4O53A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
b'RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFLFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o53A00
3NM1A 2FPYA 3MI3A 4H6KA 4N9BA 1YTDA 3UY7A 2ZRZA 2ZA1A 3S1XA 1XFBA 1A5SA 2X1SA 5CPMA 1W5MA 3W1QA 2YSWA 4LUJA 3SSJA 2PRHA 3G3DA 5BMXA 1AW1A 3TV8A 1K03A 1CI1A 4AHQA 3LDVA 4OGZA 4R53A 1JCMP 1LRQA 5KZEA 5LSMA 3G8RA 3NQDA 2A7NA 2NUWA 1GVQA 3EKZA 2FJKA 4JR5A 3TFXA 3UWQA 1ONRA 1FDYA 4HSNA 3EXTA 3CM4A 3W1AA 4Q33A 3G3MA 3WFAA 4CNOA 2WOQA 1QAPA 3O6DA 2EAWA 2ZRWA 4PTNA 5CGQA 3UZ5A 4FIRA 2YCEA 3B0PA 3E49A 3GXNA 3QYQA 1AL7A 3YPIA 2G97A 2Y6ZA 2ZYFA 4UTWA 4O28A 4BWLA 5K7JA 2A2IA 4NNAA 3TJLA 5FF0A 2A7RA 1S5TA 3BV4A 1ZENA 1GVFA 1TB3A 4ADUA 1MO0A 1XBYA 1JQXA 2WNNA 1G7UA 4XBKA 4Z0JA 3GDRA 5C55A 5LNRA 1FWNA 3M1ZA 4IMGA 1VLWA 3HOJA 4JX4A 4EOUA 4LUIA 1SR9A 1EP1A 2YYUA 4OV9A 1KM3A 1SZEA 1K8YA 2WNZA 4JTEA 4YMZA 3NL6A 4ORIA 1SO4A 2AAMA 1EP2A 2Y63A 3ABQA 1YXDA 3LBCA 4D2JA 2EHHA 4O16A 2ZRVA 2IQTA 3SZ8A 1MEHA 1OG0A 2FFCA 2DZWA 2JGYA 4N2YA 5T26A 1P1XA 3M5XA 3W1MA 3T78A 2VEKA 3W7CA 2E5DA 1XXXA 2E6FA 2A21A 5HUPA 2BSLA 4S2BA 4DF2A 3GNDA 4JDBA 4ZQRA 5BW6A 4GFSA 3BARA 3PBVA 3M47A 4Y90A 5E1QA 1YLVA 4YCOA 3KVMA 1OHLA 3UNDA 3HIJA 4HHPA 4X22A 4PA8A 3W2NA 3O16A 3MHGA 4HT3A 5KZMA 4KKXA 3S5ZA 1VHNA 3S1UA 3QSRA 4K38A 3C8FA 3HJZA 1RR2A 4MKNA 2H8XA 3W7HA 3CIXA 4JY9A 3E02A 1XBZA 2VENA 2GVJA 1EB3A 1L6SA 4JYEA 1SZNA 1G7VA 2GQ9A 1F05A 2OT0A 4WY0B 2CU0A 1FWSA 2R8WA 1X1ZA 3M6YA 5GVJA 4FX6M 1DQWA 2H6RA 3LV5A 4RLIA 1SFLA 3NQGA 3GX9A 2ISWA 4QQ3A 3LHTA 3N34A 1U83A 2TMDA 3Q37A 1UASA 2CLHA 4U4MA 3LX9A 2OT1A 4LS1A 1O5KA 2J27A 1KFKA 3UXAA 3E0IA 4O0ZA 3HGRA 1Z42A 1VR6A 4MOZA 3MP3A 4WQ6A 2CLKA 4TR9A 1KBIA 1DBTA 1TREA 4UCGA 4WD0A 4XKYB 3LLDA 4DPQA 1VZWA 2B7PA 4FHAA 4UFHA 5C54A 4JIQA 1SZGA 1J2WA 1P0NA 3ZR4A 2NX3A 5H91A 5DBTA 1JJKA 2OCZA 3PY2A 3E12A 2P1FA 1AG1O 1EWDA 3QMSA 2V8ZA 1RQEA 4NJKA 4Q32A 2J88A 1QCWA 5CPLA 1JVNA 1WBJA 2VEPA 3N9SA 3JR2A 1R47A 2NV1A 4G1KA 3E96A 2OMAA 2NXIA 5KMYA 3G1SA 3NNTA 4NZFA 3W75A 1QOQA 2YDAA 2HSAA 3NDOA 3RF9A 2PE4A 2V5BA 4N02A 3P84A 4MFDA 4RXGA 4AAJA 5AHIA 3PC0A 3EWWA 3IGXA 5AYZA 2CW6A 2G96A 3G22A 1RZMA 4YCPA 2X1RA 1BWKA 3W74A 5CG7A 4K6AA 2XN1A 4NQ1A 5LGZA 2B7QA 2QUVA 2QAPA 3DH7A 2G5WA 3R8RA 5F1UA 5U4NA 2X16A 2EF9A 4YLWA 2E6DA 1ML1A 2QDGA 3U2OA 3IIOA 1NSJA 1SU5A 3TQ0A 3P82A 4O54A 3CT7A 3H55A 3DU0A 4RJEA 4FNSA 4JICA 3UYCA 3LXBA 1DOSA 1XC4A 4HNVA 3O06A 3LHYA 1D3HA 2YPIA 1OF6A 1W37A 2CLEA 1PL9A 3ANYA 5C5YA 4J9JA 1GZGA 3BVJA 5ABTA 3HPSA 4LRSA 3UPBA 4IMCA 2C3ZA 5AHMA 5D2WA 1MEWA 5AN7A 1KBJA 5F2LA 4M6QA 3R2GA 3SR7A 3G1VA 1C8VA 1W31A 4X9SA 4XBSA 1H7PA 3P61A 2A7PA 1H62A 3KX6A 4O15A 1R46A 5K9CA 1G4TA 3C2VA 3CWOX 1W5OA 2AGKA 3CEUA 3M5ZA 3N19B 1IIHA 1TPVA 3PSVA 4OWGA 3S0CA 3AO0A 3L0GA 2CLIA 2V5LA 3NEVA 3ELFA 1FWRA 5AFDA 4UTMA 1P5BA 1TV5A 1UJPA 3PULA 1K3UA 1XCFA 1SFJA 3NQEA 4AMAA 4ZQNA 2B4GA 3WK3A 3NM3A 1LP6A 3LBMA 4UTTC 2YFOA 3HG5A 1VQTA 4FIQA 1NVMA 3NPVA 1QWGA 3KAOA 1IXPA 4MY9A 4HSOA 4O18A 3M44A 3L0KA 5AOUA 1I2OA 1JUKA 4JTTA 3UWWA 3TCEA 3STFA 1O60A 5E0KA 3MYPA 4EIVA 1NEYA 3HGJA 1DKWA 3A5VA 3NGJA 1P0KA 4GUIA 1L9WA 4IMFA 4QNWA 4RZ5A 4IWWA 1MZHA 3GIYA 1VHCA 1QPOA 5D33A 5IM51 4O12A 3S1VA 4HNUA 4K7VA 3CU2A 4FEZA 2ABBA 4QIUA 1KM6A 1C29A 1QMLA 1SZFA 1M7OA 2ZFAA 3R5EA 4AF0B 3DFQA 2RDUA 3SY5A 1SO3A 1Q3NA 3TA6A 3G0XA 4FNPA 1S3HA 4EVZA 3PUDA 1L2UA 4LT9A 3GKFA 3SFKA 3W2LA 4CQAA 3C61A 1YDVA 2DZPA 1T8XA 3LCIA 4N9CA 1EEPA 2Y89A 1RPXA 2CZDA 1I45A 3W7QA 3C3NA 3N3MA 1W3TA 2Z0IA 3QW3A 5IBXA 3VI2A 3STGA 1FUYA 2J9XA 3EWXA 4XZ9A 1KM5A 2JGQA 4JD4A 4WXZA 1TPC1 5J5RA 3SJ3A 5KTLA 4RR4A 3WJWA 3CHVA 4GC4A 5G2HA 2GQAA 3C0JA 1KFCA 3C2EA 3W6YA 3GR8A 3QPYA 3DBPA 2ZQ0A 3TSBA 4I7UA 5CZJA 4CCDA 3OG3A 4UIOA 4JIPA 5KSWA 5AHLA 2O7SA 1H50A 1EIXA 4MJZA 4AHPA 2Q3RA 4I7WA 1H7WA 1ZAJA 4Z08A 1W54A 5SWUA 3KVJA 1H5YA 4GXMA 3TQVA 3RU6A 1IXNA 4YWIA 3MBFA 3NQ8A 5HR6A 4ADSA 1DJQA 2WNQA 3NL2A 1HUVA 3QMTA 1OK4A 2PRMA 4GJ1A 3L5AA 3RNDA 3EKLA 1TYGA 3VCRA 4UR8A 5CSRA 4FXSA 2FPVA 4UFIA 1WXJA 1BWLA 5D30A 5F4WA 5K9DA 1W3NA 4UR7A 4GWEA 5LNUA 2TYSA 3QZEA 4R33A 3S9YA 1GYNA 3DKJA 3I6RA 1N8FA 1VGAA 1YADA 2E77A 5CKSA 3NL5A 5EYWA 3G18A 1FDZA 1VLIA 4TMBA 4NNBA 2V82A 3GDLA 2AQWA 4M19A 2DJLA 1HFBA 2EGZA 4EF9A 3NAVA 1R2SA 2YX0A 3RFAA 1D9EA 4O0KA 4U28A 1SW7A 4XUGA 2X30A 4FNTA 4JEQA 4M5PA 3VE7A 2NWRA 3PUEA 3G1YA 2ZZ5A 5DXXA 1L6YA 2FQIA 1X8FA 2QCDB 2XN0A 1OYCA 4FXRA 3UWYA 3W7GA 1OX4B 1SO5A 4WY0A 4UUIA 1O5XA 3W7PA 4NJJA 3UPWA 2E6AA 4UMBA 3FJ6A 3UY8A 1M6JA 3VE9A 2ZA3A 1RVGA 3RLVA 4JTJA 5DCDA 1EUNA 1VCVA 4XTDA 1X7FA 1H7XA 4MIMA 1JCNA 1WAUA 3W2KA 3HMJG 4Z1BA 1W8SA 3NZ1A 4M6PA 2TRSA 1TTIA 2EPHA 1XDLA 2VELA 2VFIA 2V9DA 5I3HA 4Y96A 4JYDA 1PVNA 3C2FA 3L9CA 3VKJA 4XKYA 3PSWA 2ZBTA 5CPOA 3M5VA 3QH2A 1RV8A 3I68A 3M41A 4LVAA 2HTMA 5K3VA 3OVRA 3G8EA 4JNMA 3W84A 3W1UA 4TX9A 6TIMA 3M16A 3BGJA 4FX7A 5D03A 1G69A 3FJLA 3TXVA 2OX1A 4Y8FA 1KV5A 4P2VA 2PCQA 2YFNA 1K02A 4RZ4A 1NF0A 2C19A 1X1OA 3W7IA 3PG8A 3LHUA 5LHFA 1F76A 2J9YA 3FIGA 4JTSA 1G4EA 