1KM4A

Crystal structure of odcase mutant k72a complexed with ump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
212
structure length
212
Chain Sequence
b'VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFAVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
molecule tags Lyase
source organism Methanothermobacter thermautotrophicus
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
total genus 83
structure length 212
sequence length 212
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1km4A00
2OMAA 1QOPA 1FCUA 2ZZ4A 4NU7A 2F84A 2VEKA 3LB0A 1JQXA 1PCWA 3GZ3A 3W1NA 1KLYA 3PBVA 4UFJA 4M6PA 2QEZA 4JIPA 5DBUA 4MYXA 3W7JA 1JRCA 2QKFA 3EX1A 5D37A 3BG5A 1K03A 2CZFA 4UTIA 3TX9A 1SUXA 4MY1A 4FX6M 5LNUA 3F03K 1AL7A 2Z6IA 3NL2A 4AWTA 3S42A 4EWND 3P8IA 1EA0A 3S5OA 3ABSA 1T99A 3LRMA 1LLWA 2YGYA 3STFA 4PH6A 4UTJA 4AHOA 3ZWSA 4DO5A 1DKWA 3O1NA 4DF1A 3W1XA 1ME7A 3L68A 1VH7A 3LI0A 3C8FA 3NNTA 2Y7DA 4XKYA 2FQIA 2WV8A 4O10A 5CZTA 3HPXA 3GYEA 1KM2A 3TXZA 3GKFA 1WOAA 1TRIA 3L5LA 4KFOA 3BPWA 2CLLA 4MLJA 4M5PA 1H62A 2RDUA 3KXQA 4ZQMA 3M47A 2YR1A 3DZ1A 4JX4A 2Q3RA 3ZWTA 3DU0A 3S9YA 4JIQA 5DCBA 3SJ3A 1J5TA 4LUIA 3AO0A 5K9CA 3FFSA 5D33A 4DXVA 3TSBA 3M5YA 1QCWA 3W7IA 2H6RA 1WBHA 1ZCOA 4A21A 4RCXA 3T40A 4ZQOA 4O19A 5FEWA 3G1HA 2DZWA 3S5NA 1EP3A 2V2CA 4XQ6A 3TH6A 2X16A 3T78A 1GPWA 4OBTA 4JTUA 1DORA 3RFAA 4NX5A 3UWYA 1A5BA 1XDMA 4RXGA 3GDKA 3W84A 2A7NA 3LXBA 4IPJA 3MBFA 1T96A 4QM1A 3B0PA 4MPQA 3WJSA 4YWIA 3I68A 1SR9A 5D05A 2R94A 3C0JA 1TTJA 2ZRZA 3UWWA 1QR7A 4TU1A 3PY2A 3NZ1A 3T4CA 4NXSA 1KW1A 2FB2A 1TTPA 2E5BA 1IF2A 3LTSA 1YXDA 1C29A 4JY9A 3KVMA 1UB3A 1Q6QA 4KFNA 4FX7A 3UYCA 4LY8A 1XM3A 5DN1A 1W56A 1EPXA 3G1FA 2P0OA 4JEQA 4NNAA 1A50A 3DFSA 1WX0A 5D2XA 3UWUA 3W75A 3TFCA 1M7PA 3C3NA 3M44A 5HNRA 3ZFHA 3KRZA 5I3IA 3NQ8A 1GVOA 3LDVA 5L6UA 1W5MA 1JJKA 2DJLA 1WOBA 3G8EA 3P7YA 1DV7A 3TW7A 1UASA 2NV1A 1FDJA 1NF0A 4W9TA 4YL2A 1KM4A 3YPIA 3G0XA 3NQDA 3B0VC 3JRKA 1JR1A 3I7RA 3NPWA 1L6WA 3T44A 3P81A 3RLVA 2ZTKA 3B4UA 3GKAA 1TPFA 3HGSA 1L6SA 4O15A 3KRSA 3EX3A 4JTHA 4XTIA 4FO4A 3W2UA 3BV4A 4UFIA 1JCXA 3B0UX 4Y8FA 4TX9A 1I2OA 1Q6OA 3MWAA 2BLEA 3R5EA 4TR9A 1GVQA 4IX0A 3SGZA 3W85A 3LHUA 1HO1A 3LBMA 4DF2A 3DGRA 3UY7A 1KLZA 4QQ3A 5HR7A 5KINA 1H50A 3D0CA 3QPZA 2NUXA 3P5YA 5AYZA 1ZAJA 4Z1DA 1VGAA 3DI0A 3L0KA 2JK2A 3FOKA 1OABA 2QDGA 2EPHA 1TJRA 3O8AA 4WOZA 3G1SA 4NJGA 5LNSA 1F76A 2VFHA 4WOQA 3BW3A 4YCPA 4UR8A 1OK4A 4JTLA 4JNMA 3QEZA 4FF7A 5AYYA 1MO0A 2JKEA 2Q8ZA 2VFGA 2ZZ5A 3DFPA 4A3UA 5DY3A 1UUMA 3M5XA 2VFFA 3HMJG 4PCFA 4K39A 3V75A 1FWRA 3G1AA 4LVDA 5I3GA 4NNCA 3UPWA 5KTLA 1GTHA 2ZZ3A 4O50A 1WYIA 4TMBA 3BLEA 1G4SA 1RQBA 1XDLA 4GUHA 3MHFA 1J2WA 1YDVA 4X2RA 5HJLA 1EB3A 3M5VA 3PR2A 3LHTA 4IUOA 4A2RA 3NA8A 5EMUA 1B9BA 5D2TA 3GDRA 4LVAA 3DXIA 4UTTC 4X9SA 1ALDA 5HWNA 3C2OA 4JX5A 2A2IA 3NYZA 1OFEA 5LZLA 4Z08A 3L5MA 4LW7A 1O95A 1SFLA 3M5ZA 2QUTA 4GC4A 2QCNA 3S5ZA 3W7HA 2I14A 4DELA 4BF9A 3N2XA 4QNEA 5LNWA 2QCDB 1SQ7A 3MBDA 1UUOA 3NEVA 2NX1A 3N19B 3IGSA 2WSQA 4LRTA 2J24A 3FA5A 4FIRA 1QFEA 1VPXA 3UY8A 3LBCA 1KFCA 2QCDA 1FDYA 4LWWA 5HUPA 4EVZA 1OF6A 3KRUA 2HMCA 4FXSA 3EX2A 3L21A 3IGUA 3A5FA 4S2BA 2DP3A 