4O53A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
b'RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFLFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
molecule tags Isomerase
source organism Trichomonas vaginalis
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o53A00
3UQNA 2CLKA 3O15A 4UR8A 3NVTA 4E2BA 1G4EA 2NV1A 2Q8ZA 1SPQA 2FB2A 3CM4A 1B9BA 4QQ3A 1GVFA 2Q8LA 1X1ZA 4TMCA 4JGDA 4A2SA 3CEUA 2WKJA 4MLJA 4N6EA 3ANYA 2CLHA 5FI8A 3LDVA 3DHDA 4NU7A 4BI5A 3TAKA 3IIZA 5G1TA 1FDJA 3SECA 1RVGA 4ORMA 4AHOA 1B3OA 1OFPA 5AHNA 3P84A 4O16A 4Z0SA 3C6CA 3O6CA 4QNWA 3P81A 2YGYA 4HNVA 3MI3A 3DENA 1S5TA 2QKFA 1WDWA 1FWRA 5CPNA 2YR1A 3IEBA 3QW3A 4OV9A 4O54A 4CQ9A 4LRTA 1RV8A 1LP6A 3M9YA 5KMYA 3ATYA 3PVFA 4UR7A 5F1VA 1ME7A 3IIOA 4MFDA 5G2WA 1UUOA 2BWGA 3WJYA 2FLIA 1GJPA 4UTLA 1Z41A 3O05A 3T78A 3C2OA 3R13A 4RKAA 2XN1A 4WZHA 3H55A 3LTSA 3N34A 1YTEA 2JGYA 4GRSA 2V2DA 2VEPA 1I2NA 4D2JA 3S8HA 4MFEA 1SR9A 1GPWA 2NWRA 2WSQA 4LS2A 2WO5A 2DZVA 4GXMA 4CQAA 2FPVA 1YPIA 1YXCA 2VEIA 3VKJA 2CWNA 1XC4A 3PSWA 1JQXA 3PC0A 4Q4KA 2FIQA 2HMCA 4H3DA 1B57A 3L66A 1R2TA 3TU9A 4ZQOA 1VC4A 1VCGA 4GUJA 4AMAA 5I3GA 4KKXA 3D0CA 2YFOA 5F2IA 3TR2A 1LORA 4IMCA 5AHLA 3SI9A 5CGQA 1OHLA 2R8WA 1GG1A 2QAFA 1MEHA 3T4CA 5HULA 3VE9A 4GBUA 1X8FA 1XKYA 1LBFA 1TTQA 4HNTA 1TRDA 2DORA 3GAKA 4O1CA 3SFKA 1AW2A 1W37A 4BF9A 1D3HA 4RZ4A 1HO4A 3OIXA 3UWWA 2WOQA 3B04A 5D2XA 3OA3A 4MUZA 3DFOA 2VXNA 5EL1A 1R46A 4WY0F 4JY8A 3B8DA 4M5PA 1RQBA 4HHPA 1WA3A 4I7VA 1SZEA 3E02A 4YWIA 2ALDA 3GR8A 1W5NA 1Z48A 2ZDRA 4JR5A 4XBKA 3RLUA 5BNKA 3KAOA 4PA8A 2TRSA 2Q3RA 1F73A 2J9YA 2YW4A 2VEMA 4QITA 3R89A 5E93A 4IXXA 3B0VC 1G4SA 2QCDA 1K3UA 4Z1DA 4LVBA 4M6QA 3O06A 4NZJA 3GYEA 4UFIA 2NXGA 4IMDA 5EPDA 1QPNA 4MYXA 4UUIA 3NXFA 4K36A 5C2XA 1FWSA 1SO4A 1SO3A 4NX0A 3WFAA 1F6KA 3I7SA 5K4XA 4CCCA 3NG3A 3KOFA 2C13A 2Y7FA 2V2CA 1R2RA 5D03A 1TPDA 4W9TA 1A5AA 3UXDA 4O18A 2WSRA 4A2RA 4PC8A 5IM51 3NNTA 2C15A 4K6AA 3MWAA 2TPSA 1XDMA 2ZZ6A 3UZ5A 5FEXA 1ONRA 4N2YA 3KXQA 5AOUA 3EX2A 3W7QA 5GVJA 3IRDA 1A5SA 3C2VA 3A22A 5KINA 4BK9A 3CWOX 5CSRA 1L2UA 3LCXA 2QCCA 2QAPA 3P7YA 3LXCA 3NQMA 3GR7A 5HUOA 3W70A 2QUVA 3G1YA 2GVGA 4I7WA 1DJNA 2Y70A 3M5XA 1Q45A 5LGZA 4NJKA 3W07A 1YYAA 3INPA 3DFSA 3RK8A 1KFBA 4HIBA 4PFMA 4DF0A 3L5AA 3DAQA 1QCWA 2E6AA 2Y63A 1ZHAA 2YZRA 3V1PA 3P74A 1LTDA 3STEA 1BEUA 4UNKA 3B0PA 4QNEA 2QCEA 4H4IA 2NZLA 2D73A 1H62A 3C8FA 2F84A 2A7NA 1VYRA 1GYNA 1KM5A 1EUAA 4RLIA 3PSVA 2VEKA 4XQ6A 2AAMA 1OFOA 1QNVA 1MXSA 1ML1A 3GDLA 1OK6A 3BARA 2X30A 1XBZA 3U8GA 3DFTA 3SGZA 2WQPA 2CW6A 3MBDA 3DKLA 3W1LA 3VFLA 2CU0A 3TH6A 4ZMGA 3MYPA 4LRSA 3L9CA 2V81A 2ZQ0A 3L67A 1K03A 4ICNA 4L4MA 1ZNNA 4ML9A 3Q58A 3IVTA 5CG7A 4O1AA 3GNNA 2NXHA 1X6UA 5DLCA 5AYYA 1CX9A 3VI2A 2E68A 1C8VA 3MJYA 1GVQA 5HWNA 4MJMA 2QCLA 4LS0A 2R14A 4CNPA 3W7MA 2E6YA 5CSSA 3IIXA 2B4GA 2ZTKA 5BMWA 1TPB1 5D2YA 3BW2A 3GDRA 4U4MA 1L6SA 3CLMA 3VCRA 3DFQA 4JTLA 3PF3A 1W3NA 3S5OA 5DN1A 3PBVA 3PY2A 2WNZA 3FYOA 3IIVA 1Q6LA 1WQ5A 4YCOA 4ADUA 1WAUA 1LLZA 1K7XA 1TJRA 1WOAA 4O17A 1OFRA 3W2JA 2JBMA 3RU6A 1OYBA 4U28A 1XUZA 3DU0A 4UNLA 4Z0JA 1ZCOA 3W6YA 1A5BA 4UTMA 2Y89A 3UD6A 5LNRA 3HG4A 4LU0A 4UTHA 3QM3A 5AYXA 2RDWA 3EX1A 8TIMA 4JN6A 3L0KA 1OFQA 1M5WA 3FYPA 4LVFA 3FKRA 3ZS4A 3MI6A 1LRQA 3TC7A 1TPEA 1K8XA 1Z44A 5HNRA 2CZEA 3BK0A 3HMJG 1ME8A 3TSBA 4UTWA 3W7IA 4FHAA 1EP2A 2NUXA 3RNDA 4O4WA 4DO6A 4HNNA 4AH7A 4M7TA 1V5XA 2TSYA 3NQEA 3PUOA 4O53A 1JUEA 4XWUA 1OFAA 3UWYA 5C6MA 2ZZ3A 3DBPA 4RXFA 3M1ZA 3M47A 1GTEA 2FB3A 2V0TA 2VC6A 4UTIA 4DF1A 1GT8A 2E09A 4UFMA 3NPVA 1DL3A 3LCHA 1AMKA 2G5WA 1TMHA 1VH7A 4M7SA 3STGA 1T8XA 3VE7A 2QUUA 2BSLA 1R2SA 1IXPA 1Q6RA 3WK0A 3W88A 3KVMA 3LGEA 2G97A 3OVQA 1H61A 3CC1A 3F4WA 1X1OA 4S1FA 1A5CA 2VFEA 4MIMA 3NQ7A 2DZPA 4O10A 2C16A 1DJQA 1KM1A 3DFNA 1IF2A 4XUGA 3TDFA 5LNSA 3HPZA 2P0OA 2FFCA 4RR4A 4CNNA 3NQFA 4LNYA 5DBUA 3W1RA 3TIMA 1X7FA 2HS8A 4AF0A 1HTIA 1OABA 3SR7A 5FF4A 1TQJA 3G1SA 2DU2A 3EKLA 1FCQA 4JD4A 3LB0A 1EUNA 5G2IA 5FEWA 2Y85A 4N02A 4NZFA 1G4PA 5CPMA 1UB3A 3QSTA 3C3NA 5AB3A 3DHFA 1FCVA 5D32A 3HOJA 1I45A 1FXPA 4PCFA 4GUHA 1FDZA 2P10A 1VLIA 4P61A 1NEYA 1R30A 4IMFA 1K8ZA 3GKFA 4Z1AA 1FXQA 3PBWA 1T96A 3TKFA 3FJLA 4O57A 4BR1A 4IPJA 1VYSX 1YDNA 4JTIA 4ZZ9A 5D30A 4OHQA 2ISVA 3TSDA 3DI0A 2RDTA 5J5DA 1RR2A 2QR6A 4N4QA 4WY0A 1ME9A 3TMQA 3M16A 2VFFA 4AF0B 5HR7A 1WXJA 3LHZA 3R5EA 1BWKA 3TW6A 4E38A 1Q6OA 4YMZA 4AHQA 1ZAIA 2YXGA 3LM7A 3K30A 3EWUA 4JX6A 1O94A 4IX0A 4JIPA 3G1DA 2J6XA 3EWZA 5F4WA 1JULA 1XCFA 4EIVA 4R34A 1KM4A 4NJIA 3B03A 2OCZA 4MZYA 5FF2A 2Z1BA 2ZBTA 1JJKA 4LC8A 1DV7A 1FWNA 3QH2A 3T7VA 4DEFA 2B7NA 5CZTA 2B7OA 2PRMA 2GJLA 4OQVA 4EWND 4WUIA 3AJXA 3FKKA 3HGOA 3Q37A 4A22A 5AC8A 4AEOA 4R53A 1W31A 3P62A 2Q3OA 1F6PA 4J9JA 3U6WA 2C1HA 2YYTA 1N55A 2C3ZA 4GC4A 1R47A 1AL8A 4KWWA 5TBOA 3EKZA 4JTFA 3QEZA 1KBJA 3BPWA 3FOKA 3RF9A 5A5WA 2GJNA 3WJXA 4NXSA 1SFLA 4Y8FA 4DQWA 2X16A 4JEQA 3G3MA 5AHMA 4OV4A 3UWZA 1ZFJA 3W1NA 2QCMA 3NQ8A 1KBIA 5LKYA 3PR2A 4JDBA 3P8JA 2CLIA 2JK2A 2WSYA 3NO5A 3M5YA 2JGQA 2DJXA 1KM6A 3W7GA 1TYGA 3UYCA 