4ERAA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGYGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 113
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4eraA00
3RHGA 1I0DA 3E38A 4IGMA 4G7EA 4BKNA 2WJDA 1P1MA 4GX9A 3GUWA 3QY8A 1ITUA 1RA5A 3PNZA 2E1WA 4H9MA 3GIQA 1POKA 1PTAA 2QS8A 2FTWA 1M68A 2ANUA 2Z24A 4DI9A 2P53A 4ERGA 3URAA 2VR2A 4J35A 5G4HC 1J5SA 2D2JA 3LY0A 1NDZA 2R1MA 1QW7A 1FWJC 4GC3A 1ADDA 4H9VA 4IF2A 4H9ZA 1ITQA 4GBDA 4CNSA 4EPDC 2YXOA 3E3HA 3LS9A 1V51A 4Z42C 4C6DA 3TNBA 1UBPC 3HTWA 5AKQA 4LCQA 2ICSA 1RAKA 3ID7A 4RE0A 2G3FA 1EJSC 2PAJA 3K5XA 3UF9A 2WJFA 4XAYA 3OJGA 4C6OA 4EPKA 4R88A 3GRIA 3MVIA 1ZZMA 2AMXA 2FTYA 4IFRA 3NQBA 1RJQA 4HK6A 2DVXA 3AU6A 4KESA 2Y1HA 2GZXA 1O12A 4KEZA 2XIOA 5FSEC 1RK5A 1FWCC 4H9TA 5HMEA 2PLMA 2UZ9A 3E0LA 4RDWA 4GZ7A 5HMDA 2VUNA 3T1GA 3URBA 3WZ0E 3DUGA 3C86A 1FKXA 5E5CA 1V77A 2R1KA 3AU2A 1XRTA 4IG2B 4INFA 4F0LA 4EPEC 4QTGA 1GKQA 3MTWA 2WJEA 3IGHX 1WXZA 3MVTA 4LALA 1EJRC 1R9ZA 3T81A 2QVNA 4KEUA 3IPWA 3B0XA 4DO7A 4J2MA 4J5NA 3JZEA 2RAGA 1NDVA 4HK7A 1RA0A 1YRRA 3E0FA 1FWHC 5A6TC 2YB4A 4IFKB 3F2DA 3S2LA 2R1NA 2Q09A 3A4JA 3KM8A 4DI8A 4RDVA 1E9ZB 1E9YB 3GU1A 2P50A 4PCNA 4BJHA 1K70A 4C6FA 4G7EB 4KETA 4C6JA 1EJTC 1A5NC 1A5OC 3A3XA 3QGKC 2OOFA 1KRCC 3UBPC 1R9XA 4R85A 4GXWA 4PBFA 5HMFA 1WXYA 4L6DA 4C60A 4DZHA 3RYSA 1V4YA 4F0RA 3CS2A 4HK5A 4B3ZA 1QXLA 2HNHA 3IACA 3MKVA 3EWCA 3GG7A 3MSRA 3MJMA 4GX8A 3IV8A 1DPMA 2R1LA 3S2MA 4OFCA 3O0FA 3OU8A 2AQVA 1YBQA 1K6WA 2PGRA 3LA4A 4V1YA 3NURA 3F4DA 1KRMA 4I6KA 3LNPA 2O4MA 3DCPA 1UIPA 1NDYA 3GTFA 2I9UA 4RDYA 2VM8A 4DIAA 1EJVC 1EJWC 4PE8A 4GY0A 3FEQA 3ISIX 1KCXA 3OQEA 4C6CA 1A4MA 4NP7A 4C6IA 2HBVA 2OGJA 1R9YA 2OQLA 2Z25A 2YZ5A 4CNUA 4IFKA 4ICMA 4KEVA 3EGJA 3T8LA 4DYKA 3E74A 1EYWA 4NI8A 4ZSUA 4XAFA 4WGXA 4C6KA 3O7UA 2A3LA 3DC8A 3IRSA 1GKRA 4HA0A 4B90A 4CNTA 1FWGC 4C6EA 4C5ZA 1EJXC 4IGNA 2EG6A 4YIWA 2D2HA 2ADAA 2BB0A 3PNUA 4WVXA 3LGGA 2VC7A 4H9YA 4LAKA 4QS6A 3K4WA 1NFGA 4C6LA 3F2CA 4CQDA 3SO7A 3QGAC 1J6OA 1V7AA 5LXXA 3HM7A 1ONWA 1YNYA 3S2NA 1NDWA 4P5UA 1GKPA 3G77A 3MDUA 3IJ6A 4V1XA 2Z2AA 2E25A 3OOQA 1POJA 1A5LC 4LAMA 4E3TA 2Z28A 2Z29A 3ICJA 4C5YA 4H9XA 3NEHA 1EJUC 2FVKA 2QT3A 2ZC1A 4LAOA 1BF6A 1FWEC 4QROA 3ORWA 2GWGA 4ERAA 1J6PA 4XD3A 3GTHA 2R1PA 2HQAA 3UR5A 4IFOA 4EPBC 4XAGA 1FWAC 3PBMA 4H00A 2DVUA 4XD6A 2BGNE 2GOKA 3R0DA 3LSBA 4C6QA 4BY3A 3OVGA 2W9MA 1I0BA 1KRAC 4XD5A 3TN3A 2OODA 3RN6A 1ONXA 4C6BA 2Z00A 4DLFA 2F6KA 1FKWA 4R7WA 3TN5A 3GU2A 4GY7A 1P6CA 4UBPC 3S2JA 3UR2A 4LEFA 4C65A 4TQTA 3GIPA 1UMLA 2FVMA 1RJPA 2Z27A 4XAZA 2DVTA 4RDZA 3B40A 4UB9A 1EF2A 2Z7GA 3HPAA 4DZIA 1FWIC 1RJRA 4IH3A 1YBQB 3B0YA 1FWFC 2OB3A 3FDKA 4AQLA 3D6NA 2FFIA 1M65A 4NG3A 2Z2BA 4KF1A 1PSCA 2YB1A 4GOAA 4KERA 4CQCA 2VHLA 1O5RA 2HPMA 3LSCA 2AQOA 3A3WA 3BE7A 4XD4A 3TN6A 4CQBA 3FDGA 3RCMA 3URNA 4C6PA 2EG7A 1YIXA 4I6VA 4C6MA 3WMLA 4QS5A 2Z4GA 1YMYA 4LFYA 4WHBA 3UPMA 1K1DA 1A5KC 3V7PA 4QRNA 3OODA 3MPGA 1FWBC 3CAKA 2VC5A 1A5MC 1IE7C 4H9UA 4PCPA 2QPXA 4HJWA 4CEXC 3PAOA 1HZYA 3PANA 1KRBC 5CH9A 3ITCA 5FSDC 4LANA 4LH8A 4G2DA 3EWDA 4IG2A 2EG8A 3QY6A 2GSEA 2PGFA 2PUZA 4QSFA 3S4TA 1M7JA 1S3TC 2Q01A 4C6NA 4LCSA 1FWDC 2UBPC 1W1IE 1RK6A 3GTXA 3LGDA 4EP8C 2Z26A 4B91A 1V79A 4L9XA 2HPIA 1A4LA 2O4QA 4IQJA 1P6BA 3GU9A 3E2VA 3SFWA 4DNMA 4CEUC 4B92A 4D8LA 2WM1A 4ERIA 3F2BA 4PBEA 4AC7C 1EZ2A 3AUOA 2D2GA 4GYFA 1XRFA 1JGMA 4GY1A 1XGEA 2GWNA 3N2CA 4JOMA 2HBXA 4MUPA 1UIOA 2CZVA 2I5GA 3IARA 1VFLA 4M51A 3CJPA 1J79A 4KQNA 4KIRA 1XWYA 3URQA 3K2GA 2IMRA 3F4CA 4ZSTA 2KAUC 3GTIA 4DLMA 1PB0A 4H01A 3MDWA 3QY7A 4LCRA 4RZBA 1PO9A 4GK8A 3LU2A 3WYZA 3TN4A 4F0SA
chains in the Genus database with same CATH superfamily
1O94A 1I0DA 4Q22A 1H51A 4GIYA 4F2UA 5FA5A 3OIHA 5DMLA 2G41A 3R11A 2OWCA 1UQZA 3UWQA 4ILSA 1X39A 4PBGA 3S2CA 3FCPA 1KKOA 4F0HA 7PTDA 1E5JA 3LGEA 4GBUA 4RXFA 3W24A 4FX6M 2BBFA 1FCVA 1JZ4A 3AMDA 4JHZA 1OK6A 2NX3A 2BXYA 4LUIA 3UJRA 1XS2A 4R27A 4B3KA 4QCEA 4AD5A 3FJLA 2DZXA 1OZMA 1KBIA 4F3HA 2GSHA 2DH2A 1DWFM 3ID7A 4EANA 3PPHA 4MZYA 1SZEA 1E73M 4XZLX 5M1TA 1KFEA 4JXCA 4LJ3A 2RUSA 5A6KA 1MQPA 2OKTA 1LCOA 1RJQA 4A35A 3MHFA 1KR0A 3E2SA 5I03A 2YPIA 1K9TA 4BK9A 1ISYA 1MXSA 4UTKA 2VEGA 2YDSA 2WZEA 4JL1A 1EQPA 1RD6A 3VXGA 2V2HA 1W17A 3LXCA 2R91A 2YZRA 3IGUA 3E9AA 3WF3A 3IGHX 1OEPA 3S5YA 1W9VA 3K8MA 1VBHA 5U4NA 3NM1A 3SN0A 4GA8A 2W92A 1RA0A 2WBKA 4IFKB 1MW2A 1XDMA 3S2LA 3A4JA 1SJCA 2YYTA 3V18A 1EP3A 1AJ2A 4G7EB 1DJWA 4PUJA 2YCJA 3CL6A 3PK7A 2GJNA 4GI6A 3DIPA 3KCLA 1V3LA 1JZ5A 1F3TA 1GTHA 1ZJAA 1PKYA 1RQBA 5E6YA 3K8LA 2YDAA 1V4YA 1YE6A 2ZKMX 4MNKA 5TQLA 1L8PA 3CPRA 4F2TA 1B3OA 1FY6A 3M4HA 1SR9A 4D6CA 4JKMA 4NL1A 3CPUA 1Q85A 3GH4A 3OA5A 1BYCA 5HPOA 8A3HA 4ENLA 1XLCA 2I56A 4M1RA 1G67A 4WRHA 4M7TA 4DIAA 1UKQA 3AISA 1D2KA 1TTJA 2XISA 1MNSA 3VM5A 2XUCA 3EMQA 4RCXA 4KT2A 3DERA 1R87A 3VIMA 2HMCA 3CIVA 1RCXB 1I60A 4S2CA 2XDFA 2YZ5A 4LYPA 4S3KA 2A3AA 1HFBA 1VKFA 5BROA 3WJYA 3AXMA 2BLEA 1EHNA 3PB2A 1VR6A 2XIBA 1C8QA 4Y2WA 1TR9A 5H1WA 4B90A 1FWGC 1AW5A 3STEA 5J8LA 4IGNA 3S9IA 2ADAA 3LQGA 