5FEPA 4BFAA 3IVTA 3C2RA 3K30A 4I9AA 3Q2DA 3W7DA 3LM7A 4DBEA 3FKKA 4ZQMA 3W83A 2Z6JA 3DHDA 2R14A 3SIZA 5G4EA 4POCA 3R13A 1EP3A 2BLEA 3W22A 1OYBA 1XL9A 5K4ZA 3OVQA 1JCLA 1KFBA 1W5QA 3EWBX 4N9EA 1ZNNA 2VKZG 3LTSA 3GZ3A 2ZRYA 1H63A 5F2IA 3TMLA 2QKFA 1WOAA 2ABAA 2VC6A 3W1TA 4ADTA 2KZHA 2NX9A 1V5XA 3TSMA 2J24A 3L0NA 1U5JA 1YPFA 2H3BA 3BLIA 2ISVA 1SUXA 4JTHA 3HPZA 3ABRA 2ZCGA 1DQXA 2X1TA 2H3DA 3B03A 3U8GA 2QCHA 3G1FA 2Z1BA 1JUEA 1TRDA 1X6UA 4GRSA 4JX6A 1MEIA 3DHFA 5D04C 3B8DA 3TQKA 4NJHA 1ICQA 4BWLC 3UWUA 5D2YA 1CX9A 1YDOA 1VYSX 1LTDA 3B05A 3L68A 5HWJA 4UMAA 1WOBA 3IIVA 2ZZ2A 2E6YA 4MY8A 1H1ZA 1ZFJA 3S5YA 2F84A 3O15A 1Z41A 1GTHA 3QM3A 3DAQA 1TIMA 4LY8A 4JYFA 2CZ5A 1O94A 1QDSA 3HB9A 4PL2A 2A5HA 2C1HA 4TMCA 2ATSA 8TIMA 1ME9A 4CCEA 1OFQA 1GQNA 4UXDA 3DXIA 1F7BA 4GBUA 3W7NA 1DJNA 3IEBA 1NFBA 3L65A 4O53A 3ATZA 4FO4A 3BLEA 2R91A 3O63A 4IX2A 4QM1A 4O19A 3FOKA 5DBUA 4TIMA 4PCFA 4FNUA 3CTLA 5DCEA 1H1YA 4JN6A 4ZL1A 3OHIA 3W70A 2QR6A 4HPXA 2QCGA 4MLJA 4Q4KA 5LNSA 3EEGA 3PUOA 3NR0A 1AW2A 4MYAA 3G1DA 3LI1A 2X1UA 5C6MA 4AEOA 3O07A 4DBDA 3M5YA 2E68A 1LZOA 4AF0A 4HKPA 3TU9A 3DZ1A 3P81A 3T44A 2ALDA 3NO5A 5I3IA 4WUIA 4GNJA 5G5IA 3GAYA 2H90A 1LYXA 3LCGA 4IUOA 2V30A 4Z0SA 2P0OA 2QUUA 3ZFHA 3BG9A 3R12A 4O11A 3MO7A 5DCBA 3L5MA 2FB2A 1GOXA 1M5WA 1TPFA 1GVSA 3SGZA 4KWWA 2BWGA 3NG3A 5BNKA 3GDMA 1N55A 1TPEA 5EA9A 2VFEA 5FESA 3P62A 3STEA 2JKEA 1FCBA 3SECA 1OX5A 3W7MA 4ICNA 2ATMA 1ICPA 3P5ZA 3MI2A 3WK0A 4N4PA 1GT8A 1VPXA 2QUTA 3UWVA 3LGEA 3FS2A 2WO5A 3FKRA 3FEMA 1W56A 1SSGA 5KITA 2FTPA 3GNNA 4UFLA 1Y0EA 4O14A 4BI6A 1GWJA 3BW4A 3KRSA 4MZ8A 1NF7A 3DFOA 2ZTKA 3NOEA 4AXKA 2ZZ4A 2ZZ3A 5LHEA 3LCHA 3TFCA 4FNQA 2LLEA 3DENA 1IXOA 3IRDA 3L5LA 3HG4A 1I2NA 4EWND 1VCGA 2GJLA 5G2IA 2B7OA 5DY2A 4ZQOA 3NPXA 4ZQCA 5D32A 1RQBA 4UTTA 3LB0A 1YYAA 3GAKA 1HO4A 2C18A 5K9XA 4A3UA 1TPWA 1T96A 1Q45A 1CW2A 3N2XA 3TAKA 3Q58A 2YXGA 3MUXA 4MY1A 4PODA 2JK2A 3CLMA 3P67A 3ZS4A 5K4XA 2R94A 2FLIA 1R2RA 2C15A 5EPDA 2W0UA 1ZCOA 2QCCA 4AVFA 1H7OA 4NJGA 3G24A 1IGSA 1TV8A 4JGDA 3ZWTA 3GR7A 4NZJA 3V75A 3W76A 1VC4A 1K7EA 2WKJA 2ZRUA 1G4PA 3F03K 3EWYA 4WX2A 3GK0A 2PRLA 1Z44A 2V81A 4LRTA 5FF7A 4ALDA 3NQFA 3GXPA 1LOLA 5DXYA 1HG3A 3KFTA 4AB4A 4UC5A 2PC4A 3VNDA 1UBSA 1VCFA 3PS7A 3G0UA 3DI0A 3UWZA 2QCDA 1OX4A 4DO4A 3EX3A 5AC6A 5LNVA 1LRTA 2J9ZA 3EB2A 3IIZA 4W9TA 3WJYA 4JXCA 2NX1A 5DLCA 1JCYA 5FEWA 1Q6RA 3RLUA 5BOOA 2ZRXA 5LZLA 4HNNA 1B4EA 3NVTA 1H7RA 4LOCA 1QNVA 5I3FA 4NX0A 1KA9F 4PFMA 1O4UA 2NLIA 1LROA 1F73A 3TJXA 5F2GA 1QOPA 1JCXA 4LC6A 4IMEA 1LLZA 3QF0A 1I4NA 5AYXA 3RMJA 1H7NA 3DFPA 4UTIA 1LORA 3TAOA 4O50A 5CZ0A 2QJIA 3P5YA 1V7YA 3T55A 3PR2A 4CNNA 1J5TA 5FEZA 3GKAA 3UQNA 5I3GA 4A21A 5J5DA 3A23A 2GPTA 4IGHA 3W2MA 1QO2A 1THFD 3KVKA 4ZVJA 1UB3A 4LS0A 1ZHAA 4Z1CA 4JTIA 4O13A 4WZHA 2CFFA 4MYXA 3OVPA 4DELA 4XQ6A 3EX2A 4DF1A 4A2RA 2A4AA 2DZSA 1I8JA 5I3JA 1YPIA 3E9AA 1GG0A 3NQ2A 4O4VA 4NJIA 5HR7A 4JTFA 1TMHA 5TQLA 1RQHA 4OE7A 2XN2A 3W85A 4UTLA 1TQXA 1QPQA 3W73A 2NUYA 2Q8LA 1WDWA 3RK8A 1XM3A 3W71A 2TSYA 3B06A 4AWSA 3W7EA 1KM4A 2FB3A 2V2DA 2HMCA 2VEMA 1JRCA 2C13A 1WBHA 2Y7GA 3S5NA 4FB7A 4NU7A 3LI0A 1K7FA 3WJXA 2BX7A 3BK0A 5D2VA 3W1NA 3C4UA 3W7LA 4LVFA 1PE1A 3KRZA 4UFMA 3W7JA 3DI1A 5EL1A 1YDNA 1B9BA 4MVAA 3CPRA 1LBLA 3DKLA 3TXZA 1A53A 3MHUA 1TTQA 3KRUA 4LVDA 2VFGA 4Y9AA 3MI6A 3PBWA 1VH7A 3P7YA 4ORMA 1DVJA 1FDJA 3S6DA 2NV2A 1GEQA 2ZA2A 3LHVA 3OEXA 2QCLA 3WK1A 3NL3A 1EPXA 4NT0A 1P4CA 3TH6A 3L67A 3MW7A 2FIQA 3HF3A 5EMUA 1QO5A 4IOTA 5D02A 1G4SA 3M7WA 4O1AA 5TIMA 4KFPA 4AH7A 1YXYA 3EX6A 2JKPA 1FXPA 1XBVA 3BGGA 5KZDA 1LDCA 3EXRA 2I1OA 1AMKA 3BPWA 3MP4A 4QJ1A 3M0ZA 1FWWA 2E09A 2YW4A 1W3IA 4Z1DA 3LCWA 4LV9A 3W07A 1KW1A 1SPQA 5F4SA 4CQ9A 1FCVA 3NQAA 4GUGA 1LBFA 4E38A 5CZSA 2QJHA 3GYEA 5HNRA 1ZALA 1KTBA 5BMWA 3W87A 2VXNA 4C1KA 3A5FA 4DO5A 2ZZ1A 2RFGA 4M6VA 1MXSA 4RV8A 4RCXA 4UTJA 4IJBA 4E2DA 1TPDA 3LERA 2RHGA 2Z6IA 1TCDA 1AK5A 2V0TA 1NAL1 3FA5A 4WJEA 3W72A 3PVFA 1R2TA 2Y7DA 5CSSA 3PF3A 4M7SA 2RKXA 3UZJA 5G2WA 1H61A 2YW3A 5MHBA 3LOTA 4TO8A 1W0MA 3C6CA 3TNOA 1A5BA 3W3OA 3B4UA 3R89A 1TTJA 3PWAA 3HG3A 1F2JA 4DXVA 5K2ZA 2DZVA 1HL2A 2WV8A 3W2UA 5HWMA 1OVDA 1ZAIA 3HGSA 4UMCA 1I2QA 5D2XA 4MZYA 1IIGA 1OF8A 4OQVA 5F1VA 4RXFA 2QF7A 5FF4A 5G4WA 4L4LA 3W1PA 5HMSA 2C14A 1LOSA 4MPQA 2E5CA 2RDTA 1Q6OA 2PURA 3ABOA 3IV3A 4I7VA 1IXQA 1SW0A 2CZEA 4QSHA 2XFWA 3W1LA 1S5WA 3W7RA 1LCOA 2ZZ7A 5TBOA 4IXHA 1GG1A 1E51A 2NWSA 1QFEA 4S1FA 1EWEA 1K8XA 4JY8A 6ALDA 3TSDA 2TPSA 5HWNA 4LW7A 4DEFA 2BTMA 3H53A 5CZTA 2B0MA 3QC3A 3TKFA 3BG5A 2DZXA 5EBUA 5FEXA 3TC6A 4ZMGA 4HPJA 4E0CA 4IXXA 1MSSA 3GB6A 5DN1A 1FCUA 3MBDA 2FPTA 3W7KA 1GYLA 5HJLA 4OV4A 3P60A 3MMTA 2ZDRA 4PH6A 2CLLA 4PL1A 5HUOA 3UXDA 4ONVA 5U7SA 1BTMA 2DZTA 4NNCA 4ML9A 1O95A 4DF0A 3TDFA 1A5CA 2NUXA 3L21A 4IPJA 1OFDA 3W23A 4R34A 3DFSA 2BZNA 2WPBA 3TW7A 3SW6A 4MZ1A 5DY3A 4BI7A 1BKSA 4GE8A 4FF7A 1TRIA 4JDYA 3W88A 5LKYA 5G1TA 4K8HA 3MP5A 3NQ6A 5F2MA 4UTWC 3THAA 2BXVA 3BW3A 2W6RA 1PCKA 4C1LA 4UNLA 4KFOA 3TUUA 1KM2A 1QPNA 3BW2A 3NXFA 3P8IA 3IIXA 3QRHA 3QEZA 5LNWA 4BR1A 