4V33A 4GYJA 4DBUA 4L65A 1UP2A 1OF8A 2ZUSA 3M64A 1XXXA 5A6AA 4OUEA 4RNJA 1E51A 4QDMA 1SJCA 3QLLA 1ZCOA 4WEVX 5E93A 4KKXA 4HCLA 3P82A 3NOYA 2J6VA 3F5JA 1UBSA 2CZVA 2GJXB 2REQA 4CQ9A 3BLPX 2VL4A 3K8KA 5AZ1A 2ZWYA 3QKEA 4MJZA 1QNPA 4D2JA 3KRZA 4LB3A 4JFUA 4IWWA 2E5CA 1QPRA 4HOXA 1A5KC 5I3KA 3N73A 4S3AA 3SGZA 3WEZA 5M3WA 1HN1A 5H8UA 4UTWA 5XIAA 3EMCA 4FI4A 3COTA 5I3GA 1A3XA 1WPCA 2WLZA 1XLEA 1KRCC 3Q58A 3R0DA 4F66A 1OCBA 4I5XA 4YYFA 4UOQA 1GYMA 4YWSA 3NJ3A 1IR1A 4CD5A 3IUHA 1LZOA 3NR0A 1EZWA 3IAPA 2RGLA 1PUDA 3TWBA 4ZZ9A 3HMJG 3KBSA 4PL2A 5CC7A 4IXHA 4WK9A 1EJTC 3LV6A 4LSBA 5D2YA 4NHVA 4FXRA 1EJXC 2D23A 3RCYA 1GJPA 2BHYA 1BRLB 1ME9A 4MFDA 1I75A 5E1QA 3RXZA 5DQPA 1OT2A 4ADTA 2PWHA 5GNYA 1GG0A 2WW5A 4D72A 4MYAA 4PTNA 6XIAA 2GUYA 3QR0A 5BXTA 4IMFA 4J7RA 4XZHA 2F38A 2WZIA 4FX8A 3UJSA 1YHTA 4QE5A 3HG3A 2Q8ZA 1GW9A 1M68A 4LVBA 1K4GA 1WUFA 5IOBA 3DYPA 1M6JA 2ONEA 1DJIA 3WK2A 2JALA 2BP1A 3PZ9A 4O14A 1PCWA 3P3BA 2I16A 3N4AA 4XAFA 3RO6A 1HL8A 4L61A 3CUFA 3LGEA 2XIBA 3O9NA 2FHFA 1T40A 3CM4A 1R3RA 3L67A 4C6PA 3QR1A 2QUUA 4REQA 4JIHA 1PIFA 7TAAA 2CKSA 2W92A 2PODA 5K2ZA 5HATA 4X9YA 4HD5A 3MQTA 2O56A 3MHFA 2C1GA 1F8MA 4UQBA 2ZRUA 2VTFA 3WK1A 1CX9A 3LV5A 2Q6ZA 1LYXA 1TVNA 1YNPA 2V5JA 3WNKA 1EDTA 1GT8A 4Z1YA 4B5SA 1FDYA 4Y9PA 3VOHA 3W2MA 1EJ7L 3GW3A 4ZFCA 3O16A 2ZFAA 5AHLA 1LG2A 4UOJA 2KZHA 4E4PA 2YDSA 1J93A 5CJNA 5AC7A 2OEKA 3EPNA 3AMDA 3BAIA 3GK0A 4GIAA 3C56A 1X98A 4JX5A 3A5FA 3TW6A 5AYXA 3EKZA 2I5QA 4AC7C 4DJEA 1PAMA 2DP3A 1B9ZA 4E3TA 4FA3A 3ITGA 2WM0A 4C65A 4UIOA 1XYZA 3E0FA 1UWSA 1B57A 4OBTA 3U48A 1T99A 3S46A 1E9ZB 2J24A 5D8WA 4JNYA 1M41A 4R53A 1ZZMA 2Y7GA 3QGVA 2BMBA 1JEZA 3H7VA 4XZNX 1VYPX 1DYSA 3WH8A 1HJSA 3BMXA 1KV5A 1UCWA 1WZAA 1PJ9A 4DEFA 4MNJA 2ACUA 3NL5A 2XFWA 