4O53A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFLFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o53A00
4UUIA 2YDAA 1OG0A 2CWNA 2OX1A 1QWGA 2Z6IA 4NT0A 3LX9A 1SPQA 2O7QA 3TJXA 4ZQNA 2Y88A 3BW2A 3UNDA 1QOQA 3NQEA 4LT9A 1SW0A 3TROA 3Q37A 2YYTA 1K7FA 3W7EA 4TX9A 3SR7A 4K37A 3NQDA 1LM1A 3KVKA 1ME8A 3MWAA 4ZVJA 1Y0EA 5D04C 5A8GA 3UXDA 1H60A 5BRBA 1ZY9A 3LLFA 1LROA 3EXTA 2VEKA 5C5YA 4UFKA 4NVTA 2QDHA 4ALDA 1LOQA 4XBSA 2XN2A 1LBMA 5AHIA 3UQNA 2C6QA 2A6NA 1X7FA 4C1LA 4E2BA 4EOUA 3CTLA 3THQA 2YFOA 4IUOA 3N34A 3LRMA 1MEHA 5LHEA 2G97A 5KZMA 1FDZA 1KBIA 4A2RA 1G67A 1VHCA 1I2PA 4UFJA 2YZRA 4AWUA 1H7PA 2OMAA 2RHGA 4YCPA 3CPRA 1T96A 3NA8A 2XN1A 1UJPA 3PG8A 3HG2A 3UWYA 5C2XA 3VI2A 1GVFA 3M5ZA 1UCWA 4RZ6A 2CW6A 2BSLA 1ZENA 5D2YA 1TTQA 1ZFJA 3M41A 3ABSA 3W76A 1M5WA 4N9BA 2WSQA 4BR1A 1OX4A 3M0ZA 4PL1A 1KM1A 4MJMA 4QISA 1TIMA 3JRKA 3GXTA 1EX5A 4UTIA 1IXPA 3L2IA 3ZS4A 1MO0A 1WDWA 4ZL1A 2G5WA 3TC6A 2JBMA 2YX0A 1H62A 3QMTA 1VCVA 4JN6A 1A5CA 3W74A 3P60A 3P82A 5FF4A 1K8ZA 1UUOA 1ZAHA 1E51A 4O52A 2KZHA 3G1DA 4BF9A 5AOUA 4JY8A 1LRTA 3C2RA 1XM3A 4LV4A 3ZWTA 5K7JA 4DXVA 2NXGA 2ZYFA 2Y63A 3A5VA 3N2MA 3HB9A 1FDYA 2WNQA 5HUOA 1XL9A 1K3UA 4WY0F 2UV8G 4LRTA 4WUIA 1VYSX 5I3JA 3EWBX 2E1DA 4K8HA 2XN0A 4EVZA 3EXSA 1A5BA 3PF3A 5TIMA 3QSTA 4QNWA 5AYZA 1KM6A 1FQ0A 1PIIA 1DBTA 1Q3NA 4FIRA 2ZZ2A 1V5XA 1M7OA 4Q33A 4C1KA 1FWWA 3F1QA 2I9EA 4M7TA 2WV8A 3L0NA 5HMSA 2QCHA 3TA6A 4AF0A 3N9SA 4XKYB 2VEMA 2F84A 3E0IA 1Q6RA 4UFMA 5LSMA 1H63A 1YDNA 3DXIA 3TQ0A 1KM5A 2JKPA 4MZ8A 2CZDA 1EIXA 5KTLA 1LZOA 1WOAA 1R47A 4FNQA 1YXYA 3UYCA 3SW6A 2YXGA 4Z1BA 4WD0A 1OFPA 2P0OA 3HF3A 3BPWA 4ZQPA 2QUUA 3ANYA 1G4SA 2C18A 4NNAA 2C14A 5F2MA 1XBZA 3O16A 3DZ1A 4FNUA 2W6RA 3TSBA 2NX1A 3NQCA 3TFXA 2WNNA 1TPFA 3NAVA 3HG5A 1KTNA 1XXXA 3EWUA 1J5TA 3BW3A 1H1ZA 3W1QA 4I7UA 5C6MA 1Q6QA 2C1HA 1EP1A 3R13A 7TIMA 4PEKA 5KINA 4DBEA 3PC0A 5DN1A 3NR0A 1YPFA 4JS3A 3T7VA 3TR2A 3BG3A 4PODA 2BLEA 1SR9A 1YDOA 1KFCA 3HPZA 2ZZ5A 3F03K 3NM1A 4RK8A 3ZFHA 1SZGA 3LBCA 1NAL1 5CZSA 1VGAA 2IQTA 2YPIA 5HWMA 2DZUA 2QR6A 5FF2A 1TQJA 3PUEA 1KLZA 2A7NA 5D05A 2GQ9A 2DZWA 3I7QA 1OX6A 1A53A 3DENA 3MMTA 1YADA 4YCOA 3STEA 1FWTA 3ABRA 4O10A 3MO7A 2W79A 3HPXA 2NXIA 3IVTA 4R7JA 1I45A 1KA9F 1U5JA 1RD5A 2WOQA 1PHWA 2VXNA 3LTYA 3NYZA 4O19A 1L9WA 3P8JA 2H8XA 2BX7A 1YTDA 3FYPA 5AYYA 2Q3OA 4OU1A 3T40A 3H54A 3W07A 2VFEA 3MHFA 1YPIA 3UY8A 2R94A 2GPTA 1W5MA 1A5SA 4IQLA 4DEFA 2RDUA 2Q8ZA 3NQ6A 4KFNA 3NNTA 4MFEA 4M6QA 5AHEA 1JULA 3MI6A 4JTJA 4BFAA 1FCQA 1LOLA 1SFJA 3UZ5A 4N6FA 5CG7A 3TW7A 5CGQA 4JNMA 3EX4A 3M5XA 3TV8A 2QCFA 3EWZA 4CQAA 3S5OA 3W2NA 3E12A 2VC6A 2ZZ1A 3TAOA 4IX0A 4K8EA 4PCFA 1Q6OA 4ONVA 3BGJA 2NV2A 5KSWA 1ICQA 1OFDA 3INPA 2J88A 4MY8A 3PB0A 2Z2UA 2ZRWA 3L0GA 3LGEA 4WY0B 5AHFA 2E5CA 1KFEA 3W2JA 4HSOA 3TE9A 2ALDA 1VLWA 3LCIA 4JGDA 1GG1A 1JRBA 1JCLA 4NJKA 4LS0A 1OYAA 2QCDB 3WJXA 3MJYA 4LUIA 1RQHA 5GVJA 3W7QA 3DFOA 4Z0SA 1W54A 4FNPA 5AHMA 2BWGA 3IVUA 5DLCA 2RDTA 2YW4A 4M7SA 1SUXA 3STGA 2ZRYA 3GYEA 1L6SA 5LNWA 3V1PA 3PVFA 1B57A 5HULA 1ZALA 4LU0A 3VE7A 2GQAA 3P5YA 2QCCA 5HWNA 1EP2A 4GNJA 3L68A 3IGXA 3PBUA 2OT0A 5F1VA 1W37A 3B04A 3O15A 3YPIA 2J9YA 3W7IA 3GDTA 1DL3A 3MUXA 3PUOA 2EKCA 3LCHA 5BOOA 3DHFA 2Y7DA 1QR7A 5D38A 2O7SA 3BGGA 3H53A 3FLUA 4UFIA 5D37A 1WV2A 2C19A 4O1AA 3GXPA 3GXNA 4O8RA 1F7BA 4HHPA 3CT7A 2DZVA 4HPJA 4JX5A 3TCEA 3RNDA 1FCVA 3HJZA 2ZZ4A 2NV1A 4IWWA 4LVDA 1VHNA 3WK2A 3IRDA 1RVGA 5E93A 3KVLA 4FNSA 4LUJA 3NO5A 1VH7A 3W7OA 4IMEA 3M1ZA 4AHPA 4O13A 3C6CA 1SW3A 4OT7A 3S5ZA 3W1XA 2ZQ0A 3IIVA 3LXCA 1LRQA 1VJIA 3QF0A 1OX4B 4NNCA 3W70A 1TQXA 1OK6A 4E0CA 1B4KA 5F4SA 4W9TA 1Z48A 3T78A 3GNDA 3NL2A 4JTLA 4YXGA 4N9CA 4OHQA 4FIQA 3TSMA 3LTSA 1SU5A 1Z42A 4ZQCA 4Q4KA 4A22A 5AN7A 5HWJA 4DO5A 2YW3A 5EMUA 3KVJA 3HPSA 4GUGA 3TXZA 4UTMA 4ZQRA 2RDWA 3F4NA 5AHLA 4ZQOA 4UTKA 4ZQMA 1TTJA 3NL5A 1QPQA 3A5FA 3C0JA 3S6DA 4WOZA 3CC1A 1FCUA 4IPJA 4UR8A 3WJWA 1N55A 3GDRA 1SZNA 2YGYA 1Q45A 3LERA 3CU2A 2G95A 1D3GA 2WSRA 3U2OA 4JIQA 3GIYA 2ABBA 3UPBA 1W5OA 4O1CA 1JCJA 3THAA 1SSDA 1QAPA 4CLMA 3KRSA 4O4VA 1TPH1 1QNVA 1W3NA 3W87A 1GVRA 3MHGA 3NM3A 2DZTA 3OVRA 1W56A 3FJLA 1LTDA 4JX4A 2X1SA 2X1UA 4Z1AA 2E6DA 1BTMA 4NJJA 4ML9A 4Z1DA 3DKLA 4R34A 4UTUA 3W1NA 4QQ3A 1KV8A 1W5PA 2QJGA 2EPHA 4O16A 3S0CA 2WSYA 4LY8A 3EEGA 2VENA 4AWSA 1HO1A 4IMGA 5D2VA 4AWTA 2YYUA 5U7SA 3ABQA 1TJPA 2DORA 5KZDA 3FIGA 3N73A 4ADUA 4MZYA 3LHVA 1JQXA 1PS9A 5CZ0A 3LI1A 3BW4A 4KKXA 1ZAIA 3S5YA 4LVGA 3G1SA 1F6PA 1KFBA 3IIOA 1YXDA 4I7VA 3NL3A 1RZMA 4TU1A 2GVLA 3CWOX 2BTMA 3HG4A 3DKJA 3P62A 6TIMA 3FEMA 4MFDA 4XQ6A 3O1NA 5LNRA 3LBMA 3W1AA 1F76A 2NWRA 1IXOA 3R8RA 5A5WA 1WBHA 1XBVA 1K03A 3U8GA 3OEXA 3MYOA 2ZA2A 4O11A 3EKLA 5G1TA 4JDBA 5D02A 1DV7A 4OGZA 3P80A 2ZDRA 1DKWA 4MIMA 4TMCA 1ML1A 1BWLA 2DJLA 2QUVA 3TMQA 1IF2A 3KRZA 1DHPA 2Y70A 4O57A 2C3ZA 2CZEA 4RJEA 4KWVA 1NVMA 1OF6A 2RKXA 3TXVA 3W6YA 2CFFA 4CQ8A 1H7RA 3QC3A 5AB3A 2TMDA 1ADOA 5DY2A 3NPXA 4WJEA 1LOSA 3QYQA 1W0MA 1VZWA 2Q3RA 3EX1A 2ABAA 2CLIA 5D30A 1KFJA 2NX9A 2H90A 3W7HA 3P7YA 3P5ZA 