3N12A 1GZ1A 3O15A 5I07A 5M3WA 3A5VA 5DBTA 1KC7A 2IKIA 1NDWA 4A8LA 4XZMX 1QI5A 2C1GA 4A29A 4KH2A 2Z2AA 3C2YA 4PMZA 1S38A 3CU2A 1AD1A 3RRAA 3QSTA 2JEPA 4E6MA 3W1UA 3CHDA 3VDBA 3VC6A 2B7PA 3PWGA 1MUWA 4YWSA 3RRXA 2BODX 1BG9A 1TZZA 2C8NA 2PWFA 4HIBA 3MSYA 3POCA 1O7AA 1UH4A 3GD6A 2ABAA 3Q67A 2QLYA 1MRQA 3I65A 3BDKA 4JQ3A 2NW0A 3T55A 4IJBA 1I2OA 3ONBA 3GVVA 1G4PA 1GOXA 2PDCA 4L6HA 3IAPA 2CLLA 3GWQA 4BEUA 4REQB 3UJ2A 2XTKA 1E55A 1AD4A 1W91A 5DCBA 1M7PA 3VDHA 3FDKA 4K8EA 4ZQRA 4MZ8A 2INZA 3ZT5A 1ODZA 1TPWA 5EA9A 3WO8A 4FNPA 2HSAA 3ALFA 4LX4A 1HJXA 3UCDA 3W7HA 1FDJA 3BE7A 2Y7DA 2V5JA 3LYEA 1GUVA 1GTEA 4BWLA 2PF0A 3M5XA 3KS6A 4EOUA 2DQXA 3V1PA 3FKKA 2V5LA 5EBAA 1UWSA 2V63A 1VQTA 1ZTVA 4HOXA 3UPMA 4LS2A 3E0IA 3WMBA 1VP5A 1RQEA 5AHLA 1Q4NX 1Q2RA 2QPXA 4URIA 3UWVA 4QGCA 1DJHA 3VMPA 3M0YA 4IPLA 1NY1A 4PRWA 1B90A 4D71A 4LH8A 3B05A 1PZ1A 3PG8A 5I3JA 4RNFA 3U48A 3UNDA 3B9AA 2PGFA 2D73A 4GJ1A 2Q01A 3KL3A 3IWPA 4C6NA 1GOMA 3M0JA 5AB3A 2BNJA 3WFAA 4WSHA 3SCWA 3AXKA 3RU6A 1EZ2A 1C93A 3FJNA 4GYFA 1BRLB 1XLJA 2PDXA 1M1BA 4TU1A 4A8RA 1MMFA 1AMKA 1EB3A 1DORA 3QV8A 1V8EA 3M7SA 2HBXA 1XGDA 1XLGA 2GJLA 3GQYA 3P80A 3FGCA 2NT1A 4KRZA 1RUSA 1BVWA 3FN9A 4O52A 2X1RA 1A5BA 4JICA 3ENLA 1XXXA 1K6AA 3THAA 2ACQA 2PTXA 1MZRA 4I9TA 3L4YA 1VCVA 1F8MA 4JNMA 2XZ9A 1E4MM 4RZBA 5H6HA 3P67A 3FNDA 4F0SA 4GNVA 3C2OA 3GDTA 4IP5A 4A05A 4XTIA 1KKRA 4DXVA 1WOAA 3V3WA 3QY8A 1ITUA 2ZZ2A 3VNLA 1XLMA 1POKA 3CZ8A 1RLDA 1JQVA 1M68A 5CSSA 2C79A 2FZNA 2ZBTA 3DC0A 1QPNA 2HS8A 3K8KA 2GUBA 1YXYA 4GFSA 2NV2A 1H2JA 1XSJA 1ADDA 5LNVA 2OELA 3BSHA 2P5NA 2HRWA 4FR6A 2O9RA 1XIJA 1P0DA 3W7KA 1OIFA 5GNZA 2ZADA 4Q8QA 4QHRA 1ONEA 4RE0A 3AIRA 1HKIA 3AYRA 3ZMRA 3NQ2A 5C54A 2XSBA 3NPWA 2WNZA 4KEZA 2NX9A 1EWEA 5E9AA 5E6ZA 2VZTA 5HMEA 4D6JA 1CXFA 1JPMA 5FJIA 4MJ4A 4AAJA 1V3HA 3SSZA 2BZNA 3WLHA 3BQ6A 3AYSA 3KAOA 1GKQA 1GOKA 1TE1A 7XIMA 4MLRA 4WOZA 4F9JA 1XG3A 3UXIA 3MI3A 4KS0A 3TONA 1QPKA 4MKVA 3JZEA 3WQGA 5FEPA 3KVLA 4UR9A 5HXMA 4J3UA 1VBJA 5H8PA 1O60A 3NDZA 1E9YB 3W74A 8CGTA 3LPOA 3VD4A 1HUVA 1FTXA 4XVDA 2RFGA 4Z0SA 5GQBA 3TJLA 4J3WA 1LF1A 3UT0A 1ITCA 3SCPA 2PRMA 4AIUA 5HULA 4NVTA 3CGTA 2VFHA 5E0KA 3ZVHB 3PSVA 4D9PA 1OHLA 3H70A 2R1LA 3T07A 3Q58A 3G1VA 3VKBA 4BI7A 3OU8A 1GGOA 3LI0A 4JL2A 3A9IA 2A3HA 4X9SA 1D9EA 3LNMA 3ZJ8A 3GTFA 4CD4A 3PTQA 4O0ZA 3RJXA 4MB4A 3AHZA 3G1AA 2PDQA 4C90A 1CT5A 3EXTA 4FOUA 1XKYA 4RJEA 3L9CA 4C6IA 2QJHA 4CCDA 4DXKA 6ALDA 3QGVA 4M1BA 4NI8A 3J7HA 2OWXA 3SCVA 4ZFCA 4GACA 3W70A 1OINA 3F4VA 2CYGA 4ZA0A 3LPGA 3BSMA 4ZR8A 2AL2B 4C5ZA 2OLAA 1HKVA 4DUVA 1EX5A 2D69A 2CEQA 4PSPA 3LGGA 3AI0A 4AZ6A 5C8BB 1P7TB 2WV8A 2J78A 3QKZA 2ZA2A 4U10A 4FR1A 3ZR4A 3QGAC 4HNVA 1KWKA 2XSAA 5G4WA 1OFDA 3G77A 4YS1A 3WLKX 3R58A 4QBXA 1DJGA 1D3GA 3HG4A 2WNNA 2Q8XA 4LAMA 1DVJA 1FOBA 2EPNA 3WH7A 4ATWA 3ICJA 2YL9A 2Y24A 1KNWA 1ECQA 2GJXA 2VOMA 2GWGA 3BLIA 1J6PA 4O4VA 1V08A 3O05A 5G2HA 3D3AA 3T8QA 5CZTA 3CAVA 3L4ZA 1K9DA 3AMCA 2HK1A 2Y7FA 4NZCA 3WUEA 1VCGA 2WZMA 1AQHA 2J7CA 1JUBA 4F4RA 4MSSA 2GOKA 2Z1XA 1UZHA 1W9XA 1S5VA 2PTWA 4R7WA 1XIIA 4REQA 3P2VA 4Z17A 4WR3A 3TLLA 3GIPA 3BGAA 3C6CA 4ZTXA 1KW1A 1P7TA 3NJ3A 1OX6A 1VGAA 1E9IA 4J3XA 2ZA1A 1HO1A 3GNOA 2ISWA 4HJFA 1XJBA 3GVQA 3QR0A 2FFIA 4NG3A 1TFVA 1UJPA 3PM6A 2HPMA 4XG1A 1BD0A 4JEJA 2DT0A 3B8DA 5HNTA 5I7GA 3CZGA 3P62A 1HVQA 1TWDA 4LF1A 3OLDA 2Y4SA 1QASA 3VNZA 3B06A 3S42A 3N2XA 1RH9A 2NQLA 3BLFA 4X9YA 3P60A 1SO6A 3ABSA 3NO3A 1CTNA 3N29A 3PBVA 1WUEA 4GI4A 1E43A 1AUSL 2QUMA 1M7OA 3WK3A 1E1CB 2AGTA 3L0NA 3G6LA 1VJIA 1W1B1 4G1KA 4GNKB 2ACSA 2TYSA 4NZFA 3ITCA 2VEIA 3VAVA 4JTGA 2XVNA 3G22A 1FCBA 4WLCA 4PUEA 3FSUA 1CIUA 4Q32A 4FEZA 5AYBA 4PUKA 2ZRZA 4ICNA 4GO8A 3WCZA 5J5DA 2DPEA 3CQIA 3C2EA 1LYXA 4AD1A 2BG5A 1T0OA 3H2OA 1H5VA 2VVNA 2Z6IA 4ZVJA 4E0CA 3AAMA 2DUZA 1H0IA 3UR8A 1U33A 5C2GA 2G3JA 3AJXA 3IEBA 2UV8G 3MUCA 1JGMA 2BHUA 3AXXA 3B8VA 1K77A 4UTJA 4FI4A 3UWUA 4Z1DA 1VEMA 4N02A 2BVYA 1PX4A 2V68A 5DY2A 3QR1A 1FBAA 3OGRA 1NAL1 2R8WA 4HA3A 1H11A 5DX7A 1HN1A 3Q94A 2CKSA 2CBVA 2XGZA 4K1GA 5HWMA 3VOFA 5DT5A 3CASA 4DLMA 1VPQA 1PUDA 4W7UA 3WD3A 4B4FA 2YLLA 4E2OA 4JN6A 2A21A 3OBEA 3TC7A 1XQLA 3E38A 2VD8A 4IXXA 3HBLA 2A3BA 4G7EA 2BY2A 3BTNA 3ATZA 5K9XA 3APGA 1LOQA 1JF5A 4JX6A 4HMDA 1VHNA 3URAA 2W6RA 1FWJC 4GC3A 4W88A 2YGYA 1XDJA 5EMYA 1JYWA 4J40A 3TMQA 4C6DA 2XFWA 5FJOA 4DJDC 4D72A 4L5ZA 1EC7A 2ZICA 1IGWA 5A69A 4AUBA 1KM4A 1ZENA 2DZTA 3DG7A 4ZO9A 1Y5XA 4C1NA 2GJRA 2WMJA 4P8VA 1DWGM 4K38A 3LX9A 4HK6A 3EX4A 7CGTA 1JL8A 3M46A 3N18A 4D6FA 4MJ2A 2F2HA 1JJKA 1I9CB 1R7OA 3QZAA 4ZOEA 4RDWA 2NQ9A 1BYAA 5M03A 1Z89A 4IG2B 1HNYA 4EAMA 1QJWA 3LZ3A 3TTOA 1GVYA 1YYAA 5BWFA 1AMYA 2REQB 2ZA3A 3W2JA 2IXVA 4OIFA 1M5WA 3RCNA 4IL0A 4MKNA 5BW6A 3QN3A 3W1QA 1LQ2A 1XLLA 1E15A 1RR2A 1IWBA 1CXIA 2NLIA 4A3YA 1VRXA 2ALDA 5LA2A 4JFVA 5K4ZA 1FWNA 4IMDA 1LQ0A 3TQPA 3OVRA 3CO4A 3I7SA 1UR2A 1KRCC 3IJDA 3U57A 4S39A 2PF8A 3CV6A 4JCLA 3QH2A 3TVAA 1VRDA 5A3HA 3CS2A 1HG3A 2HZGA 4HN8A 1F9CA 4MM1A 3T4WA 3AALA 4M6PA 3BAIA 3N2TA 1OGSA 4CVUA 5CC6A 2PGRA 4O19A 1JCXA 1VYPX 3WLJA 