4O53A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFLFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o53A00
3MBFA 5HMSA 2GVJA 1FWRA 4JTSA 2NLIA 2E1DA 1SPQA 2ZZ7A 4O19A 4FIRA 2GVGA 1PE1A 4DBEA 2E5DA 4CQ9A 4IXHA 3EWZA 2X30A 3MHUA 3NQFA 3EX3A 4O11A 4LNYA 1LP6A 4MJZA 1A5BA 1ALDA 2WSYA 4AVFA 4XQ6A 3PBYA 3W7DA 3L66A 3WJWA 2BLEA 1FCVA 3B0VC 1W8SA 1JCXA 1X1OA 2C6QA 1WDWA 1KFBA 1D3HA 2P10A 3DHDA 3LBCA 4QSHA 2JKEA 1KM3A 5CZTA 3IIPA 1KTBA 1OFRA 4O4WA 4NJJA 2ZRYA 4HKPA 3LHVA 4ZL1A 2V5LA 5DY2A 1YPFA 2WKJA 4WD0A 3ABOA 2CLOA 4UTTC 2QCMA 3LV5A 4O54A 4A22A 1IF2A 1JVNA 3CLMA 5D2YA 3UWVA 1DJNA 2VEPA 4MY8A 1OFOA 1TREA 3ABSA 3DAQA 3SR7A 5F2LA 3W84A 2Y7FA 3W3OA 3MP3A 2OZ0A 3W7RA 2C19A 1OK4A 1UCWA 3BLEA 3N19B 5U4NA 4Z1BA 4EOUA 3NL3A 4L4MA 1ICPA 3CPRA 2DORA 4TO8A 1W3TA 1DVJA 5K9CA 1SZEA 2J6XA 3NQEA 2NUWA 1KM2A 2R94A 1F76A 3TQ0A 2H3DA 1KTCA 1FCQA 4JX4A 5FF2A 5CPNA 4GUFA 3SGZA 4LVDA 1S5VA 3CEUA 3R8RA 1VZWA 1U5JA 2G95A 1J4EA 1O95A 2E68A 1I2QA 1KFCA 1FDYA 1NEYA 2AAMA 4DELA 1GT8A 3NQ6A 7TIMA 3FOKA 1OG0A 3UWUA 4OQVA 3NXFA 1BTMA 1QMLA 1YXYA 3G3DA 1OFAA 1JUEA 1RR2A 2BWGA 4JTGA 2E6YA 3CQ0A 3LCWA 3QPYA 4LRTA 1AMKA 4JYEA 1G4PA 5HWMA 4NT0A 4LVFA 2PCQA 5DBUA 1H60A 4FIQA 4N9BA 2LLEA 5D02A 3LERA 4E2DA 1XXXA 1LLZA 3GDLA 2B7OA 3LCGA 1OF6A 3IIXA 3EXTA 4LC8A 2C18A 2RDTA 4O0KA 1W3IA 4JICA 1TV7A 4JTHA 5H2ZA 2VC6A 3M1ZA 1YLVA 3HIJA 1PHQA 3LBMA 3IV3A 5CPOA 1HO1A 3W1TA 1SO4A 3GXTA 1GYLA 1YADA 1RZMA 1L9WA 1S3HA 1GVFA 4QNEA 3GR7A 3N9SA 2GQAA 3OVQA 1AW5A 1H62A 2NX9A 4O14A 3A5VA 3EX1A 3TMQA 4ZQCA 2W6RA 4RK8A 5G1YA 1GZGA 1OHLA 4K36A 3O6DA 5DN1A 1R30A 4FEZA 2GPTA 2P0OA 2CZFA 2E5CA 1NVMA 4KWWA 3F4WA 2ZZ4A 3G3MA 5TBOA 3DFTA 3W7IA 1TV5A 3W1LA 2JKPA 4JTLA 3NL5A 3W7CA 3O15A 5AC7A 2V81A 4O50A 5LSMA 2FFCA 3VE7A 1KM6A 1FXPA 4BI6A 4RZ4A 3CHVA 1BKSA 2OCZA 1I2NA 4HN4A 4RCXA 5KZDA 1TTJA 3H55A 1JUBA 4IX2A 5J5RA 8TIMA 2PC4A 5AN7A 3GK0A 3NM3A 4RJEA 3PR2A 3P80A 4AXKA 2CWNA 4HNVA 1AW2A 1LRNA 2C14A 2AQWA 2E5BA 2V8ZA 2DZWA 3T7VA 1DJQA 3W7JA 1EP1A 4QQ3A 4WOQA 1YDVA 3NPWA 1FBAA 1GG0A 4P61A 1KTNA 1FUYA 3IVSA 5HWNA 5IBXC 3W2MA 5D32A 3M44A 2TPSA 4NVTA 1P0KA 4JTFA 3E9AA 3LLDA 2ZRVA 2CLLA 4R33A 1N55A 1SW3A 4KWVA 3GZ3A 2WSRA 3NM1A 3A23A 3HQ1A 3C56A 2Y85A 1B4EA 1VGAA 4MLJA 2EPHA 3WJXA 4N6EA 5G4EA 3NZRA 4ZQOA 2QUVA 3BK0A 3W87A 1PIIA 3W86A 3TH6A 3L5LA 3W1MA 4FNRA 2VOMA 5FEXA 4NZFA 4OV9A 3VE9A 1KM0A 3FYPA 3LX9A 5BNKA 2J24A 4MJMA 3RNDA 3A24A 3LXCA 3QQ0A 4UTKA 2I1OA 1AW1A 2VEIA 1TJRA 3O06A 1Z41A 4S2CA 4Q33A 1JRCA 3GNNA 3TA6A 1B4KA 5CZSA 2C1HA 2NXIA 5AHEA 3BARA 2X1TA 4O28A 3RK8A 4OU1A 1LLWA 3PM6A 3BG5A 3G0UA 1RQBA 4ZZ9A 3F4NA 3HO8A 4UFIA 3B0PA 1KLZA 4DXVA 3SW6A 4NJIA 1ONRA 5DLCA 2RDWA 3LTYA 1ZCOA 1AG1O 3FLUA 4BWLA 2R14A 4QIUA 5A5WA 2EHHA 5LNVA 3E49A 1NF7A 1DQWA 3S9YA 4LC6A 4XKYA 4NUWA 1SZGA 1W3NA 5C5YA 1DORA 4IMCA 4TX9A 1VC4A 4K8EA 3W85A 2ZDRA 2FTPA 2Y7DA 3DENA 2C3ZA 1XL9A 3A21A 1QPRA 3LB0A 5U7SA 2Y70A 4LS2A 2NV1A 2OJPA 3GVGA 3BGJA 2A6NA 3LHUA 4XBSA 4ZQNA 4WOZA 5SWUA 4BI7A 3P62A 3W7EA 3H53A 2V0TA 4KFPA 2WPBA 1VLWA 1R2SA 2YYUA 3VFLA 3CIWA 4DQWA 4O1AA 3NZ1A 3GDKA 1RD5A 1XBYA 1S5WA 2ZZ1A 3W73A 3W7NA 5HR6A 3MHFA 1VYSX 3FA5A 1PCKA 3AO0A 3G0XA 4BWLC 1MSSA 3B06A 3IGSA 3NPXA 5BRBA 1FDJA 1G69A 1SO3A 1XDMA 2V2CA 3JS3A 3CIXA 5LNUA 2XN2A 3O05A 1SW0A 4GJ1A 5BMWA 1QPOA 4GWEA 4ONVA 1Y0EA 3W74A 1EB3A 3DKLA 3IGXA 1Z42A 4DBDA 2Y6ZA 2Q3OA 1W31A 2WQPA 2XN0A 4UTMA 1P5BA 4N9DA 4BF9A 1DBTA 2J9ZA 1B57A 4Z0JA 1IXPA 4GXMA 2HS8A 2W0UA 3MWAA 3G1VA 3P8JA 3W7QA 1T0OA 3BG3A 1C9DA 2NV2A 1YDNA 2Z2UA 2B4GA 2H8XA 3CWOX 1XCFA 3ZWSA 3TXZA 5DCEA 5D2VA 3GXNA 3EWYA 3KAOA 3N3MA 1R2RA 3LM7A 3T78A 2Y7GA 4NQ1A 1EP3A 4GE8A 1HL2A 1NAL1 2PURA 2AGKA 4BI5A 3DBPA 3KRZA 2RHGA 3EX2A 1A53A 3LXAA 3O8AA 3W1NA 3E02A 1TTIA 1M7OA 1B9BA 1W0MA 3D0CA 5KMYA 3W2JA 1CW2A 1W5PA 3B8DA 5F4XA 3W83A 1LRTA 2YPIA 3LOTA 3TE9A 3B04A 3QMTA 3U8GA 1QPNA 3EWBX 1W5NA 1KM1A 1LROA 5FF0A 2VEKA 4GUGA 4IWWA 1TQJA 3DFQA 3W2LA 3CC1A 3IGUA 4YXGA 1ZFJA 2HS6A 1EUNA 2QAFA 3M47A 1IXNA 1OJXA 3DKJA 4KFOA 3LHWA 4H6KA 3W1UA 3FKKA 2YW4A 3SGUA 3NYZA 4MUZA 5CPLA 3HF3A 5AC6A 3FKRA 5DBTA 3TW6A 4M6QA 2V9DA 2QCNA 2H6RA 2C16A 2JBMA 4NZJA 2BZNA 5FESA 2A7RA 1ML1A 3LRLA 4Z0SA 4UNLA 5G1TA 5F1VA 1QNVA 5EYWA 3AJXA 1LZOA 1ICQA 3FJLA 2QCLA 1ZALA 3M5YA 5G2HA 5D2XA 1OFDA 4MVAA 4O53A 4MY1A 4ICNA 3SY5A 5AB3A 4PFMA 4YCOA 1J2WA 4Y9AA 4FX8A 2RDUA 1GJPA 1UUOA 3GAKA 3P5YA 1FQ0A 6TIMA 4CCCA 3SFKA 2CLMA 1K8ZA 3S1UA 1FCBA 2QCHA 3DZ1A 4JN6A 1TPC1 3E12A 3PG9A 1ADOA 3R5EA 3BW3A 4ALDA 5J5DA 2YFNA 3B05A 1F5ZA 4NNCA 1JRBA 1KV8A 1JCNA 2ISSA 2CZDA 4DF0A 3BVJA 1GYNA 3BLIA 1QO5A 1WBJA 3M9YA 1OYAA 2CW6A 3LRMA 4LV9A 4X9SA 2X1SA 1N8FA 4FNTA 4KKXA 4XZ9A 1XBVA 4CLMA 1K8YA 3M7WA 1PL9A 4AWUA 2J9XA 3THAA 3C8FA 3S5ZA 1HUVA 2WO5A 4LWWA 3S0CA 1UASA 3LHZA 4IXXA 1X1ZA 1SSDA 1V7YA 5EMUA 2X1UA 4FHAA 4HHPA 3HBLA 4WQ6A 4D2JA 3G1XA 4BR1A 3N2XA 1N7KA 4I7UA 3CM4A 3S8HA 4Z1DA 2A7NA 3BW4A 1H7RA 2HSAA 4R53A 1OYCA 3TSBA 1I2OA 4QM1A 4HNNA 4LOCA 1GG1A 3W6YA 5BOOA 1OVDA 4IOTA 3BG9A 2VFDA 2NXHA 3LV6A 4FX7A 