2NUYA 4O52A 1KLYA 2A5HA 1JCJA 2OX1A 1TPC1 4EF8A 2CLOA 2NX3A 3PWAA 2BLEA 3P8IA 2ISWA 2OT0A 2RDUA 2A6NA 1G67A 1KM2A 2GQ9A 3JR2A 3NOEA 3HGSA 1GQNA 3NPXA 3TUUA 2VENA 4GUGA 3IVSA 5KZDA 3WJWA 3C56A 3UXAA 4O15A 1FY6A 1KFJA 2NX9A 3S1XA 1FWWA 1L6WA 1PCKA 4UTKA 3O1NA 5F4SA 3PBYA 3WK1A 3GB6A 4I9AA 3B0UX 4CCEA 4PEKA 3BGJA 5I3JA 1W5OA 2J27A 1KM3A 1IXOA 3GZ3A 1P0NA 2YFNA 1AW1A 1YTKA 3HO8A 2BZNA 3DH7A 3BG5A 1JCXA 4YXGA 3BG3A 4TIMA 4AVFA 2PC4A 2FQIA 3LBMA 2G96A 1I2PA 3LLFA 5HJLA 2AQWA 4UTTA 1VJIA 3W1QA 1XM3A 1XBVA 3E12A 4LV4A 4TX9A 4O4VA 1NFBA 2ZRVA 1O5XA 2NV2A 5D02A 1KFLA 1T99A 2GVLA 2R91A 3ABRA 5AYZA 4FF7A 1OJXA 1TPVA 2ZA2A 3O6DA 2Y7GA 4R7JA 4FX8A 5G2HA 4RZ6A 5LNWA 3GIYA 5F2GA 5FF0A 2KZHA 3NQ6A 1LRTA 1SQ7A 5D37A 4MVAA 1DBTA 1QO2A 2ZRWA 1UUMA 2QF7A 4WD0A 1K7EA 4IGHA 1XBXA 4AAJA 4HSNA 5KSWA 2ZZ4A 2VKZG 3L0GA 1GEQA 5E0KA 3RFAA 2Z6IA 2ZFAA 1J5TA 4QM1A 4AHPA 5G5IA 3W7EA 1ZALA 5I3HA 2W6RA 1FCBA 2YDAA 3LTPA 1F05A 1SZFA 1XXXA 2QJIA 4MZ8A 2QDHA 5AN7A 1W3IA 4Y9AA 1TTIA 1LROA 4N9BA 2WNQA 3MP5A 3W86A 2JKAA 3TFCA 3S5NA 1YPFA 1W1ZA 1N7KA 3LHUA 4RCXA 2VOMA 3TW7A 2OJPA 2ZZ1A 2QUTA 3TA6A 5F2LA 3L5LA 4JTJA 2GOUA 4WY0B 3S1UA 4JTGA 3KRSA 3LBCA 3N2XA 4OWGA 3NL5A 3KFTA 5FEZA 4IUOA 4IXHA 5I3KA 1LOQA 2YPIA 1TPFA 2FTPA 3LHVA 1SW3A 4FXSA 3TJXA 1LM1A 1Q6QA 4NNBA 3GNDA 3N2MA 3I7RA 1UASA 3QZEA 1O4UA 2OZ0A 4UTJA 5IBXC 4O14A 3C2EA 4GWEA 1XFBA 5EA9A 2EAWA 1XBYA 1PVNA 1H50A 4EVZA 3G1AA 3MHGA 1K8YA 1LDCA 1XDLA 5DELA 3LHWA 1XI3A 4FNPA 4LVAA 3OEXA 3UY8A 4RXGA 3NQVA 1I2QA 4O50A 4FX7A 3V75A 2YX0A 4YLWA 1OX4A 3E9AA 4HPJA 3PS7A 1B4KA 5K9DA 3TK7A 3H53A 4JYDA 3O07A 4L4LA 2NLIA 2HS6A 4N9DA 4XBSA 4MYAA 4DXVA 2WPBA 1J4EA 3KHJA 3QMRA 4DO4A 3C0JA 2BX7A 3MMTA 2CLLA 2J9XA 2C14A 3UWVA 1TCDA 2DP3A 3ZR4A 1C9DA 4Y90A 3Q94A 4IMEA 3QC3A 3WK2A 1KLZA 1JQVA 3UY7A 2QCDB 3NQGA 2PRHA 5HINA 1TIMA 4LY8A 4Z1CA 1LYXA 1HUVA 2Z2UA 3PBUA 3M7WA 3G0UA 4O8RA 3UNDA 1SSDA 3H54A 1MSSA 2X2GA 3T55A 1DOSA 3CHVA 1TTJA 3GAYA 4HPXA 3G3DA 2H6RA 4MY9A 1WX0A 2Y7DA 2DZTA 5KZEA 3HGJA 3NL6A 2E5BA 1L6YA 1YXYA 4XKYB 2BTMA 3MUXA 4ZQPA 4UFJA 3E96A 1KFCA 3M43A 2ZRYA 1F5ZA 1VZWA 1OX5A 2A7RA 3UPWA 3LCLA 3BV4A 3PB2A 4LVDA 4PL1A 5I3FA 1YTDA 3WJZA 1HFBA 4PL2A 1HG3A 2V9DA 1QO5A 3CEPA 5F2MA 4JXCA 2E1DA 2RHGA 1GWJA 3N9RA 4X3ZA 2YCEA 5L9FA 3G8EA 3KRZA 4FNQA 3P5YA 1QWGA 2ZA3A 2DZSA 4K8HA 2RKXA 5G1YA 3JS3A 2B0MA 2RH9A 2WV8A 1LLWA 2H8XA 3N9SA 5DY2A 3B05A 4FEZA 1F7BA 3W2LA 4LW7A 3NAVA 4I7UA 2XN2A 3M6YA 2V2HA 3GDMA 3DFPA 3W7LA 1JRCA 3OVRA 4WOZA 4GFSA 4LS1A 1H1YA 4PTNA 3CWNA 1ICQA 2ZTJA 4LUIA 4MOZA 5AFDA 3HPSA 3C2RA 5FF7A 3GXTA 2XN0A 3W74A 7TIMA 1PL9A 1FX6A 4K38A 1GYLA 1F76A 3MW7A 5FF3A 3SIZA 1H7NA 3O63A 3QQ1A 3NPUA 1JCLA 2BXVA 4BWLA 5CPOA 4N9EA 4N9CA 4UTTC 3PAJA 2GVJA 4HT3A 4UXDA 1LOSA 3CB8A 3PULA 3SW6A 2W0UA 1PHWA 2X1TA 3RLVA 4WX2A 1TJPA 1ALDA 5G4WA 2H90A 4OBTA 5TQLA 3DI1A 4XTDA 5LHEA 1WBHA 1OFEA 3EWBX 3KRUA 3MBFA 2A21A 3FJ6A 4TR9A 5C55A 3NL3A 5D2VA 1ZAHA 2GUUA 3EWWA 1VQTA 2B7QA 3A5FA 1ZJIA 4FNTA 1KTBA 2QJGA 1TB3A 2CLMA 2Y6ZA 3W1TA 2NXIA 1JR1A 3VNDA 4XTIA 3HQ1A 4WJEA 3SGUA 2EGZA 5D04C 3ABSA 3IGUA 1I2OA 1EP3A 1TPUA 3L68A 1JUKA 3SZ8A 1ADOA 1YLVA 3S5YA 1ZY9A 4UTUA 5J5RA 3EXRA 4LWWA 5A8GA 4IQLA 3BLEA 3TQVA 3R8RA 1G7UA 4JICA 3G1HA 3QQ0A 2P1FA 4WXYA 3QJAA 5D33A 1O95A 2A4AA 3B4UA 3G22A 1SZNA 1Z42A 3KVJA 4AXKA 1AK5A 1W5PA 3UWUA 3W7DA 4LTSA 3LCWA 4CQ8A 5ABTA 4NNCA 2YW3A 1W5QA 4MLRA 1U5JA 3NA8A 4DPQA 5C54A 4POCA 1VRDA 3BO9A 5EKYA 3F4NA 4GNJA 2GQAA 1PV8A 3O6YX 1QMLA 3LXAA 2VELA 2H3DA 2A7PA 5HMSA 1EA0A 4NX5A 3HG2A 3JRKA 5D2WA 3RMJA 4JTEA 4GUIA 4UC5A 1H60A 2A2IA 2TMDA 5EY5A 3LV5A 1VCFA 4CCDA 1TO3A 4CNOA 2F7FA 3M0ZA 4FNRA 1M6JA 1FCUA 3THQA 1ICSA 3LHYA 3M5VA 1W5MA 1UCWA 3G1VA 1L9WA 3W1AA 1KM0A 1W8SA 3ABQA 1P0KA 1NVMA 3N19B 5CKSA 2NUWA 4LT9A 1G7VA 5BMXA 3LI1A 3I6RA 2PURA 1AG1O 1THFD 3ZWTA 3LCGA 4KFPA 4RZ5A 3NM1A 3UZJA 5KITA 1O60A 2V5BA 2ATSA 3W22A 3BW4A 1NF7A 4FNSA 3TC6A 3T40A 2VFHA 1E51A 1QPQA 4P2VA 1JVNA 2AGKA 4DBDA 1UBSA 3WJSA 3NZ1A 1QAPA 1OX6A 1C29A 1TPWA 3EX4A 1OX4B 4QJ1A 1WV2A 4Y96A 4O0KA 4X9SA 4S2BA 1KFEA 4O11A 1QPRA 5HR6A 3O16A 1KTCA 3HG5A 1BKSA 1TV7A 1KA9F 3BLFA 3W7OA 1JUBA 1TV5A 3HJZA 3S0CA 1KV5A 1U83A 3HF3A 1YDVA 5EYWA 5G4EA 3TJLA 2O7SA 2EKCA 3U2OA 5E1QA 4LVGA 1EB3A 1TSIA 3CU2A 5D38A 3W1XA 1VPXA 1GVOA 3P60A 1NF0A 2GQ8A 2QDGA 2DZUA 2PCQA 2E6FA 2IQTA 3NZRA 5F1UA 5AHFA 4ORIA 4NNAA 1I8JA 2H8ZA 1M7OA 1F2JA 1VR6A 3A23A 5LSMA 4JNMA 3P5ZA 3G0XA 4IWWA 3UWQA 3A21A 2CLEA 3W2MA 3BVJA 4FXRA 4ADSA 1SFJA 4O19A 2A0NA 4Z1BA 5TIMA 1OYAA 3UPBA 2Y88A 2VFDA 4DF2A 3S1VA 4KFOA 3TE9A 4JX4A 3W7HA 4MJZA 1BTMA 1H7RA 3W73A 2OMAA 4YL2A 5KTLA 5SWUA 1H7PA 3NM3A 4ZQNA 4ADTA 3LRLA 5LNVA 1QR7A 3M41A 2DZXA 1SO5A 3NYZA 4WXZA 3R12A 3TROA 2G95A 3ELFA 3EX6A 3DXIA 1RD5A 2J88A 4K7VA 4HSOA 3W2UA 1RZMA 3PB0A 1J2WA 2E6DA 3GKAA 1FBAA 4TO8A 3STCA 3TQ0A 3GX9A 4X22A 3QSRA 1YDOA 3N73A 3NQDA 1HO1A 4M6VA 5U7SA 1SSGA 5EBUA 2Z0IA 1VLWA 1TTPA 1I2RA 3N3MA 4S2CA 4UFHA 2ABBA 5DCBA 3GVGA 4JDYA 3CIWA 1PE1A 2E5CA 3CPRA 5MHBA 4RJEA 1T0OA 1K02A 3LOTA 5HUPA 3S42A 4MY8A 4QIUA 4OU1A 