4LTSA 1O94A 4WZHA 3W7RA 5IM51 1KV5A 2C16A 1GQNA 4PTNA 5D2XA 3QPZA 3U6WA 4DELA 4O53A 1ZCOA 5AC7A 5MHBA 5HINA 1H7XA 2QEZA 3GDMA 3PWAA 4PC8A 4L4MA 4GFSA 4LVBA 3CM4A 3H55A 4QITA 1LDCA 4WY0A 2E6YA 3FYOA 1LORA 1EP3A 1K8YA 5LGXA 2BZNA 2YR1A 3BG5A 2QJHA 5FEZA 5FEWA 3IIXA 5H2ZA 1PVNA 4O1DA 1RR2A 2PC4A 3W86A 4JDYA 3G22A 2FPTA 3FKRA 3ZR4A 3TIMA 1DOSA 2JK2A 4X22A 1PCWA 1AW5A 4K39A 5LGZA 1LYXA 1O5KA 5CPMA 1JUEA 5K9XA 3BLEA 1IXQA 1WA3A 1DJQA 3BK0A 3LCLA 2RFGA 2NUXA 4YL2A 5CSRA 3NQVA 2JKAA 4D2JA 1A50A 1YTKA 2E09A 4Q32A 4QNEA 4NX5A 3TAKA 2Y7GA 1TV5A 1B3OA 3W83A 1F05A 1U83A 4CNPA 5FF3A 1NF7A 4X3ZA 2CU0A 1F2JA 3FOKA 3W73A 1JQVA 4Y96A 3WFAA 5EBUA 3UWQA 2NXHA 3W7LA 1GG0A 1TPC1 2CLOA 3QZEA 3O07A 1SSGA 3M43A 3QMRA 5KZEA 4CCCA 3G18A 4OQVA 1W3TA 4U4MA 5HUPA 3LCFA 3CEPA 3TX9A 1QPNA 4N6EA 2AAMA 3C4UA 3T44A 1BKSA 3TDFA 1GPWA 2E6FA 4O18A 1YDVA 3KXQA 1XUZA 4IMCA 5FF0A 3DBPA 5H91A 3I7RA 2V0TA 5IBXA 4Z1CA 2ATMA 3W22A 3PUDA 2Y62A 4BWLC 4OWGA 2FB3A 4UTWA 4OV9A 2PURA 2PRHA 3NQ7A 4LRSA 4Y9AA 6ALDA 3UWWA 5CZJA 1TV8A 4NQ1A 2HSAA 4BI6A 1UB3A 4YLWA 3CIXA 2X30A 2DP3A 1QMLA 4UMCA 2V82A 3TH6A 3W1TA 3W72A 2WNZA 3IIPA 3I7SA 1QFEA 3L21A 3R2GA 3QSRA 4UR7A 1VCGA 4IOTA 3G8EA 4UNLA 5EPDA 3HIJA 5F4WA 1G4TA 2WQPA 2RH9A 4IJBA 5K4ZA 4JR5A 1ONRA 3NQMA 3C52A 4LV9A 4GUIA 4MYAA 3CHVA 2EGZA 3TC7A 3IIZA 2ATSA 2FFCA 3G1XA 5G2WA 3C2FA 1B4EA 2HTMA 1VQTA 3SECA 3C2OA 2J24A 4J9JA 1TSIA 3L67A 4N4QA 1AL7A 4NXSA 1RPXA 2FQIA 3RF9A 3UWUA 3NOEA 1M7PA 3A22A 4CNOA 4X9SA 4AB4A 4IGHA 5LNSA 2VELA 4TO8A 1CI1A 1TYGA 4K7YA 2H3DA 3DI0A 1H51A 4Y90A 4HNUA 3B0PA 3PULA 2NZLA 2V2HA 1IIGA 3QPYA 1S5TA 3VKJA 2E5DA 2B4GA 2F7FA 4FHAA 1EB3A 4LS2A 1S5VA 3FFSA 3QQ1A 1N7KA 1OJXA 2NX3A 3GKFA 3NQ8A 4O0KA 2JGYA 1JR1A 2X16A 1OFEA 1KFKA 4FX8A 4RR4A 3TW6A 4UTHA 4BK9A 4FX6M 2ZA3A 4LS1A 3VCRA 2VFFA 5DBTA 3O6CA 3LV6A 4AMAA 3I68A 2V9DA 3PBVA 3EX3A 5HNRA 1PE1A 1LBLA 4LVAA 2VEPA 4YMZA 1JCYA 1QDSA 5CPNA 1TPWA 2ISVA 3NXFA 2VFGA 2PCQA 4JTHA 1H5YA 4K6AA 3PSWA 4XUGA 1AG1O 3W2LA 4XBKA 4MLRA 1VYPX 2FB2A 3L5LA 3UWVA 2A7PA 1TRIA 3DGRA 1FX6A 1OVDA 4LWWA 1XC4A 3GX9A 3T55A 5FESA 4AF0B 4QJ1A 3OVQA 3NPVA 1H7WA 2OT1A 1O95A 3QW3A 4MVAA 2ZRUA 4JTEA 5I3FA 1SW7A 1G69A 2OCZA 3M7WA 1G7VA 3FKKA 3G24A 2A85A 1KBJA 4IXXA 3T4CA 1DVJA 1ME7A 1TB3A 3S5NA 2A1YA 1PL9A 4PA8A 1BWKA 1W3IA 3NGJA 3LHWA 1L6YA 2BXVA 2Y7FA 1I4NA 5TQLA 5LKYA 4XZ9A 2DZXA 5F2IA 2CLMA 3R5EA 4P61A 3CB8A 1WYIA 4ZMGA 2QCEA 4XTIA 1CX9A 5ABTA 3S1UA 2C13A 3P84A 2VFDA 4UTTA 5K9CA 4E38A 5FEXA 1VC4A 3EX2A 4A29A 4JTTA 5D2WA 2NLIA 2R14A 3G1VA 4IMFA 5G2IA 5I3GA 4RX0A 1YLVA 2A6LA 1R2TA 4Z0JA 4UMBA 1R2RA 1SO6A 4IXHA 3LHTA 3FJ6A 3RMJA 5CPOA 4K7VA 4JD4A 3QW4B 4QAIA 3LXBA 2I1OA 3W84A 3WK0A 3GAKA 2QKFA 4G1KA 1MZHA 1VR6A 4O15A 2ZZ3A 1X6UA 4DF1A 4ICNA 1SZFA 3VFLA 3QH2A 3V75A 4UXDA 2CLLA 4NNBA 3CIWA 3S1XA 1EEPA 1QO5A 3E9AA 5AC6A 5HJLA 4DO6A 5D2TA 3OBKA 5AC8A 1SO3A 5CSSA 4S1FA 1ZHAA 4EIVA 3PS7A 1GTHA 4DF2A 3LCGA 1XKYA 5DXXA 1RQEA 3CEUA 3HGOA 3PB2A 2Z0IA 2R91A 3B03A 1ZJIA 2QCMA 1W8SA 3DU0A 3QMSA 3KRUA 3TU9A 1HG3A 3W7GA 1DORA 4TR9A 2EF9A 1DQXA 3UD6A 5K4XA 2CZ5A 1GOXA 3GNNA 1GJPA 2TYSA 3BLFA 4QIUA 5C54A 4RLIA 1EWEA 1RQBA 4O0ZA 4PL2A 1MEIA 3GDLA 1CW2A 3G0SA 3PR2A 3PSVA 3W1PA 4LC6A 5SWUA 1FCBA 2ZRZA 2WPBA 1LBFA 1EA0A 5AYXA 3O8AA 4A3UA 1G4EA 3LCXA 2ZA1A 5F2GA 5DCEA 2A21A 4O50A 2B7NA 3O06A 5BMXA 3QFEA 1T99A 3B8DA 2GJLA 5I3KA 2ZFAA 2VFHA 4GXMA 4JY9A 2X1RA 1C29A 5G5IA 1TPVA 2VFIA 2J27A 4U28A 1QO2A 2FIQA 1G6CA 3HGRA 1IXNA 3L66A 5EY5A 3MHUA 3EXRA 4MKNA 1VRDA 4LC8A 5EYWA 1EUAA 4XTDA 3EWYA 1SFLA 3BVJA 2V8ZA 1KW1A 3O6DA 1UBSA 1PV8A 3EWXA 3SFKA 4TIMA 3N3MA 3NZ1A 2NWSA 5CKSA 1TTIA 2NUYA 5AFDA 3S9YA 1O60A 1S3HA 4GWEA 3A9IA 4DQWA 2QJIA 4HT3A 1MEWA 1JCMP 3SJ3A 4FXRA 3C56A 4K38A 1K8XA 4H3DA 3OA3A 3OIXA 4MY9A 3CLMA 1T0OA 1N8FA 4FEZA 1EUNA 5F4XA 3LI0A 2XFWA 2ZTJA 3PBYA 1OYBA 4N02A 1GZGA 3CQ0A 1HFBA 1JVNA 3TK7A 1H7OA 1GVQA 1KM3A 3LXAA 1O5XA 2YCEA 3P74A 3EWWA 3G8RA 2B0MA 1UASA 3MI3A 2ZZ6A 3RU6A 5I3HA 2ZTKA 3WK3A 1B9BA 1A5AA 3B05A 1VCFA 1OFBA 5HR6A 3C61A 3SIZA 4GE8A 3GAYA 5KMYA 2FLIA 2Y61A 3NDOA 2TRSA 2WKJA 4JEQA 3G1HA 4JTIA 1L2UA 3W7PA 2V2DA 3TNOA 2PE4A 3HGJA 1D9EA 3M47A 5F2LA 5LNVA 4NUWA 1ICSA 3W1LA 3G0UA 3Q94A 3HBLA 1OFQA 2Q8LA 1S5WA 4I9AA 4M19A 2E68A 1F73A 1OK4A 3KX6A 3E96A 5F1UA 5DBUA 3W7MA 1WX0A 3C2EA 3PAJA 4ORIA 3DAQA 2QF7A 1TREA 1PHQA 2A5HA 1X1OA 4FX7A 3HQ1A 1G7UA 4FXSA 5DELA 3DFQA 2ZZ7A 3ATZA 4GBUA 5FF7A 3FA5A 2ZCGA 3A21A 3DHDA 1W5NA 4N2YA 2PRMA 3DFTA 2GUUA 3PM6A 2ZBTA 3F4WA 1P5BA 2CZFA 4I7WA 3OHIA 1KTCA 3W7CA 4ADSA 1K7EA 1TJRA 3W23A 3LRKA 3LOTA 1JUBA 4EF9A 3GDKA 1NF0A 3W1MA 3P61A 4O54A 1Z44A 3WJYA 1FBAA 5E1QA 1GVOA 1M6JA 3WK1A 5D09A 2CLHA 4S2BA 4UMAA 1TPDA 1XFBA 2W0UA 3KHJA 4BI5A 3W75A 3NQAA 1OX5A 1KFLA 4RXGA 3NVTA 5EL1A 3C3NA 1LCOA 2QCGA 3OG3A 2V5BA 2Y89A 4RZ4A 2NUWA 2FPYA 1TPB1 1QPOA 4OV4A 2FDSA 1LLZA 2A4AA 4UTJA 1AK5A 3VNDA 4CNNA 2B7QA 1XCFA 2EHHA 4KWWA 3TSDA 5J5DA 3RK8A 1FWSA 3LRLA 4GRSA 1JCNA 1ME9A 3EX6A 3W7KA 1OABA 4AVFA 3M9YA 3BO9A 5D33A 4FF7A 1Z41A 3LHZA 3HG3A 3MP3A 1F6KA 