1TVNA 3TZNA 4ADUA 4IJRA 1FWRA 2J7GA 3FAXA 2JIEA 2VRQA 2FZMA 3KHDA 4XISA 2I9UA 4GZEA 4FF5A 1B0IA 2UY3A 1JXJA 2NQJA 3FEQA 3HJEA 1J93A 3I4KA 4W8BA 1NU5A 2Y7EA 2IS7A 4P8WA 1Z41A 3S5ZA 2V5BA 5LNSA 1WKYA 3D0CA 1UROA 2YJQA 4FO4A 1AJ0A 3KOYA 2ISSA 3VKJA 4CD6A 1IZCA 4C6KA 3WNMA 4M7SA 1A0EA 3FSTA 3NZ1A 3VD3A 4DPPA 3THCA 3QC3A 1W3IA 5GNYA 3DU0A 4LBRA 3PNUA 5LNUA 3ZIZA 4FNRA 5HA7A 4FALA 2YBTA 3ARVA 1UASA 2DIJA 2I57A 1JGIA 1DWJM 5A8OA 1T99A 1KLYA 2FFCA 5LA0A 1VB9A 1NFPA 1POJA 3EPOA 1UQYA 2EJAA 5HAOA 4E3TA 1GK8A 4YYCA 3NO1A 4JTLA 3NEHA 4LAOA 1OFEA 1Q13A 4B5UA 3TLQA 2DSUA 3K1GA 3GNNA 3WBXA 3D46A 2OFJA 1MI3A 4B15A 3L21A 1LOLA 3PZVA 5HNUA 1I6NA 2YKKA 3QFEA 4HMCA 2E9MA 4IMFA 2BGNE 4IMAA 3AYTA 1XISA 4LVBA 3H2FA 4X60A 2V67A 1MW1A 1C90A 2WCGA 4TR9A 4MZ1A 2VDHA 5D9NA 1AZ1A 4LVGA 4UBPC 3G3DA 3QJAA 3TYUA 4R7OA 3M47A 4FS9A 4DBSA 1T8QA 1V6WA 1PTGA 2ZIDA 3B0YA 1M01A 3FA5A 1CDGA 2ZFAA 3WUBA 3BAJA 4TVCA 4JR5A 3ARXA 2A6NA 2B0MA 3PUEA 4KWOA 5I3KA 5DXXA 5LZLA 4MFDA 3BK0A 1JAKA 3B9OA 3CQJA 3TFCA 3DHUA 3SSJA 4GCAA 3PFRA 4PULA 1JFXA 2OQYA 2EG7A 3E1F1 1Z48A 5F2LA 1PXGA 2PWHA 2O7SA 4I90A 2OYKA 4MY8A 4EE9A 4Q4PA 2WHLA 5A6AA 1V3IA 1VJZA 4HSNA 1B3YA 2XN1A 3L4UA 1E6NA 2ZWZA 4Y9AA 3ZZ1A 2DP3A 3RLGA 1TPC1 4PMVA 1ICPA 1AW2A 3T9PA 3ZO9A 3VI2A 4MF4A 2GSEA 4MOZA 1YXDA 4AXNA 1IGSA 5BXSA 3PUOA 3ZJ6A 1C8VA 3EWXA 2QMJA 1D7FA 2QIWA 1OYAA 4PCTA 1UOZA 2F8QA 5C7HA 4JKLA 3LBMA 1U2YA 4D8LA 3P8IA 4WKFA 2D2GA 3HN3A 1XFBA 4GY1A 4DBDA 4U2YA 3LCWA 2EPLX 5LIXX 3BOFA 3ARYA 1ZCCA 3MMWA 1UD6A 1AFSA 3GC4A 1BVZA 1QOQA 2VT0A 4KIRA 3F5JA 5IM51 3VNMA 1PKLA 2GVYA 4EAYA 4DB7A 3G18A 2YW3A 1ISXA 4XKYB 1A5SA 2JE8A 3BARA 4WDTA 1V0LA 3WEOA 3TN4A 3EDJA 3RHGA 3M0KA 4QNWA 1OVDA 2WJDA 4ZO7A 4O57A 1RA5A 4FIQA 4NI3A 4R9XA 3R10A 3M0IA 2QVHA 1NWRA 3PFMA 1OD0A 1TV3A 1XQKA 1UR9A 1KGWA 1D8CA 3VCCA 3DHDA 3NDYA 2B7NA 3ZLHA 2QV4A 6ENLA 3UZYA 1N2VA 3HQPA 1XGZA 3FJ4A 1WKFA 2IQTA 3U3HA 5MKGB 1PCKA 4MPKA 2DT1A 5I5RA 2UY5A 4HZMA 2C15A 1HTIA 2BTMA 3E49A 1QWGA 4PSRA 4DO6A 3R1ZA 3W25A 3DAQA 1B3XA 3HQ1A 4YLWA 3TDFA 4IFRA 3VZYA 1ZU8A 4ZO6A 3W1TA 1KFJA 3TEVA 1A47A 5FD0A 1JR1A 4AF0A 2A0NA 2IQDA 2NSXA 4YTTA 2F6XA 5HMDA 3AZRA 3BMVA 3NM3A 3URBA 1VFMA 3LMZA 2JF7A 2IPJA 2HE5A 2OYMA 2PA6A 3ARRA 3CL7A 3B9NA 2J88A 3PBWA 1IR1A 4G8TA 3IANA 4NILA 5FF0A 1ZP4A 4HPNA 2BX7A 2R6OA 3R0KA 4DO7A 2ZUWA 4XBKA 1XH0A 1SFJA 3QXBA 4GI8A 3VGDA 3ANVA 1H5YA 3P3BA 3QOKA 5BZAA 1Y5VA 4D6EA 2PWVA 3RFAA 4RNJA 3NGFA 4AEFA 1K70A 3VDGA 3UG4A 3VX0A 4JTTA 5CPOA 4C6JA 1EJTC 2QAFA 3GW3A 1PS9A 1J0KA 3NXFA 2FB2A 1YHTA 4AD4A 2QCFA 1SJDA 1HL8A 3FIGA 4WD0A 1W5OA 3DENA 3RCYA 4P7LA 1XBYA 2DH3A 3CZKA 1Q66A 3WNNA 1LJYA 2BV9A 2TRSA 5FF2A 3SURA 3WN6A 4HCDA 1IXQA 4OBTA 3I7QA 4OOZA 1W3JA 2GYIA 3APYA 2D20A 4L4LA 4OV4A 5BNKA 4NSBA 3TCSA 4CNNA 5F2MA 1EJVC 3G1SA 4GY0A 2JK2A 2V3EA 1DL3A 3WNKA 5CBBA 1JCLA 4XSLA 4PMNA 4IWWA 1PDYA 1E6QM 1I2RA 4CD5A 4NY2A 3L4VA 2B7QA 2OMAA 1LG2A 1E0UA 1BHGA 1X38A 4WKAA 4DYKA 1XP3A 1T7LA 2ZX9A 4IP4A 4J9JA 3ZM8A 2IKGA 5IHRA 2DEPA 4L4PA 3VIIA 2QDEA 1D3CA 3WEZA 2JBMA 1GKRA 4B5XA 4HSHA 1EJXC 5D33A 2G95A 3TYCA 1HQTA 3IIZA 3SO7A 4CQDA 3W76A 4IMEA 2F84A 3MJYA 1ZCOA 4AFYA 1J01A 1Q45A 3DOPA 1XLHA 1GG1A 4V1XA 3BW4A 3UWWA 4JFUA 1WUFA 3HGSA 3U5UA 4FK9A 3MP3A 3BW3A 1EJUC 4UQBA 3DYMA 2RDWA 1V3JA 1Q5MA 2X1UA 2HCVA 3S9ZA 3UG8A 1LLOA 5AYYA 1NEYA 1OC5A 2TAAA 3E0WA 4GQQA 3DGBA 5BXRA 3OBAA 2Z1SA 3R0DA 3N73A 3OVGA 1KRAC 2DJLA 2TODA 2VI0A 2NUYA 4QIUA 2GGJA 4PTNA 3O9NA 2WAGA 3L12A 3S2JA 4TQTA 5C2XA 2PEVA 3ITOA 3V5OA 4Q4OA 3SGGA 1ME9A 2HWGA 4WK9A 3B40A 4XX6A 3VGEA 1IEQA 1PIIA 3V35A 3GNDA 5EPDA 3WDIA 2Z2BA 3SN1A 4GKTA 4H6RA 1ZJIA 4UIOA 3VM7A 3H26A 2C1HA 2ZUTA 1HVXA 3T2OA 2D3NA 3TWBA 4J7RA 3S9YA 3FDGA 3W7RA 2Q6ZA 4HU3A 3WY1A 4LAZA 4G1NA 3H2AA 1HP5A 2WZTA 2V3FA 4HTYA 4AZCA 2VC5A 4FNUA 5CPTA 3H7UA 1H0GA 3F4NA 3MY9A 2EKCA 5HINA 1I75A 3GDBA 4XBJA 2ODOA 2Y8UA 3CUXA 4UNKA 4IG2A 4BQ2A 1GEQA 5IHSA 1Y0EA 4QJ1A 3C3UA 1UUQA 2X09A 1NWSA 2GDQA 1XLFA 4I5UA 1J96A 4ONVA 4OZOA 4RV3A 1DJZA 2GQ3A 1FDYA 1GG0A 2RJHA 4JTRA 4S23A 1XIMA 1EYEA 1TPDA 3NG3A 1G7UA 1P6BA 3TW7A 3EA1A 1L6FA 3RM9A 1TPFA 1XLDA 2CFFA 2BHYA 4K8HA 3LMYA 5C71A 3AHVA 3SQSA 4FXFA 3QHNA 6TAAA 4S3FA 4KGJA 2GPTA 1UKPA 2GLKA 1VFLA 1TTIA 3MB9A 1AA1B 3O6AA 4MNJA 5F2IA 1WX0A 1XWYA 4AEEA 1J10A 2XSXA 3CYJA 4ACYA 1I8JA 1SW7A 4WY0F 3C0SA 1W3NA 1XIEA 5T9BG 4PB5A 3BCFA 3KRZA 1QW9A 4DJEC 1O5QA 3RILA 1J8VA 4HSOA 1XPYA 2J6VA 3VDAA 3S5OA 3TX9A 3GUWA 1FQ0A 2E4TA 1S46A 3ZR6A 4TUFA 1SM9A 4HPXA 1QK2A 1PTAA 4XZNX 3W6YA 4UTHA 1FA2A 1GPFA 4ERGA 4GCXA 4NNAA 4KWWA 2G50A 3DEQA 4F9DA 2D2JA 4AW7A 1SSGA 1JPHA 3RMEA 3PVFA 3M41A 5D03A 3RF9A 4R33A 3I4EA 3VIGA 3NYDA 1VAHA 1KCKA 2MNRA 3T6CA 3IIOA 1WAUA 3Q37A 3M0ZA 1ISVA 3GVGA 2XWEA 4DBEA 2DZPA 1Q8AA 2EF9A 3NFUA 2ATMA 5CCZA 3WD2A 2YDRA 5RUBA 4RZ4A 2QCHA 5HWNA 5HANA 1ICQA 5AYZA 2FHCA 4DBWA 5DELA 3WJSA 3SUSA 4HMEA 3SQLA 9XIMA 1M9HA 4Z0JA 1CLKA 2GZXA 1XCXA 4MB3A 3W83A 3W86A 2DGAA 1WCGA 3R13A 1GORA 4US5D 4I9AA 1ICSA 4JEQA 3RAOA 4NRRA 3T1GA 5EMJA 3RM8A 1KBKA 4BS0A 3H53A 4IHCA 3VIOA 