3QOMA 3SSZA 3FAWA 3TC3A 1ONEA 1VGAA 4UTJA 4KEUA 2PLJA 3AYSA 1ZY9A 3B9AA 9XIMA 4IG2B 3DG6A 1BG4A 2V3GA 1XLJA 1KO0A 5AC8A 1MXSA 4GMEA 1UKOA 4H2CA 4BHYA 2OX4A 4A8NA 3I3EA 3WBEA 4URIA 1JDEA 4HP5A 3PZQA 4DJFD 3PUGA 3EGJA 3KLLA 3W1XA 1XSKA 5ABEA 5M03A 1PVNA 1BQCA 4H04A 5C2CA 1ADDA 5FL1A 3VIJA 2OO0A 1SZFA 3DENA 2YDQA 1BG9A 2G96A 3DZ1A 4K38A 1MQRA 2WCSA 2CBVA 4AX7A 1FCBA 1P0NA 3OLEA 1H0GA 1A5NC 4ROPA 5I3HA 4TTUA 1RBLA 1WAWA 2J9XA 4X63A 4CNSA 2GQ3A 1UZHA 2WNNA 3WF0A 4D8LA 5BNKA 2HE5A 3W22A 1SO6A 2ISWA 2ZUTA 1TWWA 4AHOA 1NFGA 1CENA 3NEVA 3VDBA 4A8LA 3VOGA 4RNFA 1PWLA 1SO3A 2GJNA 1CGUA 4NILA 2BVDA 5C6MA 3PTDA 1XIEA 2XN0A 2PDGA 5FCZA 1JCMP 4Z2IA 2JKAA 1EIXA 4XISA 2Z2UA 2WMIA 4R7WA 1AQHA 3N13A 1QRQA 2V69A 4Z08A 1UR8A 4DBEA 4IIGA 2VXNA 2HNHA 3BH4A 2YBVA 3ID7A 4MOZA 4AD0A 2NX1A 3W7CA 1S5NA 2IUZA 3FGCB 4JYFA 4GJIA 4M6UA 4Z2JA 4DYEA 1ZLPA 1DHPA 4LYKA 3CBWA 4GWEA 3VIFA 4D6EA 1GQKA 4PGLA 1B2YA 3BZJA 4JTRA 3B8VA 3GRIA 4EWND 4ICNA 2QV4A 1H7RA 1PXGA 5F1UA 2NLYA 2OLAA 2VO5A 1G6CA 3BMWA 1E0UA 1PYFA 3I7SA 4QP0A 1FUYA 4UC5A 5EBAA 3WNMA 1VEOA 1GEHA 4L6HA 1XIDA 3BLEA 1JPKA 3FHQA 4JXCA 1R8LA 1CNVA 4LAOA 3QSRA 1K8XA 3WFAA 3L9CA 5I23A 3FNDA 1R9ZA 5J8LA 3C52A 1OHLA 1XLFA 1P6BA 3B0UX 1W1A1 2GVGA 2HROA 1W8SA 3M7WA 2A3HA 3WJXA 3A47A 3SN0A 2QYGA 1PDYA 1UC5A 1M01A 3QW4B 3VDAA 1TPH1 2OJPA 3LHVA 3SDOA 4RDWA 3P67A 3WDPP 3R4IA 3W7QA 3FA5A 1KFJA 1TV5A 4NJJA 2BWGA 3HBLA 1BYCA 1OYBA 4P5UA 5D03A 4IQLA 4YS1A 1E6PA 2ZZ7A 3GXTA 3ITLA 4RLIA 2A85A 3KTCA 3EPOA 1HF6A 1XDLA 3A3HA 2IKHA 4WVXA 1W37A 2RDUA 1VYSX 1A5OC 1CGYA 4R7OA 3W1NA 2GWGA 1LUCA 3MBFA 1XBZA 3MDUA 3BL3A 4A35A 4QROA 3O06A 4LVFA 1LLZA 2HISA 4PMUA 3D3AA 3NSNA 4O4VA 4JN7A 1FH7A 3G8RA 1ADOA 1ML1A 4IIFA 3LRLA 1RY0A 1XCFA 1PX3A 3SQLA 3AS0A 