3NL6A 5EKYA 1OF8A 4MOZA 3HMJG 3LCWA 1YXCA 4UFHA 3W7JA 3W2MA 4UTWC 1X1ZA 1R2SA 1XDMA 3W3OA 3G3MA 1XI3A 4NZJA 3GK0A 4MZ1A 3LHUA 4NJIA 1SO4A 2JGQA 3NPWA 3JS3A 4ORMA 3M5YA 3I6RA 2X1TA 2A7RA 1FWRA 1H1YA 1VYRA 5AHNA 5K2ZA 2P10A 5DCBA 4M6VA 4AAJA 1L6WA 2A2IA 4WXZA 3G0XA 2HS8A 3WJZA 3W1RA 4N4PA 1AMKA 3B0UX 5FEPA 4R53A 2H3BA 4NJGA 2ZRVA 1EPXA 1ALDA 2A0NA 3DFPA 1KM0A 2Y85A 3MW7A 3LB0A 3RFAA 1TV7A 3A24A 3AJXA 4ZZ9A 1I8JA 1JUKA 3VE9A 2VOMA 4JYDA 2E5BA 1P0NA 3EB2A 4O12A 5L6UA 3NZRA 4X2RA 3DFSA 4IMDA 5K3VA 3DH7A 1H61A 1QOPA 4MLJA 2PRLA 3KOFA 3B4UA 3TFCA 2V5LA 2OJPA 3LDVA 3L65A 3M5VA 2DU2A 2TSYA 3CWNA 3W7NA 3G1AA 1BEUA 4JYEA 4NU7A 1TPEA 3O6YX 2AQWA 3OVPA 3R12A 1G4PA 4M5PA 4Z08A 2QCNA 4BWLA 1IIHA 1F74A 1YTEA 1Q6LA 4IX2A 4YWIA 2Y6ZA 3UPWA 4UFLA 5DY3A 1IGSA 2B7PA 5KITA 5J5RA 3I65A 2B7OA 4XKYA 1MSSA 2E6AA 1V7YA 3DI1A 1AL8A 4Y6GA 3TMLA 4CQ9A 3P67A 4UC5A 3NQFA 3BARA 3PBWA 5L9FA 4RV8A 1HTIA 2FTPA 4N9EA 3SZ8A 5T26A 4B5NA 1R30A 2X2GA 2Z6JA 4HNTA 3K30A 3S1VA 1JJKA 1I2NA 1W1ZA 2OZ0A 4O4WA 3DFNA 3NG3A 4HIBA 3ABOA 3IVSA 1GYNA 1VS1A 4NXKA 4H6KA 4A21A 3GVGA 2I14A 5BW6A 1QPRA 3EKZA 1GYLA 4QSHA 3M44A 3GR8A 3UY7A 1WXJA 1OFAA 1XDLA 3C8FA 3HO8A 3RLUA 4UCGA 5G4WA 3IV3A 4KFPA 1WBJA 3O63A 4MJZA 3STCA 2V81A 4H4IA 3MBDA 1GTEA 1GWJA 3JR2A 3IGSA 3NQ2A 5DXYA 2YFNA 3P81A 2H8ZA 3LHYA 3RLVA 1HO4A 3KFTA 1J2WA 5HR7A 4O14A 4AHOA 4TMBA 1C8VA 3AO0A 5BNKA 5DCDA 3Q2DA 4NZFA 2R8WA 5LHFA 2E77A 4JTGA 1DJNA 1TTPA 4FO4A 1THFD 1TMHA 4POCA 3P8IA 2LLEA 3L5MA 3TQVA 1GT8A 4K36A 2C0AA 3HOJA 3WJSA 2ZRXA 3TUUA 3W1UA 2J6XA 3KAOA 1I2OA 4PH6A 4HSNA 4WXYA 4M6PA 1WOBA 3G1FA 4KFOA 3N19B 4A2SA 1XBXA 2QAFA 3UWZA 1NSJA 1KM2A 3W9ZA 3GKAA 3M6YA 4HNVA 4DBDA 1FWNA 1NFBA 3UXAA 3IGUA 1R46A 4N9DA 2HMCA 1LP6A 4Y8FA 4WX2A 4MUZA 4JTKA 1FXPA 1K02A 2EAWA 1TCDA 4OBTA 2VKZG 4FNTA 1I2QA 3GLCA 5U4NA 3KVMA 4GUJA 5FI8A 3HGSA 2CLKA 1H50A 3BLIA 4R33A 1NEYA 4JTFA 2GOUA 1OYCA 2QAPA 1KTBA 1PCKA 1FUYA 2V2CA 2HS6A 4HNNA 3S8HA 5HQEA 3USBA 5G4EA 4DPPA 3SY5A 3MI2A 1I2RA 4HN4A 3QQ0A 2H6RA 3TKFA 1UUMA 1X8FA 3PG9A 4EF8A 2Z1BA 4UTTC 3MP5A 1GVSA 4JX6A 5G1YA 8TIMA 3LM7A 4UNKA 4AEOA 3ATYA 3MBFA 4JICA 5C55A 1FY6A 5LZLA 3LV5A 4JIPA 4GC4A 1ZAJA 4GJ1A 1XUUA 4LW7A 3W85A 4WQ6A 4O1BA 3S42A 3G1YA 1SZEA 3B0VC 4JXCA 2D73A 2VEIA 3MP4A 5TBOA 4DF0A 2CLFA 1HUVA 1W5QA 3L9CA 3D0CA 4OE7A 1SO5A 1EWDA 4NJHA 4ADTA 3PY2A 1J4EA 1RV8A 4UIOA 4LNYA 1JRCA 2C15A 4RXFA 4RZ5A 3W7DA 2QCDA 1O4UA 3NEVA 3C2VA 3TQKA 3BG9A 4LVFA 4BI7A 1OFOA 3R89A 3ZWSA 5CZTA 4AHQA 1WQ5A 2G96A 4FNRA 4AXKA 2ISWA 1TPUA 4HKPA 2YSWA 2QDGA 3Q58A 4P2VA 2QUTA 5G2HA 3N9RA 3N2XA 2GVJA 3SGZA 5LNUA 3QRHA 4RKAA 3NPUA 1VPXA 2J9ZA 3W71A 1OFRA 3ELFA 4EWND 4PFMA 1KM4A 1AW2A 5D03A 1P1XA 4CCEA 4O28A 1VLIA 2J9XA 1H7NA 3QEZA 1C9DA 3STFA 2ISSA 5K9DA 3SSJA 1OHLA 4FB7A 1LLWA 2GQ8A 3N14A 1LRNA 4JTSA 3E49A 4AH7A 1T8XA 1P4CA 2JKEA 3SGUA 3W2UA 2V30A 1ZNNA 3GR7A 4DO4A 3E02A 5I3IA 3QM3A 1JCXA 3L5AA 4GUHA 3QJAA 4GUFA 2DZPA 1FXQA 4O17A 1DQWA 4LOCA 3W2KA 3L0KA 3MYPA 4IPIA 1HL2A 4L4LA 4MY1A 5D32A 2GVGA 3G3DA 1QCWA 1SQ7A 1TRDA 4MPQA 4DPQA 5CPLA 1W31A 3UZJA 1KLYA 1WAUA 3LLDA 1F5ZA 2GJNA 2FJKA 1D3HA 1P0KA 1FDJA 3A23A 3TJLA 1GEQA 4XWUA 3W88A 1YYAA 2P1FA 4HPXA 4WOQA 3S1WA 2DZSA 4S2CA 5EA9A 2TPSA 2FPVA 3GB6A 3SI9A 2WO5A 4JYFA 5BMWA 4CCDA 4MYXA 4NX0A 2AGKA 4RCXA 5E0KA 1K7XA 4E2DA 5IBXC 3M16A 3BV4A 1ICPA 3FS2A 2Y7EA 2QCLA 3IEBA 3O05A 2CLEA 4UTLA 3NQGA 1MXSA 1XBYA 4JTUA 2WJZA 3LTPA 3GZ3A 1AW1A 1TO3A 4QM1A 2DJXA 3B06A
chains in the Genus database with same CATH superfamily
3VA8A 2WW5A 3REQA 1J96A 1L6FA 2VD9A 1SPQA 2O7QA 2Y88A 1CGWA 4NIRA 1QOQA 4LT9A 2R1PA 2YYTA 2VX4A 4K37A 3KVKA 4IICA 4ZVJA 4AISA 1H60A 2CXGA 2G8ZA 2CHOA 1LROA 4HYWA 3UJFA 2Z00A 2YL5A 2HBXA 3PHAA 4GX9A 3BCDA 4Z2JA 4AVNA 3WLMA 3D3AA 2QDHA 1MZRA 4ALDA 1FWAC 2BVDA 3BLKA 4L5ZA 2XN2A 1LBMA 1CCWB 1AMYA 3U57A 1Q66A 1ONEA 4LBUA 1HL9A 3VDCA 4AZ6A 1KBIA 3E0VA 2CKSA 4JN7A 1H7PA 2OLSA 2PF8A 3CPRA 5J04A 3VI2A 4KWOA 2PWVA 2RAGA 4NL1A 1V51A 4UCFA 2BOGX 5D2YA 5CBJA 3MZ2A 2YCIX 1Q65A 3EMCA 3M0ZA 4PL1A 1KM1A 2PDGA 1XLLA 1E3XA 2E9BA 3UERA 4M3PA 5I77A 1Q5MA 3L2IA 3TC6A 1CNVA 4Z2GA 4EANA 3MSGA 4JN6A 3F2CA 3L23A 3P60A 1E51A 2KZHA 3IJQA 1KFWA 4KWSA 1KCKA 3ZWTA 3DCPA 3LS9A 3N2MA 1GUVA 1UW9A 3ITVA 2X42A 3DC8A 4ZA0A 3WSUA 3IUDA 1K3UA 4GVFA 1XRSA 4WUIA 2D3NA 3EWBX 4K8HA 2XN0A 3L2MA 3TYZA 4QG6A 4EVZA 3EXSA 1FQ0A 1Q3NA 1XRFA 1MDLA 4FIRA 3CUZA 1DWAM 4OTKA 4C1KA 3THUA 2WV8A 4PMXA 5HMSA 3TA6A 1OCNA 2ZUWA 1UUQA 4ZXLA 3SCNA 2F84A 3KBMA 3K8KA 5A2CA 1R3VA 1EO7A 5CGMA 1AH4A 2DSUA 4CN1A 3OGSA 4AFYA 1A5LC 2CZDA 2BOEX 5A6LA 3I6TA 1WOAA 4S3CA 4O0QA 3AXXA 3BSHA 4D6JA 1YXYA 4H6QA 2HCVA 3EPNA 5B80A 2C1GA 4XD5A 5TAOA 3ITTA 2DSKA 1PPIA 3ECQA 4NI3A 3MU7A 2QUUA 1G4SA 2C18A 3LN3A 3O16A 4FNUA 3UZYA 1EDTA 2X09A 2WNNA 1TPFA 4S39A 1US3A 4W7WA 3NWRA 1RALA 2IPGA 3GH4A 3RX4A 1VBRA 4ERAA 4HYRA 5I3DA 2BXZA 2C1HA 1EP1A 3R13A 4PEKA 4JS3A 5CSUA 3IGHX 3S2MA 4KGJA 2JF6A 1KFCA 3HPZA 5A6MA 2CHRA 5HNUA 3NM1A 4RK8A 4OIFA 3C3UA 3GTXA 4YTSA 4V33A 1B3VA 3SO7A 4Z2IA 1VGAA 2IQTA 2P76A 