4O53A

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFLFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o53A00
1WV2A 1I8JA 3L0GA 1W5PA 4IMCA 1HTIA 4A2RA 2YW3A 1XC4A 1HO1A 2O7QA 3CIXA 2PRLA 1YLVA 4WXYA 3BW4A 2D73A 2NX1A 1OX6A 2DZSA 2QCHA 3MHUA 4K38A 1FQ0A 3STGA 4IWWA 2P1FA 3SFKA 1LZOA 2J9YA 1OFPA 1BWKA 1XM3A 1TJPA 3ABOA 4O0KA 3HJZA 1RZMA 2RKXA 3DKLA 3P5YA 2QDHA 4YLWA 1LRNA 4Z08A 4X3ZA 2YYUA 1OFEA 3SECA 5FESA 2DU2A 4DO6A 3ZS4A 4ALDA 4DXVA 4MFDA 4RZ4A 3S42A 4HNUA 3VI2A 3P5ZA 3NQGA 5AHEA 3WK2A 4BWLA 3EXTA 2NWSA 5I3KA 2WKJA 1LLZA 1SFJA 3TSBA 4O1BA 3TW7A 5H91A 1IGSA 3BARA 5HJLA 1WA3A 1E51A 1MXSA 5AHNA 1L6SA 1H1YA 4WUIA 3S1UA 3G1HA 1GVQA 2OT1A 4LOCA 3RK8A 1YADA 3T44A 1D3GA 3LDVA 3U8GA 3G1AA 4O52A 3EWBX 1KFLA 3QQ1A 3EWWA 3W7NA 3CT7A 3YPIA 5HR6A 3OVRA 4O53A 1YYAA 5CPNA 1B9BA 1YTKA 2E5CA 2DP3A 3O6YX 3NEVA 3G1YA 3C56A 3WFAA 4K6AA 4KWVA 4PH6A 3P67A 2OT0A 1G7UA 3NQDA 3TC7A 2ZZ1A 3HMJG 1X6UA 3EX4A 1OFDA 1P1XA 3EX1A 4UUIA 2FLIA 2E6YA 3A5FA 4W9TA 2EHHA 3NQ6A 3S1WA 3T7VA 3W7JA 5C54A 3RF9A 3NXFA 2DZPA 3NR0A 2CLKA 4UXDA 5FEPA 4HPXA 3LCIA 4JDYA 1RR2A 2ISVA 3TDFA 3E49A 5D38A 1JCNA 2X16A 2H90A 5AYYA 1K8XA 3LTYA 2XN1A 3W1QA 4GUJA 2YR1A 4WX2A 2AGKA 3GDTA 4WQ6A 3BVJA 2RDWA 3C2RA 4LVAA 1WX0A 1IXQA 3ABQA 2FIQA 2FPTA 3MP5A 3I6RA 4GUGA 4LT9A 1TPUA 1VCFA 1XBVA 2NXIA 2E6DA 2DJLA 1KFBA 4O8RA 3L0NA 2A21A 2VFDA 4JDBA 2TYSA 3LI1A 3UWUA 4OV9A 3EX6A 3TSDA 5DY3A 3BK0A 4O57A 1JUKA 1LBFA 1SR9A 2B7OA 4UR7A 3UYCA 4RK8A 5T26A 4JTSA 4JTUA 2ZZ5A 4NJHA 5D30A 3C2EA 4HIBA 1LDCA 5TQLA 5HUOA 4LVDA 5FEWA 4HSNA 2OCZA 4LUIA 3PBYA 4ZQMA 2RH9A 4TU1A 4O15A 3G8RA 1L6WA 2QDGA 3MJYA 1WXJA 1JCXA 3W1XA 4UTHA 4WD0A 1TPH1 3S6DA 4LVFA 2G96A 3KRUA 5I3FA 2XN2A 2CLOA 2A2IA 5K9CA 3IIVA 2WOQA 3WK3A 5CZ0A 5HWJA 3G18A 1KLZA 3H54A 2FDSA 2NV2A 1ME7A 4NUWA 4U28A 2B7QA 3LV5A 1Q6LA 5CPMA 1WAUA 4BI6A 5F2GA 2C18A 3W7DA 1FCVA 2DJXA 3LCFA 2PC4A 3PR2A 3QMRA 3IV3A 3PB2A 3W74A 3FYOA 1M7OA 4POCA 3RU6A 5LSMA 1JULA 2YFOA 4MZ8A 3VKJA 4JS3A 2WJZA 3B04A 3QRHA 1HO4A 4M7SA 4ZMGA 5DBUA 1UCWA 4RX0A 5G4WA 4MVAA 1H7RA 1N8FA 1TPEA 2R14A 3TROA 2H3DA 3QC3A 2IQTA 1VCGA 2ZYFA 2DZTA 1D3HA 4CCCA 3LCGA 2QCDB 1FDYA 2C0AA 3GDMA 1F5ZA 5D03A 4ADTA 1VLIA 1ZENA 4J9JA 4UC5A 5HR7A 4RJEA 1UUMA 4UTKA 1JRCA 4LY8A 3GDKA 2C13A 4K8EA 2V5LA 4IMFA 2I9EA 1EP3A 1DOSA 1TB3A 2YDAA 1QPQA 1VYSX 3QYQA 2ZTJA 1IXPA 4HNNA 4TR9A 2HS8A 1R2RA 1MO0A 3BPWA 2CWNA 1VH7A 5BNKA 4RV8A 4PODA 5E0KA 1JCMP 3O06A 1EA0A 4A29A 5AOUA 1SQ7A 6TIMA 1QPNA 4DPPA 2XN0A 1TPB1 3E02A 3UXAA 2BSLA 4AVFA 2Q3OA 1KFCA 2VOMA 3GX9A 4QM1A 3MYPA 2OMAA 5K9DA 3ABSA 3GAKA 5EL1A 3W7QA 5KTLA 1Z41A 3QSRA 4K8HA 4O19A 1RQHA 2XFWA 3GXNA 4E2DA 1AW5A 1WDWA 2QJHA 1W5MA 5FEZA 3N19B 4LS2A 3AO0A 1NF7A 3C2VA 2ATSA 1PL9A 1EUNA 4M6QA 2B7NA 4EOUA 1WOBA 2ZZ2A 3NQMA 2G97A 3C2FA 3KOFA 2NX9A 4EF9A 5CPOA 1TPVA 3B0VC 4FNUA 3ANYA 4O1CA 4MKNA 3SIZA 3SSJA 3OG3A 3G3DA 4GUHA 4H6KA 1HUVA 3BW3A 3P74A 5BMWA 1TQXA 4N6EA 4MOZA 5D09A 5KSWA 3QQ0A 4NU7A 3D0CA 3QW4B 3EB2A 4O17A 1PCWA 1UB3A 4IX2A 1GVSA 5K7JA 3NDOA 5KMYA 3W76A 4K7VA 3DFNA 4CNNA 1IIGA 1TV7A 3G22A 3PB0A 3S8HA 2A7RA 4CQAA 2V30A 1QAPA 3L65A 3C6CA 1DJQA 5IM51 4UTTA 1VCVA 3W2KA 4CLMA 2PCQA 5CSSA 2ZZ7A 2O7SA 5D2YA 5AC7A 4L4LA 3T55A 3F4WA 2Q8LA 3CEUA 1H7XA 1Y0EA 3LHWA 4MPQA 3WJYA 3H55A 3M16A 2ISWA 2V2DA 2JGYA 2P0OA 4TMCA 3QSTA 4ADUA 1AL7A 3R12A 3KAOA 5LHEA 2EKCA 5E1QA 2GPTA 5D33A 3WK0A 2ZFAA 1G69A 2X1RA 4UFHA 1GJPA 1HFBA 4BI5A 4ZQPA 2PE4A 2FB2A 3RFAA 1D9EA 2Y7DA 3W1LA 3C0JA 4WY0F 3CB8A 4DBEA 2UV8G 4KFNA 2QUUA 4MIMA 3OVQA 1ZY9A 1HL2A 3L0KA 3MI2A 3LCLA 2CZEA 3IGUA 3W7KA 3N2XA 1S5WA 1SZNA 4WOZA 3IIPA 1EWDA 2C15A 3O6DA 4IXXA 5G2WA 3VFLA 2H8ZA 3I65A 1H7NA 3NQVA 4K37A 4UNKA 3ABRA 1I45A 2GJNA 3DZ1A 2CLFA 1KV5A 2Y61A 1W3IA 3KFTA 3O16A 1G4EA 1SUXA 3L5AA 1NSJA 2A4AA 1YXYA 1TCDA 4ZQRA 5EMUA 4JY9A 1KFEA 2FJKA 5L9FA 2Y85A 4GFSA 3ZWTA 2OJPA 1OVDA 2B0MA 4H4IA 1XUZA 3P8IA 5DLCA 4OE7A 1GYNA 3LXCA 3SW6A 3B0PA 4JX6A 2ZQ0A 3T78A 3OVPA 3W7OA 4LVGA 1L6YA 4NXSA 3GKAA 3M5XA 1LM1A 4O0ZA 1K03A 4YMZA 3BLFA 4NJGA 3BO9A 4O54A 1GYLA 1W5QA 2HMCA 3CTLA 3OIXA 3SJ3A 3DGRA 3KHJA 2W79A 2RDUA 2NUWA 3TNOA 2H3BA 4ZVJA 1G6CA 4JTLA 2GVJA 2RHGA 4MUZA 1K02A 1FWSA 3IIOA 1N55A 3STFA 4EVZA 1OFRA 4EWND 4N4QA 2QCNA 3DFSA 3F1QA 1Q45A 3G0XA 1JQVA 4BWLC 3PAJA 1Q6RA 3EKZA 1YTEA 4YWIA 5LGXA 2W0UA 5BMXA 1YDVA 4AH7A 1VR6A 2YYTA 1VGAA 4TX9A 1GTHA 3BG5A 1BTMA 1O94A 1VZWA 3NQCA 3HOJA 3HGRA 7TIMA 1W5OA 4XQ6A 2BLEA 5K9XA 2VFEA 1LOSA 2YPIA 3PSWA 3TA6A 3TMQA 1BWLA 4CCEA 5FI8A 1ME8A 4UTLA 2JGQA 1ICSA 3I68A 1H51A 1J5TA 4JYEA 2E77A 3TAKA 3B06A 1F76A 1PCKA 1FXQA 3F03K 3UXDA 1DQXA 2A1YA 5DXXA 5L6UA 5DBTA 1TTPA 5I3GA 3PBWA 4DBDA 1F2JA 5HINA 3USBA 2PRMA 1GT8A 4OV4A 4QSHA 2FPVA 1W56A 4R34A 2E5BA 3NNTA 4A21A 1F6KA 5TIMA 3IVTA 3GNNA 5CGQA 3EKLA 3DH7A 4RR4A 1FCBA 2Y70A 4DO4A 4MFEA 5AYXA 4JD4A 1LOQA 4ML9A 4GNJA 4UFKA 4FHAA 4IPJA 3HPSA 4I7WA 3W1PA 4ICNA 3O07A 2AAMA 1LOLA 4O10A 2CLHA 1O60A 4R7JA 3MBFA 4PEKA 3LBCA 1I2OA 5J5RA 1SO3A 3S5NA 4RLIA 3KRZA 2NV1A 1SO4A 4ADSA 1B3OA 3G3MA 3PULA 