2Y61A 3BGGA 1MEIA 4BFAA 1F74A 3W9ZA 4UMAA 4EOUA 3W7RA 4UFKA 1V7YA 4ALDA 3IIPA 1G69A 3LTYA 2CZ5A 2R94A 3MHUA 4K37A 1PHQA 1PS9A 2V8ZA 4FIRA 1KV8A 5DXYA 5KZMA 3TCEA 1IGSA 3HB9A 1W54A 2ZZ5A 3F03K 3W83A 4JYEA 1MEWA 4IPIA 2WJZA 2Y7EA 4JTUA 1OFDA 4WOQA 1W56A 5U4NA 5K4ZA 4NXKA 3G18A 3B06A 4GJ1A 4AWTA 3L65A 3OG3A 4AWSA 1IXQA 3A9IA 1TRIA 4MKNA 4NT0A 4O12A 3SJ3A 3I68A 3EWXA 5LGXA 3IGSA 1B4EA 4HN4A 2QCNA 3QPYA 3FFSA 3CIXA 1YXDA 1DHPA 3NDOA 1FQ0A 3W2KA 3W71A 1NSJA 5DCEA 2EHHA 3W1MA 4IMGA 1EIXA 3FS2A 3S9YA 4H6KA 3OHIA 3W7PA 3W1PA 4M6PA 2DJLA 2I9EA 1CW2A 4Y6GA 4ZQRA 3R2GA 2ZYFA 4TU1A 4XKYA 3LCFA 2ZRXA 3LHTA 3W75A 1RPXA 3CQ0A 3QPZA 4G1KA 2XFWA 1WOBA 2PRLA 3OVPA 3O8AA 2E77A 3EEGA 4HNUA 4K7YA 3TMLA 1SW0A 2TYSA 4KWVA 3W7KA 5C5YA 1HL2A 1OFBA 3C4UA 2LLEA 4TMBA 4JS3A 3C52A 3LRMA 1XL9A 3GXNA 4NJHA 5T26A 3W23A 3NQAA 3W84A 4JTKA 1MO0A 2W79A 4DPPA 1S5VA 1QPOA 1OG0A 1ZAJA 1DKWA 5FEPA 3LV6A 5HQEA 3N14A 1IIGA 4HKPA 1ZENA 1PIIA 4UMCA 4UIOA 3FEMA 1G6CA 4UTWC 4JY9A 4B5NA 5HWMA 3TFXA 1P1XA 3TX9A 3PUEA 3E0IA 1UJPA 1FWTA 3STFA 3P61A 3IVUA 2X1SA 3A5VA 1QFEA 1WBJA 2HSAA 3OBKA 3BW3A 3M5ZA 2ZA1A 2HTMA 2YYUA 5L6UA 4AWUA 4GE8A 1EEPA 2NX1A 5IBXA 3L2IA 3KX6A 1YADA 3DGRA 1O5KA 2EF9A 5CZ0A 3LCIA 3W87A 1OK4A 3HBLA 1OYCA 3FIGA 3CTLA 3HG3A 4RV8A 5BW6A 1LBLA 4RX0A 4E0CA 1GTHA 3P80A 3W85A 2J9ZA 4N4PA 3QMSA 4AB4A 4C1KA 3W72A 1KFKA 1OF6A 2QCHA 3G8RA 3MP3A 5DCDA 1FUYA 3C2FA 2ZZ2A 3LRKA 4JIQA 4O0ZA 1H7OA 5CZJA 4ZQMA 3ZWSA 4LC6A 3MHFA 2FDSA 2H3BA 1Q3NA 4GUFA 1GG0A 1S5WA 3TV8A 5I3IA 2QEZA 4JTSA 1QOQA 2X1UA 1EWEA 5K7JA 5DY3A 2A6LA 1D9EA 2E5DA 4LUJA 2C6QA 4BI7A 3FA5A 4NQ1A 3THAA 3G1FA 4Q33A 2V30A 5AHEA 5AC6A 3USBA 3MO7A 5LNUA 1JCYA 4O13A 3I65A 3BG9A 3NQ2A 2ZCGA 1RQHA 2ATMA 4NUWA 1SZGA 1OVDA 2A85A 4OT7A 4ONVA 2I14A 1JCMP 1LCOA 1OF8A 3P82A 3IGXA 2J24A 2OT1A 1VGAA 4M19A 4N6FA 4IJBA 5D2TA 3SSJA 2YSWA 1KTNA 4Z08A 5HWJA 4QAIA 3SY5A 3LXBA 3HIJA 3WK3A 2QCGA 5LHFA 1AL7A 3QRHA 1GZGA 3W7JA 1TREA 5D09A 2ZZ7A 1RQEA 3LERA 3NR0A 1DQWA 1W0MA 1LOLA 3L21A 3S6DA 1A53A 3TXZA 3ZFHA 1LBMA 4DBEA 1Y0EA 2JKEA 1EX5A 5K9XA 1VCVA 1A50A 1N8FA 4R33A 2PE4A 2I1OA 1GOXA 3GLCA 5BOOA 2ZRZA 3NPWA 4K39A 2FJKA 1VHCA 2CFFA 2V82A 3NGJA 3TXVA 1H7WA 2A1YA 3EXSA 3GK0A 3TSMA 4MPQA 3YPIA 4DELA 3E49A 4QISA 3QMTA 3DZ1A 1IXNA 4UCGA 1H1ZA 4YCPA 2ZRUA 2CLFA 1H5YA 6ALDA 3W1UA 1QOPA 3LX9A 4C1LA 4OGZA 1SW7A 4KFNA 3PUDA 3CT7A 3G24A 2ISSA 4ZQCA 1G4TA 4NVTA 2WNNA 3L0NA 3EX3A 1ICPA 2EPHA 1GVSA 2C18A 2RFGA 4LV9A 4MY1A 2CZDA 5K9CA 3I7QA 3EWYA 1GVRA 1MZHA 1VYPX 2QCFA 3HGRA 3QF0A 3AO0A 1KW1A 2UV8G 1M7PA 2ABAA 3KVLA 4FIQA 4JX5A 4RK8A 2Z6JA 3S5ZA 5K2ZA 1DVJA 4IX2A 2DZWA 3EB2A 2B7PA 5H91A 2VFIA 3P67A 4A21A 1H51A 1FDYA 1BWLA 1K7FA 2FPYA 4ZL1A 1AW5A 2VFGA 2C0AA 4Q32A 5AHIA 2NWSA 1EP1A 5FESA 3W76A 1PCWA 3EXTA 4XZ9A 3NEVA 3F1QA 4PH6A 5F4XA 1D3GA 2GPTA 5K3VA 1LZOA 1VS1A 3G0SA 6TIMA 3ABOA 4QSHA 1CI1A 1EPXA 5DBTA 3ATZA 1SU5A 1WYIA 3L5MA 4JTHA 3TAOA 1S3HA 1SO6A 3TQKA 5LZLA 4IOTA 4FO4A 1TQXA 3GDKA 4JTTA 1XUUA 4LOCA 4EF9A 3S1WA 3QFEA 3W3OA 5D05A 4E2DA 4A3UA 4O1DA 3GXPA 3W7NA 4PODA 5CPLA 5AC7A 3A24A 4FNUA 2X1RA 3BLIA 5DXXA 4FB7A 4FX6M 3GDTA 1H63A 3DKJA 3QYQA 1JCNA 1QDSA 4OE7A 4O1BA 4UMBA 5CZSA 1TV8A 1I4NA 3HPXA 3KVKA 3W2NA 4BI6A 1TPH1 2V5LA 3NL2A 3Q2DA 1H7XA 2QJHA 4K8EA 4O28A 3QW4B 2Y62A 2O7QA 3MI2A 2C19A 1VHNA 3PG8A 4DO5A 3M44A 4CLMA 1SUXA 4NJGA 3TNOA 4MZ1A 3PM6A 3G1XA 1JRBA 3C61A 3FLUA 1P5BA 3LI0A 2FPTA 3MYOA 4NJJA 3MP4A 5H2ZA 1LRNA 4WQ6A 1W3TA 4BWLC 4X2RA 3IV3A 5EMUA 4A29A 2JKPA 1NAL1 5BRBA 1P4CA 1DQXA 3PG9A 3NQCA 4JYFA 1EWDA 3T44A 1IIHA 1DORA 3LLDA 4UFLA 3W7CA 4ZVJA 2CZFA
chains in the Genus database with same CATH superfamily
1K8CA 2CLKA 3O15A 4UR8A 4E2BA 4C5ZA 1UH4A 2D3LA 4Q4PA 1GVFA 4TMCA 2WJEA 4JGDA 1XIDA 3THCA 2WKJA 1NIUA 3PTMA 3ANYA 1MRAA 3RCMA 3EMCA 3ITTA 4BI5A 4DJDA 5G1TA 1VFFA 4ZOEA 3SECA 2HVOA 4AHOA 2HEJA 4Z0SA 2D3NA 3C6CA 5E9AA 2PZ0A 1L6FA 4ERGA 4G6CA 1NELA 3F7JA 1S5TA 1K9DA 2OQYA 3QR1A 2EKGA 3QW3A 3K8KA 1QHZA 1BF2A 4CU7A 4K8GA 2AMXA 1WP6A 3M9YA 5KETA 3N13A 3CBWA 4M8UA 4OOZA 3WJYA 4RUBA 1ITUA 1MUCA 4UTLA 3AIBA 1C91A 3SCNA 3H55A 4GRSA 3N4AA 3WD4A 3N18A 3TR9A 4WJ8A 2NWRA 4LS2A 4GZ7A 2WO5A 2DZVA 4GXMA 4LF2A 4XD5A 3H7RA 2CWNA 1XC4A 2QQ6A 1J0JA 1SMDA 4Q4KA 2W63A 3ITVA 3IUIA 4QQUA 2BBFA 3L66A 3CWHA 1XF0A 3UR2A 3BCFA 3F4VA 1RLDA 2YLLA 3TR2A 1LORA 3KW3A 3SI9A 1OHLA 4IIEA 1KD0A 3T4CA 3VE9A 4GBUA 1X8FA 3G6MA 1UR0A 4JFVA 1LBFA 2Y0FA 1AW2A 4BF9A 1QHPA 2XDFA 2EG7A 3OA3A 4UOJA 1OCQA 1D2KA 2OSWA 4QCEA 4V1YA 4JY8A 2XGIA 3B8DA 1RQBA 2D2OA 1B30A 1UD4A 1SZEA 2WWCA 4YHEA 4ES4A 4JR5A 4C6QA 4C90A 3RLUA 3KAOA 3CGTA 4BEQA 2Y5JA 1E9YB 1F73A 4QTGA 2VL4A 3UCDA 3R89A 1HX0A 4IXXA 3B0VC 1XLCA 3R94A 1LLOA 2REQB 1H5VA 4Z1DA 1DEDA 4IMDA 3F2CA 4MYXA 3BUVA 2D69A 3P93A 3V0UA 3MUIA 3NXFA 3SM0A 2QMJA 1F6KA 4HA1A 5HATA 4GLEA 3NG3A 3KOFA 2C13A 4JFSA 3SCTA 2GSHA 1BSIA 4O18A 4PC8A 1TWZA 5IM51 1IR1A 2C15A 2I5IA 4Q7NA 5FA5A 5IFPA 1DXEA 1ITQA 2ZZ6A 3UZ5A 2XIQA 4N2YA 1X6LA 1F4HA 3IRDA 3C2VA 3EAUA 1ZSXA 4GZEA 3CWOX 3CUIA 1JZ7A 1L2UA 3IK2A 4HPNA 2QCCA 3LYEA 1KRAC 