1GGOA 1XV8A 4W85A 5FF2A 3DYPA 3PUEA 2QPSA 1O68A 1XYZA 1C9WA 2QULA 3ENLA 5D05A 3I7QA 1B31A 1OX6A 3SBFA 1CT5A 1A53A 3DENA 1UD2A 3ABRA 5A94A 3TW9A 3LM3A 4XZIA 3HPXA 3QY6A 1XPYA 1EQPA 1S2WA 1E1CA 2VXNA 3ITXA 5AYYA 2Q3OA 3W07A 1XF0A 3B8TA 3H7UA 2OR2A 2BGSA 1NDWA 3UGRA 2RDUA 2Q8ZA 4PGLA 3KWXA 2HWGA 3NNTA 2P3ZA 3MI6A 3A3WA 1LOLA 1SFJA 3G6MA 1W2PA 3GS6A 1C93A 4IG2B 5HJYA 4LUSB 1MDRA 3H8AA 3M5XA 2QCFA 3AIBA 4CQAA 4ROPA 4NAFB 3N12A 5I02A 1WAWA 3T2OA 1FRBA 4I8YA 2Z2UA 2ZRWA 3L0GA 1B9ZA 1V03A 3LGEA 4DJFD 4H9UA 3QGKC 4TQTA 1ISZA 1LQAA 1UZHA 2Z29A 3WN6A 3R58A 4HMEA 3VTRA 4FS9A 1YX1A 2VGFA 3QOKA 2QCDB 3WF0A 3ISIX 3BJSA 2FZNA 3DFHA 5GVJA 3W7QA 3ZR6A 4KRTA 2OODA 3AFBA 1JZ6A 2BWGA 2R9RA 3IVUA 5DLCA 4EPKA 1RA0A 3RN6A 3STGA 3GYEA 4PMZA 2ZUNA 4IH3A 3PVFA 5HULA 4LU0A 3EMZA 3QV6A 3SCUA 2IXUA 4GNJA 4DBUA 3PFRA 2P88A 4OUEA 2F6KA 4MNJA 2J8FA 2XZ9A 3DHFA 3R0KA 4XBJA 1SM9A 1EO5A 4UFIA 1QW8A 3WUGA 4HPJA 3ANVA 7TAAA 2G41A 3V18A 1UR8A 3Q65A 1FCVA 3HJZA 5H8PA 1I0BA 2YA0A 1GJWA 1NIUA 4AX7A 1RVGA 4W8AA 3KVLA 1HQTA 2PTYA 4IMEA 3M1ZA 3L7RA 1XLHA 3MS8A 4KRUA 2QPUA 4XIAA 4AHPA 3S5ZA 3KM8A 3ONCA 4M80A 4JKLA 3LXCA 2PD9A 1LRQA 3ZLFA 4A05A 1V02A 3QF0A 1OX4B 5J8LA 3W70A 3WFLA 1TQXA 3BANA 3BZGA 3G77A 4WJXA 3VILA 3VDBA 3NEHA 1MMFA 1Z48A 4Y2WA 3ID7A 3GD6A 2IW0A 1ISVA 3UJSA 1C90A 1IEIA 3UGVA 1WPCA 4C65A 4WDXA 1EF3A 4PCSA 2VUYA 3EOOA 4HHHA 4ZQRA 2RDWA 5AHLA 4UB9A 4BY3A 4DRSA 3S46A 3NL5A 3W37A 2E8ZA 4WOZA 3AHZA 2ZX5A 1N55A 2YGYA 1UG6A 3VO0A 3SURA 1D3GA 3KOZA 5HPOA 2WSRA 5B7YA 3AC0A 3NSMA 3N4FA 1W5OA 3N2TA 2GZXA 4CLMA 3LEPA 2Z7GA 1MQRA 3W87A 3S2LA 2DVXA 2WLYA 4S23A 3OVRA 4JIEA 6A3HA 1M7XA 3H6OA 4AZCB 2X1SA 2GGEA 2X1UA 4PUUA 1A3XA 4Z1AA 3WCZA 3WH6A 1ISXA 1UD8A 4Z1DA 2F9RA 2PLMA 1R0MA 4WDUA 4LY4A 3W1NA 3TR9A 1LJYA 4GQBA 1E4IA 2WSYA 4LY8A 4AWSA 4AWTA 3CUIA 2YYUA 4W7UA 1EQCA 3VKCA 3NQBA 5U7SA 3ABQA 5KZDA 2ON3A 1VEOA 4MZYA 3LHVA 1FP9A 2XSBA 4GXPA 4GD0A 2DEPA 1ZAIA 3RG6A 3IIOA 4M29A 1F6PA 2J7HA 4RNIA 4ACYA 2VI0A 3HG4A 5FAJA 4ZFMA 4DN1A 3P62A 3NJ3A 3O1NA 1F76A 2NWRA 3WFZA 4B4HA 5GJNA 1IXOA 2R6OA 2WAGA 3B9NA 3GXMA 2HROA 5G1TA 4HA0A 3UCCA 3P80A 1ITQA 7ODCA 1BWLA 3CL7A 3AIQA 3UETA 3PWIA 4KWVA 1BRLA 1VENA 2C71A 1OF6A 2H9AB 3AI0A 3CV6A 3HN3A 3W6YA 5A6SA 2CFFA 4CQ8A 3SGGA 3QC3A 5DY2A 3LMYA 4R9XA 3VGEA 2D24A 5C9ZA 4D72A 5BOFA 3FVDA 2NX9A 2H90A 3P7YA 4LTSA 2AL2B 4FZIA 3W7RA 1KV5A 4RE2A 3WQPA 3QPZA 4DELA 4ERIA 4XAGA 1E1CB 1Y5VA 1GQLA 4LBRA 5HINA 1H7XA 2I57A 2QS8A 4B3KA 2J77A 3AYSA 1LORA 3VZYA 5H2ZA 3IIXA 5DRCA 1RR2A 1ADSA 3G22A 3EYPA 3TIMA 3DHPA 3VNMA 2I9UA 3S6OA 1DOSA 1AW5A 4JTAA 1LYXA 1O5KA 3EDEA 2O92A 1V6XA 4HU8A 2J7CA 3WD0A 3UFYA 5K9XA 1KBBA 1IXQA 3VGGA 4I9TA 1DJQA 3BK0A 2RFGA 1R3WA 1W9BM 5CSRA 1EC8A 2JKAA 1BVZA 1TV5A 4CVUA 1IT0A 4IFKA 1B3OA 4PZVA 5GNYA 1XYMA 4CNPA 1WKYA 4GISA 5CC5A 1TFVA 5FF3A 4W88A 1WDSA 1UHVA 4EXBA 2CU0A 1P6WA 4GZ7A 3W73A 2GUYA 4KW2A 4NI8A 4DI9A 3UWQA 5GNZA 1TPC1 2CLOA 4ICCX 4CEUC 3SUSA 1W3TA 4U4MA 3LCFA 4GY1A 2AAMA 1Z3NA 2B31A 5MKGA 3TDFA 1W9DM 1GPWA 2YB4A 4O18A 3KXQA 4QE1A 1GQJA 2V0TA 4X63A 2Y62A 3HV8A 4OKDA 1GQKA 5CC7A 1MUWA 4OV9A 1XIMA 2WSKA 5CZJA 4XZBA 4NQ1A 3FK4A 1XYFA 3AS2A 1AJ0A 3RDKA 1QHPA 1QMLA 4UMCA 3VX1A 3CHFA 2V82A 1XC6A 1RK5A 3USZA 3W1TA 2I7GA 3VOJA 1QFEA 2IPJA 3L21A 1FFRA 1VCGA 2GYIA 4IOTA 3VIKA 4H04A 4XB3A 2OZ8A 4OOZA 1R9XA 4RNJA 3LNMA 1K4HA 3BC9A 4YTRA 4MYAA 3TC7A 5DO8A 4LF1A 3C2FA 4GQ0A 3DYOA 1CXKA 3DIPA 2BVWA 1VQTA 3SECA 3C2OA 2J24A 4J9JA 3HZ3A 1HVQA 3IWPA 1XG4A 4N4QA 3EAUA 2FQIA 3RF9A 3TYAA 1GVIA 1PJ9A 4JQAA 4IGHA 4EKJA 1UP2A 4YTTA 1CI1A 1XD1A 2H3DA 4L6DA 2DQXA 3B0PA 5IOBA 2I5QA 4IQEA 5LIWX 1MI3A 1ZJBA 1QUMA 1Z8AA 3E2RA 1S5TA 1R3TA 3TN6A 2E5DA 1TA3B 4ACZB 4FHAA 1EB3A 3E2SA 4MDOA 4GMEA 6REQB 4TX8A 3QTPA 2NX3A 2BODX 4WJ8A 2X16A 1OFEA 4IJRA 1FH7A 4RR4A 4UTHA 4CU8A 3AWNA 2ZA3A 2TAAA 3LPPA 3M6DA 2V9DA 4GA8A 1XR2A 1LBLA 1W1TA 2VEPA 1TPWA 2AMXA 2PCQA 1OD0A 1AG1O 5BU6A 3N29A 1V93A 2UY4A 3I4EA 1UP0A 3W2LA 2FB2A 1D7KA 4H2CA 3UESA 3UWVA 3VM5A 3TLQA 2YKKA 3QKEA 3DECA 3VABA 3FV9A 4LWWA 3WBEA 2CBVA 3T55A 3UXKA 3KLKA 4UBPC 2X0HA 4QJ1A 3OVQA 3E0FA 4AZIA 4HSHA 2ZRUA 1FA2A 5I3FA 1D2KA 5FACA 4DAFA 1XG3A 5XIAA 4QX4A 1TB3A 2NT1A 1PL9A 1BWKA 2W61A 2WCGA 3NGJA 3W38A 3FY1A 4QTGA 1WZKA 4HOXA 2Y7FA 1I4NA 5TQLA 2DZXA 2VQUA 2PWHA 1WYIA 4ZOEA 4XTIA 1XIJA 4GYFA 1EZ2A 3P84A 4B5WA 1GQIA 5K9CA 4ZSTA 2QVHA 4ZR8A 4A29A 3KS6A 3G1VA 2WZMA 5G2IA 4IMFA 1RXOB 3I3DA 1VFTA 3PK7A 4UMBA 5HQMA 1R2RA 4CU7A 3LHTA 3AAMA 5CPOA 2QXWA 3DG7A 4QAIA 1ZSXA 1TCMA 3UBPC 2QKFA 4DBWA 1BQCA 1MZHA 4N42A 2PA6A 2OO6A 1BGGA 1SZFA 1LQ2A 3ZJ6A 1G01A 4NNBA 5I78A 1EEPA 1QO5A 2E40A 3GE7A 4NYYA 4M8UA 3WLRA 4ZE5A 5AC8A 1SO3A 4S1FA 1ZHAA 4EIVA 3RCNA 3ONBA 2Y5EA 2REQB 4FLRA 4E8GA 4DF2A 3BAXA 2VEGA 2XFRA 4QGCA 2Z2AA 3AZRA 4DXXA 4IFOA 1C7SA 1ZJIA 2QCMA 3CUHA 4RNFA 3RRXA 3B3DA 1FH8A 3TU9A 3M0KA 2ZDSA 2NVCA 2EF9A 1P7TA 1XLBA 3GNNA 4L4OA 1GJPA 4QIUA 1QXLA 1MEIA 3H2CA 1FCBA 3GXFA 2YJQA 2VD8A 2WPBA 1ZP4A 4LCQA 1G4EA 1MW1A 1M68A 1LQ0A 2A21A 4S3KA 5BMXA 2WZEA 3QFEA 5GNXA 2WPGA 3KLLA 