1B4KA 3U6WA 1TV5A 1WYIA 1L9WA 1KBIA 4JNMA 1XDLA 3W83A 1JJKA 4HHPA 2V0TA 3PM6A 4JTFA 1ZHAA 3UWWA 2YCEA 1TQJA 5KINA 4DQWA 1SZGA 1VQTA 2Y7EA 4PC8A 3HG5A 4AMAA 2Q3RA 4Z1DA 5HWNA 4CQ9A 3W7RA 1T96A 1KM6A 3W2UA 3DU0A 4HNVA 2ZA3A 3FKRA 3O15A 2V82A 1OYBA 3B4UA 1FWWA 2ALDA 3QPZA 2ZTKA 2WQPA 3P80A 1ONRA 4R53A 2E1DA 1M6JA 3HGJA 3P61A 2C14A 3L2IA 4M6VA 3NA8A 1H63A 2BZNA 4BF9A 3W9ZA 3W3OA 3FS2A 3S5YA 4LC8A 4S2BA 4IXHA 2JKEA 2CU0A 3GZ3A 3BLIA 5FF3A 2B4GA 3R5EA 1WBHA 1B4EA 1F73A 1AL8A 5CZJA 4QJ1A 1DORA 4JN6A 4PCFA 2NUXA 4NZJA 3DFPA 1RD5A 3CM4A 1OK4A 3NL6A 4O16A 4JIPA 2A85A 3G24A 5AB3A 1FX6A 3GR8A 2VEMA 1GEQA 1J2WA 2ZRWA 1AK5A 1XUUA 4JR5A 2DZVA 2Y7FA 4XWUA 1AMKA 5EY5A 1P0NA 3EEGA 1K8YA 3NQ2A 3Q94A 2BXVA 1Z48A 4MYXA 3PUDA 2QCCA 2YFNA 1QOQA 3T4CA 3DENA 3NL2A 1C8VA 4E38A 3L66A 3QZEA 4S1FA 3GYEA 1I2NA 4KFOA 1RV8A 1EP1A 1QDSA 2A0NA 2Y63A 1S3HA 4ORMA 3FJLA 1OX5A 3M5ZA 1BKSA 2ZDRA 4R33A 3I7QA 2Z6IA 4UTIA 3SR7A 3LOTA 3ZR4A 2A7NA 1PV8A 4O1AA 1RQBA 2GJLA 5EPDA 1QOPA 3MUXA 1G4SA 4M5PA 4DF0A 3N14A 3NQAA 3N73A 1H60A 1G7VA 3B0UX 3N9SA 3NM1A 3CHVA 4FF7A 3EWZA 3TMLA 2DORA 1A5AA 2E6FA 4N9DA 1F05A 1EP2A 2VEPA 3HPXA 5EA9A 3SY5A 1DJNA 3UWZA 5H2ZA 3M43A 1XKYA 4TMBA 3CEPA 3M5YA 4WJEA 3IRDA 2ZZ6A 3RMJA 1UASA 1VC4A 3QMSA 4OWGA 3M6YA 2FPYA 2VEIA 1QCWA 1ZCOA 1ALDA 3W7HA 3UD6A 4M7TA 5LNRA 1H7WA 3CQ0A 1K8ZA 3W73A 1LRTA 5K2ZA 3THAA 5G4EA 1PHWA 1FCUA 2A5HA 3Q37A 1PHQA 1KBJA 1OX4B 3MYOA 4JX5A 4Y90A 4UMAA 4GUIA 5LHFA 1Z44A 3NYZA 3EX2A 4LRSA 3MO7A 3GK0A 4IOTA 1QO5A 4XBKA 4NNAA 4UMBA 3CLMA 3A23A 3EX3A 3TQVA 1M5WA 1YPFA 1MZHA 3N3MA 3S9YA 3M41A 1KFJA 1ME9A 2DZWA 1QMLA 3PG8A 2VC6A 1TRDA 1K7FA 4N9BA 4I7UA 2YX0A 3GKFA 2YGYA 3PS7A 5HNRA 5DN1A 3W84A 1V5XA 4O1DA 1FY6A 3S1XA 3STCA 5KZMA 1EPXA 2GOUA 2QCDA 3TV8A 4JYDA 4C1LA 4CNOA 5G1TA 3W1UA 4XBSA 3W2MA 4LU0A 1SW3A 5AHFA 3TIMA 4L4MA 2ZA2A 4O4VA 1R46A 3ELFA 3WJXA 3DXIA 4HKPA 3HIJA 5D2VA 1FUYA 1P0KA 1S5TA 5F4XA 5GVJA 3NGJA 4UTWA 1FXPA 4A2SA 3MHFA 1GQNA 4UTTC 1I2QA 4MJZA 1W3NA 3FYPA 1H1ZA 3O63A 2GVGA 3GIYA 2OZ0A 3CC1A 1GOXA 4B5NA 3W1NA 1MEHA 3C52A 1W3TA 5IBXA 1SSDA 2X30A 4YL2A 3G1XA 3DAQA 3TE9A 5G2HA 3NL5A 1TPC1 3DFQA 3U2OA 4YCOA 2GQ9A 5FF2A 3SGZA 3A9IA 2HS6A 3G1SA 3W71A 1YXDA 4UTJA 1OFQA 1KTBA 2EGZA 1LORA 4Y8FA 4CCDA 2TMDA 1CI1A 3S5ZA 6ALDA 3NQ8A 3EWXA 5DCBA 1A50A 5G5IA 1XFBA 3OBKA 3QJAA 3IIZA 3QEZA 3ZWSA 2V2HA 4Q4KA 3DFTA 1KTCA 3G1VA 3NPVA 4HN4A 3NPUA 1H61A 3KXQA 3W7CA 3MBDA 1S5VA 1LCOA 4JTEA 1JCYA 3T40A 4DF2A 4LC6A 2A7PA 1XXXA 3W72A 3HPZA 1SW0A 3EWYA 4O28A 5DY2A 4UTMA 2VFFA 4KFPA 2CW6A 1TSIA 4A22A 4N9EA 2WNNA 2NLIA 5BW6A 3INPA 1IXNA 4FO4A 2B7PA 1GG1A 2QUVA 3IVSA 3VNDA 1ZNNA 1SPQA 3FJ6A 4GJ1A 4FXSA 2QEZA 3MHGA 1V7YA 2VFIA 3HF3A 1H5YA 3P82A 1EIXA 4O4WA 3LLDA 1KM4A 3CWOX 1K7XA 4LTSA 4FX8A 1NAL1 1JCLA 4RCXA 1UJPA 1VYRA 2JK2A 1OF6A 1P5BA 3GB6A 3UY8A 3L68A 4NQ1A 4NNBA 1X1OA 2CZFA 3W23A 3NL3A 3P60A 3FA5A 4D2JA 4IX0A 4WZHA 3O1NA 3P62A 3DHFA 2F84A 2WNQA 3LCWA 1F7BA 1WBJA 4O18A 5D2WA 2ZZ4A 4DO5A 1THFD 4AF0B 1YXCA 1TV8A 4IJBA 1W31A 1QR7A 1DBTA 4LVBA 3R2GA 1TTIA 3QM3A 3TCEA 5CKSA 3PWAA 4Z0JA 1A53A 1RVGA 4XZ9A 3LERA 1XI3A 1KV8A 2ATMA 2EF9A 2VKZG 3W07A 3G0SA 4E0CA 4OT7A 3MP3A 1KM3A 1W5NA 3PUEA 4FNTA 3TX9A 5CPLA 3PVFA 3DBPA 2TRSA 5HQEA 4MJMA 3R8RA 4RZ6A 3FLUA 4PL1A 3G0UA 3LTSA 1UUOA 3N2MA 4MY8A 1T8XA 2BWGA 2J88A 3LRMA 4EIVA 4QITA 3AJXA 2H6RA 3CWNA 2QAPA 2F7FA 1XL9A 1OYCA 4WY0B 5G2IA 4AAJA 3GDRA 4NX5A 3QFEA 1ZAIA 2RDTA 3DI1A 3ATYA 4Q33A 1IF2A 5CG7A 1DKWA 3B03A 4WY0A 1K3UA 3HO8A 3MWAA 1ADOA 5LNSA 2ZRYA 1OYAA 2ZRZA 1YTDA 1Z42A 4MYAA 4FXRA 1JR1A 3VCRA 4GUFA 4FIQA 1X1ZA 3W7PA 5BRBA 3MP4A 1AG1O 3W1MA 5HMSA 3O6CA 1F74A 4O11A 4ZQCA 4O14A 1L2UA 3TR2A 1PE1A 3N34A 4NJJA 2WPBA 3LBMA 4GBUA 3CU2A 3EWUA 2LLEA 3I7SA 1DV7A 4XTIA 4DPQA 4MY1A 1LLWA 5AHMA 4AHQA 5AC6A 2HSAA 5AC8A 1OG0A 4IMDA 2J6XA 3WJSA 5K4ZA 3EXSA 4LS1A 1LP6A 2VELA 4YXGA 2OX1A 4AWSA 4AHOA 2YXGA 4MY9A 1DQWA 1KA9F 1OK6A 3BGGA 5KZDA 3LM7A 2FQIA 2I14A 5D04C 4FNQA 2E09A 5LNWA 1LBLA 1KW1A 3W70A 5F2IA 3SZ8A 1M7PA 4BR1A 2NXHA 1OJXA 2C3ZA 3NOEA 5AFDA 3KVMA 4M6PA 3P7YA 4FX7A 2WV8A 4Y6GA 3W7GA 2Y88A 1K7EA 3GAYA 3L5LA 1ZAHA 1TPWA 4N4PA 1CW2A 2WNZA 4K7YA 2R8WA 2JBMA 4FIRA 4EF8A 2E6AA 3V75A 2ZBTA 3TFXA 3QPYA 1TJRA 5EBUA 5F4WA 1VS1A 2VEKA 1GVFA 2GUUA 4N02A 4RKAA 3LHUA 3NZRA 3B8DA 1AW1A 1FDZA 4JY8A 1GWJA 2A6NA 2TPSA 3FOKA 2PRHA 4PTNA 2QCLA 5D02A 4JIQA 1AW2A 4LV4A 1R2SA 5DXYA 3A22A 4MLJA 1GTEA 3PF3A 1C9DA 3TH6A 1SZEA 2R94A 5U4NA 1H62A 1BEUA 1TIMA 3LXBA 3HG4A 1OF8A 5U7SA 3DFOA 4KKXA 1JQXA 4YCPA 4DF1A 1OFAA 2Z2UA 2CZ5A 3LCXA 3W22A 2WSRA 1TO3A 5DCDA 1YDNA 4O50A 3W2LA 2Z6JA 2GQAA 1ZALA 3UPBA 3PBVA 3W1AA 3W75A 1G4PA 3C3NA 3NQ7A 3VE9A 4FB7A 3PG9A 2DZUA 2Q8ZA 3M44A 2QKFA 3B05A 4UTUA 3S5OA 4OBTA 3W87A 3LHTA 3MW7A 3GNDA 3A24A 3TAOA 1U83A 4JTKA 4NXKA 1OFBA 3HB9A 3W6YA 1FDJA 5ABTA 3E9AA 1FBAA 3TXVA 1A5BA 3IGSA 3LX9A 4JYFA 4NZFA 4QISA 4MLRA 4ZQNA 3TXZA 3PUOA 1KM0A 5CZTA 4N9CA 2H8XA 4FNSA 4RXFA 1KFKA 2NUYA 2ZRXA 4UFLA 3W86A 3PBUA 3C8FA 4M19A 2CZDA 3IEBA 3W2NA 2BTMA 1KTNA 2WO5A 1Q6QA 3K30A 