3KBMA 4UCGA 2XIQA 2FJUB 3TTSA 3CIWA 1ISZA 1E4LA 2PWEA 4F0LA 4EPEC 2I14A 3WLTA 2AAMA 7ODCA 1Q6RA 4WJ8A 2WO5A 3FXYA 1EJRC 1EF3A 3MP5A 1VHCA 2XIIA 3G1RA 3LUTA 3KBWA 1H4PA 2V3GA 5I3DA 3LCXA 4KEUA 2GSJA 2PWGA 2RAGA 4YMZA 5FJJA 3QOMA 2YFOA 1PYMA 2QCDB 1LUCA 3ECQA 2QUNA 4Y96A 4W5UA 5AC5A 4Y9PA 3W85A 1IXOA 2BFGA 1Z44A 5EMMA 1E51A 1EWDA 2PU0A 4IISA 4JNZA 3I6RA 4FLSA 4CD7A 3MI2A 2C18A 3MZNA 2ATSA 4B3ZA 1XIBA 3WJZA 1XC4A 4JTEA 3TOPA 4S1FA 4FPSA 1DPMA 4OOUA 3WBAA 1RPKA 2AL1A 4HA1A 4V1YA 9CGTA 1B2YA 3N14A 3NSNA 4JTCA 1P4CA 3UZZA 2VM8A 3VGGA 1Q65A 2VR4A 1KCXA 3HF3A 4MHBA 2V3DA 2H90A 4XZWA 3F4WA 1S3HA 2V2CA 3ITLA 3L4WA 1UR3M 2A4AA 3OEXA 4RK8A 5JH2A 1J18A 1KLZA 4ZCWA 2OO0A 3C0QA 4A22A 4GI9A 1V6TA 1BVNP 3DC8A 4WUIA 2ZX7A 3HG3A 1ZL1A 3SUWA 1X1OA 3G0SA 1KB3A 2AKZA 3GXIA 3IUDA 2XM2A 3OTRA 1R6WA 4WXZA 4C6LA 4N9DA 4NIRA 4O0KA 3H4WA 4DJFA 1Q3NA 4D6HA 3KHJA 1MFUA 1G69A 1JULA 5F1UA 2QJIA 4JTSA 3MDUA 4P61A 3ITVA 1HL2A 1R3SA 3GZ3A 2G0WA 2ZE3A 3TZFA 2Z28A 3TWAA 1GQLA 2FHBA 4H9XA 3WD1A 1BF6A 3T0BA 3AIQA 4CGTA 2AQWA 4GE8A 3UR5A 4B2DD 1WKEA 4AMAA 9XIAA 1TJ2A 5FF4A 4JTDA 2HV5A 1CNVA 1BGGA 4E8DA 4DF0A 4C6QA 3D5HA 5LIUX 3THQA 4U3AA 2ZDSA 4JYDA 1BSLA 1XBXA 1B1YA 2Z27A 1OF6A 1EF2A 4TTGA 1OK4A 4X22A 5DMMA 1UW9A 2EPOA 4UMCA 1QNRA 4AQLA 1WA3A 4NAEB 2HE8A 4N4QA 3SBFA 3TTYA 4CQCA 1XYZA 2E7FA 2AQOA 1OG0A 3W1XA 2CWXA 3ARZA 1EO7A 4XVEA 1H7PA 5LXEA 1GYLA 2BVTA 7TIMA 3EWUA 5AC7A 1MYRA 2VYOA 3LM7A 1L8NA 1YMYA 4AZCB 3DBNA 3GC5A 4QRNA 2FTPA 3OODA 4D8AA 3R89A 3KVJA 4JIPA 3U7VA 3CAKA 1MQRA 3VTRA 4H9UA 4JFTA 1H7XA 4UFHA 3AYVA 1XIDA 4FNSA 3LBCA 2ZVIA 3C4UA 1KQYA 3POHA 4GXMA 4CNOA 3CMGA 3K4AA 5LSMA 2PRLA 4Q3MA 2EG8A 1NM9A 3QV9A 3TYBA 1AVAA 1S3TC 4FNQA 4CLMA 2VXNA 3CHVA 2GL5A 2BMBA 1VFOA 3XINA 2PWUA 1SYTA 1J0HA 4EP8C 3GR4A 1E0TA 2OSYA 4MDPA 2A7PA 3LN3A 4IQJA 3BW2A 4M19A 3CZJA 5ABTA 2GJPA 2P8CA 2VEMA 2GWNA 1Q2SA 3GC2A 1K3UA 1H7NA 3MA8A 2OX1A 4ADTA 1Q6LA 3OQ8A 3EDFA 1UP2A 5U7SA 3UY7A 1VYSX 1LTDA 1BTCA 3F4CA 4Z2JA 3WF1A 1VCFA 2X0HA 2KAUC 1G1YA 1NIUA 3LQLA 2DQWA 1I2QA 3W71A 1YADA 3WLMA 3UEQA 4E2DA 1OYBA 3BAKA 4Y90A 3UU0A 1HJUA 4FOKA 3MO7A 2NVAA 4PMJA 1N8WA 1K7XA 5K9DA 3S1UA 2ZZ3A 1IZKA 3MUXA 3T40A 1EDTA 1TIMA 5CSYA 3EYPA 1EP2A 3DFSA 2OZ0A 4GXPA 4JNYA 4LU0A 4S3DA 4QR6A 1ZS2A 3TAKA 5D2WA 1OFRA 3HV9A 4JDYA 5B80A 4I5XA 1NDZA 4QDPA 2FZ8A 5A6LA 3DFHA 4H9ZA 3LLDA 1V6VA 1KM2A 2QW5A 1UZ4A 3NZQA 2PTDA 1PZ3A 4QG6A 3K1DA 4PCSA 4Z42C 2PDYA 3TNBA 4X61A 1W54A 1HXJA 1CX9A 4RPPA 1CXHA 3SCUA 1R3YA 2VEKA 3K5XA 1GYNA 4P7QA 3W38A 4PMOA 4AYSA 1J0YA 4I9MA 4QNEA 2ZXDA 2CHRA 4IIGA 3I68A 3S46A 4ZOBA 2J7BA 5A95A 2NV9A 1OX5A 2YIHA 1O12A 3OHIA 4UOZA 2QDGA 1PVNA 6XIMA 2PLMA 3HGRA 2QJJA 1FDZA 3NWRA 4J3VA 3AZTA 1UA7A 1FKXA 1QPRA 3RX4A 4S3BA 4ZGYA 2FZBA 3B9EA 4KEMA 2WLYA 3EOUA 3AZSA 3MYPA 2Y2WA 4UOJA 5M2FX 5TBOA 3OZYA 1XYAA 2GGGA 1NQKA 4DYEA 5SWUA 3ITTA 2YCLA 1NDVA 1J9YA 1L2UA 4LTSA 4WJXA 4M3PA 3AXIA 3R4IA 2EXOA 4OV9A 3S1WA 3KM8A 4CUCA 4XIAA 3PS7A 1SU5A 3GU1A 4PFMA 3ZT6A 1KGUA 2FPVA 4IT1A 4O1AA 4IL2A 1QO5A 5FACA 3WK1A 1YX1A 1A5OC 1UWUA 3H2MA 3TP4A 3A47A 2PU1A 4DF2A 1J2BA 2VKZG 4W4QA 3NR0A 1O1HA 2DSKA 4F0RA 4ZE5A 4L80A 1C92A 1W9DM 1A0CA 2BDQA 3LV5A 1SW3A 4EACA 3O0FA 4F48A 3EOEA 3W72A 3I3EA 4I6KA 4JDBA 1DJIA 1MO0A 5D04C 5AC6A 2XIJA 1ENUA 4HHMA 3ISIX 3W22A 3H22A 4XK2A 5G5IA 4W87A 1RQHA 3WH8A 3ONCA 1HL9A 4UXDA 4QISA 2VURA 1FVPA 3EGJA 1EXBA 3CUGA 4KPLA 3E12A 5C9RA 1IF2A 4GH3A 3VUPA 4F0MA 4HNTA 1QO2A 3GX9A 3PZNA 1TV7A 1GVIA 4WVXA 1A5CA 1HJVA 3D3FA 5BRQA 2VJXA 3R5EA 3W7DA 5I00A 5JIWA 3F2CA 4H19A 1TO3A 3U2OA 4S38A 4EF9A 3H2NA 4P5UA 1BRLA 3IJ6A 4HB7A 2E25A 4B5NA 1KGXA 3N9KA 3G24A 4Q4MA 3B8IA 4C5YA 5C9WA 1UJQA 4CCEA 1WZKA 2W66A 3ES8A 3GTHA 3CXOA 1ZBKA 3SRHA 3VPLA 4IFOA 2X40A 3TC3A 4HD5A 2OPJA 3VOCA 1JUEA 3G6MA 2WMIB 4H00A 3TQ0A 1OADA 1TPUA 3LXBA 3FX4A 4AZHA 2OODA 3RN6A 1EA9C 4C6BA 3R25A 2Z00A 2F6KA 3FVDA 3TN5A 1XBZA 3R2GA 3HJZA 3UR2A 3SCOA 2FVMA 3IRDA 4ZL1A 2NVCA 1KCLA 1P5BA 1H7OA 1AZ2A 2XVLA 1PX3A 2PDGA 5TF0A 3HFTA 7A3HA 3EXSA 5A94A 2J6XA 3T4CA 5ABHA 2CLOA 3CEPA 2J7DA 3LK6A 3EPMA 5GPRA 3G0UA 1KQZA 1O1ZA 2DFAA 4ZEPA 4EF8A 2Q3RA 4CCZA 4YWIA 1PTDA 3VNYA 3VA8A 2Z4GA 3HG2A 3GTNA 1OIMA 1WO2A 3WDHA 1UKOA 1V3MA 1K1DA 4U31A 1X96A 5A6BD 3W73A 4QDWA 1FRBA 3RUBL 1KXHA 1V6UA 1CWYA 1PKMA 3EDKA 1XRSA 1HKKA 3T0TA 4LANA 4J2PA 1Q6QA 5XIMA 3W9ZA 1WB0A 5AYIA 3CTTA 2YFNA 2QGYA 1F6PA 4HNOA 4L1XA 3WDRA 3H55A 4W7VA 3BLOA 1V0NA 5AVHA 5B7YA 1WBHA 3WQVA 2VWSA 1OJXA 1EHAA 3APTA 1B3WA 1DWAM 4IPJA 1W1ZA 3L5AA 3NZGA 4DJED 3G5EA 3MS8A 4CN1A 1UIOA 2B7OA 3AROA 3XISA 1QU4A 2DU2A 2HJPA 1EOMA 3VZZA 3BGJA 4TMCA 3NL5A 1GJWA 2IMRA 3CWHA 4CN4A 4LQ1A 4GD0A 3WF0A 4DYJA 2X7WA 2FJKA 3QY7A 2GFTA 4ACZA 1NP0A 4DM1A 3W23A 1MDRA 3LU2A 4Z1CA 3VDCA 5LIKX 3KEHA 4MYAA 4CD8A 1C91A 1DHKA 1ZRQA 3N4EA 3W7MA 3NOEA 1W0MA 2VFFA 3N15A 3NQVA 5IOBA 2WKJA 2WLZA 3W81A 4DF1A 5LKYA 5REQA 3GIQA 1BWKA 1OWQA 1SQ7A 5E93A 3AWOA 2Z24A 1FXQA 2AL2A 3JZUA 4J35A 4K3ZA 3QF0A 3LEPA 3DFYA 3M6YA 5G1YA 2G5WA 1FWTA 1X6UA 5BWAA 4WQ6A 3NZRA 1UH2A 4G7FA 5AKQA 4P2VA 3CHCA 