4A6GA 3H8AA 1W0MA 3LXAA 3O63A 5D02A 2YOCA 1U5HA 1VFLA 1DIDA 1LQAA 5HJLA 5DO8A 3FVDA 1R3SA 2PUZA 1O60A 2YFNA 4ML9A 4EWJA 1SO5A 2WJZA 1JZ8A 1SJDA 4NXKA 1OCQA 2AKMA 1FHVA 1TTPA 4WOQA 2X7VA 3A5VA 1ZL1A 2B7QA 3PZUA 1I2QA 3GTIA 1ISVA 1E3XA 2WWDA 4H1ZA 4KT2A 2JF7A 4ENLA 4KGLA 5I2UA 2CLPA 2DZPA 3VVGA 1MRQA 1E1FA 1E5JA 3WELA 1FWSA 4QS5A 1JAEA 3GVRA 2WJDA 3FS2A 2WKLA 2CHRA 5CBIA 2V3FA 3Q2DA 4CQDA 3AIUA 1DTUA 3UXDA 4GUJA 4HNLA 4LS2A 3HFTA 4AZHA 4OZOA 5M17A 3GDTA 1OG0A 3IJ6A 2DZAA 3S2JA 2EHHA 4HTBA 4W8BA 4D1IA 1QI2A 4PUUA 5A2AA 2QGHA 3LGDA 4K8GA 2PDHA 3I6TA 4LF1A 2V2CA 3W2LA 1E6ZA 2PEVA 4TQTA 4N42A 4M29A 5IDZA 1MNSA 3VTRA 1W3JA 2NUYA 3G3MA 3SRKA 3G18A 3WN6A 3P5YA 4HYVA 1TCMA 5CGMA 1F07A 5HNRA 1UQZA 4JOMA 3CPGA 1TMHA 4MGGA 3CZGA 2YFOA 1RJPA 1IT8A 1ZAJA 1R38A 1DJQA 2R91A 4BEUA 4J1OA 3GSMA 4L56A 5HUPA 2W63A 3WK3A 3QC3A 4AX6A 1MFUA 2OCZA 2PDKA 1EPXA 4ZOAA 4K68A 2HWGA 3TJIA 2Q71A 4GKTA 4MAZA 4UR7A 2FDSA 1AJZA 3FKRA 3GR8A 2A1YA 4N4PA 3A6OA 1CT5A 4OJYA 1W9BM 5AOUA 3OB8A 3AIEA 1OD0A 4UTKA 5CC3A 4CLMA 1TPB1 3CS2A 5EBUA 1BKHA 2GUUA 3ARWA 4JZ5A 2D0FA 2VVSA 1AG1O 3B4UA 4DJED 4HHHA 1JZ2A 4YLWA 4GK8A 4E3VA 1UWRA 4UTWC 3TFCA 1RPKA 2GJLA 5I00A 1V5XA 4XAPA 1RAKA 4DM1A 1UH2A 4ACYA 3TA6A 4IPJA 1WXYA 2ACRA 8RUCA 1LWIA 3PBVA 1B90A 2EJ1A 3BTNA 4DWDA 3EKLA 3L5LA 3P6LA 1WP6A 3MZNA 4WDUA 3DDMA 5BU9A 1S5MA 4N9DA 2WHMA 3WQWA 4OHQA 3IJ9A 3ARPA 4DUVA 4F48A 4HSNA 2A2IA 3UWWA 2PP1A 5EKYA 3WBAA 1UKTA 4HGXA 3NGJA 4IOTA 3AHXA 4JR5A 2ADAA 3M07A 4YVXA 3G2GA 3L0KA 5CAHA 3G6LA 5CZTA 3KOFA 4CEXC 1DHKA 2ALDA 3PUOA 2E6YA 5LIWX 3WYZA 4J27A 5DRCA 1V3MA 3VIMA 5H8PA 5KZ6A 4CU7A 2PDPA 4Q8PA 4M5PA 1KTCA 2Z27A 1OGGA 4O15A 4QG8A 4KERA 4AFYA 1GCYA 3RX4A 4LS0A 1TJ0A 5I3IA 3H22A 3UFYA 3GH4A 3RR1A 3SRDA 1P0DA 1CECA 