3VE7A 4ZQOA 4LNYA 1WQ5A 2CLMA 3TSMA 3TK7A 3TKFA 5A5WA 1A5CA 2W6RA 4C1KA 3W1TA 4DELA 5KITA 4UIOA 3KRSA 5D32A 1QPRA 4X9SA 5HUPA 5F1VA 1FWTA 3NQEA 1TTQA 4JTJA 4A3UA 3A21A 3L67A 1LBMA 3LHYA 5F1UA 1W8SA 1NF0A 4QAIA 5F2LA 2QUTA 3UZ5A 1UBSA 5AYZA 1R2TA 1I2RA 4Z0SA 4JTIA 4FNPA 4K36A 2J24A 3BV4A 2YZRA 3STEA 2C6QA 3UWQA 4QQ3A 3E0IA 4ZL1A 1W0MA 2I1OA 2VENA 5D2XA 4N6FA 2Z0IA 2G95A 2J27A 5E93A 3LXAA 2BX7A 4Y9AA 4UFIA 5EKYA 5KZEA 1CX9A 5AN7A 4Q32A 1ICQA 4JTHA 4JICA 4E2BA 1YDOA 1MEWA 2ABBA 5D05A 3TFCA 1TRIA 3LTPA 4TIMA 2V8ZA 1VHCA 1NVMA 2X2GA 5DCEA 3OA3A 4FX6M 3NG3A 1O95A 2QJGA 1RQEA 3FFSA 3NM3A 4NJIA 2QAFA 1RPXA 2CLIA 4WOQA 5C5YA 1IIHA 2X1TA 4UTWC 1NFBA 3DI0A 3W7IA 1VJIA 1GVRA 5HWMA 3UPWA 1H7PA 3BG9A 3KVKA 4GE8A 4O12A 1KLYA 3JRKA 2ZRUA 4JTGA 3TU9A 3CIWA 4JEQA 1I2PA 3WJWA 1SO5A 3NZ1A 1U5JA 5IBXC 1MEIA 1W1ZA 3WK1A 1OX4A 3TQ0A 3N9RA 1I4NA 3Q58A 3NAVA 4IMEA 4JX4A 3UNDA 4Z1BA 5LNUA 1A5SA 1N7KA 2VFHA 1TREA 4BI7A 2GVLA 3W7EA 4BK9A 4UFMA 1Q3NA 3R13A 5A8GA 4IPIA 1KM1A 1O5KA 1XCFA 4NNCA 1LTDA 3LRLA 4UCGA 4IQLA 3RLUA 4AEOA 1XBZA 2Y89A 4K39A 2EAWA 1VLWA 1EUAA 3HG2A 4LUJA 4G1KA 2FB3A 4PFMA 3Q2DA 1KM2A 1SO6A 5SWUA 1EEPA 4NJKA 5LZLA 5EYWA 3PC0A 4P2VA 3TW6A 4DEFA 4JXCA 5MHBA 3FKKA 2Y7GA 1J4EA 4HSOA 1JUBA 1WOAA 2NWRA 2Y62A 4PL2A 4RZ5A 3MI3A 1GG0A 1OHLA 2TSYA 3P8JA 4XUGA 2A6LA 4IMGA 4BFAA 3MI6A 3W85A 4I9AA 5I3JA 1LROA 1O5XA 3GXTA 2KZHA 5FF7A 2VFGA 5D37A 4AB4A 1SSGA 4JTTA 5LNVA 1T99A 2CLLA 1QNVA 5AHIA 1W37A 1SZFA 1DVJA 2AQWA 3W7MA 4KWWA 3E12A 3L5MA 2X1SA 4PA8A 4UNLA 3TJXA 3JS3A 3KX6A 3TQKA 1GVOA 4Z1AA 1NEYA 2ABAA 1LYXA 4FNRA 1F6PA 1VHNA 3LCHA 2WSQA 1Q6OA 1H7OA 2C16A 3LB0A 3UQNA 2CLEA 3O05A 3FIGA 4QNWA 4HPJA 3QMTA 3THQA 2QJIA 5FF4A 2DZXA 1QFEA 4Z1CA 4P61A 3QW3A 3ATZA 3QF0A 4UR8A 4H3DA 1TYGA 4RXGA 1XBXA 5F2MA 2V9DA 5LGZA 3L9CA 4QNEA 5TBOA 3I7RA 1VRDA 2Z1BA 3LV6A 4AWTA 3NPWA 3P81A 3SI9A 2QCEA 2ZA1A 4QIUA 3GXPA 5C55A 4AHPA 3QH2A 4LWWA 3G1DA 1XBYA 2Y6ZA 2E68A 3BGJA 8TIMA 3UWVA 1JRBA 3TUUA 3G8EA 4OU1A 3S1VA 4ONVA 5I3HA 3IIXA 4AWUA 4NVTA 1TPFA 3EXRA 3LGEA 3LHVA 4GWEA 4UMCA 3W88A 4TO8A 3E96A 1DL3A 3JR2A 5FF0A 3M9YA 1H50A 1R47A 1HG3A 4JGDA 4CNPA 4NT0A 1ZFJA 1C29A 5LKYA 1XDMA 5C6MA 1TPDA 3M5VA 2JKAA 4HT3A 4GRSA 3FEMA 4IGHA 3OHIA 3V1PA 1DHPA 5FEXA 3NO5A 3R89A 4IUOA 3RLVA 3WJZA 3CPRA 5C2XA 3GR7A 2EPHA 3M47A 3BG3A 3TJLA 2X1UA 5HULA 2RFGA 2J9ZA 1G67A 2QCFA 5CZSA 4I7VA 3GLCA 3LRKA 3NVTA 3GVGA 4LV9A 4UFJA 3UZJA 3W2JA 1O4UA 1EB3A 2YW4A 3LI0A 2VXNA 4AF0A 4ORIA 4WXZA 3NQFA 3HQ1A 4U4MA 1LRQA 3O8AA 3IGXA 3MMTA 1VYPX 1ICPA 2QF7A 4HNTA 3LLFA 1TMHA 3C61A 1QWGA 5K4XA 3DKJA 1P4CA 2GQ8A 5DELA 1PIIA 4N2YA 1GZGA 2YSWA 3P84A 3HBLA 3BW2A 3OEXA 1G4TA 4OQVA 4GC4A 1EX5A 2ZCGA 1PVNA 4XTDA 2FTPA 3GDLA 1SW7A 2V81A 1R30A 3W7LA 4OHQA 2ISSA 2E5DA 3M7WA 1QO2A 3M0ZA 2QCGA 4LRTA 2NXGA 4LS0A 3H53A 5F4SA 3S0CA 5AHLA 2NZLA 3HGSA 3F4NA 3UWYA 3C4UA 2G5WA 1FWRA 4NX0A 4MZ1A 1X8FA 5J5DA 3ZFHA 3A5VA 3SGUA 1JCJA 1T0OA 4ZZ9A 5I3IA 4OGZA 5CSRA 1FCQA 3M1ZA 2FFCA 3PSVA 5K3VA 2QR6A 3KVLA 1JUEA 1PS9A 1EWEA 1YPIA 3UY7A 4LW7A 1VPXA 1SU5A 2QCMA 4GXMA 3TC6A 1B57A 3KVJA 3NPXA 2WSYA 2C1HA 3C2OA 1OABA 2NX3A 1QPOA 2V5BA 3W1RA 1MSSA 3IVUA 2ZZ3A 1IXOA 1SFLA 1FWNA 3L21A 5G1YA 4AXKA 1ZJIA 4X22A 1OFOA 4O13A 1TTJA 4X2RA 1GPWA 2CFFA 2JKPA 4XKYB 2HTMA 2P10A 2C19A 2J9XA 3G1FA 1ML1A 4S2CA 5D2TA 4FEZA 3DHDA 4MZYA 1W54A 1X7FA 4Y96A 3LHZA 3RNDA 4XKYA 3HGOA 3BLEA 1ZAJA 2V2CA 1KM5A 3HG3A 4CQ8A 2PURA 2R91A 3PY2A 2ZRVA 5BOOA 1JVNA
chains in the Genus database with same CATH superfamily
4GYKA 1W5PA 1WZAA 2ZOXA 1V0LA 1HTIA 2YW3A 3N15A 2GL5A 1YLVA 2FZNA 1J79A 2D73A 4Y2WA 2NX1A 1UR8A 2QCHA 4NHVA 3SCQA 1AODA 1TCMA 1NELA 2J9YA 4PRWA 2J13A 3ABOA 1XLAA 3DKLA 3WLJA 2EEXA 1FTXA 4YLWA 2FZ8A 1CBGA 1UZDA 4AZCB 1OFEA 1DTUA 1C9WA 1FKXA 5FESA 1K4HA 1FWEC 3WLQA 3ZS4A 3R0DA 4L1XA 3UP8A 1A3HA 3P5ZA 3WK2A 5C9UA 3EXTA 1KCZA 4NP7A 1XX1A 1BVZA 4O1BA 3CUGA 3TW7A 1G94A 3BARA 3AWOA 3EWCA 3BCFA 4A8IA 5FSEC 1E51A 5AHNA 1L6SA 4PB3A 3S1UA 5HMDA 4LOCA 3RK8A 3T44A 4H9UA 3RLGA 1J6PA 4US6A 3MTWA 2Z7KA 1A5NC 1DE5A 3QQ1A 3VNJA 3CT7A 1KWKA 5CPNA 3NEVA 2DP3A 3WFAA 4PH6A 3NEHA 1O1HA 3WDJA 5C70A 1OFDA 3BE7A 2WLZA 2FGZA 4W9TA 3UXLA 3RIKA 3RF9A 3NXFA 2GYIA 3A6OA 2VGIA 4UXDA 3TTYA 1DYSA 2Y8UA 4BCEA 2ZUSA 4GH3A 2I56A 2X16A 2H90A 3LA4A 4WQ6A 1J0JA 2ZUWA 1WX0A 1UZ4A 3MP5A 2FIQA 4GUGA 1VCFA 1XBVA 2NXIA 1MI3A 3MB9A 2E6DA 1U1HA 1KFBA 3CZGA 4FXJA 1P7TB 2QNEA 2XVNA 4HA1A 2TYSA 4IFOA 3FX4A 2XWDA 1A5MC 3UCDA 5DY3A 3I6TA 1SR9A 2X41A 3RITA 1E6QM 3UYCA 4JTQA 1BGAA 1NM9A 4NJHA 5D30A 1VFUA 2OCZA 4DJEA 4LUIA 4ZQMA 4PB4A 7XIMA 1OQFA 1L6WA 3W0KA 3MJYA 1TKKA 4U10A 2WZMA 2Z26A 4WD0A 4ECLA 3S6DA 2V5DA 3VNMA 1UMLA 1RSCA 2X0HA 1NDYA 4O0QA 5K9CA 2J7FA 3IIVA 2WOQA 3WK3A 1JF6A 1XLFA 2VZTA 3WQ6A 2NV2A 1YRRA 2EG7A 3LV5A 1Q6LA 3VK5A 3URNA 2C18A 1FCVA 2DJXA 3CK5A 1NOUA 3FYOA 4CEUC 3NJ3A 5LSMA 2YFOA 2VC7A 4IUGA 3VKJA 4JS3A 2QMKA 1K9FA 4ZMGA 3T0TA 4I8YA 5G4WA 4MVAA 2DT0A 1N8FA 3OBAA 4MF4A 1PKLA 3MUIA 1VJZA 1QASA 1S2AA 1VCGA 2DZTA 1KB3A 4M24A 1WDQA 3OLEA 3LCGA 1OWQA 