1LWIA 2R82A 4IMGA 3ZYZA 5A8NA 3GRIA 2FMNA 3U4FA 5FEZA 4JD4A 1M03A 5JQ9A 3B0VC 3S47A 3BO9A 2Y1HA 2X2GA 3GBDA 4LUSB 3KDNA 1B9ZA 4XQ6A 3O6CA 5CPLA 5D9MA 1CGYA 3E0LA 5M5DA 2WHJA 3BC9A 1UOKA 3BLKA 5FIPA 4TMBA 3OYZA 1L6YA 5EY5A 3WK0A 2YA0A 3QZ6A 3I6EA 3T81A 3ZXWA 1RV8A 3CV1A 2ZZ1A 1EBGA 4J3ZA 2A5HA 1CGXA 5G1MA 3M5YA 2ZWYA 3BQ5A 1H1NA 1VIZA 1OCQA 3F5LA 2ZUNA 1YRRA 1FWHC 5A6TC 2YB4A 3QTPA 3T0DA 2YOCA 4ZENA 4DI8A 2CLMA 1W37A 1E1FA 3S0CA 2P50A 4HNCA 4JYFA 3A3XA 2Z6JA 3V1HA 3GHRA 1V02E 1IWAA 4LEQA 5HMFA 6PTDA 2WMIA 4L6DA 3TKFA 1L6WA 3N34A 4M8UA 1G94A 1RY0A 1TWZA 1QXLA 2WMHA 3VZXA 3AJ7A 4PUUA 4LNYA 3MMTA 1EQCA 4N9BA 4E4FA 2G96A 1CENA 2Y63A 1F3XA 3UW6A 2O4MA 3K13A 1UIPA 1QWKA 1DP0A 1HF6A 3D47A 4RDYA 3EXRA 5IFTA 4CCCA 2VD9A 2R14A 1L0PA 2O9PA 2GGHA 4R53A 1VS1A 1GJPA 3F7JA 3VUSA 3UFYA 2W67A 4KEVA 1U22A 1Q6FA 2ZUVA 5DT7A 3WEMA 5LIWX 4GWEA 8XIAA 2A3LA 3CC1A 2V8ZA 2ZX6A 4QJ4B 2V69A 1WE5A 4V2XA 4D6GA 2BB0A 2WVUA 1RCQA 3W7EA 4LAKA 3K4WA 4S3GA 4JKKA 4YL2A 3NQMA 5AN7A 1YNYA 5CGTA 1E6SM 1UZDA 2C71A 4MADA 1EO5A 4HU4A 5TAOA 2PB1A 3NXLA 4AMCA 2VRKA 3ABZA 1G4TA 1UB3A 4PRTA 2DZBA 1BFNA 3L66A 1TV8A 3EWBX 1PCWA 1KWGA 1JDDA 4H8VA 4UMBA 3ZT7A 2DUAA 1OYCA 3HPXA 1V03A 1OFOA 3MMUA 4GVHA 3LSBA 3UYIA 3ZWSA 2C1IA 1KFWA 1ZY9A 2WNQA 3TN3A 3OLGA 2WANA 3A13A 4B16A 2WMFA 1LT8A 1XR2A 1JQXA 3DFTA 3ZR5A 4HU8A 5FCZA 4LS1A 3GB6A 2CW6A 2D3LA 2ONEA 3QSRA 2WJZA 4KF1A 4UQ9A 3S83A 4XV0A 4HQVA 3TXZA 4B5SA 4RZ6A 5FI8A 3VD5A 2WSQA 2OX4A 1C9DA 2NUXA 3BJTA 3A3WA 2BGQA 4N0RA 4HYVA 4L61A 2EPHA 2J9ZA 4FAMA 2NX1A 4JFWA 1W8GA 3GYCA 3P8JA 1C8YA 3H4XA 3PF3A 5JBDA 1ZALA 4A3RA 3N6QA 4BCEA 2O0TA 2YW4A 1RPXA 3PG9A 2EKGA 4UTWA 1A5MC 4QAIA 4IMCA 3T09A 3V0UA 3QC0A 1JPIA 1W32A 2INFA 3MUY1 3WLOA 4S3JA 4AHPA 1F4AA 1KRBC 1FHDA 1XLIA 1I1XA 1LDCA 5A8MA 2VZOA 2JKAA 2Y6ZA 4JTFA 3WF4A 1IT8A 5K2ZA 3UA3A 5I3IA 3UVAA 2X41A 2UBPC 1WPCA 3NL3A 2PDPA 5HWJA 3Q45A 3GAKA 2NWSA 1B57A 4B91A 5XIAA 4DJFD 4IP7A 3H54A 1Z8AA 1S2UA 4YHEA 1X7IA 3E2VA 4LRSA 4QM1A 4ZMGA 3IJQA 7TAAA 5AC8A 2Y88A 5EFDA 3AMLA 4XUGA 5J5RA 1K03A 1HW6A 1UYQA 1Z69A 4AYGA 1FH9A 4JAWA 2WPGA 3MUAA 1E71M 2ZE0A 3UGRA 3KTXA 1WKDA 3NQ6A 1T6MA 1BXBA 1B9BA 2PZNA 2GUUA 3P82A 1XYCA 1Q6OA 5BOOA 1F3EA 1RLCL 5KMYA 1E9LA 2DZAA 2WYSA 3RJYA 4JIHA 3FHAA 5LHFA 3M16A 5A2CA 4FLOA 4XUYA 4RE4A 5CC7A 3BMWA 1GOIA 3O3RA 2XGBA 2OCZA 3HV8A 3UCCA 3UXAA 1YE4A 2J8TA 5CJNA 1BQCA 3TYZA 4L9ZA 5FJRA 2C91A 1K4HA 5CAHA 1KXQA 3PAJA 4X2RA 4EVZA 3O6YX 3L4TA 2EBNA 4NRSA 3U7BA 5HQLA 4NJGA 4E4PA 3W01A 1Q6GA 2W0UA 4Q4QA 1XUUA 3TIMA 1XYFA 2J47A 4GGHA 3V75A 1WZAA 2P76A 4LY8A 3VKDA 2DZSA 1CXKA 3T7VA 3QHOA 5K3VA 3VOJA 4R88A 3I10A 3TXVA 1NOFA 1ZZMA 4LUSA 2E68A 1W3TA 3NQBA 5CG0A 1UP0A 3QKEA 1FHLA 3L0GA 2XIOA 5JU6A 1FWCC 2XZ7A 5LGXA 1QVBA 2D0HA 2Q8ZA 1FCUA 3IK4A 5KZ6A 2G4JA 3GG1A 3WZ0E 1XIGA 2CU0A 1AQFA 2VEFA 2ZTKA 1WYIA 3N2MA 3C2FA 3W82A 2YX0A 3ZVHA 4V28A 1AG1O 3ANYA 1S5NA 3RGTA 1HKWA 1R9ZA 3H4GA 3EKLA 1R2TA 3PPGA 4Y9OA 2PSNA 5KTLA 5JXQA 1Q7ZA 3B03A 3ATYA 2R1NA 4Q7BA 1VFHA 4JPGA 2RDUA 3W7OA 1XYMA 3IGSA 3KCJA 1TZ7A 4ZB0A 3QGKC 2ZZ4A 3EAUA 3S6TA 4O14A 2NQHA 4AZ7A 3RYSA 3EX1A 5E0CA 4HOZA 4UTLA 3QYSA 2XINA 3IUHA 1RD5A 1PIFA 1JD9A 1S5MA 4E5TA 2QUVA 3STPA 2VVSA 1OFBA 1XHGA 1BXNA 2X1IA 1JPKA 3L5LA 4US6A 3ITXA 1QK0A 3NQFA 5A6BA 3PWIA 1OG6A 4Q6XA 3W0KA 4C6CA 1WDWA 1M7XA 1TCMA 1TRIA 2V5DA 3I6TA 4KFPA 1YPIA 4ATLA 3UG5A 3MANA 2EPMX 1KM1A 3AUJA 4XKYA 2QDDA 4D1JA 4GUIA 3NIYA 3SRDA 1S2WA 4NAFA 4U28A 1IT0A 1ADSA 2VNCA 4P7RA 1US2A 1JDCA 1TUXA 1EPVA 4D1IA 4BZYA 1KM5A 2YXGA 3FHQA 3REQA 4B4HA 3UA4A 3RLUA 4UMAA 2PDMA 4DJDD 1QOXA 4OGZA 1Z32X 2WVVB 3CQ0A 4PTXA 1OQFA 4HPGA 2OT1A 1TWIA 2FYMA 4WJEA 4JS3A 4Q7IA 3W00A 3KTCA 2QT3A 4H3DA 4IGHA 3WBEA 2ZQ0A 4PMYA 3SUUA 2Q02A 5AFDA 1FWEC 3A22A 4AIEA 2OLSA 4MIMA 4NU7A 4UOQA 5XINA 4ZXOA 3C2RA 4XAGA 3M0MA 2YSWA 2PP0A 2CZ5A 4QP0A 4P8XA 3GFYA 5I23A 3S1XA 4FOJA 3M0VA 1HX0A 3UYCA 1B5TA 4LYRA 3KUMA 4YTQA 4QJ3B 5KZDA 2QJMA 3BOXA 1KXTA 2DVTA 4MWAA 1GOWA 3OZMA 3JW7A 3IAQA 4IH3A 4NJHA 1M65A 2YB1A 4OWGA 3S5SA 3T44A 4AZGA 5BOEA 1H09A 3GG0A 5AVNA 1TMLA 4M82A 2CXGA 4LC8A 1CBGA 4CQBA 1F61A 1GVQA 3N11A 3S5NA 1RXOB 2X30A 1UG6A 5A2AA 5HR6A 2VX4A 4I6VA 3WH6A 3U2ZA 4GH1A 4LBSA 4LFYA 1R3QA 5AY7A 1P0EA 3MBDA 4HGXA 3N4AA 1IEVA 4N4PA 2A1YA 1DQXA 1EC8A 1JUKA 2CERA 4PCPA 4TV5A 4HJWA 4CEXC 1PKNA 2POZA 3MUZ1 3ZJ7A 3EOOA 1EIXA 4QEEA 4K36A 5LNWA 1C3FA 3ITGA 5FSDC 3T05A 1C7TA 5A2BA 4WDXA 4PTWA 2Y8KA 4AY8A 4QE5A 2XN0A 3R8RA 2G3IA 1BYDA 2P3EA 2XFFA 2BY3A 4HPJA 1DTNA 5AYXA 2FH8A 1WBJA 3LB0A 1P0KA 1OGBA 1TVPA 3WSUA 5C55A 3VX1A 4L9XA 1PHWA 5JUVA 2O4QA 2VCAA 3TFXA 4WDWA 1JDAA 1XIFA 3GIYA 4DO4A 3TE9A 2E40A 1VC4A 1S2VA 1W3LA 3KBJA 1XRFA 3NL6A 1BTMA 3W4RA 5DMNA 5AZ0A 3EEZA 1F76A 2J75A 3OIXA 4WXYA 4MUPA 3HO8A 2BWGA 3MBFA 3IIVA 5D9OA 4PMXA 2QMKA 3W1AA 2DZUA 2PFHA 4AWEA 2HXTA 5L6UA 4NZ3A 1VFFA 3RNDA 1F8IA 4O4WA 1F07A 1UHVA 4GUFA 2Z1BA 1VF8A 5CSUA 3CB3A 1AK5A 3A4WA 4NT0A 4Z1AA 4M80A 2CLPA 2F61A 2HNEA 3DFPA 5CBJA 1MUCA 1P1MA 4GX9A 1ODUA 5FAGA 3HZ3A 1E6RA 2PDNA 5T8GA 2X16A 4N6EA 4MGGA 