4JTKA 3IGSA 1W5NA 2QDHA 4TU1A 2Y85A 2UV8G 4FNRA 3DFNA 5D09A 4JTGA 4RZ6A 1FCQA 2QJGA 1TV7A 3KVLA 5I3KA 2A1YA 3BO9A 2VFDA 1I2PA 1JR1A 1DORA 2B7NA 3B0UX 4WOQA 4QNEA 4WY0F 2G95A 3W86A 1F74A 1WYIA 4GUJA 2NXGA 4DO6A 2DZUA 1EA0A 3A22A 1Q6LA 4DPPA 4O8RA 1VRDA 1B3OA 1N7KA 1VYPX 3QW4B 4GUHA 3NYZA 1VS1A 2QAFA 4E2BA 4H4IA 1KV8A 5C2XA 1GJPA 3UD6A 3GLCA 3B04A 5FI8A 3V1PA 5EKYA 4BK9A 3PB0A 1QR7A 1LBMA 3A21A 2DORA 3C2OA 3N9RA 3I7RA 3W2JA 2YR1A 3G1XA 4HN4A 3EWZA 3FFSA 1FBAA 3LRMA 2O7QA 1KM1A 4RK8A 4CLMA 4NUWA 3QQ0A 1TTPA 4A2SA 2W79A 3S8HA 3CQ0A 3BG3A 2WQPA 2NXHA 1JUBA 4UFJA 1YTEA 2GOUA 1PHWA 1GTEA 1FQ0A 2GVLA 3HO8A 1FY6A 3S5OA 2VOMA 1TJPA 4P61A 3AJXA 1F6KA 3IVUA 1F5ZA 1ALDA 5BRBA 3CB8A 2ZTJA 1EX5A 2GUUA 3C52A 2I9EA 4AHOA 4OBTA 3LCLA 4IX0A 1GPWA 2C0AA 5AHEA 3LTPA 3A24A 1G67A 4LVBA 1SQ7A 3LXCA 1AL8A 4KWVA 3O05A 4HNTA 5A5WA 3GDTA 3N14A 3ABSA 2QEZA 2QCNA 3Q94A 4ZQPA 5HULA 2VEIA 7TIMA 5FF2A 3LRLA 1JCJA 3S1WA 4X2RA 3T40A 1TPUA 4LVGA 4WOZA 4LTSA 1PCWA 1T99A 5D2TA 1ME7A 1Q6QA 3KOFA 3NQMA 2A6NA 3WK2A 3NZRA 4CNPA 4IMDA 4BF9A 3G1AA 4ZZ9A 5H2ZA 3OBKA 4EF8A 3HQ1A 3MHFA 3P8JA 3QSTA 3HPXA 2DP3A 1KFJA 3EX4A 3NPUA 4WXYA 3TC7A 2J6XA 2Y70A 1W5PA 4OU1A 3D0CA 2Y7FA 1FWTA 2E1DA 2RH9A 3F1QA 1OX6A 4N6FA 4LV4A 3QFEA 3PG9A 2Y7EA 2ISSA 3WJZA 2I14A 2A85A 2CZFA 2EKCA 1B4KA 2ZZ6A 4LNYA 1PIIA 3L66A 4LWWA 1ME8A 4IPIA 3W1XA 1S5VA 4NXSA 3A9IA 2V2HA 1FXQA 3WJSA 1J4EA 3LHZA 2WSQA 3PB2A 4XWUA 4A29A 4JTLA 1Z48A 1YXCA 2CLOA 1XUZA 3LLFA 1A5AA 3O1NA 2C16A 4M7TA 3LTYA 3M43A 5FF3A 4O17A 5HINA 3EXSA 3TX9A 1JRBA 3F4WA 3B0VC 3MJYA 3OA3A 2C6QA 1K8ZA 4O1CA 4O1BA 1KM0A 3NQ7A 5EY5A 2A6LA 3C56A 1KFLA 4QITA 5LGXA 2VFHA 1JQVA 1L6WA 1KTCA 1ZY9A 1SW3A 4K8EA 1OFOA 2OJPA 3VFLA 3FYOA 4A22A 4AWUA 4UTKA 1OFPA 3INPA 4LU0A 4BI5A 3H54A 2Q3OA 4Y6GA 2HS6A 4LC8A 3ATYA 1WQ5A 3TROA 3M9YA 4IQLA 5F4XA 4YXGA 2H8ZA 5D37A 3G0SA 4FX8A 1GVOA 4O52A 5AB3A 4X3ZA 3ZWSA 2CLMA 1KTNA 1RD5A 3USBA 1D3GA 3GVGA 4LS2A 4PC8A 3TE9A 1OFBA 2YGYA 3THQA 1PV8A 3P74A 1R30A 3S42A 2HS8A 1TQJA 3F4NA 1VYRA 3W7OA 1OJXA 5D05A 5DELA 3HBLA 1LRNA 1T0OA 4N6EA 3CEPA 4K7YA 1C9DA 1LLWA 1UUMA 3LCFA 1H51A 1K7XA 1OABA 2D73A 1OYAA 2DJXA 3G1HA 2VFFA 4UTUA 1WV2A 1KLZA 1EUAA 1LM1A 2NZLA 1HO1A 4O4WA 2RDWA 3I7SA 3P80A 2V2CA 5AC8A 4Z1AA 2QCFA 4AWTA 4RX0A 2Y62A 2GJNA 4XTIA 4L4MA 4DQWA 5AHFA 3O6CA 1OFAA 1SO6A 3I7QA 3O6YX 2WSRA 3T7VA 4UNKA 3QMRA 4N4QA 4UTHA 1XKYA 3L2IA 4R7JA 1PS9A 3IVSA 2X2GA 5D38A 2Y61A 1HTIA 5AYYA 3FYPA 3GDKA 1LOQA 1QPRA 3NQCA 1ZJIA 3PM6A 4K39A 5E93A 1VJIA 3PBUA 4HIBA 3T4CA 1WX0A 3EWUA 3DGRA 1W1ZA 3IIPA 2JBMA 1YTKA 1ADOA 3FLUA 2QCEA 1TSIA 2YZRA 3PAJA 4NVTA 1XBXA 1ZAHA 3BLFA 1DHPA 2JKAA 4KFNA 3CIWA 1FX6A 5G1YA 5A8GA 1I2RA 2CWNA 3I65A 3HG2A 4O10A 1G6CA 1XDMA 2F7FA 4YL2A 3PBYA 4OT7A 2FDSA 4MLRA 3CWNA 3QJAA 1WA3A 4JS3A 4K36A 4PEKA 1F6PA 1AW5A 2Y88A 3MWAA 3TR2A 2GVGA 5IBXC 3OIXA 2OZ0A 4O57A 1DL3A 1OFRA 1ICSA 1PHQA 5KINA 3MYOA 3EX1A 2DU2A 4N9DA 3TMQA 1OFEA 1IF2A 3NQVA 3QPZA 3U6WA 3HGOA 3STCA 1H60A 3SI9A 5L9FA 1GVRA 2WSYA 1UUOA 2WJZA 4UFKA 3N73A 4K37A 4MUZA 3KHJA 4O1DA 4GUFA 1XI3A 1BEUA 1TO3A 3TIMA 3TK7A 3NPWA 3LXAA 4NXKA 1JULA 1UCWA 4QAIA 5L6UA 3SGUA 3NA8A 2QCMA 4H3DA 4CCCA 3N2MA 2P10A 1M7PA 5AHNA 1DV7A 5CPNA 4MFEA 4B5NA 3LHWA 2Z2UA 4MJMA 1B57A 1TPB1 1XUUA 1TJRA 2Q8ZA 2A0NA 3GXTA 1KFEA 1OK6A 2GQ8A 3CC1A 3LRKA 3LV6A 2CLFA 4CQ8A 3LCXA 4OHQA 1A50A 4NX5A 5HQEA 1TPH1 3W9ZA 3IGUA 4RKAA 5AC7A 3JRKA 3QQ1A 2YYTA 3KXQA 3DFTA 3O8AA 1SSDA 3JS3A 4QISA 4S2CA 4JTUA 4JX5A 3TW6A 2E5BA 1KLYA 3W1RA
chains in the Genus database with same CATH superfamily
2WKGA 4HU4A 4PMOA 4N9BA 4H6KA 3UY7A 2WB5A 2X1SA 4S39A 3W1QA 4LUJA 4HHMA 5DFAA 1E0VA 1XHGA 2EG8A 1ADSA 4KBXA 1P6CA 3M0XA 1FWFC 3DHPA 2QNEA 3G8RA 3WLTA 5JH2A 2DVUA 4UR9A 2Z1WA 2NUWA 3UCQA 3UWQA 1ONRA 3EXTA 3G3MA 2X8RA 2WOQA 2PZ0A 1QAPA 2QUMA 4R85A 3BSHA 3UZ5A 2YCEA 2JFEX 3E49A 3GXNA 3BCDA 1QNOA 1OC7A 2VGBA 2G97A 2ZYFA 4O28A 4BWLA 4H9ZA 3TZFA 2A2IA 3MVTA 2MUCA 5FF0A 4GVIA 5LA0A 3BV4A 4TQTA 2VZUA 1K9TA 2WVUA 1XBYA 3H2CA 2WNNA 3NQBA 3AI0A 5IDIA 3BAIA 4QCEA 4Z0JA 3GD6A 3GDRA 4R9OA 1C7TA 3M1ZA 4IMGA 3SCUA 4Q8NA 2DT0A 4EOUA 3KRBA 5D9OA 1SR9A 3GXFA 1KM3A 1YNQA 4JTEA 4U33A 1JI2A 3NL6A 3WYZA 2XVNA 1SO4A 3B0YA 1EP2A 3GXIA 4E8GA 1UR0A 3AIRA 1YXDA 7ODCA 2CHRA 4D2JA 2EHHA 3P3BA 1MEHA 1OG0A 2JGYA 3M5XA 1J0KA 3V5FA 3LZ3A 1XXXA 2DFAA 4KCVA 2BSLA 1TV3A 3GNDA 3BARA 3PBVA 5CAKA 4ZA0A 4Y90A 1ZB5A 4HA4A 3BV7A 3RR4A 1LQAA 4X22A 1P48A 4AFYA 4UWMA 4PA8A 3W2NA 4MWAA 5KZMA 1NDYA 1DWAM 3S1UA 4PBGA 4DZHA 1RR2A 3PK7A 1BXCA 5HAOA 4Q4OA 4JY9A 2QDEA 3M4HA 1SMDA 2GVJA 1ISYA 1RK5A 1BYAA 1G7VA 2GQ9A 3PPFA 4WY0B 3LYEA 1X1ZA 3UJSA 1W9UA 1DWIM 3CYVA 2H6RA 5HMFA 1S5NA 1OGSA 1EYWA 2ISWA 3N6JA 3N34A 2TMDA 3QBUA 3CHFA 2CLHA 2E9BA 4UTFA 1O5KA 3UXAA 3F4VA 3E0IA 4O0ZA 1ZGDA 4DX3A 2WVVB 2JEPA 3VOFA 1KBIA 1CNVA 1TREA 2YDRA 2UY3A 2WANA 1KCXA 2BODX 4DPQA 4ERAA 2YXOA 4FHAA 1W9XA 4JIQA 3TYDA 4PB3A 1XGDA 3TZNA 1CXLA 2HRWA 2NX3A 3ES8A 1Q7MA 2P1FA 1JZ5A 4G7EB 3QMSA 2XVPA 1IEQA 4HBKA 1XJBA 1CXEA 4DHGA 3RCNA 1WBJA 2XGZA 3N9SA 3JR2A 