3GDMA 1UR3M 3BSMA 3CUHA 4UBPC 4YPJA 1VLIA 3H7VA 4J9JA 4JIEA 3C5QA 3BSHA 1UUMA 1XH2A 1QPQA 4DWDA 1XFCA 1SVDA 2ZTJA 1PX4A 4IG2B 4HNNA 5EGRA 1R2RA 3CL6A 4IFKA 5BNKA 3RM8A 5I03A 4ZR8A 4L80A 4V33A 4PODA 3FGCB 1SQ7A 1CZ1A 1BYBA 3BLPX 1R6WA 3AIBA 3GAKA 1Z41A 3BQ6A 3QSRA 2DVXA 3ZM8A 3PTQA 1NWSA 3AO0A 1PL9A 3WNPA 3BXWA 2G97A 3WBWA 3L4TA 1OGSA 2EBNA 1R9ZA 4LJ3A 1OCQA 5JQ9A 1W1A1 2VR5A 4C7FA 3ANYA 1V6XA 2QULA 3T6CA 3UYIA 1LUCA 3DBNA 3OG3A 3VD7A 3G3DA 1HUVA 3P74A 1H2JA 4N6EA 3N18A 3T07A 3EBVA 4O17A 1UB3A 3W76A 3DFNA 3BOXA 1IIGA 3PFRA 3S8HA 2V30A 1XGEA 4NRRA 1FP9A 4GYPA 1DJQA 1JF5A 4CLMA 4OBRA 2ZZ7A 2O7SA 2C1IA 2V3GA 3C0LA 1R3RA 4Y9OA 1KQZA 4W93A 3CEUA 1H7XA 2YBTA 4MPQA 3WJYA 2YCIX 4PBGA 2ISWA 1UJQA 4ASTA 4XIAA 4U5IA 1XLEA 4DWSB 1KRMA 2IPGA 3R12A 1YNQA 3WK0A 5FAGA 1YEYA 1G69A 3CV1A 1HFBA 4PMXA 3AIEA 3RFAA 2Y7DA 3C0JA 5D4YA 3CB8A 1W1TA 2QUUA 3UR5A 3GC4A 3OVQA 2GVEA 1HL2A 1JZ2A 1LL6A 4JCLA 2CZEA 4P8VA 3RM9A 4XD3A 4AX7A 3S3GA 1SZNA 2VZUA 3IJ9A 3IIPA 4GFIA 2D0HA 3VFLA 4P8WA 1CIUA 3HTWA 3I65A 4GABA 1H7NA 4K37A 1PSCA 1I45A 2G3NA 2GJNA 4H1ZA 4AD4A 2VQTA 1R9XA 3KFTA 1G4EA 1ZL1A 4M1RA 3AXKA 3L5AA 1NSJA 3S2CA 2A4AA 4Q22A 1TCDA 3N2CA 1TR1A 4H9TA 2NT0A 3VA8A 1JDCA 4RDVA 1NWUA 5I79A 3BH4A 1JAEA 4E2VA 1XDJA 4FOUA 2OU4A 1TIWA 2XSAA 4TQTA 2EJ1A 1JCTA 3RO6A 2ZQ0A 2R24A 3T78A 3OVPA 1NTHA 1M68A 4ROPA 1V3IA 4D6CA 4PTVA 4DJDC 3WO8A 3BLFA 3BO9A 4O54A 1GYLA 1W5QA 3CTLA 2NUWA 2RDUA 1RLDA 2DFAA 4IIDA 3WBAA 4Z42C 4J2MA 2RHGA 1N55A 4EVZA 4N4QA 4QDWA 2VWTA 3PPGA 4NZ3A 3G1RA 3PAJA 4LEFA 1KRAC 4S39A 2PDYA 4KRTA 1YDVA 3GHSA 3P3BA 3VIMA 3BG5A 1BTMA 4D1IA 3NQCA 2ZWYA 7TIMA 3CIVA 4XQ6A 3I10A 2VFEA 1LOSA 3PSWA 3NSNA 4D6IA 2JGQA 1CLXA 4B3LA 4JYEA 4L56A 2OB3A 1DQXA 3B0YA 5DXXA 1JZ3A 5DBTA 5I3GA 4DBDA 3DC8A 5HATA 2VHLA 1W56A 3BZJA 4A21A 1F6KA 3AYTA 3S4TA 1BKHA 1PTAA 2DH2A 3IVTA 3EKLA 4UTFA 3GO2A 5AYXA 3R1ZA 1UH4A 4GNJA 4UFKA 5I6SA 3HPSA 4ICNA 3R8GA 1QTWA 1LOLA 1R7AA 1XLHA 2ALRA 4RE2A 3ARQA 4U5KA 4AZCA 1M03A 2PDUA 2OYKA 2FZDA 1SO3A 3S5NA 4RLIA 2WZIA 3CO8A 2NV1A 1EJVC 4XVEA 1E4IA 2INFA 3AIVA 3G3MA 1L9WA 3WFLA 4RW3A 3JU2A 3PJXA 3VCCA 4REQA 4PBEA 3PM6A 4JTFA 4IZGA 3UWWA 4W8BA 4ZGYA 3IJ7A 1E55A 1TQJA 3WBYA 4HB7A 3MUCA 4PC8A 2Q3RA 3N2TA 4CQ9A 4M0XA 3WQ8A 3WL0A 2XH0A 1B90A 3R11A 3T8QA 3B4UA 1A5UA 2ALDA 1YIXA 2IS7A 2DIKA 3HGJA 3P61A 2C14A 3PJWA 4M6VA 3VIFA 4ZOAA 1H63A 2QHAA 2BZNA 4AZ5A 5A3HA 1K6AA 2J77A 4WRHA 4MWAB 3FSTA 4MG4A 3SCNA 3ABZA 3CMFA 5FF3A 3R5EA 3OQEA 1Y8BA 1F73A 5AC5A 2BOGX 1DWJM 1UG6A 4N0RA 4JN6A 4PCFA 3VOFA 1C8QA 3NL6A 3W38A 2UWFA 2XISA 3KM8A 1XHGA 1GEQA 4HSHA 2RGLA 1AK5A 2XJ7A 1U30A 2BASA 3SUWA 4XWUA 5EY5A 1AJ0A 3RN6A 2FGBA 3JUGA 1Z48A 3PUDA 3REQA 2E4TA 3I3BA 1PX3A 4WK9A 3QV6A 1UUQA 4ZXOA 3TYCA 1YNYA 4IPPA 2O55A 3SJNA 4R33A 2V5CA 4CEXC 3LOTA 1E1CB 2A7NA 1PV8A 2GJLA 1QOPA 1G4SA 4GX9A 1XCXA 3N14A 3NQAA 3N73A 1RJQA 1UD8A 3LMZA 3GH5A 3N9SA 2XG9A 2NQ5A 4M80A 2E6FA 1TUXA 4YTTA 3AOFA 3UWEA 2J7DA 1C90A 1F05A 5CPTA 4WCJA 3TN4A 2YL8A 3AMDA 3HM7A 2YBVA 4XB3A 1UASA 3POCA 1WXYA 3M6YA 4QAWA 2P50A 1W3LA 3EPNA 1H7WA 1ZRQA 3CQ0A 1K8ZA 5CC3A 2PDXA 3V0UA 5G4EA 3BAIA 2WC3A 1TZZA 4Z1YA 3MYOA 3N4FA 1PB0A 2QPSA 4JCMA 4F4RA 3EX2A 4LRSA 1EDTA 4GCXA 2Z00A 3GK0A 1LG1A 1M53A 4IOTA 1QO5A 4XBKA 4Q7IA 1D8CA 3CLMA 1F3WA 3A23A 2HNHA 1XINA 3SCTA 1KC7A 1UH3A 1KFJA 1QMLA 3MCOA 1HJVA 1TRDA 3H6OA 3KOWA 4Z2JA 1K7FA 4N9BA 3QY7A 1ZZMA 3SDOA 1AH0A 4C7DA 5XIAA 3F4DA 4JFVA 1M7XA 3W84A 2WK2A 2Z27A 1FY6A 2GOUA 1UR2A 4JYDA 1V6YA 1OIMA 4F48A 4F40A 4S3AA 1AMYA 4XBSA 3W2MA 3EDFA 1XRTA 1R46A 2BP1A 3HIJA 4JTDA 4FK9A 1FUYA 3AMGA 4AISA 1B1YA 4JQAA 1WZLA 4LYKA 5GVJA 4WEVX 3MHFA 1S39A 2CNCA 3KLKA 2WJEA 2WVVB 3IACA 4BKNA 2X05A 1AFSA 2GVGA 1OADA 1IV8A 4QE1A 3SCVA 4TOQA 4JQ4A 1VFTA 2D20A 4YL2A 3F2BA 1A3XA 3RUBL 2PA6A 4H00A 3KCJA 1JNEA 3DFQA 4YCOA 2QJNA 4AW7A 3OW1A 5FJOA 3A9IA 1CLKA 1EJWC 3GUWA 1KTBA 4LB4A 4DWSC 2QS8A 3R0KA 2L5HA 5G5IA 2QVNA 4IGNA 5XINA 3GG1A 5LXXA 4AC1X 1JPIA 3DFTA 3AHVA 3EB3A 2ADAA 3NOYA 2PU0A 3VDGA 4JTEA 1JCYA 3T40A 2BY2A 3CV6A 4HVXA 3N04A 2FKPA 3I4KA 2PDQA 5JU6A 4GINA 4O28A 9XIMA 4MSSA 4RPQA 4UTMA 2YL6A 3LG3A 3IK2A 1EC9A 1P48A 3AHTA 4N9EA 4XSMA 4D6JA 5BW6A 3INPA 1IXNA 4IPNB 4QHRA 1GG1A 1E5JA 1E56A 1VBRA 2INEA 3VNDA 4M51A 2POZA 5H8UA 3FJ6A 3S46A 4GJ1A 3OVGA 2E0PA 2VFIA 5IXEA 3CWOX 3C2YA 3PPHA 3WD1A 4B16A 3N2BA 1GOIA 2CERA 1VYRA 2JK2A 4PYSA 3S6TA 2PTZA 3UY8A 3GC2A 1Z7AA 1SFSA 5A95A 3NL3A 4PB5A 2GVYA 3SQSA 4IX0A 1B30A 2F84A 2WNQA 4O18A 3KOYA 2ZZ4A 4LBSA 3AWNA 3CV7A 5TF0A 4XZLX 1YXCA 5DT7A 3WQVA 2OSWA 2R1LA 5CKSA 3U2ZA 1A53A 1XCWA 4XZ9A 4GNKB 5CAHA 4MKVA 4AU0A 4B4FA 1UD2A 3NSMA 4OT7A 3BCDA 4V1YA 2EPKX 4FNTA 3PVFA 3F5JA 4Q8UA 2TRSA 4MJMA 3R8RA 1XLCA 4RZ6A 6XIAA 4UOJA 1EPVA 4AIUA 2ZC1A 3B9EA 4AD1A 2PWHA 3SUVA 1UIPA 2F38A 3P14A 4EIVA 2ZUNA 3GU9A 2H6RA 4QITA 4FAMA 4J28A 1EC7A 3DG7A 4Z2KA 1XL9A 3VKKA 4CD4A 1A0CA 4MAVA 1FWFC 2D3NA 2V3DA 3NVDA 4ZXLA 4NX5A 1OZQA 1A4LA 4HCHA 2RDTA 3ATYA 3KCOA 4RNJA 1JAKA 3H70A 3MA8A 3GY1A 1K3UA 2JEPA 4IP7A 1L8NA 1PZ1A 4XV0A 3RPTA 4ATDA 