1T99A 3B8DA 4MWAD 4GJIA 1A5OC 4IL2A 2ZFAA 1C8XA 4JY9A 1RCQA 1BHGA 5DMMA 1F3EA 3RM4A 1C29A 1EJXC 1E15A 4HGXA 2VFIA 4JFWA 4U28A 1QO2A 1EC7A 3L66A 1NY1A 2PAJA 2QGYA 3MKKA 2V8ZA 3V1HA 4CUCA 1IWAA 2QNEA 3AYVA 5CKSA 2GFTA 5AFDA 1O60A 2QJIA 4HT3A 1P6BA 5FOOA 1JCMP 3MQTA 4FXRA 3CH0A 1HKMA 1PZ1A 2IPFA 1REQA 3OIXA 3CLMA 4AX6A 1EUNA 2XFWA 1S2AA 3NDYA 1LL7A 1KM3A 1ITUA 1H4PA 3LXAA 1TWZA 2YCEA 2YL8A 2X40A 4M24A 2B0MA 4B5UA 3TA9A 1BQGA 4YIWA 5HR6A 3SIZA 5KMYA 1TJ0A 2VCBA 3K46A 3G1RA 5FL0A 2Y61A 2POTA 1TUFA 1N8WA 2V2DA 5REQA 4XD3A 4NRSA 3TNOA 2VM8A 4DJFA 1D9EA 3M47A 3ZVHA 5LNVA 1EGZA 3W1LA 1GOWA 3Q94A 3HBLA 1S5WA 4EE9A 6CGTA 3MV11 1OK4A 4HK7A 1TWIA 3E96A 5F1UA 2ZX9A 2Z1KA 2PEVA 1AA1B 1P1MA 4ORIA 4ZODA 3OZOA 1DJZA 3MY9A 1PHQA 3CPUA 3TTQA 4XAFA 4V1XA 4FXSA 4GBUA 1B30A 1RA5A 1VFSA 3GU9A 1MXGA 1W5NA 4EPDC 4EWJA 2V5DA 1M1BA 2EPLX 3MPGA 3PM6A 2ZBTA 1GW1A 2DW6A 1YMYA 3W7CA 1TZ9A 3NZQA 4ZB2A 1O5QA 2QVNA 2EJ1A 3W1MA 1QATA 3R10A 3H2NA 1DJHA 3OQ8A 1Z44A 3QHMA 1E6SM 2GDVA 1LG2A 3WF1A 3ALGA 1DEDA 2UBPC 1QU4A 5E1QA 1XRTA 1M6JA 1GZJA 1HJVA 4Y9PA 2W27A 1TV2A 3ITLA 3T0DA 5C8BB 3VDAA 2CLHA 1TPDA 2ZX6A 2W0UA 4U31A 3AHVA 3C3NA 4GABA 1JL8A 2NQ9A 3HPAA 4RZ4A 1TPB1 2FDSA 1K6AA 4AEFA 4K2SA 4NZ1A 2BY0A 3FW6A 2ISDA 4KWWA 1J10A 3N18A 3TSDA 3MZNA 5J5DA 3KTXA 4IQJA 2WBKA 3RK8A 1FWSA 3IACA 4GRSA 3N6JA 3EX6A 3W7KA 4H7ZA 4AVFA 1HNYA 1Z41A 3HG3A 4HA1A 2HK0A 3LZ5A 3NL6A 1VIZA 1OF8A 4MOZA 1YXCA 4UFHA 1XDMA 1R2SA 5EFFA 2YA1A 4NP7A 5HDRA 2J47A 4MZ1A 4UZUA 3WZ0E 3LHUA 5PTDA 3VGBA 4KT2A 4Q4QA 5A8OA 2BASA 1F9CA 3PBGA 2JGQA 2UY5A 3JS3A 3M5YA 3I6RA 1PDYA 4AWEA 3GXIA 2CCRA 4Q8VA 3ZQ9A 1H1YA 3GFYA 2JE8A 5AHNA 2ZUTA 5K2ZA 1OG6A 3U7BA 1MFUA 4LUTB 4WXZA 4DUOA 3G0XA 2HS8A 3WJZA 3NYDA 2XWEA 4N4PA 3JZUA 4MWAA 2IQ0A 4HTYA 4R53A 7PTDA 1LWIA 2RJHA 4NJGA 2A0NA 3DFPA 1KM0A 4GO8A 1ZB5A 4JNYA 1VFHA 3CB3A 1I8JA 4IP5A 1NFPA 2W91A 4JYDA 3PTDA 5AYBA 1FHDA 1M04A 4R88A 5L6UA 1EGVA 1XGEA 3OZYA 5EGRA 1U5VA 4JHMA 2BDQA 3TFCA 4HA3A 1XKJA 4XX6A 4GIAA 1CXHA 4HK5A 3M5VA 5E09A 1P0DA 3G1AA 1BEUA 3E2QA 4F40A 3GW0A 3O6YX 2GJXA 1YQ2A 1V4YA 2PSNA 5TD4A 3KW3A 1Q6LA 4PMYA 3F7JA 2XVLA 4FMVA 3SN0A 3WQOA 2D2JA 5EMJA 2PDFA 5DY3A 1IGSA 2FKPA 5CGTA 3UYIA 2B7OA 5T9CE 2E6AA 4YVPA 5C9UA 2Y5SA 3P67A 5D4YA 1E40A 1DE5A 1NDYA 4ZO7A 3AICA 4RV8A 5L9FA 1AD4A 1J01A 4TXEA 2FTPA 4G7EB 2GGIA 1R30A 2X2GA 2WSPA 3K30A 4DXKA 4IGNA 4HIBA 3ABOA 3IVSA 1GYNA 3N17A 2FFIA 4NXKA 2BY1A 4A21A 5BW6A 4PTWA 1QPRA 5FJTA 3M44A 4XZWA 1UJQA 1J0YA 3R0DA 1XDLA 1VRXA 1Q7MA 3BAJA 3OODA 4KFPA 4ATWA 4CD6A 2NW0A 1TJ2A 3O63A 4ZO9A 4NASA 1GWJA 1BG4A 1A3HA 1JCTA 1HGWA 3P81A 4JIIX 4L64A 3VNLA 4TX6A 4AZ5A 1E6NA 1J2WA 5BNKA 3VD9A 2PWFA 1JDAA 4A3YA 4HB7A 5LHFA 1ZZMA 3NTYA 5BXTA 2BHZA 3SRDA 3N6QA 4FF5A 3P8IA 2LLEA 3TQVA 2WMHA 4ATDA 1PZ3A 4K36A 2C0AA 8A3HA 1I2OA 4PH6A 5IXEA 4B91A 5FCZA 3CWHA 3G1FA 4KFOA 4MAVA 3B8UA 4JL1A 3M64A 2QAFA 1A4MA 3L4XA 3W9ZA 1IZCA 1G9HA 1NFBA 1JNDA 1M53A 1LP6A 2VHLA 2XFFA 4Y8FA 4WX2A 1XLCA 4MUZA 1PTDA 1UYQA 2EAWA 4RV3A 3F5JA 1UWTA 4OZOA 1I2QA 1JD7A 3WQVA 3K4AA 4B9ZA 3HQNA 1V3HA 3HGSA 2CLKA 2Q6ZA 3ARXA 1OYCA 1O5RA 2QAPA 4I5XA 2OSYA 3UVAA 1XYLA 1I1XA 4GKLA 2OB3A 3NO3A 1SJCA 2V2CA 3WNLA 1VP5A 1BAGA 3S83A 3SY5A 3MI2A 4KWUA 3SCPA 1UD3A 4HN4A 2IXVA 4GACA 3ITYA 1W17A 1UIPA 3A64A 1XGDA 4EF8A 2Z1BA 3MP5A 2G3IA 4LB4A 3N4EA 5ABHA 5G1YA 3LM7A 4AEOA 3CYVA 2NQJA 4IHCA 4AD5A 5C55A 4M1RA 1FY6A 4GLEA 2PDLA 2OU4A 3M0VA 3LV5A 5EMYA 2DH3A 1J79A 1J0IA 1Q4NX 3B0VC 4Z1YA 4U5IA 3FXYA 3M0XA 1HUVA 2XIIA 1PBGA 3L9CA 3TYUA 4OE7A 1SO5A 4UOQA 2OO0A 4R3UA 2C15A 4DUVA 4RXFA 4AY1A 1K77A 3S9ZA 3NEVA 1X6LA 1AD1A 4AHQA 1WQ5A 1ITCA 2G96A 4IIGA 3S47A 1RCOB 2ISWA 4ZO8A 3CQHA 1O12A 3FAWA 5G2HA 4AYSA 2XINA 3MA8A 5LNUA 3QRHA 8RUCA 4RKAA 2ZUMA 4EWND 4PFMA 1ZUAX 1Q7QA 4L4PA 4C7GA 3F4CA 4NG3A 3QEZA 4L9XA 4P7NA 1C9DA 3G5EA 3STFA 5K9DA 3SSJA 3CHDA 4FB7A 4S3EA 1LLWA 1VPYA 3N14A 1LRNA 1KRCC 2PLCA 4JTSA 2G50A 1P4CA 4JFVA 1E9IA 3GNOA 1JYWA 3B9AA 4G6CA 1IR1A 4DO4A 1WXZA 1Q6CA 3E02A 1JCXA 3L5AA 4GUHA 3L0KA 5M5DA 3CO8A 1SQ7A 3BLOA 3A4WA 5CPLA 4L80A 1W31A 3UZJA 3CT2A 1WAUA 1B2YA 1OCQA 2EEXA 1UOKA 3LLDA 3P0XA 3WQGA 1F3TA 2PDMA 1P0KA 4J35A 3RIKA 3A23A 2AKZA 3BAYA 3IAPA 4JTRA 1UD4A 1XJBA 2WCSA 3W88A 4HPXA 1PX4A 3S1WA 4Q8TA 4DX3A 2TPSA 2FPVA 2J62A 5I2UA 4OVXA 4XO6A 4RDVA 2EO7A 1O1ZA 1KC7A 2E8YA 3B40A 5IHRA 5A8NA 3GR4A 4IL0A 4B9YA 1TWSA 1XLDA 1AQFA 4RCXA 3GFZA 1DWGM 5E0KA 4E2DA 3M16A 2Y7EA 3IEBA 1W6TA 4QRNA 3AXKA 3W26A 4UTLA 5FJOA 2XH4A 3NQGA 4LAKA 4MADA 5A6KA 3GVVA 2D0FA 4LALA 2WJZA 5A1AA 3GZ3A 1TO3A 4QM1A 4K68A 1HZYA 3LPFA 3T0TA 2OX1A 4C6IA 4UZSA 1QWGA 1V3IA 2Z6IA 3KZSA 3NUKA 3NZPA 1C3FA 4L61A 4PMUA 2BY3A 1PXGA 3BW2A 3UNDA 2VZTA 3K4DA 1US0A 4X2PA 3WLJA 3PWGA 3TROA 3MDWA 5H8UA 1DQUA 3FDKA 1RLCL 3WQEA 1ISYA 1QVBA 3MWAA 5D04C 3GU1A 1ZY9A 3LLFA 4I3GA 2VZUA 1HKIA 3VOIA 2PDYA 4XVDA 4GNVA 2XFYA 4B5VA 2F2HA 1LOQA 4GIRA 4XBSA 4X60A 3UQNA 2OEMA 2PWGA 2DY3A 4E2BA 1GHSA 3CV2A 3N34A 2D22A 3LRMA 5H6HA 4A2RA 1VHCA 1ECEA 2RHGA 4GZJA 4YCPA 2J66A 3PG8A 2XN1A 1UJPA 3V35A 