2R1MA 1KGUA 3GR7A 5HUOA 1GQJA 4KETA 4D6HA 1IZJA 2CWXA 2BVWA 1IWPA 4MB3A 3W26A 3BCDA 5M5DA 2YL9A 2WM0A 4NJKA 3W07A 1P6WA 1HGYA 3RK8A 3GH7A 1QASA 3POHA 4N42A 4W85A 4AZCA 1QCWA 2WHLA 2Y63A 2YOCA 5LYRA 3QHMA 2YCIX 8CGTA 2V69A 3P74A 1XS2A 4JKKA 2NZLA 5HOSA 4B3ZA 2F84A 2A7NA 3QY7A 3APYA 2J78A 2P50A 2VEKA 3PSVA 3PHAA 1QNVA 4KWOA 4LCRA 5D8WA 1EJ7L 3BLPX 3GHRA 1ML1A 2AMGA 2V3FA 2X30A 5GNXA 3L4TA 1Z8AA 2CW6A 3S2JA 3DKLA 3A12A 3L12A 3KE0A 4ZMGA 3ITXA 3MYPA 1R9XA 4I5RA 1OIFA 1QBBA 2YLAA 2JIWA 3VDGA 4IH3A 4L4MA 4D8LA 4M82A 1E0UA 3AIVA 1YHTA 3BANA 4MAZA 3IVTA 2ZC1A 3GNNA 1A5OC 3EA2A 3P0XA 5DLCA 5AYYA 3WKZA 1ZGDA 1GVQA 2QCLA 2R14A 3W7MA 3REQB 4AMCA 3AOFA 4YTQA 3FGCB 3DFQA 4LY4A 4F2TA 3H2OA 3N04A 5ABHA 3PY2A 2WNZA 4R85A 1P6BA 2VRJA 1HKJA 3WQ6A 1KR1A 1TJRA 2WVSA 1A5KC 1NU5A 3VKKA 2XSBA 4O17A 2ZUMA 3MY9A 1AFSA 2JBMA 4L1XA 3KLKA 5B80A 3WQWA 4J2MA 4UNLA 1ZCOA 2Y89A 2PDGA 4UTHA 3IJLA 3EBVA 1GPFA 4JN6A 3OZOA 3ARPA 3L0KA 2BXYA 2XH4A 1GHSA 1AD1A 4LVFA 3FKRA 3ZS4A 1HKMA 3OLEA 3AWOA 3TC7A 2DVXA 1Z44A 1WUEA 3TSBA 4QLKA 3R8GA 1J93A 1XCXA 1RA0A 3U2ZA 2E25A 2NUXA 2GGIA 2FVLA 4AH7A 1X6NA 4MB4A 3VXGA 1G94A 3PUOA 2Q71A 3DBPA 3UXIA 1V3LA 1PDYA 3NTYA 1DL3A 5DT7A 1AMKA 3QYSA 1IWAA 2I5QA 3QN3A 3STGA 1XRSA 2BSLA 1ZLPA 2XJ7A 2J62A 2D20A 5CGMA 1H61A 3CC1A 3F4WA 1VIZA 3UP8A 1ZJBA 2PB1A 4Q4SA 4UR9A 4PTDA 4W8BA 5JIPA 5HMEA 1IF2A 3USZA 1MNZA 4MG4A 1Q65A 3B9AA 2OKOA 5HXMA 3MKKA 2DV0A 2FGBA 4RNJA 4DM2A 3BAWA 3S9ZA 4CNNA 2J7BA 4QBXA 3IJQA 1AZ2A 4AF0A 1ISVA 1OABA 4F79A 5FF4A 3G1SA 4ERIA 1HKKA 4JD4A 5G2IA 4RL3A 3GVRA 5AB3A 1FCVA 1OZMA 3HOJA 1I45A 4GUHA 2BXZA 1TV3A 3WQGA 3WYZA 4P61A 3FYYA 2GLKA 3EOSA 2D2GA 1UR4A 4J35A 2D23A 3GRIA 3VA8A 4OHQA 2ISVA 3TSDA 3DI0A 2RDTA 1KB3A 3OLGA 5J5DA 2X09A 4N4QA 4WY0A 4AX7A 4KIEA 4KCVA 4B92A 1WXJA 3PZQA 1AJZA 2WW5A 3F2DA 3FHQA 3TW6A 3AXKA 1KQYA 5D8ZA 2YXGA 5EFDA 3LM7A 5A8OA 4JX6A 1O94A 4IX0A 1TVLA 2J6XA 3EWZA 1Q2SA 1JULA 1E56A 3S2CA 3W00A 4R34A 2V67A 1XYBA 3E0LA 1EJXC 2XVLA 1OCBA 3B03A 3RJXA 3T08A 1BSLA 2ZBTA 1JJKA 1DV7A 1FWNA 3QH2A 1EYEA 2B7NA 5CQ1A 4WUIA 3AJXA 3Q37A 4IG2A 4R53A 3W29A 3P62A 5E6ZA 2Q3OA 1PYMA 5CPTA 4J9JA 2C1HA 2YYTA 1AL8A 1Y5WA 3ICJA 4JCLA 3PJXA 3IAPA 4ZOCA 3FOKA 5A5WA 2GJNA 3DEQA 5A95A 3V7PA 4DQWA 5JBEA 5DANA 4IL2A 1B0IA 3KP0A 1ZFJA 3W1NA 3NQ8A 1KBIA 3ZLFA 4JDBA 2PLJA 1GQLA 1IHIA 3OGVA 1MI3A 1Z32X 5HNNA 1GW9A 2PLCA 1TYGA 2NUYA 1KLYA 2J4GA 4QLLA 4EF8A 4YTUA 2NX3A 1BGGA 3PWAA 2IXUA 2PDJA 1JYWA 2DZBA 1G67A 2GQ9A 5EBAA 1F61A 3LMZA 3NPXA 3TUUA 2VENA 2DSUA 3KCLA 1WXYA 3IVSA 5KZDA 2VVNA 1DJXA 3WLQA 4DUWA 3UXAA 4O15A 3GC2A 4FAMA 4C1NB 2GK1A 4Q8WA 3ECQA 4PTXA 4UTKA 1L6WA 1QATA 5F4SA 3CUXA 4NKCA 3WK1A 3B0UX 4AVOA 4DJEA 2XIOA 4GI8A 3RILA 3VCCA 3EMQA 3EB4A 2YFNA 3WF3A 1W6TA 1AW1A 4KS0A 2PEVA 1Q66A 3FX4A 1KCXA 2G96A 3LLFA 2AQWA 5H8UA 2PCEA 1UWTA 1QW7A 3FAXA 1XM3A 5CAKA 3SRFA 3CT2A 3QGKC 4W7UA 5H6HA 1NFBA 1C90A 2NV2A 1KFLA 1T99A 2GVLA 2IPFA 1OJXA 4QS5A 3O6DA 3QV6A 2F6UA 4RZ6A 2HJPA 5DEZA 5LNWA 3NWRA 5D37A 3COTA 4MVAA 4GYFA 1HKWA 1KBKA 1PEZA 3GTNA 4WD0A 1K7EA 4IGHA 4AAJA 3ITLA 5FACA 2VKZG 1JPHA 4E4PA 3UJ2A 1XLFA 4ZBCA 2ZFAA 1A0DA 1J5TA 4AHPA 3W7EA 1E1EA 5I3HA 2W6RA 3IV8A 1SZFA 3TTEA 1XXXA 1JI2A 3EOOA 3VKDA 4D8AA 1TTIA 3SCSA 1TVNA 1LROA 3MP5A 3SCWA 3TFCA 1LT7A 3UFYA 1N7KA 4GNKB 1HT6A 3LHUA 4XZWA 2QHAA 3CUZA 3TA6A 1X96A 3L5LA 5F2LA 9RUBA 4AZBA 1QNRA 3KRSA 3LBCA 1HF6A 3N2XA 1OD8A 5I3KA 4X61A 2BS9A 4DZIA 4HHMA 5HDRA 2YPIA 2QLYA 2GWNA 3AS1A 2NQZA 2CPUA 3TJXA 2BOEX 1Q6QA 1HJVA 3KBMA 4NNBA 3ZVIA 3GNDA 3N2MA 3NQBA 3UESA 3I7RA 3FGCA 3VIMA 5FL1A 3PPGA 2IMRA 5A6LA 3C2EA 4GWEA 1SFTA 3G1AA 1E9ZB 1K8YA 4LEQA 2ZE0A 3TOPA 2EO7A 1XI3A 2VI0A 4ACYA 4H2CA 1B3ZA 2PGEA 5CJNA 3NQVA 3T0AA 3IARA 3T9PA 4FX7A 3LZ5A 1OX4A 2F38A 1UD8A 4JYDA 7TAAA 5I6SA 4MYAA 1V0NA 2AQVA 3T2OA 1GZ1A 1UA3A 1REQA 4DO4A 3C0JA 3LD5A 3MMTA 3BOFA 2CLLA 2J9XA 4MNJA 3V5CA 4JZ5A 1TCDA 4Q8TA 1JQVA 5JU6A 2QCDB 3GW0A 3NQGA 4D71A 1TIMA 3CQKA 1GQIA 3E5BA 4B3LA 1VJSA 2VC7A 3H54A 3UPMA 3GAYA 4HPXA 1WX0A 6XIAA 4AY1A 3XISA 1FKWA 4ZQPA 1SJBA 4UFJA 1F4AA 5CPQA 3CMJA 3RPMA 4OUEA 3UPWA 3TA9A 4E3TA 4LVDA 1YTDA 5LXEA 3N12A 2EEXA 2BVYA 2E1DA 1WKYA 4X3ZA 3RX3A 3P5YA 3QR3A 3WLKX 5G1YA 3JS3A 3TYZA 3TEVA 3AWNA 1FVPA 1KCZA 2H8XA 3N9SA 5DY2A 3ZSTA 4FEZA 5FSEC 1C92A 1KXVA 2I17A 3BAKA 2QUNA 2XN2A 1V51A 2DSZA 1SYTA 1XLMA 4O1EA 5TF0A 4HU3A 2V2HA 3GDMA 1EXPA 1HKVA 1NJJA 4DN1A 4LS1A 1H1YA 1ICQA 1ZCCA 3C2RA 1PO9A 4HU8A 1F76A 5EMKA 2YB1A 4NSBA 3SIZA 2QXWA 1KWKA 1XPYA 3EMZA 3ZJ6A 2CC0A 3R0KA 3AIRA 4MJ4A 1FWGC 4BWLA 3KP1A 4N9CA 4W5ZA 1Q6GA 4HT3A 3A4XA 4UXDA 1PHWA 2DGAA 3ARYA 2VGIA 2XISA 3RLVA 1TMQA 5G4WA 2H90A 2QVNA 5LHEA 1OFEA 4G1NA 4L9YA 3EWBX 1KQZA 3WD1A 3NL3A 3UW6A 1VQTA 3UJSA 1JFXA 2XVPA 4PZVA 2QJGA 3DYPA 3W24A 3SQSA 3MB9A 2NXIA 1JR1A 1T7LA 3VNDA 3BJTA 5ABEA 3HQ1A 1IR2A 4Z2GA 3SGUA 3UYIA 3IGUA 1TPUA 3A9BA 2EPKX 4B5TA 1NFPA 1OY0A 3GC4A 3SZ8A 1ZY9A 2PDUA 2D1ZA 5HNUA 5A8GA 3R8RA 1G7UA 3AI0A 2QJNA 2P1FA 1E3ZA 5D33A 2A4AA 2R24A 3GIPA 4AXKA 1AK5A 3UWUA 3W7DA 1IEVA 1HGWA 2BMBA 3PNUA 4HJWA 1MMFA 3V18A 