4G1KA 5KMYA 2PTXA 1JZ7A 3EMCA 1ZBVA 3A3XA 3B3DA 2PE4A 4NZ5A 2YCLB 2ESCA 3DBNA 3SUWA 2YLAA 3QTGA 3OBAA 5AYZA 4OIFA 1J8VA 1L2QA 4GYPC 3FXGA 1RZMA 2X0HA 1Y65A 2W5FA 2R82A 4H6EA 3W74A 4I8DA 4K6AA 2YA1A 1GVEA 5LGZA 3WDPP 1Q4NX 2PDYA 4YVPA 2EF9A 4WKAA 2E6DA 4YLWA 2ZOXA 4DM2A 4YWSA 3IIOA 3IJQA 3TQ0A 4O54A 4CKQA 3H55A 1IT0A 4RJEA 4FNSA 5EMKA 1E4IA 1QNQA 3LHYA 3KTSA 1OF6A 4RNFA 1PL9A 1TWZA 4OJYA 5C5YA 5AC4A 4R5EA 3BVJA 3HU7A 3HPSA 4HYVA 5AHMA 3RX2A 3NSNA 5IXEA 1MEWA 1TKKA 1KBJA 1I9CB 3T0CA 3WUGA 3G1VA 2HNEA 2R1PA 2VGIA 2ZC1A 3TYCA 4PMUA 4XBSA 3P61A 4W8LA 3L4WA 1R46A 3CWOX 2AGKA 3RN6A 1TPVA 3NZGA 3RM8A 3ZR6A 4TUFA 1KQYA 2V5LA 2CBVA 4NF7A 3GU1A 1K3UA 4MAVA 1SFJA 1V3HA 3LNPA 3BL3A 1LP6A 2A3HA 3LBMA 4FXFA 3V0SA 3C3UA 2YFOA 3GUWA 2AQVA 2ZC8A 1IXPA 2GGIA 4JTCA 1RP8A 1ISZA 4MY9A 5HMEA 4K3ZA 5AOUA 1AJZA 4FOJA 3WNLA 3BSMA 4JTTA 3UWWA 4LX4A 3TCEA 1O60A 4Q7BA 2V68A 1P0KA 3IJDA 4F9JA 4RZ5A 4CU8A 4JQAA 1QPOA 2ISFA 4D1IA 2J7BA 4GI9A 3CU2A 2ABBA 5CC5A 3ARQA 1KM6A 4I5XA 3VDCA 1M7OA 2ZFAA 4LF1A 4F8XA 4GYKA 3LMYA 3GKFA 2J75A 5DMNA 2F6UA 1T8XA 1GKPA 5I03A 2BFGA 2Y89A 2NQJA 3BCFA 1X39A 3C3NA 3CUZA 1JPIA 1ZTVA 3QW3A 3PZUA 1FUYA 4IH3A 1AMYA 4RE4A 1KM5A 1OSEA 1VBJA 4RR4A 3OB8A 3ZR5A 1F3XA 3C2EA 3RAOA 1XLHA 3PWIA 4W4QA 3R8HA 3OG3A 3BAYA 1WZAA 3S2CA 1H50A 3N15A 5JMUA 1YIXA 3KVJA 2WWCA 1GOKA 1EH9A 4A6GA 1E6QM 2D2GA 1OEPA 3VGDA 4KW2A 1PX3A 1XLBA 1TZ7A 4Z2IA 3R11A 1DJQA 4JL2A 2WNQA 1MFUA 3OYXA 1DIKA 1M03A 2HXUA 4GJ1A 3T2QA 5CPTA 4D6FA 1G9HA 3WH9A 5D30A 3M0LA 1WO2A 4GWEA 1W32A 2XINA 5FA5A 1XISA 1KBBA 4R33A 3S9YA 1V02A 2GK1A 1J01A 1VGAA 1EDGA 4QE4A 2PLMA 5E09A 3WH8A 3NL5A 3CH0A 2Z2BA 4Y9NA 2OZ8A 1FDZA 1VLIA 1XLKA 2X2YA 3OYZA 3VO0A 1XP3A 3NAVA 2RUSA 3HQNA 3LSBA 2YX0A 1D9EA 4U28A 2P88A 3DGBA 3VE7A 5JBFA 3G1YA 3OGRA 5DXXA 2FQIA 1X8FA 5GNYA 3M07A 1T8QA 2NT0A 4ZO6A 1DJGA 3CAWA 1H4PA 1KCLA 2GJRA 3W7GA 1OX4B 2VZOA 1O5XA 1E0XA 2QPSA 3UPWA 2E6AA 3BZGA 4X61A 1IWPA 5ABFA 3VE9A 2G3IA 3RLVA 3E2VA 1EUNA 4IT1A 4AZ7A 1CGUA 1X7FA 1JCNA 3ENLA 3QZ6A 3HMJG 1E5NA 4B91A 2WWDA 3CBWA 1CXFA 3NZ1A 3WLJA 1REQA 4W8AA 2TRSA 4Y96A 5CPOA 4CQCA 3M5VA 3QH2A 1IYXA 3M41A 5EMJA 3CHDA 5CCZA 3G8EA 3R6IA 1TR1A 3KOYA 1GKRA 3W1UA 3N2BA 2ZUSA 2WKLA 3KS5A 3EOSA 4FX7A 1R3TA 3FJLA 1TR9A 4Y8FA 3FJNA 4CU7A 4OTKA 4WKFA 4GX8A 2YFNA 2BVDA 1NF0A 3AHTA 2HCVA 4RZBA 4JTRA 3LHUA 5LHFA 1CTNA 3FIGA 1QNRA 4PGLA 3UG3A 3K30A 4I9AA 3Q2DA 5CEWA 3VD3A 3OODA 1P1MA 2VVSA 4ZQMA 2Z6JA 3QGKC 2Z28A 2IMRA 4E2OA 1WKEA 1W5QA 1KFBA 4YTQA 3LTSA 3GZ3A 2ZRYA 2OZ3A 3H7RA 1H63A 3QN3A 1EGMA 4RUBA 3W1TA 2NX9A 3EDDA 4NI3A 3L0NA 2AMXA 3PJXA 1U5JA 4S3FA 1UIOA 5A6TC 3ABZA 3A64A 5I3DA 4DWDA 2FVMA 3UFYA 2HVOA 5DO8A 1U2YA 1W2PA 2DGAA 2ZCGA 3U8GA 1SFTA 1CLXA 3WD2A 3G1FA 4ZR8A 4JX6A 1MEIA 3DHFA 6REQB 3CQKA 3R7MA 2I5QA 2D3LA 2V5JA 3TLLA 1U30A 4Q6XA 2PDJA 5HK4A 3UWUA 1RJRA 3KZSA 3BJFA 3A3WA 4KETA 2AKZA 4DZIA 4X2PA 4AD5A 1TJ0A 4NRRA 4MY8A 3S5YA 2FZBA 1Z41A 2PEVA 3NVDA 4V33A 1GTHA 3QM3A 1WPCA 1XRVA 3QKZA 4LY8A 4JYFA 4PL2A 4QJ4B 3LGGA 2A5HA 4TMCA 2ATSA 3O0KA 8TIMA 4CCEA 1OFQA 1ISXA 1NQKA 4UXDA 4ES4A 1Q2RA 3PFMA 2P8CA 4FO4A 7PTDA 4ZEPA 4AZCA 2R91A 5IHSA 3GNRA 3SRFA 2PPGA 4IX2A 3NYDA 4S23A 1XLLA 3FOKA 2WMGA 4QS5A 4TIMA 3SY1A 1H1YA 4LH8A 1W1A1 4ZL1A 4KEZA 4DI9A 2QCGA 3UVIA 4IIDA 2C71A 3EEGA 4RV3A 4TTGA 3NR0A 1IZJA 1OADA 1XV8A 5FD0A 4MYAA 1J10A 3ZYZA 4Y9PA 1DJXA 2E68A 4XUYA 2ZX7A 2ALDA 4D8AA 3MKKA 2W9MA 4I90A 1F3WA 5ECUA 3ZFHA 3R12A 3WLPA 3MO7A 5DCBA 4JHZA 1UZDA 3URAA 1TPFA 4GO9A 1OCJA 3H2EA 3WO8A 1UWUA 5BNKA 1HN1A 3GDMA 3HPAA 4AD1A 3CZJA 2PDWA 1BGGA 4DJEC 3P62A 1BG4A 2JKEA 3SECA 3F5JA 1ICPA 3AQUA 1GT8A 4QLLA 2A3LA 4L4PA 3CAVA 3FS2A 1JGMA 4F0KA 2FTPA 4UFLA 4WJ8A 1S2AA 4XSLA 4MZ8A 3DFOA 1QW9A 3DC0A 2J7CA 3SUTA 3IS4A 1XINA 4LYKA 1ONWA 2UBPC 5LHEA 3LCHA 1R9ZA 4FNQA 1MI3A 3HG4A 1I2NA 4C6JA 4ZQOA 1H49A 3NPXA 4ASTA 1V6XA 2HWGA 1O1HA 3LB0A 5AY7A 1F6YA 5EFFA 2PGEA 2O9TA 4CN1A 4A3UA 3OG2A 4IZGA 8RUCA 1Q45A 4H9UA 3TAKA 1P7TA 2YXGA 3MUXA 2C0HA 4AIEA 5C71A 4J35A 5K4XA 2Y5EA 1ZCOA 4JGDA 3ERPA 4QLJA 1VC4A 1G4PA 3THCA 2Y2WA 3GK0A 2RJHA 2WJDA 4LRTA 3ID7A 1D7KA 4RDZA 4PCSA 2JE8A 1XS2A 4UC5A 4Z2KA 3RX3A 1KR0A 1Z32X 5IRPA 3UWZA 1QU4A 2F6XA 3U4FA 1GQJA 3TN6A 4DO4A 3LENA 3ZLHA 1XFCA 3WJYA 2A79A 2NX1A 4M56A 3DYPA 1FHDA 1RBLA 2PBOA 4LCSA 3VD9A 5I78A 1FWDC 1SR0A 1C93A 2GWGA 1TV4A 1DP0A 1KKOA 1UP0A 3K46A 4LOCA 1QNVA 4AU0A 5TF0A 1R3YA 1EGZA 4PFMA 3CPGA 3WEZA 3TJXA 1M1BA 1JCXA 5LIXX 5HJYA 4IMEA 3QF0A 1I4NA 3DFPA 4O50A 2PU1A 3KBMA 1V7YA 4CNNA 3UGRA 3GKAA 1ISWA 3KOXA 3V18A 1LQ2A 3KVKA 1VEPA 4HYRA 4LS0A 1PZ0A 3WLKX 4Z1CA 2HV5A 4GHRA 3GYCA 3PTKA 3APYA 3OVPA 2HJPA 3EX2A 1DJHA 4QJ5B 1B5TA 3EKGA 4DF1A 1Q66A 3E9AA 3AIEA 3AMKA 5ABHA 4O4VA 5HR7A 1EC8A 3VUPA 3DFYA 4JQ2A 4CU6A 1EHAA 2XN2A 1VBRA 3W85A 4UTLA 3VD4A 2J78A 1DTUA 3B8IA 3Q65A 2Q8LA 1WDWA 3RK8A 1XM3A 2TSYA 3P93A 4H2CA 1KM4A 2V2DA 1JRCA 1HW6A 3SCPA 4FB7A 4GBDA 4NU7A 5CLWA 7ENLA 3W1NA 4A35A 4UFMA 3DI1A 4TXEA 1YDNA 3WDIA 1UZ1A 2VGFA 3P6LA 3H2AA 4WF7A 1A53A 3MHUA 4LVDA 2ALRA 3N12A 1PDZA 1GONA 4ORMA 1OB0A 