4O53A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFLFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o53A00
5CG7A 1I45A 4LS2A 1J2WA 2E5CA 1RQBA 2QCMA 3NZRA 1B57A 2R14A 2ZA2A 3UZJA 1SSDA 3W7PA 3FKKA 5D32A 1OK6A 2WNQA 5MHBA 5AFDA 2CLOA 1L9WA 5AYYA 4FB7A 1XBXA 1FDJA 3W83A 1KM4A 3EX2A 5DCBA 3ABRA 4BF9A 1SZGA 5CPLA 1OHLA 3L5AA 3QF0A 5IM51 2YPIA 2ZRWA 3IIPA 4M6VA 1L6YA 4MOZA 3IIZA 5LKYA 3LCWA 2NXGA 4MYXA 3LCIA 3CEPA 1XDMA 3STEA 2H3BA 2C18A 4DO5A 1M7PA 2P0OA 3VFLA 1DJQA 1KLYA 4U4MA 3E9AA 5L6UA 2YZRA 2E6DA 3W2NA 4YLWA 1GZGA 2KZHA 1FBAA 3TDFA 3NVTA 3TAKA 4LVDA 3WJZA 3PBUA 3FS2A 3B06A 3TNOA 4K38A 3S8HA 3Q94A 1EEPA 1SR9A 3TC6A 3NQEA 4ZQNA 3SJ3A 1JJKA 3ABOA 3L0NA 5K7JA 3OIXA 4XKYB 3LV5A 1TV7A 1GVRA 2Y70A 2JBMA 3P8IA 3LRLA 5G2HA 3LCLA 1JCMP 4FIRA 5AC6A 2B7NA 2Z0IA 3M43A 5FF4A 1RR2A 1C8VA 2DZWA 3NAVA 3HF3A 3UY7A 3EWBX 3KXQA 2ZZ1A 1P1XA 1ZFJA 1P0NA 3S1WA 2CLEA 2E68A 3HGSA 5HQEA 4FNRA 2GJLA 4TIMA 4HNNA 5U7SA 2FB2A 3IIVA 3SGZA 4DXVA 5LGZA 2A21A 5FF3A 4CQ9A 1VHNA 5D38A 4O13A 2A6LA 2VENA 3BO9A 2B7QA 4NT0A 2C3ZA 2ISVA 4B5NA 3TQ0A 3W2UA 1WAUA 1ZENA 1ME7A 3QEZA 1EP3A 1LBFA 2ZCGA 4N6FA 2JK2A 4RLIA 4HNUA 5BRBA 3UWWA 4FO4A 4UMBA 2P10A 1VH7A 3WJXA 4MZYA 3W7HA 1KFEA 3QMTA 1H7PA 3PR2A 3UPBA 4LC8A 1M5WA 4O4WA 3O05A 3I7SA 1K8XA 3G3DA 3BGJA 4BI6A 4Z1CA 1VYRA 1D9EA 3G1AA 5HINA 2B7PA 3B04A 4N9CA 2QCNA 3P5YA 1PIIA 3RU6A 3BARA 2V5BA 1XM3A 1DKWA 3QM3A 4IXXA 2CWNA 3EWUA 3W1AA 2XN1A 4E38A 4BFAA 1TTJA 4CNNA 3C6CA 4K7YA 5KTLA 1BTMA 5DN1A 5AB3A 2VFGA 1SW7A 1EPXA 4N9DA 1WOAA 4LWWA 3LOTA 5FEZA 2O7QA 5U4NA 2X1UA 1XKYA 2V9DA 4IOTA 1LCOA 2YDAA 4O14A 4LRSA 1MSSA 4HNTA 1EP2A 3LHWA 3P67A 3DENA 1OK4A 3LTYA 3P61A 2HS8A 4KWVA 1G7UA 4NX5A 4O4VA 1EP1A 1X1ZA 3WJSA 4IQLA 4J9JA 3W75A 4MZ1A 2ZDRA 3LTPA 2UV8G 8TIMA 3QPZA 1UUMA 4O10A 1KV5A 2Q8LA 4FNSA 3L68A 4LV4A 3S6DA 5BOOA 1H7XA 4LU0A 4CNPA 3PM6A 4BI7A 4PCFA 1T8XA 1TPUA 4UNLA 4LT9A 3KRZA 2E6FA 3GKFA 3N73A 2QCLA 1XBZA 4WQ6A 2ZA1A 4PH6A 1Q6RA 1UCWA 3NPUA 1YLVA 3I65A 5DCEA 3R12A 3W23A 3W7MA 3ELFA 4JDYA 3M41A 2CZEA 4DPPA 2QAFA 3GIYA 4Z08A 3VKJA 4NJJA 4N4PA 4HNVA 1KM3A 2IQTA 3BG3A 2V2HA 4AF0A 1BKSA 4Q4KA 1F6KA 3GNNA 1XBYA 4LS0A 1ZAJA 3G0UA 1JVNA 1RVGA 1WX0A 1K02A 1DJNA 2CLIA 4DQWA 5IBXA 3W2JA 2DZSA 3PS7A 2CLHA 2FFCA 3PBYA 3IVUA 4OU1A 1TJPA 1VCVA 4Y6GA 1Q6QA 3EXSA 4WY0F 2NWSA 2YW3A 3TV8A 1J4EA 4UIOA 3N34A 5BW6A 4NX0A 1DL3A 5CPNA 4O11A 2GVJA 3N3MA 4PL2A 5I3KA 4UMCA 1GWJA 2YXGA 3KAOA 3W1NA 2QUUA 3JS3A 1SO5A 2DORA 1AW1A 3G8RA 5CPMA 1F2JA 3DGRA 1G4TA 4IJBA 4S1FA 1KBIA 1NEYA 3INPA 4NXKA 3HQ1A 4JY8A 4JICA 5CSRA 1GVSA 3GX9A 4IXHA 5AOUA 3NQFA 1W3IA 1SZFA 2CZ5A 1R46A 2PC4A 3M5VA 2NX3A 1OFOA 2QF7A 5DLCA 5KZDA 2ZZ6A 1OYCA 5BMWA 3SIZA 3BLEA 3GK0A 4JYFA 4C1LA 3HG2A 2NLIA 3WK0A 4Z1BA 1JCLA 5LNVA 2NX1A 3IIOA 1FWTA 3L5MA 4ICNA 1W3NA 4X3ZA 3NQMA 1H62A 4NJGA 2XN0A 3HG4A 4GXMA 4NZFA 3ATZA 1FUYA 4R34A 1OJXA 3C2FA 3HPZA 4JR5A 3B4UA 1X8FA 2QCHA 4GRSA 1ZNNA 3RLVA 3W7OA 3M5XA 1OFBA 1TPH1 2E1DA 2NV1A 2VXNA 3G8EA 2QAPA 5AC7A 5CSSA 4Z1DA 4PL1A 3BGGA 4K6AA 4O15A 2VFHA 3GVGA 2ABBA 4FX7A 2E09A 2FPYA 3M9YA 1TPFA 3MWAA 2H3DA 2ZTJA 3DBPA 1I2RA 3W1PA 3R13A 2GVLA 2V30A 3CIWA 1BWKA 4C1KA 1I2NA 3STCA 2TYSA 4CQAA 1VLWA 4DF0A 3MI3A 2C14A 3P7YA 5AN7A 2J9ZA 2QUTA 4DELA 3LERA 2WSRA 1OABA 4MY1A 1ZY9A 3A24A 3W7QA 1VZWA 5FF0A 3M5ZA 2X16A 3QW3A 1A5BA 3LHVA 3Q2DA 2FJKA 4N2YA 1GVOA 4DEFA 3TSDA 1ZCOA 3F4WA 4JTSA 1FY6A 5HUPA 3TH6A 4MFEA 2YYTA 1UUOA 3GYEA 2VC6A 1XXXA 3TX9A 4MZ8A 3DKLA 4Y8FA 2CLFA 4IMCA 1YPIA 3QRHA 4ADUA 4GBUA 4AHPA 1P4CA 1F73A 5F2MA 3KHJA 2Z6JA 3QMRA 2GUUA 4I7VA 2BZNA 2YCEA 3PSVA 2QCEA 1CW2A 5EA9A 1SO6A 5TQLA 3DFTA 1F5ZA 4LC6A 5AHIA 3TR2A 5DY3A 4Q33A 1SFJA 1K7XA 4UFKA 1H1ZA 5K9CA 3DFQA 1UB3A 3NG3A 4A21A 4AWUA 3HPSA 1TIMA 2DZXA 3NZ1A 4O17A 3H53A 3C2EA 4FX6M 4LY8A 1MEHA 2VELA 5K4ZA 3TW6A 1SPQA 2DP3A 2W0UA 5D02A 1VRDA 2FDSA 1LOLA 4OBTA 1VHCA 3ZFHA 4OV9A 4UFHA 2CW6A 3TMQA 3CU2A 4WUIA 5D2VA 4EF8A 2EHHA 3W22A 3O07A 3CQ0A 1JCJA 5EMUA 2PRLA 3LLDA 3TKFA 1AW2A 3L67A 3B03A 4K7VA 1DORA 4EVZA 4O0ZA 3O15A 3W73A 2PURA 2OMAA 1IXPA 3NNTA 2BLEA 1R47A 3LBMA 1LP6A 1O60A 1W5MA 2NWRA 3IGSA 1U5JA 1TQJA 2BXVA 1OFAA 2JKPA 1UBSA 3NL5A 3S9YA 3DAQA 2WJZA 4I9AA 2H90A 3GKAA 4DPQA 5CZJA 1H7NA 1SO3A 2C13A 5C2XA 4GUIA 2P1FA 5LHEA 4RZ6A 3W74A 2NUYA 1FCVA 3B0VC 1AK5A 2QJGA 3P84A 1GG1A 5K9DA 4M6PA 4A3UA 4CCDA 1JRBA 1QWGA 2BSLA 2DJLA 2ZRUA 3W2KA 5TBOA 3ZS4A 3FKRA 1IIHA 3GNDA 3EB2A 2TRSA 4GNJA 1OYBA 2EGZA 1FWWA 4AF0B 5AHFA 1JULA 4JIPA 1TCDA 2RDWA 3NQVA 4FIQA 4NQ1A 4FX8A 1GJPA 5J5DA 4UTUA 4WX2A 1U83A 5AHEA 3W86A 2F7FA 1XBVA 3N9SA 4CCEA 1VYPX 4IX0A 1GEQA 3ABQA 1DBTA 2A6NA 1VQTA 3PVFA 3GDTA 1YADA 3EXTA 4AXKA 3LHTA 2VEIA 2YFOA 4S2BA 1N7KA 4CNOA 1HUVA 1K7FA 5KMYA 2ALDA 1EWEA 3MBFA 4BWLC 3LRKA 4RXFA 1DQWA 4JTTA 2YX0A 5AC8A 1EUAA 3GLCA 4JEQA 3S5ZA 3QQ1A 4ZQPA 1AW5A 1F7BA 5D2TA 5I3FA 3QZEA 1MEIA 3PY2A 4Q32A 1AG1O 4MJZA 1PVNA 4LVBA 3RNDA 4LNYA 5G1TA 3BW4A 5HMSA 3OHIA 4DF2A 4R7JA 4BI5A 1Q3NA 2A7NA 4H3DA 1H7RA 1LLWA 2GOUA 2QKFA 3SW6A 5IBXC 4ZQMA 5HR6A 3MP5A 