1UWRA 2J13A 3R58A 2YKKA 5C54A 4Z42C 4POCA 1VRDA 1XG3A 5XIMA 4L1GA 3QOKA 3F4NA 1PJ9A 3E6EA 4P5UA 2FJUB 4HBKA 4RPPA 4X9YA 3Q67A 2H3DA 3I10A 5CC6A 4PCTA 1XLLA 2PS2A 4CU8A 1NQKA 4OKDA 3LV5A 4DZHA 1TO3A 3U0HA 3M0ZA 2F2HA 5BWAA 4KEMA 4JTAA 3RU8X 1XRFA 1G1YA 1UCWA 4Q8VA 4E3VA 2BG5A 1XD1A 5CKSA 1CDGA 1EO5A 2P88A 1G7VA 3LI1A 3I6RA 3CL6A 1XLIA 3VMPA 3ZWTA 4LEFA 4XO6A 4KFPA 3UZJA 5KITA 1V6YA 3VK5A 3QHNA 3A13A 3WUFA 3WLOA 2VZVA 1M1BA 3T40A 2Z1SA 2VFHA 4P2VA 4LAKA 3TYUA 3NZ1A 3WJSA 4QEEA 4F0SA 1TPWA 1QW9A 1E0XA 1FWDC 1OX4B 4GACA 2GWGA 1TV7A 1W1VA 3S0CA 2YL8A 1EZ2A 4MUPA 5A6JA 4IICA 2DSKA 4GPNA 2GQ8A 1NOFA 5FJPA 4DBSA 4ORIA 4EPBC 1KXQA 3M46A 1GK8A 3U9IA 1M04A 5B7ZA 3P5ZA 1X7IA 4JQ2A 1BKHA 3A21A 1V6TA 3CQHA 4O19A 3W02A 2A0NA 4Z1BA 4HU0A 2WZIA 4DF2A 4I90A 3SUUA 2QDDA 1FKXA 4X0NA 3ONCA 1H7PA 4ZQNA 1UH2A 3VM7A 2IPGA 2PZNA 3ELFA 4OECA 1HVQA 3D46A 3HPFA 4J2PA 3WEMA 1J2WA 3GX9A 3NQDA 4M6VA 3K8MA 4QGCA 3ZT5A 3VNIA 3AC0A 1EGMA 5I03A 2PDWA 2BOFX 3RPTA 1JAEA 2G50A 5I7GA 1I2RA 2E8YA 1XSJA 2ABBA 3LENA 5CG0A 1XLGA 4JDYA 1XIEA 3CPRA 5MHBA 3AZSA 2YCKX 2BGQA 5LIWX 3AUOA 1EJRC 4ICCX 3JW7A 3BGGA 5JH1A 3UF9A 1TJ1A 1NWUA 1O12A 4EOUA 2BGSA 1RY0A 4PRTA 4X0VA 4UFKA 4EXQA 3ZJ8A 4XV0A 1NARA 3LTYA 2CZ5A 9XIMA 1JPKA 3VIFA 2ZUSA 2VGBA 1PHQA 1IYXA 3VAVA 4GGBA 1KV8A 2V8ZA 3A4WA 3URBA 2FKPA 2XSAA 1X1NA 3IPWA 3F03K 3CO4A 4DJDD 1P6CA 2D2HA 3N6HA 4IPIA 1R0MA 5FL0A 4JTUA 1Y5XA 1W56A 5K4ZA 4PUDA 2V5KA 1D3CA 3URAA 4AWTA 5M2FX 4OBRA 3L65A 4PUMA 1IXQA 3BLOA 2QPSA 1TRIA 4MKNA 4NT0A 4O12A 3SJ3A 3I68A 2V6AA 1W1PA 1D8WA 2C71A 1B4EA 4KCUA 1P43A 2ZX5A 3MA8A 3QPYA 3FAWA 2OODA 2EHHA 3W1MA 4ZOBA 1EHNA 4JKMA 3OHIA 3W1PA 2DH2A 4FMVA 2OQHA 4QX4A 4QE1A 4EAYA 3D47A 1V93A 3W75A 3WBWA 4PRRA 5LA0A 2XFWA 1KBBA 2UY3A 2PRLA 4LYKA 3O8AA 5EGRA 4HNUA 2WZHA 2WK2A 4H9XA 4JQ1A 4NYYA 4MKVA 2LLEA 4D1JA 3WF1A 1FWFC 4CD8A 1EH9A 5FD0A 4JTKA 2G3MA 4DPPA 3GIQA 1OG0A 1OIMA 1DKWA 5FEPA 3ZT6A 2WZTA 1E15A 1C7SA 4IG2B 5HWMA 2AKZA 1P1XA 1UW9A 4XD6A 1FWTA 3BLLA 3P61A 3CV6A 1Q2RA 1H1NA 3A5VA 4ZXOA 2VX6A 4HSHA 2VT0A 1AA1B 1EEPA 3KX6A 2JALA 4V33A 1O5KA 3ALGA 2D0GA 2QV4A 4S3EA 4GKTA 4JL1A 3ANVA 3HG3A 3QC0A 3RIKA 3E0WA 4RX0A 4F3HA 1U1UA 2L5HA 1O5RA 1ODUA 4AB4A 4C1KA 1KFKA 1OF6A 1J0YA 3MP3A 3DYOA 2VX5A 4LXFA 1DPMA 1C8XA 1XRTA 1D7FA 2W27A 4ZQMA 4H6RA 3R43A 3KWSA 1PKYA 3AZTA 3PJUA 2H3BA 4ECLA 3FEQA 4P7OA 1S5WA 2J8GA 2X1IA 5DY3A 4Q4OA 1ZBWA 1EF3A 1I1WA 5AHEA 4IIHA 1P7TB 5AC6A 5LNUA 3I65A 1PPIA 1HIZA 2TAAA 2ATMA 1TX2A 1SZGA 4YS1A 3B8VA 4ONVA 5G4HC 3MSGA 3UERA 3P82A 4IJBA 4F0MA 2J8TA 1L8NA 4WDTA 2NQJA 3EKGA 2MANA 3GG0A 3SUWA 4W87A 3RO8A 5A6BD 5IHSA 2XVNA 1TA3B 2Y24A 5LHFA 4HPHA 3AIUA 2ZXQA 3S2NA 4MAVA 3H26A 4KEVA 4K2SA 1TREA 2HE8A 3W7JA 3GO2A 3UCQA 1PTAA 2ZZ7A 1PUDA 5IHRA 2PGWA 4LB4A 2VEGA 1GONA 4L56A 3TXZA 4DBEA 1Y0EA 2JKEA 1VCVA 3FN9A 1A50A 4LUTA 3SCVA 5A94A 2I1OA 2ACQA 1AQ0A 3DOPA 1M41A 3ES8A 2Z4GA 1XWYA 2CFFA 3TXVA 3GK0A 4MPQA 4DELA 3E49A 2VDGA 4WEVX 1IEWA 1Y5VA 3BJFA 1KC7A 2UY5A 3W1UA 3VNKA 3LX9A 1UZ1A 1SW7A 2F61A 1WDSA 1DHKA 3EPMA 3GQYA 4ZE4A 1G4TA 3BDKA 2WC3A 3L0NA 4BQ2A 2EPHA 3WNOA 1FHUA 4S3DA 5AC5A 2WCAA 5K9CA 3EWYA 5JQ9A 1GVRA 3LLXA 4BZYA 3WL0A 3QF0A 3AO0A 1KW1A 1OT2A 4PMDA 4H9MA 3KVLA 3HFYA 1DVJA 3R0DA 3EB2A 2VFIA 4Q8NA 2J7CA 4XZBA 2FPYA 1AW5A 1YRRA 4FR6A 2NWSA 4XZ9A 3NEVA 3F1QA 1E4IA 3RO6A 3BAXA 1JPIA 1V0KA 1LZOA 1VS1A 2HXUA 3DYMA 3G0SA 4GYPC 3ATZA 1SU5A 3L5MA 4JTHA 3TQKA 3T09A 1MWOA 2VRQA 4IOTA 4CD6A 1QJWA 2QJMA 4JTTA 2QT3A 3M0YA 3VGEA 3CL8A 1F8IA 1ITXA 4QROA 2ESCA 4E2DA 3N25A 3O3RA 4NILA 4V28A 4O1DA 3GXPA 3ERPA 3WLHA 5AC7A 4K3ZA 3KBNA 5A6MA 3L4YA 3KLLA 1XLKA 4UMBA 4ZODA 3WQOA 3SCUA 1H7XA 4K8EA 2Y62A 4PUWA 2C19A 1VHNA 3PG8A 3H4XA 4LB3A 4E4FA 2PGFA 4DBWA 1QI4A 2YJQA 2GDQA 5M3WA 4H83A 4JPGA 3FLUA 3LI0A 3VDAA 3VDCA 3MYOA 5C71A 3IJDA 3MP4A 5H2ZA 4WQ6A 1W3TA 1GOIA 4DAIA 3DFYA 4A29A 4BF5A 5BRBA 3CNYA 3N4EA 1EWDA 4DRSA 3E0FA 1ESWA 3NGFA 4UFLA 3W7CA 1KWGA 2CZFA 4HHHA 3RDKA 1WPCA 3EWDA 3UQNA 3RITA 5JH2A 3E1F1 1PX3A 3WFZA 3CEUA 2V38A 1E4LA 4HNCA 4M1RA 2CLHA 3S6TA 1VF8A 3LDVA 3DHDA 4NU7A 3RM4A 5H1WA 3IIZA 3GBEA 3VKAA 3I3DA 1A5LC 1FDJA 3T2PA 1RVGA 4Z2IA 4AD1A 4O16A 2PC8A 3WUBA 2PTZA 1CXIA 4GKLA 4HNVA 4M80A 3DENA 2DIKA 4G8TA 4CD4A 2D0HA 5AYBA 4ZFCA 5CPNA 3PNZA 4Q7IA 1PKMA 3VD9A 4C60A 2ZX7A 4O54A 3M07A 3CLWA 4CQ9A 4LRTA 1Z69A 5KMYA 3UG8A 3OGRA 2J66A 1UUOA 1S2UA 2PTWA 1P0EA 2BWGA 2FLIA 2V3DA 4Q8UA 1GJPA 7REQB 1Z41A 3C2OA 2XN1A 3DN5A 2VEFA 4WZHA 5A6BA 5MF5A 3LS9A 2X0YA 3N34A 4MHBA 1O6IA 4UB9A 1FP8A 2W67A 4DY1A 2WLYA 3AICA 2VEIA 1YXCA 1CGYA 2WYSA 2V5DA 2DQWA 1AH3A 2HMCA 5BXSA 1CXKA 3VABA 4XVEA 3TU9A 1VC4A 2O0TA 1F3EA 3F4CA 4GUJA 4AMAA 5I3GA 3D0CA 4GO8A 2Z25A 4IMCA 4PTVA 5CGQA 2CITA 2R8WA 1MEHA 5I2UA 5M03A 4H9UA 4QLJA 4GFIA 1TTQA 4HNTA 1TRDA 2DORA 3SFKA 3NIYA 1XICA 4NZ5A 4F2BA 1D3HA 4PBEA 4C91A 1HO4A 3T4WA 3OIXA 4U33A 2WOQA 2AL2A 3KTCA 3DFOA 5CC7A 1J0HA 1N8WA 5FOOA 1R46A 4FS9A 4EP8C 3L4WA 3SADA 4HHPA 3CXOA 2IKIA 1XDJA 1W3HA 4D6DA 4RE4A 4XBKA 4NAFA 5XIAA 1G9HA 4HNOA 5BNKA 4PA8A 2Q3RA 2J9YA 2BFGA 2VEMA 4ERAA 