4N9CA 3FFSA 1O60A 1WBHA 5HUOA 3WK0A 3CT7A 2YDAA 1PVNA 1MEHA 1VRDA 3TAKA 1RQHA 3TC7A 4CQAA 3QJAA 2VFHA 2A6LA 2Q8ZA 5KZEA 4RLIA 5AHFA 2H90A 3S5NA 3S6DA 3P67A 1RQEA 1TRIA 4QJ1A 4JTUA 3PF3A 4PCFA 3S1VA 2C15A 2FQIA 4K39A 1WV2A 1XUUA 4Z1CA 3W2KA 1H1ZA 3W76A 3N73A 2NWRA 4YWIA 3G1YA 3DH7A 3L67A 3P7YA 4O17A 3NQ8A 2ATSA 2RFGA 2QCEA 4K7VA 4UFLA 2JGYA 5AYXA 3PUDA 1VHCA 1F7BA 1EA0A 3WK1A 2P1FA 4Z1AA 2R91A 1SFJA 1AK5A 5G2WA 1IXOA 2QDGA 4MZ1A 2VXNA 1CI1A 5FEPA 1W37A 2CLEA 2ZA3A 3OBKA 1RV8A 1DOSA 3GDMA 1XBZA 2C0AA 3HG3A 3NQAA 4MY9A 3OG3A 5HJLA 1JR1A 2PRMA 3G22A 1LTDA 3TMLA 1RVGA 1SU5A 2A4AA 4LUJA 1VYPX 3PUOA 4XKYB 1ME7A 1EX5A 1OX5A 5KZMA 4RXGA 1NSJA 4UUIA 1VCGA 1C29A 1KA9F 1TMHA 4AMAA 1QOQA 4ZQMA 1C8VA 4UTLA 1JCMP 4OBTA 2A7PA 5AYYA 3GIYA 2FJKA 1QR7A 4DPQA 5AHNA 4FO4A 4GRSA 5ABTA 1EPXA 5FF4A 3L68A 3L9CA 1KM5A 4L4LA 1P0NA 3I68A 4WY0B 2J27A 3ZS4A 4PC8A 5CGQA 1F6KA 1EUAA 5K4ZA 4Y96A 2UV8G 1OFEA 1K3UA 3C2FA 4AH7A 1ZHAA 3NAVA 4AB4A 1SQ7A 2ZRWA 3PB0A 1TPFA 5BW6A 3U2OA 2X2GA 3NO5A 1LBMA 3TIMA 4NXSA 3THQA 3BLFA 2OMAA 2DZSA 1ME9A 1QPQA 5F4SA 1ICSA 4Q32A 3ABRA 4DO5A 3KVJA 3G8EA 5HWJA 5CSRA 1SZNA 1QWGA 4ZQPA 1B3OA 4UMCA 3G1HA 3C6CA 2OX1A 5KTLA 2VELA 2WSQA 4LTSA 3TAOA 3TK7A 3A22A 5EKYA 5LNRA 4EF8A 4LY8A 4N9EA 4LW7A 3W7MA 4OE7A 4RX0A 3UY7A 3H54A 1S5TA 2V82A 5LKYA 4AAJA 5FEWA 3OHIA 5CPMA 4MKNA 3Q94A 1I45A 1EWEA 4FB7A 4AEOA 1VR6A 3QSRA 3V1PA 3MBDA 2VENA 4GNJA 4UR7A 3S1WA 3S5OA 1VYRA 4FXSA 3NQ2A 1OX4A 2ZRXA 3MO7A 4LS0A 3SI9A 1O5XA 4JYDA 4LS1A 3DI1A 1BWKA 3O6CA 4WZHA 4POCA 3A9IA 2XFWA 3LCHA 2E77A 4Q4KA 4RKAA 4UR8A 4XTDA 3DGRA 3QYQA 4MZYA 2WOQA 4O15A 2BX7A 4YL2A 4A2SA 2ATMA 2ZCGA 3GAYA 4NJHA 1ZAIA 2B7NA 1M5WA 3M6YA 3DU0A 2PE4A 3EWXA 4AHPA 2QUTA 4JX5A 2PRLA 3UY8A 5K4XA 1G7VA 2QJIA 1SSGA 1K8XA 3DFOA 2Q8LA 3TSMA 2EAWA 1UUMA 4HNTA 3INPA 4PH6A 5MHBA 1FY6A 1WX0A 3P61A 1XC4A 2CLFA 3SJ3A 4FNQA 3OEXA 4GFSA 3MMTA 4S2BA 1WOAA 3PSWA 3PBUA 4PTNA 1LBLA 4NNAA 4IMDA 3TJLA 2Q3RA 3W7LA 5LGXA 5FEZA 1O94A 4M6PA 3KVLA 3LI0A 3PG8A 4U28A 3PB2A 3EKZA 3E0IA 5FF3A 1Q6RA 5EL1A 3W1AA 3RMJA 3MUXA 1JCJA 4XUGA 2RKXA 3W70A 2BSLA 3NPVA 2ZTJA 3P81A 5E93A 3S1XA 3NQCA 3W72A 3OVRA 1G4SA 2ZA1A 3DI0A 4ADUA 4CNNA 1LYXA 2NUXA 1GVOA 2W79A 3QQ1A 4WXZA 4JIPA 2NWSA 1UB3A 2GUUA 2YCEA 3WJYA 5F2GA 3B0UX 1TRDA 3MW7A 1H7PA 3KFTA 2QEZA 2V2HA 3Q2DA 2A2IA 4UXDA 1XDLA 4ZQRA 3I65A 4DEFA 1FWSA 4EF9A 2H8ZA 2YR1A 4FNSA 4TIMA 1TTPA 1DQXA 5D30A 2ZRZA 3T55A 3QZEA 4JTJA 2IQTA 3C2EA 2DU2A 3MI3A 1SO5A 1XKYA 3HPXA 4JY8A 1H5YA 3GNDA 4O0ZA 4O13A 1K02A 1XM3A 5I3GA 3W7OA 3FYOA 4MOZA 5F4WA 1RPXA 5HINA 1GVQA 3BPWA 4UFJA 3USBA 4Y6GA 2ZZ3A 2CFFA 4N6FA 5DCDA 1L6SA 1FWTA 3W9ZA 3JR2A 3SIZA 4HIBA 3M43A 3N34A 1DKWA 4ADSA 3QW4B 4IPJA 1A50A 4IMGA 1F05A 5E1QA 1LM1A 1G4EA 2PRHA 2ZRUA 3CWNA 3M0ZA 3TFCA 1EEPA 4JTEA 4RZ5A 4IPIA 4AWSA 2Y89A 1R46A 3HGJA 1IXQA 4M5PA 3TU9A 3L5MA 2Y62A 4FNUA 2QJHA 3W2NA 2OT0A 1JCYA 3E96A 4N4PA 3MYPA 2QCDB 3GDTA 4JIQA 1H7NA 1W5QA 3CEPA 3VKJA 4UC5A 1L6WA 4NNBA 1OFQA 1SW7A 3W2UA 5A8GA 4CNOA 2G97A 3IIOA 2Y7EA 4E0CA 4LVBA 3NPUA 3O16A 2QUUA 3W7HA 4MYAA 1P4CA 2HMCA 1GEQA 1HG3A 2ALDA 5FI8A 3G1DA 1X7FA 4B5NA 4IJBA 3WK3A 4RR4A 1Q45A 1VS1A 4NX0A 2GQ9A 2V5BA 4EVZA 1LDCA 4Y90A 2A5HA 3FEMA 3R89A 3VNDA 3TUUA 4M19A 4UCGA 3TC6A 1ZENA 1Q3NA 4JY9A 2QAPA 2GJLA 1GPWA 3NDOA 1TYGA 1H1YA 3C4UA 5AHLA 3P74A 1W5MA 3I7QA 3SECA 3C2OA 2ZZ2A 5DELA 3R12A 4K8HA 1QFEA 1LOQA 3NL6A 5DXYA 1A5SA 2I9EA 4UFMA 3IIVA 5E0KA 4O8RA 1XFBA 2FPVA 3UXDA 3GKFA 5H91A 1W5OA 3MP5A 3QEZA 1LRQA 4PA8A 1GQNA 3OVPA 3GB6A 3ZWTA 4MFEA 4JDYA 4A21A 4UMAA 1UJPA 3C3NA 5TIMA 1GVSA 6ALDA 2B7QA 1DV7A 3W7GA 5F2IA 4FX6M 5D33A 5KSWA 4A2RA 5CKSA 2ZQ0A 3FIGA 3RLUA 4K6AA 4K37A 1QOPA 3EKLA 4X2RA 3UD6A 5K2ZA 1VQTA 1KFLA 4CQ8A 3EX4A 4RZ6A 1X8FA 1YTEA 1KV5A 4JTTA 1OYBA 1YXDA 1X6UA 2CU0A 4GUJA 1IIGA 2FLIA 2ISVA 1P1XA 3A5FA 3UPWA 2DJLA 3M41A 3K30A 4WY0A 4TMCA 2QCCA 3QMRA 1TPUA 1FWWA 2NXGA 4EWND 2X16A 4M7TA 3W88A 3ABQA 2OT1A 2R8WA 2YZRA 3MI6A 1R47A 1TCDA 1WOBA 3HB9A 3UWWA 1CX9A 1W54A 3LRKA 1GTHA 2HTMA 3KXQA 3P8IA 4PL1A 3KVMA 1Q6OA 5G4WA 5C2XA 3EXSA 3W07A 3T40A 1GVRA 1F2JA 4IMEA 1H63A 3Q37A 2B0MA 4M7SA 4O1DA 4O12A 3IVTA 2QF7A 5EBUA 4DF2A 3ATYA 4JEQA 4JX6A 1KBIA 4HT3A 2WNZA 1WAUA 1OK6A 2EGZA 1TQXA 1I2PA 4AF0A 1HFBA 4IGHA 3NG3A 3ANYA 3WJZA 3Q58A 3HGOA 1VJIA 3UNDA 1JQVA 2QR6A 3LCFA 3F1QA 1K03A 2DZUA 4X3ZA 5K7JA 4OWGA 1JJKA 1H50A 4YMZA 3ZR4A 3G1AA 3HJZA 2F7FA 5I3HA 1MZHA 5HULA 4TR9A 5AOUA 3VCRA 3L0GA 3NQGA 3UYCA 1VLIA 3T4CA 3CU2A 5BMXA 3NR0A 5D38A 4WJEA 1K7XA 1SZFA 5C54A 3HGSA 1MO0A 4UTUA 5AC8A 2DZXA 1G6CA 4JNMA 5KITA 2ZZ6A 1OX4B 1H7XA 3NVTA 3EB2A 4O52A 2YW3A 3KX6A 3TROA 2DP3A 4WX2A 5L6UA 4FXRA 1FXQA 1MXSA 4TU1A 4GUIA 1Q6LA 5CZ0A 1KBJA 5EPDA 2QCFA 3PWAA 3S42A 1DL3A 2WNQA 3WJSA 1SR9A 2O7QA 3KRUA 3NA8A 2VFIA 4AWTA 3MP4A 4NJGA 1XUZA 4JTKA 3G0SA 2GOUA 2A85A 2TRSA 3QH2A 3LCIA 4UIOA 3PY2A 4NXKA 5I3JA 1T99A 1QCWA 2JKAA 3ATZA 1A5CA 3C2VA 4MLRA 2YX0A 4JTIA 4YLWA 4XWUA 4UFHA 1M6JA 2CZEA 1I4NA 3STEA 3N2MA 2Z0IA 3G18A 3SSJA 3DFNA 4AHQA 1E51A 2CLIA 3GR8A 3MYOA 4O1CA 