4MKNA 2RKXA 3PBWA 1OF8A 1C9DA 3T78A 3D0CA 3GZ3A 4IPIA 2RHGA 4RKAA 4QQ3A 4XZ9A 4MVAA 1TO3A 5FEPA 1RZMA 3DFNA 4O1BA 2Y61A 2QDHA 3BG9A 3OEXA 5D2WA 1W0MA 4QSHA 4ALDA 1LROA 1L6SA 3ZWTA 2A7RA 5D37A 1OFQA 3W7JA 1H5YA 2FPVA 5D30A 2I1OA 1L2UA 3GDMA 2DZUA 5LNUA 1JUEA 2QJHA 4IPJA 1LBMA 3QW4B 1VR6A 1OFPA 7TIMA 4Z0JA 3C56A 1Z44A 3LV6A 1W5OA 1VJIA 3UWZA 3G22A 3L66A 3C8FA 2J6XA 3UZ5A 4RV8A 3DKJA 5CZ0A 3CM4A 3MBDA 1DHPA 2HSAA 1HL2A 4WY0B 3BPWA 4POCA 3IRDA 3QYQA 2B0MA 1A50A 4K8HA 2PRMA 3A21A 4UXDA 5CZSA 4M19A 5FESA 1NAL1 3G1SA 4UR8A 2NUXA 3RFAA 4GJ1A 3NR0A 2HMCA 2WO5A 4ZQCA 4QM1A 1UASA 2GVGA 3E96A 3NQCA 4FNUA 1DVJA 4JXCA 3NDOA 4AHQA 4X9SA 2WNNA 5HR7A 2ZRZA 4RZ4A 3W70A 4A2SA 4O1CA 4PA8A 3QSTA 1LM1A 2A4AA 3M1ZA 1YXYA 1Z48A 1LRQA 1XUZA 2Y62A 3QPYA 5G2WA 1BWLA 3MYOA 3WK3A 4Z0SA 3HPXA 3C0JA 1KA9F 3DI0A 3STFA 3GDKA 1OX5A 1G7VA 2G95A 4N9EA 1H50A 4NJIA 1DV7A 2QCFA 3QQ0A 5C55A 4JYDA 2CFFA 3W1MA 4UR7A 3CLMA 1WBHA 3SI9A 3K30A 1NF0A 2A0NA 2WSQA 2NV2A 1WA3A 3F1QA 3NQ7A 3BW3A 3NEVA 4QITA 1MO0A 3C61A 3OVRA 1SSGA 4GWEA 3G1YA 3L21A 4IX2A 5H91A 1FCUA 1O5KA 2X1SA 4HT3A 4X2RA 2CZFA 1LBLA 3UPWA 5F1UA 3P74A 2PRHA 3KVJA 3PG9A 4JX4A 3M6YA 4O53A 1O5XA 1TRDA 2E5DA 3L0GA 1I4NA 2C19A 4JGDA 5F2IA 3NL3A 4BWLA 2DJXA 1VS1A 5AHNA 2V2CA 3EX3A 3UYCA 3MP3A 2CU0A 2E6YA 1JQXA 3BLFA 2YR1A 1LORA 1NF7A 4JTLA 5HNRA 3O6CA 2ZZ7A 3DI1A 3V75A 1X7FA 5HUOA 1JCXA 5LGXA 1YTKA 2WQPA 3IVSA 5EKYA 3O6YX 1FDZA 5LNSA 1XL9A 4O18A 2TMDA 3MP4A 4E2BA 1Y0EA 3N19B 3IIXA 5F2GA 3VI2A 3W2MA 4UTMA 3EX4A 3CPRA 3W7NA 4WXZA 2ZZ2A 3UWUA 5FF7A 4PFMA 5KINA 1GPWA 3MO7A 1S3HA 4KFPA 3S1VA 1Z41A 2OZ0A 1QFEA 3IEBA 2ISSA 4QIUA 4E2DA 1RV8A 2VOMA 3LGEA 3NYZA 4RJEA 3PBVA 1H61A 3HMJG 4UFIA 4JNMA 1TQXA 4JTJA 5D2XA 5K9XA 3EWZA 1M6JA 1OVDA 2H8ZA 4O52A 2ZRXA 4O1AA 3QH2A 2Y88A 2QCDA 2QEZA 3S1UA 4O19A 2ZYFA 3TC7A 2QR6A 2C1HA 3BG5A 3W07A 1K8YA 2B4GA 3FA5A 4LOCA 3E0IA 2A1YA 3GDLA 3O16A 3U6WA 3NL6A 2V0TA 1LLZA 2W6RA 3TMLA 3S5OA 1OF6A 3DFOA 4MLRA 1IIGA 2ZA3A 3ANYA 1G6CA 4MY8A 1XUUA 5EYWA 3WFAA 2A2IA 2B7OA 1ZAHA 1M7OA 1SUXA 1W8SA 2TPSA 2CZDA 3RF9A 3W1RA 1TTPA 2EAWA 1TYGA 1EA0A 3A9IA 2JKAA 2X2GA 4YL2A 1QMLA 4HIBA 4YWIA 4DO6A 1N8FA 4UTIA 3BLIA 2RFGA 3W87A 1HFBA 5HWJA 4JTIA 2ZZ4A 4K8EA 4W9TA 4IUOA 3CTLA 1KW1A 2H6RA 4N4QA 3NM3A 4LRTA 3TFXA 3LXCA 4RXGA 1JRCA 5DY2A 3M5YA 4A29A 4OQVA 4MPQA 4MJMA 3G24A 2BWGA 5LHFA 3PC0A 3B0PA 3FIGA 3TU9A 3THAA 1QPOA 4Y96A 3SGUA 1FCQA 1W56A 1RQEA 1YTDA 2E77A 3MMTA 1XI3A 5CKSA 1FCBA 4QNWA 3W85A 4OHQA 1THFD 1I2PA 3TCEA 1SO4A 1GTHA 3LHYA 3W84A 4TX9A 2VKZG 4AAJA 3T44A 3AJXA 4P61A 4HPJA 4OWGA 4BK9A 5D05A 4FNQA 4EWND 3HGJA 3HO8A 2ISWA 3LRMA 4JTGA 5CZTA 3OVPA 3R2GA 4WY0A 1KFCA 2DZPA 3NM1A 1B4EA 5A8GA 3PAJA 4O8RA 1QR7A 1XC4A 4NU7A 5EY5A 3C2RA 3PUDA 5E1QA 3RLUA 3TA6A 1GYLA 3SSJA 1S5WA 1G4PA 4NZJA 4JYEA 3A22A 1A5SA 1TTIA 4GC4A 3LXBA 2Y7GA 3UXDA 1GYNA 3EWWA 3P8JA 4LTSA 5C6MA 2C15A 3PSWA 3CC1A 3O1NA 4K37A 4XBKA 1G67A 1FWRA 5AYZA 4DBEA 3W71A 1UJPA 1J5TA 5H2ZA 4I7WA 1OX4B 4O1DA 3PWAA 4UCGA 1WQ5A 4ADTA 3NOEA 3NPVA 4WJEA 1TJRA 5HJLA 4PTNA 3P62A 1YDNA 5FEWA 3G18A 4M5PA 1L6WA 4A2RA 2A5HA 5KITA 1OYAA 3DHFA 2QJIA 2C0AA 1SZEA 3N2MA 4LW7A 3MHFA 3NQ8A 1CI1A 3NXFA 4ZL1A 2QUVA 4FNPA 4JS3A 4GUHA 5G2IA 5G4EA 3NPWA 4TO8A 1ME8A 1KM5A 2QCGA 4HHPA 5FF2A 3HGOA 1QOPA 4FNTA 2V5LA 3M7WA 1I2OA 3EX6A 4UTTA 1SW0A 2ZTKA 1WDWA 3B8DA 2Y7FA 3THQA 3NQDA 2WSYA 1RD5A 3GR8A 1A53A 4HSNA 2Y89A 4XBSA 1V7YA 3T40A 3NPXA 2F84A 3W6YA 3EX1A 3W7GA 2J27A 1R2SA 3T55A 1OFDA 4OT7A 1ONRA 4KFOA 1LRNA 1HG3A 3NQ2A 2R94A 2FLIA 1XFBA 3LDVA 5K2ZA 1YXDA 3FLUA 1I8JA 3O6DA 1K8ZA 4GFSA 1H63A 3I6RA 1AL8A 3MW7A 5FI8A 1YDVA 2FQIA 1KLZA 1EX5A 4NVTA 4UC5A 1N55A 3M47A 4FF7A 5I3JA 1GG0A 1FQ0A 5DXYA 2A85A 3GXNA 2NZLA 1Q6OA 3NQGA 4N02A 1GQNA 1ME9A 3UQNA 5BMXA 3G3MA 3PULA 4JTEA 4XQ6A 2ZBTA 4XWUA 2VFEA 2V2DA 3QMSA 3TSMA 3E02A 4HSOA 3IGXA 4BR1A 3I7QA 3TAOA 3F03K 4MY9A 2X30A 1WXJA 2DZTA 4CCCA 1TPC1 3VNDA 3DHDA 2Q3RA 2V8ZA 2VFIA 1CX9A 3TFCA 1T99A 2LLEA 1VPXA 3GXPA 5K4XA 2J88A 3M16A 3DFPA 2FIQA 5SWUA 4JTUA 3FYOA 1ML1A 1W31A 3CHVA 4R33A 2DU2A 5C54A 1MEWA 4S2CA 1YYAA 4IGHA 5C5YA 4RR4A 1GOXA 3FEMA 3S0CA 1WOBA 2Z2UA 2VEPA 1EWDA 3O06A 2G97A 3O8AA 2GQ8A 3H54A 4RK8A 4DF1A 3CIXA 4IMEA 3CWOX 3LLFA 3HB9A 1LOSA 3C2OA 1QO2A 1XDLA 1HO4A 3TROA 5F1VA 1Q45A 1K03A 5I3IA 2ZRVA 2QCDB 3OG3A 3L0KA 2VFFA 3GR7A 3L9CA 1OFEA 4ZVJA 3T7VA 3EKLA 1ZAIA 3FJ6A 3GDRA 3DU0A 4L4LA 1H51A 1TPEA 2XN2A 5D03A 4LS1A 2ZFAA 2V81A 3LB0A 3B0UX 3ATYA 3C3NA 1VYSX 1VC4A 3W7CA 4MFDA 1A5CA 4NJKA 1JCYA 4UTKA 3LHZA 3VE7A 4TMCA 3M44A 1R30A 3FYPA 1W1ZA 3L2IA 4QNEA 1TSIA 1R2RA 3KFTA 4X22A 3W76A 1QOQA 3LX9A 4N9BA 1LZOA 1SZNA 1OX6A 2WOQA 2A7PA 2PE4A 1W37A 4JD4A 2RH9A 4JX5A 1KFJA 3UD6A 3VCRA 5FEXA 3MJYA 3SFKA 3KVKA 3Q58A 1QPNA 4RZ5A 4ZQOA 4GUGA 3GB6A 4IWWA 3V1PA 3W1LA 2OT0A 1ZHAA 4ORIA 1IGSA 1F6PA 1ALDA 3HG5A 3WJWA 2Y85A 1LOQA 4KKXA 4JX6A 3SR7A 3U8GA 2ZZ3A 1YPFA 3C2VA 1KM1A 1TPB1 3S5NA 3I68A 4RX0A 4Y9AA 4AHOA 2GPTA 2TSYA 4O54A 2WPBA 2Q8ZA 1YXCA 5F4WA 3YPIA 2R8WA 2EKCA 1PS9A 2PCQA 4FXRA 1KM2A 4O28A 2EF9A 