4GIEA 1UCWA 3NZGA 2QIWA 3MMUA 4XZNX 3W00A 3CHCA 3GG8A 1ZENA 2HXTA 2IKHA 1BYDA 3ABSA 1XSJA 3NDZA 2WSQA 3T0CA 4QISA 1TIMA 2J4GA 4QLLA 3VNKA 1PUDA 1MO0A 2PTWA 3BZJA 1Q8AA 2YX0A 4KEZA 4D1IA 3SADA 1A5CA 4P8XA 1DJGA 5FF4A 1K8ZA 1ZAHA 3VKKA 4BF9A 2KAUC 5AOUA 3R7MA 4F0MA 4EPBC 1CGXA 1QBBA 1A49A 4DXVA 2NXGA 5GJMA 4QS5A 1J93A 4JFSA 1ONXA 3LQGA 3HB9A 3PBMA 2QPXA 4HNOA 5HUOA 5A6AA 3SN1A 3VFCA 1VYSX 3DUGA 4WRHA 2E1DA 3PZIA 5AZ1A 3ZT6A 1KM6A 1K9FA 1PIIA 1EH9A 1V5XA 4IPNB 2PLKA 4Q33A 1BXNA 1RP8A 1FWWA 3F1QA 4M7TA 3AROA 3W81A 4O1FA 3H22A 3GYCA 4F0SA 3JVAA 3N9SA 3GC2A 2FTYA 2O9TA 5KEZA 4AZHA 2WJFA 3BXWA 4FXFA 2WC4A 4WSKA 1DWFM 1EIXA 1PDZA 3DGBA 2JF7A 2O9RA 1LZOA 1YBQB 5FSDC 4MWAC 4C60A 3T0AA 2VDHA 3EA3A 3UYCA 4J3XA 2V3DA 2YXGA 4Z1BA 3WMLA 3WLLA 3IJLA 4U3AA 1JPDX 3ANYA 4NNAA 3FSTA 3DZ1A 5A6TC 1ONWA 1TV3A 3NQCA 4AXNA 3CQKA 1BXBA 1J0JA 2OZ3A 3LENA 1KTNA 4DJEA 1XXXA 1H49A 3AIVA 3EWUA 4YJ5A 4DO7A 5C6MA 7TIMA 3WD4A 2Z1XA 3PC0A 3NR0A 4Q4RA 1YPFA 3T7VA 3BG3A 4PODA 2P8CA 4J3WA 1SR9A 4DY1A 3PFMA 2V5KA 2YCLA 2WMGA 4TV5A 1ZBWA 3LBCA 3G6LA 3D46A 1AZ1A 3H23A 1TZ7A 4LGXA 2DZUA 2EQDA 4BKNA 1MQQA 2PDPA 2HNHA 3WNMA 1FWTA 4C5YA 4O10A 2ONEA 4PULA 3IVTA 4YVXA 5EFDA 1KA9F 2WOQA 2G3FA 3LTYA 4GY7A 3H7RA 3ZSSA 2H8XA 3IJ6A 5HBFA 1F8MA 3WMSA 3T40A 3H54A 4H9MA 2IPWA 1AUSL 1CZ1A 1QNPA 3NFUA 2R94A 2WZTA 4OUIA 1KGUA 5IFPA 1W5MA 1A5SA 4IQLA 4DEFA 3SSZA 3EDFA 5C7VA 4GQGA 1X39A 4UOZA 3EOSA 4PCTA 4JTJA 4CNSA 3R1ZA 4L6OA 1J8VA 4GINA 1WZAA 4ZGYA 4IT1A 3EX4A 1OT2A 1XICA 3W2NA 4P8WA 2VC6A 3TAOA 4Q8MA 3WH8A 4IX0A 4PCFA 3BGJA 2NV2A 2Y24A 4F0KA 5EMLA 3VNZA 3KDNA 2PLJA 4MY8A 4NAEA 4YS1A 1IE7C 4WY0B 1XH0A 2VO5A 1KFEA 3W2JA 1RY0A 2D20A 2ALDA 4NF7A 3LCIA 3M7SA 3SQSA 5E70A 1IEQA 4H9VA 4LUIA 3K1DA 3LZ3A 1DE6A 1HX0A 1H5VA 3DFOA 3W02A 4Z0SA 1JDDA 1OINA 3PP7A 1UWSA 2ZRYA 4DZHA 1L6SA 3VU2A 1X96A 2HEJA 3V1PA 2QW5A 2G3MA 2Y8VA 7A3HA 3QGVA 2Z1VA 1ZALA 2XH0A 3MB9A 5LXXA 3PUGA 2GQAA 2YCLB 1VFUA 3SQLA 5HWNA 3DOPA 3PBUA 3B04A 3O15A 1ZGDA 4I5RA 4JPGA 3BMXA 3GDTA 4TVCA 2EKCA 4PMOA 5BOOA 2V5JA 1R5YA 2NLYA 3BGGA 3H53A 1YW1A 5FJIA 2YL9A 4L6HA 1QOXA 3MCNA 4CEXC 3GXNA 4O8RA 5MF5A 1AJZA 1F7BA 4W5UA 4JX5A 2DZVA 1EA9C 3PPHA 3VXGA 3DYMA 2ACQA 1KBKA 4LSBA 3AOFA 3WK2A 1FWEC 3U7VA 4LUJA 3NO5A 5LIKX 4MB1A 3POCA 4O13A 1J9YA 3OYXA 4ZO6A 1TZZA 1XLJA 4S38A 3IIVA 3OG2A 1VJIA 4NNCA 3WBYA 4AD3A 4YXGA 1PTAA 4DJDC 4OHQA 4D9PA 1SU5A 3U3HA 4C90A 1J0KA 3VIJA 4A22A 2BGNE 1M3UA 5EMUA 3KVJA 4GUGA 3THCA 3TXZA 4UTMA 4QAWA 3PN8A 4WEVX 4R7WA 2R82A 3C0JA 1JDFA 3CC1A 4UR8A 5E9AA 4E2OA 3GDRA 2RGMA 3LERA 3CU2A 4PUNA 2XH2A 4W86A 3U2OA 3FSUA 2OGYA 2XH7A 1JPHA 3IJDA 2HJPA 4UQ9A 1QAPA 3KRSA 2QDEA 1GVRA 1D8CA 5ECVA 3MHGA 2UZ9A 1K1DA 1P0EA 1XQKA 2VEFA 3FJLA 1FKXA 1UQZA 2E6DA 2W66A 3GG0A 4ML9A 4GYPC 2PODA 3CNYA 3OIHA 4UTUA 4QQ3A 2UY2A 2OTDA 3CK5A 4O16A 3S0CA 3PTMA 5D9PA 3I10A 2GJRA 3OPSA 1NU5A 4HK6A 2VL4A 1Q85A 1L6GA 3TONA 3N73A 4ADUA 4LAOA 2EJAA 1JQXA 1EF2A 3BW4A 1EC9A 1LLOA 1UC4A 4LVGA 4S3BA 1YXDA 2QF8A 3CL6A 2GVLA 3TJ4A 2QUMA 4K8GA 1Q4WA 3CZJA 2ZXDA 3AYTA 4MFDA 3P3BA 3C0SA 4DIAA 1V6VA 5LNRA 3AXMA 3I3BA 1XBVA 1K03A 1ENUA 3KP0A 3OEXA 3EKLA 1LF1A 4MWAB 1JGMA 4B2DD 4JDBA 3QZAA 1E0UA 3L4VA 4ZB0A 1ML1A 2QUVA 1IF2A 3KRZA 2C3ZA 2CZEA 4URIA 5I5RA 4F4RA 4PN2A 2RKXA 1S39A 5EU9A 1E9LA 5CPTA 3WLTA 4PE8A 4WKHA 1XIBA 3WIJA 3NPXA 1J11A 3QV7A 3QYQA 3IS4A 3A4JA 3EX1A 2Q3RA 1KKRA 3FXGA 2QV4A 1EGMA 3C86A 4LYRA 5DANA 1CEOA 1X8CA 3P5ZA 4W8BA 4WZHA 2BBFA 2FVLA 4J3UA 1GQNA 5D2XA 2HVNA 3ARPA 4O53A 4LCRA 5MHBA 2WJDA 2QEZA 3GDMA 4PC8A 4L4MA 2R1KA 4GFSA 4QITA 2MANA 3SJNA 2XIBA 5I06A 2FHFA 1GORA 1OC6A 2E6YA 2Q09A 2YR1A 1R3RA 2QJHA 3EWDA 3GVRA 1W9UA 3MT1A 3W86A 4JDYA 3FKRA 3ZR4A 4AZCA 4U33A 4M1BA 5I7GA 1PCWA 4ZFCA 4K39A 5CPMA 2DQWA 3MO4A 1JUEA 4TUFA 3BLEA 3SDOA 3AS3A 1I9CB 3GH7A 5JMUA 3OP2A 2XUCA 1A50A 2XPKA 1A0DA 1YTKA 3N2OA 1NF7A 4US6A 4C6PA 1F2JA 3WQ4A 3H4WA 3M0JA 4LFYA 1R3YA 3L4ZA 5EBUA 2G0WA 4J3TA 1PKNA 4RZBA 4J5NA 3N13A 3TWBA 3QZEA 5DT5A 4PUEA 1NOUA 2P5NA 5KZEA 2QMKA 3G18A 1CB7B 4L9ZA 1AQHA 1B3YA 3D47A 2XWDA 1XUZA 5FF0A 5FD0A 3GHUA 1W3HA 3UPMA 3W22A 4AD0A 4BWLC 3AS0A 5BZAA 4GG9A 2GK1A 5DEZA 2FB3A 5CCZA 2PURA 1C91A 2XIQA 4Y9AA 4Z2KA 2HISA 6ALDA 5EBAA 3AJ7A 2HSAA 1UB3A 4YLWA 3OBEA 3CIXA 4KCTA 4JKKA 2W4XA 2PDIA 3GWQA 4K3ZA 4A35A 3IIPA 1E0XA 4HU3A 2PDCA 3QSRA 2OG9A 1PKLA 4PSRA 3CYJA 4UNLA 3S2CA 1SZRA 1YPXA 5F4WA 1Q6GA 2E67A 1PX8A 2RH9A 4Q6XA 3SFWA 2VUNA 3WF3A 1KRMA 5LIUX 2W5FA 3S4TA 3IIZA 1P48A 1XCXA 1GYMA 2I5IA 3DN5A 1TSIA 3WX7A 4EXAA 4I8DA 1AL7A 1N8IA 4XZLX 1A4LA 3PZUA 3CUGA 1TVNA 2PWDA 3NOEA 4CNUA 1M7PA 4CNOA 4AB4A 1YNYA 3U2ZA 4TO8A 4REQB 4V15A 3PULA 2V2HA 1IIGA 4DHGA 3MKVA 1NM9A 3VKJA 4EXQA 2F7FA 3MUIA 4LS2A 2ISFA 3FFSA 4U5KA 1N7KA 1OJXA 3NQ8A 3GKFA 2OKOA 1XLEA 3VCCA 5GPRA 4CVWA 1KFKA 4FX8A 3V4BA 4LS1A 3R43A 5DBTA 3LV6A 4AMAA 1KBLA 2GJXB 3L4YA 4NZ4A 3PBVA 3EX3A 1V3MA 3CAVA 4YMZA 1T8QA 4B16A 1QDSA 5CPNA 3NXFA 4EPEC 5CC6A 3JU2A 1H5YA 4Y9NA 1E6ZA 4K6AA 3PSWA 4XUGA 1VYPX 2PF0A 2A7PA 1TRIA 3EA1A 2PDNA 3DGRA 5HANA 1QBAA 3GX9A 