1R86A 1JR1A 1VFOA 1X1ZA 1AG1O 3CZKA 4MB3A 5HMSA 1NWRA 3O6CA 3WNKA 4O11A 4O14A 4Q6JA 3TR2A 1Q7ZA 1ISWA 1VD6A 4GBUA 3EWUA 4GQBA 1DV7A 1X7IA 4TVDA 3K1GA 3FN9A 1OG0A 1RBOB 3EXSA 3FXYA 4LS1A 3GSMA 5E70A 3VD3A 4E8CA 2A79A 1W9UA 1DQWA 2VQUA 1OK6A 3V4BA 4M56A 2OWCA 4QTGA 1EFZA 1KCKA 2QV5A 1PZ2A 3TJ4A 4JHMA 2C8NA 1W2PA 1OJXA 4QX4A 5CSUA 3WIJA 2WV8A 3A4JA 3BAXA 1K7EA 1TPWA 1G9HA 3OBEA 5AVHA 2QUMA 1Y65A 2PF0A 4EF8A 2ZBTA 3TFXA 3QPYA 4YS1A 1UOZA 4URIA 5CGMA 2HVOA 2PTWA 4N02A 1DJGA 3B8DA 1AW1A 4PMQA 1GWJA 4F0MA 2D69A 4PTNA 1O66A 2QCLA 5D02A 3SURA 4PSPA 5DXYA 4KRUA 3A22A 4MLJA 1E1EA 3PF3A 4AD3A 3VUPA 3QOKA 3VABA 3WMLA 1H62A 1Y5WA 3B8UA 1TIMA 4JNZA 1FFQA 3HG4A 1OF8A 2DT2A 1JGIA 3DFOA 4KKXA 5REQA 5JXQA 2Z1XA 3IJ8A 4YHGA 1OFAA 3AC0A 2Z2UA 1W91A 4X61A 4Y9NA 3IWPA 4JAWA 1J0ZA 1TO3A 4L4OA 5DCDA 4WDUA 2VGBA 2Z6JA 5A6LA 4X0VA 4G5DA 4A35A 2DZUA 4LAZA 3M44A 4OFCA 3WUGA 4MKSA 1ZP4A 5I09A 4QS6A 5LA2A 3S1GA 1V3HA 2Q01A 1U83A 4QFUA 4Z2HA 1FDJA 5ABTA 3FHQA 3E9AA 1FBAA 4PFHA 4KH2A 3QYSA 3IGSA 3LX9A 3EGJA 2W9MA 4H6RA 4FNSA 2UY3A 1RK6A 2CWXA 4MWAA 1KFKA 2ZRXA 5CG0A 1PAMA 3TTEA 1BGGA 3XINA 1MFVA 2GDUA 2ZUTA 4DY1A 5CC5A 5IDIA 4KS0A 1Q6QA 3K30A 1IWPA 1J5SA 3TP4A 5B7YA 3TSMA 3TK7A 3TKFA 1MW0A 3W1TA 5KITA 3KRSA 5D32A 4C6PA 1TTQA 1OEPA 3A21A 1UKSA 3L67A 2ZIDA 1KWGA 4PCTA 1BVWA 3LHYA 5F1UA 1W8SA 3CYJA 1S2TA 5F2LA 4WDWA 3GDBA 5FSDC 4FSAA 1R2TA 1V3MA 2CYGA 1UWQA 5GPRA 3KBSA 1E1FA 1QI4A 2PGRA 2C6QA 3UWQA 4AXNA 3ARZA 3E0IA 3ZJ6A 2W62A 3IJQA 3LBOA 5EMMA 1OG6A 1VFSA 3FXGA 2J27A 5E93A 1EF2A 4UZSA 5CC6A 2DUZA 3TFCA 3LTPA 4U2ZA 2CITA 1VJSA 1AJ2A 4JZ5A 3CYVA 1VHCA 2GDQA 3OB8A 3VU2A 4JFWA 5DCEA 3OA3A 4Z2LA 3NDZA 3NM3A 1RPXA 2GWNA 4CNSA 4WOQA 5C5YA 2X1TA 4UTWC 1O1ZA 3W7IA 4QSFA 3KVKA 4B5XA 4YIWA 4GX8A 2ZRUA 2IKHA 2WXDM 1WZKA 1JZ4A 3DFHA 4ZA0A 4H8UA 3MSYA 5HQMA 1U5JA 2BY0A 2OR2A 4EXBA 3R25A 3TQ0A 3N9RA 4G7FA 1ZTVA 4B5SA 5FJJA 2V5JA 1EO5A 1XSIA 4UFMA 4AIBA 1Y5VA 5A8GA 1J0HA 3OZMA 4UCGA 3V35A 4FXFA 2BXZA 3RLUA 4AEOA 2NVAA 3W02A 3II1A 2GGGA 2PTDA 1DIKA 2ESCA 4ZE5A 3MQTA 4PFMA 3G6LA 2QXWA 5D9MA 4EXQA 4OECA 2WVSA 1WO2A 5MHBA 2Y7GA 5FIPA 5C9XA 2VX4A 1GHSA 2Y62A 4RZ5A 3MI3A 4GD0A 3H2EA 4FZIA 3MI6A 2C91A 4DBSA 5I3JA 1LROA 2KZHA 2VT0A 2VFGA 4O1FA 1PX8A 2CXGA 5JVLA 2WHMA 5D37A 1FP8A 4HPGA 1PIFA 3UW6A 5CGTA 3QV9A 4AFYA 2CLLA 3TCSA 3L2LA 4H8VA 4GMEA 3ZT6A 3RRAA 2WVVA 4CVWA 5AHIA 1DVJA 2AQWA 1XGZA 2BGQA 3W7MA 4S3FA 3EAUA 4KWWA 2X1SA 4AZHA 3WNLA 3JS3A 3TQKA 3B3DA 3SB0A 4Z1AA 4C7GA 3GS6A 1LYXA 3VMPA 3Q45A 4I6KA 2WSQA 1UPPA 5JBDA 3LB0A 3AICA 3FIGA 4HMEA 3QMTA 3NO1A 4D6FA 4P61A 3QW3A 2XFYA 4WJ8A 1ESWA 2YZ5A 5F7UA 1VRDA 2Q02A 4F9JA 3NPWA 3UERA 3CLWA 3GXPA 5LXEA 3B8TA 2A3CA 2Y6ZA 1DXEA 2E68A 3CPUA 8TIMA 2HROA 1YMYA 2WQDA 1ITUA 1MYRA 1FHUA 3IJ6A 2EQDA 3LGEA 3LHVA 1V02A 4ACZB 3JR2A 3UJSA 3M0IA 1M41A 1VBHA 4E2OA 4JGDA 1EZWA 4NT0A 1ZFJA 1C29A 1XDMA 1RD6A 4A8NA 1ZBWA 3WQPA 3V1PA 1DHPA 2BOFX 5FEXA 4HK5A 3R89A 3M0YA 4IUOA 4XVDA 5C2XA 3NWRA 3FW6A 3TJLA 1FH8A 4HD5A 7ODCA 3KTXA 3PZMA 4AEEA 3GVGA 5HA7A 3PK7A 3UZJA 3W2JA 1TJ0A 2PWFA 3S83A 1O4UA 1EB3A 1UH2A 3LI0A 4ORIA 3VGHA 3PJUA 3RYSA 2Z4GA 5CLWA 1LG2A 3U4FA 1FH9A 2BDQA 4JIIX 5HXMA 5GNYA 3QQWA 4EPKA 2FZ9A 3TYBA 3FEQA 3BV7A 1G4TA 4GC4A 2X7WA 2ZCGA 3A3HA 2OKTA 1UKTA 3W7LA 2E5DA 2PS2A 3L2MA 2GGHA 4AWEA 5IHRA 1QO2A 2PLMA 4MNJA 3E5BA 5A8PA 1Z8AA 2IKGA 2PODA 4HNCA 3HGSA 3F4NA 4QRNA 1Q6FA 4PMOA 1FWAC 5I2UA 2VP8A 4AZGA 1UZHA 3CO4A 3M1ZA 3NIYA 3NQBA 4LGXA 3VNIA 1VEOA 5DQPA 3KVLA 1PS9A 1EWEA 5A2AA 3GIPA 3TA9A 3MSGA 3KVJA 3CTTA 4XX6A 4ZOBA 1OABA 1GW9A 5HNNA 1XF0A 3UT0A 3L21A 3U5UA 4EKJA 3QR1A 4X2RA 2CFFA 1H1NA 2C19A 4DRSA 1ML1A 4XO7A 1MXDA 3GTIA 3KOZA 3ECQA 3RNDA 3ORWA 3SBFA 3BLEA 2V2CA 1KM5A 3HG3A 3MJMA 3UEQA 3PY2A 2ZRVA 1NDVA 5JH2A 1JVNA 1WV2A 3L0GA 1VIWA 4IMCA 3VTRA 2DH3A 2O7QA 4M29A 3LN3A 3UA3A 3CIXA 1Q6EA 1VFMA 2CBUA 5CJNA 2Z28A 2ZUUA 1OX6A 2HE5A 2XH7A 4K38A 4IWWA 4TUFA 3SFKA 3M4HA 3WMBA 2XIMA 2YJQA 3MS8A 1OFPA 1XM3A 4O0KA 2W66A 3ERPA 2MNRA 2RKXA 3P5YA 1NARA 2W3ZA 3NZGA 4P7LA 4Z08A 1UZ1A 3D47A 4X3ZA 2WC7A 1ADSA 1XP3A 2DU2A 4DO6A 3VI2A 1M01A 4BQ2A 4B2DD 3NQGA 4C6FA 5I3KA 1TWIA 3TSBA 2IQDA 3HPAA 1CGWA 5D9OA 4IIHA 4C91A 1ZGDA 1S38A 5HJLA 1QW9A 2GK1A 1MXSA 2FHCA 3L23A 2DW6A 4GQRA 3WEMA 1BTCA 3U8GA 3G1AA 1C8YA 4O52A 6REQB 2DUAA 3EWWA 3DECA 3W7NA 1J0YA 3YPIA 5HR6A 3OVRA 1VAHA 1YYAA 1YTKA 2E5CA 3DESA 2ACUA 4LF1A 4K6AA 2O0TA 1HJQA 3ZJ8A 3EOOA 1IR2A 3S5SA 2ZZ1A 1X6UA 5ENLA 3W81A 3GVRA 1BQCA 2J74A 5EU9A 2E6YA 1XLLA 3A5FA 2XVGA 2EHHA 3NQ6A 3DG6A 1IEWA 3NYDA 3S1WA 2PD9A 3W7JA 5C54A 3R6IA 4C5YA 5A8OA 3KP0A 1RR2A 1RHCA 2D0GA 2EJAA 3E49A 5D38A 1CT5A 2CHOA 3E38A 1NFPA 3MCMA 5AYYA 1K8XA 1QI0A 4FR1A 3ZSTA 2YCLB 1K8CA 5DT5A 4AZBA 4TX8A 3BVJA 3AIWA 1FWGC 3NDYA 1EJXC 3N4AA 3TONA 4O8AA 1TPUA 4BF5A 1B3YA 1MUWA 4MDPA 1HKVA 2DJLA 3LK6A 5I77A 2W27A 4ZOEA 2VDIA 2A21A 1HP4A 2PP0A 3BK0A 3CZEA 2B7OA 5D8WA 5T26A 1NQ6A 3GW3A 4CGTA 1JGMA 3BMWA 4HIBA 5TQLA 2Z1KA 1U33A 3T2OA 5FEWA 4LBRA 4W5ZA 1E70M 4TU1A 5LA1A 4O15A 3UNTA 1HL9A 4KESA 3CH0A 1FWJC 3AS0A 