3OIXA 2GQ8A 1ZJIA 3BGGA 1SUXA 2C13A 3FS2A 3L2IA 4KFNA 4OV4A 1JCLA 3M5XA 4NJKA 4P2VA 2ZBTA 5D37A 2YGYA 3NEVA 4EIVA 1JUKA 5EY5A 2E6AA 3DFPA 2ZYFA 1FWNA 3W7PA 1D9EA 3QC3A 3RLVA 3O6YX 3TV8A 2DZTA 1BEUA 3G1SA 5LHFA 2ZTKA 3QW3A 2VFGA 2QJGA 1T96A 4JD4A 3TNOA 3C61A 4ORIA 3PUEA 4FF7A 5D04C 3I7RA 4MIMA 4PODA 4JYFA 3L21A 4G1KA 1TIMA 1KFKA 4LVAA 4C1KA 3LGEA 3GLCA 3O63A 1VCVA 3MJYA 4JDBA 2F84A 2Y63A 3HG5A 3DFSA 4R34A 4O10A 1TV8A 1V5XA 3HG4A 1TPH1 4A29A 1WQ5A 1OABA 3PVFA 3RU6A 3SZ8A 1KLYA 5I3IA 1ZAHA 1J5TA 1LORA 1FDZA 3DXIA 3PC0A 2V30A 2E6FA 2ZZ5A 4DPPA 1TPVA 2X1RA 1K7FA 3R13A 3TFXA 2JK2A 3STFA 3WFAA 1FCUA 3L65A 3P5ZA 1FX6A 3STGA 1VHNA 4K38A 2ABBA 4MYXA 2V2DA 4HPJA 4YCPA 3P60A 2QCDA 1ZAJA 3QSTA 4QNWA 4O57A 2D73A 3LTPA 1H7OA 4OGZA 1SO6A 1GOXA 1KFJA 1A5AA 3W1RA 2ZA2A 2VEMA 4QISA 3RFAA 5G2IA 2DZVA 5LGZA 1THFD 1YDOA 1YTDA 3I6RA 1XI3A 2CLHA 3TJXA 4UTHA 4M6VA 3KOFA 3GX9A 3LCLA 3NNTA 2Y61A 4CCDA 1NF0A 3TQKA 1MEWA 5LHEA 1LOSA 2EF9A 4JS3A 5C6MA 1Q6QA 3GXPA 3L0KA 5LNWA 2KZHA 1YTKA 4N2YA 1TO3A 2YSWA 4I9AA 5CZJA 3O07A 4MFDA 4IUOA 3LDVA 3PSVA 4CNPA 4TMBA 5K9XA 4ADTA 2FIQA 2A0NA 1AL7A 2FDSA 3BV4A 1HTIA 1VH7A 2ISWA 3STCA 2FB2A 4RV8A 3P84A 1ZNNA 2NX3A 1WA3A 4ZMGA 5I3FA 2WNNA 3V75A 5GVJA 3W23A 4DO4A 3KRSA 1Z48A 3EWUA 4QITA 2TYSA 3G1FA 4O16A 3UZJA 3GKAA 1T8XA 3M16A 5G5IA 4JXCA 4UTTA 3QRHA 2Z1BA 2Z6JA 3LHYA 3UPBA 5K3VA 3R2GA 1KM4A 1IIHA 4K7YA 4UMBA 1L2UA 1LOLA 5DY3A 2Y88A 5IM51 3PBWA 1I2RA 2CZ5A 1F6PA 4Y8FA 2GJNA 3JRKA 1YPIA 2QDHA 3C52A 2BXVA 4N4QA 1EIXA 1VCFA 1OFBA 1ME8A 1D3GA 3N14A 3I7SA 1NFBA 3EEGA 1OF8A 4QAIA 5CG7A 3IVUA 1U83A 1VPXA 3GYEA 4LV4A 2CLKA 5LZLA 3C0JA 5KINA 1R2TA 4ZVJA 1PV8A 3HPZA 4WUIA 5AFDA 4GC4A 3HPSA 1PHWA 3HOJA 4I7VA 3W22A 5HR7A 3YPIA 2TSYA 3B03A 4ORMA 3TDFA 3DHFA 3MHGA 5DXXA 1QO2A 3NQ7A 5FF7A 3PAJA 4BFAA 1LCOA 1LBFA 3UXAA 4UNKA 1TPB1 3KVKA 1TJPA 4O1BA 1F73A 1DHPA 2O7SA 4HSOA 5AHMA 3P82A 5F1UA 4IQLA 5IBXA 3LHTA 3W75A 1G4TA 2GVLA 3UWZA 4HSNA 2B7PA 3HGRA 3W1PA 2WV8A 3O1NA 1F74A 3TSDA 1GWJA 3UWYA 1WYIA 4AF0B 4OHQA 2WJZA 1WXJA 3CTLA 4NX5A 3NL2A 5HQEA 4BK9A 2A21A 2I14A 3QPZA 1IGSA 5TQLA 3HMJG 3W7KA 3QFEA 3LI1A 1OX6A 3LXBA 4HPXA 1HO4A 4FNPA 4MPQA 3S5YA 1JQXA 3T44A 3C2RA 3TCEA 3G24A 4NU7A 4UTIA 3EXRA 4CCEA 1W56A 1BWLA 2FB3A 4LRSA 4I7WA 1ZY9A 1XBXA 3U6WA 4GUHA 2DJXA 1TPWA 3TW7A 1PS9A 3QF0A 1MEIA 5DCBA 5I3KA 1QDSA 3NGJA 2ABAA 3VI2A 3W71A 4O4VA 5D2WA 3WK2A 3KHJA 3CB8A 3TXVA 1H7WA 2EKCA 4X22A 2VKZG 1EWDA 1GTEA 5C55A 1TSIA 1EP2A 5D05A 4E38A 2YXGA 3OA3A 4E2BA 1I8JA 4WY0F 3UWQA 4UTJA 3L0NA 3TR2A 4IMFA 1W1ZA 3ELFA 3F03K 4J9JA 4ML9A 3NQDA 1KW1A 1O5KA 3NOEA 2VFFA 4S1FA 3TKFA 3NQMA 4U4MA 4N02A 4OT7A 2BTMA 5T26A 2DZPA 3RF9A 5D09A 3BW2A 5K9DA 4DO6A 3QM3A 1YXCA 4XTIA 1H51A 1O4UA 4RXFA 5LNSA 1JULA 4H3DA 4UFKA 2VFEA 3LLFA 4PEKA 3TQVA 3GDRA 3IEBA 2Z6IA 2RH9A 3M5ZA 3B4UA 2J88A 3L5AA 1TPDA 1QAPA 1TPEA 4LU0A 5CSSA 4C1LA 3QMSA 2NUYA 3EX6A 1TB3A 3PS7A 4W9TA 5F2MA 1G7UA 4A3UA 4PL2A 3TX9A 2YFOA 2NX1A 4Z08A 3MI2A 1H61A 4UTWC 5HUPA 4JR5A 4LUIA 3UQNA 2NZLA 5L9FA 3W1QA 1K7EA 1KFEA 2FPTA 4LT9A 3PBVA 1Z44A 3IRDA 5EA9A 2E6DA 4WXYA 2ZFAA 1OFPA 1G67A 4IX0A 5HNRA 3EWWA 2H3BA 4O18A 1SFLA 4JGDA 4DF1A 2J9YA 2YYTA 3IIZA 2G5WA 2E09A 1YYAA 2QKFA 1UBSA 2JGQA 4MZ8A 3UZ5A 5D2TA 3LTSA 1TTQA 1AL8A 1L6YA 3HG2A 1PCWA 3PULA 4UTWA 3G8RA 4R7JA 4XBKA 2TMDA 4LVGA 3BO9A 4AHOA 2QCGA 3W1XA 3N9RA 2FPYA 3LCXA 4GBUA 3M5VA 2XN1A 3FJ6A 3NQVA 1M7PA 2G96A 5AYZA 2A1YA 4HNUA 4H4IA 5D03A 5AHIA 3ZFHA
chains in the Genus database with same CATH superfamily
3FXYA 1FWRA 1FWAC 2NLIA 4O19A 1E4MM 3PZNA 4XIMA 3T0TA 2FMNA 1UWTA 1PE1A 4B16A 2VI0A 5LIWX 4IXHA 1J11A 3AJ7A 2NSXA 2QJNA 1UROA 4O11A 1ADSA 4J1OA 4MJZA 1A5BA 1ALDA 1DJIA 4OBRA 3PBYA 4D9PA 3WUBA 1FCVA 4GCXA 4AQLA 2NLYA 5FACA 3MDUA 4S3DA 1JZ5A 4ICCX 4KGJA 2V3EA 2JKEA 3GIPA 1E55A 5GPRA 3AHXA 4D71A 4HZMA 4PTVA 4NRRA 4HKPA 3LHVA 2V5LA 1YPFA 3LPOA 3NVDA 1CXFA 4WD0A 3ABOA 2CLOA 2WHKA 4W89A 3ZLFA 3WH6A 4LCQA 3PTMA 1V03A 4O54A 4A22A 1IF2A 1X39A 4INFA 3CLMA 4IGNA 3UWVA 1QXLA 3ABSA 3DAQA 3SR7A 4AIBA 2WSPA 4M0XA 5CPTA 2Y7FA 1ITXA 2BASA 3BLEA 3GDBA 3N19B 5U4NA 3VIGA 3VIKA 4AVNA 2CEQA 1P6BA 3CPRA 3UGRA 4TO8A 1CYGA 1G5AA 2QIWA 3GZAA 1DVJA 5K9CA 2J6XA 4LYPA 1TIWA 2IKGA 3KP1A 2J25A 3TQ0A 3UA3A 3ZJ6A 5C9UA 2BOGX 1UR2A 4UQAA 1GKQA 1S2AA 1IZKA 5CPNA 4PSRA 2VUYA 4GYJA 1ZBKA 4IFOA 2XG9A 2FGZA 2G95A 1J4EA 2UY2A 4H41A 3CQJA 2HISA 4EAMA 3ARUA 2DSVA 5DMMA 4DELA 3NQ6A 7TIMA 1R3VA 4OQVA 3PWIA 1BTMA 4IIGA 2WHMA 5E9XA 1ISVA 3KWSA 4YS1A 4QDWA 3G3DA 1OFAA 3RAOA 1WKYA 1GUVA 2E6YA 5A6BA 1AMKA 4JYEA 2FGBA 2LLEA 4MJ2A 4YYCA 4E2DA 2DVTA 4L1XA 3VGDA 4Z1YA 3LCGA 2ODOA 3EXTA 4LC8A 2HE8A 1VBGA 3EA3A 1R8LA 4JICA 4AMCA 2VC6A 3QN3A 3M1ZA 1PHQA 5CPOA 3W1TA 1SO4A 1YADA 2Y5EA 3CNYA 2PD9A 3N9KA 5FJPA 4DZAA 5DMYA 2PDYA 2PDHA 2PDIA 1F3TA 4J40A 5DN1A 4W8AA 3VD4A 4FEZA 5H6HA 2WHLA 4EXQA 3UPMA 4KWWA 3F4WA 3A12A 4H01A 3H2EA 3SCUA 4ASTA 3B8UA 4JTLA 3NL5A 6TAAA 3O15A 4FK9A 5LSMA 3NEHA 1PTDA 1RCQA 3VE7A 3R4IA 1KM6A 1J0JA 3CHVA 1BKSA 1EO5A 3GVRA 4FLOA 3H55A 4QLLA 1CXHA 