3GXTA 4O1DA 1SPQA 1XUUA 4I7WA 5SWUA 2JBMA 1DL3A 2P10A 3NGJA 2QR6A 3FKKA 5DXXA 1ZY9A 2FIQA 3W2LA 3N9SA 4R53A 3NQ6A 1SFJA 1BEUA 3W7PA 2YYTA 4H6KA 4LNYA 4M7TA 2ZRYA 3RF9A 3TMQA 1KTBA 1AG1O 3Q94A 2EHHA 3G24A 1H7WA 5F1VA 1O5XA 1RVGA 3W7DA 4O0ZA 3MUXA 3OVQA 3EXSA 5F4WA 4H4IA 2A0NA 3DFTA 3TR2A 3G1VA 4JTIA 4AF0B 5EYWA 5HINA 4WY0B 3EX6A 2TYSA 2JGYA 2BZNA 4UTUA 1FWWA 1JUEA 1H7RA 4LUJA 5TBOA 5KZMA 1CW2A 3VE9A 2E6YA 4Q33A 1TB3A 1VCVA 1ADOA 1DQXA 4O8RA 3KAOA 1H1YA 3O6YX 4LU0A 1ICPA 2DZTA 3DBPA 3W1RA 3WK3A 4O16A 1S3HA 3QZEA 3TIMA 1EWDA 3LCGA 1K7XA 3W83A 1KFKA 4FNTA 1LM1A 3QQ0A 1KFBA 2R14A 5F1UA 3TA6A 3NPVA 1MZHA 2ISSA 1SZGA 5E1QA 1Z42A 3E96A 4OE7A 4ZQRA 3UWVA 5D09A 3W1QA 3P60A 4UNKA 1LZOA 3DI1A 1LP6A 3CB8A 4NXKA 3EWBX 2Y63A 3SECA 3Q37A 1ONRA 2A1YA 1AW1A 3G1XA 4UCGA 4NQ1A 1OFAA 4YLWA 4JTGA 1OG0A 4ZQPA 3LM7A 1VC4A 3GX9A 3O16A 5DLCA 4UTTA 3TUUA 1OFRA 4FNPA 1Z44A 2YW4A 2E1DA 3STCA 3W71A 4IMCA 1T0OA 3NL5A 2AQWA 4KKXA 3OA3A 1KTNA 3IGXA 2WPBA 1CX9A 3NL3A 1Q3NA 2DZSA 4FB7A 3F4WA 2CW6A 2FPVA 3LCXA 3OG3A 4O53A 4L4LA 1ZJIA 4S1FA 2CLHA 4OV4A 2B7PA 1S5WA 5A5WA 2Z1BA 2I1OA 3A21A 5FEPA 2E6DA 2ABBA 4CQ9A 3S0CA 1R2SA 5KMYA 3E0IA 4AVFA 4C1LA 4PFMA 3WJZA 4Z1CA 1LCOA 2WQPA 5AHIA 4MLRA 2VOMA 4I9AA 3TROA 3W07A 1VYPX 2QUVA 2Y85A 3N34A 4MZYA 1XL9A 2A7RA 1M5WA 1UCWA 2GQAA 5HWMA 5AYXA 3DFQA 1PIIA 1BWLA 3RU6A 1X8FA 2QCLA 3TQ0A 5U7SA 4GNJA 1Y0EA 2BTMA 1XXXA 2WSRA 3WFAA 5IM51 3MI3A 4MZ8A 2EF9A 2GQ8A 3N73A 3SY5A 4RLIA 4I7UA 2WNNA 1H1ZA 1RZMA 4EOUA 4M6QA 1FCQA 1FCVA 1TREA 3W1TA 2O7SA 2A6LA 2P1FA 1WAUA 1TIMA 5K9DA 1TPVA 4O17A 5D2VA 1XC4A 2LLEA 4IOTA 4R33A 2DZUA 4ADTA 3R89A 3IIZA 3GB6A 1FX6A 4AMAA 1G4PA 3L5AA 4GBUA 4PL1A 4KFPA 1QPRA 3HPSA 2V30A 4HPJA 4J9JA 1HTIA 5AOUA 1F74A 1C8VA 3W2MA 4WXZA 3FYPA 2A5HA 1P1XA 5HUOA 5EL1A 4GJ1A 2ZA2A 4FIQA 1SZEA 3FIGA 5C55A 5H2ZA 3LHVA 5K3VA 1FWSA 2H8ZA 2ZZ2A 3E9AA 1N7KA 3W1UA 2NUYA 3HGRA 3LCLA 5FF7A 1I2NA 1D3HA 4CCDA 2NUWA 1EIXA 4NJHA 1FXQA 3UZJA 3S1XA 5KZDA 1Q45A 2V2DA 1P0NA 1W31A 4N9DA 3C2EA 1UBSA 2GOUA 4MY8A 4DO6A 5KZEA 3DKLA 1FXPA 3B8DA 3LV5A 2E6AA 1LTDA 3MP4A 1IGSA 2ZZ7A 3W23A 2VEMA 4LVBA 3TXVA 3W3OA 4Y90A 4BWLA 3LV6A 3P61A 1L9WA 1DJNA 3DFNA 4M7SA 4AB4A 1GQNA 3R8RA 4EF9A 1LRNA 3S1WA 2J27A 3MHUA 4OV9A 3VE7A 1D3GA 5D03A 2WJZA 3NQVA 2JKPA 5AHFA 1FCBA 5IBXA 2GVGA 3S5YA 2YX0A 1O94A 4RR4A 1SSDA 3QRHA 3I65A 3PBWA 3PS7A 3IVTA 1YYAA 2Y7GA 4QISA 5TIMA 3W86A 1HUVA 2UV8G 3I6RA 5I3KA 1OJXA 1TPH1 3LHYA 1OX5A 3LTPA 1VYSX 1W5OA 1OVDA 3HO8A 4WZHA 1EWEA 3OIXA 4CQ8A 1FBAA 5F2LA 3M43A 1KM1A 3GXPA 1ZENA 4FNQA 4UMCA 3E49A 4HPXA 3S8HA 4AF0A 1H60A 3G3MA 2CLFA 1VS1A 4K7YA 4NT0A 1A5SA 2BXVA 2C3ZA 1VHNA 2Y61A 2ISWA 2GJNA 3PB2A 4NJKA 2H90A 2X1UA 3O63A 4MUZA 5C2XA 1FWNA 3EB2A 5AC8A 4CNPA 2YXGA 1Z41A 2E77A 2V5BA 3P80A 1NAL1 3W87A 4GRSA 2QCGA 3G1YA 3UNDA 4BK9A 4HNTA 1N55A 2RFGA 4CNOA 2BX7A 1ICQA 4Y96A 4JX6A 5CSRA 4Z1BA 1QWGA 3KX6A 4IMFA 2V0TA 1RV8A 5G2IA 5AFDA 3KVJA 4JXCA 4IJBA 3L9CA 3SSJA 4FHAA 1OYBA 3TSMA 4K36A 3NQEA 4OT7A 5H91A 2ZCGA 5CG7A 3HBLA 1VZWA 4X3ZA 1VJIA 3FJLA 1YDOA 3NQFA 1PS9A 3LHZA 2C18A 4O57A 1F2JA 5D2YA 3PUDA 2ZRUA 3UZ5A 4N02A 3P67A 3MO7A 3M6YA 2QCEA 2CZ5A 2GVLA 2J6XA 2DZXA 2XN1A 4I7VA 