4H2HA 3PPHA 1F8MA 1RA5A 1JG9A 1UYQA 4LVBA 1UC5A 3O06A 1E40A 1NM9A 4NZJA 3GYEA 1DJHA 1QPNA 2PDBA 4RE0A 1SO4A 3TN3A 3AHVA 1E9LA 5K4XA 4PSRA 2V2CA 5D03A 3DDMA 1NDZA 2WWDA 2ZE3A 4FK9A 4FPSA 3FCPA 2ZWYA 1V4YA 1WUFA 5ABFB 3U7BA 3W7QA 1UJQA 5GVJA 3HV9A 4IT1A 3A22A 5KINA 3A64A 4BK9A 3ES7A 6XIMA 2G3IA 5XINA 1RSCA 1JFHA 3N2OA 2PDNA 3F5KA 1POKA 3W70A 3WQEA 2OLHA 2GVGA 3N2BA 1QK0A 4W8AA 4QRNA 3H12A 1J18A 3INPA 1UP2A 5A8MA 3MVTA 1A5MC 3FDGA 3PWGA 3BCJA 3DAQA 3W38A 1M68A 5AZ0A 3H70A 1ZHAA 2GGGA 1ELSA 4GXWA 1FWBC 5GJNA 3B0PA 4H4IA 4QR6A 3PTKA 4FOUA 1CPUA 4BS0A 1JF5A 1BYBA 1MXGA 1GYNA 1KM5A 4Y7EA 1A5NC 3KBVA 4XQ6A 2AAMA 1SGJA 1WKEA 3WDHA 1NFGA 1WZKA 2ALRA 3E5PA 1XIHA 3GDLA 1EOMA 1XBZA 3U8GA 3SGZA 2FH6A 4GJJA 4TVCA 2BV9A 3BXWA 4B2DD 1Z89A 1HJXA 3L9CA 4GY7A 4M6UA 1NH6A 1ZS2A 2V81A 6CGTA 3HMCA 2ZQ0A 1K03A 4ICNA 1BLIA 1S39A 3Q58A 5CG7A 4O1AA 1OG6A 3CYVA 1X6UA 3AMDA 1KXHA 3WENA 4W8LA 3CZLA 2E6YA 1FRBA 1XSKA 3G6LA 2ZTKA 4NZ1A 3XIMA 4GQBA 4U4MA 4GIYA 3CLMA 5HAOA 2REQA 4JTLA 2XUCA 3A4JA 3S5OA 5DN1A 1UIOA 4KH2A 3PBVA 5I3DA 2O92A 1Q6LA 4YTSA 4ADUA 4E8DA 1WAUA 3K4DA 1WOAA 4L4PA 4R7WA 1CGUA 1AD4A 3W2JA 4Y9OA 3VVGA 4JNYA 4S38A 3DX5A 4ZO7A 3GFXA 1A5BA 4UTMA 4IP5A 4HCDA 2WMFA 3UR7A 3MJMA 4PBFA 1M5WA 2PDIA 1Z7AA 1MFVA 3FYPA 3W6MA 3WN6A 1LRQA 3CV2A 2PDYA 2HK1A 1B9ZA 1TPEA 5HNRA 2B81A 1EDQA 2VURA 3HMJG 1ME8A 2OQLA 4FHAA 5DMNA 4HNNA 1OCJA 1US0A 4M7TA 5REQA 1V5XA 3L23A 4O53A 1FA2A 4H41A 4PUJA 3FY1A 1XIBA 3KDNA 4LYPA 4PMNA 4RXFA 3M1ZA 4WKAA 1GTEA 3QY8A 3N3TA 2V0TA 1TE1A 4HZMA 4DXXA 2VC5A 1TMHA 1VH7A 5C2CA 1EPVA 3WLMA 3VX0A 1BXCA 3B97A 1T8XA 2FGLA 1FWEC 5HNTA 1OC6A 3QV8A 4JTRA 4PUKA 3KVMA 1IWBA 1Q8JA 1XW8A 2W66A 3HQNA 4MWAB 4HK6A 1J5SA 3MPGA 3NQ7A 1DWJM 3N9KA 3VUPA 3HN3A 3TDFA 3WLNA 2ONEA 1HJSA 4LX4A 2P0OA 3EDFA 4RR4A 2O4MA 3NQFA 3FDKA 3ZZ1A 1X7FA 1MVYA 1HTIA 4GI6A 4HD5A 1XIJA 1EUNA 3EDDA 4N02A 5CPMA 1UB3A 2PD5A 4F0LA 3SGGA 5TD4A 1FXPA 1VLIA 3TN6A 3V5OA 4AG0A 1R30A 4ML4A 1BF6A 1XQLA 1FH8A 2GUBA 3OPSA 1BAGA 1YDNA 4QG9A 4JTIA 4ZZ9A 1VBGA 1AMYA 2GGEA 2QIWA 3B4YA 5AECA 2QR6A 1ME9A 4AD3A 2VFFA 5CJ5A 3WDIA 4F2UA 1BWKA 4YMZA 3TZFA 2Z1WA 4JIPA 5HJXA 1XP3A 4IZGA 4PUNA 1KM4A 4A6GA 1RUSA 4LC8A 3T7VA 1BYDA 2B7OA 5A8NA 1CXEA 4J7RA 2WKLA 4EWND 2QPUA 2E8ZA 3HGOA 3WNLA 5AC8A 2XH7A 1VD6A 1F6PA 2ZOXA 2OLAA 3U6WA 2XM1A 2PWGA 5TBOA 3EKZA 3QEZA 1KBJA 1CGVA 1FFQA 3VGGA 2UZ9A 3WJXA 4J5NA 4NXSA 4Y8FA 3VFCA 3S1GA 5J04A 4W7VA 4HK5A 3V35A 3T0DA 1W91A 5CJMA 1PTGA 1MUMA 4ATLA 1OB0A 4J28A 1KM6A 2Q09A 4AWEA 1TPC1 1XYAA 2CLOA 5E70A 2BLEA 3P8IA 2OT0A 1GCYA 2O55A 3HQPA 1EOKA 5FAJA 4B5SA 1EIBA 2X0SA 1FWHC 4YIWA 3KOWA 2GSEA 3C56A 3SAZA 3BH4A 2YL6A 3VIJA 1FY6A 4BA0A 4UOQA 3O1NA 1UMYA 2QGYA 3GB6A 3O0KA 4CCEA 1YMYA 3BOXA 4D6IA 4PEKA 3VOIA 3BGJA 3S4TA 3DG7A 2WVVA 3B0XA 1KM3A 1P0NA 2FZDA 8A3HA 4HPGA 1UP3A 3OIHA 1T40A 3BG5A 4A3RA 4KIRA 4AVFA 4YVVA 2BVTA 3CHCA 2FQIA 3LBMA 5HJLA 1DWAM 2EPOA 4UTTA 3STPA 5EFFA 2QW5A 1RBOB 2PDFA 3H21A 3POCA 4X63A 1E6RA 2ZRVA 1J0IA 1YW1A 4C6FA 1QVBA 3BE7A 3EB3A 4UOZA 2BHZA 1RJRA 2Y7GA 2BB0A 4MADA 4IP4A 4A3YA 3GXFA 1MW0A 5AVNA 2PDPA 1SQ7A 1BFNA 4ZSTA 2ZRWA 5KSWA 2RDXA 4IFRA 5E0KA 1GEQA 3RFAA 1W1TA 3V4BA 2VOTA 3ID7A 2PLKA 1UKTA 1JZ6A 2WM1A 3O6AA 3FHAA 5C8BB 2P3EA 1F05A 2WJDA 4MZ8A 4PMXA 4NF7A 6TAAA 3OQEA 4AEFA 4D8ZA 2HZGA 3A3HA 3EA1A 3S5NA 1YPFA 4NI3A 4RV3A 3U5YA 3M64A 5BCAA 3FXYA 4IP7A 3AHZA 1Y7VA 4JTJA 1UIPA 2XZ9A 1M53A 2XWDA 4NZCA 4OWGA 3OLDA 4IXHA 4NIRA 4LAUA 3DFHA 1TPFA 4YU1A 2DQXA 3LG3A 2FTPA 1SW3A 4PMJA 1UASA 2ACUA 3ZIZA 4UTJA 5IBXC 1UOZA 3ZMRA 1UROA 1N2VA 5A6TC 4EVZA 1B5TA 1JXKA 1CWYA 2XU2A 1LDCA 5DELA 4WGHA 3LHWA 3OEXA 2PWUA 4WDXA 1R3VA 3GTFA 2VC9A 3AZRA 1I2QA 3AS0A 1S2CA 2IPWA 4C65A 3OG2A 3M0JA 4GVGA 5K9DA 3OB8A 3O07A 1ENUA 2NLIA 2BOGX 2HS6A 4WF7A 2IPJA 2QDEA 3WIJA 3SUVA 4XBSA 1C93A 3NYDA 3QMRA 2WPBA 3RHGA 1DXFA 2BX7A 4ASTA 4YVXA 2X40A 2Y8VA 2NSOA 4J4KA 2OSXA 2C14A 1SVDA 2IKHA 4UZSA 1C9DA 4Y90A 3SCQA 4YYFA 4JCMA 3UZWA 2PRHA 4L65A 3MANA 1B1YA 4BY3A 4TOQA 3CHFA 3M7WA 3G0UA 4KWSA 1SSDA 1W3LA 4DB7A 2PP3A 1OC5A 2X2GA 2GJXA 3CHDA 2H6RA 4MY9A 4IQDA 3HGJA 3NURA 3CZEA 3NL6A 2A79A 2CBVA 1PX4A 3UETA 4XKYB 4DBUA 1BG4A 3AIQA 3E96A 1KFCA 3M43A 4JFTA 2ZRYA 4QE5A 1QI0A 3AU6A 2XM2A 5BROA 1VZWA 1B90A 3LCLA 3PB2A 4PL1A 2ZUNA 1VFMA 1HG3A 4KMQA 4BQ3A 3CEPA 5F2MA 3CPUA 3XINA 2Y8KA 3C0SA 1XLDA 2J79A 3N9RA 1XYFA 5IOBA 3G8EA 5FJIA 1QWGA 3VD7A 4D6CA 2DZSA 4ATDA 1R7OA 4PCSA 3MS8A 4XO7A 5ABFA 4ZXLA 2PDXA 1JL8A 3AFBA 1F7BA 1RBAA 4LW7A 3NAVA 2J7GA 3II1A 5HMFA 3OYZA 3SDOA 3WUGA 5HA7A 5PTDA 1KRCC 1V03A 1JRCA 3OVRA 1TJ0A 4PTNA 4LUIA 4XIMA 3FVDA 1IEIA 7TIMA 4CD5A 5I07A 1GYLA 3WQ4A 1SR0A 3M0LA 3QQ1A 3MKVA 3KWXA 1PIGA 2E3ZA 4U10A 3NPUA 1T8QA 2BXVA 4AXNA 4JHZA 3C0LA 3OGSA 3KOYA 3PAJA 1LOSA 1RK6A 3CB8A 4QE4A 2W0UA 3SW6A 2PFHA 4QFUA 2X1TA 4B5VA 1TJPA 2H9AB 3GU1A 4W86A 1ALDA 1XV8A 3UU0A 1E6SM 4OBTA 5TQLA 4XTDA 1KRMA 2J25A 1R3QA 3MC5A 2JIEA 3KRUA 1P1MA 1V3IA 4J3XA 2A21A 3FJ6A 1E0TA 1VFSA 1W3JA 1TKKA 3CHEA 4TR9A 5D2VA 4WDWA 3RCYA 2GDVA 2FVKA 4UZUA 3A5FA 4RPQA 1TB3A 2CZVA 5A1AA 2Y6ZA 2C8NA 