1JUBA 4IX2A 4GZ7A 5AN7A 1UYQA 3APYA 4HZ6A 1MNSA 2CWNA 1CB7B 1X97A 3WQ4A 2V8ZA 2DZWA 3WF4A 4XAGA 3W7JA 3B9NA 4WOQA 1TVLA 3NPWA 1FBAA 5CXPA 4WGHA 2YB4A 3ZLGA 1T6MA 1HJUA 3W2MA 3ZZ1A 3M44A 1ISWA 2OWXA 2W27A 3QKZA 1EEXA 2PFHA 1LL4A 2AKZA 4O1EA 1XYFA 2CLLA 1BKHA 1QRQA 4KS0A 2OZ3A 3GZ3A 3O3RA 4MWAE 2XU2A 1BXNA 3SJNA 3N4AA 1XLKA 3CZJA 4KWSA 1QI0A 4FNRA 1CEOA 3ME3A 3NO1A 4GBDA 1KGWA 2YCLB 5IHSA 3QV7A 4EXBA 4L56A 3QQ0A 4HN8A 3T0AA 4L4OA 1QBAA 1AW1A 2VEIA 2VD9A 3UCDA 1U5HA 4MB5A 1ESWA 2GGHA 1S46A 5CEWA 3TA6A 2NXIA 5AHEA 4DBSA 3BARA 3WF3A 2X1TA 3BSGA 3DG6A 3TOYA 3QHOA 4PZVA 3MMDA 3BSMA 3PM6A 3BG5A 2HVNA 3GHRA 4ZZ9A 4LSBA 1KLZA 5CQ1A 5KETA 3EWDA 4NJIA 1PTAA 1QHOA 2CIPA 4DHGA 5FD0A 5A5WA 5LNVA 4WDWA 1DQWA 2DQWA 4IMCA 1VC4A 3AXXA 5AYIA 2WLYA 1QPRA 4B5UA 5U7SA 3VKBA 2OJPA 4OUIA 4ERAA 7ENLA 1IEXA 2X1IA 4ZQNA 1J6PA 2VX4A 1MRQA 3W7EA 4JKKA 1R2SA 2YYUA 5A2AA 3CIWA 4O1AA 3W73A 2ZZ1A 3D46A 2G3FA 1VYSX 3FA5A 1V02E 5C70A 3IGSA 3SUWA 3OGSA 3L2MA 5GNYA 2I9UA 1FDJA 1G69A 1XDMA 1HGWA 3APGA 2G8ZA 2XN2A 1J79A 1SW0A 3R10A 1MNZA 1S3TC 4L80A 1LQAA 4HA0A 1Y0EA 3W74A 5FSEC 4PUJA 1U1JA 2Y8VA 1Z42A 3F5JA 2OODA 2Q3OA 3BLDA 1CWYA 4Z0JA 1EL3A 3S3GA 3P8JA 3M0XA 3P6LA 1C9DA 2NV2A 3LD5A 3BV7A 3B8VA 3CWOX 3DUGA 4W86A 1EJWC 4GI8A 1D8WA 1OGGA 3F4DA 5DCEA 4IGMA 3LM7A 4I3GA 3N6QA 1Q6GA 2Y7GA 2W3ZA 3PZOA 2PB1A 2PURA 1NAL1 3IGHX 1AQFA 3DBPA 3K4WA 1EOMA 2E25A 3O8AA 3CIVA 3SFWA 4PUMA 1B9BA 1NM9A 4O1FA 5F4XA 3W83A 1M04A 1FHUA 3LOTA 3U9IA 4JTAA 2JFEX 1QPNA 3UR7A 1NDZA 1LROA 5FF0A 2QPSA 2ZOXA 3MZNA 2OVLA 5JU6A 4YXGA 5HANA 3GQYA 1EUNA 2QGYA 3M47A 1OJXA 2YIHA 4KCTA 1TUFA 4RPPA 1S1PA 2J6VA 4DUOA 1FWIC 2IQ0A 4U3AA 3LHWA 4H6KA 3W1UA 1W9UA 3N04A 5KEZA 3FKKA 1HX0A 2PGWA 3SGUA 5CPLA 3HF3A 3BAWA 4M6QA 4GO8A 2PODA 2B81A 2QCNA 3IUDA 1KXHA 3SCVA 3GWQA 3GU1A 4DJEA 2C16A 4CD8A 1A5NC 1EDQA 1A5MC 5F1VA 3AJXA 3M5YA 4MNLA 1FHDA 3WDPP 1GOMA 2J79A 5AB3A 5TNVA 4PFMA 1YMYA 1J2WA 3B97A 3MC5A 3FDKA 3TLQA 3SN0A 6TIMA 4CCCA 1V3HA 3WLHA 4JNYA 1UWSA 2V5JA 4GZIA 3EMCA 2XFYA 4JHOA 1QK0A 3AIUA 2QCHA 3DZ1A 4JN6A 1F3EA 4EACA 1TPC1 1QU4A 3R5EA 3B05A 4DVOA 5LA0A 5KZ6A 5A6AA 3TCSA 4L6OA 3DFYA 1FKXA 2ZXQA 3TONA 4M3PA 1WBJA 3O2LA 3OP2A 3R58A 3U2ZA 4LV9A 2Z26A 2QV4A 4KKXA 3K13A 1FWCC 5HATA 4WKAA 3QV9A 4NI3A 3HQPA 4WDXA 3SM0A 3AXIA 1UC5A 4LWWA 4E4UA 4LF1A 1UASA 4IXXA 4IL2A 1VB9A 4FHAA 2IXVA 1JDFA 4AIUA 4ECLA 3ITVA 1HXJA 4QR6A 2VR5A 1LLOA 4DYJA 4FALA 1XLMA 1UPPA 2HSAA 1ADDA 2CHRA 4HNNA 4AZGA 4KEMA 4IOTA 3BG9A 2RAGA 1XLFA 2NVAA 1ZTVA 1FH9A 4KERA 2QVNA 4IUGA 4N9CA 3WK0A 4H9UA 1WBHA 2OZ8A 1IR1A 1PVNA 1IEVA 1RQHA 1DJZA 2FZ8A 4JN7A 1U2YA 2WZIA 3S6DA 1OCBA 2EJ1A 2P88A 1MW2A 1V77A 2I5IA 2GSHA 3LLXA 1P0BA 1UKTA 1TE1A 1JD7A 4IT1A 4W93A 4K39A 1WV2A 1H1ZA 3N73A 2NWRA 5DANA 4JNZA 3O9NA 2VR4A 3NQ8A 2RFGA 2QCEA 1EOKA 1VHCA 2W92A 4AYSA 4C6EA 1XYBA 3WQPA 4AY7A 3GRIA 2AQOA 4IF2A 4GIEA 1V6YA 2PDPA 4PE8A 2R82A 1XGDA 5FEPA 3RHGA 1RV8A 1DOSA 4LCSA 4PUUA 1UQYA 3GDMA 3VK5A 3SCQA 1KCXA 1DE6A 2NV9A 3HG3A 3NQAA 2YXOA 1B3VA 4BF7A 1RVGA 2OSXA 1SU5A 1XIEA 1VYPX 7ODCA 2QHAA 3RYSA 2XIJA 4FS9A 3VMOA 2YL9A 1NSJA 4UUIA 3EPNA 1VCGA 4DYEA 1TMHA 4AMAA 1D7FA 2Z24A 1QOQA 5G1MA 1C8VA 1JGIA 5M3WA 1J9YA 5AYYA 3F4VA 1RBAA 2AMGA 4XAFA 3E2SA 3L68A 4L4LA 1P0NA 4MNJA 4WY0B 1NFPA 3DDMA 3N2CA 2HPMA 5CGQA 1L8NA 3PZGA 2HXUA 4Y96A 2NT1A 1OFEA 2Z28A 2OSWA 1EH9A 1JYNA 1K3UA 5DEZA 4JTDA 4HBKA 2HCVA 4AH7A 1ZHAA 4WSHA 1TPFA 3CT2A 4PBEA 2R1LA 3CJPA 3THQA 1GQKA 1ME9A 1QPQA 3SUVA 3O0KA 1VFSA 1UW9A 2CNCA 4C91A 3VKCA 2EPNA 5HWJA 3S9ZA 4U2YA 1QWGA 2R1KA 4JKLA 3C6CA 4ZEPA 2VX7A 3LA4A 4A05A 3TP4A 2VELA 1MXGA 5CG0A 4GI6A 3POHA 3SRHA 4BQ4A 4G2DA 2PDFA 4LW7A 4RX0A 1QATA 2GVYA 4AAJA 2CWXA 3MA8A 1DEDA 2OELA 1EWEA 4KRZA 2BHUA 1TJ1A 4DUVA 3S1WA 3WNNA 1VYRA 3J7HA 5B7ZA 3H24A 4ZBCA 3WMBA 4FR1A 1OD0A 4P8WA 1WKFA 2AMXA 3HV8A 4GQ0A 1KCLA 2DH3A 1BWKA 4POCA 1XYMA 4ACZA 3A9IA 3DGRA 2WWCA 4ZSUA 2BVDA 1ZUAX 4A2SA 4HNOA 1EQPA 1US3A 4BF5A 1ZAIA 1M5WA 2J74A 3MVTA 5FAGA 4MAZA 1F6YA 1OADA 4H1ZA 1K4HA 2W61A 3MJMA 2PC8A 3RIKA 1UD2A 1J6OA 2YL8A 5A6MA 5TF0A 4H7ZA 1ZBVA 3N2TA 1EX1A 1NFGA 1B3WA 1CB2A 4FNQA 4S2BA 3BLOA 2D3LA 2QDEA 2BGSA 2WMFA 4PTNA 1XLGA 4IMDA 3WQOA 4XIAA 4M6PA 3KVLA 1I1WA 2QUNA 4U28A 1FWDC 5E5CA 3WLRA 2WB5A 3NZQA 3OVGA 3EB3A 3VMNA 3V5CA 2TODA 3GY1A 2BSLA 4BA0A 3P81A 5E93A 1CXKA 1KRBC 4KCUA 1SR0A 1YQ2A 1E0WA 4UWMA 3W72A 1G4SA 2ZA1A 1X7IA 1XIJA 1GVOA 1QW9A 3VIPA 4AZ6A 4WXZA 2X0SA 2V69A 2YCEA 4ZFCA 3WJYA 1E5NA 3AYTA 3V0UA 2PU1A 2QEZA 4B3LA 1RLDA 2A2IA 2QLYA 2VNCA 3PK7A 4HP5A 3F5KA 1CDGA 2RGMA 4GQGA 2ZRZA 3V35A 4KRUA 2HE5A 1XKYA 3KBVA 4JY8A 3GXDA 4E2VA 4DZ5A 1K02A 5I3GA 3W7OA 1LG1A 1RBOB 3B0YA 4C6OA 4RDYA 3BCDA 2PWHA 2ZZ3A 4GACA 4N6FA 1MQQA 5DCDA 4ENLA 3M43A 4HNLA 3N34A 1DKWA 2PAJA 1RPKA 3PTKA 3ZO9A 1HJVA 4M29A 4Z17A 5IDZA 3WH7A 2WZHA 3CWNA 3CZGA 4JTEA 1R5YA 4H8NA 3MV01 4RZ5A 1R46A 3HGJA 4M5PA 3TU9A 1TKKA 4FNUA 1FRBA 5CPSA 1UOZA 1QI2A 3S2NA 3VFCA 1SMAA 2PDCA 4UQDA 4OBSA 2VZTA 4W87A 4ATLA 4JIQA 1W5QA 2BS9A 2E3ZA 1MQRA 2CITA 5D9MA 2PSNA 4B3KA 4NNBA 4TX6A 