2YFOA 3THAA 3A9IA 5LKYA 3ELFA 1DJQA 1YADA 3CQ0A 5DCEA 1GT8A 3TNOA 3N14A 4K7VA 5LSMA 3NVTA 1X7FA 4UXDA 2X1RA 4WXYA 3TV8A 1THFD 5F2GA 3BW4A 3LI1A 1BWKA 3W7LA 3TC7A 2RKXA 1X6UA 2Z6JA 1LDCA 1RPXA 3N9RA 3M7WA 5FESA 4ZVJA 4RZ5A 3O6CA 2IQTA 5G4EA 2ALDA 2NWSA 1FQ0A 1TQJA 3CM4A 2NXIA 1I2RA 2GVJA 2ZRWA 5DBTA 3KVLA 4PA8A 5EY5A 2A7PA 4O13A 1YTKA 3TAOA 1YXCA 3NDOA 2H3BA 2VXNA 3S6DA 3H53A 1LRTA 2X30A 4RK8A 3L0NA 4GE8A 2VKZG 2D73A 3KVKA 3TKFA 1K8YA 1GWJA 2FDSA 1CI1A 2B7QA 3HPZA 5CPNA 4DEFA 1GVRA 3KFTA 3EWZA 4E0CA 5D02A 1H51A 5HMSA 3CLMA 4OGZA 1R2TA 3TJXA 5F4SA 1R47A 4IMEA 4HSOA 4JD4A 3C4UA 3QSTA 3PBYA 1SSGA 1C9DA 1SZNA 2E09A 2FTPA 3TU9A 3MYPA 1D9EA 4XBSA 4N6EA 3GNDA 4O11A 4O18A 4AHQA 4Q4KA 5J5RA 5GVJA 1H63A 1WDWA 3QMSA 4RV8A 4HHPA 3W1MA 3W1PA 5IBXC 5U4NA 2WKJA 4AEOA 3N2MA 1NSJA 4XWUA 1F6KA 2BSLA 4IQLA 4XBKA 3CIWA 1JVNA 2ZBTA 3IIPA 1JQVA 3M16A 1HO4A 2ZFAA 2NZLA 3NXFA 5LHEA 1YTDA 2CLOA 3LCFA 3TE9A 5G5IA 3CHVA 1TPB1 2VFIA 4HN4A 4JTKA 2FJKA 1VRDA 2ZA1A 6ALDA 1B57A 2QCMA 1K02A 1HL2A 1YXYA 3QFEA 4MIMA 4QAIA 2RDTA 4GXMA 3LRLA 1W3IA 4JTSA 3LTYA 1LBLA 5HWJA 5K4XA 2PE4A 2OZ0A 2OT1A 2DU2A 1TCDA 3R13A 2WNQA 2E6FA 2JGQA 1N8FA 1TV8A 3UD6A 1F6PA 3BG9A 4N9EA 4JTEA 4DQWA 3QW4B 3TMLA 4JICA 4K6AA 2WSYA 3I7QA 2YDAA 4EF8A 2NXGA 1GEQA 2X1TA 2FPYA 3LRKA 4UNLA 2GQ9A 3H54A 1Z48A 1F73A 1XI3A 3R2GA 4MVAA 3TQVA 3E02A 3F1QA 3W7MA 1AW2A 1R2RA 2Y70A 4JTTA 4UFLA 2QF7A 2FFCA 3CEUA 3L67A 2J88A 2PRMA 3HGJA 5K2ZA 4K8HA 4ADUA 1L2UA 4FNRA 4ADSA 1WQ5A 4HKPA 2PRHA 1PCKA 1HFBA 2AAMA 1OFBA 3PF3A 1XBVA 3IEBA 1IXPA 5D32A 2ATSA 1NF7A 1J4EA 1YLVA 2YW3A 3RLUA 1KFJA 3GR7A 3R12A 3PULA 1M7OA 3WJXA 3GLCA 2Z0IA 2J9YA 4Z0JA 2PC4A 3E12A 1KA9F 4LVGA 4NJJA 1EUNA 3TK7A 1OX4B 3DHFA 4RJEA 5AHMA 2NX9A 1OHLA 3HQ1A 3PVFA 1EEPA 1KBIA 1L6YA 3BK0A 4UFHA 3SFKA 2E68A 3IRDA 5EKYA 2C6QA 5BRBA 3QC3A 1TYGA 4KWVA 2B7NA 3O6DA 3QH2A 1BTMA 3FYOA 3LCIA 1BKSA 3NAVA 4N6FA 3BW2A 4JTJA 1A5AA 3OVRA 2OJPA 2VEIA 1RD5A 4MFEA 1ZALA 4NZFA 1XCFA 5D38A 7TIMA 4M19A 5G2WA 1WXJA 1GZGA 1PHQA 4FX8A 3L66A 2H8XA 2A21A 4QIUA 3ABOA 2EGZA 1MEWA 2RHGA 1H7NA 1PVNA 5T26A 2FB3A 3B03A 5FF4A 4UTWA 3HJZA 4UTKA 2R8WA 5FI8A 5LHFA 1GYLA 2E5CA 1G7VA 3A5VA 4MY9A 1H5YA 1OYAA 1ZAIA 4Q32A 4IXXA 1KM6A 1X1ZA 3F4NA 2B4GA 4ALDA 5MHBA 3GDLA 3UPBA 4GUGA 3H55A 1EX5A 3L0GA 3EXRA 1VCGA 3BGJA 3PSVA 1ML1A 1H7OA 3MMTA 2C15A 1RQHA 4GUIA 4JYEA 5I3FA 3NQ2A 4IWWA 2V9DA 4LV9A 3O06A 5D04C 3TW6A 3DKJA 3O05A 1JRBA 4Z1AA 3W76A 2CZEA 2VEPA 5KSWA 5C5YA 3SW6A 3NOEA 5AHNA 4N4PA 5C6MA 1AK5A 2V82A 2FLIA 3LXAA 5J5DA 2Y89A 3FLUA 4XUGA 3W2KA 5DCDA 5LGZA 4P61A 1H7PA 4CCEA 1JCYA 2I9EA 1H61A 4CNNA 1S5VA 4XKYB 4O1CA 3U8GA 3BLIA 1PV8A 3DFOA 1I4NA 2Y62A 5FEXA 3TAKA 4H3DA 3HG5A 1SZFA 1TPDA 4O52A 5TQLA 1TPUA 3EKLA 3CWOX 4E2BA 4U28A 4E38A 3M41A 3N3MA 3W73A 1HG3A 1VLWA 2YSWA 4ORIA 4NUWA 1O5KA 2PURA 1FY6A 4U4MA 1U83A 3PBUA 3WK2A 1OK6A 2YZRA 4JYFA 4LV4A 3M1ZA 4JGDA 4WY0A 1W54A 1AMKA 4BI7A 3W2NA 3STEA 3BLFA 3QMTA 3MYOA 4LC6A 1PHWA 4RZ6A 5CPMA 3NQ7A 4N2YA 1FWTA 5BNKA 2Y6ZA 2QUUA 3BARA 4GUJA 3FKRA 1I8JA 3HF3A 1NEYA 2ZZ1A 5I3HA 3GVGA 4M6VA 3VNDA 2J9XA 4HNUA 1QO5A 1XFBA 4RKAA 5L9FA 4YMZA 2VFEA 6TIMA 1JCNA 1ZHAA 4UTWC 1DVJA 2A85A 1ME9A 