3VX1A 4CQBA 4MNMA 1GEQA 2HQAA 4AYSA 1BYBA 1EPXA 2XVKA 1AVAA 3AYTA 4B5VA 3TH6A 2P0IA 1JZ4A 4LUSB 5AC5A 5EMUA 3D6NA 3M7SA 3QHMA 1Y5WA 1FH8A 3M7WA 2FDMA 1XIGA 3G6LA 3VDAA 3I3BA 2JKPA 4LUTB 2J7HA 3BGGA 5C2GA 1BSLA 3B0XA 2VX4A 5AYIA 3ARUA 1UR3M 4US6A 5BCAA 1JD9A 3M0ZA 3LCWA 2JF7A 4LV9A 5PTDA 4XZWA 1UD3A 4J28A 4CQ9A 1E15A 4PYSA 4KWUA 1JYXA 4H1ZA 4DJFD 3GYEA 1P6BA 2DEPA 4P8WA 2VXNA 1NARA 3A5FA 4DO5A 1TVLA 2ZZ1A 5I2UA 4EWJA 1MXSA 1X38A 2BOEX 2PB1A 3T09A 4RV8A 4EXAA 2BVTA 3H8AA 1AH3A 2XG9A 1TCDA 2XDFA 1NAL1 3W72A 1R2TA 1GZJA 3PF3A 4M7SA 1JAKA 2RKXA 5G2WA 4L6HA 3ME3A 4ROQA 3N2TA 1RCXB 5IFTA 3WFZA 3R89A 4LAUA 3HG3A 4RPPA 4EKJA 3EAUA 1HL2A 2HZGA 3HGSA 4UMCA 3THDA 2X1IA 4RXFA 2QF7A 2C14A 1GEHA 3W37A 2RDTA 2PURA 1IXQA 4QSHA 4XZHA 3W28A 3W7RA 2KAUC 4HZ8A 1HX0A 1ZJHA 4C6DA 4PCTA 4IXHA 3ITVA 2J25A 2NWSA 1L8PA 1QFEA 5KETA 2CC0A 4YTUA 6ALDA 3TSDA 1VFMA 3ICJA 5CZTA 1XQKA 3QC3A 4KH2A 4IPLA 4K2SA 2DZXA 5EBUA 4HPJA 2Z4GA 5C9ZA 3GB6A 5HBFA 2OKOA 6PTDA 1GYLA 3WX7A 5HJLA 1XRTA 5JXQA 1UC4A 3WQFA 2CLLA 3UXDA 4LAMA 1BTMA 2DZTA 3PZIA 3MO4A 1ZP3A 3BLDA 1Q6DA 1VIWA 1JCTA 3SW6A 4FR6A 3WELA 1BKSA 1PB0A 3WF2A 3W88A 4PTWA 2ZIDA 5CC7A 3THAA 5IDZA 4M6UA 1KGXA 4PRTA 3W02A 3BW3A 1PCKA 3TUUA 5A8PA 1QPNA 3MPGA 4LSBA 4TU1A 5M17A 2Y85A 2YA2A 3QGVA 3BOXA 1IEWA 3GH5A 2A1YA 5C2CA 3BO9A 4XIMA 1DORA 2B7NA 3B0UX 3ZQ9A 4U10A 4QNEA 4WY0F 4GUJA 3TYZA 3UCCA 4DO6A 1NFGA 4DJFA 3RCMA 4ZTYA 1E0TA 1QHZA 1V0KA 5JIPA 2D0HA 3DECA 4TV6A 4H4IA 1KV8A 1GJPA 5JIWA 3V1PA 4GQGA 3MWCA 4YU1A 4BK9A 1Y8BA 2IQ0A 1QW8A 3UGVA 4ROPA 3W2JA 1R3RA 2YLLA 1WDDA 4HN4A 4RPQA 1FBAA 4W85A 1BTCA 3BSGA 3ITGA 4NUWA 1NDVA 3ALFA 2V3EA 2W79A 4A2SA 1E1FA 2WQPA 3FCPA 3E2RA 1YTEA 2VX7A 3LPOA 1PHWA 4D72A 3HO8A 4E6MA 3S5OA 3PJWA 3AJXA 3IVUA 2ZTJA 3GHTA 2XHYA 3S46A 2ZE3A 2GDVA 2R6OA 4MADA 3U5UA 4IX0A 4GQRA 3SO7A 1G67A 4DJDC 3LXCA 5CXPA 4HNTA 5A5WA 4TOQA 2J13A 3MCMA 4NL1A 4A05A 4B3ZA 4U3CA 3WNOA 1MW0A 3KBNA 5FAGA 4LYRA 3S1WA 4X2RA 3T40A 1GHRA 4LTSA 1PCWA 2WXDM 3NQMA 3NZRA 4CNPA 4EE9A 1RSCA 4ZZ9A 4GGHA 4GX9A 1PWMA 3MHFA 4C5ZA 3W6LA 3MKCA 4R27A 3IARA 4L1XA 4D8LA 5CAHA 4OU1A 2RGLA 1QHPA 3KL3A 3FJ4A 1FWTA 2RH9A 2OWXA 1IR1A 2Y7EA 3CAKA 1ZP4A 4A3QA 2A85A 2NSXA 2PDQA 4XAPA 3GW0A 1GJUA 1ME8A 2JIEA 2VR5A 4CD8A 3K1DA 1S5VA 3A9IA 4LALA 1FXQA 3WJSA 1OGGA 3PB2A 1B54A 4IL0A 1JPDX 1A5AA 2XM1A 5FF3A 4O17A 2ONEA 2DUAA 1E3XA 1JRBA 4TX6A 3WQ8A 2PDHA 3B0VC 1Q7ZA 4GQ0A 5I79A 4O1CA 3CAQA 4YJ5A 4UQCA 2OVLA 3O9NA 3C56A 4Q8OA 5LGXA 1JQVA 1L6WA 5CQ1A 1KTCA 1ZY9A 3ZT6A 5BXSA 1OFOA 1CB7B 1UZ4A 2OJPA 3L2LA 4F79A 3WEMA 4A22A 4MWAB 2WZHA 1DHKA 3I6TA 1IEXA 1NOUA 1QI0A 2Q3OA 1ZZMA 2P3ZA 4Y6GA 2QYGA 3EOUA 4DM1A 3SUUA 3M9YA 5CSYA 2H8ZA 4FSAA 4H6QA 4O52A 5AB3A 4J7RA 3II1A 1IE7C 3USBA 4XD4A 4PC8A 3ZVHA 2NQ5A 1PV8A 3P74A 1R30A 3TR9A 3S42A 1PBGA 1MZRA 2FJUB 1KNWA 4GD0A 3W7OA 5HOSA 1UMYA 2XIBA 3KL0A 2INZA 2QXWA 3AFBA 1T0OA 4N6EA 1E4LA 3KDOA 4J3VA 2E9LA 1N8IA 1Q2SA 3FXYA 1OABA 2D73A 2DJXA 2OQLA 2E28A 3BMXA 3EDFA 1EUAA 2NZLA 2RDWA 3W6MA 1FH7A 4PUJA 5AC8A 2DZBA 4AWTA 2GJNA 4EAMA 3S9IA 4WIWA 4UNKA 1ZQ5A 2EG7A 3QMRA 4N4QA 3SCSA 5DRCA 3IVSA 2Y61A 3GDKA 1QPRA 1J18A 1VJIA 3RLGA 3T4CA 5REQA 1QI3A 3GFYA 1FH9A 4IMAA 3ZVIA 1XIJA 4GYJA 1W1ZA 1JG9A 3W25A 1UWQA 2E4TA 3A9BA 1TSIA 3PAJA 4IPNB 4O0QA 4NVTA 4GY0A 3T0AA 2UZ9A 5A6SA 1NWTA 1XBXA 2QJJA 3VC6A 3UEQA 5HPOA 4HK5A 4O10A 5I09A 1QI2A 1F61A 4GI6A 2D2OA 4K36A 1DQUA 3WZ0E 4QG9A 3QY8A 3MWAA 4LYQA 3ZOAA 2GVGA 3T0BA 3TYEA 4O57A 1OFRA 1PHQA 3R8GA 4N9DA 2DU2A 5H8PA 3STCA 3R10A 3SI9A 1GVRA 2HPMA 3H22A 3HV9A 1R87A 5G1MA 1ESWA 3KUMA 3KWSA 4O1DA 4BA0A 3H21A 1JULA 3SGUA 4H3DA 4CCCA 2OQYA 1GOWA 4S38A 4G1NA 3AHVA 3AU2A 1MXDA 4MFEA 4XBJA 3LHWA 4MJMA 1GQIA 3BDKA 1PKLA 3NFUA 2Q8ZA 2A0NA 3GXTA 3LRKA 2Y5JA 4YIWA 1A50A 2VT0A 4NX5A 2Y8KA 2ZXBA 5AC7A 4AIOA 1MNZA 3SIMA 3SN4A 3O8AA 3JS3A 2E0PA 5A3HA 3CUHA 4ZOBA 5HPCA 4P7LA 4G2DA 1AODA 2NV9A 1UWIA 3OLIA 4F0MA 3T0DA 2FPYA 2UWFA 3PWGA 2WHKA 2ZRZA 2ZA1A 3S1XA 1XFBA 4V1YA 1RCQA 3APGA 3URBA 2VUNA 4H8HA 4ATWA 3H4GA 3VIHA 3A4JA 2VZVA 3BQ6A 1PUDA 2D0GA 1H41A 4M29A 4R53A 1JCMP 2C8NA 1LRQA 5LSMA 3VIMA 4AZIA 3NQDA 2XIMA 2YJQA 1T40A 3EA3A 2Z26A 4HSNA 1POKA 3W1AA 2VRKA 4Q33A 1K9EA 3ZO9A 3O7UA 2PTZA 5T8GA 1QK0A 5HANA 2IKHA 1Z69A 3QLDA 1V3LA 1PAMA 2XSBA 5BWFA 3O2LA 3UJRA 5K7JA 3RX4A 4S3KA 3WLSA 4F9DA 1ZENA 1GVFA 2XISA 4ADUA 4J1OA 1O5QA 1G7UA 3PZQA 2JALA 5LNRA 2EPKX 1UD6A 1AJ2A 1VLWA 1IEVA 3MUAA 2YYUA 3V16A 1WZKA 1K8YA 4YMZA 3CV7A 3HQPA 2Y63A 3GTIA 2YCKX 4D8ZA 4O16A 3HM7A 3UCDA 1XIDA 5T26A 2I16A 4QCFA 3T78A 1ZJAA 1A49A 1SM9A 3OIHA 4MJ4A 2VRJA 2Z00A 2GK1B 5HUPA 2PUZA 4JDBA 2AL2A 1DXFA 1QBAA 3M47A 2XGIA 3ITCA 4HA3A 1S46A 4LCRA 5XIMA 1NDWA 2OPJA 4IP7A 4CD4A 2ISDA 1JAEA 4J3UA 4HT3A 3S5ZA 1ITUA 3C8FA 2G50A 3W7HA 1EOMA 3CIXA 3C0SA 3KOZA 1XBZA 4HA0A 4JYEA 1ZCCA 3CZLA 4BQ2A 2CU0A 2OQHA 1GK8A 1DQWA 4F0SA 3KDNA 1J0JA 4ZODA 4QQ3A 3LHTA 4W5UA 1S3TC 3Q37A 1UASA 4U4MA 1S2TA 1UKSA 4L64A 4LS1A 4ACYA 3WDHA 3VIGA 3HGRA 1REQB 4L9ZA 2VCAA 1QUMA 3QY7A 2PI6A 4UCGA 1FP9A 4WGHA 1MWOA 2ZWZA 1VZWA 1YW1A 