2PDWA 3WDQA 4DAFA 4M29A 2VR2A 4UFKA 2CBUA 2ISFA 3NQDA 4H9VA 4GISA 2WCAA 1GNXA 1Q63A 4CNSA 2OSXA 3A4AA 3CHEA 4LUYA 2ZRVA 4FA3A 1F73A 4A6GA 3TW9A 3CO8A 2DSWA 3GKAA 1J4EA 1QT1A 4E2VA 1B4EA 3WNLA 3WQOA 3GM8A 2PZ0A 2AMXA 2FTYA 4C1KA 4IIFA 4HU0A 4DM2A 4TO8A 3AU6A 4DBUA 4UR8A 1LORA 2OEKA 5FSEC 4CQ8A 3C52A 3PUGA 1UMYA 4PUWA 4U3CA 4A3UA 2O92A 1N7KA 4F2BA 4E38A 3ABXA 3KL0A 3GXDA 1O5XA 3AU2A 5DCDA 4P7NA 3GUGA 1KBBA 3VNDA 2PDUA 1WXZA 3QR3A 2HVNA 3NA8A 1VIWA 2WHKA 2QCNA 3IPWA 1U5HA 2X1TA 4W89A 4L64A 5D05A 4AF0B 3KBSA 4YXGA 2J27A 4HYWA 3VKKA 3PN8A 3E0FA 3USBA 3H2EA 3IVUA 4M5PA 4JTHA 1RBAA 5F4WA 5G4EA 4JHMA 5DEZA 1K7FA 2PLCA 5DXYA 4QQ3A 2OGYA 3SCRA 2JKEA 3VVGA 1DJNA 4LGXA 1RBLA 1ZAJA 4AU0A 4OT7A 3WELA 4WSKA 2PC8A 3GO2A 4I3GA 1LP6A 3KVMA 3WNPA 1T8XA 2GK1B 5AHMA 5KEZA 4AZBA 1UC5A 2OLHA 1OZQA 4OFCA 2PDKA 6REQA 3GNXA 1KRMA 3EWWA 2O9OA 1TJ1A 4RE2A 1AL7A 1CLXA 3I3BA 4BI6A 1D7KA 4FLQA 5D37A 1M04A 2PDIA 2B31A 4NZ4A 3ZOAA 2HBVA 3HA1A 3K30A 1P48A 2CHNA 4UCFA 1JIBA 3OVPA 3T8LA 1EYWA 2B81A 3DFOA 4ZSUA 4DNHA 4NAFB 3C8NA 2PDBA 1CB2A 3MWAA 3O7UA 3UXKA 4Q4KA 3CM4A 3FGCB 2QCLA 4K1WA 2V30A 1CGUA 4QS6A 1XLEA 1W9PA 1TV5A 3SM0A 3VK5A 3OGSA 1V7AA 4IX2A 1A53A 4ORMA 3HURA 1TREA 3Q4DA 1E0VA 5F2GA 3SQMA 2BOGX 2RDTA 5CZKA 1GWJA 3IJ8A 2Z29A 4A3HA 5ABFB 4M81A 2PC4A 1OB0A 2ZC1A 3SCSA 1DOSA 1TCDA 2WW5A 2D23A 2CZEA 2CPUA 4BF7A 3ELFA 2R1PA 1VBRA 5ECVA 4PTDA 2NUWA 1KXVA 2VTFA 2WSPA 4XD6A 3BLLA 5M17A 1IWPA 5L9FA 4NJJA 1IT7A 1JYVA 1JVNA 4R34A 2HDJA 4HNLA 1OCNA 2WWCA 4BI5A 1SJBA 3MUIA 4YHGA 1G4EA 4UTIA 3DGRA 3OLEA 5C2CA 2BVDA 2YCIX 1ITXA 3WG6A 1IEXA 2MUCA 4MJMA 3P84A 4NZJA 4IPPA 3WBWA 4GJJA 4DZIA 1RJRA 1R5YA 3B8UA 1FWFC 4IZGA 1E3XA 2DZWA 3GFXA 3PZOA 1RP9A 2P0OA 3FA3A 1PZ0A 3EDEA 3TYAA 2NZLA 2W91A 5GJNA 2XG9A 2WPBA 4RUBA 3TC6A 4MY1A 4J27A 3EOSA 2A79A 3WQ6A 3UXDA 2GJXB 1XUZA 1YIXA 4FXJA 2D22A 4H7VA 1XM3A 1MEWA 1THFD 4E3VA 4WHBA 4YCPA 1DYSA 4ZE4A 5C9ZA 4C1NB 1XLBA 3FAWA 1BYBA 2BVWA 3R94A 3B0PA 1N8IA 2GGEA 1AL8A 2FH6A 3CUFA 4GVFA 6REQB 4DJFC 3AS1A 4ZQPA 1F74A 3CUJA 1MEIA 3QYQA 1C9WA 4FLRA 4UQAA 1E4NA 2G3NA 1F3WA 3V0TA 1EZWA 1DE6A 5I09A 1XW8A 1H1YA 3L68A 4XZIA 1OX4A 5DQPA 4AX6A 2G37A 3A64A 3GE7A 1F5ZA 3LGDA 2WXDM 1X6LA 3I3DA 5TD4A 4HCHA 2HPIA 3OG2A 4F66A 4RW3A 3CYVA 4DNMA 3GG8A 1MNZA 4S3CA 4GLEA 4FX7A 2I1OA 3A6OA 3DH7A 3TROA 4AVFA 5IBXC 3II1A 1Q7MA 2Y70A 1XCFA 4L1GA 3BG9A 1QAPA 1UWRA 4AD3A 2I5GA 3NEVA 3UZWA 1SUXA 2ZXAA 2VENA 5C70A 3JS3A 4FZIA 3W2NA 3GYEA 3GTIA 5K7JA 1PEZA 3VIHA 1PB0A 3WFLA 1NVMA 4IPIA 4O8RA 4YJ5A 3RX2A 3E2QA 3U8GA 1OD8A 1R2RA 1JCJA 4H6EA 2J62A 5GJMA 4H2HA 4OQVA 4ZZ9A 5DY3A 1YPXA 1CYGA 2QF7A 4ROQA 2QCGA 2YA2A 4MFEA 1UH3A 4DJEA 1UD4A 2P53A 2H8ZA 2XGIA 4HHPA 4JTUA 4K6AA 1W1TA 3CMJA 2VFEA 3G1XA 3QQ1A 4IF2A 3FY1A 4Q8WA 8RUCA 1TA3B 2ZUMA 2YXOA 4ZODA 5BXPA 3LS9A 2X2YA 5I0DA 2CCRA 2G3FA 4Q8VA 3NO5A 4QCFA 4EX4A 1Q6EA 4PEEA 3OJGA 4EPKA 1A5UA 4JTIA 2BXZA 4MWAB 3N1AA 1X1ZA 5C5YA 3ABRA 4KCUA 4TVDA 2JALA 5EGRA 2DVXA 2PBGA 5A8QA 2X42A 2VGIA 5I2UA 3A23A 1O66A 2YCLB 2VFIA 3WL0A 4UTMA 4GZ7A 3DUGA 3C86A 4GYPA 3OZPA 4MAVA 3LZ5A 2AKMA 3W88A 1R30A 3S8HA 1GVEA 4G6CA 4INFA 4LVAA 4GHRA 4QTGA 3ARWA 3VE7A 5D2YA 2WJEA 3NTYA 1MDLA 5HJLA 4WY0A 1UWQA 1O95A 1XSKA 2DIKA 4J5NA 4HHLA 5KINA 4HK7A 1DIEA 4PMUA 4PODA 4L4OA 2PDJA 2LLEA 5C9UA 3LRLA 3WQDA 3CTLA 3QW4B 2WQDA 2VP8A 3AMKA 3GFZA 1PV8A 1U1JA 4K2SA 1BQGA 3UG3A 3P74A 4H2CA 1XH2A 4WF7A 3WLSA 2WNWA 1Q7QA 1S5TA 1T5AA 3GHTA 2E1DA 4W7WA 4D6DA 2FLIA 2HK0A 1EP1A 3RITA 4DZHA 4HK5A 1VLWA 2XIMA 4GFIA 2VX7A 2A3EA 3WMCA 3VOGA 3IV8A 1V0MA 4MG4A 5A6JA 3V16A 3WQCA 1TPVA 4FIRA 1CGVA 3GVWA 2IPGA 4DZ5A 1J12A 1EJWC 1JCNA 2J66A 5H2ZA 1OT2A 3HPFA 3DYPA 1ZB5A 1H50A 5FKYA 3PTDA 3ARSA 4O28A 4HKPA 5D8WA 3UGVA 3O8AA 3R79A 3TNOA 4EKJA 3SGZA 4XAFA 4O1EA 5CZSA 3IV3A 3VGHA 3NVDA 2FVLA 1RSCA 3IRSA 3AICA 2QEZA 1HJSA 4W5ZA 4U5IA 4IUGA 4QX4A 2ZYFA 4LW7A 1IIHA 3TK7A 1A80A 1E56A 2GVEA 5T91A 1Y5WA 3W6LA 2O56A 3SCNA 4DHGA 5JBEA 1RBOB 4MMWA 3REQB 2W61A 4LYKA 4DUXA 4IIBA 3VU2A 1FFRA 3W07A 1XL9A 1G7VA 4PUDA 3CH9A 2FVKA 5I77A 2X0YA 3JRKA 3KWSA 1Y65A 1M41A 1H3GA 3G1DA 4UC5A 5I6SA 1C29A 4M6UA 2RKXA 3GKFA 3DYOA 1MZHA 4UTTA 1E6PA 1XPGA 4RKAA 1FWAC 4OE7A 4EXQA 5DF0A 3G2GA 4FXRA 4GKLA 1I0BA 2PP1A 2ACUA 3MYOA 4KWSA 4HTBA 1FH8A 1YDOA 4I7UA 1R8LA 3W1NA 3NPVA 2WB5A 1TX2A 4Q8NA 1X98A 2FMOA 1TVLA 5EFFA 3W28A 5TIMA 3AIBA 3N17A 4XAZA 3EB4A 3RIKA 2FB3A 2CLIA 5CJMA 2Z7GA 4EWJA 4FSAA 4AH7A 1GQIA 3SADA 3CAQA 1LL4A 2CLFA 2Y0FA 1WQ5A 3S3GA 1ZSXA 3R8GA 2VHLA 4FNTA 4ZOAA 2C3ZA 2FDMA 3MI6A 3QLLA 2YLAA 4Z2KA 2WC4A 2BXVA 4WIWA 3W6MA 1GEHA 2YCEA 3VMOA 2CC0A 3KOXA 4M56A 4Z1BA 3GLCA 3QMSA 1R3TA 4O10A 3AIUA 3F03K 1L9WA 4AIOA 1C8XA 3C61A 2GVJA 1U1HA 5HBFA 3AMGA 3FYYA 1ADOA 2GQAA 3N19B 4CVWA 3MW7A 3NQEA 4DWSA 8XIMA 3EWDA 5DFAA 4QSFA 2XH7A 1M7JA 1L2QA 1GVOA 3ZWTA 3PP7A 3VKCA 2VO5A 1RK6A 4HZ6A 4O16A 3GTXA 4WGHA 3GDMA 1JFHA 1QNOA 3BVJA 4LT9A 4Q8UA 3M5ZA 3MCMA 2INEA 2V5CA 2E3ZA 1W2VA 4HT3A 3GU9A 1SJAA 5CGQA 4YPJA 3H8AA 1Y8BA 2UWFA 4AC7C 1TWWA 3QMTA 3THDA 1LOSA 1X8FA 1V6XA 3SJNA 