4L4MA 2OX1A 4IMDA 4LS1A 2E5DA 4O12A 5CZSA 1TSIA 3W7CA 1W3TA 2VC6A 4O0KA 2Z2UA 1K8ZA 3G8RA 3O15A 3EWWA 3TFXA 1K3UA 1TO3A 1QPNA 5LNRA 3NQGA 1G67A 1LYXA 2B7OA 4K38A 3TDFA 3GDTA 4O4VA 1F5ZA 1GVFA 2X2GA 3TC6A 3GK0A 3PC0A 3C6CA 2CLKA 4DBDA 3UXDA 2NXHA 3NQMA 5G2HA 1SW3A 4MJMA 5EBUA 1X1OA 4D2JA 4UTLA 1K7EA 3NM3A 5F2MA 1O4UA 2BWGA 5CPOA 1VLIA 1KTCA 4UR7A 1VQTA 3KOFA 2QAFA 2G95A 4LOCA 4R34A 3DH7A 3CTLA 3PUOA 3W7OA 3CC1A 2C16A 5AHLA 1TTQA 4A2SA 3QF0A 3OVPA 5G1TA 1EP1A 1MEIA 4O1BA 4TMCA 1O60A 4GFSA 1IIHA 2V5LA 3SIZA 2VELA 5KITA 2VFDA 4YCOA 1OF8A 1GTEA 3NQCA 1LOSA 3W7KA 1PE1A 4HIBA 3FS2A 3SR7A 2Y7FA 2HS6A 4MJZA 4AWSA 3T7VA 5G1YA 1TTIA 1AW5A 1OFDA 5DELA 4IX2A 4JN6A 4ZQCA 4DO4A 3UXAA 1LRQA 3W72A 1UJPA 2Y88A 4WY0F 3CIXA 4LVFA 1G69A 2R91A 4FXRA 4JYDA 4YXGA 3GR8A 4AXKA 1YPIA 3CPRA 3Q58A 4A22A 2B0MA 2V2HA 2ZA3A 4HSNA 2A6NA 1OX6A 3G0SA 4ORMA 1LBMA 5FF0A 2NV2A 3GNNA 2KZHA 4WD0A 1G7UA 4XTDA 1P0KA 2V8ZA 3U6WA 5CPLA 2QCHA 4BI5A 2DJXA 1TMHA 1W5NA 1Q6RA 3LX9A 2C19A 3A24A 2Y7EA 1IXOA 3C2RA 2ISVA 3BVJA 4DPPA 2V81A 3W88A 2ABAA 2H3DA 4G1KA 1SO6A 1SO3A 4UMBA 4BR1A 4OQVA 1K8XA 2DORA 5D2WA 2QJGA 1EP2A 1TJPA 3PG9A 4UTHA 1TPEA 3WK1A 3IVSA 1QPQA 1H7XA 2NWRA 5EA9A 4UC5A 4WQ6A 4WUIA 2C13A 3JS3A 4JS3A 2ZYFA 4GWEA 2EKCA 2QJHA 1Q6LA 1T8XA 1TRDA 1JULA 4MKNA 1TV7A 2YPIA 1KFEA 4IMGA 1LOLA 4R7JA 5E93A 4LRSA 4QITA 1ZAHA 1TV5A 3USBA 4FNSA 2CFFA 4BWLC 4JR5A 4A29A 2C0AA 3STGA 1EUAA 2WNZA 3IIXA 4TO8A 4PC8A 4K37A 3HG3A 5AC7A 4FEZA 4CCCA 4LTSA 3W7EA 5BOOA 2HS8A 2GPTA 3EEGA 3U2OA 1G4TA 1I2PA 3HB9A 3NG3A 4QSHA 5AB3A 3O07A 1W5QA 4O14A 3AJXA 4AAJA 1AL8A 3EWYA 4HNNA 1G6CA 2NX3A 4LS2A 4LC8A 1XKYA 5K7JA 3BG3A 1W5PA 1GG1A 4RX0A 1RR2A 4AH7A 1OX4A 3SZ8A 2ZRVA 2ZDRA 3LLFA 1GG0A 1GYNA 3QM3A 1TPC1 2VENA 1B4EA 1FUYA 3IV3A 2HTMA 3C61A 3DHDA 3TSDA 3VKJA 2Q3OA 4DPQA 3C56A 2G96A 3OBKA 4AHPA 3MP3A 3W1LA 1QDSA 2CLMA 4OHQA 3W70A 2AGKA 3PM6A 3W7QA 2XN0A 3MHGA 1WV2A 4GUFA 1U5JA 5K9XA 1KBJA 1W0MA 2X1SA 4IXHA 3MP5A 3B05A 1P5BA 2XN2A 4PTNA 4LS0A 3C2VA 4POCA 4AWUA 1VHCA 1VR6A 4E2DA 4IGHA 3WK0A 3G3DA 3GAKA 4JDBA 2G97A 3PAJA 1QO2A 3LLDA 3QW3A 1QNVA 1NVMA 4O28A 3G1DA 1QAPA 4ZZ9A 3QMRA 3P74A 3FEMA 2C1HA 1SW7A 3S1VA 3TQKA 3VCRA 5CSSA 4EIVA 2CWNA 1ZNNA 3SGUA 3BGGA 3TJLA 1OFOA 3QSRA 3RNDA 4MYAA 1OFPA 4N9CA 4QNWA 3A22A 5CZJA 3RMJA 1JCJA 3V1PA 1KM5A 3EXTA 2C14A 2QDHA 5F2IA 5I3JA 4UTMA 1E51A 3CT7A 4TIMA 3NR0A 4IPIA 3M9YA 2CZDA 3MW7A 5C54A 3VFLA 1YTEA 3IIOA 2YFNA 5HR6A 4DF0A 1F05A 3B06A 1TQXA 2ZQ0A 5HULA 3W22A 5A8GA 5AN7A 1LOQA 3JR2A 3PUEA 1ICSA 2XFWA 4Z0SA 3HG2A 5AC6A 4NX0A 4UFKA 5CKSA 1A5CA 1PL9A 1DBTA 5AHEA 4P2VA 3HG4A 1GOXA 1I2QA 1JUKA 4HNVA 3GIYA 1IXNA 3INPA 4BFAA 3LOTA 4WX2A 1P4CA 2ZTJA 3SI9A 2F7FA 4X22A 3GXNA 4S2CA 2TRSA 3UQNA 1LORA 3W7NA 2DZVA 3KHJA 2PRLA 3THQA 3MJYA 5BMWA 4MFDA 1JCMP 3RK8A 3P82A 3QQ1A 4FNUA 3S1UA 4PEKA 4JDYA 3OHIA 4HT3A 4UIOA 5FF2A 3GAYA 3L2IA 4CQAA 3M0ZA 3DAQA 4RXFA 1SO5A 1WA3A 1QMLA 2QCCA 3WJWA 3Q2DA 1VCFA 2WOQA 2TPSA 3NM1A 2DZPA 4JY8A 3EWXA 3W2JA 1V5XA 3PB0A 5D30A 4ZL1A 3DENA 4KWWA 1A53A 1XBYA 3ANYA 4NJIA 1KV5A 3ATZA 3EWUA 5DXYA 5G4WA 3TCEA 1DOSA 2NLIA 2FPTA 3IIVA 5CGQA 3HOJA 5K4ZA 3PWAA 4ICNA 2WO5A 3VI2A 4NVTA 2GJLA 