4ZQRA 1Q6LA 4MIMA 5EPDA 3MUXA 4YXGA 4JIQA 5AHMA 2C16A 4UTWC 2GQ9A 1WYIA 1RPXA 3G1VA 4NJHA 1OX4A 1ICPA 1TPWA 3F4NA 3PB2A 4MLJA 1LDCA 2YSWA 1EUNA 3CEUA 1AL7A 3C4UA 2O7SA 1P0KA 1FWNA 1QPRA 2J9YA 4YMZA 4AWTA 4LVAA 3R89A 1SU5A 2AQWA 3BV4A 2OJPA 3LXAA 4U28A 1HTIA 2ABAA 3Q37A 3NQAA 4LVFA 1SW3A 2AAMA 5DELA 4KFNA 4PEKA 1VCGA 1H7WA 3H55A 3B05A 5D09A 3P5ZA 4ZMGA 1KTNA 1KFBA 5LZLA 3UWQA 3KX6A 1KFKA 3S1XA 5G5IA 3FOKA 5D2YA 2BX7A 2I14A 3DZ1A 4MYAA 1B9BA 3PF3A 3DFSA 3EWYA 3G1FA 4NNBA 5DCDA 1G4EA 2Z1BA 1QDSA 1OG0A 2CLLA 4AEOA 3UNDA 2Q3OA 4CLMA 3CT7A 4GUJA 4K36A 2WNZA 4O0KA 5F4SA 3NL2A 3R5EA 2NUWA 3LI0A 3LCXA 4UFLA 4EIVA 1X1OA 3QSRA 5LSMA 4JDBA 4M6QA 4LUIA 1W5NA 1JCNA 1ICSA 4O57A 4EOUA 4KWWA 5J5RA 4XUGA 1JR1A 3JRKA 3PUEA 2J9XA 4AWSA 5AYXA 4UNKA 4Z1AA 1HO1A 1MXSA 4O50A 1KV8A 4QJ1A 4YCPA 3LCGA 1QNVA 5KZMA 3RK8A 3TJLA 1BEUA 5E93A 3C52A 4UTHA 4WZHA 4XTDA 1KM6A 5D33A 1DOSA 5DBUA 1EIXA 4UTLA 1EB3A 1QO5A 1GTEA 1TREA 4H4IA 3G0SA 3P82A 3EEGA 3QJAA 3KRSA 6TIMA 3LM7A 2G96A 3OA3A 4UTTC 5HWMA 2QDGA 3QC3A 3BW2A 3G1XA 3HGRA 1F05A 4DBDA 4ORMA 2OCZA 3MI2A 2RDTA 1TRIA 3W7EA 2Y6ZA 3HOJA 4QAIA 3W1UA 2FTPA 3W7IA 3AO0A 3A23A 2VEKA 1PV8A 3ZR4A 1FXPA 4TR9A 3UWYA 2ZRYA 4ADSA 4JY9A 4P2VA 1RQHA 3HIJA 4IMGA 3OVQA 3ABSA 4WXYA 3MHUA 5ABTA 2V82A 3FFSA 2YW4A 3EKZA 1X6UA 3S42A 3WK2A 2ZQ0A 3W3OA 1C29A 2E5BA 1MZHA 4O16A 3TE9A 1KM0A 2CLKA 4PC8A 4AVFA 3LI1A 1VCFA 3G0XA 3W7DA 3UY8A 5CPOA 3KVMA 1XCFA 1IXOA 3E12A 2I9EA 3KVLA 1PHWA 1Z42A 5EBUA 1S5TA 5G4WA 3BK0A 3R8RA 3HG3A 2Y7EA 3TXZA 2VEMA 3IVTA 4YCOA 1JUBA 4NXSA 1PE1A 2FPTA 2WKJA 1H60A 2VFDA 1A5AA 1GT8A 1SFLA 1I2QA 5I3GA 3LCHA 4N6EA 3N9RA 1G4SA 4WOQA 4HN4A 4A22A 2ATMA 3QFEA 4LUJA 4Y90A 2ZZ5A 1TB3A 4UTWA 3BVJA 4FXSA 3W1XA 4UUIA 1DQXA 4ZZ9A 4UFMA 3UXAA 2GQAA 2YYUA 3CWNA 4L4MA 4OV4A 2NX9A 5F4XA 1YTEA 1W5PA 4XKYA 3MI6A 3UWVA 2YFNA 3P81A 4MUZA 4OE7A 1V5XA 3TSBA 4FEZA 5I3HA 1ZJIA 3TJXA 1O94A 2Y7DA 4TU1A 5LNWA 1FXQA 2BTMA 4LV9A 2X1TA 4IMFA 3P80A 2D73A 4O12A 4D2JA 1TPDA 1WBJA 4TMBA 2HS6A 2Z6IA 4NNCA 3RMJA 4HKPA 2C6QA 3E49A 4DO4A 3P60A 4AMAA 3W7KA 2G5WA 3OBKA 3PUOA 3LBCA 1K3UA 3G1DA 1FWSA 3SZ8A 1YDOA 2NXHA 5D04C 2JKEA 5HULA 5E0KA 2DZVA 1H7OA 3EXRA 1IXQA 3GAKA 4GE8A 5K3VA 2W79A 1PCKA 2JGYA 3TW7A 5BNKA 3KOFA 3HBLA 3W7RA 3NA8A 3TXVA 3FJLA 1K7EA 4JTHA 1JUKA 1IXNA 2E6AA 2H8XA 3SY5A 3EWXA 3VE9A 1OFRA 1TV5A 1TTQA 4NUWA 4WOZA 5CGQA 3DH7A 4QISA 4UTJA 3N14A 2OT1A 1H1YA 3T4CA 1KTCA 5F2LA 1E51A 4WD0A 1FDYA 1LTDA 1F74A 6ALDA 3HJZA 4K39A 3W72A 5A5WA 1O4UA 2WV8A 1AMKA 3ZWSA 4JTKA 2OX1A 1SQ7A 4JN6A 1W54A 2J24A 1FX6A 3A5FA 3TIMA 5G1YA 2HTMA 3NQ6A 3PG8A 3CB8A 1G69A 1ICQA 3MHGA 3LTSA 3WK1A 1D3HA 1LRTA 3TK7A 2FB3A 5AHLA 4E0CA 1WV2A 1ADOA 3NGJA 3GAYA 3W9ZA 1VLIA 4XTIA 1P5BA 4ONVA 2YGYA 1QAPA 2EPHA 4M7SA 1TPVA 1B3OA 2Y63A 5GVJA 5DBTA 4AB4A 4G1KA 3TQKA 3M0ZA 3L65A 1KTBA 1W5QA 4UMAA 1IF2A 1NFBA 3SECA 5KZEA 5EL1A 3O63A 1O95A 3STGA 3PB0A 1D3GA 4LVGA 1F76A 4PODA 4I7UA 3WJYA 1PHQA 2JGQA 3I7RA 1R2TA 3W2LA 4OGZA 4NNAA 1QCWA 3S5YA 5TIMA 2AGKA 3W7LA 2R91A 4GUFA 3USBA 3TQVA 3NO5A 4FHAA 1PL9A 3G1HA 2RDUA 5LNRA 1W3TA 3JR2A 5DXXA 4AH7A 1PCWA 1B4KA 3IV3A 3KRUA 2X1RA 5HWNA 1ZALA 4EF9A 3LHUA 1S5VA 1KFLA 2GJNA 3GXTA 3U2OA 1NVMA 3W88A 3MYPA 1LYXA 1JQVA 4UFJA 3L5LA 4JTFA 4RCXA 3W1QA 1NSJA 3W1TA 4H6KA 2CLMA 3LCFA 3DXIA 1VGAA 1KBJA 1QPQA 3TUUA 1GVFA 5T26A 5L9FA 2XFWA 2QCCA 4ML9A 5KSWA 4M7TA 1T0OA 3A5VA 4R53A 3IGUA 1TV8A 1T96A 2NXIA 4CQ8A 1GVQA 4IMDA 4HPXA 3N2XA 1TMHA 2ATSA
chains in the Genus database with same CATH superfamily
2REQA 3E2VA 5I3DA 3PZQA 1I45A 3HU7A 2V3DA 3BTNA 2E5CA 2BY3A 1RQBA 2QCMA 2R14A 3UZJA 3W7PA 2DZBA 4Q8QA 5D32A 4IPNB 2CHNA 1L9WA 5AYYA 2E40A 3EA2A 5CPQA 2PS2A 3ABRA 1SZGA 5A8QA 1OHLA 4HZ6A 2YA2A 1D8CA 3L5AA 3QF0A 2YPIA 4MOZA 1EDTA 4LYPA 2G4JA 3GHSA 1KNWA 3LCIA 3UEQA 1T40A 3VFLA 1E56A 4C6LA 4U4MA 4HSHA 2YZRA 4YLWA 2W27A 2KZHA 2Z1WA 3TDFA 3RAOA 3SJNA 3VZYA 3BXWA 4C65A 2XGIA 3B06A 4K38A 3TNOA 2HE8A 6ENLA 1EC8A 5B80A 1EEPA 3TC6A 1JJKA 4MNKA 2Q09A 2J74A 2JIEA 4JBRA 4OJYA 5K7JA 4XKYB 1RK5A 1TV7A 5G2HA 2GDUA 4F8XA 3HN3A 1B2YA 3AUJA 7REQA 4G2DA 4FIRA 5AC6A 3M43A 4AMCA 3GW3A 5FF4A 3KEHA 2ZUTA 4EP8C 3HF3A 3EWBX 2ZZ1A 1ZFJA 3VK5A 2HK0A 1UR2A 2GJLA 2FB2A 3IIVA 3SGZA 4DXVA 3CZLA 1T41A 5D38A 4I8DA 4O13A 2HCVA 2QHAA 3BO9A 1Q6CA 2Y2WA 1E4LA 4R9XA 2DVTA 5CSUA 1ZENA 2FFIA 1ME7A 2Q8XA 3RN6A 2G3NA 1LBFA 5I78A 4AIEA 5BXSA 2INEA 1CPUA 3ZT6A 3WY1A 2EEXA 1SFSA 1F8IA 1KKRA 3F5LA 4MZYA 3W7HA 3HV8A 3CGTA 4EACA 4LC8A 3UVAA 3TWBA 2VGBA 1AH0A 4PR4A 1EXPA 3BGJA 2B7PA 5BRPA 3T0AA 2QCNA 3BARA 4IXXA 2CWNA 2Y5SA 1TTJA 1BTMA 4DVOA 1EPXA 2E3ZA 5G4HC 4HD5A 1OC5A 3VGEA 2X1UA 4A8LA 5EGRA 1XKYA 2VOTA 2QGHA 1OK4A 5BWFA 1JFHA 1S38A 3K8LA 4QLKA 1G7UA 1X1ZA 1XLCA 3DYOA 3PP7A 3APTA 3PBGA 3FA4A 4W7VA 2X0SA 3W75A 3OLGA 3GS6A 2UV8G 3L4WA 3QPZA 4H9UA 5MKGA 1J93A 4FNSA 3L68A 4LV4A 4INFA 1ISVA 3RM9A 3S6DA 3BDKA 1GHSA 1POJA 2D20A 1BSLA 4BI7A 5KEZA 4UNLA 3LG3A 4PMZA 5E9XA 1MDLA 3T81A 3I65A 4FZIA 4B4FA 4M24A 4IUGA 3SY8A 4IP5A 5DQPA 2G3FA 3ELFA 1C93A 3BZGA 4JDYA 3SUVA 