4GQRA 3CAVA 4WJEA 5AYIA 2EGZA 4OFCA 5DMLA 4NZ3A 1I2OA 1WDRA 3EYPA 2WMKA 3E2QA 1JUKA 2XZ7A 3L68A 1ADOA 1R8LA 2AOSA 3V16A 2ON3A 2OZ8A 2PP1A 4UTUA 5J5RA 1XPGA 3VYLA 3SY8A 2DH3A 2R1LA 2TODA 2A3AA 4PCPA 4GISA 1SZNA 3PBMA 4R88A 1NWSA 1W5PA 1U22A 4CNTA 4DIAA 1QU4A 2V5JA 2BVDA 2YB4A 4CQ8A 3TTQA 3MUY1 4OUIA 3S83A 1U5JA 7REQA 3I4EA 5MKGA 4CVUA 1PWLA 3IJ8A 2WMIA 3MTWA 4D6JA 3MCNA 1QMLA 2A7PA 5HMSA 2P8CA 3A4AA 3K46A 4JIHA 1VCFA 3MSYA 4G5DA 2WMJA 1M6JA 3VGFA 3AMCA 3SRDA 3THQA 1XFCA 2WLZA 3M5VA 1W5MA 3G1VA 1KM0A 1CB2A 2WC7A 1NVMA 3VIPA 4RDVA 1PB0A 1TWWA 2Q01A 2NUWA 4LT9A 2ZUWA 2FZMA 2PURA 4RZ5A 1R38A 4XAPA 3THUA 2V5BA 3GUWA 4Z2JA 2ATSA 3W22A 1TWIA 2Z29A 1UD5A 4FNSA 2DSWA 4M81A 3ORWA 1U5VA 1E51A 2AGKA 4DBDA 1UBSA 1OX6A 4GCXA 3PANA 1WV2A 4Y96A 4F0HA 1NTHA 4GVIA 5HR6A 4CU6A 3H24A 1BKSA 3RRXA 4C1NA 3PZMA 1JUBA 1TV5A 4L5ZA 4WRHA 1U83A 2HV5A 2QMKA 2VDHA 1CGXA 3WH9A 3ARRA 1GVOA 3P60A 1WZLA 3APGA 5CPSA 5IFTA 2E6FA 4H9TA 1K70A 5F1UA 4NNAA 1I8JA 2H8ZA 1M7OA 5AY7A 3VD4A 5LSMA 4IHCA 3W2MA 5CLWA 3BVJA 3IACA 4WGXA 3ARUA 3BL3A 3UT0A 1PIFA 1V3MA 5TIMA 2VFDA 4FOJA 4CEXC 5IXEA 1X98A 2ZC8A 4KF1A 1J6OA 1BTMA 5KTLA 4B16A 4JN8A 4Q22A 3M41A 3AYRA 1E6XM 1UA7A 3TROA 2G95A 3EX6A 3DXIA 4C7DA 2J88A 1JZ2A 4K7VA 4HSOA 4URIA 3HA1A 3K8LA 1FBAA 3STCA 3TQ0A 1XGEA 3QSRA 3N73A 1HXJA 2Z0IA 2JE8A 1EF2A 1VLWA 1H49A 2JFEX 1RJQA 2INZA 2XSXA 1E4MM 1U1JA 3DC0A 4XKMA 3WQDA 4I5UA 1RJPA 4IMAA 3CS2A 4Q3MA 1AQFA 4OU1A 2WSPA 4MJ2A 5KEZA 4YJ5A 5FJTA 4BFAA 1F74A 1KR0A 1LF1A 1W1YA 4L6DA 4ALDA 3IIPA 1EYWA 1H3GA 3AJ7A 4DXKA 3KS6A 4EKJA 1HW6A 3EDEA 1IGSA 1Q4WA 3R10A 4JHOA 2G3JA 4JYEA 1MEWA 3VD5A 4HU4A 2WJZA 3AS3A 3ZSSA 1OFDA 4WOQA 4LUTB 3H2FA 4ZTXA 5CSYA 2RUSA 1A49A 3BLDA 3M0XA 3R1ZA 2G3FA 4AWSA 4KERA 5LGXA 3W27A 1EGVA 3IGSA 2HPMA 4HN4A 4C6EA 1W17A 3UZZA 2VGFA 2VP8A 1TA3A 4FA3A 3KTXA 3W81A 3EZ4A 4AU0A 2J8FA 4QEHA 3FS2A 3W7PA 3VUSA 2CKSA 2CNCA 1CIUA 5A8PA 3L2LA 4XKYA 1EJWC 5E0FA 3GG1A 3CQ0A 4Y9MA 1JF6A 1WOBA 2R82A 2GGHA 3VNYA 3OVPA 3V36A 4K7YA 1EC8A 3TMLA 2TYSA 4NP7A 5IDZA 5CSUA 1F3WA 3CUHA 4YTTA 4D72A 1XLBA 5T26A 3W23A 3NQAA 3PTDA 3W84A 3U4FA 3K1DA 1LQAA 3O7UA 3L4UA 1ZAJA 5HQEA 3VNZA 3N14A 1ZENA 4WK9A 3FEMA 3RR1A 1G6CA 4OOUA 4JY9A 1QI3A 3TLQA 2NVAA 1UJPA 1NDVA 3CO8A 3ABZA 3ZOAA 2X1SA 4RNHA 1QFEA 1WBJA 3BW3A 1V6UA 3M5ZA 2C1IA 2ZA1A 4ZTYA 3UNTA 1WB0A 2WPGA 3GTXA 3APTA 5L6UA 4GE8A 3WQCA 3IJ6A 4MWAD 5IBXA 2R1KA 1K9EA 3LY0A 4LYQA 2HWGA 6REQB 1P7TA 5CZ0A 1UQYA 4E8CA 3LCIA 2YBUA 3AALA 3DUGA 3MSRA 3N11A 1LJYA 3CUGA 2PPGA 4X2PA 4A8IA 4EXAA 3IRSA 1HL8A 3AYSA 1ADSA 3W85A 4CCZA 1O68A 5CC3A 4ACZB 5C0QA 4TVDA 3WDPP 3H2EA 4HA4A 4O0ZA 3FW6A 3ZWSA 2QGHA 4LC6A 3MHFA 4GUFA 1P0DA 4FLQA 4GI4A 1KRBC 4IF2A 2QZRA 3TV8A 3U2CA 5I3IA 1CXLA 1QOQA 2X1UA 3V0TA 4JHMA 4M24A 2C6QA 2YA1A 2F2KA 2WXDM 3G1FA 4Q33A 3W01A 2F9RA 4US5D 1T41A 5ENLA 1I1XA 4MNKA 4EWJA 4O13A 4AEEA 4CQBA 3G5EA 2ZXDA 3UVAA 4JQ4A 4NUWA 4AIUA 3ONBA 5FKYA 1AZ1A 2I14A 1OCNA 4Q4RA 4KQNA 1R85A 2J24A 2OT1A 3V3WA 1FFRA 1XIMA 4LUYA 1TMLA 4LNCA 3TTYA 3WZ0E 1RD6A 1TUFA 5BRPA 3SY5A 3LXBA 3ITYA 3WK3A 2QCGA 2O9RA 4PUUA 2NV9A 1GZGA 2HNEA 2ZADA 1RQEA 3N4FA 3EPNA 3WBYA 3CUJA 1W0MA 4GXPA 3ARQA 1A53A 3ZFHA 4HYRA 2ZXAA 4JTDA 4MB5A 4DI9A 5K9XA 4PE8A 1N8FA 2QPXA 2PE4A 4GX9A 1ONEA 1MXDA 4R27A 5CH9A 3T1GA 4PMUA 1DJZA 2VTFA 1WDPA 4M3PA 2WVTA 3TSMA 2OEKA 1UG6A 4YN5A 3DZ1A 4AIOA 2OO6A 3VKCA 4R9XA 2I57A 4YCPA 4YVPA 3ARSA 4QDPA 5BU6A 4C1LA 5EMYA 4KFNA 4WKFA 2NVDA 4ZQCA 1QK2A 4GQ0A 3NZGA 3NSXA 2C18A 4LV9A 1BVNP 1JD7A 3MKCA 3I7QA 1MRQA 3ABXA 1MZHA 1VYPX 4H8UA 4XD4A 3VOCA 3VOGA 1S5MA 5AKQA 1FTXA 4JX5A 2ABAA 2FMOA 3EEZA 4W5UA 3RMEA 3S5ZA 4IX2A 4A21A 3P67A 3CTTA 4ZL1A 1E73M 1JXJA 4A8NA 4AIBA 1GEHA 5I23A 5FESA 1QT1A 4KGJA 4H8VA 1DXIA 1EX1A 2GJRA 5F4XA 4U5IA 4R5EA 1M65A 4QSHA 1XGDA 1VIWA 1EPXA 2NSXA 4I5XA 1CGTA 1WYIA 1A3WA 3M0HA 4IPLA 1SO6A 5LZLA 2W5FA 1ZBKA 4HA3A 4L1WA 2DSVA 1IQ8A 1TQXA 3GDKA 4KCTA 2OR2A 2C7FA 2FZNA 3VMNA 4LOCA 4S3BA 1A4MA 4L6HA 2I56A 3QFEA 2XFFA 3ZT7A 5D05A 4A3UA 1DIDA 4C7FA 3A24A 4RNIA 4FX6M 2W91A 1WKFA 4GQQA 1QDSA 4IIGA 1DP0A 4J3VA 1I4NA 3KVKA 1TPH1 2V5LA 2QJHA 3QW4B 1YEYA 3MI2A 3GHUA 4CLMA 1SUXA 4C6BA 3KTSA 5DMMA 4UNIA 3PM6A 3G1XA 2E9BA 1I6NA 3C61A 2FPTA 3WQPA 4KBXA 5GJMA 1H0GA 5EMUA 3WLSA 2JKPA 3GNXA 3NEHA 1DQXA 3NQCA 5D9OA 1IIHA 1ISWA 5C9XA 5I00A 1UWQA 2DUXA 1IT8A 3W6LA 3NZPA 4ZVJA 3MCOA 1RAKA 3BSHA 2E4TA 1LL6A 3NVTA 5DX7A 1G4EA 2NV1A 3W37A 2FB2A 3CM4A 1B9BA 2OWCA 4E5TA 4YWSA 3WSUA 3BSGA 4A2SA 4BCEA 4ZCWA 4D6FA 2VD9A 1I75A 5D4YA 1W1B1 4BJHA 1UZDA 3TAKA 3MUCA 1ISYA 1Z9AA 2PDMA 3NDZA 4ORMA 4B15A 3UJEA 3TVAA 1ISXA 3P84A 3P81A 2AGTA 3MV11 3WH5A 2PUZA 3MI3A 2I5GA 2PWEA 5IDIA 2BASA 3S2MA 3PN8A 1WDWA 3IEBA 4RW5A 5HMDA 2Y8UA 1LP6A 3KOXA 3ATYA 3PVFA 1ME7A 5G2WA 1ZRQA 3LPPA 5JIWA 4CNSA 1RCQA 3O05A 5DT5A 3T78A 3SCPA 3QV7A 3RM8A 3OQ8A 4PMOA 1KKOA 2JGYA 1UR3M 2VEPA 1JDCA 1ADDA 5HJYA 1I2NA 3QKEA 4D2JA 3S8HA 4MFEA 3AXIA 1SR9A 4V27A 1GPWA 2PDQA 3VD3A 3R0UA 2FPVA 3VKJA 4EE9A 3LNMA 1G5AA 3PSWA 5REQB 1JQXA 3C0QA 2FIQA 1CLVA 3NOYA 1JEZA 1R2TA 4DM1A 4ZQOA 3GR4A 