2CLKA 1OFQA 1U30A 4IQDA 3ERPA 1TUFA 3PZGA 1OSEA 2BSLA 3U6WA 4TXEA 4JX4A 3VOIA 1GOOA 3MU7A 4F8XA 2XH2A 5F1VA 3URQA 4A2SA 4GIEA 1QPQA 3CPGA 3M1ZA 3RR1A 4UFJA 3EEGA 1TJRA 4K8GA 3FFSA 2A7NA 5IFPA 2PDHA 1PZ2A 3NSMA 3KL5A 1TPB1 2QNEA 3WYZA 2G97A 2JFEX 1WAWA 2RJGA 3BAXA 4IGMA 2EJ1A 4YVPA 1V93A 2XJ7A 3N6JA 3AQUA 1F05A 2R24A 4PA8A 3OLIA 2ANUA 4LWWA 5KZMA 5ABGA 2QQ6A 3G0XA 4NZ5A 4AC1X 3LY0A 3ZQ9A 3NQ8A 5DRIA 1SZRA 3DECA 1SR0A 1TR1A 4POCA 3LI1A 4KKXA 3WLLA 4EPDC 1R47A 3VIFA 3VO0A 1JZ7A 3SDOA 4JIIX 4Y9NA 2EEXA 4AZ5A 1UBPC 3BH4A 3HTWA 2QPUA 4LCQA 5I3HA 4HOWA 1OFAA 3UF9A 3DFNA 5E09A 3G1YA 8TIMA 3MVIA 4M6QA 1BG4A 3B0UX 5FL0A 3WIJA 2QCDA 4U2ZA 4H8UA 4H9TA 2OSWA 1AH3A 2W62A 4AWUA 3KDOA 1W3KA 1MWOA 2WQPA 1A5AA 1MFVA 4QLJA 2CHOA 3LHZA 3SGUA 3IIPA 2BP1A 1US3A 1YPFA 3FS2A 2EO7A 2QVNA 3IJ7A 4ROPA 2BGSA 3CQKA 1T96A 3KP0A 3MSGA 4JQAA 4KRUA 1YKWA 2JEQA 2WVTA 1PYFA 2E6YA 1VENA 2Q09A 4RDVA 1F7BA 4BJHA 2JGQA 1AH4A 3W7IA 1XINA 3BSGA 3L5MA 4UUIA 4H83A 4DPQA 2X0SA 4NNCA 4C91A 3XIMA 3SY1A 1DBTA 3BV4A 4MKSA 2J7EA 2R9RA 3WMSA 1ZJBA 3EWCA 5IXEA 5BRBA 4OVXA 3MJMA 3QHMA 3WENA 1ZJHA 3S2MA 3KVKA 4UR7A 4V27A 3BPWA 3SB0A 1SFSA 4PTVA 1BEUA 1RALA 3DCPA 3TQVA 3RLHA 1D3HA 3E6EA 4JTJA 2WZHA 3PPFA 3OA3A 3KOFA 1TTQA 5DO8A 2OQLA 4RV8A 4ICMA 2JIWA 2E9BA 2PD5A 1WZMA 4F0KA 3DX5A 4WGXA 1QNQA 3H7RA 3VFLA 2CETA 3M43A 3WQPA 3QPYA 4HA0A 3SJ3A 1TQXA 4LNCA 5G2IA 4O17A 1TE6A 3IJIA 4YIWA 4W8AA 4JQ1A 1GT8A 3MCOA 5PTDA 1NFGA 1SPQA 3CZEA 1HGWA 2ZVRA 2PMQA 5REQB 2Q71A 2V6AA 4NX0A 4DY1A 1XLKA 1ONWA 3W3OA 4JGDA 4C7FA 4LY4A 3PUDA 3E02A 3OOQA 1DWIM 2W3ZA 4ML4A 1VZWA 4UFLA 3GXFA 4FX8A 2GDVA 3B9DA 2ZDRA 4L56A 1XYBA 4JN8A 2AGKA 3O6DA 4LYQA 1UCWA 1KFCA 1PPIA 4NXKA 3EX6A 4RX0A 1K9FA 2VEPA 4AVNA 1HT6A 2WWDA 2J9YA 4V15A 3ABQA 3L2MA 3PBGA 3RR4A 3B4YA 1Q8JA 2W9MA 4AVOA 4XD5A 4AX7A 3C8FA 3KLLA 3VYLA 1VFTA 1SZGA 3FLUA 4GY7A 2C13A 4W9TA 4HNUA 2TMDA 5I24A 1P1XA 4PYSA 1J0IA 2CESA 5CC3A 1F6KA 1W1PA 3FKRA 4C65A 2FGBA 1YNPA 2Q8LA 4V33A 2OOGA 4O50A 1GQKA 2Q3OA 1GQNA 1DQWA 1E5NA 4LUTB 2OVLA 2OB3A 2C7FA 5EYWA 4GOAA 4KERA 3ITYA 1DEDA 4MYXA 3OP2A 3LSCA 3Q65A 3W2LA 4R5EA 5JBFA 4H8HA 3STFA 3QW3A 3LPFA 4M0XA 4N9CA 1A3HA 4IQLA 3N6HA 3A4XA 4ZB5A 4GMEA 5D2TA 5HQMA 4C6MA 4JIEA 3DKJA 3WH9A 3MC5A 1JDEA 4D6IA 2V2DA 3LV6A 4GNJA 1W56A 1MSSA 3MPGA 1ECEA 3TCEA 4GC4A 2FIQA 4C7DA 1BAGA 1XRVA 1UP3A 4DEFA 1NTHA 5DANA 5A6SA 3PAOA 3CMFA 1KFKA 3PANA 1B30A 4PB4A 5C6MA 4NKCA 4OUEA 1EBHA 4JBRA 5CH9A 5C0QA 3WJWA 3KCOA 4I5RA 3DN5A 4ADSA 3PZTA 4GVIA 3TYEA 1LG1A 2H9AA 4QAWA 1K8YA 1P6WA 4E4UA 3G8RA 2WHMA 3LERA 3NAVA 4KFOA 1A4LA 4OKDA 2VGFA 4Q6JA 5D02A 2JF6A 4ZTYA 2WM1A 3VABA 4PUNA 4PBEA 2UY2A 3W2UA 1ZUAX 5JIPA 1PWLA 4YTRA 2BY0A 1UD5A 5AOUA 2QULA 2YR1A 2OZ3A 3QBUA 3VILA 3OHMB 1J79A 1W8SA 2J8GA 1K8CA 4KQNA 2WC3A 4JQ2A 1MXGA 3BXWA 4N2YA 3DXIA 4K7YA 1JXKA 4JIRA 3CWOX 3CLMA 4H01A 2VELA 4A8IA 2D1ZA 1IZJA 1PO9A 2RH9A 4N6FA 3KX6A 4LB4A 3ARUA 3ZVIA 4PRRA 2XWDA 3P5YA 1EPXA 1J0JA 3GHUA 2CZFA 5CJ5A 1HJQA 2VRJA 5E0FA 1QW8A 1JEZA 3BICA 3TTQA 1FHVA 5FAJA 3NQCA 1OC7A 1KTBA 1R86A 5HOSA 2CZDA 4N9EA 3SN4A 3BLEA 5G1TA 1FHUA 2Y89A 3H6OA 1VYRA 3F5KA 1BWLA 2POTA 4HZ7A 5T9CE 1NWUA 5CPMA 3EMCA 3KE0A 3L4XA 1H62A 1ZNNA 2V5KA 5D09A 3DZ1A 2VWTA 4ZQMA 2Z2UA 1EJSC 1JI1A 1EOKA 3PTKA 4JTKA 4UTWC 4B5TA 3UWZA 4GIRA 2ISDA 4Y9MA 5I3FA 3L7RA 4FB7A 3VGFA 3EKZA 1JNDA 1H60A 2HVOA 4K39A 4GZJA 2ALRA 1EKOA 3TA6A 5F7UA 3LHVA 1GOQA 1QMLA 3RXZA 4LRTA 4DJDA 4O0QA 1SO3A 5E5CA 4W84A 1LWJA 2E09A 3CL8A 2FZDA 1XRTA 1A3XA 2C14A 3HPSA 1W5PA 3MTWA 2C19A 2VUYA 4KCVA 4UQCA 1LL7A 4LALA 5ABEA 2I5IA 3LHTA 3WQWA 1SGJA 2PODA 1QBAA 3GR7A 3BANA 3R6IA 4E8GA 2F6UA 3KZSA 1H63A 4K37A 1CEOA 3L65A 3W02A 2KX9A 1JYXA 4O1FA 5AZ1A 1I2PA 2WSYA 1V3KA 2X8RA 4CQ9A 1T40A 3N2BA 2XVKA 2OOFA 3UBPC 4GXWA 1SVDA 1R3VA 1FXPA 4UTTC 4F40A 1KA9F 1DWHM 4QE1A 1UBSA 4U33A 3IACA 4AEOA 3BAWA 2E5DA 2SFPA 3BWWA 3LA4A 1W1YA 1NARA 3NURA 3BCJA 4A21A 1B3ZA 1GVFA 3MSDA 4XO6A 5FESA 3KRUA 2QCMA 4PE8A 2J24A 3VKAA 1PAMA 2AOSA 5EMKA 1A50A 3NQ7A 3DKLA 3GAYA 3LRMA 1YTEA 2I9EA 3TSDA 1OT1A 1W3HA 5AHNA 4TX6A 3TJIA 2NLYA 4J1OA 3M7WA 5MHBA 2PP3A 4JY8A 6XIAA 3JR2A 3WD0A 4CNTA 4ORIA 3W27A 4CU6A 2EG6A 1AJZA 1KTCA 2D2HA 3EZ4A 2XM1A 3GY1A 3DG6A 4A2RA 2P8BA 4DN1A 2MANA 3G1FA 2YL8A 5ECUA 3AHXA 3HM7A 2XH0A 2V38A 3IS4A 4IX0A 2J4GA 1HKMA 1LLZA 4Z1YA 4JCMA 5JVLA 1WXJA 4ALDA 1FP9A 3DI1A 4XTDA 3ORWA 2XPKA 1RVKA 3HOJA 1JCTA 1OX4B 4UTUA 4AB4A 1KFBA 1QOPA 3LHYA 1CXEA 5K9CA 4ZO8A 5BMWA 2E6DA 3VGBA 2XVPA 3T0CA 3ARTA 4HZ8A 1ZHAA 3CH0A 2W4XA 1LBMA 1JZ8A 1I45A 4QQUA 1KV8A 1A49A 2QXWA 5EL1A 1LL6A 5D32A 3QEZA 4PH6A 3E2RA 3B8TA 3GSMA 4OUIA 1HGYA 1RJPA 1AW1A 1K4GA 1KO0A 5AC4A 3HPAA 1Y7VA 4YU1A 2W79A 2QHAA 5BYWA 4Q8OA 4Z2IA 1OBAA 2EHHA 5FEXA 3OW1A 1IV8A 4BWLC 2GDUA 5D4YA 3WNOA 5E1QA 1H61A 2JKPA 3BLDA 4DWSC 4IM4A 4DRSA 3TN6A 3EDDA 1CPUA 4NAEA 5AHEA 5DLCA 1XLAA 4QS5A 4DVOA 4X2PA 2WSKA 3N13A 1H49A 3RLVA 3R0UA 3U5YA 5I79A 1A5KC 2Y5EA 1N82A 1I1WA 3TA9A 4DX3A 3VIJA 1ZAIA 2BASA 3RK8A 1JZ3A 3HMCA 3UZ5A 1JRBA 1PDZA 3BLPX 5EKYA 5BCAA 2QCCA 4Y7EA 3GHSA 