2CZEA 1HIZA 3URQA 3ITXA 4D71A 3ZMRA 3BG3A 4GD0A 2C71A 2PDXA 4A3HA 4LS0A 3L4XA 3A3WA 3RLHA 4MM1A 4NAFB 1DJNA 4DQWA 1TV2A 4P8WA 1C8XA 2CLHA 1DQUA 3PBYA 4DXXA 1DIOA 1UR0A 3IVUA 3AC0A 4OU1A 4KEUA 1ZPTA 4QTGA 1JD9A 1Q6QA 3VD5A 3N34A 2QLYA 3OG2A 5HNTA 4NX0A 4WDWA 2DT3A 2PFHA 5HPOA 1J18A 4ZOCA 1KRMA 2YXGA 3KAOA 3W1NA 1SO5A 2DORA 3CO4A 3T8LA 3G8RA 3WEMA 3DGRA 1O6IA 4S1FA 3MUIA 4YVPA 3HQ1A 6PTDA 1BLIA 4HJFA 2AGTA 2UY2A 3PZGA 3VIMA 1L0PA 1KCKA 2F6XA 5AOUA 3NQFA 4IIHA 4IG2A 4WEVX 2PC4A 2NX3A 1OYCA 3SIZA 3BLEA 4JYFA 3HG2A 4KCTA 3WLKX 3L5MA 1E0WA 1R3TA 1W3NA 2XN0A 3HG4A 3KOXA 1OJXA 3C2FA 4Q7NA 3B4UA 4FF5A 5B7YA 4PCSA 3RYSA 3GNRA 2NV1A 4PGLA 5HOSA 2XG9A 2QAPA 4ZO8A 3VD3A 5CSSA 5A6AA 4Z1DA 4PL1A 3BSHA 5AVNA 4O15A 4FX7A 1PKYA 2E1WA 1J0IA 3MWAA 3T0DA 2WM0A 5MF5A 3E74A 3B4YA 1OADA 3WQOA 1HGWA 1A47A 1BWKA 3P0WA 2AQOA 4XAPA 1ZGDA 2HBVA 3SY1A 3M4HA 3MI3A 2QUTA 4PMOA 3LERA 5IDZA 1NU5A 2XIBA 5AC5A 1ONWA 2BMBA 2X16A 3Q2DA 4AIOA 3QGVA 1GVOA 4DEFA 4L9XA 3TSDA 1ZCOA 3F4WA 3GW0A 4PRRA 1SJAA 3ITGA 4LAZA 4B90A 1XW8A 2I5QA 3NGFA 4GA8A 1XP3A 2VC6A 3F4CA 4MZ8A 4Y8FA 1PO9A 4IMCA 4H9MA 4ADUA 2W91A 4GBUA 4HYWA 5F2MA 3RCYA 2Z6JA 3QMRA 2FZBA 4KBXA 2BZNA 3BURA 1EPVA 2QCEA 4D6IA 1N82A 5EA9A 5TQLA 4MDOA 1F5ZA 3MKVA 5DY3A 4Q33A 1G0CA 3WH7A 1M1BA 2C91A 2V69A 3NG3A 1PXGA 4A21A 2ZX5A 5I24A 1BRLA 4PTVA 1X39A 2GK1A 4LY8A 4CEUC 3IJ9A 4YHGA 3RM8A 3R10A 2R6OA 4WJXA 5D02A 4OECA 5B7ZA 4UFHA 4JL1A 3TMQA 4ZR8A 2CIPA 2P8BA 2CLPA 3CV2A 5I06A 1XYFA 3ABZA 4UOZA 1AW2A 3L67A 4K7VA 1KD0A 4W87A 4O0ZA 5MKGB 2PURA 4M6UA 2OMAA 1IXPA 3NNTA 3SUUA 1E4IA 3WDJA 3LBMA 3KBSA 1W5MA 3R58A 1U5JA 1TQJA 1EYWA 2YJQA 2XH4A 2JKPA 3LQGA 1EGVA 4DZAA 2WJZA 5E70A 4WKHA 2Z28A 1ITQA 2H90A 2WMHA 1M3UA 3GKAA 1AJ0A 5CZJA 1W9PA 3E1F1 1SO3A 1K9FA 6CGTA 4U2ZA 5LHEA 4RZ6A 3W74A 1FCVA 3B0VC 3WQ8A 3NSMA 1AK5A 3P84A 5TNVA 5DMNA 2BSLA 1BYAA 2DJLA 1TZZA 5TBOA 3FKRA 3NOYA 2F38A 1IIHA 4I9MA 4XISA 1FWWA 3QLDA 6REQA 3QXBA 2O9OA 1UD5A 4FIQA 2XGBA 5J5DA 4IP4A 1A3WA 1R9YA 1UD4A 1EBGA 3R43A 4WX2A 5AHEA 3STPA 5I5RA 3W86A 4C6EA 2F7FA 3H2AA 1YRRA 3N9SA 3BUVA 3ORWA 4IX0A 1GEQA 1DBTA 4AVNA 1WDQA 3GDTA 4AXKA 3AYRA 1S2TA 2W5FA 4WJ8A 2PEVA 2ZXDA 4S2BA 1MXDA 3UESA 1XD0A 3T09A 4RXFA 1DQWA 5AC8A 2D0HA 3G6MA 1IEIA 5JIPA 5CPSA 2P76A 1TKKA 1F7BA 1ZS2A 3U2CA 4K68A 1XINA 4F4RA 1XQLA 4Q32A 2WHKA 1AG1O 3VOCA 3RNDA 2WMIA 4LNYA 1IYXA 3OHIA 4IG2B 4BI5A 1B1YA 2A7NA 1WDRA 3IJLA 3SW6A 4G1NA 3SADA 1JDDA 4ZQMA 5HR6A 3MP5A 1D8WA 1E0XA 1W2PA 3GZ3A 4QQ3A 2PDYA 3K4AA 2IQDA 2PDKA 1W0MA 1LROA 1E9ZB 1VFTA 1H5YA 5J04A 3V1HA 2RDXA 3LENA 3GDMA 5LNUA 4CQCA 2F6KA 1FFQA 1LBMA 1OFPA 2VD9A 1BYBA 3UWZA 4C6BA 4YNGA 1CB2A 3L66A 1W3JA 2J6XA 3WQCA 4RV8A 4GVGA 3DCPA 5CZ0A 3CM4A 3C86A 1DHPA 3SB0A 4WY0B 1L8NA 5CLWA 3QBUA 1XX1A 3CQIA 3SRFA 4K8HA 4UXDA 1I0BA 4UR8A 1B3VA 1XIGA 4F66A 4HOWA 3AICA 4ZE5A 2HMCA 2WO5A 2PDFA 3WLMA 2F2KA 1UIPA 3NQCA 4J3TA 1UR9A 4QDWA 4JXCA 2PWHA 4R7WA 5HR7A 2ZRZA 2I57A 3QSTA 4GIAA 3R8HA 4UQ9A 2E8YA 3SUTA 1LRQA 3PZTA 3BLLA 5G2WA 1BWLA 1BRLB 3I6EA 4FK9A 1QW7A 4Z0SA 3HPXA 2GK1B 3C0JA 1G7VA 4J3UA 2WMKA 2DH2A 3BAKA 4EAYA 1IQ8A 3CLMA 2VGIA 1WBHA 1SR0A 3SI9A 1JFXA 4URIA 3K30A 1TWDA 3P2VA 3CK5A 2WSQA 2NV2A 2G41A 1WA3A 3F1QA 3CMJA 4ICCX 4L56A 4R7OA 4PYSA 1X6NA 2CXGA 5H91A 3TTOA 1YW1A 2VWSA 4AY1A 3P74A 5H6HA 2PRHA 4HBKA 3VNLA 3T42A 1Y8BA 3M6YA 3OZYA 3N3TA 3H6OA 4BWLA 4DIAA 3LUTA 1VS1A 3N11A 3WQFA 4AY8A 4JNYA 2ICSA 2CU0A 4TX8A 1V3HA 4NKCA 4FI4A 2CBUA 4LFYA 3MCNA 4F0MA 1X7FA 3GVQA 3VGHA 2CBJA 1YTKA 4IL0A 5LGXA 3MO4A 1GQKA 1JGMA 5EKYA 4HVXA 1ZZMA 3O6YX 1FDZA 2PI6A 5LNSA 1BHGA 3WELA 4UCFA 4B92A 2FJUB 2WKLA 4UTMA 3EX4A 3LNMA 3CPRA 1CCWB 3W7NA 2Y0FA 6REQB 4BEUA 1GPWA 1VJSA 2XJ7A 1QFEA 3IEBA 7CGTA 2ISSA 1Z9AA 4QIUA 4E2DA 3ZM8A 1S5NA 1ITUA 5CBBA 4H1ZA 4FP1A 1DWGM 2ZE0A 5FA5A 3HMJG 3EWZA 1EHNA 2X0HA 4MSSA 4O1AA 2A3LA 3MUZ1 3S1UA 4GYKA 4IJCA 1XC6A 2QR6A 2X7VA 2VMFA 2VC9A 3B9AA 1YNYA 2B4GA 4LOCA 4WR3A 2A1YA 3NL6A 3OGVA 1G5AA 1QT1A 3DFOA 4MLRA 1IIGA 1XISA 4MY8A 4L4PA 3DGBA 1V8EA 3WFAA 1ZAHA 4RNIA 3ZO9A 3L23A 3FK4A 1W8SA 3HV9A 3W1RA 4HB7A 2EAWA 1TYGA 4LBUA 1QMLA 2WMIB 3BLIA 3WLHA 4IJRA 4C6IA 4GACA 4H04A 1O1ZA 4NZ5A 4E6MA 4DZIA 4U5IA 2BXZA 3CTLA 4N4QA 1VAHA 3NM3A 3I6TA 4XUYA 4WSKA 3S47A 4W8LA 1UWRA 3LD5A 3WL0A 3WF3A 3G24A 3QOKA 1EF3A 1EZ2A 3BCFA 1VRXA 3B0PA 3IJIA 2O9RA 4DJFC 1YTDA 2E77A 3MMTA 4O8AA 3A9BA 1FCBA 3BL3A 4XK2A 3LZ5A 3K1DA 4E2VA 1GTHA 3UG8A 3AJXA 1BG4A 3EDEA 1IR1A 3ONBA 4HPJA 3LU2A 3CB3A 1ECEA 1F3EA 2XWEA 2GYIA 2ZXBA 4JQ1A 5A8GA 3N2OA 1M65A 2JFEX 4P7RA 3W0KA 5EY5A 3CHDA 3RLUA 3TA6A 1ECQA 3FA3A 2PDPA 2OFJA 4NZJA 1XYLA 3A22A 4WHBA 5JUVA 2Y7GA 2G50A 3P8JA 4LTSA 5C6MA 3MKKA 4K37A 1LWIA 1FWBC 1C8QA 4W84A 1J11A 1YE4A 4UCGA 3MCOA 5HJLA 3G18A 4DUOA 2GJXA 5A95A 5KZ6A 1ONXA 2BV9A 2DUZA 4GH1A 4KEMA 3OZMA 3QV8A 2OQYA 3N2MA 1GK8A 3NXFA 4ZL1A 3VA8A 5A6KA 2QUVA 4FNPA 3H2NA 3MQTA 4CN1A 2GGGA 3RPTA 2QCGA 2GVEA 3HGOA 2PA6A 1UR4A 3N2CA 3KHDA 3WDHA 1E3XA 1I2OA 3EX6A 2PDHA 1SW0A 2ZTKA 4KWUA 4W8BA 4KETA 5HATA 4YYFA 2HWGA 3NPXA 2D0GA 4ML4A 4YVVA 