4EWJA 1MMFA 4E8GA 3W2UA 3K8MA 2VM8A 3NPUA 4YWSA 2NQ5A 4ZCWA 2HMCA 3KE0A 1HG3A 1OQFA 2ALDA 5FI8A 1X7FA 3DYPA 4IJBA 4RR4A 2AAAA 4DJFD 2FVKA 4M19A 4A4AA 2WKLA 1ZENA 1Q3NA 1V6VA 3WD3A 4LAUA 2INFA 1TYGA 3LZ5A 5AHLA 5BRQA 2ZZ2A 5DELA 1TUXA 2QJMA 3GSMA 3GTFA 4J27A 2FPVA 3CL6A 3QV6A 3GKFA 5H91A 3UXDA 1XD1A 2DIJA 4F0HA 2YCKX 4UMAA 3ZVHB 5TIMA 4PUKA 2B7QA 2VQTA 1XF0A 2WKGA 3AHYA 4FX6M 5D33A 1G0CA 4A2RA 1ITCA 1W3KA 2V3FA 3ZR6A 4WCJA 2BBFA 1QNOA 1TCMA 1EC9A 3FA3A 4X2RA 1J0YA 2QGHA 5K2ZA 2X2YA 6CGTA 2NT0A 4RZ6A 1KWKA 2BVWA 4AX6A 4HQVA 1X6UA 2CU0A 4QG8A 3ID7A 3PP7A 3RO8A 1IIGA 2FLIA 2ISVA 3A5FA 1IYXA 3M0LA 3M41A 1XR2A 1TPUA 1YNQA 4AD0A 1FWWA 2NXGA 2E4TA 4R3UA 2X16A 4M7TA 4YN5A 3W88A 2XH7A 2R8WA 3MI6A 2BV9A 1SMDA 5GNZA 3C0SA 2D1ZA 3UWWA 1QHPA 3LRKA 5DX7A 1SGJA 5G4WA 2X0YA 4L9ZA 2P76A 1AVAA 4JIRA 4M7SA 3IVTA 5DRIA 4DF2A 4Q4OA 3ATYA 1LT7A 4PTXA 2OGJA 2QS8A 1AMYA 1DWFM 3TN5A 5C8BB 3N2BA 3KLLA 2PLJA 1TQXA 4AF0A 1H09A 3ANYA 3LG3A 1AH4A 1EYEA 3WELA 4HU8A 5CAHA 1JQVA 4UR9A 1K03A 2DZUA 1QT1A 3GR4A 1OT2A 4HOXA 2VURA 2WYSA 1A47A 3G1AA 3HJZA 3QTGA 1PKMA 3N12A 4AZ7A 3CMGA 4TR9A 2HDJA 3MTWA 4G6CA 2W62A 1XYLA 4DJDA 2UBPC 3CU2A 5D38A 3VOJA 1K7XA 3I10A 4DBUA 4DZHA 4R9OA 4KH2A 4J3XA 5KITA 1F8IA 1H7XA 3F7JA 3W28A 1IWBA 4I6VA 3H7UA 4WX2A 4F48A 2ZADA 4Q8WA 4R27A 1XIFA 2IQDA 1DJGA 1Z89A 2P50A 3PWAA 1SR9A 3WF0A 2XVLA 1UP2A 4YPJA 3UCCA 3QH2A 3U57A 2WJFA 1ISZA 3EEZA 3ITYA 5I3JA 5REQB 3S2JA 3GFZA 3PJUA 1T99A 1QCWA 2JKAA 4MLRA 1G94A 4TXEA 2YX0A 4JTIA 1NWRA 4XWUA 5BWAA 4OKDA 2PD5A 4UQCA 1CGUA 4ZFMA 4HVXA 9RUBA 1I4NA 1X6LA 3STEA 4IIEA 3N2MA 2C1IA 2Z0IA 3GU9A 3G18A 4FP1A 3SSJA 3MYOA 4O1CA 2FTWA 4Q6JA 3OIXA 4H9VA 1SUXA 1AD1A 1F3XA 5D37A 4E2OA 4HMEA 4EIVA 1R3RA 2O55A 3QC3A 3O6YX 1REQB 3G1SA 1TWSA 2QJGA 1T96A 1QWKA 4US5A 3I7RA 3V0TA 3W24A 3L21A 1KXVA 2V5DA 4G1KA 3TN3A 1TIMA 3WLNA 3ARZA 1S39A 3GLCA 4CD5A 1VCVA 1VPYA 4PMXA 1UP3A 2F84A 1K70A 3DFSA 4R34A 4A29A 4J2PA 1RUSA 1EGZA 3RU6A 3SZ8A 1J5TA 1LORA 1FDZA 2OLSA 3WLQA 4LBUA 1M68A 3PC0A 2V30A 3RG6A 3FCPA 3CUHA 2E6FA 4AC7C 3I3DA 1TPVA 2X1RA 2WQDA 1K7FA 1S5MA 4AZHA 3Q67A 3STFA 3WFAA 5BXTA 1KQZA 4C6MA 3BGAA 4PMUA 3STGA 1AQ0A 1CGTA 4HPJA 2O0TA 4YCPA 2QCDA 1JNDA 1UWAA 3GVQA 3SCSA 4O57A 1H7OA 4BQ5A 1XCWA 1A5AA 5FIPA 2VEMA 3UCQA 1NOFA 2E8ZA 3CGTA 3WUEA 1YDOA 1XI3A 3TJXA 4E4FA 1TZ7A 1JPIA 4UTHA 1KR0A 1X1NA 4M6VA 3LCLA 3WNPA 3NNTA 5LYRA 4OECA 4CCDA 3TQKA 1I6NA 1B90A 5C0QA 2I56A 3BSHA 2E40A 3TYZA 5LHEA 3B8TA 3P2VA 1Q6QA 3GXPA 2KZHA 1V79A 4IIDA 1YTKA 1TO3A 5EMJA 2YSWA 2CBVA 5CZJA 3O07A 4NHVA 1E6RA 3WY1A 1OWQA 4TMBA 2E0PA 4WKFA 5EMYA 1VD6A 3WKZA 1T5AA 2A0NA 8RUCA 2WVUA 3FEQA 2ISWA 4LAOA 3WIJA 1UKQA 1XIHA 2XGBA 3AIRA 2GUYA 3P84A 2NX3A 3N29A 4E3TA 3W23A 4DO4A 1B3ZA 3DERA 3CHDA 2G41A 1JZ2A 1E73M 2TYSA 4GGHA 2Z29A 5BU9A 3GKAA 2FH8A 3RXZA 5B7YA 2AKMA 2WVTA 2HEJA 3KBNA 3T9PA 3NURA 3LHYA 4C1NA 1IIHA 1TR1A 4B90A 1E6QM 2Y88A 4YTSA 3PBWA 3W27A 4Y8FA 2GJNA 1QK2A 1YPIA 3C52A 2BXVA 4DWDA 1EC8A 4GVIA 1PO9A 1VENA 4QJ4B 3EEGA 1JPHA 3UERA 3RDKA 2ZUNA 4LV4A 1UKSA 1QNRA 1LUCA 1XHGA 5CSYA 3GNOA 4Z2KA 1PV8A 2WK2A 3R8HA 3VDBA 1ZJAA 3HOJA 3ZVIA 3TYDA 4REQA 5I03A 4E6MA 2WHJA 4YNGA 4J3ZA 3TN4A 3WSUA 3T07A 1UD8A 4A3QA 1M65A 3FA4A 5F1UA 3B8SA 1HZYA 4ZO8A 1JXKA 1EJVC 2NVDA 5IBXA 2GJXA 2FHCA 2RJHA 4F2BA 4D8ZA 3HPAA 2G4JA 2ONEA 2WV8A 3K5XA 4AC1X 1MRAA 4HB7A 5H8MA 1GWJA 3GNXA 4IICA 4Q8OA 4NX5A 3CTLA 2A21A 2I14A 1OX6A 1HO4A 3KS6A 1XC6A 3MV11 2O92A 3T44A 3VUPA 3QKEA 2DGAA 3EXRA 4UTIA 3W02A 4AD1A 4HSHA 4F3HA 4A8NA 4I7WA 1ZY9A 3TW7A 2QUMA 4GJIA 5I3KA 2G50A 1E6NA 1BQCA 3W71A 4O4VA 1FA2A 3KHJA 3TXVA 1H7WA 5C55A 2OQHA 5D05A 1H0IA 3WBAA 3OA3A 4E2BA 4UTJA 1TFVA 2PTZA 4LUYA 4AVOA 3FDGA 3OZPA 1W1ZA 1KNWA 1NOWA 1JCTA 1O5KA 3NOEA 4U4MA 5CCZA 4L5ZA 6ENLA 4YHEA 1HL8A 5JQ9A 1A3XA 1Y5VA 3BW2A 3L4TA 4WGXA 4NYYA 3VOFA 3VNIA 4C6CA 2FZDA 1H5VA 4J4KA 3B40A 8CGTA 3VIIA 4UFKA 4IPNB 3I4EA 1EXBA 3KTXA 3IEBA 2Z6IA 2RH9A 3UP8A 3BCJA 1JNEA 2CC0A 3L5AA 1VEOA 1TPEA 4CVUA 3UYIA 1X98A 4HK5A 2XGIA 2DFAA 3A64A 5F2MA 4HOWA 4PL2A 1UUQA 4H6EA 2JEQA 3SRDA 4ES4A 4LUIA 1KFEA 1JFHA 2FPTA 3U4AA 4QE1A 4UZUA 4Z2JA 3IRDA 4WXYA 2ZUTA 1G67A 4NSBA 2O9OA 2HRWA 3EDJA 2DVXA 4G7FA 3VOCA 4O18A 4H8HA 4DF1A 1ZU8A 2G5WA 3M7SA 2MUCA 2JGQA 2GFTA 5GJNA 3UZ5A 3UETA 3LTSA 1AL8A 3HG2A 5TD4A 4JTCA 1EZWA 1TV2A 2YLLA 4UTWA 4GZEA 4V27A 2ACQA 4BEQA 4MNKA 5MKGA 1WNOA 4GBUA 1WDDA 4TX8A 3VILA 4QAWA 2PWEA 2PGEA 3M0HA 2YL5A 3VM5A 1NTHA 3C0QA 2ZZ7A 1EF2A 4J5NA 1UKOA 1KWGA 4CQCA 3GBDA 1GVEA 4GISA 4QS5A 4DBEA 1JZ4A 4CQ9A 3SUUA 4H9MA 5MF5A 1C93A 1XH1A 3IWPA 2VGGA 3V7PA 2NQJA 2VCBA 3PAOA 1V6UA 2E9BA 3AUOA 4AVFA 2Z4GA 3L66A 3MDWA 3B0VC 1W8SA 2C6QA 1WDWA 1A4MA 1KFBA 5XIMA 2DSUA 1VP5A 4QSHA 4GA8A 1A5KC 3GHUA 3REQB 3SAZA 1A49A 1KTBA 2VGFA 3FVDA 1UZDA 2I5GA 2ZRYA 4NJJA 5DY2A 4Y9MA 3ARPA 2Z7KA 2GK1A 2WKJA 2XFRA 1W3LA 2OQYA 2VCAA 4PFHA 1A4LA 4P7LA 4DWSB 1L0PA 3USZA 5D2YA 3CUFA 1DJNA 4MY8A 3W84A 2YCIX 4ZXOA 4BQ2A 4RDVA 1RK5A 4PEEA 2DZBA 3W7RA 3VD7A 1HKVA 2C19A 1OK4A 4WEVX 4Z1BA 4ZE4A 1UR8A 4EOUA 1ICPA 