2J7EA 4HPNA 1X98A 2BY3A 4ZODA 3W1XA 3BJFA 4UTHA 2IQ0A 3TW9A 1QU4A 3KRUA 3R94A 1M1BA 5I3FA 1JPHA 2XN2A 1ZS2A 2CLOA 1TMQA 1W3JA 1XLDA 2CESA 3LQLA 3CS2A 2WBKA 4QS5A 2F6UA 4W8AA 5CPMA 5F2GA 2PC4A 3PR2A 3APGA 3W74A 4HJFA 3UVIA 6TAAA 2V5KA 3QV7A 4K3ZA 1YDYA 3GXIA 3BAJA 1JULA 1EJUC 3VMOA 4MZ8A 4ACYA 3GUGA 3CAQA 2VD8A 5A6SA 4M7SA 1W9XA 1W9PA 1UCWA 4RX0A 2FVLA 5HOSA 3UPMA 4J27A 2G3JA 1S3TC 1BRLB 1EEXA 5IDZA 4UZUA 2IQTA 3VOCA 2ZYFA 1NU5A 1WDDA 3UCCA 2O92A 2C0AA 1D7KA 1X1NA 2HISA 1VBJA 1MDRA 3MC5A 4Q7BA 1PUDA 1ODUA 5HR7A 1E72M 2C13A 1BSLA 2I9EA 1EP3A 4UQAA 1TB3A 3V5CA 1EF3A 1IXPA 4LYPA 4GQQA 3SUSA 2XIOA 3C0QA 2CWNA 4CD5A 2W92A 3AMKA 4RV8A 2FDMA 2YA0A 4UQDA 3O06A 5E6ZA 3H2MA 2J79A 4E8DA 5DEZA 4XAFA 2XN0A 1RBAA 4S3CA 3E02A 4PMDA 2BSLA 1PXGA 1KFCA 2VOMA 2Y0FA 3ABSA 1JG9A 4B5WA 1V3KA 4K8HA 4BS0A 3J7HA 4EANA 1AW5A 2QJHA 1W5MA 3WDPP 4G8TA 3S9IA 2DT3A 3VIHA 1EUNA 4DJED 2B7NA 4EOUA 3E1F1 2ZZ2A 5C71A 3NQMA 2OEKA 3WLTA 3GIQA 1MMFA 3AISA 2NX9A 1P1MA 3KHDA 1CDGA 3VOGA 4EPEC 1JDFA 2D2JA 2QGHA 2J8TA 4GXWA 3B0VC 4FNUA 1L6GA 1KBKA 1V08A 4HOWA 5D09A 3ZVHB 4NU7A 2D22A 3D0CA 3UR2A 2CHRA 3EB2A 1GOMA 4I3GA 2V3EA 3VM5A 4P8XA 3PB0A 1TV7A 2A7RA 3U9IA 3UA4A 1B0IA 4CU7A 1F61A 3SCWA 3QGKC 5IM51 3W2KA 2VNCA 5IRPA 3WLIA 3RMEA 2PSNA 1GZJA 5D2YA 1DXIA 3RPDA 2XSBA 1BLIA 1I0BA 1Y0EA 5MKGB 2WSPA 3M16A 4ACZA 1RP8A 4TMCA 4ADUA 5AZ0A 3O9NA 4V27A 5LHEA 2EKCA 5E1QA 2GPTA 2DIEA 2I16A 1GJPA 2Y5SA 4BI5A 4ZQPA 3W29A 2FB2A 4DI9A 4WY0F 4MIMA 1JDAA 1ZY9A 3MMWA 4QEHA 2PWDA 2I57A 4U31A 3VXGA 4F8XA 3KS5A 3TC3A 1S5MA 4HK7A 4J4KA 1UMYA 4NZ4A 4B9YA 4ZOCA 3O6DA 5G2WA 1OC5A 3PTDA 2V63A 1X38A 1LT7A 5I02A 4CU6A 2Y61A 2P88A 3ONCA 2PDCA 1E4MM 2WMHA 3AYRA 2W4XA 4JY9A 4A3YA 5CLTA 2Y85A 2YBUA 3ZWTA 4MAZA 2OJPA 3CAWA 1OVDA 4HYRA 4ZB2A 4H4IA 1NWTA 3V1HA 2HPIA 4PMNA 4OE7A 3ITCA 2XDFA 3SW6A 3B0PA 2JIEA 4Z17A 2KAUC 2XIQA 4DJFA 4LVGA 1X6NA 4NXSA 4TTUA 3WFZA 4MB5A 4O0ZA 1K03A 4IL0A 2PF8A 3N6HA 3KHJA 2W79A 3LM3A 2H3BA 1W6TA 3DDMA 4XZHA 1XIEA 2VM8A 4MUZA 1K02A 1F3XA 1FWSA 3R79A 4J3WA 1OB0A 1OFRA 3DHUA 1Q45A 4BWLC 2QQ6A 5LGXA 1YTEA 3OGVA 4PUWA 4XZIA 2PDGA 1NIUA 2YYTA 1GTHA 1O94A 3T0CA 1XIJA 2GLKA 3HOJA 3HGRA 2XU2A 1OC6A 4AQLA 2BHUA 1RUSA 2BLEA 3BZGA 1AQ0A 1BWLA 1EJSC 1JDDA 4MDOA 2BXYA 1HNYA 3DERA 3I68A 4K2SA 1GKQA 1J5TA 3TVAA 1ISVA 2E77A 4HMCA 2Z1SA 1DWAM 1TTPA 2CBVA 5HINA 2PRMA 3VZYA 4EP8C 2Z2BA 1LWHA 3ZT7A 2ISFA 1M65A 5HDRA 2E9BA 5CGQA 1FCBA 2V38A 2Y70A 3HURA 4EPBC 4BJHA 4A4AA 1REQA 2G3FA 4LNCA 3TLQA 4FHAA 4IPJA 2OGYA 5DMNA 3H21A 4TV6A 4UR9A 4W4QA 3AU6A 2XSXA 3WSUA 4F3HA 4NIRA 1I2OA 1NDZA 2VDHA 3DYOA 3N29A 3UZWA 3FSUA 7PTDA 3H7RA 1CPUA 3NFUA 2WMKA 4MTVA 4GIEA 2E9MA 3U6WA 4JNMA 1XDLA 3EMCA 4YTQA 3MPGA 1WXZA 3FDKA 3IAQA 2XIJA 5TAOA 1HL8A 3ZYZA 1G1YA 5AKQA 4HNLA 1VQTA 1I1XA 3I4EA 3HG5A 4AMAA 1GVEA 4Z1DA 1RCXB 2P8BA 3ABXA 1PKYA 2QVHA 1JZ6A 3W2UA 3ZQ9A 3AHYA 4A3RA 1OYBA 1B31A 2XFRA 2ZTKA 4JKKA 2NQZA 1PDZA 1MNZA 1CXHA 1M6JA 4RE0A 3VIJA 3ID7A 4P7NA 2D23A 3GE7A 5E9AA 4A3HA 3NA8A 4DM1A 4BF9A 4PN2A 5XIMA 2BFGA 3W9ZA 1UHVA 3W3OA 3KRBA 1US0A 3FS2A 4LC8A 4I8DA 1RALA 2JKEA 5AY7A 3K4WA 4ERAA 2ZXAA 5A6KA 3BLIA 1WBHA 1WKFA 3F5LA 2G3IA 2R1PA 5BROA 1RD5A 3CM4A 1OK4A 4O16A 4WKFA 4D8AA 3XIMA 1NFGA 4HCLA 1FX6A 2YCLA 3GR8A 3QHNA 2XM2A 1XUUA 2D24A 4A8RA 3CPGA 4LXFA 4J5NA 1AMKA 3EEGA 2W61A 3Q94A 3RX2A 3T4CA 1C8VA 3L66A 1UA3A 1I2NA 1RV8A 4ORMA 2DT1A 1OX5A 3M5ZA 2ZDRA 4UTIA 3HFTA 1H0IA 3FHAA 2VCCA 2BODX 4M5PA 3B9DA 3CB3A 1FWBC 1G7VA 3W28A 2IXVA 3CHVA 4D6HA 1H3GA 1ZJHA 4C6BA 2ZX5A 1KGXA 1XSKA 2VTFA 3HPXA 5H2ZA 3EOSA 1XKYA 3CEPA 4WJEA 4YYFA 3IRDA 1IEVA 3M0JA 4GACA 2ON3A 1B3XA 3QMSA 1QW7A 4ZO9A 1QCWA 1XQKA 4WHBA 1ALDA 5AVNA 3UD6A 3W7HA 3BLLA 3CUXA 4DLMA 1UWUA 1LRTA 5K2ZA 1FCUA 2UBPC 3Q37A 1PHQA 1KBJA 2C0HA 3A3XA 2CIPA 1OX4B 3CL7A 3I3EA 4GUIA 1Z44A 3NYZA 4B5TA 2VZOA 3MO7A 2OPJA 3ITXA 2BVTA 4NNAA 3R0UA 2ZVRA 1J0IA 3EX3A 4HU4A 3TQVA 3S9YA 3N3MA 2RUSA 3M41A 3EDKA 1XYLA 2FJUB 1DWIM 2VC6A 2JF7A 3LGDA 1QBBA 4OOUA 5MF5A 4D8LA 1BRLA 2YGYA 1V5XA 4R27A 3VC6A 1J8VA 1JD7A 1P6BA 3BC9A 4CNOA 4ZB0A 2W5FA 5FACA 1PZ0A 2WMGA 4J35A 4JTCA 4GVFA 3CNYA 2VC9A 1SW3A 3TIMA 2ZA2A 2J78A 3KL3A 4LUSB 4HKPA 1ZJBA 1GK8A 4JPGA 4Q8QA 5D2VA 3JZEA 1E9LA 3GFXA 4IGMA 1VF8A 1WP6A 4V2XA 1E6NA 1MVYA 2EO7A 1FXPA 2QIIA 4A2SA 1T41A 4UTTC 4TXEA 3F4VA 2HBVA 4MJZA 1W3NA 4K1WA 3T2PA 4FA3A 1UD4A 4MADA 1MEHA 2W63A 1QT1A 1UP2A 2Y8KA 3G1XA 3OIHA 3DAQA 5AC4A 2HXTA 3TE9A 3WL1A 2GUBA 3NL5A 1DEDA 3SGZA 3G1SA 4MNLA 1R38A 3ITOA 3W71A 1YXDA 4UTJA 5HMEA 2ODOA 1S5NA 2F6XA 4CCDA 3S5ZA 2WM0A 3GW0A 6ALDA 1TX2A 1A50A 1WAWA 4C6QA 2WAGA 3KEHA 3OBKA 5AECA 3RGTA 2V2HA 2P0IA 2VURA 4HN4A 5KEZA 1H61A 3W7CA 4ES4A 1AZ2A 2AKMA 4YHEA 4DF2A 1EKOA 4PUKA 3W72A 1F07A 5I00A 3ZVHA 1ITXA 3WLOA 2CW6A 1K6WA 4B3ZA 4FO4A 3QVQA 1QI3A 4JTAA 3IVSA 4HA0A 1R3VA 1Q65A 2QEZA 1V7YA 3SCSA 1H5YA 4LALA 3P82A 1EIXA 4O4WA 1K7XA 5MKGA 4CU8A 4M6UA 1NAL1 2E25A 1DHKA 1UJPA 3AXXA 1OF6A 3L68A 4NQ1A 2PDFA 4PRRA 1PIGA 2Z29A 1DIEA 2CZFA 3P60A 4IGSA 3AYSA 3FA5A 3P93A 1KR1A 3O1NA 1YE6A 3DHFA 4DO5A 