1A3XA 3WD3A 2YFOA 5F2IA 4IGMA 3OU8A 2QAFA 2W62A 1OM0A 1TIWA 4NRSA 4O1CA 4RZ4A 3KM8A 2VUNA 3UWWA 4FOKA 2PI6A 2J7DA 3C5QA 4JEJA 5EL1A 4GK8A 4WY0F 4M5PA 1WA3A 4I7VA 4CNUA 2J7FA 2ZX6A 4XD3A 4YWIA 3FJNA 2GJXB 3LPOA 2ALDA 3GR8A 1W5NA 2ZDRA 1S3TC 1QOXA 1BRLB 2QVHA 1G4SA 1UZHA 2YL5A 3ARZA 4UFIA 2NXGA 4S39A 3I6EA 4UUIA 2PDCA 5C2XA 1FWSA 1LL4A 1XHGA 4HP5A 1Q6FA 1XGZA 3I7SA 4CCCA 2Y7FA 3K2GA 1R2RA 4XG1A 1TWSA 3SB0A 4HMEA 1VEMA 4QDMA 1GGOA 1IEQA 4W9TA 3LN3A 1A5AA 3CPGA 3UXDA 2WSRA 4A2RA 3BSMA 4K6AA 3LZ3A 3MWAA 1R3TA 2UY4A 1MUWA 1R7AA 1XDMA 4Z2HA 5AOUA 1OSEA 2R1PA 3E3HA 2G37A 3HJEA 1A5SA 4KEZA 2F6KA 5HBFA 1QBAA 4V2XA 2WMIB 4MPKA 4CN4A 2QAPA 2CBIA 3P7YA 4G7EB 3W53A 3BOLA 3D6NA 2BY1A 4B4FA 3SRHA 1DJNA 4J40A 3FSTA 5LGZA 4FXFA 3DFSA 1CTNA 2JQXA 1KFBA 1E6ZA 4HIBA 1Q85A 4PFMA 2PP0A 4DF0A 4UQDA 1Q7MA 3L5AA 4B5UA 3PZNA 2YZRA 3PZTA 4JTCA 1LTDA 1BEUA 3OOQA 3GM8A 4QNEA 3HFTA 2OFJA 5A2AA 1H62A 4KEUA 5CBBA 3P3BA 2MNRA 1VYRA 4PEEA 3WMCA 1CLXA 4US5A 3C3UA 1MYRA 5CXPA 3WY1A 3JZEA 3T42A 1UWIA 1MXSA 4GQGA 1ECQA 1ODZA 2OG9A 4H8NA 1T5AA 1OK6A 3BARA 5BXRA 4Q6XA 4KRTA 1GOMA 3CAWA 2VGGA 2CU0A 3VFLA 3W1LA 3TH6A 3LEPA 1VPYA 4PBGA 4YHGA 5AVHA 1IEXA 1KKRA 3CIVA 3L67A 4AZ5A 1OGBA 3IANA 4QAWA 4IPNB 4DLFA 3I4KA 4CN6A 3AISA 4H04A 1ITCA 2NXHA 5EB8A 3K4AA 1CX9A 3VI2A 2E68A 1GW1A 1DWGM 1JPDX 5HWNA 1A5UA 4LS0A 5CSSA 4TQTA 2B4GA 5BMWA 1TPB1 4HMDA 5D2YA 3BW2A 3GDRA 1L6SA 4OZOA 3PF3A 1W3NA 3DESA 3N15A 3FYOA 1ZB5A 3E38A 1TELA 1F07A 3QV9A 4DWSD 4GVHA 1HP5A 4YCOA 4PTWA 3TOYA 1V3HA 2HRWA 1OFRA 4L64A 3RU6A 1JIBA 2CXEA 2O9PA 2GGJA 2CEQA 1OYBA 1XUZA 3DU0A 4MDOA 3UD6A 2AL2B 2ZX8A 2WSKA 6REQA 3QM3A 4W88A 2XGBA 1XR2A 2RDWA 4FI4A 8TIMA 3TNBA 2AAAA 1ZL1A 3T0TA 4XZIA 3ZR5A 3ITGA 4LBRA 3WQVA 3AMGA 1TFVA 4TXEA 1CGWA 4U5KA 2CZEA 3N29A 4UTWA 4RDWA 1KFWA 1UKOA 4P8XA 1B3YA 1EP2A 3RNDA 1QNSA 4P7NA 2TSYA 3NQEA 3MZNA 1CYGA 4H6EA 4XWUA 3PTQA 1VEPA 3T0CA 1ONWA 2ZZ3A 3M47A 3N17A 1VJZA 2FB3A 2HBVA 2VC6A 2HE5A 1CENA 3K4WA 5A8QA 4UFMA 1K77A 3T07A 2NW0A 2CESA 2G5WA 3VE7A 1LL7A 5BYWA 2QUUA 2BY0A 2WZMA 3R7MA 1R2SA 1IXPA 1S38A 3WDRA 1Q6RA 3WK0A 3LGEA 2G97A 1UKQA 2HROA 1M7XA 1X1OA 5BOFA 2J7EA 1A0EA 2RJHA 1A5CA 4AISA 2DZPA 1P48A 4ENLA 4O10A 2C16A 1DJQA 1KM1A 3BZJA 2XGZA 3DFNA 4XUGA 2VZUA 1LT8A 4KT2A 2PAJA 5LNSA 2D2JA 3HPZA 2A3LA 2QNEA 4H19A 2FFCA 4LNYA 5DBUA 3W1RA 1U1HA 2HS8A 3OYXA 4UWMA 3SR7A 2OO0A 1QNPA 2DU2A 3VOFA 1FCQA 3LB0A 5FEWA 4NZFA 1UWSA 3AUJA 3CYJA 3C3NA 6PTDA 1QHOA 4GGHA 2VWSA 5D9NA 2P10A 3BURA 1NEYA 1UD3A 4MGGA 4IMFA 2UY2A 3GKFA 4Z1AA 1FXQA 2FH8A 1T96A 1LWJA 4ROPA 2FGZA 3FJLA 1BPLB 4Q8MA 4IPJA 4BR1A 5B7YA 4NHVA 4ZB5A 4TTUA 4LALA 2OYKA 1N8IA 3TMQA 3TN4A 3M16A 2VO5A 4P7RA 4PB5A 1R3SA 4Y9NA 2GK1B 1KGWA 1EJTC 3AIEA 4XBJA 2A3HA 1XX1A 2FMNA 3CV7A 5E0CA 1E3XA 3K30A 3EWUA 4FXJA 3CH0A 4FSAA 1AH4A 3CB3A 3G1DA 5F4WA 3THDA 1XCFA 1YNYA 3SJNA 4PRWA 4NJIA 3WX7A 5FF2A 4MZYA 2GUYA 1UR2A 4DEFA 3S3GA 3VILA 4I6KA 3URNA 2V5CA 1EJVC 2GJLA 4MF4A 3RCNA 1E43A 3PZGA 4A22A 4AEOA 1E9IA 2DT3A 3LQGA 2C3ZA 1R47A 3UGRA 3S5SA 3BPWA 3RF9A 3VIKA 3ZQ9A 4YTRA 3UZYA 2PDKA 1JGMA 1EHAA 3UWZA 1EJSC 2QCMA 2DPEA 3PR2A 5HPCA 4LBUA 3P8JA 2WSYA 3NO5A 4B9ZA 4UQ9A 2JGQA 4NYUA 3UR8A 4NL1A 1BXBA 4XVDA 3W7GA 4ZE5A 3MMUA 2QF8A 2A5HA 3F5LA 1JCJA 4PUEA 2WCGA 3NFUA 2ISWA 2OOFA 3I3EA 4JN7A 2RDUA 2A6NA 4PFHA 1KM2A 2PWDA 3NOEA 1WCGA 5T91A 1R5YA 4JOMA 1NY1A 4CVWA 1GQNA 3G77A 3QPEA 3WJWA 2OX4A 3S1XA 1PCKA 4ROQA 2WHMA 3PBYA 4DAFA 4I9AA 4MM1A 3UWEA 3BWWA 2J27A 4RE3A 3GZ3A 3GH5A 1Q6DA 4Q8PA 1YTKA 3DH7A 4GH3A 2EJ1A 3BG3A 4TIMA 3IJ7A 1YQ2A 4E2OA 3R8HA 2PC4A 1I2PA 4MNLA 3W1QA 2Z1VA 1XBVA 3NZQA 3TN5A 1W3KA 2YA0A 4LV4A 4E6MA 4DUXA 4O4VA 1PWMA 5DO8A 2PTDA 5D02A 3ABRA 5AYZA 5C9RA 3HPAA 3TC3A 3V5FA 4BQ5A 5F2GA 3BMXA 5FF0A 2KZHA 3NQ6A 3SBFA 1A4LA 1QO2A 4HZ8A 1DTUA 1UUMA 2QF7A 4KPLA 3WNKA 4HSNA 2GZXA 2XIMA 1GORA 1CBGA 2ZZ4A 4AZ6A 2VQUA 4R9OA 3UZXA 3FK4A 2A3BA 4QM1A 2Z6IA 5G5IA 5HQMA 1ZALA 1FCBA 2Z28A 5MKGB 3LTPA 1XIIA 3H2MA 5AN7A 1DIEA 5BRQA 4XAFA 4N9BA 1XYMA 2WNQA 3GUGA 3W86A 2JKAA 4NASA 2PBOA 2PSNA 1W1ZA 4Z1YA 3KUMA 1ZUAX 1E70M 3BTNA 2VOMA 4I8YA 2V3EA 2ZZ1A 3DCPA 5C9ZA 2QUTA 2Z27A 1EGZA 2GOUA 1QUMA 3TYBA 2X05A 3KFTA 5FEZA 2D0FA 4GYKA 4KRUA 1ZQ5A 4AY7A 1JPMA 5I5RA 1NDYA 1LOQA 4JFUA 4Z2LA 3W28A 3FA3A 3ARWA 3LHVA 2OXNA 2DIEA 1LM1A 2VDIA 5HQLA 3ZXWA 2UWFA 3QZEA 5I79A 1XKJA 3NUKA 2WVUA 1O4UA 2Y5SA 5EA9A 1PVNA 3RUBL 4H7CA 3MHGA 4MWAE 1UBPC 4G56A 2ZVRA 4IIDA 3UY8A 4EANA 5A2CA 3V75A 1B31A 2YX0A 3E9AA 1GKPA 1BVWA 1TZ9A 1B4KA 4P8VA 3TK7A 3KL3A 4L4LA 4F0KA 3CZ8A 1L8PA 2OPJA 4A4AA 2Y5EA 3KZPA 1VBRA 3H23A 4DXVA 3KHJA 2VHLA 4RE2A 4PMVA 3VZZA 3SY1A 3UWVA 4GHRA 4HOXA 2DP3A 1SJAA 2VVSA 3ZR4A 3Q94A 4IMEA 1M7JA 2NT0A 1KLZA 2HVNA 1QI2A 3UY7A 1GKRA 4L7ZA 5HINA 4Z1CA 4C6IA 3M0VA 1MSSA 3T55A 3WL1A 1DOSA 1TTJA 1UD2A 1HJWA 1MZRA 3QTPA 1GVYA 2Y7DA 2DZTA 2P8BA 2PBGA 5KZEA 2A3CA 1UC4A 2CCRA 4HOZA 2VNCA 4EPEC 2E5BA 2PMQA 1L6YA 1YXYA 3QQWA 1LG1A 1F5ZA 2VCCA 2Z00A 2A7RA 4NAEA 1E1FA 4HK7A 1QXLA 2E28A 3AXMA 3WJZA 3BQ5A 2A3EA 4PL2A 4YNGA 2V9DA 1QO5A 4G7EA 4IGSA 4C6CA 3BAJA