3H22A 4C6OA 5FL0A 1HG3A 2PUZA 1XIBA 2R94A 1JZ6A 4AUBA 4FXFA 1R85A 4GFSA 1H63A 1AL8A 1UKPA 2VVSA 1YDVA 3KLLA 2EKGA 4FF7A 2PWUA 4Y8EA 4F0LA 1NWRA 1W1B1 3GXNA 1IR2A 1GQNA 1UWAA 4Q6XA 2NW0A 4JTEA 3CWHA 1C7SA 3A4JA 3LMYA 2VFEA 3E02A 4YTQA 3TAOA 1K9DA 2QW5A 1NWTA 4CCCA 2OLSA 3VNDA 2Q3RA 2J6VA 3WUGA 3ID7A 3TFCA 3LM3A 1RALA 3ITVA 4XD6A 1XLMA 3GQYA 2FIQA 5C0QA 4S3AA 1EYEA 4RE2A 3CHVA 1NQKA 2WSKA 3RR4A 2XU2A 4L64A 4W5ZA 1AD4A 4RR4A 1GOXA 1WOBA 2PTXA 2PWEA 2Z2UA 3FY1A 1DIDA 1F4HA 4DYKA 1E9IA 3NTYA 4YTRA 1WO2A 1E1CA 4DI8A 2VVNA 1QO2A 1XDLA 2ZUVA 3CNYA 4O1EA 2ACSA 3WDQA 5DMMA 1E9YB 3OG3A 2VFFA 2JQXA 3B3DA 3L9CA 4J3SA 2C1IA 1AJZA 1FWGC 2RJHA 3GDRA 3IJ8A 5BROA 4L4LA 1DJXA 2XN2A 5CSYA 3RX2A 3FW6A 4L61A 5DF0A 3OZOA 2PLKA 1A5CA 4OOUA 1UD2A 3KS5A 4ZE4A 4LCSA 2DQXA 1R2RA 7TAAA 1B30A 3KFTA 2VL4A 5ECVA 3MSRA 4N9BA 1E71M 1LZOA 3G6LA 3HQNA 2CWXA 3EEZA 2E8ZA 4ECLA 3B40A 3GBDA 2BNJA 4JD4A 3U5UA 4JFSA 3ITTA 4PBEA 2O55A 3AXXA 3Q58A 1QPNA 1ZP3A 4QAWA 4IWWA 1JIBA 2HPMA 1UH4A 4ORIA 1AH4A 3ARXA 1ALDA 4DZHA 3HG5A 1UQZA 3VDGA 1C7TA 3SR7A 3VIGA 3U8GA 2ZZ3A 1KM1A 1TPB1 3S5NA 4H7VA 3I68A 2PWVA 2GPTA 2TSYA 1SVDA 2YKKA 2DIJA 1R3RA 1YXCA 4JN7A 2EKCA 1PS9A 4L1XA 1VFHA 2QMKA 3BQ5A 2V5JA 5RUBA 4FXRA 4A8IA 3QHNA 2A3EA 3MSYA 5EPDA 4XSLA 1UC5A 2XINA 2GQ9A 1DWAM 3G1VA 4NJHA 4IFKA 1OX4A 4PUMA 3GE7A 4ZODA 1TPWA 1EEXA 1VBUA 2YSWA 3LEPA 3D3FA 1FWNA 1XRVA 4LVAA 4GBDA 3EOLA 1SU5A 1FHUA 4H8VA 2OJPA 4U28A 2WYSA 1HTIA 3Q37A 3NQAA 5BOEA 2BS9A 4KFNA 3OYZA 3USZA 4AZIA 4HN8A 5A6BA 4YTUA 2PLJA 3GY1A 1LF1A 3KX6A 3G77A 1KFKA 1UA7A 3OBAA 4S3FA 2I14A 4D6CA 3KOZA 1J12A 1OQFA 2EO7A 1TJ1A 3G1FA 4NNBA 3FXGA 1R3QA 2XTKA 2Z1BA 1OG0A 3H2MA 3UNDA 4K36A 4L1GA 3CPGA 3NL2A 3LCXA 4GFIA 1UIOA 2G3IA 9RUBA 2OYKA 1H5VA 4P8UA 1ICSA 3WQPA 4Q22A 4LY4A 4KWWA 4C5YA 2OO0A 2YXXA 4HJWA 3JRKA 2UBPC 2P53A 5HANA 3FSUA 4ERAA 4UNKA 4Z1AA 1KV8A 3HQPA 3WLIA 4YCPA 4X0NA 2WHMA 4KRZA 4A3RA 5KZMA 3RK8A 4GVHA 2WAGA 1UMYA 4L6OA 1DIEA 3KOWA 1KCZA 1VF8A 4JTAA 3EWDA 4XTDA 5JH1A 1KM6A 5D33A 1DOSA 4UTLA 4J3WA 4P8XA 3TYAA 1TREA 1EA9C 2EPLX 3LM7A 1BAGA 3OA3A 4M80A 2XFFA 3OBEA 3CQKA 2QDGA 3G1XA 3HGRA 3RHGA 3SCSA 4HA1A 4GJIA 2OCZA 1R0MA 1TRIA 5CAHA 3EMZA 4G9PA 3G1RA 1TG7A 1QHZA 4MG4A 2VEKA 1SFTA 3UWYA 4ADSA 4JY9A 1RQHA 3HIJA 2OZTA 5M5DA 3GXDA 3SIMA 3WLJA 3UXLA 5HQLA 4NYYA 5E0CA 5D9MA 1CGVA 4J35A 3DG7A 5EFFA 1PX4A 3RO6A 4KCWA 3G0XA 4MB1A 3W7DA 4BQ5A 4J5NA 1IXOA 1E1CB 3E12A 2VDGA 1K9EA 1S5TA 1A3HA 4XG1A 1XG3A 2X2YA 1P0EA 2VEMA 3TXZA 1BYCA 3IVTA 3QZAA 5AECA 2PBOA 4YCOA 5JH2A 4EK7A 3ZJ7A 3LCHA 4LB3A 1A80A 4Z2IA 2J8FA 4W7WA 3KL3A 4N6EA 1Q7ZA 1CT5A 4LXFA 3UZYA 1FHDA 4V27A 1QNQA 3QFEA 3REQA 4Y90A 2PTYA 2C79A 4ZZ9A 2OSXA 2YA0A 4HA0A 2CBIA 1TA3A 4GKLA 4PUNA 2YYUA 3CWNA 4ZBCA 4TTGA 4GY7A 3I4KA 4JQAA 1W5PA 3UWVA 3GH7A 4I8YA 3TSBA 3W28A 1FVPA 3URNA 1GKPA 1UKOA 1FXQA 1Y5WA 5D8ZA 1D7FA 4IM4A 4LV9A 3WBXA 3P80A 3QV6A 2WXDM 2QJMA 3URBA 4TV6A 2Z6IA 4NNCA 1PTDA 3LNPA 3VDCA 1DP0A 4HKPA 1PDZA 1UP0A 4AC7C 1UP2A 1V03A 3P60A 4GGHA 3W7KA 3AS0A 5FAJA 1O7AA 1YDOA 3BOLA 5D04C 2OOGA 3WF4A 1H7OA 3EXRA 2XSXA 2WPGA 2FGZA 4B9ZA 3TC3A 3R0UA 2W79A 4GQ0A 4DJDA 3SCPA 1E9LA 2Z1SA 1F61A 3UGVA 2NVAA 5BNKA 3DUGA 4NP7A 2PP1A 3NA8A 1KXQA 1K7EA 1IXNA 2E6AA 1OFRA 1TTQA 3VX0A 1X1NA 3DG3A 1QHPA 1RP8A 4H41A 4WOZA 5CGQA 4Z2LA 4H9VA 4E8GA 1XIEA 2AOSA 5E6YA 3N14A 3CUZA 3PPHA 3SRHA 1E51A 4WD0A 3EGJA 1US0A 1LTDA 3FN9A 2OSWA 3UR5A 4UB9A 3UT0A 4DY1A 5HBFA 1PZ1A 1Q5MA 2DGAA 1XIIA 2WV8A 3GG1A 3UZWA 4P5UA 2OX1A 1SQ7A 2J24A 2HTMA 5BXTA 1JF6A 3PG8A 3UYIA 4RZBA 5E09A 1XLIA 5BXRA 4Q4SA 3MUCA 2D2JA 4QE1A 5A69A 4B2DA 4ONVA 1QAPA 1VFMA 5EMKA 5AZ0A 5GVJA 5DBTA 4AB4A 4E3VA 3TQKA 2UZ9A 1WB0A 3M0ZA 3CH0A 1W5QA 1A5UA 3P6LA 1MI3A 1O95A 4QGCA 2Z24A 1D3GA 1F76A 1OM0A 5E6ZA 4DUVA 5FAGA 1J10A 3I7RA 3W2LA 5EU9A 3VNIA 3S5YA 2GGIA 2AGKA 4X61A 5C9ZA 3NO5A 1PL9A 1ZBWA 3H4WA 5EB8A 3VC5A 5IRPA 1W3TA 3JR2A 4AH7A 3IV3A 3B9DA 2OTDA 1MMFA 2X1RA 5CH9A 3VOIA 3K8KA 1ZALA 2BGQA 3W82A 3VNYA 1LWHA 1F3WA 2OODA 4PFHA 3UETA 4DJED 4Y9OA 3E5PA 2UY3A 5EMYA 1NVMA 3U2OA 3LPFA 3MYPA 2ISDA 4MADA 1JQVA 1NFPA 1J0ZA 1RBAA 2CLMA 1LQ0A 1UWSA 3CV1A 2PU1A 1EF2A 5CXPA 1QPQA 3TUUA 4MWAC 2VRKA 2B31A 3VNMA 1GVFA 5T26A 2GWNA 1U30A 3EKGA 3ZT5A 4C90A 4R53A 1GZJA 3AJ7A 5HQMA 3F4DA 4HQVA 4MWAE 4HPXA 1WDDA 2ATSA 5CG7A 3WSUA 4PB4A 1B57A 2ZA2A 4X2PA 2OKTA 4W8AA 4OFCA 2CLOA 3QHMA 4PRTA 4FB7A 2VX6A 4XZLX 2DUXA 4NZ3A 3W83A 1UQYA 4S3BA 3THCA 4WF7A 5CPLA 4RNFA 5I02A 3VMOA 3M0MA 4MYXA 1AZ2A 3RILA 3TONA 5CC7A 2H3BA 3WLQA 1M7PA 3WO8A 3WNOA 1KXTA 3E9AA 4ZOEA 1SJBA 3KCJA 2E6DA 3W2NA 1DTNA 3AXMA 4JIRA 4JQ4A 3NVTA 1GUVA 3WJZA 4MB3A 1BVZA 3FS2A 2CESA 1K6WA 3S8HA 3Q94A 4XO6A 4PSPA 3SJ3A 4HHMA 1KR0A 2G3JA 4QLJA 3OU8A 3ES7A 1UKSA 2VEGA 2JBMA 3LRLA 3PANA 3LCLA 3KDNA 1Q2SA 1V7AA 2J8GA 2FTWA 1O1HA 2DZWA 4H6RA 2QUMA 3VPLA 2P3EA 4GIEA 3GVVA 3U48A 3WF0A 4PULA 8XIMA 3QGAC 2FZ8A 4QROA 3BMXA 2VQTA 3Q45A 3U4FA 2A6LA 2VENA 3FYYA 3NO3A 1FKXA 3RPMA 3FHQA 1H3GA 3AHYA 1AODA 3RIKA 3AQUA 3QEZA 1EP3A 1ODZA 1ONEA 3M0KA 2PP0A 1ISYA 3LQLA 