1EBHA 1Z3NA 1TV8A 1QR7A 3TCEA 4LVBA 3R2GA 1TTIA 3QM3A 1HVXA 2PZNA 1D3CA 6A3HA 1DPMA 2PDMA 2IPJA 1HVQA 1RVGA 1R8LA 1KV8A 2ATMA 1VIZA 4AD5A 4C5ZA 4E0CA 4C6JA 3MP3A 4QGCA 4G1NA 1YBQB 5CPLA 4CD6A 4RE4A 3DBPA 3FLUA 4S3GA 3LTSA 1UUOA 2PPGA 2BWGA 1ODZA 4L4PA 2QAPA 4AZIA 3OZPA 2WKLA 3ZR5A 1F4AA 4DX3A 3KWXA 4WY0B 5G2IA 3QFEA 3AHXA 4Q33A 4TX6A 1EGMA 3U7BA 1EGZA 1HN1A 1DKWA 3B03A 3WDIA 4C60A 3MWAA 2DSVA 3A47A 1DWHM 3HO8A 2ZRYA 2NVDA 4A05A 2YXOA 1SJCA 2HNEA 1YTDA 2XIIA 1Z42A 4Q8TA 3VCRA 4GUFA 5BZAA 4CQBA 5BRBA 5HJYA 1KKRA 1DIDA 3CQKA 1F74A 3KBVA 4Q4MA 3RHGA 2NQLA 1L2UA 4DM2A 4KRZA 3ZMRA 3OLDA 3AFBA 2LLEA 4XTIA 5M3WA 4MY1A 1LLWA 4AHQA 3O2LA 1XIIA 2HSAA 5AC6A 5AC8A 4W7UA 5K4ZA 3WJSA 3W27A 4ENLA 1RLCL 2P5NA 3E0WA 4NYUA 3EMZA 3PWIA 4AHOA 3AS1A 4YYCA 4JQ1A 4K8GA 1KA9F 4P7QA 4GG9A 1QVBA 5LNWA 1LBLA 1M7PA 4BR1A 2C3ZA 3FVMA 1P6WA 4M6PA 4Y6GA 2VVSA 3W7GA 4E4FA 5H1WA 1SR0A 2ACQA 3GAYA 2X1IA 1BAGA 1ZAHA 3BURA 1Q7QA 3MDWA 1MWOA 3T1GA 2R8WA 4QBXA 2JBMA 4RDZA 1YPXA 3MV01 1MQQA 2BHZA 3WDRA 4FF5A 4BZYA 2TPSA 3LPPA 2OEMA 4AZ6A 1C9DA 3RCMA 2R94A 3WF2A 3APYA 3R4IA 4D1JA 1UOKA 3KBJA 4YCPA 4DF1A 3SN4A 4RPPA 2CZ5A 3MUY1 1OY0A 2RGMA 3LCXA 3W22A 1PO9A 1YDNA 4HOZA 4FLSA 3BGAA 3UPBA 1ZALA 3W1AA 3WH5A 4ZEPA 1G4PA 3C3NA 3VE9A 1RVKA 4Q8VA 3BOLA 2FGLA 2Q8ZA 3PHAA 2NV9A 2PDKA 3MZ2A 3WF0A 3W87A 5E0FA 3GWQA 3VZXA 1ZJAA 5FJUA 2D2OA 1T40A 3W6YA 2HQAA 3GHUA 1C93A 1V51A 5FCZA 1RP9A 5A94A 4JEJA 3LQGA 4JYFA 3W53A 8A3HA 4QISA 4MLRA 2VX5A 3CQHA 5CZTA 2H8XA 3SSZA 1QJWA 1QRQA 4UFLA 3W86A 3OA5A 2CZDA 3IEBA 2BGNE 3VKDA 4ZQOA 2R9RA 3VKBA 5A69A 2QDEA 4LNYA 4PUMA 4U3CA 5B7ZA 4I9MA 2E7FA 4X9SA 5KZ6A 3WF3A 3GNPA 3ZOAA 2FVKA 5I0DA 1Q4WA 1RK5A 4AUBA 2XWEA 4KERA 4QAIA 4AEFA 1JL8A 1LF1A 2QUTA 4LEQA 1I2RA 4JTIA 3IANA 4K36A 2J24A 3BV4A 3QBUA 3STEA 1WPCA 3T2QA 4QQ3A 1TA3B 3OGSA 2I1OA 2VENA 4Z2GA 2G95A 5FJIA 2BNJA 1DJYA 3LXAA 1XLBA 2BX7A 4Q3MA 2ZXDA 1CX9A 1R0MA 4Q32A 1ICQA 4JTHA 1MEWA 2ABBA 5D05A 3CQIA 1NVMA 4KBXA 4GBDA 1XSJA 4N7QA 3S2JA 4IFRA 1VJIA 1EDQA 3WF4A 3IUDA 1KLYA 2Z24A 3AALA 4IICA 1OSEA 4A6GA 1Y5XA 1W3KA 2PGWA 5DMMA 5IBXC 1W1ZA 3WK1A 3M0XA 1OX4A 2CHNA 4IP5A 4L9YA 3RCYA 4I5UA 4IMEA 2NW0A 3RG6A 3T05A 4D72A 5CCZA 1A5SA 5CQ1A 4LQ1A 4OKDA 2OSYA 2VFHA 3OO2A 1XYZA 4TV5A 4PE8A 2DEPA 3W7EA 4DI8A 5I78A 3R13A 1ZP3A 1KM1A 1LTDA 4YVXA 1EOMA 3AQUA 1JZ8A 1E6SM 2Y89A 3N17A 1GONA 2EAWA 3GM8A 4AVNA 3VGDA 1GQLA 1KM2A 3CUJA 5SWUA 4E3VA 4NJKA 4MWAD 1NP0A 4IM4A 3BL3A 4JXCA 3FKKA 1J4EA 1XIFA 1UYQA 5TNVA 1GG0A 3G77A 2TSYA 4IMGA 4BFAA 4LUSA 3W85A 1EL3A 4F0SA 5FF7A 3M0VA 2GSHA 1WUEA 1KNWA 2WM1A 4IIGA 5CBBA 5LNVA 2NQ9A 3AS2A 1S2CA 2XZ9A 3M07A 1H11A 1W37A 1K9DA 3E74A 4KETA 3Q4DA 1JFHA 3LY0A 4PA8A 3SN1A 3TJXA 4PRTA 4H6EA 2ACSA 1MW1A 3M0LA 3EDEA 1VHNA 4UCFA 3LCHA 3VGEA 3WD4A 1Q6OA 1H7OA 2C16A 3UQNA 2WJFA 3AMLA 3O05A 1XH1A 4QNWA 5DX7A 1QI2A 4QR6A 3ATZA 2QYGA 2J7GA 4C6DA 2VRQA 3QF0A 1K70A 1XRFA 4RXGA 3L9CA 1EZ2A 4MMWA 4N42A 4QNEA 2QUNA 3LV6A 4AWTA 3RCNA 3FA3A 5ABFB 2QCEA 3KTSA 1AA1B 4LX4A 1H49A 1Q13A 1W2VA 3GTFA 2EKGA 2VL4A 4R7OA 4HHLA 2PGFA 3UWVA 3AU2A 4OU1A 1IEIA 3SQLA 3S1VA 3FJNA 3WBEA 3PZTA 2XINA 4EWJA 4C6KA 4NVTA 1ITQA 3EXRA 4AIEA 3AMCA 1Q6DA 3WZ0E 1DL3A 3ENLA 3PUGA 3M9YA 3QV8A 1H50A 3UG5A 4CNPA 1BG4A 3HPFA 2O4QA 3E2QA 4L5ZA 1TPDA 4RZBA 3B9NA 1M9HA 4HT3A 2HXUA 4WDTA 3FEMA 4LAMA 5HMFA 4HCDA 2D2HA 3QXBA 1HJXA 2OODA 3VIIA 3AXIA 5BRQA 3RLVA 3RILA 1H4PA 3M47A 3BG3A 3UESA 5HULA 4DUVA 1G67A 5CZSA 2VX7A 3GLCA 3NVTA 4PMJA 3CJPA 3CZLA 2UZ9A 2HZGA 4B92A 4L61A 4XG1A 1TVNA 3MDUA 5BCAA 3V7PA 1R5YA 3IPWA 4U4MA 3IGXA 2QF7A 3MMTA 1ICPA 1GJWA 4R5EA 3GNRA 1Y7VA 3APTA 1P4CA 2J8GA 1DWFM 4N2YA 3GG0A 3TN5A 1RJRA 4P7RA 2A3AA 1EX5A 4XTDA 4GLEA 2FTPA 4F0HA 1JZ5A 1SW7A 2VX6A 2ISDA 3UGVA 4LAOA 3SY8A 4DZAA 3KL0A 4S3DA 3S0CA 2YOCA 4E4UA 2NZLA 3F2DA 4DXXA 5A6TC 1V79A 3K8MA 3A5VA 1ZBVA 3SGUA 4D6DA 5I3IA 1XYCA 1W1VA 4AZ7A 2OSXA 1GQJA 3AI0A 3VZZA 2QR6A 3CXOA 3LSBA 1MRAA 1Z6KA 1JUEA 1X97A 4LW7A 1ISYA 1VPXA 1SU5A 2QCMA 1BYDA 4YWSA 4EK7A 3H2AA 3GYCA 1UWSA 2NX3A 1QPOA 3W1RA 1E0XA 3IVUA 1E6XM 1SFLA 5G1YA 4AXKA 1R3SA 1GVYA 4XKYB 1E73M 3PPFA 2J9XA 1UP0A 3TWBA 4H19A 4FEZA 3DHDA 1X7FA 3BLKA 2I5QA 1ZAJA 2XFFA 3VIPA 3H2OA 3TQPA 3H4XA 5BOOA 2C1GA 3H23A 1HO1A 4D71A 1BQGA 2PRLA 4WXYA 3U48A 5BU9A 3A13A 2DZSA 2ZE3A 3MHUA 3STGA 3HV8A 2P1FA 1LZOA 1PWMA 4DJDA 5KETA 1BWKA 1UWRA 1BHGA 4JQ2A 3ME3A 2QDHA 4AY7A 1UKOA 1MFUA 2YYUA 4WJXA 4G6CA 3C0SA 3GQYA 3AXMA 4GYFA 2MANA 4MFDA 2FTWA 3PWGA 3GVVA 2EPNA 1C91A 1R87A 4EAMA 1PKNA 2WKJA 1LLZA 3KOXA 2F8QA 3VOIA 4GO9A 3U2CA 3VGBA 2OQYA 2OLAA 3AJ7A 1NOWA 3FAXA 3G1HA 1GVQA 2OT1A 2XUCA 1YADA 2AKZA 3HQNA 3LDVA 1L6FA 3T08A 2WVTA 2YL9A 1KFLA 1E40A 1WKEA 2CC0A 4PTXA 4XZNX 3G1YA 1MQPA 2FVMA 3CUIA 3RM4A 3P67A 4WKAA 1C7TA 1G7UA 3NQDA 3ZT5A 1EYEA 3TC7A 4FPSA 2DZAA 2Y1HA 4QDMA 1WKYA 4HHMA 2D2GA 1J2BA 1QATA 9XIAA 2BGSA 1CGXA 4KWSA 4C6LA 1VPYA 3T7VA 2DZPA 4OIFA 1LWIA 3TEVA 2OQLA 5FEPA 4X9YA 4Q8OA 4FALA 3LCIA 2OGJA 4H41A 3TDFA 3GG8A 1JCNA 1Z32X 1W8GA 3SEPA 2XN1A 2RAGA 1OT1A 2YR1A 4GUJA 5FAJA 