3PAJA 2O55A 1V77A 4US6A 4UFHA 1FP9A 2J74A 3T4WA 1I0BA 4OV4A 5DMMA 2BTMA 1CXEA 2XDFA 4WSKA 5F2IA 3PG9A 4LNYA 3U5UA 4Q4RA 5IXEA 1A5SA 3STPA 1WZKA 3ARZA 1XCXA 4IIEA 1DWHM 2OG9A 1R87A 4FHAA 4B5UA 2PDWA 1Z69A 4FK9A 1R3TA 2VEGA 2VFEA 1UWQA 3ZWTA 2WZTA 1A4LA 4ZR8A 3CQJA 2BV9A 1JD9A 2J8GA 3VD4A 3ABSA 4OWGA 2FGZA 4GZ7A 2D73A 5FA5A 1UD2A 1F3EA 2CU0A 8XIMA 3TOPA 2QCMA 2WKGA 5I07A 2DZBA 4CNOA 1J5TA 1CXHA 2DH2A 1ZPTA 3VIPA 4GZIA 1B31A 3WLKX 4G7FA 1I1XA 4GUIA 1OGBA 4FR1A 3WD2A 1NQKA 3RPDA 3RG6A 4M6VA 1K6WA 5A8NA 1Q4WA 4DJEC 1Z7AA 2PLMA 5H2ZA 2CXGA 1N55A 4L4LA 4QX4A 3BSMA 4XZ9A 1AL7A 3A24A 1KM5A 4CKQA 5D09A 3SY8A 2OPJA 4MWAD 1UIOA 2P3ZA 4GFIA 2WC7A 3ZSSA 3WH5A 5FI8A 3POHA 3LDVA 1V6YA 3WLNA 4BY3A 5FAGA 3RCMA 2FDMA 2DGAA 3P84A 1CTNA 3IJ8A 4KETA 1G4EA 4AISA 4DQWA 4KBXA 3TQPA 2XGBA 4YU1A 4IHCA 4NUWA 2ZADA 4AZCB 4JTTA 3VNZA 3TMQA 3OJGA 3B0YA 3ITVA 4YNGA 3C2YA 2HBVA 3GU1A 4CNTA 3I7QA 3CUHA 3C8FA 2FFIA 3K4DA 4JTJA 1XP3A 3CQ0A 1GNXA 4HZ7A 4U3AA 1H7PA 3I4KA 4MF4A 1JUKA 3AO0A 3WO8A 1J8VA 1X96A 1K4HA 1XINA 5BOEA 1XHGA 2BHUA 4GQ0A 4LGXA 5HBFA 4I3GA 2GSJA 2CYGA 1GVOA 4F0KA 2FZDA 4Q6XA 2OR2A 3CYJA 1UH3A 3KAOA 1MDRA 3GDKA 4UR8A 2VHLA 1LRTA 3GIPA 4XAGA 4IJRA 5D05A 1B5TA 2VDHA 1OZQA 5E6ZA 1GW1A 3SUWA 4QLLA 2DZUA 5I03A 2NQLA 4JNZA 5DXYA 3LHUA 1XLDA 3P0WA 1W9XA 3JR2A 3LPGA 2FJKA 3CL8A 2ABAA 3UG3A 1CEOA 1YQ2A 2X42A 2QDDA 4UTMA 2ANUA 3LMYA 1UPPA 1DJNA 2E28A 4GJJA 4X60A 1KBKA 2Z0IA 4K39A 5IHSA 4DO5A 1WCGA 3AALA 4PTMA 4WX2A 2QPXA 3R8GA 1YEYA 2ZX9A 4ORMA 4INFA 3ZJ8A 1ZCCA 1T41A 2OQLA 2VEKA 1JULA 4FSAA 3EX6A 2PFHA 1WOBA 1ZNNA 5HPCA 1OFQA 1ZBCA 3HZ3A 1F9CA 3II1A 2EKCA 2X16A 3UGRA 3OZOA 2C6QA 1MFVA 4W5UA 4UXDA 1LROA 1OCNA 2PZ0A 1UJPA 3W7HA 2VJXA 2H8XA 4RXFA 1Q2RA 3K1DA 3GVVA 2R1KA 2J7HA 4ZTYA 