1W8GA 3E0FA 3DIPA 5CLTA 2X05A 4AISA 1WP6A 5H91A 5DBTA 2OCZA 4MNJA 5FKYA 3PY2A 4DUWA 4XAYA 2X41A 4Q3MA 2BMBA 4Q32A 2AL1A 4GJJA 3O3RA 2J88A 1FTXA 5CPLA 2VZTA 2X42A 4DVOA 2XPKA 3LGDA 3ARVA 2P3EA 3CUFA 2AMGA 3RF9A 3QXBA 2D23A 4GVHA 3P84A 4WCJA 4AAJA 5AHIA 3PC0A 3UR2A 3VIJA 3K8MA 1EYEA 2CW6A 2G96A 3WLLA 4YCPA 4GXWA 4Y2WA 4U31A 3WQWA 3T42A 1BWKA 2QMJA 5CG7A 2J7EA 4AZHA 2XN1A 1EQCA 2QUVA 4MF4A 4H04A 1V79A 1G01A 2NT1A 1FWIC 2G5WA 3DH7A 3R8RA 3RLHA 4C6EA 4B5XA 4MHBA 3QZAA 1MUCA 4PUDA 3U2OA 2WM0A 3JZEA 1NSJA 1SU5A 1Z6KA 4RL3A 4V2XA 4JICA 2HBXA 1FWEC 2Q01A 1DOSA 4H2HA 4ECLA 4HNVA 3D3FA 3AALA 2CPUA 1W37A 2CLEA 4J9JA 4J3WA 3LPGA 4PUWA 1EIBA 3UPBA 4IMCA 4TX8A 2C3ZA 2GDQA 4UZSA 4I6KA 3VMOA 3VDGA 4R7OA 5F2LA 4IF2A 1C7SA 5EMLA 5HQMA 1FWCC 4TVDA 3F2DA 3RILA 3W24A 1C8VA 3QV8A 1W31A 4X9SA 3UZXA 1H7PA 5JVLA 2V3FA 4AIUA 1H62A 1R3VA 3KX6A 5K9CA 3WD0A 3CEUA 3N19B 3NDZA 3PSVA 1VFHA 3V5CA 2Q6ZA 1V77A 2Q09A 3L0GA 4MKSA 3NEVA 2BGQA 3ELFA 3SADA 1XDJA 3AS0A 5AFDA 4C6BA 1TV5A 3PULA 3N6HA 5T9BG 1UZHA 3IK2A 3WK3A 2YB4A 3NM3A 2Z24A 4KMQA 3AOFA 4UTTC 1VQTA 4FIQA 4DWSD 1LWIA 4XD6A 3KAOA 4UCFA 1UQYA 4BJHA 4HSOA 3L4UA 4O18A 2VR4A 4AZCB 3UZYA 1I2OA 4IFRA 1JUKA 3ZJ7A 1ONXA 3STFA 1KRCC 4EIVA 3NOYA 4IMFA 1UA3A 1R38A 4XX6A 2IKIA 4IWWA 1QRQA 1VHCA 2VGGA 1YEYA 1XSIA 3QTPA 4HNUA 4K7VA 4FEZA 3T05A 1X1NA 1HVXA 1UR9A 1XH2A 2XUCA 4UQAA 1CGXA 2HNHA 3SY5A 2RDUA 4C6OA 1SO3A 1Q3NA 3TA6A 4FNPA 5M5DA 1L2UA 3SFKA 4QAWA 4ZFCA 3C61A 3ECQA 4HPHA 2DZPA 3CO4A 3WQ5A 4N9CA 1EEPA 1RVKA 2CZDA 3W7QA 5T9CE 3N3MA 3VI2A 3BOLA 5E70A 3EWXA 4XZ9A 2P76A 2JGQA 4JD4A 1TPC1 4PSRA 1E0UA 3EB3A 3KL5A 5KTLA 3F7JA 3SM0A 3CHVA 2GQAA 3C0JA 5B7YA 3ABXA 4KWOA 3W6YA 3U57A 3DESA 3PZ9A 4I7UA 2MNRA 4NAFA 5KSWA 3JU2A 1CPUA 3GG1A 4KCUA 1H7WA 1MW1A 2OEJA 3AISA 3GIQA 4Z08A 5GNZA 1GGOA 2DT3A 4QHRA 5DT5A 2ZWYA 1XRSA 4GXMA 2YBUA 4Z2GA 3RU6A 6TAAA 4JQ3A 3MBFA 2PTDA 1S2UA 2BVYA 4HPGA 2G3NA 3WN6A 8A3HA 3NL2A 5AZ1A 3RNDA 4AZBA 1JEZA 3SCRA 1TWDA 1D8WA 2OYKA 2QIIA 4UFIA 3GRIA 4YNGA 1B3VA 4OVXA 1ZUAX 4B5TA 2TYSA 3IJLA 3QZEA 1Q6EA 1P7TB 3REQA 5CJNA 1GYNA 1XH0A 1HJVA 3DKJA 3I6RA 1R7OA 1V93A 3RM9A 1ADDA 3BAXA 3CUXA 5EYWA 3G18A 5CBJA 4TMBA 4NNBA 4NILA 3RXZA 2V82A 3GDLA 1ZRQA 2AQWA 2DJLA 1HFBA 1QJWA 1TZ9A 3GC2A 3UXLA 3BLKA 4JNZA 2D22A 4KEVA 1YE4A 3ITYA 4O0KA 4DWSA 1SW7A 4XUGA 2X30A 3S5SA 4Q6JA 1JIBA 3KM8A 2PF8A 4B3LA 2Q71A 2HDJA 1WKFA 2WLYA 1UR2A 1J93A 5A95A 3CQJA 4FXRA 1US0A 3L23A 2UY5A 1B0IA 3NSMA 4UUIA 1PSCA 3VZYA 1SJAA 2FZ9A 4RW5A 4Z17A 3W7PA 1BPLB 1AFSA 5DMMA 3FJ6A 4H83A 5BXTA 7XIMA 2FKPA 2INFA 4XTDA 4MIMA 1WAUA 3W2KA 3N6QA 1W8SA 4M6PA 3OLDA 1TTIA 2VELA 1XDLA 3GC4A 2VFIA 5I3HA 1FWGC 2E9MA 3SCTA 4XKYA 2ZBTA 1BVNP 3I68A 3CUIA 3OVRA 4JNMA 1QNPA 1JYNA 3VAVA 3V35A 1YHTA 6TIMA 3BC9A 1G69A 4AUBA 2OX1A 3WF4A 4MB4A 1KV5A 2NQ9A 1CLKA 1HKJA 1QXLA 1VFTA 2V5KA 5T91A 1EKOA 1Q65A 3AIWA 1F76A 1NWSA 4JTSA 4L1GA 1E3ZA 1QHOA 1FWAC 5FJUA 3IVTA 1I0BA 2A3EA 3DOPA 1ZS2A 1B9ZA 1BLIA 6XIMA 2I56A 4IG2A 2QGYA 2XH7A 4E8CA 5HNNA 3LM7A 2PWUA 4DBEA 4J5NA 4NI8A 2TAAA 4H7ZA 1UR8A 3R13A 4C6IA 1XL9A 3I10A 4D6DA 1JCLA 3ARZA 2V63A 5BZAA 4HZMA 5JU6A 2BXZA 3OGSA 1QASA 2QKFA 3MSYA 1Q63A 2KZHA 3TQPA 3EYPA 2C1GA 1XG3A 1QW7A 1RUSA 1PKNA 3WQOA 3PBMA 3TOYA 1E1EA 5CJMA 3BLIA 5DQPA 1WDPA 2ISVA 1SUXA 4NIRA 1JZ6A 4F0LA 1KGUA 3AMLA 3EDKA 3IJ7A 2H3DA 3T2OA 3IRSA 2QCHA 2PFHA 2Z1BA 1HZYA 2ACSA 1X6UA 3N4FA 2CZVA 3EPOA 4QFUA 1W1PA 2QDDA 3TQKA 1TUXA 4J40A 1TX0A 3MU7A 3E2SA 4DRSA 5LIYX 1YDOA 1VYSX 4F40A 1UIPA 1GOMA 4GH3A 3S1GA 3T0TA 1AH4A 4NZ4A 4HTBA 4GKTA 1IT7A 3UA4A 1V6YA 4X0NA 4UMAA 3TTEA 4YS1A 2GGHA 2E6YA 3AUOA 1JDEA 2NQLA 2R1KA 3O15A 2ACRA 4RDYA 3PAOA 3DAQA 4L80A 4XD5A 1NTHA 4H7VA 2VNCA 4C7DA 1F7BA 1NFBA 3L65A 1WZLA 3E3HA 3TYAA 1J0HA 3ATZA 3BLEA 3DEQA 1IWAA 3VMNA 2VO5A 3WLNA 5LA2A 3WBEA 1V6VA 5DBUA 4PCFA 4FNUA 3CTLA 1MDLA 4PMDA 3O0FA 3OHIA 1X97A 3W70A 4MLJA 5LNSA 4D9PA 1AW2A 3LZ5A 5LXEA 2X1UA 5I7GA 4DBDA 3UERA 3M5YA 4C6MA 4HZ7A 4AF0A 1M53A 4HKPA 3TU9A 3P81A 5I3IA 4NASA 3LCGA 4IUOA 3PANA 2F61A 4CVWA 2V30A 4Z0SA 2QUUA 4O11A 4AVOA 3L5MA 3E74A 2BY1A 3SN1A 4FI4A 2BWGA 3NG3A 1E1CA 1N55A 4GI4A 1TPEA 3HJEA 3V5OA 1CGVA 5CC6A 2WPGA 3WNMA 4Q8UA 2PD5A 3VKBA 2WVSA 2PC8A 1E72M 3W7MA 2FGLA 3DHUA 3P5ZA 3VNIA 3RDKA 4N4PA 4JCLA 3HN3A 1VPXA 1GJWA 1ZSXA 2WO5A 3FKRA 3FEMA 2VC7A 4QX4A 4Q4SA 2J79A 1POJA 3XISA 3BUVA 1YNYA 4YHEA 3BW4A 2BXYA 3DG6A 4FOUA 3NOEA 3OQEA 4JBRA 1K6WA 3TFCA 1IXOA 3L5LA 3DCPA 4Q7NA 5G2IA 1H1NA 5DY2A 1S39A 5D32A 2Z1KA 3GAKA 4HGXA 4N7QA 2GZXA 4EXBA 1U1UA 1VFOA 2YKKA 2IKJA 9XIAA 3OW1A 3NZPA 1EJRC 1TPWA 2YA0A 3NXLA 1CW2A 3I3DA 3N2XA 3Q58A 3CLMA 2DV0A 2Z7GA 2E7FA 3P67A 2O9OA 2FLIA 2O0TA 3E5BA 5GJMA 1S5MA 4RE0A 3GG8A 4I5RA 2QCCA 4AVFA 3SQLA 1WUEA 3G24A 1IGSA 3GR7A 4NZJA 3EWYA 4WX2A 3MQTA 5FF7A 3GXPA 1LOLA 3HFTA 3H24A 1NJJA 2PA6A 5FAJA 4AB4A 3FAWA 3NEHA 1EF2A 1NH6A 4QG6A 1YNPA 2D20A 3H23A 1R3WA 4R88A 4WK9A 2QCDA 1CT5A 1O7AA 3CMGA 1TWWA 3URQA 3MV01 2W63A 5LNVA 3IIZA 2J9ZA 3VK5A 1PIFA 3PZMA 3BGAA 1TUFA 3DERA 3H4WA 4XAFA 3W53A 1BGAA 4O8AA 1ZLPA 