3MI2A 3QYQA 5F4XA 1VYRA 4CLMA 1QPOA 3W7GA 3K30A 1XUZA 3QJAA 4NNBA 3NQAA 2Q8LA 3GDMA 3ATYA 1M6JA 4PL2A 3W74A 1QOQA 3I7SA 3NZRA 4UUIA 2A4AA 5BW6A 2W0UA 3LERA 4ZMGA 1SU5A 2ATMA 1XBXA 3W6YA 4N9BA 2G5WA 3ABQA 2CLEA 1KM0A 1B4KA 4O1AA 4C1KA 5FEZA 1JCLA 1I45A 3OEXA 4Y9AA 3C2FA 1FDZA 3G0UA 1MXSA 5LGXA 3A23A 1LLZA 4WJEA 3W7RA 1IIGA 4ZQNA 3UWQA 3NPXA 3ZR4A 1MEHA 1W8SA 1ME8A 1YDNA 4XZ9A 2TSYA 1DHPA 2QAPA 3P62A 3EKZA 1DQWA 2JKAA 1F7BA 3NO5A 3EX4A 3W9ZA 4Y6GA 5EPDA 3LHWA 1KV8A 3ZS4A 1IXQA 1TPWA 1SW0A 2HSAA 5ABTA 3IVUA 1R30A 2O7QA 4B5NA 3BO9A 3CU2A 2YYUA 1V7YA 2PCQA 2J9ZA 3LXCA 2W6RA 3P8JA 3WJYA 3QPYA 1W37A 3PSWA 1G4EA 3ABRA 2ZRXA 4UMAA 4UFMA 4ONVA 1LBFA 4K8EA 4RZ4A 1OFQA 5DY2A 2OT0A 4JTFA 1LROA 3CEPA 4OWGA 1YPFA 3T55A 4DBEA 4QJ1A 3P84A 5LNVA 1W1ZA 4LT9A 3MI6A 4N4QA 5HQEA 5BMXA 2GUUA 2RDWA 4MZ1A 1MSSA 2YCEA 4O54A 2TMDA 1KFLA 1WBJA 2OCZA 2CU0A 1B3OA 3NPUA 2QCFA 1R46A 4NZJA 3HGOA 3LGEA 1GJPA 3C52A 1RQEA 1GVSA 1KM3A 3G22A 1W3NA 3NL6A 3L65A 4OU1A 3P5ZA 3G18A 2CLIA 2QJIA 4O4WA 1S5TA 1SO4A 2RH9A 4MOZA 3LCHA 8TIMA 1OYCA 1ZFJA 5E0KA 2W79A 3CWNA 3UWZA 2EAWA 5FF3A 3FJ6A 4ML9A 5CZ0A 1XBZA 2ZZ6A 1K7FA 3PG8A 1JUBA 4BI6A 3B04A 4PODA 3W1AA 1NFBA 3HIJA 3LCWA
chains in the Genus database with same CATH superfamily
5HQLA 4QEEA 4LB3A 3PBVA 4UFJA 2BY1A 2QEZA 1X8CA 3W7JA 3VC6A 1JRCA 3PANA 5J04A 5D37A 3WSUA 3BG5A 1K03A 4V27A 2H9AA 3A9BA 4MY1A 5LNUA 3KW3A 1W3KA 2XVLA 1F3TA 1UKSA 3R0UA 3KZPA 2F2HA 4DBSA 2PDYA 2YGYA 1PX4A 3FDKA 4PUDA 1JFHA 2FMOA 4Q3MA 3W1XA 1ME7A 3EPMA 1VH7A 1ITQA 4QS5A 4IF2A 2DH2A 2FQIA 4HQVA 2WV8A 3C2YA 4O10A 3HPXA 4QE4A 1KM2A 4WJ8A 4QJ5B 2A3LA 1TRIA 4XSMA 4KFOA 5JMUA 3ZJKA 3BPWA 4U10A 4RPPA 3KXQA 1YRRA 1DE5A 1KBKA 1KC7A 3ORWA 1E6QM 5FL0A 1ZJHA 1XCXA 1MDLA 4KS0A 1LT7A 2AL2B 3ZWTA 3S9YA 1OGBA 4QR6A 1J5TA 4I5UA 3AO0A 1CXFA 1EYWA 5D33A 2GLKA 1QCWA 2PLKA 2PDFA 5FJPA 4HVXA 2GFTA 2HNEA 2NQZA 5KZ6A 2BHYA 1YBQB 4JQAA 1XIBA 2X16A 1E9IA 1UG6A 3U2EA 3T78A 3RRXA 2XSAA 3ZJ8A 1DORA 2VDIA 4W84A 4HU4A 1AA1B 2XDFA 1ZB5A 3AISA 4A8IA 3UWYA 1A5BA 1XDMA 4RXGA 4YTUA 4PUMA 3NO1A 3UW6A 2A7NA 4WDUA 2FDMA 1T96A 1ZJBA 4MPQA 4A3QA 3I68A 1CXHA 1N8IA 2OO0A 5CSUA 3QLLA 1IT8A 1ZTVA 1DHKA 3NZ1A 3PY2A 5A6JA 2VZSA 2FB2A 4H6QA 3VX1A 3FEQA 5C70A 1UKTA 1F8MA 1IF2A 3WBWA 2J77A 4JY9A 1VPQA 4JIIX 4PULA 1Q6QA 2I5QA 1XM3A 4XZBA 2P0OA 3EEZA 4NNAA 3UEQA 3DFSA 3JU2A 3UWUA 2G0WA 1J5SA 3C3NA 3KBSA 3M44A 1QNOA 3QY6A 4DJDA 1GVOA 3RX3A 3DYMA 1JJKA 5AC5A 1J93A 2DJLA 3GDBA 3G8EA 1SJDA 2AGTA 4MGGA 1ECEA 2NV1A 4HZ8A 2AL1A 3TNBA 1KM4A 4RNHA 5A8MA 3WD1A 1OCNA 3NGFA 2PTYA 3I7RA 1L6WA 2E9BA 4HPHA 2YCJA 4LAZA 3R25A 4QAWA 5IDZA 1R7AA 1Z32X 1M41A 3S4TA 1LQ2A 2EQDA 2OKOA 4JTHA 2XGIA 3W2UA 4C6FA 3B0UX 3EOEA 3MWAA 5IDIA 4PRTA 2GL5A 4TR9A 1GVQA 1KXVA 1JEZA 4FP1A 1Z7AA 3LBMA 4DF2A 3VUPA 3A3WA 3G5EA 4Q4PA 3D46A 4PB4A 3EGJA 4UQEA 5H1WA 3FK4A 1WUEA 3QPZA 2NUXA 1CWYA 1ZAJA 3MMWA 2PFHA 4J3WA 3WY1A 2JK2A 1RCXB 3T0TA 1NY1A 4WJXA 1QW9A 4KF1A 1E6XM 4NJGA 4WOQA 3GH5A 4ZB5A 2A3HA 4D8LA 3EDEA 4JTLA 1RP9A 5I78A 4QX4A 2VO5A 3AHTA 5AYYA 2Q8ZA 2VFGA 3W81A 4QCEA 2VFFA 2HBVA 3PNUA 3G1AA 3MSYA 3QY7A 1GTHA 3BLEA 6TAAA 1R9YA 1WDSA 1MZRA 3GU9A 3ARRA 4XZIA 4W5UA 5BRPA 