1VBHA 1RCXB 3WBAA 1EBHA 5JBEA 2P10A 2A3BA 1O12A 3WJXA 1KFEA 3UPBA 1CXIA 5CBJA 3O05A 1K8XA 1T6MA 3RM4A 2XM2A 3G3DA 2ZADA 4Z1CA 4QS6A 1VYRA 1SMAA 4FLQA 5HINA 1ZB5A 2HBXA 3B04A 2BVWA 4IPLA 4Q8UA 4GYPC 1PIIA 2NSOA 1DWFM 2V5BA 1XM3A 2NQHA 3QM3A 2PGFA 2R1NA 4BFAA 4K7YA 1MW1A 5KTLA 4F40A 3WLSA 4N9DA 3DX5A 1Y5XA 2IUZA 1HVXA 5FEZA 4GPNA 2NQ5A 4XD4A 1W1TA 4IOTA 3AZTA 3UG4A 3U9IA 1PTGA 4LRSA 2BXYA 1S2WA 1EP2A 5FJUA 1AMYA 1TZ7A 4BQ3A 3BOXA 4GCXA 2XPKA 3ZJ8A 2HS8A 4KWVA 4NX5A 4AY7A 3WJSA 1XLKA 4J9JA 3AAMA 4MZ1A 1QJWA 3GR4A 8TIMA 3S6TA 1XWYA 1UUMA 4O10A 1XV8A 3WUBA 3C0QA 3U0HA 3GXFA 3H4XA 3JVAA 3ZVHA 2W62A 4CNPA 2FH8A 3PM6A 1T8XA 1TPUA 4LT9A 5CGTA 1PX3A 3KRZA 3ITYA 3N73A 3SQLA 4A4AA 2Z26A 4R88A 4H2CA 1YLVA 4QE4A 4XX6A 3OO2A 3N15A 4CN6A 1VB9A 2PZNA 4B5TA 1ZJAA 2WVUA 1CGXA 4DPPA 2WANA 4N4PA 4HNVA 1KM3A 4RPPA 1MDRA 1FH7A 4Q4KA 3IJ6A 3FHAA 2E67A 1WX0A 5ABFA 4HU8A 1QNPA 4M1BA 1K02A 2CLIA 3PZOA 3W2JA 2O4QA 4K3ZA 3T9PA 3PS7A 4F79A 2PF8A 3HPFA 3HQOA 3VOFA 5I00A 4Y6GA 3WNMA 3MSGA 4GX9A 3TYCA 1J4EA 4UIOA 3VD4A 3WLNA 1E6ZA 5BW6A 1QHOA 3VIPA 1DL3A 3GTXA 2GVJA 3N3MA 2CBVA 4PL2A 5I3KA 1SZRA 3JS3A 2ZC8A 3VOJA 1BD0A 1F2JA 3LS9A 5A8OA 4F3HA 1PBGA 2GL5A 4UQEA 3WQDA 4OTKA 3AXHA 3WH6A 3AIQA 3WNNA 5DLCA 1RY0A 2O9TA 2NQLA 2XSAA 3GK0A 4C1LA 1JCLA 5FJIA 5E0FA 1FWTA 3NQMA 1TIWA 4MDPA 4NJGA 1C9WA 4GXMA 4NZFA 1Q4WA 3VIOA 4ZXLA 1PB0A 4JR5A 2AL2B 3GG8A 3HM7A 1C92A 2QCHA 1ZNNA 1PZ2A 2ZUSA 1OFBA 3TTYA 4HMCA 3THDA 3BAJA 1XPGA 1Q8JA 3BGGA 1DJZA 5XIAA 4K6AA 2PU0A 4YJ5A 2E09A 2FPYA 3ZXWA 4RL3A 2GVLA 4HYRA 1R3SA 3CIWA 1JGIA 1QWKA 1JAKA 4TTUA 4JTQA 1VLWA 2BY1A 5AN7A 3CMFA 4BZYA 2W61A 2DZAA 5FF0A 2IXUA 5M3WA 3CTTA 2GFTA 3QW3A 3VKAA 2F8QA 1CGYA 4I5UA 2PLMA 2E7FA 1VPQA 3ARSA 1O68A 4NAEB 1RA0A 1XXXA 3TX9A 5A6SA 4GCAA 1N8IA 2XIOA 4AHPA 1U5HA 1F73A 1DWIM 1V0KA 3FJNA 3TJ4A 2ACQA 3PSVA 1RCOB 1S39A 2DUAA 3SFWA 2WKGA 5T91A 3ZVIA 3RPDA 3PJUA 1SFJA 1K7XA 5K9CA 3AMCA 5LA1A 4Y9MA 3U5YA 3GTFA 1OIMA 3DFQA 1WP6A 3CHFA 3HPSA 4O17A 4HU4A 3E6EA 2VELA 2VURA 3GSMA 1IWBA 1OEPA 1LOLA 3NIYA 3F7JA 4GQBA 1E70M 3W6MA 4AVOA 4L80A 4EF8A 3KCLA 2EHHA 3VKCA 3W22A 1XICA 3EMCA 3CQ0A 1JCJA 2XZ9A 4LGXA 1PIFA 3UNTA 3B03A 1MQRA 1DORA 5IHRA 2DW7A 2GGJA 2BLEA 3ZJKA 1UZDA 1LP6A 2D1ZA 2ZVRA 3IAPA 1O60A 2NWRA 2YCLA 3IGSA 2BXVA 2EG6A 1FWHC 1OFAA 3K1GA 3S9YA 4DBUA 1DWHM 2EPKX 3E2QA 1NP2A 3DAQA 4DPQA 4PMUA 5EBAA 2C13A 2P1FA 2CC0A 2YDQA 1IEVA 1R3VA 3SCQA 4S39A 2NLYA 4AD2A 1C3FA 2NUYA 4I3GA 4W7UA 3SM0A 3DFYA 2HVNA 3V5FA 1QWGA 2CERA 3VAVA 4G5DA 3GNDA 3DN5A 2ZUWA 4GNJA 1OYBA 1LL6A 2J7BA 5AHFA 1JULA 4LYKA 5DX7A 1TCDA 1IEWA 2RDWA 3NQVA 3QV9A 4J3VA 1RJRA 1HX0A 3TEVA 1DJIA 3VU2A 1CECA 2XVLA 1Y65A 3ABQA 1VQTA 1OINA 3PVFA 3FEQA 4H7ZA 2VEIA 4JTRA 2QQ6A 3GFZA 3A12A 3O7UA 5A3HA 2EQDA 1HUVA 4TX6A 3MBFA 3KS6A 5A6LA 3UA3A 2YX0A 5A8NA 3EDJA 4ZO6A 4ZQPA 4QBXA 5A8MA 3ABXA 4MMWA 3IACA 3PY2A 1DTUA 4MJZA 1PVNA 4M56A 4R85A 1J9YA 5G1TA 1OG6A 3BW4A 3MMUA 3B9EA 3L4VA 4DF2A 1JZ2A 2VNCA 4M1RA 2QKFA 6TAAA 1WUFA 4MKNA 1HKKA 1WXZA 1HKVA 4S3GA 2OWXA 1E6QM 1OF8A 2KAUC 4IPIA 3D0CA 2RHGA 1DWJM 4XZ9A 3IJ7A 4W5UA 2HV5A 3QR3A 4AD3A 1EFZA 2YCJA 2O0TA 1L6SA 3ZWTA 5D37A 2I17A 1JYNA 3N6QA 1I75A 2Q01A 2PD9A 1JUEA 4GG9A 4IPJA 3QW4B 5JXQA 1VR6A 1UG6A 2XZ7A 1H11A 2Z00A 1Z44A 1W5OA 2WZEA 2YIHA 3G22A 2FZDA 2WWCA 3LSCA 6XIMA 9XIMA 1V77A 4YWSA 3MANA 1L6FA 1HL2A 4QHRA 5CJNA 3BPWA 3WMBA 3RJYA 2FMOA 3VILA 2B0MA 4EPEC 2VZSA 1KCXA 5A6TC 4D8AA 3A21A 2WQDA 4S3EA 2DSUA 3RFAA 1LG1A 3B8IA 5XIMA 4XD5A 2FMNA 4QM1A 2VCBA 2X05A 2VD8A 2GVGA 1US3A 3POCA 4EXAA 3BLKA 3MPGA 1DVJA 4C1NA 2BGNE 3W29A 4X9SA 3OGSA 3H2OA 4RZ4A 3W70A 4DLMA 4PA8A 2V38A 4AZCA 3S2CA 4S23A 4UWMA 5JBDA 1YXYA 1Z48A 4HNOA 3NQBA 3WLOA 1ZTVA 3T1GA 3DI0A 3GDKA 5HA7A 3V16A 2G95A 4NJIA 2R1LA 1DV7A 2QCFA 3QQ0A 1E5JA 4NIRA 2PD5A 3HJEA 1KKOA 1NF0A 1E6XM 4M0XA 3AS1A 3BW3A 3NEVA 1MFUA 3UW6A 3C61A 3OVRA 3WLPA 3WF2A 1JNEA 1REQA 3G1YA 1E0UA 3N18A 1O5KA 1L6GA 4IISA 2VC5A 2MUCA 3UBPC 1DYSA 4O53A 2VR2A 2E5DA 1JPDX 3U7VA 4C6FA 2C19A 4JGDA 2POZA 3WFZA 2YCLB 2WVVB 4JFVA 3UYCA 4IIEA 5GJPA 4IICA 3BLFA 2QVNA 5HNRA 1FWFC 2ZZ7A 5HUOA 2VT0A 2WBKA 1GJWA 3GWQA 3WL1A 5FIPA 3WBEA 5AKQA 4IT1A 4DYJA 1XL9A 4L6HA 2VX4A 2DIKA 4IIBA 3IIXA 3VIFA 1M68A 5AZ1A 1XLBA 2QVHA 3NYDA 1VFUA 3UR7A 4LQ1A 5KINA 2YL6A 3MO7A 1S3HA 1CXEA 1J8VA 1Z41A 5HMEA 1UPMB 3BJSA 4Z17A 3FDKA 4WLCA 3LGEA 3NYZA 3PBVA 2EG7A 4JTJA 5D2XA 1TVLA 5K9XA 2QCDA 4KGLA 2QEZA 4O19A 2ZYFA 3O3RA 3TC7A 3DYMA 2D0FA 1W8GA 3EOUA 3FA5A 2X40A 3L2LA 3GDLA 2V0TA 1LLZA 3K4WA 1HJSA 1S2UA 3S5OA 3OHMB 1E6NA 3PPGA 4BQ4A 1XUUA 1V3IA 3P93A 1QI3A 1M7OA 1SUXA 1XYZA 3L4ZA 4PSRA 3RF9A 3TYDA 1EA0A 4YL2A 1QTWA 4XZBA 4DO6A 1N8FA 4WDXA 2RFGA 1HFBA 4K8EA 2VCCA 1KW1A 1VP5A 2PCEA 2H6RA 1BGGA 3TFXA 4E3TA 1RCQA 1Y5VA 3SCWA 3UGRA 4IQEA 3N25A 3D47A 4MJMA 1N2VA 1HT6A 3DDMA 3FIGA 4QJ5B 3NCOA 2WNWA 4NY2A 4M8UA 3CL6A 3SGUA 1FCQA 1R3YA 4EAMA 1IV8A 4PZVA 1XI3A 3E2SA 9CGTA 4E2OA 4NZ1A 3L7RA 1EJSC 3LHYA 2VKZG 4KEVA 4AAJA 1NARA 5DT7A 3T44A 4S38A 2OR2A 4GQGA 4OWGA 2DDXA 4BK9A 5D05A 4FNQA 2QDDA 