1PS9A 4I6KA 1VBUA 1UG6A 3T2OA 5J04A 2XFYA 4PB5A 2DDXA 3CZLA 1W54A 3H7RA 4C6QA 4L7ZA 4RDVA 3NQ7A 1IGWA 2EKGA 1D3CA 5B7YA 2J9ZA 2R1NA 3IJDA 3T08A 4R34A 1R3VA 1SJBA 1YXCA 4DVOA 1TR1A 1EYEA 4ZMGA 2C0AA 4C1NB 3HU7A 4FLRA 2WC3A 5AFDA 1C8YA 4CVUA 2DW7A 5LYRA 4IG2A 3UG4A 1IWAA 3H12A 3NUKA 3VZYA 5D9NA 3LHWA 4NAEA 1XIIA 4MTVA 3EWZA 4CN4A 3G77A 4BQ4A 3ALFA 2IMRA 5D04C 2E40A 5F4XA 1W5NA 4ALDA 2PDJA 3LRKA 5HPOA 4LT9A 1SZRA 5CEWA 3GIYA 4W89A 3L4ZA 1GYLA 3AROA 3QPEA 5A6TC 3KHJA 3N2OA 2CBUA 2PLKA 1G69A 2XVLA 3ZVHB 4I9AA 2V82A 4LJ3A 3MY9A 4IMCA 1RA0A 2TRSA 2YBTA 4O1CA 1EX1A 3W72A 3TTEA 1IT7A 3DESA 2ZUVA 2J77A 2PCQA 1KCXA 4M3PA 1Q7MA 3DECA 3PB0A 1PE1A 4Q6JA 4GX8A 2EPHA 5HOSA 4UFIA 4W84A 3J7HA 5F1VA 4QJ5B 4W7UA 2NUWA 4CQCA 2DUXA 1LT7A 3KBVA 4AXKA 3UPWA 4Z1CA 2B81A 3ARSA 1UA7A 4F3HA 3H53A 1NELA 1OYCA 2W67A 3DEQA 4HJFA 1KM0A 3WENA 2HDJA 2J7FA 1XRFA 1UD3A 3HV8A 3FDKA 8A3HA 3KCJA 1W56A 4W7VA 3UYIA 1PZ3A 4WDWA 4RV8A 4U5KA 2ZUWA 1WXJA 1BHGA 4QSFA 4MJ2A 5A2CA 1QOQA 4RZ5A 2PC4A 1BXCA 3QBUA 2BNJA 4IFKB 3FGCA 4JCLA 3M0XA 2V5CA 5CBBA 1JI2A 3V7PA 1OM0A 3V36A 1ICQA 1VIZA 4PUKA 1B4KA 1VBGA 3P61A 2Y63A 3EOSA 4WKHA 4Y9MA 2R1PA 1V4YA 1L2UA 1O1HA 4HZMA 2HV5A 1IEVA 1TCDA 3FV9A 2E68A 4TUFA 1LL7A 2YL8A 2VKZG 3CEPA 4A8RA 1ODUA 4FF5A 1J18A 3EXTA 4HVXA 3ZSTA 3UG5A 5C7HA 2ZOXA 4MNLA 4JTFA 5ECVA 2ISDA 2HPMA 3R11A 4TXEA 1YIXA 4HK6A 4CN1A 1JFHA 1OF6A 2GLKA 5HR6A 1V0LA 1FDZA 1FFRA 1TJ2A 3U9IA 3EB3A 1UWIA 2JKPA 3VUPA 3O8AA 3B03A 2CLMA 2HCVA 4MADA 3WMLA 4M8UA 1ZRQA 1VRXA 4UQEA 4N9BA 4K7YA 2WOQA 3O6DA 4W4QA 3MW7A 3AQUA 4IFRA 3TLQA 3QMRA 3BANA 3PB2A 5AVNA 1NOFA 3DFTA 1MZRA 3SB0A 2OZ8A 1S3HA 1LBFA 1Q7ZA 3IRDA 5LKYA 1HVXA 2C13A 4BF7A 2NUXA 4FX7A 2WQPA 4GQBA 5HA7A 3THQA 4IJBA 3PANA 1ISWA 1VJSA 4DJDD 