3H2EA 4X2RA 3M5VA 3PR2A 3LHTA 2PSNA 2QXWA 4A2RA 3GHUA 1EZWA 2DV0A 4ERIA 4UTTC 3ISIX 4X9SA 4JX5A 4A6GA 1JAKA 1EC7A 2OWWA 5EU9A 2PUZA 3L5MA 2DSZA 2QUTA 3W7HA 3BLPX 2GK1B 3WQVA 3K8MA 4QNEA 5FL1A 4LUTA 1O5RA 1SQ7A 2WHKA 3MBDA 1UUOA 3NEVA 1AQ0A 3N19B 3IGSA 3VMPA 3FA5A 4OOZA 1JZ2A 1VPXA 3NWRA 3SCTA 3JZUA 3LBCA 2QCDA 1FDYA 4FXSA 1S39A 3EX2A 4TVUA 2AOSA 5CLWA 3WH5A 3GXTA 1XUUA 4L5ZA 4GZ7A 3WNNA 3MUCA 1EJTC 1V6WA 4GI6A 3NGJA 1FWJC 1J79A 3W38A 3W2LA 2FIQA 1IGWA 4MKSA 5A94A 4N42A 1AH3A 4LNYA 3CL8A 1RLCL 1KTBA 3G24A 2D0FA 1OBAA 1RVGA 3QKZA 3MUXA 3EXSA 3PZNA 5C9UA 5G1MA 3DFTA 3G1VA 4A35A 4X9YA 4CUCA 2GWNA 5HINA 4MTVA 2NT1A 4MUPA 2P8CA 3O2LA 1ZJAA 1XW8A 4YTTA 1FWWA 2P76A 2ESCA 3WLRA 3FW6A 4LUJA 1KCXA 5TBOA 1OM0A 4BY3A 2E6YA 4GK8A 4Q33A 3ITTA 1W2PA 3TZNA 1M01A 1DQXA 3VM7A 4LU0A 3WK3A 4O16A 3WMSA 4GLEA 3QZEA 4I9MA 3V3WA 3ZVHB 3V18A 2V67A 2UBPC 1YNYA 3NPVA 1Z42A 4OE7A 5AVHA 3UWVA 3WLMA 5LA2A 1YBQA 1B90A 4DWSA 2Y63A 1LWJA 1RAKA 4S3CA 1ONRA 1AW1A 1N8WA 1OFAA 1HKJA 1VC4A 5DLCA 1A3XA 1UKOA 2GGEA 4EAYA 1Z44A 2J8TA 3M6DA 2YW4A 2G3MA 4GZEA 2PWDA 2WXDM 3A3HA 7ODCA 1TELA 4HGXA 4H8UA 2ICSA 4KKXA 3HM7A 3OA3A 3JVAA 3MC5A 2VR2A 2CW6A 3AALA 4U3AA 3IJ9A 4Q8UA 3OG3A 2O9TA 1G0CA 4GXPA 4L4LA 1W1VA 4S1FA 2CLHA 4JIHA 4UNIA 5FEPA 1G01A 4LUTB 5BU6A 5BROA 3I10A 3OOQA 4R5EA 5H8UA 4CQ9A 3S0CA 4C1LA 2QGYA 1LCOA 2E9MA 2YB4A 2VOMA 4FZIA 1PBGA 4GC3A 2QUVA 2YL9A 3AU2A 4LJ3A 1XL9A 5H8MA 1XYZA 2VM8A 1M5WA 4B3KA 4ZFMA 3WQ8A 4R9XA 3QV7A 1CXKA 1RK5A 3SADA 2RUSA 3RU6A 2QCLA 3TQ0A 4GNJA 1Y0EA 3WFAA 2WSRA 5IM51 1RJRA 1EXPA 3PPFA 4MZ8A 3N73A 4EOUA 1FCQA 4GQRA 2O7SA 2W66A 2A6LA 2PB1A 4GNKB 1TIMA 1TPVA 3ARQA 4KIEA 5D2VA 2LLEA 4IOTA 1TX2A 3GB6A 4AMAA 4NAEB 4WDXA 4NKCA 3AZRA 2V30A 2BGQA 4GNVA 5A6AA 2DDXA 3CAVA 3GNPA 1F74A 5BXSA 2IUZA 3R79A 3W2MA 4AD2A 1YNPA 5HUOA 4GJ1A 1YIXA 4IICA 4FIQA 4JFUA 3VNMA 1EJSC 3MQTA 3GU1A 1PTDA 5REQB 1O66A 2ZZ2A 3E9AA 1FWCC 1L8NA 2NUYA 2EPMX 2BY2A 3EDDA 1D3HA 5FJTA 2NUWA 1JFXA 1F8IA 3J7HA 4N9DA 4OJYA 1J12A 1FXPA 1BLIA 3LV5A 2E6AA 1AQMA 3W23A 1ISZA 2OO6A 2VEMA 3DX5A 4JTAA 2V3DA 1JZ8A 1L9WA 4J35A 1TKKA 4EF9A 3S1WA 3AMCA 3RR4A 1D3GA 3R8GA 3TLQA 4Q7IA 4AD4A 1PO9A 1FCBA 1XCWA 5IBXA 3KEHA 3S5YA 4D8AA 1RSCA 4RR4A 1PDYA 3F7JA 2ZXDA 1SSDA 3NSNA 3QRHA 5E6ZA 1EYEA 3M0HA 1R6WA 4QISA 4MNLA 3LTPA 1H49A 1QUMA 3OIXA 3OLDA 4Q8WA 1ZSXA 3GU2A 3S8HA 3UFYA 3W28A 2CLFA 1T8QA 2X0SA 2BXVA 1S2WA 2C3ZA 1J0KA 4AD5A 3WMCA 2YA1A 1J8VA 1XLHA 4U2YA 2OPJA 2EKGA 3PB2A 1BVZA 2SFPA 5ABGA 4WF7A 3OZMA 1DYSA 3GC2A 1Z41A 1PYMA 4CN1A 3P80A 1NAL1 4EACA 3UNDA 4HYRA 3IV8A 6A3HA 2BX7A 4LAKA 4IM4A 1DP0A 4Z1BA 3KX6A 8CGTA 4IMFA 2V0TA 4UZUA 3SRKA 4JXCA 2PLCA 4HYWA 3RO8A 3E0FA 3MZNA 2VYOA 4K36A 3VGDA 1JNDA 2TODA 3NQEA 3SFWA 1GOOA 1GKPA 1YDOA 1VFOA 4F9DA 1KWGA 4MAZA 3I4EA 3UZ5A 3SUWA 4N02A 3P67A 3U57A 3CTTA 1FH8A 4LPCA 3HU7A 2CZ5A 5A6BA 2J6XA 1KXQA 3TW9A 2HWGA 2XN1A 4J27A 1CYGA 3ELFA 1DJQA 3TYAA 1GT8A 4A8RA 4K7VA 4B5WA 4IIEA 1X7FA 4EXQA 1ISWA 4ERGA 4AD0A 5F2GA 1BWKA 1E4MM 4X61A 3WMBA 3GRIA 1BF6A 3PUGA 1I9CB 1BRLB 1RPXA 4UBPC 1F9CA 1CNVA 3W24A 2GGHA 3O6CA 1PKNA 4A3HA 3CO4A 3ITYA 4XK2A 4IMAA 4R85A 1E1CA 4RDYA 5DBTA 3KVLA 3REQB 4MM1A 2CERA 1E3XA 