2HQAA 1EDQA 3SCVA 3C8NA 5FESA 4AF0B 3MC5A 4H1ZA 3PZQA 2X7VA 1ADDA 2Z25A 4HJFA 4F8XA 1G69A 3MUY1 1M7JA 2WK2A 3M7WA 5GJPA 1QW9A 1XGZA 4B4FA 1KBJA 5CLTA 1ME7A 2CKRA 4AW7A 6XIMA 3S5NA 4MUPA 4PA8A 4LYKA 4I90A 1L6YA 1R3SA 3HTWA 1R7AA 1Y7VA 3WBWA 4XZ9A 4HZ8A 4KERA 2WANA 1E5JA 2FDMA 1VEMA 2PU0A 4ZOBA 1HXJA 1K4GA 2C13A 1EPVA 4UTTA 1XD0A 1VC4A 4GVHA 4Q7IA 4X0NA 2NLIA 2AL2A 2GDUA 2R14A 3UG4A 1EJUC 5I3GA 1BSIA 1R2TA 2A6LA 4Z0JA 4QDWA 4PMJA 3RMJA 2BB0A 4K7VA 4D6IA 1ZRQA 2I1OA 3WK0A 1I6NA 3II1A 4O15A 4G1NA 2ZZ3A 4ICNA 1AZ2A 5C9WA 3BL3A 3V75A 4OECA 3KZPA 4UXDA 2CLLA 4KEUA 4WVXA 4PUMA 5AC6A 4CNTA 5HJLA 3AMKA 5CSSA 3H2MA 1TJ1A 1GTHA 4PMQA 2Z24A 3A12A 1PZ0A 1U1UA 2ZC8A 3PB2A 2Z0IA 2CBIA 4HBKA 3UXIA 1UOZA 1W8SA 3DU0A 3QPEA 1POKA 1R7OA 4KIRA 1YDYA 3W7GA 2X41A 4TR9A 1DWHM 4JQ1A 4TV6A 1DQXA 2ZOXA 3UD6A 1IEWA 2PPGA 1GOXA 3L12A 3BLFA 3F5KA 5C54A 2WVSA 4PL2A 3GDLA 3PSVA 4LC6A 2CWXA 5DRIA 1LBFA 1PWLA 3O8AA 3IUIA 3LCXA 2ZA1A 3KCJA 2DSZA 4XD4A 2YDRA 3CZEA 4W8LA 3BMVA 3CH9A 2C0HA 2VYOA 4KH2A 4PRTA 1TPVA 3VIGA 5I23A 5DQPA 1IXNA 5EY5A 3Q45A 4UWMA 5TNVA 3LPGA 3EXRA 4MKNA 1VRDA 4LC8A 1EUAA 3MVTA 4KS0A 4F2TA 1G94A 4AQLA 4XD6A 3EWXA 3PZTA 4TIMA 2PDWA 1OCJA 2PCEA 3WLIA 4FPSA 1TTIA 5EB8A 2EBNA 4YHGA 4BS0A 1MEWA 1EYEA 1QHZA 2V63A 3CV1A 2ZICA 3SRHA 3E5BA 3OA3A 4MY9A 1QI4A 1N8FA 4FEZA 3QR3A 3V5OA 4N02A 4JTCA 4IP7A 2X1IA 4CN6A 3G2GA 3SCSA 3RU8X 3BOFA 1X1NA 3EWWA 3GIPA 3OHMB 2WQDA 3H2EA 3GBDA 2CPUA 3MI3A 1JI1A 2GUBA 1VBJA 3O3RA 4UTFA 1IYXA 3C61A 4A3QA 5E5CA 3ZT7A 2FLIA 5ABFB 4MJ4A 2INZA 2TRSA 2V3GA 4Q4OA 4GI8A 2OYKA 5ABGA 4GBDA 1JZ3A 3N9KA 5F2LA 2W67A 1XINA 2PTDA 1QNOA 4KF1A 1T6MA 3G0UA 4H9ZA 3WDPP 1OFQA 2Q8LA 4I9AA 4FLSA 4M19A 2E68A 1F73A 4LH8A 1Z7AA 5DBUA 3PJUA 4A8RA 3ARZA 4TOQA 1CYGA 4GI6A 3GVQA 3DFQA 1QK0A 2ZZ7A 1RBLA 3ATZA 1TE6A 3JZEA 3UA4A 2XTKA 1TIWA 1NARA 3DFTA 3HURA 1WCGA 1W3LA 3L4TA 1TJRA 1DXFA 3W23A 3VD4A 3LRKA 3P61A 2HXUA 1MQPA 1JF6A 3OQEA 4DNMA 3KBSA 4W87A 4FAMA 4YTQA 1GVOA 4RDZA 3VVGA 5D09A 4S2BA 1DHKA 1VIWA 2WJEA 1PYFA 3GQYA 1OX5A 2WYSA 1OC7A 4RXGA 3NVTA 5H1WA 3PPGA 4GH3A 1Q6DA 2QCGA 2J13A 3UR5A 2V5BA 4QHRA 4EX4A 4OBRA 4OV4A 1LLZA 3UG8A 1TMQA 3VNDA 2B7QA 4E5TA 4H7VA 2VWTA 1ZBKA 3LRLA 1WUEA 4PUKA 1D3CA 3UJEA 2YBTA 3BO9A 5D33A 2FMNA 2I16A 3LHZA 5JH1A 2ACUA 1F6KA 2XVGA 3WUEA 5EKYA 1WDQA 3W7JA 3W2MA 1CDGA 1X1ZA 3WH9A 1XI3A 4G9PA 4NZJA 3QR1A 3ERPA 4JBRA 4NJIA 4OBSA 1H09A 1FP8A 1SO4A 3NPWA 2A7RA 4KCUA 1FWRA 4S3GA 5JBEA 1VYRA 2YB1A 4CKQA 3KOYA 2ZC1A 3W25A 4FR6A 3T9PA 1L6WA 2A2IA 2ADAA 3CUFA 1N82A 1A80A 3KS5A 1AMKA 4W5ZA 5FEPA 2WMIB 4HU4A 3N04A 1EPXA 2Y85A 2OELA 2OQHA 5CAKA 3LB0A 3RFAA 4BEQA 3KBNA 2VOMA 4O12A 2FHCA 3VOHA 4AC7C 2ICSA 1D8WA 5K3VA 3DH7A 1H61A 4MLJA 8CGTA 2V5LA 3PPCA 3BGAA 1LL4A 2X7WA 1QI2A 2OEJA 1XPGA 1GVEA 3CWNA 4QS6A 2A3AA 1TPEA 4GJJA 4BWLA 2QCNA 1IIHA 4KBXA 3UPWA 4FLOA 3CL8A 1OEPA 2B7PA 2D23A 3LMZA 5J5RA 3I65A 1MSSA 1HGYA 3DI1A 3WO8A 1KQZA 4KQNA 1SJDA 4CQ9A 1V0MA 4BQ4A 1IEVA 1BXCA 4DYEA 5FJPA 1RVKA 5CEWA 2Z6JA 4HNTA 4DWSD 1B0IA 3U48A 3BTNA 2OZ0A 2PDHA 4QE5A 2WM1A 2PU1A 1YIXA 2ZWYA 3RHGA 1JZ2A 4BJHA 3GVGA 2I14A 1KRBC 1GYLA 4L7ZA 3PJTA 3GR8A 1WXJA 4C6CA 1RBOB 1T40A 3RLUA 4UCGA 4KRZA 4XZMX 4UQDA 3NO1A 3OB8A 1A0EA 5DXYA 3IGSA 3KOWA 2GGGA 4US5A 1FWIC 2F6UA 1NP2A 2E4TA 4C6FA 3RLVA 3CGTA 2XM1A 4B5XA 2BNJA 1R87A 1E70M 5I79A 2PGWA 5HR7A 3OVGA 4O14A 4TMBA 1C8VA 3AO0A 1DIDA 4ILSA 4NZFA 2R8WA 4BHYA 1PB0A 2WCAA 4JTGA 1DJNA 1TTPA 2R1NA 4FO4A 3UCDA 1TMHA 2X8RA 4PMDA 2OQYA 3WJSA 5FJUA 3TUUA 3KAOA 1HJWA 3GXDA 4HSNA 3HM7A 4WXYA 1WOBA 4RDYA 3MANA 1NSJA 4MGGA 1JPIA 2P8BA 3M6YA 3K8MA 3UXAA 3IGUA 4N9DA 2HMCA 2J7FA 4INFA 3QN3A 1DXEA 3ZR5A 3EWCA 3XISA 1TCDA 3PZVA 1CBGA 2EG6A 4FNTA 3GLCA 3CLWA 4GUJA 5FI8A 1S1PA 1XLMA 1TUXA 4R33A 4GZEA 1NEYA 4JTFA 4I9MA 5CJNA 1XIDA 5AVNA 2EPNA 4NAEB 1B3WA 3GHTA 2PS2A 4HNNA 3S8HA 4GY0A 1E4MM 2O9OA 3WELA 2ZUSA 5C7HA 1JFHA 4Q4SA 2FZBA 2WWDA 5JBDA 2H6RA 3S2JA 3TKFA 4YN5A 1VBUA 3PG9A 4PB3A 3R25A 3T2QA 1T41A 4UTTC 1TA3A 1GVSA 4JCMA 1W3JA 3VX0A 4JX6A 2IKGA 3GIQA 1H2JA 5BXPA 3GFXA 3NSNA 4NAFA 3RUBL 2QGHA 2VR5A 5LZLA 2KX9A 1T7LA 4GC4A 1ZAJA 1PZ2A 3W85A 3WF2A 4WQ6A 3S42A 4FSAA 3G1YA 1UBPC 4DF0A 2CLFA 4JQ2A 1UKQA 3LLXA 4I6VA 4JAWA 2XGIA 1EWDA 1TVPA 4KETA 5C2CA 4C1NA 4NJHA 4C6EA 3PY2A 1SYTA 1UWUA 4Q7BA 2OXNA 2J78A 2J7GA 4RZ5A 1HF6A 1TX2A 3C2VA 3R8GA 3BG9A 1OFOA 4C6DA 3BAWA 4AXKA 3UJRA 3J7HA 3IUHA 2Y4SA 4MHBA 3OLGA 2QDGA 3Q58A 2QUTA 3N9RA 3N2XA 4QXIA 3GO2A 2J9ZA 3ELFA 3ZLHA 5IDIA 1UH2A 1MW2A 4O28A 2FVMA 3ARVA 3WNPA 4GK8A 4RL3A 2RUSA 1HIZA 3XIMA 3NIYA 5CH9A 1V77A 1OCBA 3S1GA 1VKFA 1U33A 3OZMA 2HE8A 3BUVA 4AH7A 3FGCA 3KOXA 1K8CA 3N2CA 1BWVA 3W2UA 2V30A 1WO2A 3EZ4A 6PTDA 4PCNA 3URQA 1NOFA 1S2CA 4GUFA 3KCOA 4O17A 5A6JA 1B3XA 4PMVA 3ABXA 3TYEA 2OWXA 3UZZA 4L4LA 4WLCA 2O4MA 4JZ5A 1QCWA 4MPQA 4DPQA 3R4IA 3XINA 3TCSA 2QHAA 1KLYA 1F5ZA 2FJKA 3R6IA 4NRRA 4AD1A 1FHLA 3TJLA 4XWUA 1YYAA 4WOQA 2PDJA 2OWWA 3P0WA 2WO5A 3R0UA 4C6QA 4JYFA 3MSRA 5BMWA 1DJWA 4MYXA 2AGKA 2CC0A 3V36A 1XIFA 2CHNA 1ICPA 2IUZA 4XVEA 3FS2A 