4WX2A 3VINA 1B2YA 1XGDA 2AGKA 3GDTA 3MU7A 4IIEA 4J3TA 4D6GA 5M17A 3UF9A 1E0UA 3OYZA 2DPEA 2PDPA 3PBGA 3TWAA 3ABQA 4HZ7A 2FPTA 4LT9A 3CQJA 4HBKA 3EYPA 5G4HC 2G0WA 3RRXA 3Q65A 2O9OA 3IRSA 3L0NA 2VFDA 1CXEA 3VDHA 4E8GA 3GH4A 1SGJA 3LI1A 3UWUA 3N13A 4OV9A 3TSDA 4YTSA 3OQ8A 3GXFA 1E0TA 2ZXBA 1JUKA 5A1AA 4F66A 1P7TA 3CZJA 1JZ7A 4JTSA 2FYMA 2ZZ5A 3C2EA 1K4GA 5HUOA 1DTNA 2RH9A 1J11A 5CPQA 5M1TA 1TA3A 2QDGA 2YA2A 2ZX9A 4AYGA 1UPMB 1WXJA 1EDGA 1F3TA 4RL3A 4GK8A 4GVHA 5E6YA 3FDGA 4Q8NA 4Q7NA 1TPH1 4LVFA 4HMNA 2G96A 3PZIA 2R6OA 5AZ1A 2A2IA 4MHBA 3H8AA 1UBPC 5CZ0A 5HWJA 3G18A 1KLZA 4C1NB 2AMXA 1OCNA 2FDSA 2I5GA 4NUWA 4U28A 2B7QA 4BI6A 5JIWA 1O68A 3W7DA 4JL1A 1GKPA 3PB2A 1Q5MA 3VNYA 4HPHA 2HK1A 3RU6A 1XIGA 2FH8A 4L64A 2ZX6A 2WWCA 1HO4A 2FZBA 5DBUA 2G4JA 4LCQA 1CB7B 2VD9A 1Z9AA 1V77A 1KXHA 4DZHA 2VR4A 2R14A 3TROA 1DQUA 2H3DA 3QC3A 4LUTB 4KW2A 5BXTA 1D3HA 4CCCA 2QCDB 1JNDA 4ZTYA 2NVCA 4GH1A 4WGXA 2Q6ZA 1ZENA 3IAPA 1B3ZA 2PC8A 1JRCA 1PTGA 1SMAA 2SFPA 4LY8A 5H8PA 4K8EA 3EA2A 4IMFA 5EFFA 1TWZA 2YDAA 3QYQA 2OZ3A 1J10A 3GHTA 3VD4A 5T8GA 2YDQA 4L65A 1OZMA 2ZXQA 2HS8A 3KBMA 3NGFA 2F61A 3BPWA 2PFHA 4LF2A 4JOMA 1CTNA 4GCAA 5E0KA 1JCMP 4IG2A 4A29A 1IEXA 2V69A 4CD7A 6TIMA 3GH7A 4DPPA 1TPB1 3UXAA 1DE6A 3GX9A 4NI3A 2WZHA 4EAYA 5K9DA 3FGCA 3KBWA 1UWAA 4GI8A 2OTDA 5EL1A 3W7QA 1EBGA 1EQCA 2CCRA 4O19A 1RQHA 2XFWA 2CKSA 3GXNA 3VD9A 1SJBA 3WN6A 2PTYA 4W5UA 3TYZA 3H2CA 1NF7A 2ZUMA 3C2VA 3VD5A 4JFSA 3B40A 4M6QA 1WOBA 3KOFA 3T9PA 3V16A 3OZOA 1LUCB 5CPOA 3AUJA 4I9TA 5GQBA 4DO7A 3N2OA 1DJWA 3PJTA 3BDKA 4HGXA 2G3MA 5GJMA 5BMWA 1TQXA 3V18A 5KSWA 1TE1A 3FNDA 4JHZA 1KGWA 2BV9A 1J93A 1PCWA 4KGJA 4IX2A 5K7JA 3NZQA 3NDOA 1E9IA 4R9OA 5ABFA 5KMYA 4K7VA 1E3ZA 4CNNA 3G22A 3FV9A 4CQAA 2IKJA 1XLIA 4LYRA 2GGEA 5AC7A 4J3VA 4GJIA 4MGGA 3T55A 1QI5A 2Q8LA 3VDAA 1HGYA 1D8WA 4BQ3A 3H55A 2QPUA 2JGYA 2P0OA 1UC4A 3QSTA 3BCJA 1AJZA 3KAOA 1C3FA 4W7VA 1JYVA 1GGOA 4FLRA 2VZSA 2ZFAA 3GG7A 3QZ6A 4UFHA 1E4NA 4YVVA 3UETA 2WMIB 4XAGA 1JD9A 3N9KA 2GGIA 4DWSA 3ARSA 3N6QA 1M7JA 3TN3A 3W4RA 5AYIA 1WCGA 3ZZ1A 3L0KA 1ZLPA 3IGUA 1S5WA 4WOZA 1RJPA 4IXXA 2H8ZA 3BMXA 1TJ1A 5H8MA 2IPFA 3ABRA 3UZYA 3DZ1A 1KV5A 3D3AA 1W3IA 3WLMA 1SUXA 1IE7C 3CT2A 1GOWA 5EMUA 4GY1A 5JMUA 1UR0A 4XK2A 1KFEA 2GOKA 4GFSA 2DSKA 1AQHA 1EXPA 2ZADA 4US5A 3M0KA 4HZMA 4R88A 1XUZA 3P8IA 3ARUA 5BWAA 1EOKA 2ZX8A 1GYNA 3LXCA 1HIZA 4JX6A 2PDBA 3W7OA 4B91A 2JF6A 4QROA 1EJ7L 4O1EA 2ZC8A 2GSEA 3WNNA 4NJGA 2HMCA 3OIXA 3SJ3A 3DGRA 3CH9A 1G6CA 4HA4A 3L4XA 4QEEA 5FOOA 1ONWA 3CHFA 1R3QA 2GVJA 2OKOA 3IIOA 1OD0A 5FL1A 4EWND 4B3KA 2YL5A 4GGBA 4DZIA 1JQVA 2VRJA 3EKZA 4YWIA 2W0UA 3PTKA 5BMXA 1NP2A 1BSIA 1VR6A 4AH7A 4TX9A 1IYXA 2RJHA 2WC4A 4GKTA 1BD0A 3EOUA 3TA6A 3TMQA 3WLHA 4CCEA 4YU1A 4UTLA 3VKCA 3WX7A 1W1IE 3TAKA 3WD2A 1V0KA 3WUBA 1PCKA 3UXDA 3LPFA 2A1YA 2HE8A 3QGAC 2DQXA 8RUCA 2CPUA 2PMQA 4RE3A 2QV4A 1GT8A 4W85A 2VJXA 4QSHA 2J7CA 2VCAA 4R34A 2E5BA 3M0HA 1AH3A 2ZE0A 1ONXA 3K4AA 3IUIA 1U22A 3GNNA 1V3LA 3WQEA 3ITLA 1LL7A 4RR4A 4XBJA 3E2VA 4DO4A 1YX1A 4JD4A 4HOXA 1LOQA 4ML9A 1IZKA 1BF2A 2ONEA 4KCUA 3O07A 4HA3A 2AAMA 4OZOA 3U0HA 3OHMB 4H9XA 1E6PA 1E0WA 4R7JA 4L6DA 1P6CA 1HKMA 4REQB 3LBCA 3MMDA 3KRZA 1SO4A 3I6EA 1XYMA 1TV5A 3B9OA 1KBIA 4PR4A 5RUBA 3W83A 1RCQA 3LZ3A 4HHPA 4K1GA 3BLOA 4ERGA 1JPMA 5LIYX 1ZHAA 1IT7A 4QXIA 1PJ9A 3WLPA 5B80A 2OX4A 4GVIA 5E0CA 5KINA 2C71A 4DQWA 1SZGA 1ISZA 1SJAA 2YCJA 2VDGA 2Y7EA 1GVIA 5JUVA 4ZO7A 3CHCA 1ENUA 4X2PA 5LIKX 3W7RA 3IK4A 5H6HA 3M46A 1B54A 3DU0A 4HNVA 1DP0A 2ZA3A 4DJFD 4NILA 1PDYA 4DJEC 5M03A 1NQKA 3SN0A 3AYVA 1FWWA 4GIRA 4V28A 3P80A 1RH9A 3SM0A 2E1DA 1F8IA 3L2IA 4KIEA 1NDWA 3R7MA 1RY0A 2CU0A 3GZ3A 2NLYA 2D0FA 7CGTA 2B4GA 5EMJA 1AL8A 3UJFA 1L0PA 2QIWA 2NUXA 4NZJA 2F2KA 3DFPA 4WR3A 1GPFA 2VWSA 4GPNA 4NI8A 1TG7A 4IQJA 2A85A 3G24A 1CCWB 4CQCA 2VEMA 4B5UA 3REQB 1J2WA 2ZRWA 3QY6A 4HNOA 4JTRA 4JR5A 1T7LA 3P0XA 1TELA 5A6BA 1K8YA 1CNVA 4MYXA 2QCCA 4DAFA 2YFNA 5IHSA 3DENA 1W3HA 3O7UA 2HPMA 4BQ5A 4E38A 2XPKA 3GYEA 3HZ3A 4HU0A 4KFOA 1P0EA 2A0NA 4NASA 3BWWA 3AROA 5A6JA 1S3HA 3UXKA 3ITYA 1FWCC 1IQ8A 1BKSA 2Z6IA 2GJRA 3SGGA 3KTCA 4O1AA 1RQBA 2YLLA 1KXTA 5EPDA 3MUXA 4L1WA 2J25A 4DF0A 1H60A 4CKQA 3NM1A 1XPYA 3EWZA 3TMLA 2DORA 1PYFA 2O9PA 1LL4A 4DZ5A 1E1CA 2IXUA 3CAVA 4LFYA 3QZAA 4N9DA 2FTYA 2VEPA 1UW9A 5EA9A 5BYWA 2OLHA 3WF1A 1PEZA 3M43A 5J8LA 5E9XA 4CQDA 2WANA 2ZZ6A 4IMAA 3RMJA 1OCJA 3S2NA 4AC7C 1FVPA 4OWGA 2GSJA 2VEIA 3R10A 3TTOA 2AMGA 5LNRA 4C1NA 1A5LC 3W73A 1UKQA 1F4HA 4I6VA 1GOKA 5CPSA 1PHWA 4CN6A 2A5HA 2JIWA 4C6CA 4JX5A 4Y90A 5LHFA 1EXBA 2DSZA 3VNLA 4NSBA 2WKGA 4H9MA 4UMBA 4J40A 2Q8XA 1I0DA 2PUZA 4W7WA 4DHGA 2DZWA 3T0BA 1EO7A 3E2RA 1OINA 1GORA 2RJGA 3SCRA 3LENA 1CGTA 2YX0A 4LUTA 1PZ3A 3PS7A 3SFWA 1XG3A 1A0DA 3VIOA 4O1DA 1KCLA 4HTYA 5KZMA 3PNUA 2QCDA 4JFUA 4XZBA 3TV8A 4LB3A 4D9PA 1K77A 4C1LA 1W32A 4JIRA 5G1TA 3W1UA 4LU0A 2XGBA 1GUVA 4L4MA 1OGGA 4Y9MA 3DXIA 4MNKA 1JIBA 4R9XA 1P0KA 3CL8A 1S5TA 4JHOA 2Q09A 3BUVA 4Q4QA 3NGJA 4UTWA 4GIYA 4GYPC 1I2QA 4IPLA 1YE4A 4J1OA 4YJ5A 3O63A 3GIYA 1GOXA