1GGOA 2F2KA 1W91A 2XWEA 2Y8KA 4S3BA 1BVNP 3NQEA 1QHZA 3BTNA 1IT8A 1F76A 1FCQA 4JX4A 3GH5A 3PHAA 3VGHA 2A3HA 1RH9A 4LBRA 1V3IA 4AYGA 3SGZA 3GH7A 2D0FA 3CEUA 3R8RA 3VGFA 5JH1A 1TJ0A 4CD6A 2E68A 4R7OA 3TA9A 4C7DA 1HKJA 1E5JA 3SY1A 2XIOA 1GT8A 1HJXA 4PMJA 3FOKA 4RE4A 3NXFA 2DT2A 3A4JA 5ECUA 3AHTA 1YXYA 1JUEA 5JUVA 1RR2A 2BWGA 4LRTA 1DIKA 3UU0A 3B9AA 2ZX8A 4LVFA 1H60A 1Q7QA 5D02A 1N82A 1VFHA 1G9HA 3OBEA 1XXXA 3T42A 1LLZA 3WLMA 3MPGA 3IIXA 5D8ZA 2ACRA 4LXFA 1W3IA 4H19A 4ILSA 1FFRA 5H2ZA 3RM8A 1GNXA 1RCOB 2WC7A 4P7RA 2A3CA 4KIEA 3IV3A 3D3AA 3VD3A 1HO1A 3GXTA 2D0GA 3GR7A 5DO8A 2FGLA 2GQAA 1AW5A 1H62A 2GQ3A 3A5VA 3A47A 1OHLA 4K36A 3O6DA 1R30A 3CL7A 4DWSD 2DT1A 3LEPA 2IMRA 3B0XA 3EKGA 5TBOA 3W7IA 4HHHA 2ZICA 4QDPA 4O50A 4N0RA 3VA8A 5FJOA 2FFCA 4BI6A 1BWVA 2OCZA 3RM9A 1I2NA 4HN4A 5KZDA 4CQDA 2VL4A 4OIFA 1PKLA 5JMUA 5E70A 3DIPA 4H7CA 3WF2A 1CGWA 1RK6A 3NM3A 2G3IA 4QRNA 3ARQA 2E5BA 2BODX 1M03A 1EP1A 3OOQA 1YDVA 1PJ9A 4LYRA 8XIMA 3UEQA 5CBJA 4GH1A 4D8LA 4F9DA 2F38A 4RUBA 2KX9A 2G4FA 5D32A 4NVTA 4I6KA 4M24A 4JTFA 3KOZA 3MUAA 2ZRVA 2J8TA 4R33A 3WMSA 5CLWA 2ZWZA 3E0FA 3MSDA 1HKKA 3ZLHA 3NM1A 2QQ6A 3A23A 1GOWA 1HW6A 3HQ1A 3C56A 2Y85A 4TVUA 4MLJA 2EPHA 4FPSA 4GNKB 1E1CA 3BK0A 5HJYA 2Y0FA 3W1MA 4AD3A 2X40A 2VOMA 2EPLX 5FEXA 2F2HA 4UOQA 3HURA 3QHNA 2J24A 3A24A 3M0YA 1EKOA 3ANUA 1REQA 2BP1A 1TJRA 2J13A 2R9RA 1Z41A 1E0VA 1GOIA 4PCPA 1B4KA 3PZ9A 3UWEA 1Q85A 3H4WA 3O7UA 4ZSTA 1HL9A 1LLWA 4LAZA 4GIYA 3ARSA 3NDZA 3JVAA 3R43A 4B5WA 3AS2A 3OIHA 1EJXC 4MADA 3SQSA 4DXVA 5C9ZA 2E9MA 1ONRA 2PDBA 2RDWA 3UFYA 5HOSA 2R14A 4KMQA 2CXGA 4MGGA 4XKYA 3SADA 3LUTA 4C7GA 4XVDA 1XPYA 1SZGA 1W3NA 1DORA 1HN1A 1N8WA 3A21A 3ICJA 5A6SA 3VM7A 1E6XM 3BGJA 4GXWA 1PUDA 4WOZA 2IS7A 2WPBA 2J78A 1Q8JA 3U2EA 3VFLA 4HGXA 1O7AA 1B5TA 1US0A 3KDOA 3GDKA 1RD5A 1W1VA 1S5WA 1MUWA 3W7NA 5HQMA 3MHFA 3AO0A 1Q6FA 4BWLC 4EANA 3PBMA 1MSSA 3EPOA 3GBEA 5TAOA 4WVXA 1HKIA 3S9IA 2X42A 1SO3A 4M1BA 4DLMA 3JS3A 3CIXA 3VGGA 1XQLA 6PTDA 4GJ1A 4LUTB 5AKQA 4CNSA 1Q13A 4LCRA 5FJTA 1EB3A 1K77A 2ZXDA 1DXFA 2FH6A 3H7RA 2WQPA 2XN0A 4CUCA 5AC4A 1DBTA 4X63A 2BGQA 2ZE3A 3UXLA 3GD6A 3G1VA 3BQ5A 3WG6A 1VFOA 3BG3A 2H8XA 2CLPA 1OT1A 4LH8A 3NYDA 3EWYA 4KF1A 3KAOA 1JI1A 1V4YA 1W1YA 3T78A 4NQ1A 3DX5A 2QYGA 2J8FA 2W9MA 3FXGA 3MCOA 4JFWA 4W8BA 3ZQ9A 1HNYA 4S38A 3CV7A 3W2JA 1ECQA 3B8DA 1EPVA 1UD6A 3CYJA 1W9BM 1PAMA 3U8GA 3EOOA 1B3YA 3EOSA 4IWWA 5FCZA 2JQXA 2TAAA 1Q7ZA 2HS6A 4IPLA 2WM0A 2OEMA 3RLHA 3UW6A 3DKJA 1XKJA 5H1WA 2PUZA 1VFMA 1U5VA 3OYZA 1XINA 3URNA 2VC9A 1W9XA 2YW4A 5PTDA 4HPNA 2WVVB 4QFUA 2V9DA 5DMNA 1GW9A 1K9EA 2D2OA 3IJ9A 1K4GA 1Q2SA 4A3RA 3IRSA 5FESA 1CIUA 4OFCA 3GTHA 4JIEA 3L4VA 1QNVA 5EYWA 2YBVA 3FJLA 2A3BA 3AUJA 2BVTA 1KCKA 5D2XA 1UA3A 3MSRA 4L6DA 3TEVA 4GY0A 3BOXA 3WL1A 3QOKA 4Y9AA 3T81A 4FX8A 1GJPA 1FTXA 1UUOA 2J7BA 1DWJM 3GAKA 1WPCA 4MDPA 4JEJA 2EG8A 1ZRQA 4DUWA 2JIEA 3RPDA 4B15A 5IFPA 5A8OA 4ALDA 3BW3A 1M3UA 4C6PA 3VVGA 3CAKA 2ON3A 3EDKA 3WEMA 4NNCA 1KV8A 4AD5A 3K8LA 3EBVA 3BLIA 1QO5A 1ZGDA 2C1GA 3M9YA 1OYAA 4LGXA 2CW6A 4X9SA 2X1SA 1CXIA 4W7WA 4FNTA 4XZ9A 4CLMA 4DN1A 1YPXA 3M7WA 4AWUA 3W37A 3KUMA 2J9XA 1GJWA 3C8FA 3LGDA 2WO5A 2RDXA 3S0CA 3LHZA 5CJ5A 1V7YA 4PRTA 4D2JA 3N2XA 3DHUA 4I7UA 4Z1DA 2DSKA 1H7RA 5EB8A 1OYCA 3BXWA 3TSBA 3A3XA 4CNTA 1GG1A 4J35A 3FN9A 3QYSA 4KCVA 4RW5A 3LV6A 4FX7A 1WDRA 3FFSA 1O60A 2YDAA 1VRDA 2CYGA 3QZAA 3TAKA 1IEWA 4GYPC 2VFHA 2A6LA 1EDTA 3LENA 1RQEA 3CZKA 4QJ1A 4HA3A 5I24A 1B3XA 2WMGA 3RILA 3EMZA 2BG5A 5JIWA 3ORWA 4RE2A 3T8LA 4Z1CA 3W2KA 3W76A 2EXOA 4K7VA 1X6NA 2JGYA 4GPNA 5AYXA 3U7VA 2YOCA 1F7BA 2ZX9A 2P1FA 4TUFA 6REQA 1IXOA 2QDGA 4O8AA 2CLEA 1UIOA 3FVMA 3AU2A 1XBZA 3OG3A 1E9IA 4UCFA 4XZMX 3UXKA 2PRMA 3RPMA 3SCPA 4F4RA 3TYCA 1RP9A 3VUSA 4KEUA 1OZQA 1P0DA 1IHIA 1KA9F 3Q65A 3CB3A 1TX2A 1J0KA 3C3UA 1XX1A 4UTLA 4M51A 1JCMP 5FAJA 1O6IA 1JF6A 3GIYA 4RZBA 5AY7A 4DPQA 5AHNA 4GRSA 1EPXA 3E3HA 3I68A 3VDAA 4PMOA 2GGGA 2ACUA 4PC8A 1F6KA 5K4ZA 1GK8A 1CLXA 1JDEA 3C2FA 3K1GA 4A8IA 2PP1A 1WO2A 2X2GA 3SQMA 1XISA 1LBMA 4CQBA 2OMAA 5CC6A 1JFXA 3E2QA 4ZTXA 4PCNA 3ABRA 1NIUA 3KVJA 4B92A 3G8EA 1SZNA 4G1NA 2RJGA 1X38A 3G1HA 2GL5A 2I5QA 5E9AA 5BCAA 3UR8A 2WSQA 1CBGA 2VUNA 4LTSA 4S3CA 3TAOA 3TK7A 4MWAA 1RLCL 1EO7A 4EF8A 4LY8A 2WMIA 3ZIZA 3W7MA 3GW3A 1S1RA 1S5TA 3URQA 1KFWA 1Z7AA 2PP3A 5FEWA 3OLEA 4MUPA 4JN8A 4MKNA 2DEPA 4XZHA 4FB7A 4AEOA 4GVHA 3QSRA 2SFPA 3MBDA 4HHLA 4LJ3A 4K2SA 2OEKA 4FXSA 3IJQA 4LS0A 1XLDA 4NIRA 4LS1A 2OLHA 4WZHA 3ITGA 2QZRA 3LCHA 2E77A 4RKAA 3WD0A 3QYQA 2WOQA 1Q6EA 2BX7A 2NQHA 4AD2A 2ZCGA 1W1IE 5T9BG 4U3CA 1VEMA 2PWFA 4HHMA 1KRMA 2FHFA 3EWXA 2IXUA 3EB4A 5K4XA 5IHRA 2GJPA 1SSGA 3RITA 2OLAA 3TSMA 2VZVA 4AZBA 1ONWA 1VBRA 5HPOA 3THDA 2WAGA 1MW3A 4B3ZA 1EJSC 1F61A 3QR1A 3VKKA 4GFSA 3MMTA 4LF2A 4MAVA 3WENA 1WKEA 1OSEA 5E6YA 1R86A 3UG8A 1JZ8A 1F3WA 5FEZA 2I16A 3MKVA 2PP0A 3PB2A 3WH9A 3N3TA 3EKZA 3AS3A 3ERPA 4LY4A 1W2PA 1JCJA 3W82A 2ZXAA 3WQDA 4ZE5A 2ZTJA 1AFSA 3K46A 4EP8C 2P8BA 3A4WA 1I75A 3NQCA 3IPWA 3OVRA 1N2VA 2HVOA 3GUGA 3DI0A 3AQUA 4CNNA 1LYXA 