4EAYA 4NY2A 1E1EA 4XKMA 2CLEA 2O55A 3TQPA 1PX3A 3RR4A 3HJEA 2DIEA 3JW7A 4HHLA 1XBYA 1K9TA 3LTPA 1QW7A 3NSXA 2DJXA 1CXFA 4UUIA 2YDAA 1BYBA 2CWNA 3AHTA 4GGBA 4NT0A 1MXDA 3SY1A 3LGGA 1SFSA 2E0PA 4JHOA 3TJXA 1ZJHA 2VRKA 4F2UA 3KTSA 3LYEA 3NQEA 4IQDA 1SW0A 3E6EA 3RAOA 3Q37A 5TF0A 3W7EA 1GOOA 3SR7A 3NQDA 1LM1A 4H19A 3SUTA 2VTFA 4U3CA 1FWBC 2GK1B 2YCJA 5A8GA 1E0WA 5BRBA 2E9LA 1XISA 3EXTA 5C5YA 1O1HA 1XLGA 1Y65A 4NVTA 4GI4A 1JD9A 1M41A 3ZYZA 1KCXA 2WBGA 5AHIA 1X7FA 1EJWC 1JYVA 3CTLA 4PCPA 5LA0A 4IUOA 3RX2A 4UQBA 3VYLA 5LHEA 3FCPA 5KZMA 1G67A 1I2PA 2CERA 3WQ6A 2YZRA 4AWUA 3CZGA 1OADA 2JFEX 3UWYA 1L8NA 4IIEA 4Q8NA 2CW6A 4MB3A 1UWRA 4H8HA 3W4RA 1TTQA 1ZFJA 3AZTA 3W29A 3M41A 3TWAA 3W76A 1E6PA 1JPKA 1M5WA 2DT2A 4N9BA 3WH5A 2A3CA 3MVIA 5AY7A 3SRFA 1EX5A 2HRWA 1IXPA 2VC7A 3ZS4A 1XYCA 4LAMA 1WDWA 3GBEA 4WK9A 2JBMA 3VNYA 3QMTA 5JH2A 2E1WA 4DZIA 1VCVA 3AHXA 2VR4A 3VZZA 3W74A 4J28A 2CEQA 4JFTA 1UUOA 3SCOA 4JNZA 2A3EA 2ZUUA 3G1DA 3KWSA 4MSSA 4JY8A 1GKRA 2DZAA 3TNBA 3C2RA 2GLKA 4J4KA 4LV4A 2ZUVA 1RY8A 1KXVA 4CCZA 2JEPA 2ZYFA 1DJYA 4B92A 3A5VA 5AC5A 3EA2A 3UW6A 4QJ3B 2WNQA 1EJ7L 3SEPA 1XL9A 4CQBA 5I3JA 4A6GA 3PF3A 2GQ3A 4QNWA 5AYZA 3U4AA 1DBTA 3B9OA 3WMBA 3AU2A 4PMNA 1F4AA 2I9EA 1OC5A 3L0NA 4AF0A 1HT6A 1UC5A 4XKYB 3MUAA 2VEMA 2X2YA 2YBUA 3E0IA 1Q6RA 3O0FA 1E6QM 4BF7A 4W84A 5LSMA 1XS2A 1H63A 4IIFA 1YDNA 3AWOA 3DXIA 3WDHA 3AIRA 4GOAA 4ZENA 2V38A 3H2FA 1R47A 2VX5A 4FNQA 1MYRA 2D2HA 3GM8A 4WD0A 1OFPA 3CAQA 2Q71A 3HF3A 3BPWA 4ZQPA 2OVLA 1FWGC 2AOSA 2WMKA 3DX5A 5CJMA 3LK6A 1CLVA 1GOMA 1E6XM 1XBZA 5F2MA 3ZT5A 2O9PA 4LBSA 4H8UA 4Q3MA 3TSBA 1V0KA 3NAVA 3HG5A 1J5TA 3ALFA 4I7UA 4CQCA 2FHBA 2WHJA 2GOKA 1Q6QA 3WD2A 2F8QA 1VFLA 4H6RA 4JIRA 3VIOA 3NVDA 1PYMA 3WL1A 3TR2A 5LYRA 3W6LA 3HV9A 4PUWA 1GOIA 3COTA 3VD3A 3F03K 2WMFA 1NAL1 5CZSA 1IR2A 2BY2A 1V02E 4YU1A 3CBWA 4QDPA 3IARA 2YPIA 1TV4A 3UG3A 4H00A 4RE0A 2ALRA 5I00A 2A7NA 3K13A 4KPLA 1OM0A 4YCOA 3STEA 6REQA 3MO7A 2W79A 2NXIA 1RD5A 1PHWA 3NYZA 4O19A 1L9WA 3P8JA 3WQ5A 1XH1A 4OU1A 2VFEA 3MHFA 1YPIA 1OSEA 4JTQA 4LQ1A 1V08A 3MJMA 1EDGA 3VINA 4R9OA 3REQB 7CGTA 4MFEA 4DWSA 4ENLA 5C2GA 4REQA 4Q4PA 2INFA 1FCQA 2JEQA 1JG9A 1C8QA 1Q13A 2WKGA 1BD0A 4GCAA 5CG7A 4JNMA 4AU0A 5LIYX 3EWZA 4X0VA 1YNPA 3WQ8A 4K8EA 1JXJA 5D9NA 4AYGA 1ICQA 5IRPA 1NOWA 3VOGA 3INPA 2J88A 1VJSA 3N2BA 4PSPA 2C79A 4E4UA 5AHFA 5CAHA 1SGJA 2E5CA 1CTNA 4MNMA 1VFFA 2OLAA 1JCLA 4NJKA 3AXIA 1MW0A 3WJXA 4YHEA 4E4FA 3MJYA 3CUJA 4Z42C 3WQWA 4FNPA 5E0CA 3SY8A 1REQB 4Y8EA 3BMWA 2RDTA 4M7SA 4DZ5A 2Z4GA 4ECLA 3FHQA 4FXJA 3EOUA 3IANA 2XG9A 1B57A 4WCJA 1KCLA 3VE7A 1EBGA 4N7QA 1LT7A 3P5YA 2QCCA 4GKTA 1CXIA 3IGXA 4MTVA 1W37A 4ZEPA 2J9YA 3TOYA 4HZMA 4I6KA 1O6IA 1E72M 3PUOA 4DM2A 2Y7DA 1XLKA 1UWQA 3EDKA 2O7SA 3FLUA 1WV2A 4O1AA 4P5UA 3ZVIA 3GXPA 4M0XA 3QHNA 3V7PA 1E71M 4QFUA 1Z32X 4OOUA 2HZGA 3TCEA 3QLLA 2V69A 4CQDA 4IWWA 4LVDA 1VHNA 2WHMA 4Y7EA 2WVUA 3IRDA 5E93A 2JQXA 4DJDD 4J3ZA 1SW3A 3QY7A 1K6WA 3W1XA 1ECQA 2YDSA 3IV8A 2QJMA 5CZKA 6ENLA 1B4KA 3T78A 4JTLA 3H70A 4FIQA 1AQMA 3LTSA 5T9BG 5A8PA 1Z42A 1JAKA 2ZVIA 2GGJA 2DUZA 4LEFA 4Q4KA 5AN7A 5HWJA 2YW3A 3VOCA 1AODA 4RE3A 3VD5A 5KZ6A 5LIXX 3F4NA 4ZQOA 3SIMA 1EXPA 4UTKA 1TTJA 2PP1A 3LY0A 1Y5XA 3S6DA 4AD2A 3P6LA 4JQ3A 2A3HA 2FVKA 1FCUA 3WLOA 1DJIA 3WJWA 1UH4A 1L0PA 1Q45A 5XIMA 3LPOA 1HKJA 2G95A 3B0XA 2ACSA 1UROA 4JIQA 3GIYA 5A3HA 3AZSA 3O7UA 3ARYA 3THAA 1SSDA 3STPA 2Z7KA 1W3NA 2VNCA 5BXRA 3NM3A 1SFTA 1ZCCA 2DZTA 5CSYA 3BURA 1W56A 1Q2SA 1LTDA 3NGFA 4JX4A 4C6LA 1F8IA 1G1YA 5DMYA 4D6EA 3DKLA 5C0QA 4YTUA 1HL8A 2QJGA 2P50A 2WVVA 2VENA 1RBAA 5JIPA 3MCMA 2JIWA 1HO1A 4IMGA 1YBQA 3ZJ8A 1TJPA 4XZHA 3NXLA 1PS9A 4L56A 3VMPA 5CZ0A 3LI1A 4KKXA 3S5YA 3FA3A 3TC3A 3G1SA 1KFBA 4I7VA 4MKSA 2BTMA 4HOWA 3DKJA 1YRRA 2NQZA 3U2EA 2PP0A 4XAPA 5C9XA 3W1AA 3T42A 3R8RA 3P14A 1WBHA 4D6HA 3U8GA 1MWOA 4Q22A 3MYOA 2ZA2A 4O11A 1FWHC 1U1HA 5D02A 1AVAA 2PB1A 2ZDRA 4TMCA 1U30A 4NZ3A 1I60A 3PJXA 2JALA 1DHPA 2Y70A 4O57A 4RJEA 3TXVA 4MG4A 1H7RA 1UWIA 2DV0A 2TMDA 1ADOA 3AUOA 4WJEA 1LOSA 5BCAA 2YBVA 3OZPA 1Z89A 2ABAA 2CLIA 5D30A 1KFJA 1F07A 3W7HA 2OOFA 4PTNA 4C6JA 4FOUA 4D8ZA 5AC7A 1UPMB 3PWAA 1BPLB 1GOKA 3RLHA 3H55A 2OFJA 1LDCA 5A2AA 4LXFA 4M6UA 1EP3A 1RPKA 1V3KA 2BZNA 2VVSA 3QV9A 3BG5A 5FEZA 5FEWA 4J40A 2V3FA 3MCOA 4MNKA 2D69A 2FPTA 2VJXA 5C70A 3GDBA 3UXLA 2JK2A 2C91A 5LGZA 3VMNA 4H9XA 4F48A 4HMDA 3SUWA 5BYWA 4RDWA 1WDDA 4D2JA 4HQVA 1X6NA 4QNEA 3TAKA 2Y7GA 4FLQA 1XHGA 1F05A 3PJWA 1PEZA 3EBVA 2P0IA 4YVVA 2YLAA 1YHTA 2W3ZA 3FOKA 1JQVA 4Y96A 4DUWA 3R94A 2YOCA 3RYSA 1SSGA 3O07A 3M43A 4QSFA 3QMRA 4CCCA 3WNKA 5HUPA 3B4YA 4PYSA 2OZTA 3M46A 1QPNA 4N6EA 1FWDC 3T44A 5M1TA 4TTUA 1W1IE 2XIMA 1YDVA 1JYNA 3IAQA 2XJ7A 3BWWA 2DSWA 1HKKA 5IBXA 1NELA 4Z1CA 1BVWA 2J79A 4DJEC 1GONA 4BA0A 4UTWA 2PRHA 4LRSA 3SN4A 1VPQA 3UWWA 1TV8A 3URNA 4BI6A 4GQRA 4EACA 2DP3A 1JAEA 3TH6A 2POZA 1ZLPA 3TTYA 3ARTA 2PBOA 1V3LA 3I7SA 3T07A 3R2GA 4D6GA 4UR7A 2OLHA 4Y9MA 2VC5A 5EPDA 3HIJA 1PWMA 1G4TA 4XV0A 2WQPA 4NSBA 4IJBA 1ONRA 3ZZ1A 3E3HA 3C52A 4GUIA 1L2QA 1V6YA