4EWND 3HGJA 3HO8A 2VEFA 1YQ2A 4JTGA 5G1MA 5CZTA 1XCWA 1MRAA 5I03A 3NM1A 3QLLA 4GI4A 1QR7A 4FSAA 3PUDA 5E1QA 5JVLA 1NOUA 3OLDA 3T08A 3ARTA 1QNSA 3BANA 3H7UA 1A5SA 1K77A 2PF0A 3LXBA 3WH8A 1A5MC 2C15A 4XBKA 4GYFA 2EPOA 4DBEA 3W71A 5H2ZA 4U5KA 4I7WA 2FZMA 1WQ5A 3NOEA 4WJEA 2V5CA 2YBTA 4PTNA 3H2CA 1YDNA 4DNHA 3N4AA 4QQUA 3A3XA 4C1NB 6XIAA 4LAOA 1TVNA 2QJIA 3TN4A 3NQ8A 2XM1A 3II1A 4D8LA 5G2IA 5G4EA 4EXBA 4U2YA 4PUJA 3CHEA 3PPCA 4FNTA 1QOPA 4ZOAA 2V5LA 1LJYA 4UTTA 1QUMA 4Y9NA 2OEMA 1QPKA 3TP4A 3NQDA 4XZMX 2Y89A 2WK2A 1G1YA 3EX1A 1R2SA 4FMVA 2QF8A 1F3XA 3W4RA 4KT2A 4S3KA 4BS0A 1MWOA 4YTTA 1WKYA 3WFLA 5K2ZA 3O6DA 1A5LC 2TAAA 5I79A 2BOEX 2C0HA 2PTZA 4TVCA 4ZB0A 1Z89A 1EX5A 4UC5A 3M47A 1I0DA 1R5YA 3IWPA 1GG0A 2HPIA 4Q4RA 5DXYA 8A3HA 5HAOA 2A85A 2INZA 4RDWA 2PTWA 1UZ4A 3NQGA 5BMXA 3PFMA 2WC3A 1MNSA 3G3MA 3KWXA 4JQ3A 1PX8A 2OX4A 1R87A 1YDYA 3W81A 4IIFA 4QCFA 3N04A 3IARA 3BJFA 1IZCA 1TPC1 1CXFA 2V8ZA 2HZGA 3OZPA 1CX9A 4CNUA 4AD4A 1VPXA 3W26A 5DO8A 3FVMA 3IAQA 5K4XA 3PZNA 2J88A 4V1XA 3DFPA 1R38A 4D8ZA 3FYOA 1ML1A 5GPRA 4R33A 4Y9PA 2PAJA 1M04A 5C54A 4IGHA 1Q85A 3S5SA 4IPPA 3U4AA 5C5YA 2XVNA 1YHTA 2VEPA 1EWDA 3O06A 4RK8A 4DF1A 1PYFA 3CXOA 4QG8A 4LUTA 3HB9A 1QNRA 4EX4A 4DZ5A 4REQA 4NL1A 1HO4A 3TROA 2QCDB 4JZ5A 4I5RA 3GR7A 4HNLA 1O66A 3KBJA 2Z1XA 2XIIA 3FJ6A 3W24A 5BWAA 3WD1A 3AMGA 1H51A 4XVEA 5D03A 2P5NA 2V81A 3CV6A 3B0UX 3C3NA 1VYSX 3RCMA 1M7JA 5A2AA 1DJHA 3ECQA 4RNJA 3CBWA 4K2SA 4GHRA 2XIMA 3LPPA 3SCNA 4NZCA 2WJDA 2YL5A 4JNZA 3LX9A 2WOQA 2A7PA 2PE4A 1EXBA 4HP5A 3VIKA 2RH9A 4JX5A 4H9ZA 1KFJA 3S6OA 3VCRA 2DPEA 2DVUA 3MJYA 1EJTC 4ZQOA 4GUGA 3VX1A 3V1PA 3WQVA 5DRIA 3S2LA 1JYWA 1W9DM 3EPNA 1W2VA 3BCJA 3WJWA 1HVQA 3B9OA 4KKXA 3VC6A 1DJYA 3V5CA 1BTCA 3C2VA 3TYUA 1HKMA 4Y9AA 4AHOA 1EH9A 2R8WA 3WQGA 2PCQA 1LQAA 1B54A 4MWAD 2EF9A 4O28A 4J1OA 1V6XA 3MUXA 3S46A 3H7VA 3ISIX 4YXGA 4JIQA 2C16A 2HK1A 2IKIA 5C2GA 4R3UA 1JDEA 1Z3NA 1JG9A 3F4NA 2FVKA 3PB2A 1LDCA 1EUNA 3CEUA 1CXLA 4AZ7A 4H19A 2O7SA 1E0TA 4F2UA 1J6OA 3SRKA 1QPRA 1V3MA 4YMZA 1M7XA 5LIXX 3KZPA 3LXAA 5BRQA 4Q8MA 1X8CA 4FA3A 1VCGA 3GNPA 3AIBA 3U3HA 3ARUA 3B05A 3VZXA 4ZMGA 1EZWA 3CH9A 4IZGA 3WD2A 4JPGA 3NEHA 2OYMA 5I2UA 3MV01 1GVIA 2HVMA 5G5IA 3GDBA 2BX7A 3DZ1A 2E9LA 1XSKA 5DCDA 1KGUA 4OKDA 3EOOA 4J4KA 3S9ZA 2CLLA 4WGXA 3LMZA 4NYUA 4AEOA 3KDOA 3TJIA 3KBMA 3LGGA 4RDVA 2DVXA 2WNZA 2Y5EA 1PKNA 3EOEA 4P8VA 1PIGA 4JN8A 1E4MM 2PODA 4UFLA 1OCJA 1UR8A 1X1OA 4M6QA 1JZ4A 4LUIA 1P6WA 4JHOA 3VVGA 1JCNA 4IFRA 4EOUA 3VM5A 4AZGA 3WBWA 2IPWA 3J7HA 5J5RA 1IEXA 2QGYA 3LY0A 3KLKA 3ES8A 1HO1A 4ROPA 4F0HA 3MSDA 1BEUA 1XGZA 4MGGA 1ITXA 4GOAA 5C9RA 1GHRA 1UMLA 2CCRA 4WZHA 3LA4A 4DWSA 4X9YA 2E9MA 3BZJA 1SJDA 1GEHA 2G0WA 5DBUA 5LA2A 3N9KA 4JOMA 3ERPA 3MMWA 3P82A 3GU1A 3KRSA 1B9ZA 4HZMA 3RGTA 4CGTA 1D3CA 5HWMA 1RA5A 4ERGA 1B31A 3QC3A 3BW2A 1HW6A 2XH0A 4ORMA 4US5A 1XLGA 4YIWA 3H4GA 2RDTA 3Q65A 3W7EA 3HOJA 4XB3A 3UG5A 2FTPA 3W7IA 3A23A 2HXTA 1KC7A 1JXKA 1GQJA 2W67A 5KETA 3A47A 4F9JA 1WZLA 4WXYA 3UXIA 3NSXA 1CXHA 1Q8AA 2YW4A 2REQB 3S42A 4GABA 3GVRA 3O6AA 4MPKA 1MZHA 3BAXA 4G7EA 1KM0A 3OVGA 2CLKA 4LUTB 3CAVA 2WC7A 1Z42A 1OD0A 3AMDA 5G4WA 3MUAA 4KWSA 3QN3A 4D6GA 1E0VA 1W3KA 1SFLA 2CEQA 3AIWA 3MDUA 4W4QA 4NSBA 3TNBA 1VFLA 2C8NA 3PPFA 4ZA0A 2X1IA 1WKFA 4A22A 3TQPA 1QI5A 2ZZ5A 3A4XA 2AL1A 2WHLA 1V08A 1MUCA 3GXIA 2E4TA 2GQAA 4MAVA 4L9ZA 4L4MA 4OV4A 2WZHA 4CUCA 3ARRA 3MI6A 3PTQA 2YFNA 4MUZA 2D23A 3TR9A 1X38A 1ZJIA 2Y7DA 1UHVA 2GQ3A 2X1TA 4AX6A 4XVDA 4HK7A 3VOHA 4O12A 2UY5A 2HS6A 4DJEC 3E49A 7REQB 1UR3M 1XIHA 5I77A 2BB0A 1M01A 1W3LA 4EPDC 3LBCA 3AS3A 4E4UA 2Z25A 3AMKA 3GAKA 4JTDA 1F8MA 4E4FA 1A0DA 4GE8A 5K3VA 4Q4OA 1BF2A 1PCKA 3HBLA 2JF6A 3FJLA 1PKLA 2QMJA 3AWNA 1H4PA 1OZMA 2YLAA 4C7DA 2OT1A 1H1YA 3AWOA 1KTCA 3UFYA 3UCCA 3VCCA 2WMJA 1V93A 1KXVA 3WIJA 4ACZA 6ALDA 3MUY1 1TUXA 2HRWA 5A5WA 1CGUA 1O4UA 2E9BA 4L1WA 4F0RA 3QKZA 2HXUA 3IJQA 4AX7A 1W54A 1FX6A 3A5FA 3CZ8A 3TIMA 3ARPA 3N6JA 2YDRA 3MHGA 3LTSA 2NT1A 2E0PA 2INFA 5GNXA 3GFXA 1IWPA 4BJHA 1WV2A 3L2MA 4S3CA 3N17A 1VFSA 3ANUA 1KTBA 2VZUA 1IF2A 1NFBA 3SECA 1UYQA 3NURA 5EL1A 3GHRA 1E6SM 4DYEA 3SSZA 4TUFA 4I7UA 2PC8A 1NFGA 5LIKX 4A6GA 1LQ2A 3VNZA 3GC4A 1QCWA 3TYEA 2WW5A 1NY1A 3ME3A 5TIMA 2PDGA 2ON3A 1ITCA 3GUWA 2R91A 3USBA 1Q7QA 3TQVA 2WWDA 1VEMA 4Q8VA 2RDUA 2ACRA 5DXXA 1PCWA 1DXIA 1A4LA 3KRUA 4AQLA 3SCTA 3KL0A 2WJEA 2HJPA 3PBMA 1OIFA 4NRRA 1FH9A 4QEEA 1XYAA 4W85A 3WCZA 4QJ3B 1V0LA 3L5LA 3W1QA 3W1TA 4DWSB 4QDPA 3LCFA 3DXIA 5IHSA 1KBJA 3DG6A 4BHYA 2XYLA 5A6MA 4LBSA 5L9FA 2XFWA 3WKZA 4M7TA 1EJ7L 1UROA 1TV8A 5GNYA 1J0KA 2V5DA 1T96A 4DNMA 3VKDA 4IMDA 1P0BA 4DRSA 3V3WA 2X8RA 1QK2A 2Y1HA 4RPQA 2WZTA 3RMEA 4LS2A 1J2WA 3ZLHA 1W1VA 3RDKA 2J66A 3M0JA 3QPEA 1WKEA 3KRBA 5MHBA 1Q4NX 5IXEA 4ZTXA 4ACYA 4M82A 2WMFA 6A3HA 1XBXA 1C90A 3W01A 1W17A 4IHCA 1WXYA 4Z2JA 3RRXA 1EQCA 3IIPA 4M6VA 5LKYA 2NXGA 5DT5A 3CEPA 2ZOXA 4HTBA 3STEA 4C6PA 1OGBA 4DO5A 2P0OA 3TW9A 2F61A 1DJQA 1KLYA 1JYVA 1K6AA 1GZGA 4UTFA 3WMCA 1RVKA 4LVDA 3UVIA 2J7CA 3NZGA 1R7AA 2ZUUA 1ZSXA 1SR9A 