4Q8TA 1RCOB 4NYUA 3INPA 4US5A 5BXTA 2X1SA 1ZAHA 1CGTA 4X3ZA 1NJJA 1GW9A 2PUZA 3L67A 1ONRA 1QDSA 3V5FA 2HS6A 1TX0A 1FWDC 2C0AA 2GQ8A 4O12A 2YL5A 4KIEA 2Z26A 4PMRA 1XCWA 2QDHA 4W8LA 5HMSA 3LOTA 3LHUA 5CSRA 5FEWA 3B97A 1B3VA 4ZQOA 3R8HA 1ML1A 1E0WA 4D8ZA 2OEJA 1EDGA 2VGBA 2F9RA 1CECA 4LXFA 3SEPA 2DJXA 4BQ4A 4XIMA 3DBPA 4UWMA 4D2JA 4M51A 3CUZA 4P7OA 4JHOA 2QCEA 4JQ4A 5D2VA 3AOFA 4FXSA 4JIQA 1WDQA 5FJTA 1LM1A 3K2GA 3LCGA 1CGWA 1O4UA 3E0VA 4NF7A 4Q8MA 3SIMA 2PCEA 4FP1A 3W2MA 1R3RA 3GDLA 2GQ9A 5D8ZA 3N25A 3AFBA 1V5XA 4MWAE 2QR6A 2X05A 2IPFA 4NQ1A 2G3MA 1SW0A 2DSVA 4LS0A 4H9MA 5H8MA 1JNEA 2G8ZA 1U1UA 4QG9A 3SY5A 1OCBA 1LRQA 1J5SA 3PJWA 3M0XA 1S2AA 3KLKA 3ZSSA 1SSDA 1JG9A 1JD7A 1ZFJA 1K9EA 2FGZA 2WOQA 2WVSA 3NQAA 4J3SA 3FXGA 3BL3A 4OBRA 1W1A1 4OJYA 3N3MA 3E3HA 1JI2A 1SZNA 1EGMA 1I4NA 5FF3A 3WBYA 3EWZA 4HMNA 4XAYA 3O1NA 3T78A 4C6OA 2ZC8A 3IJLA 1LZOA 1ME7A 2OWWA 3LLXA 3QV6A 2Y5SA 3UWYA 1GVSA 3WUGA 2J25A 3COTA 1TWSA 2DZVA 3GNRA 1XC6A 2VX6A 4QSHA 1RK5A 4B9YA 4CU8A 1LQAA 3M0HA 1LROA 4NZ1A 4WOQA 5D2XA 1MVYA 4PC8A 3FYPA 3VIKA 4ATDA 3B4UA 2QZRA 4JYEA 1WNOA 4DXXA 1V77A 4E8CA 4H04A 2CNCA 4GGBA 3WUFA 1V02A 4AWTA 3FJ6A 2E67A 3GXNA 5CLWA 1QHZA 3WDPP 2Y8VA 5CEWA 1UPMB 3TUUA 1ZLPA 2VDGA 3RU8X 3B0XA 1MUMA 3NQGA 5KETA 3RG6A 1DIKA 1K02A 7REQB 4G56A 2I16A 2PRHA 3G1HA 2ZRYA 1FCQA 1E9ZB 3S6DA 3PJXA 4FHAA 4AZIA 2V0TA 2VFGA 2PWDA 1F4HA 2E77A 1XV8A 1W2PA 3FVMA 1BSIA 2YYUA 3SCTA 2L5HA 2WC7A 1R9XA 3VINA 1GPWA 3O63A 2OXNA 1WXYA 3F1QA 1E6ZA 2GVGA 4LVDA 2HNHA 5A1AA 3GNPA 4O8AA 4IXHA 1UWTA 2WCSA 1C7SA 1ZGDA 3PJTA 4WX2A 1B4KA 4R7JA 3QPEA 1PHQA 3LNPA 5BU9A 3WDJA 3KBNA 1DXIA 2PI6A 1NDYA 2E8ZA 1JZ2A 3LCLA 1P0NA 3GK0A 2YDQA 5BMXA 3MT1A 1E40A 1MRAA 4AXKA 1A4MA 4HN4A 3UVIA 2XN2A 2NWRA 1UUMA 4OBSA 3OBKA 3FOKA 1ELSA 2VZSA 1IQ8A 1OABA 3WQFA 3GXMA 3QQ0A 3NYZA 3E74A 4I8YA 4BF9A 3V36A 3BZJA 4WZHA 4O13A 1OGGA 1IEIA 4O53A 2IQ0A 5BU6A 4CKQA 2H3DA 1NH6A 1W9BM 4J28A 2F38A 4MWAD 3TMLA 4PMDA 1OC6A 1SFLA 2HVMA 3A5FA 3IGXA 4O1DA 4IJCA 2YXXA 2PBOA 4S3EA 1S5WA 4GRSA 1A0DA 2ZRUA 4I9JA 3STCA 1XI3A 1A5LC 2PD9A 3CUHA 1TG7A 2EAWA 4YN5A 1BLIA 4HCLA 3CHFA 2ZZ7A 4ECLA 4MAZA 2NVDA 2XVGA 4C1LA 4RW5A 2H9AB 4GIAA 3ALGA 3KS5A 1OM0A 3W84A 5T26A 3O16A 4LOCA 3PBMA 1FX6A 3W7CA 4BF5A 3H12A 3WQ5A 4B9ZA 2E6AA 1DV7A 3WLQA 1L6GA 4PL1A 1ONXA 2RGMA 5I3GA 4KRTA 3HIJA 1FKWA 4A3QA 3PZUA 2OT0A 1GVRA 3QTGA 4EXBA 1Z42A 1TMQA 1X97A 1UMLA 3O0KA 7ENLA 3VNKA 4RDZA 3C0JA 1YEYA 3H24A 1K8ZA 1TV2A 1ME8A 1S2CA 4BQ3A 3EX3A 4JY9A 1ZP3A 3VFCA 1HIZA 3D6NA 1SO5A 1QI0A 1X7FA 2OQHA 1PSCA 3U0HA 3A3HA 1DXFA 2J79A 1A3WA 3TH6A 2W27A 3OPSA 4O1CA 2IUZA 2CITA 3FK4A 4GYKA 2VDIA 3QZEA 1W5NA 2H8XA 3URNA 4AHOA 1TJPA 3CUIA 4MNMA 2FHFA 4PCFA 3GVRA 1ZQ5A 3MWCA 5CAKA 2ZX8A 1UUOA 1YW1A 3V7PA 2IPWA 2XHYA 3H2CA 4RLIA 3UY8A 1ISWA 1PIGA 3UD6A 3W26A 4W93A 2HROA 5KITA 1TJ0A 1CXLA 6TIMA 4S3AA 4DUWA 3OB8A 4X0NA 1DXEA 2YCKX 3HB9A 4G2DA 3TV8A 4G5DA 4TX9A 4AY7A 3QY6A 3S4TA 1R2SA 2XFYA 5FJUA 2V81A 3O2LA 2PTYA 1TKKA 4KCWA 3W75A 1V79A 1UPPA 3KZPA 1DJXA 2PLKA 3SFWA 3DHFA 3M6DA 4ERIA 2CXEA 1VH7A 3BV7A 2ZRWA 3LLFA 3KOWA 1XGEA 2PDLA 5C9XA 4J4KA 3TTEA 4JOMA 3MZ2A 4MNLA 1EGZA 3IARA 3SRFA 4EIVA 3P0WA 3CJPA 9RUBA 1QNPA 2O9TA 3CB8A 3NL2A 5GVJA 1W1VA 4P8UA 1TZ9A 4BHYA 3TJXA 2X7VA 4ZSTA 3PZIA 4XBSA 4RNIA 1KBJA 4B2DA 2CBIA 5EBUA 2XFRA 2VQUA 4WSJA 3CQHA 3GR8A 2WVVA 1XF0A 4UQDA 5AHFA 1EA0A 1PWMA 3VD7A 4HHHA 1K7EA 4BKNA 3LXAA 3FW6A 3PR2A 2E1WA 1X1NA 2KZHA 5BOFA 4L7ZA 1FUYA 1XD1A 4ACZB 1GCYA 4CN6A 5G4HC 5LHEA 2R94A 1AQMA 2R1MA 3R43A 3GZAA 3PZMA 3YPIA 4AD2A 5JH1A 4YCOA 3B8WA 3IJ9A 1ITQA 4CU7A 2XH4A 3KW3A 4L4MA 4MJZA 1MW3A 1EJ7L 3V4BA 1R7AA 1V51A 4NJKA 3AWNA 2ACRA 1UWIA 1BWVA 1RAKA 4Q33A 2OZ8A 4ZB2A 3VD9A 1CB7B 1AODA 1J2WA 3M44A 3SFKA 3LBOA 4Q4SA 1QPOA 1Z6KA 1FFQA 1S39A 1S1RA 4UNIA 5CQ1A 4KESA 1GHRA 1GQJA 3UPBA 3WQ4A 5LA1A 4OECA 3KRBA 2PGWA 4KFNA 1WOBA 3BAYA 2UZ9A 3MQTA 3LHWA 1LLWA 2ESCA 3WX7A 4Y8EA 3DESA 4GABA 4N7QA 4DZAA 2ON3A 2D0GA 5FL1A 1SMAA 1EIBA 4L65A 3MVTA 1F6YA 4CNPA 1JYNA 5HPCA 3IIXA 3A24A 4PR4A 1V6YA 1WV2A 1RY8A 4MWAC 3VIPA 1LUCB 4AIBA 3CV2A 3TAOA 3F2DA 3C3NA 1REQB 1QI2A 4NNBA 2EGZA 4RPQA 3CAWA 4JZ5A 5CXPA 3R12A 4C6FA 1Q6CA 4I7WA 1B31A 3ABOA 2OJPA 4WY0B 3ZSTA 3G8EA 1DHPA 2HISA 3RPDA 1JCMP 1HKJA 5MKGA 4QEHA 3L0KA 1FWWA 1KD0A 3K4DA 3P7YA 4GUGA 4MTVA 3CZLA 4TOQA 3GW0A 4ASTA 1K6WA 1X6NA 3F4DA 3W7NA 1FP8A 5ENLA 1ZBWA 4H1ZA 4ZOCA 2J77A 1TQJA 5HDRA 3HGOA 4EXAA 1UZ1A 3DFQA 3VE9A 2CBJA 5CPQA 4BQ5A 2EQDA 4A4AA 4QITA 1IYXA 3P6LA 3L23A 1N55A 2J7FA 2ZXQA 1QBBA 4PUMA 3DDMA 1SO4A 2DV0A 5KSWA 3SR7A 1YDNA 3W1RA 3GXTA 4AY1A 4OHQA 1DE5A 1B54A 3WD4A 5A8PA 1KR1A 3B8SA 2OTDA 3NZPA 1JZ6A 1XKJA 4MY9A 5IBXA 1H7RA 5LXXA 2FPTA 1TELA 3U4AA 1KM3A 3MV11 3BG3A 3OZOA 3NCOA 3E5PA 5HUPA 2VQTA 4LPCA 3PULA 1L6SA 3PSWA 4ZXLA 4YVXA 3QVQA 1E70M 3N9RA 4QROA 4XZHA 4XD3A 4HA4A 1E3ZA 2HQAA 3KXQA 1FH7A 1NFBA 3QFWA 3G3MA 3W7GA 4XSMA 4BY3A 1PBGA 3UERA 3ZJKA 3C5QA 3STGA 2ZZ5A 1YNQA 4RL3A 3A9BA 1UC4A 1RZMA 4XZBA 1P6CA 1UWAA 3BG5A 4HVXA 2HEJA 3UNTA 4PN2A 3IK2A 3BUVA 4UB9A