2H3BA 3VIHA 3V5FA 2ZUSA 5CJMA 3S6DA 3H53A 1FKWA 4PUJA 5D8ZA 3T9PA 3T8QA 4GPNA 5FAJA 3KWXA 3E2SA 3KVKA 4GYPA 4CEUC 4JNZA 1GWJA 1CI1A 2PTDA 9XIMA 5HMFA 3UBPC 1GVRA 5TD4A 3EWZA 2VC9A 4PMZA 1R2TA 2W67A 4IMEA 4JD4A 2BGNE 1SSGA 4WIWA 3IUDA 1YPXA 2BHZA 2E09A 4XBSA 4YVPA 1V02E 3M07A 4N6EA 4O11A 3RITA 4AHQA 1VFLA 2OEJA 4JL2A 5J5RA 3QVQA 1H63A 1JL8A 4RV8A 1U5VA 4KERA 3W1MA 3KTXA 1PZ0A 3CYJA 3K8KA 2WPGA 3XINA 4IQLA 3GTFA 1TV3A 4Y2WA 4X2PA 1CXLA 1JVNA 2ZBTA 1JQVA 3CZJA 2VCBA 5LHEA 3TE9A 4KWUA 5G5IA 3CHVA 1VFFA 4GI4A 4GGHA 4BKNA 1VRDA 2AQOA 2BOEX 4C5ZA 1NDZA 3CQJA 3QFEA 1TA3A 4MIMA 4QAIA 3FA3A 2RDTA 5CC3A 1UP2A 3S46A 4XZNX 4JTSA 1LBLA 1ZGDA 2OZ0A 2I5GA 2OT1A 2DU2A 3VO0A 1TCDA 3R13A 2E6FA 4C5YA 2JGQA 2R1MA 4IJRA 4JTEA 4JICA 2CCRA 2OZTA 3VKDA 1GEQA 4QFUA 2FPYA 4UNLA 2D69A 2VVSA 2ZX5A 2WANA 4B92A 3R2GA 3KE0A 3TQVA 4GQGA 1AW2A 2Y70A 3E38A 2QF7A 1XSJA 3GXFA 5C9WA 3EA3A 4J2PA 5D9OA 4K8HA 3KLLA 4ADUA 1MUCA 4HK5A 2CWXA 3UR2A 1PCKA 2PTZA 2AAMA 4J40A 2PPGA 3PF3A 3W29A 2X7VA 1IXPA 1XGZA 3R12A 3VINA 3PULA 4FLQA 3VKCA 1FH9A 2P88A 2FZ8A 4NJJA 5ABFB 1UIOA 1JYNA 3FN9A 4XSLA 3UGRA 3U4AA 5AHMA 1OHLA 3HQ1A 1EEPA 3OQ8A 4M3PA 3TWBA 2FZNA 6PTDA 5EKYA 4J3SA 4B91A 5BRBA 2ASHA 5CXPA 1HJXA 1UOKA 1BTMA 3ARSA 3FYOA 3NAVA 4NAEA 4E2OA 2PDGA 2FYMA 3MU7A 5EFFA 4L80A 2OJPA 2VEIA 1RD5A 4MPKA 4PB5A 1XCFA 1PHQA 3WQDA 4MADA 2HROA 5T8GA 3WDPP 4GI9A 4E2VA 2RHGA 2QDDA 2FB3A 4XD3A 1V7AA 4UTWA 5EMMA 3GG0A 4UTKA 4MJ2A 4LY4A 1GYLA 3WLSA 3ZJ7A 4PCSA 1HJWA 1H5YA 1DWGM 3KHDA 1KCKA 3AS2A 4CD8A 3TLLA 5AC4A 1EX5A 5I6SA 1H7OA 4GUIA 4XZHA 5I3FA 3NQ2A 2OX4A 1E9ZB 3O05A 2PZ0A 3ZLGA 5JBEA 5C5YA 4ZCWA 4N4PA 3VGGA 4CQDA 5C6MA 4P8VA 2XM1A 2HPIA 3TQPA 2JALA 2Z29A 5AYBA 4P61A 1H7PA 1LL6A 4DUXA 3GH4A 3U8GA 3FX4A 5I5RA 3DFOA 4H3DA 2ADAA 3FYYA 1UA3A 3RMEA 5BXPA 3CWOX 4L1WA 4E38A 1EC9A 3Q67A 4ZOCA 3M41A 4PFHA 1KRAC 4AWEA 2XZ9A 1YE6A 4NUWA 1UZDA 1O5KA 1FWGC 4FF5A 3R10A 3H23A 4DRSA 4EXBA 1UC5A 3UZWA 4JGDA 4WY0A 2O56A 1XH1A 1YX1A 4B4HA 3OLIA 3STEA 4DLMA 3BLFA 3QMTA 1DIOA 1ONEA 4RZ6A 3OP2A 4N2YA 3CUZA 1FWTA 1YMYA 3CV6A 3FGCA 3BARA 5TNVA 3FKRA 3AIQA 2BFGA 2P5NA 4HCHA 3VNDA 1UWRA 1Q6DA 1H09A 4D6EA 3IJ7A 3QC0A 1X1NA 4B4FA 4HMEA 1XRSA 2DVTA 3SIMA 2VFEA 4FOJA 6TIMA 1JCNA 1PTGA 1ZHAA 1DVJA 4HA4A 4L4MA 4M6UA 2E5DA 3UERA 3AIUA 3WO8A 3R43A 1ECQA 3NQGA 1J18A 3PFMA 2DZAA 1DXIA 4K38A 4NI8A 3GDTA 4I6VA 3GK0A 3CQKA 4RDWA 3NQMA 5G2HA 4MJMA 2PD5A 3HURA 1X1OA 4D2JA 2VP8A 1K7EA 5I24A 1KGUA 2F6UA 4BQ4A 4E3VA 1XRFA 3GFXA 3KOFA 4U3CA 1PUDA 4NZ1A 1D3CA 4OIFA 5AECA 3CTLA 1G1YA 3W7OA 3CC1A 4B9ZA 4EPEC 2C16A 3BMVA 2YBVA 1TTQA 4A2SA 4Q4SA 3CUGA 4Z2JA 2V5LA 4MB5A 1BFNA 4R88A 5KITA 4YCOA 1OF8A 1GTEA 4YTRA 1LOSA 1PE1A 4HIBA 2E40A 1O68A 3EA1A 2HS6A 4AWSA 3AS3A 5G1YA 1CGWA 1GORA 1AW5A 1EGZA 2PI6A 3AWOA 4JN6A 4DI9A 4BQ3A 4ZB0A 4DO4A 1LRQA 4WY0F 4JCMA 4LVFA 3LQLA 1VEPA 3I3EA 4IH3A 2XVGA 3M0IA 4J3TA 2Y8KA 2XVKA 4XD4A 4AIEA 1YPIA 3CPRA 4CD5A 1CCWB 3LPFA 1UWSA 5D4YA 3SCOA 1OWQA 5FF0A 2POZA 1LBMA 4PMOA 3GNNA 1FWFC 3BJFA 1I1XA 4H01A 5E0FA 5CPLA 1M3UA 5A8PA 2Y7EA 3MKCA 5DMMA 3QOKA 1ZUAX 1NDVA 4NRRA 4DPPA 1XJBA 3W88A 2XSXA 2I57A 4LYQA 5HDRA 3VIGA 4JQ1A 3H4XA 1QK0A 1SO6A 5IFPA 4NIRA 