3KOWA 2W79A 4JIPA 1UC4A 3B8IA 4DJED 5F2GA 3GXFA 1TRDA 3MW7A 1H7PA 3KFTA 1DIEA 1OD8A 3Q2DA 3I6EA 4HPHA 1XYCA 4UXDA 3SCNA 3I65A 1FWSA 4TIMA 2YR1A 4FNSA 2WC3A 4R85A 4H00A 4GINA 3H23A 3QHMA 4DUXA 3QZEA 2IQTA 2DU2A 3MI3A 3PZIA 1SO5A 3HPXA 4ZGYA 1H5YA 1KO0A 2XVNA 4O13A 2X7WA 4MOZA 5F4WA 3BURA 5HINA 4CEUC 3PJXA 4UFJA 3TTQA 5A8MA 2EQDA 3GG0A 1S38A 1T41A 4BJHA 4M1RA 4HIBA 3SIZA 3G2GA 3VIHA 3QW4B 2GGEA 4L61A 2XIBA 1A50A 2OOGA 5A95A 5E1QA 3I3EA 3AMGA 1RCXB 1YNPA 4HOZA 2PRHA 5AVHA 5A6LA 4AWSA 2VWTA 4PMNA 1DJWA 3L5MA 2FKPA 4DI9A 1C8QA 1ZBCA 2QJHA 5FL0A 3ZJ7A 3PFMA 3W2NA 1JCYA 1U1UA 3MYPA 3GDTA 1RSCA 3VGEA 1H7NA 3CHCA 3DN5A 4UC5A 1OFQA 1SW7A 3ZR5A 5A8GA 1XPGA 2ZKMX 4CNOA 2Y7EA 3O16A 3BLKA 3FGCB 5CC5A 3W7HA 4MYAA 2X05A 1P4CA 4DIAA 1GEQA 2D22A 3FAWA 1PXGA 3G1DA 3NSMA 2W4XA 1Q45A 2GQ9A 3BWWA 4EVZA 4Y90A 3TUUA 3R89A 3PPHA 4ZB5A 4UCGA 4F0RA 4DZIA 3THUA 2QAPA 2DV0A 2Y4SA 1PEZA 3QGKC 3QZ6A 3BAJA 3RX4A 2P0IA 3R12A 1OCJA 3NL6A 1VIWA 2Q09A 1A5SA 2I9EA 5IFTA 4IP5A 3IIVA 1V6TA 4O8RA 4PA8A 1GQNA 3GB6A 4MFEA 2OYKA 4A21A 1K1DA 3C3NA 3WZ0E 1GVSA 3W7GA 1DV7A 4TQTA 4E8DA 1Q66A 4BY3A 5CKSA 3FIGA 4QTGA 4Q8UA 3EKLA 2WJEA 3XINA 3UD6A 1LWJA 1KFLA 2OFJA 4CQ8A 1OM0A 4X9YA 1GQLA 2EPMX 4JTTA 7PTDA 2VDIA 1OYBA 4HCHA 2PBOA 5D9NA 1VFTA 4GUJA 4BHYA 1O66A 2G37A 1V0LA 1Q2RA 2BXZA 4TMCA 2QCCA 4EWND 3V4BA 3ABQA 3T0BA 2QT3A 2YZ5A 4LX4A 3UZXA 1V3LA 2AL2B 1YIXA 1BXBA 4PMRA 3E0WA 3P8IA 1BRLA 1Q6OA 5C2XA 2PEVA 3W07A 1XGEA 4C6DA 4JTQA 3L7RA 3WL0A 2AQVA 2B0MA 1CLVA 3BOFA 1A5LC 3WEZA 3BJSA 4UTFA 1KBIA 2VD8A 1ZPTA 5JIPA 3NWRA 2EGZA 1LQ0A 2EO7A 1R87A 1I2PA 1BRLB 1E1FA 3QXBA 3UNTA 3VMPA 3B3DA 3WJZA 4GKTA 5A94A 3WNKA 1VJIA 2PDUA 4XD3A 2V63A 3KCOA 1VPQA 3KL0A 1HT6A 1UOKA 4YMZA 3ZR4A 1Q4WA 2F7FA 1MZHA 3OZMA 3NQGA 3NR0A 1MUMA 2X41A 4WJEA 1SZFA 3AHZA 3GU2A 2BHYA 3F2CA 1CNVA 1MO0A 1CGVA 4L1WA 3AIVA 4KEZA 3EB2A 4JQ1A 3PNZA 2VRKA 1DXEA 1NWTA 2YKKA 1FXQA 1NU5A 1MXSA 5AC5A 3KEHA 4GX9A 5E0FA 4D6CA 4GIAA 4XKMA 3KRUA 2O7QA 3NA8A 2VFIA 1XCXA 4PB5A 4HYWA 4NJGA 1P7TA 3WDHA 2Y24A 3O6AA 3VZXA 1XRFA 1P43A 3PY2A 4NXKA 4K1GA 3WD2A 1XICA 3C2VA 1AJ0A 4YLWA 4UFHA 3IUIA 3H2OA 1GQJA 3AYVA 2CLIA 3KOXA 1YW1A 3XIMA 3HM7A 3W0KA 5GQBA 3FS2A 3L2IA 1J12A 4OV4A 3M5XA 5A2BA 1L6GA 3OJGA 3IJ6A 2ZBTA 4WJXA 2YGYA 4XX6A 1JUKA 5I09A 5EY5A 3CZ8A 3VIOA 3DFPA 2E67A 3ES7A 4LQ1A 4A3HA 3W7PA 3AMKA 3DGBA 2ZTKA 4JIIX 2VFGA 4IQDA 2Y8UA 3AS1A 4JD4A 3TNOA 3T05A 3C61A 4ORIA 3KBJA 2F6XA 2Z2BA 4FF7A 3D47A 5D04C 4G7EA 1Q4NX 1O1HA 4JYFA 1W3JA 3TWBA 1BPLB 3MJYA 3HG5A 2PU0A 1TV8A 1IT7A 3O0FA 4KIRA 1XG3A 1OABA 1KLYA 1ZAHA 4GFIA 5DRCA 2J47A 1ZP3A 3CUXA 2GGJA 1BG9A 3EMQA 4Q8MA 3WBWA 1SJAA 3L65A 4B5VA 2GWNA 4W4QA 4K38A 2XSXA 4MYXA 4QNWA 4QDMA 2D73A 1SO6A 2YA0A 1KFJA 1YBQB 4QISA 3RFAA 4ERGA 5G2IA 1ECEA 1CECA 2P5NA 2CLHA 3KOFA 1TWWA 3GX9A 2XYLA 1K6AA 4PRWA 1NF0A 1MEWA 1EQCA 3LSCA 2EF9A 1JEZA 3UXIA 3VNMA 3L0KA 5LNWA 2OG9A 4HA4A 1POJA 4FR6A 1EF3A 4I9AA 2QULA 4PCSA 4MFDA 3S47A 4YU1A 1AUSL 1W9VA 2WCSA 3G77A 4G7EB 5A6BD 3CQIA 1FVPA 3MY9A 4KPLA 5K9XA 4NF7A 3NGFA 3GXIA 4PB3A 2FDSA 4JQ3A 4JOMA 5D4YA 4QE4A 3NFUA 3K1DA 2PS2A 4ZMGA 2WNNA 3AOFA 3FSUA 5GVJA 3BJFA 3WEOA 1UA7A 4QJ5B 1HVQA 3UZJA 4HU0A 3EDEA 4P7QA 1IV8A 3GH4A 5HMDA 4MSSA 3VZZA 1W32A 5G5IA 4AEEA 3QRHA 3NDYA 3JZUA 1BYBA 4F79A 3GG8A 2CCRA 4UMBA 1LOLA 2CHOA 1TG7A 1F6PA 4DXKA 3MSGA 1GKRA 3VXGA 4N4QA 1SZRA 1AQHA 1CCWB 1OFBA 3U3HA 1HJWA 3N14A 1W17A 1NFBA 4WHBA 1OF8A 4QAIA 3V1HA 3GYEA 3WQWA 3FY1A 3GIQA 1K9FA 1R2TA 2W5FA 4ZVJA 4KWUA 4FOUA 4WUIA 1PHWA 3W22A 4CN6A 1K8CA 3YPIA 3B03A 3KDNA 3TDFA 3CASA 3MHGA 1QUMA 3NQ7A 2PF0A 5FF7A 3PAJA 4MG4A 1D8CA 1TPB1 3RCNA 3KVKA 3KWXA 3WLJA 1E9LA 1JPDX 3H4XA 2NW0A 4QBXA 4MWAC 3LHTA 3BJTA 3W75A 3UWZA 3HA1A 2F8QA 4IFKB 1WZAA 4H7VA 5LXXA 3KW3A 3K8KA 3TSDA 3ITOA 1YX1A 2V3DA 1WYIA 4AF0B 2WJZA 2A3EA 3NIYA 4A8RA 3W7KA 4XAYA 4LUSB 4J28A 4HPXA 4JFVA 1MI3A 2XZ9A 3S5YA 1JQXA 4NU7A 2GK1B 4CCEA 1PZ3A 4AY8A 1BWLA 2VRQA 4PGLA 5HA7A 4LRSA 3THCA 1E4IA 4RV3A 1PZ1A 2DJXA 1KC7A 3NGJA 4F66A 2ABAA 3SRKA 4AY1A 1MDLA 2XIMA 1U22A 2C7FA 3IV8A 4J3VA 1GTEA 1PSCA 4W88A 4P8XA 5A2CA 1MYRA 3BANA 3GC4A 1KXQA 2FFIA 1E71M 4WY0F 3UWQA 3LS9A 4LEFA 1XIMA 1ZQ5A 3PN8A 3GHSA 4B2DA 4IMFA 5ABHA 3F03K 4F2UA 2PTDA 3C8NA 4J9JA 3OGRA 4ML9A 2HXTA 3AI0A 1RA5A 4ICMA 1FWFC 1TMLA 2VFFA 4S1FA 4OT7A 1QW8A 1K9TA 3S83A 1JYVA 5LIKX 2OOFA 3DOPA 1GORA 4PTWA 4NAFB 1DXIA 4XD4A 1EDGA 4LBSA 1GVIA 2VQUA 5DMLA 4D1JA 1O4UA 1KD0A 2BB0A 3GDRA 3M5ZA 4KESA 1QAPA 4LU0A 5CSSA 2VP8A 4L6HA 2NUYA 1TB3A 3PS7A 4W9TA 4A3UA 3L4YA 7REQA 2JALA 3TX9A 2YFOA 4YVPA 4Q4RA 4NL1A 4Z08A 1BG4A 5HUPA 4JR5A 3APTA 5IXEA 3UT0A 1J2BA 1DWHM 1Z8AA 2HROA 4PUDA 4F0SA 1OFPA 3GFXA 4IX0A 2XM2A 1ZB5A 2VC5A 1BF6A 4ZODA 2Q8XA 3TJ4A 4PTMA 1W6TA 4TTUA 2E09A 3GTXA 4QEEA 2QKFA 2DUAA 4MZ8A 1UR1A 2G3MA 4PCTA 1V3JA 5D2TA 1PCWA 4RDWA 1NDVA 3PULA 4CEXC 2PWUA 4DM2A 3EA1A 3G8RA 2PWDA 4XBKA 4Y9PA 1J18A 2TMDA 3TR9A 3LK6A 3SRFA 3P93A 4LVGA 3VNKA 3CPGA 1X96A 2Q01A 2FPYA 4Y9NA 3ECQA 3M5VA 4HK6A 3IANA 3FJ6A 1M7PA 2G96A 3SIMA 1F4HA 1OEPA 2D24A 