2QR6A 4PBFA 2XUCA 3WF2A 3MPGA 5EMJA 2YZRA 2WBGA 3CH0A 4GXWA 3RR4A 1QI3A 4C6IA 2XU2A 2PLCA 3SFWA 5JIWA 1C8QA 3K2GA 4WF7A 1WYIA 1XM3A 4BQ5A 3W2JA 2XFFA 2VC5A 3MMDA 2GYIA 1LF1A 1L8PA 2FVLA 1MQQA 2J79A 4AWEA 1OWQA 3M46A 3ZT7A 1EGMA 4P8XA 4GNVA 4CD6A 4Y6GA 4A3QA 1IZKA 1OIFA 2CZEA 2E5BA 3WDQA 5FEZA 4WY0F 2RDWA 4LQ1A 2I9EA 1FCVA 2DIEA 3MB9A 3H2FA 1LCOA 3SIMA 3WX7A 3LCXA 1KCLA 1NU5A 4C5YA 3I68A 4LH8A 4RZ4A 3W24A 1GQJA 3JRKA 4UTTC 3A3WA 4ZXLA 3ZVIA 2IXVA 2QVNA 3GHSA 4G7EB 4Q4MA 2QJIA 3RLHA 3T55A 5MHBA 1RPXA 2Z28A 3L12A 3QYQA 4MB4A 1O5QA 3NURA 5HDRA 3HPFA 1P1MA 4DX3A 2ZIDA 1R46A 2J7CA 1JF5A 1O5KA 4OV9A 3CB3A 1TQJA 2Y8KA 1MQPA 1XCWA 4KCWA 2BBFA 3TSMA 2DY3A 3ATYA 3UWZA 2MUCA 1UA3A 1S5TA 2DZSA 1U22A 1A3HA 1SR9A 2RJHA 1HZYA 1G01A 4IP7A 3WD3A 2FLIA 1D9EA 1DJGA 2PDBA 4GBDA 2NVAA 1GQLA 3HPSA 2V3EA 1QPQA 2VFFA 1FWIC 2WMJA 3VOFA 4AVFA 3RF9A 5I02A 4C6BA 1NWUA 4GC3A 4WLCA 4RNIA 1F5ZA 3WL0A 4HOZA 5G1YA 2POTA 4PRRA 4C6FA 1XIFA 4AF0A 5AYIA 3O6CA 1GVSA 4MFEA 3T8QA 1I2PA 2VYOA 2ICSA 3WJYA 2AQOA 3TUUA 5K9CA 3NWRA 2OZ3A 3PPHA 2W27A 1HG3A 2CESA 2G95A 3BMVA 3ABXA 3EA3A 3A4XA 3DI0A 1JYXA 3FXGA 5E6YA 1G67A 3S2MA 1FVPA 1E40A 3CAKA 4GY0A 3E2VA 3VX0A 2ZRXA 1YPIA 1EP2A 2VURA 1EC9A 1QI0A 1MWOA 4KFOA 1KXTA 2JIWA 3LI0A 3T6CA 1TPWA 2J88A 3OZPA 5ABFB 2NZLA 1U5VA 2QDEA 2ZRZA 3FYYA 5ENLA 1G94A 2WZEA 5DX7A 1Y7VA 3G0SA 3FJ6A 1MNZA 1VCFA 4JKMA 3ENLA 4BF5A 3V5OA 4TX6A 4HPJA 1VD6A 3ORWA 2D2GA 4H9TA 3PFRA 2F6KA 1DQXA 4O28A 4ZOCA 3CXOA 2OO6A 1EQCA 2QLYA 1WO2A 1DXIA 4GNKB 4UTUA 1RV8A 3VGBA 3NYZA 4XWUA 1YE6A 3N18A 1AD1A 1JGIA 1RCQA 2OYMA 2ZX5A 1JQVA 3ZR6A 6REQB 1SMAA 1XLGA 4NY2A 2IPGA 1Q6LA 3MSDA 1WBHA 2I5IA 2NV2A 1GOMA 1JPDX 1SO4A 3SJNA 1HL2A 3KP0A 2YSWA 4O1EA 4JL2A 3RJXA 3AHZA 2L5HA 3LPOA 2VGFA 1F2JA