1Q6RA 3MC5A 3A4WA 5BOOA 1EHNA 2ZRXA 3IK4A 4W84A 3AWNA 4GCAA 2R1NA 1RP9A 5KEZA 2RDXA 1OD8A 3H12A 4B9ZA 1F73A 1QOPA 4NY2A 4LC6A 3RJXA 1LORA 3MTWA 5CZ0A 5CGMA 3VTRA 2QJIA 1MVYA 2X0YA 1FFQA 3N17A 1J5TA 3UQNA 4CEXC 4M80A 5J5DA 3A23A 4NG3A 3RMEA 3PUGA 1RBOB 4JHMA 1FA2A 3W2MA 1UKPA 3UG5A 1QO2A 3WMBA 1ZHAA 3H2OA 4BKNA 4ZSUA 4JTIA 4WZHA 3PP7A 1PTDA 1GYMA 4MYXA 3ITXA 4B90A 2DSWA 1FRBA 1C9WA 2A4AA 3T8QA 4QXIA 1YPIA 1Q4WA 1TA3A 4NJIA 3RO6A 5E9AA 4AW7A 4PTMA 4GA8A 2QT3A 3BXWA 5D8ZA 3W73A 2NUYA 1HKWA 1UD4A 4AWSA 1QVBA 2FB3A 2I17A 2HMCA 1WBHA 3A12A 3S5NA 2I5GA 1DIOA 4DUXA 3K4AA 3LI0A 5IFPA 3BK0A 5D2VA 3C4UA 4O1FA 4LVFA 2B81A 5E5CA 3T07A 5CPQA 5DX7A 5EL1A 3H4XA 1ITCA 3CPRA 2V5DA 3KBVA 3EZ4A 2VDHA 4Y9AA 2VFGA 3MI6A 3QHNA 4OECA 5TAOA 2BP1A 4PBEA 1DVJA 4EXQA 1FDJA 3S6DA 1RY8A 3PPHA 3LNMA 1IZKA 5BOFA 4GNVA 4PR4A 3WK1A 3NL3A 1P4CA 3M0KA 4B4FA 2OOFA 4RDVA 3HF3A 1BSIA 1QO5A 3VOCA 1W3JA 3FEQA 2ZX8A 3EDEA 4G56A 5TIMA 1XYLA 4IISA 1AQHA 4DAFA 4LQ1A 4IPPA 2VDIA 3OTRA 1I1WA 1HP4A 1NQ6A 1J96A 4FP1A 3SRHA 5I6SA 4QJ1A 4XV0A 4F0RA 4U3AA 2J7DA 3K8LA 1SPQA 5FJPA 3ZVHB 3H7UA 3ZXWA 3VNZA 2PWEA 5F4SA 2XH2A 3N2CA 4GKLA 4GUGA 3XIMA 1LBFA 3FVMA 3MB9A 3S2NA 3OU8A 3WD1A 1GHSA 1V3IA 3LM3A 1ZALA 1IT8A 3W87A 1EZWA 3SGGA 3V36A 3H2NA 1QATA 4UZUA 2F8QA 1WUFA 1J6PA 3GSMA 4M51A 3FGCA 3AIQA 1J79A 1TPDA 3MA8A 3LERA 2D1ZA 2DZAA 3PVFA 4ZSTA 2Y7DA 4Y9OA 4DN1A 1XD1A 3UZJA 4D6EA 4TO8A 3GG0A 4C1NA 4ATDA 4A3RA 3PWAA 3W2UA 1I2QA 1XYZA 5D2XA 4MZYA 4RE2A 1O5RA 4OQVA 3OGVA 2D0FA 2Z29A 5F1VA 4L4LA 5HMSA 1LOSA 2WAGA 3F4CA 2RAGA 5GJPA 1HKIA 3LQLA 4I7VA 1SW0A 5REQB 1V0MA 3B8VA 2ZZ7A 5TBOA 1E6XM 1E51A 3T08A 4ZXOA 3VC5A 1K8XA 4JY8A 2VZSA 3SEPA 1RLCL 2TPSA 1LQ0A 3H53A 1VFSA 2G3JA 4EK7A 3TKFA 3BG5A 1NOWA 4ZMGA 4E0CA 4IXXA 1KBKA 2DUZA 5DN1A 7CGTA 3MBDA 3POCA 1BYCA 4A8NA 2ZDRA 4ONVA 3N3TA 5U7SA 4HNCA 3FK4A 1UPMB 2HEJA 4B5UA 2IXVA 4L65A 3BZJA 3TDFA 2FZDA 1A5CA 2NUXA 3W23A 4J3XA 2BZNA 4MZ1A 2D69A 3U2EA 4FF7A 4I9JA 2OU4A 1UPPA 4K8HA 2YDSA 3PNZA 4IQJA 2ZX6A 4KFOA 4MWAE 1KM2A 4F3HA 3CGTA 1QTWA 4XISA 1H09A 2EQDA 4I5UA 3ZJ8A 2QDHA 1LLOA 2UV8G 2E67A 1E6PA 1TV7A 3LS9A 5I3KA 3WLOA 2CEQA 4KEUA 2VFDA 1I2PA 1GOOA 4H9VA 2G95A 2QMKA 1WYIA 4QS6A 4JQ1A 2NXGA 5A2BA 3A22A 1NOFA 4DPPA 4HCLA 1VRDA 1B3OA 2W61A 1VYPX 3PN8A 4GUHA 3NYZA 1VS1A 4E2BA 4OOZA 5C2XA 1FHVA 3WH7A 3A6OA 1PO9A 1LBMA 1A4MA 3MV11 4ZTXA 3NGFA 5MF5A 3BOFA 3A21A 3C2OA 3N9RA 2OFJA 2Y8VA 4ZOCA 5LYRA 4GIAA 1OCBA 3BAWA 3EWZA 3CS2A 2O7QA 2VD8A 3OZMA 1Q6FA 2R9RA 3RGTA 4Q7IA 4DNMA 4NZ1A 1JUBA 4WSJA 1EJWC 1FQ0A 3BWWA 3CQHA 4MWAC 3TYBA 1TJPA 4P61A 1HL9A 1F6KA 2VQTA 1ALDA 3WBXA 3VOIA 3THUA 4AY8A 3VDBA 2C91A 4C5YA 4JIIX 5EFDA 1GPWA 4QTGA 5H1WA 3KE0A 3A24A 4LVBA 2FMOA 1SQ7A 1XLCA 3O05A 3GDTA 3GFXA 3GG7A 3ABSA 2ZXQA 4S3CA 3OPSA 2PWGA 3FSTA 1GOQA 4HYWA 1ECQA 4LVGA 2J66A 4WOZA 5D2TA 1Q6QA 3WK2A 3VZZA 4IMDA 4BF9A 4L9XA 4P5UA 5H2ZA 1O12A 4LAKA 4EF8A 2VM8A 1UD2A 1O66A 2DP3A 3VOGA 1NY1A 2Y70A 3QVQA 1W5PA 4UOZA 4BS0A 4IIEA 1KXQA 3PG9A 3R79A 4C6PA 2AGTA 3PTQA 2FHCA 2I14A 2OTDA 3AZSA 2EKCA 3WQCA 1DJYA 2IXUA 3LEPA 4E3TA 5LIWX 4LNYA 1PIIA 3BURA 2GWNA 4IPIA 1E43A 4H7CA 3RJYA 3CV2A 1J4EA 4XWUA 4A29A 2F6KA 2HVNA 4M1BA 1YXCA 1BF6A 4UQBA 3O1NA 2C16A 2PGWA 4M7TA 2V3DA 1B3YA 1WZMA 1KFWA 1BVZA 3EXSA 3TX9A 1CGYA 3TC3A 1A80A 3VD5A 2AL2B 4X0VA 1GVYA 3OA3A 2C6QA 4CEUC 4O1BA 1QI5A 1CXKA 4X9YA 4OUIA 2ACUA 3QR0A 1KFLA 1T6MA 3H2MA 2VFHA 1SW3A 5I06A 3VFLA 3C0QA 4M8UA 3FYOA 1QBBA 1F3EA 3CZGA 3INPA 1WKYA 4QE1A 1IZCA 3H54A 2ZICA 3KW3A 4BI5A 1UUQA 2HS6A 3ATYA 1WQ5A 3TROA 4IQLA 4YXGA 1IV8A 3G0SA 1EJ7L 1GVOA 1BRLA 2CLMA 5J8LA 1KTNA 3GVGA 3UF9A 3CL7A 1DJWA 3T9PA 4EACA 4W88A 3THQA 4H8NA 5FACA 1VEMA 4P7NA 3ARXA 1TQJA 4QEHA 2PZNA 1G94A 3O6AA 4H8UA 1KWKA 4K7YA 1R3SA 4BEUA 1TWIA 2FHBA 4LYPA 2CHOA 1K7XA 3SFWA 4OKDA 1WV2A 1KLZA 1LM1A 4S3BA 2V2CA 4Z1AA 4YVXA 3CH9A 2Y62A 1LT7A 1OGBA 4AQLA 3O6CA 1SO6A 1UKOA 2WSRA 4P8XA 3TOPA 3GM8A 3RR1A 3AICA 3RUBL 2JQXA 3N4EA 4UTHA 3OLEA 3E1F1 5D38A 3MZNA 1VJZA 3NQCA 3IJ8A 1ZJIA 3PM6A 4GVFA 3WH6A 1JF5A 4HIBA 4DUOA 3B97A 4GLEA 4DO7A 5RUBA 2HISA 2WMHA 3TEVA 3PNUA 4AZGA 4IIHA 3T8LA 3FLUA 2QCEA 2YZRA 3SSZA 4PB4A 1EEXA 5JBEA 3W29A 2VP8A 3VKDA 1ZAHA 3BLFA 1DHPA 3ANVA 3BH4A 8CGTA 1XGEA 1I2RA 1HKKA 2F7FA 4YL2A 4OT7A 2EG6A 5A6BA 4UBPC 1RJQA 4D6HA 3QJAA 4AC1X 1WXZA 4JNYA 1HJUA 4DUVA 1CGWA 1IR2A 1JL8A 2OZ0A 5KINA 4QEEA 1FHLA 1U5HA 4H9YA 1OFEA 3NQVA 4WLCA 3HGOA 3U6WA 4WSHA 4S3DA 4WDWA 1YX1A 3C5QA 4YVVA 1TX2A 4K37A 1XI3A 1TO3A 3TIMA 3NPWA 4QAIA 1UCWA 3UETA 1NELA 4WJXA 3UJFA 2GL5A 1PZ1A 4XSMA 3IUIA 5HATA 2OKTA 2BGSA 2CERA 4HHHA 3AU6A 1XCXA 1B57A 2ZUMA 4JZ5A 1TJRA 4PUNA 5HQLA 1KFEA 1OK6A 2XSXA 4Q8MA 3PZOA 1T41A 2CLFA 1W3HA 3LCXA 1XPGA 4OHQA 2PDCA 3A13A 3IGUA 1B30A 4GO8A 1GCYA 4RKAA 2JIWA 3JRKA 1J0IA 5MKGA 3KXQA 4F2TA 1NWUA 3PZTA 5C7VA 4RE3A 4S2CA 1E56A 1E71M 3WMLA 3W1RA 3GC5A 3NM1A 5E0FA 3RRAA 3MI3A 1YTDA 3R25A 1RH9A 1XLIA 1A5SA 5CPMA 4XIAA 1W5MA 2HPIA 2YSWA 1AH0A 3G3DA 1GVIA 1AW1A 1JYVA 3GW3A 4AD0A 2FTWA 4AHQA 5E9XA 4GPNA 4OGZA 4ML4A 4QRNA 1GKQA 3CMFA 