4NAEB 3RX3A 2GVJA 3P0XA 2E1DA 1SPQA 1O1ZA 1UH2A 5GJMA 3WDIA 4ZB0A 1SFTA 3ONBA 3SN4A 1ENUA 2GVGA 4W8LA 2X30A 3MHUA 4BKNA 3NQFA 3VOHA 1S2VA 3AZTA 1ZP4A 2J7DA 1LP6A 4C65A 3OODA 3BH4A 4XQ6A 2NSOA 4GY7A 9XIAA 2BLEA 1UIPA 2PLCA 4A35A 4DLFA 1FHLA 4DX3A 5HQLA 2Z1XA 3PZMA 1D3HA 2P10A 4FLSA 3B4YA 3WFLA 1BF2A 2EG6A 1HKWA 1V3KA 1KM3A 4L65A 1OFRA 4I5UA 4GKLA 4R5EA 2QPUA 5CH9A 5C71A 3MKCA 3QV8A 4HMDA 4UTTC 4O0QA 3RR4A 4US5D 3LV5A 1IQ8A 3BCFA 1G01A 4N7QA 1QNSA 4GQQA 4QCEA 5EMKA 2DT3A 2FVLA 3WLPA 3W3OA 3MP3A 1XIDA 2EG7A 3DC8A 4DWSA 1R3QA 1HJSA 5M17A 4QHRA 2XVKA 3S6OA 2R94A 3NOYA 4B9ZA 1KTCA 3CK5A 2WSKA 3IJDA 1H3GA 4LVDA 1S5VA 3G1RA 3NSXA 3RUBL 2BDQA 1U5JA 3IK2A 4GD0A 4LUSA 1HKMA 3IUHA 1KFCA 1FDYA 1NEYA 1XLIA 1H41A 1GCYA 4QE5A 4QLKA 1FH7A 1OG0A 3UWUA 2Z2AA 3LM3A 4PRRA 1EHAA 4MTVA 1GVYA 4EX4A 4HYRA 1QI4A 3E0LA 2I7GA 1W9PA 3CQ0A 4C6BA 3LCWA 3QPYA 4ZOCA 1HP4A 2BHZA 1P6WA 5HWMA 4NT0A 1O12A 3AIBA 3IARA 1X8CA 4M56A 4NRSA 2PZ0A 3H6OA 4PUNA 1UH4A 1CZ1A 1CXEA 2B7OA 4CKQA 1OF6A 4F0MA 2XTKA 1FOBA 4ATWA 1L8PA 4O0KA 3B8WA 2WBGA 3ARYA 3SGGA 3MCNA 1YLVA 3HIJA 3SURA 1GYLA 1RZMA 1L9WA 1V8EA 1GVFA 5J04A 4QNEA 5LIYX 3OVQA 2NX9A 4O14A 1M7JA 3EX1A 3R8GA 3KTSA 4D6IA 1YNYA 2W6RA 5G1YA 4XZLX 4GYKA 3SDOA 2P0OA 2CZFA 1PB0A 2E5CA 1NVMA 2UWFA 3H21A 3W1LA 3DYOA 4NI8A 2J7HA 5AC7A 3NUKA 3U5YA 2J7EA 2WANA 3E1F1 4QEHA 4RZ4A 1IE7C 4BCEA 3CWHA 4PMQA 5ECVA 3UG5A 4A6GA 3NCOA 5A3HA 4RCXA 1TVPA 1Q8AA 4XG1A 2YDRA 5J5RA 8TIMA 2PC4A 3QGAC 3CV1A 3P80A 1JZ3A 4HNVA 1AW2A 1R3YA 3G5EA 1BXCA 3HTWA 5LA2A 4TV6A 3W81A 3T7VA 2PWGA 3H2FA 3T0CA 2QNEA 2ZUUA 4P61A 3MZ2A 1FUYA 3GG1A 2VVNA 2VOTA 5HWNA 3U4FA 5IBXC 2TPSA 1P0KA 1P6CA 2YCLA 3LLDA 1XYAA 2GSEA 4KWVA 2WSRA 1JIBA 1KR1A 2ZUVA 4D6JA 3HZ3A 4HNCA 1B4EA 4QG9A 4N6EA 3AXKA 4ZQOA 2PBGA 3W87A 3W86A 4AIEA 3NTYA 3TH6A 3WN6A 2WZTA 1A80A 2GLKA 4OV9A 3VE9A 3FYPA 4XSMA 1RJQA 3IJLA 2GDQA 3RRAA 1NELA 4AZCB 1V3MA 2DVUA 2I1OA 4EPDC 2OEJA 1P7TB 4Q33A 3EOEA 4BQ3A 3WQ5A 2XVGA 1DJYA 1FWHC 4XV0A 1BYDA 3S46A 3RK8A 4GVFA 4OU1A 1QVBA 5I5RA 1RY8A 2X7VA 5H8PA 3G0UA 1RQBA 1YE4A 3HO8A 4UFIA 2Y1HA 1ODUA 3BDKA 3M0MA 1QTWA 3SW6A 3WH5A 3LTYA 3WDQA 2HVMA 1ZCOA 1AG1O 3FLUA 3PNUA 4Q8TA 4BWLA 4GHRA 4QIUA 3ZMRA 3E49A 3S9YA 2CZVA 4NUWA 5C5YA 4TX9A 1TWDA 2CESA 4K8EA 4P8UA 2ZDRA 2Y7DA 3FHQA 3K2GA 5DT7A 1IZCA 1E56A 4M6UA 4Y7EA 4U33A 2AL2A 2A6NA 2OTDA 1D3CA 4XBSA 2EEXA 3T08A 4JBRA 1U1HA 7TAAA 4Q7NA 4D6HA 2V0TA 3WQGA 4BZYA 1ONXA 4AU0A 4DQWA 1LWHA 1PCKA 3G0XA 3B06A 3TNBA 3M0VA 5BRBA 1P0EA 3VYLA 3FGCA 4LPCA 3DEQA 2V2CA 1I1XA 1WUFA 1BHGA 4ONVA 2L5HA 3KCJA 4YTTA 3DKLA 2GJXB 3VNYA 1T40A 4K68A 1P5BA 3RN6A 4N9DA 1B57A 1XDJA 4W84A 1IXPA 2HS8A 1EGVA 4UZSA 3R0DA 4M80A 1T0OA 4FLQA 2D2HA 4DBWA 1YDNA 4AFYA 1Z6KA 3ZWSA 3GXNA 3UESA 2X09A 2CPUA 5JBEA 5HJXA 3ZYZA 1RAKA 1IEQA 1HL2A 1PDZA 2PA6A 2AGKA 4H8VA 1TTIA 1FWBC 1M7OA 3D0CA 5KMYA 1CW2A 1H11A 1W5PA 1LRTA 2YPIA 3TE9A 5FOOA 3B04A 3QMTA 1SVDA 4CD4A 3EWBX 1KM1A 1Q6CA 3VOGA 3DFQA 2VEFA 4JL2A 3GG7A 1ZFJA 4GI9A 2MNRA 1GKPA 3TJIA 1IGWA 1KGXA 2QAFA 3TTYA 2AGTA 3CAVA 1E3XA 2OPJA 3KCLA 4KFOA 5GNXA 3SQLA 2OR2A 3W26A 3M46A 1GZJA 2E1WA 1E4NA 3NYZA 5AC6A 1UMYA 4K8GA 1ZLPA 2FZ9A 4ZA0A 3F4CA 2DIEA 2H6RA 4NZJA 1ML1A 3R94A 4UNLA 1TV3A 1R9ZA 4UNIA 2WM1A 3CS2A 1LZOA 1ICQA 3ZOAA 2PCEA 1Q5MA 5M2FX 4MY1A 3FJ4A 4ICNA 3W6MA 5I77A 4B4FA 4YCOA 1Q7MA 2ISFA 1KQYA 3P5YA 1B1YA 4B9YA 1FQ0A 3BMXA 3SFKA 4D6EA 1SJDA 1GHSA 2CLMA 4PULA 2DUZA 3ONCA 1T8QA 3ITXA 2BXYA 4KT2A 3E12A 2A3AA 3PG9A 4LFYA 1F5ZA 1JRBA 2ISSA 2CZDA 4DF0A 4PMYA 1GYNA 4ACYA 2WVSA 5LA1A 4OZOA 4E3VA 1XBVA 1NWUA 3GC5A 1GQIA 1VIZA 2YA2A 1V08A 3PUGA 1D7KA 4ZB2A 2XZ7A 5MKGB 1E1EA 1HQTA 2F6KA 2VDHA 5C7HA 5EMUA 1PX3A 2V3GA 2X1UA 4HHPA 3HBLA 4WQ6A 3STPA 2GUBA 2XSAA 4KRTA 1N7KA 1UWIA 3CM4A 3S8HA 1B30A 3BW4A 3CPUA 4R53A 1NDWA 4IZGA 3WMCA 5BOOA 1VEPA 1OVDA 2XH2A 2VFDA 2NXHA 2E8YA 5HUOA 4Q8VA 1MEHA 5I06A 3PFRA 3AIEA 3QJAA 4CQAA 2Q8ZA 4RNHA 4ZOBA 2XHYA 4RLIA 4CD7A 2DDXA 5KZEA 5AHFA 1I60A 3S5NA 1B31A 3P67A 4JHMA 5B80A 1QASA 3PF3A 2Q6ZA 1OC5A 1EJTC 4I8YA 3S1VA 2C15A 2FQIA 3CHFA 4YWIA 3EWCA 2ATSA 4XO7A 4UFLA 2Z7GA 3SCTA 1EA0A 4Z1AA 4Z42C 5G2WA 4MZ1A 1CI1A 1XV8A 1W37A 2W66A 4GIRA 3NQBA 1T7LA 4TVDA 3AHVA 4MY9A 1JR1A 2FMOA 3G22A 1R85A 1LTDA 1QI3A 1Y5XA 3TMLA 1PWMA 1LQ2A 3RPTA 3PUOA 4XKYB 1ME7A 1EX5A 3DC0A 5KZMA 3V5OA 2VR2A 5EMLA 2PLMA 4ROQA 3MUY1 4WRHA 2F6UA 4F2TA 4ZQMA 3T2OA 3R0KA 3CH9A 3PZQA 3RJYA 4OBTA 4WSKA 1QR7A 1OCNA 1P48A 5ABTA 1JAKA 1GZ1A 3TTEA 1KM5A 2J27A 3KM8A 3H2MA 3LZ3A 4MWAB 3BC9A 3KOYA 3VNZA 1P1MA 2UV8G 2J62A 2YJQA 1XRSA 3NAVA 4AB4A 4W85A 3DYMA 3PB0A 3WX7A 5BW6A 3A3WA 1JDDA 2DZSA 3T2PA 1WDQA 3LPFA 4DO5A 4MNMA 1E9YB 5EU9A 4UMCA 3E2RA 3MMWA 6A3HA 4GGBA 3L4XA 5AECA 1OY0A 3IJIA 5AZ1A 2JF6A 2XINA 4OE7A 2V82A 3WFZA 5LKYA 5CBBA 1OC7A 3CH0A 2RUSA 6XIMA 3OHIA 4C6JA 4CN1A 1AZ2A 3MWCA 4S3JA 4A3YA 1VR6A 3P14A 3DG7A 2O4QA 1E43A 4GNJA 3S5OA 1TA3A 3LPGA 3B9DA 2V6AA 3GVWA 3W29A 1O5XA 3AS0A 1J0ZA 1KRCC 3BLPX 4XTDA 1PX8A 1LT8A 4MZYA 4O15A 1YEYA 2CERA 4YL2A 4B4HA 3GAYA 4NJHA 2VGIA 4OVXA 3VIMA 4KWOA