1LT7A 4ZQNA 2CPUA 4XZHA 4ZTYA 3M7SA 3ABOA 3OIXA 4F2TA 4KIRA 1GVRA 3P8IA 4GXWA 3V0UA 4FOJA 1RJPA 1JCMP 2Q02A 4CNTA 1W1A1 1X97A 4EXQA 1BWVA 5I23A 3ZOAA 1P1XA 4L65A 1P0NA 2E68A 2BOGX 1M03A 5A1AA 2GVYA 4FNRA 1PZ0A 2RGLA 4HNNA 5U7SA 3WN6A 5A94A 3CZEA 4CQ9A 5J8LA 2E25A 4NT0A 2VDIA 2C3ZA 3Q67A 4B5NA 3TQ0A 3W2UA 1EJRC 1WAUA 3EWCA 3CUJA 3VINA 2ZCGA 4N6FA 4RLIA 5BRBA 3UWWA 3MTWA 3S83A 4UMBA 4UQAA 3BSMA 3WENA 3SBFA 4LAKA 3AIVA 3KWSA 4AXNA 4B5WA 4WKAA 1M5WA 3A6OA 4O4WA 1GNXA 2X42A 1E72M 3I7SA 4JFTA 1QU4A 3W37A 4R9OA 9XIAA 2IQ0A 3UR8A 2PZ0A 4ZGYA 4H9TA 5C7VA 3JZEA 4N9CA 2BASA 3P5YA 3BGAA 1XR2A 3UCQA 1VEPA 4E38A 3EWUA 3W1AA 2XN1A 1EJXC 3NVDA 4ATLA 4LX4A 2ISFA 1XYBA 4R27A 3MVIA 2VFGA 1EGZA 1OWQA 1SW7A 4DWSD 2YL9A 3KUMA 4W88A 4Q6JA 4C6QA 3PZ9A 2BODX 2O7QA 3B8VA 1ESWA 1ADDA 4YVXA 1MZRA 2V9DA 5ECUA 4ZSTA 3GIQA 1GW9A 1LCOA 2YDAA 4LALA 2V68A 1RD6A 4HZ7A 1ZQ5A 3VUPA 3I4EA 1XQKA 2V3FA 5A2BA 3LTYA 1HGYA 3U2ZA 4O4VA 1EP1A 2ZUNA 4IQLA 3FGCA 4DLFA 2WCAA 3ZYZA 1JD7A 1ZRQA 1QI2A 2ZDRA 3PNZA 4NHVA 3LTPA 2NVCA 1BVNP 5FD0A 1Z6KA 3ITLA 4KQNA 1KV5A 4HPHA 2Q8LA 2GDVA 4LEQA 4XAZA 4JAWA 1JI2A 3R1ZA 1XH2A 4GINA 3R7MA 2WSPA 1B5TA 2E6FA 3ZIZA 2QCLA 1KB3A 4WQ6A 2ZA1A 1TWZA 1Q6RA 1UCWA 3NPUA 1E43A 5DCEA 1OC7A 3R12A 4ATWA 2FHCA 1Z7AA 1PZ3A 4IP7A 1XRTA 5D4YA 3VUSA 3M41A 2QAFA 2CKRA 3NFUA 2Z4GA 2IQTA 3CZKA 7ODCA 2V2HA 4PUEA 5M17A 3ZQ9A 4AF0A 1F6KA 1XBYA 5FCZA 1ZAJA 2WVSA 1JVNA 1RVGA 4FPSA 1QW9A 4LUSA 2BY2A 5IBXA 2DZSA 1KQZA 3V0TA 1MFVA 3VGBA 2FFCA 4KIEA 1E73M 1Q6DA 4KRUA 2G37A 1DXFA 3PK7A 1TJPA 3GH5A 2G3MA 3B9NA 3EXSA 3FAWA 4MTVA 2YW3A 1A0EA 5CPNA 5H8PA 4KRTA 5CPMA 4G7FA 2VCAA 1G4TA 5REQA 4XBJA 1XIDA 3AU6A 4NXKA 2Z1VA 4JY8A 2EJ1A 5C70A 2PWFA 1JPIA 2YLLA 1GVSA 2F2HA 1W3IA 5LA0A 2CZ5A 1DJGA 1SYTA 3M5VA 5KZDA 1UJQA 1KBLA 2PDIA 3QTPA 3WK0A 4P7NA 4Z1BA 1V6VA 2NX1A 3IIOA 4M3PA 3WDRA 4EE9A 4D9PA 3EB4A 2FGLA 4J2PA 4ICNA 2BHZA 1H62A 2QPXA 1J96A 3ATZA 3KW3A 4R34A 4G8TA 4GRSA 3RLVA 3W7OA 4GYPA 4GZIA 1I60A 3G8EA 4GIYA 2FTYA 4C6KA 3GVGA 2W92A 3T07A 2ABBA 1TPFA 3KE0A 2H3DA 2ZTJA 3VMPA 2V30A 4GY1A 1IZKA 1XKJA 3CO8A 2TYSA 4CQAA 2RGMA 4DF0A 1WKDA 3P7YA 2WMGA 4DELA 1FWDC 4MY1A 1ZY9A 2PDCA 1GOMA 4HMNA 5GJMA 1UW9A 1UA3A 5IDIA 3A24A 3W7QA 2J77A 3M5ZA 3URAA 5LIWX 1A5BA 3LHVA 1CLVA 1UKQA 2FJKA 2PPGA 4JTSA 3BLPX 1FY6A 5HUPA 3OQ8A 3QR0A 4KPLA 3TH6A 3THUA 1PEZA 1YBQA 2YYTA 1HP5A 4FR6A 3GYEA 3T0BA 3VCNA 1H49A 4ZO7A 3QVQA 2FHFA 4TXEA 1S5MA 1MUMA 1L2QA 3GBEA 2OYLA 3IRSA 3KHJA 3WLLA 2DV0A 1PDYA 3N12A 1KBBA 4I7VA 2YCEA 1KRAC 4HU3A 4RE0A 3GFYA 1JYXA 4OOZA 5ENLA 4NG3A 4LC6A 5AHIA 3TR2A 5A8PA 2X7WA 4HGXA 3V7PA 8XIAA 3OTRA 1H1ZA 4KEZA 1R6WA 4AW7A 5LXXA 2PDMA 1QRQA 1TIMA 1GKRA 2DZXA 3NZ1A 3C2EA 4U3CA 1MEHA 3FAXA 4DN1A 3TW6A 2RJGA 3SQSA 1SPQA 2POTA 1V02A 1VRDA 4MKSA 2FDSA 1F4AA 1ADSA 3IANA 1VHCA 2XFRA 5FSEC 3A13A 4OV9A 2CW6A 3OW1A 3CU2A 4WUIA 1A5KC 5EMMA 3FGCB 3M0IA 5BOFA 3EA1A 5CJ5A 5EMUA 2PRLA 4RW5A 3R11A 1E4NA 4H6EA 4EVZA 4US6A 3O15A 3UPMA 2FDMA 3B8TA 3BH4A 3GU9A 8RUCA 4PBGA 3DEQA 1YNQA 2VYOA 3GM8A 3MU7A 4WRHA 5C2XA 4AD0A 4GUIA 5GQBA 3FX4A 4LYQA 2Y4SA 1H1NA 1WDSA 2QJGA 4ILSA 1GG1A 3UA4A 5K9DA 1H41A 2F6UA 4ASTA 4A3UA 1BQGA 3N1AA 4IMAA 4QS5A 1JRBA 1UPPA 2GDQA 3RJXA 1PKMA 3OOQA 1KWKA 1PYMA 3EB2A 1ISZA 2A3CA 2TRSA 3OIHA 4AF0B 2DT2A 3KZSA 1VFOA 1OCNA 4FX8A 4LUSB 4UTUA 1XCXA 3UP8A 4CCEA 3S2MA 2ACUA 2A6NA 1YADA 4I5XA 3C0LA 4FS9A 1PTAA 1X98A 3HPAA 1A49A 3CAKA 3PJTA 3EB3A 3KP1A 2ALDA 1EWEA 1U1JA 4RW3A 3W25A 4MKVA 2OZ3A 3C8NA 5ABHA 2IPGA 4GNVA 1OCQA 4WDUA 4YTSA 4ZXOA 3PFRA 4B5SA 3S5ZA 3GLCA 3VOGA 3KTCA 4QCEA 5AC4A 4D72A 5E5CA 1AW5A 3GIPA 1IHIA 1MEIA 5REQB 1LLOA 1NTHA 3CLWA 4CD5A 3ITOA 4WDTA 4LVBA 3V5OA 3WQ4A 1HKWA 5CJMA 1EX1A 4QDMA 2PBGA 4R7JA 1K8CA 1LLWA 2WM1A 2GOUA 1IT8A 5D8WA 3KL5A 3VFCA 1WE5A 5AY7A 3VIHA 2CKSA 4HMEA 2P8CA 2RKXA 1CBGA 1OB0A 4TVUA 1C9DA 5I09A 4A3QA 4PMYA 2EG8A 1NQ6A 3S3GA 2DY3A 1BXCA 2OO6A 5FEPA 1RZMA 3DFNA 3ANVA 2Y61A 2QDHA 4AFYA 4YN5A 3BG9A 4CD7A 4I9JA 3GU2A 3VM7A 3OEXA 5D2WA 4N42A 3S1GA 5C2CA 3VGGA 1OFQA 2RUSA 2FPVA 2J13A 3AROA 1Q7MA 2QNEA 2I1OA 1L2UA 5AVHA 3TZFA 1QXLA 1UUQA 3FNDA 7TIMA 4Z0JA 4F2BA 3C56A 1TFVA 1VJIA 4GY0A 2PWGA 5H8UA 4C5ZA 3UZ5A 1SJCA 4ZEPA 3IRDA 3QYQA 4GO8A 2ZX9A 1HJQA 3XIMA 2DT0A 1BSIA 1JZ5A 2ZX8A 1A50A 2PRMA 2PB1A 2HNEA 1YBQB 4M19A 1I1XA 5FESA 3G1SA 2NUXA 3GUGA 4GK8A 1XH0A 3TOYA 3NR0A 1VENA 5H8MA 4ZQCA 2D2HA 4TQTA 3HA1A 3R0KA 4FNUA 4HCLA 1FP9A 1ENUA 3NDOA 4AHQA 3UERA 4C6MA 2V5KA 4A2SA 3H2EA 1UWUA 2V67A 2A4AA 3M1ZA 4LYRA 2GJXB 3I3EA 3GD6A 3QPYA 4P7QA 3WK3A 4C6NA 3STFA 3WLTA 5HXMA 4JYDA 2CFFA 4DAIA 2DFAA 3CT2A 3V35A 1IT7A 4QITA 1MO0A 5CZKA 3T0CA 1UH2A 4IX2A 3OGRA 1FCUA 2X1SA 2DSZA 4HT3A 4X2RA 2CZFA 4GH3A 3UPWA 5F1UA 3SDOA 1UD3A 3PG9A 4JX4A 2J47A 1TRDA 5CGMA 3CQJA 3L0GA 1K4HA 3VIJA 1TZ9A 5F2IA 3N13A 3NL3A 2YOCA 5FJTA 2DJXA 1UZHA 1LWJA 1R3WA 3QTGA 3EX3A 2CYGA 2VZTA 2YDSA 2YR1A 2A3HA 2Z1KA 1LORA 1NF7A 4JTLA 4B9YA 4C7GA 4AZHA 3W53A 3PUGA 1JCXA 4DB7A 3L4YA 4PUWA 3IVSA 1BQCA 1POKA 4H9XA 1W1IE 4O18A 2TMDA 4E2BA 2WLYA 1UKTA 3NUKA 3VI2A