2OELA 5KZEA 2OR2A 5JUVA 2FYMA 1GVQA 4Q22A 3EKZA 2FJKA 4JR5A 1RXOB 3MMDA 3UYIA 1W9VA 3IANA 1Z3NA 4CNOA 4F48A 3B9OA 3GU9A 3WQPA 5DRIA 4IL2A 4F2BA 1EJUC 4FIRA 1J6OA 1AL7A 2Y6ZA 3P2VA 3H26A 2BS9A 4UTWA 1UJQA 4NNAA 3TJLA 3GVWA 4GCXA 2HVMA 2A7RA 4EPKA 4NAFB 4UQ9A 1MO0A 3A4XA 1JQXA 4B92A 4XBKA 2MANA 2CNCA 1IEIA 5HXMA 3B9AA 4JKKA 1CCWB 4DXXA 1CB2A 1TE1A 4LUIA 4L56A 3VOHA 3LG3A 1X7IA 1N82A 2WNZA 4Q8WA 4ORIA 3PTDA 2G4JA 4IQEA 4Y8EA 3FDGA 4KGJA 5B7ZA 3ABQA 1UH4A 1Z89A 3VMPA 3LBCA 3P14A 1UWTA 1DTNA 4GABA 3VOJA 2DZWA 1ENUA 4N2YA 1P1XA 4I8YA 3S4TA 3W7CA 2E5DA 3REQB 2E6FA 2A21A 4KESA 2DSZA 4S2BA 4GFSA 3CL6A 3QLLA 3MCNA 2CKRA 4YCOA 3KVMA 3J7HA 4HSHA 1L0PA 1LUCA 1OHLA 1XW8A 4V15A 3S2LA 3SN0A 5FIPA 3S6OA 3KS6A 5A94A 3C86A 3W4RA 3I6EA 4LXFA 3MHGA 3U4AA 4KKXA 4DWSB 3RO8A 1P43A 3E2QA 1KRAC 1KXVA 2EBNA 1Q8JA 4K38A 4JFWA 4BQ5A 2PTWA 4XO6A 4MKNA 3UWEA 2H8XA 4DB7A 1T7LA 2YBVA 3N18A 3E02A 1HF6A 1EB3A 1RBAA 1SZNA 1S1RA 4REQA 1F05A 2OT0A 3CQIA 1XLGA 3HZ3A 5ENLA 3M6YA 4JFVA 4FX6M 3LV5A 4AY7A 3NQGA 4QBXA 2Y1HA 3AHYA 3TN4A 2ZUVA 4H19A 2CXGA 2AKMA 5C9RA 1E9IA 1K9DA 1DYSA 1Z42A 4MOZA 1CIUA 2OSYA 3PJTA 5BYWA 3MP3A 3AC0A 3T6CA 4J3ZA 4XB3A 3KP0A 4WD0A 4XKYB 3CYJA 3LLDA 4C6KA 1XIIA 3FVDA 2PDPA 1I0DA 1SZGA 1J2WA 3ZR4A 1JJKA 3Q67A 1VBGA 3E12A 1A5OC 1EWDA 1KD0A 3G2GA 1WKDA 4B5SA 3IJ6A 3DG3A 1JVNA 2NV1A 2YOCA 1PKYA 2DQWA 2NXIA 1V0NA 3NNTA 4NZFA 3W75A 1QOQA 2YDAA 1XIHA 2HK1A 6XIAA 3W38A 4IG2B 2V5BA 3GO2A 3R0KA 1TG7A 2WNWA 4QE5A 4CN6A 4UNIA 2WBGA 3G22A 3WNNA 1V4YA 4IQDA 5CBIA 3EA2A 3AROA 2QAPA 1QWKA 1C3FA 1ECEA 5F1UA 5GPRA 4AG0A 2X16A 2OOGA 1ML1A 2QDGA 4GC3A 1M65A 3CT7A 3L4XA 5CJ5A 3DU0A 5HMDA 1XGZA 3HA1A 1S2CA 3UYCA 3LXBA 1XC4A 4YYCA 3AXMA 4XZNX 3O06A 8XIAA 3ANYA 2PWDA 4OFCA 2FFIA 1O6IA 1VFFA 1GZGA 2F38A 4A8RA 1MUWA 1DWHM 4CD6A 1B2YA 4PMVA 2W4XA 1A5MC 3UESA 1LWJA 5AN7A 2EPMX 4I3GA 1V6WA 5XIAA 3SR7A 4B5WA 1PKMA 3CV1A 1VKFA 2D2JA 2A7PA 3M6DA 1G4TA 1G1YA 1KR1A 2CHNA 3M5ZA 1M04A 1IIHA 3S0CA 2ANUA 1J0YA 3AO0A 2CLIA 2BHYA 1Q5MA 1K4GA 4CNUA 2ZADA 4UTMA 3AS1A 1P5BA 3F2CA 1UJPA 2YXXA 3EPNA 4DYEA 4E2VA 4AMAA 2BG5A 4FLOA 1RLDA 4C65A 4WDTA 3HG5A 1UHVA 3NPVA 2YL5A 3ZJ6A 2OX4A 3M0MA 3M44A 1UKQA 1Q85A 4B2DD 2D24A 5E0KA 2G41A 3MYPA 1NEYA 1DKWA 5DMLA 1L9WA 1US2A 2P50A 4MB1A 5BXPA 3GH7A 1OCQA 2VR2A 4PUEA 4O12A 2FTYA 3VNYA 3BQ5A 2VJXA 4QIUA 1C29A 1QMLA 2CYGA 2VC5A 3KHDA 3R5EA 4AF0B 4WKHA 3MVIA 4OZOA 3G0XA 2E3ZA 4XVDA 4CQAA 1YDVA 3GFZA 3LCIA 4YTRA 4HN8A 1B3WA 4QGCA 2CETA 2BVWA 3DN5A 2IKGA 1U5VA 1I45A 1W3TA 2Z0IA 4ATLA 5IBXA 2J9XA 1E1CB 3QR1A 1JI1A 5J5RA 3Q4DA 3L7RA 1ITXA 4NRSA 4JIHA 4ZO7A 1KXHA 5D9PA 2DIKA 2BASA 1EZ2A 3GR8A 2XYLA 3DBPA 3TSBA 4LUYA 5CZJA 4UIOA 3GXMA 4JIPA 2XH0A 2XFYA 1YBQA 4K68A 4MJZA 4AHPA 4L6OA 1JNDA 4I7WA 2WMIA 1ZAJA 5EGRA 2WSPA 5SWUA 1EPVA 1H5VA 4U5KA 4QQUA 4CGTA 4HQVA 1H5YA 1IXNA 4YWIA 1S2VA 4DYKA 2PLJA 1G5AA 3BE7A 4M0XA 3GTNA 3DYMA 3PBGA 2ZUUA 1UP3A 3QMTA 1E6NA 1OK4A 2PRMA 3GTFA 3VCRA 5CSRA 1MNSA 1GW1A 1S2WA 4FXSA 2NQZA 5IOBA 1BWLA 2DY3A 4J3TA 4UR7A 5LNUA 1R0MA 4D6IA 1UP2A 4HU8A 3UW6A 5CPSA 1PWLA 2Q02A 4PUMA 3WLHA 2E77A 2PDKA 3KOWA 5CKSA 3WQVA 4FPSA 1WB0A 3AWOA 4UOJA 2EGZA 4JN7A 4EF9A 4P8VA 4GQQA 2OGJA 1R2SA 3TWAA 5DANA 1DE6A 4AX7A 4L9YA 2OWCA 3PZVA 4JEQA 1HQTA 2NWRA 1PDYA 3PTMA 4DIAA 1HGYA 1L6YA 4C7FA 4B2DA 3MSDA 3HPFA 4H00A 4PRRA 2QCDB 3VCCA 2HROA 4HJFA 4NJJA 3ZLGA 3BICA 4UMBA 3AYRA 2J74A 2ZA3A 2DH2A 2PP0A 4KT2A 3AAMA 5DCDA 1VCVA 3M0VA 4YPJA 3FW6A 1AZ1A 1HVQA 1H7XA 3VNJA 4W93A 2Z1XA 2A3CA 3MKVA 4GZEA 3OLGA 5H8UA 3VILA 2EPHA 2V9DA 3SCNA 2GDUA 1PVNA 3C2FA 4HHLA 4JYDA 5KZ6A 3L9CA 1W9PA 1TJ1A 5K3VA 3SBFA 5HNUA 4KIEA 4TX9A 3UU0A 3D46A 5D03A 4U2ZA 3SQMA 4TTUA 4F2UA 1GQKA 4RZ4A 5CSUA 1ONEA 1X1OA 3PG8A 2OLHA 2J9YA 3K8KA 1G4EA 3UP8A 1XR2A 3AXIA 1JDDA 1TA3B 4BFAA 4C6QA 1R85A 4MUPA 3VABA 1RA0A 2NVAA 1EXPA 4JN8A 3SCOA 2E8ZA 1US3A 3W83A 2R14A 3SIZA 1V3KA 3GH4A 4I6VA 1EP3A 2BLEA 1OYBA 2BHUA 2PCEA 5K4ZA 3OVQA 2VKZG 1SYTA 1WOAA 1V5XA 3WDQA 1H2JA 3OA5A 1YPFA 4UOQA 4A4AA 1O1ZA 5JQ9A 3S83A 1HXJA 4JTHA 3DC8A 3HPZA 2WZEA 1TFVA 2C7FA 2REQA 1DQXA 2X1TA 1K4HA 3EB4A 3GBDA 4E5TA 2ICSA 1JUEA 1TRDA 4GRSA 4JFTA 4Y7EA 3B8DA 4PZVA 4HCHA 3TJIA 1KB3A 2L5HA 3N25A 4OBRA 3WD4A 4KCTA 1CX9A 1GNXA 3B05A 3MY9A 2WK2A 4H6RA 1WOBA 3IIVA 2ZZ2A 1Z7AA 4OUEA 2POZA 4ZE5A 3B40A 1ZFJA 3K1GA 2XIJA 1BG9A 2F84A 1EC9A 3BAJA 3AIBA 2J8GA 4P8UA 1RAKA 3KBWA 1OIFA 2QVNA 2CZ5A 2DW7A 2WC3A 1TJ2A 3V0TA 2PDFA 1TMLA 1ME9A 1XSKA 1Q6GA 4GBUA 5CBBA 3KCJA 4LB4A 3WUEA 4JTDA 4GZIA 4QM1A 3WDJA 4O19A 2V6AA 3IUDA 3GQYA 4NKCA 4JN6A 1A5UA 2QR6A 4HK7A 4HPXA 1JZ8A 4Q4KA 1YPXA 4F66A 3GU2A 4GYPA 3FGCB 4IFKA 3G1DA 3LI1A 3CASA 5LA1A 5C6MA 4AEOA 5ABGA 4ZE4A 1LZOA 2DT2A 1VB9A 3GHRA 3VKAA 3T44A 3BMWA 1WXYA 3NO5A 4BQ4A 2GFTA 3GNXA 6ENLA 2QQ6A 4GNJA 3GAYA 3TW9A 4C1NB 2XZ9A 3MUIA 4DJFC 4ZCWA 2P0OA 1W1B1 3BG9A 2PDUA 2FB2A 1GOXA 1M5WA 3EOOA 1LL6A 9CGTA 4BF7A 1NIUA 5FESA 1PTAA 2WHJA 3V1HA 3DYOA 3EBVA 3BAKA 4FXJA 4AEEA 4CNSA 1JFXA 3KTCA 3MI2A 4IGNA 3WK0A 3SJNA 3W01A 1XIFA 3DUGA 4ZOAA 4DLFA 3UWVA 3LGEA 1PPIA 5KITA