4UMBA 5FCZA 5GNYA 4BR1A 3CYVA 4O1EA 3U5UA 1NJJA 3V5CA 1PXGA 1ZP4A 1EP2A 2CESA 3UF9A 1TJPA 2YXXA 4MWAC 3DC0A 2QPSA 2NWRA 2ZX7A 4DWSC 2CC0A 2IS7A 4E8CA 3EDKA 1O6IA 2EKCA 1T8XA 1NWSA 1HF6A 4YWSA 1VRXA 4C65A 4M51A 3WBYA 5E9XA 3CHEA 4FNSA 3NDYA 1GJUA 4B5XA 4BWLC 2VX7A 4A29A 4LYPA 1MMFA 5XIAA 2XVPA 2VDGA 2BVWA 4GI8A 3WLJA 3MS8A 4X63A 5BOOA 3W7EA 3OZOA 3EEGA 3U2OA 4QJ4B 2CPUA 1TVPA 1I2PA 4AFYA 1P48A 1LLOA 5CAHA 1PEZA 1FVPA 1E6RA 1XLEA 1G6CA 1TR9A 1A0DA 4XB3A 3M0JA 4LS2A 1XKYA 3L4UA 3WD0A 2OLAA 3BG3A 1MFUA 2ZUNA 1OX4A 4NYYA 4X0VA 4NAFA 1B4EA 1NQKA 4JAWA 4M1BA 3C61A 1MXGA 3TSDA 3VKJA 4DN1A 1K6AA 4Z42C 4P7RA 1EJWC 3PM6A 3W7QA 3B9EA 1M68A 1GOIA 1C8XA 1KBJA 3ENLA 4FLRA 3O0KA 2XN2A 5JXQA 3C2VA 2PF8A 1VHCA 4BS0A 2WJEA 1VENA 4W93A 1QO2A 3LLDA 3G1DA 2CITA 1QHZA 3W0KA 4Y9OA 2X40A 3B9NA 4QJ3B 1EJVC 5KETA 1POKA 3SGUA 4MYAA 4QNWA 2WMIB 3RMJA 1JCJA 2QDHA 4L9XA 4UTMA 2FZMA 2V5KA 4MNJA 4YU1A 3XIMA 2WCAA 2R6OA 4DZIA 1ADDA 4LUYA 3B06A 5T9BG 1A4LA 3PUEA 3UETA 3FAXA 4GKTA 4DNMA 4RUBA 5JIPA 3LM3A 3LYEA 3TWAA 1LT8A 3ABZA 3NSXA 4LXFA 3GD6A 1EHAA 1AZ2A 4ZODA 3GXNA 2OLHA 1E43A 3UQNA 1AH4A 4QLJA 3CUFA 3DFYA 3HN3A 1BPLB 4FNUA 3S1UA 4PEKA 3OZPA 4EE9A 3OHIA 4HT3A 3M0ZA 3DAQA 4RXFA 4AY1A 4IGNA 1RA0A 2QCCA 2DZPA 2YL6A 1OCQA 2X41A 3BZJA 1XBYA 1KV5A 4OZOA 2PDJA 4XO7A 3D3AA 5A8NA 3CUXA 5G4WA 1OC7A 1V3LA 5K4ZA 5CGQA 2PBOA 3QTPA 4US5D 3K13A 3BMWA 4XZWA 1W1YA 2PP3A 3F2BA 2PWFA 3QJAA 1FHLA 3UJSA 1KKOA 2Q8LA 3ATYA 3UJRA 1UZ4A 2WKGA 3NZRA 3LERA 1AD1A 2WC4A 3BV7A 1MUWA 3ABQA 3K5XA 4IIGA 2IMRA 2VEGA 4O1AA 4V1XA 2ACUA 4C1KA 3W01A 3PP7A 3C2FA 5LGXA 3A23A 3WLLA 1V79A 3W7RA 1B3XA 4LQ1A 3ZR4A 4OVXA 2ZOXA 1UR3M 1DHPA 1UA7A 1W91A 3RCNA 4DJED 2Z2AA 2PC8A 3NO5A 1F7BA 5EPDA 3R7MA 3GVQA 3ZS4A 1AUSL 1P0EA 4KCVA 3U5YA 3B40A 1HJQA 2I56A 1SW0A 2HSAA 3FSUA 4RE4A 1MW3A 1XH2A 1V7YA 2PCQA 2Y8UA 1H2JA 7TAAA 3WJYA 1I60A 5DMYA 2PLMA 3QPYA 2ZRXA 1PKMA 1GOQA 4L7ZA 4AY7A 4JTFA 2VWTA 4AX7A 1EEXA 3TYCA 1E0XA 3T55A 4Q4MA 4LT9A 4N4QA 5HMEA 4DNHA 2GUUA 1LL4A 3OVGA 2R24A 1J10A 1KFLA 2CU0A 1RP8A 1B3OA 1R46A 4NZJA 2HDJA 3V0TA 1YHTA 3SRHA 3C52A 3G22A 1GVSA 4F9JA 5E9AA 3NL6A 4GIEA 4OU1A 3SB0A 2OQLA 1ISYA 3VILA 3G6MA 1SO4A 2RH9A 1BYCA 2J7EA 1FP9A 2VWSA 1ZFJA 2I5IA 1SFSA 1MRQA 2EAWA 4GO8A 4ML9A 2QJNA 3OHMB 3H2NA 4G6CA 3PG8A 2J7DA 4HMDA 3P0XA 1JUBA 1MVYA 3W1AA 1Z69A 3SUTA 2B31A 1QOPA 1FCUA 2ZZ4A 2F84A 4GHRA 2VEKA 3A64A 3GZ3A 4KIRA 3UNTA 5BRQA 3Q4DA 3KOZA 3OGSA 3EX1A 3CLWA 2IPGA 1E0TA 3PTDA 5CJ5A 4UTIA 3TX9A 2VQUA 4YVVA 4H6EA 3VX0A 3WH9A 1GQIA 1Z6KA 1SVDA 2Z6IA 5DMNA 1V02A 4AWTA 3LBOA 1UKPA 3GC4A 3N2BA 1UPMB 1HKIA 3S5OA 1EA0A 2CXGA 3STFA 4PH6A 3HPFA 3DYOA 2E67A 4DO5A 2W91A 1DKWA 3ITCA 2FJUB 2ZX8A 1Q8JA 3CMFA 3LI0A 1V0LA 4YTSA 2EJ1A 1WZKA 4RDZA 3QR1A 1BF2A 3GKFA 3VGFA 4DB7A 3BOFA 3L5LA 4MLJA 4NAFB 2ZIDA 4FR6A 4M5PA 2QULA 1DWFM 4ZQMA 1QATA 4P5UA 3DZ1A 1NU5A 4JX4A 4PTXA 4HOWA 3DU0A 1AJ0A 2OXNA 3HMCA 4DXVA 3CZEA 3M5YA 5LXXA 3ES8A 1WBHA 2VZOA 3IK2A 4HMCA 3PZVA 2HK0A 3O6AA 3KWSA 4GG9A 4XQ6A 5G4HC 3PWGA 2CZVA 1MW1A 3PFRA 4JTUA 4D6IA 4NX5A 1DXFA 3GG8A 3KL3A 4IPJA 3MBFA 2QV4A 3VVGA 1V0NA 4YWIA 4LFYA 3UYIA 2QLYA 2R94A 1EO7A 1TTJA 3KM8A 1QR7A 4TU1A 2GDUA 3B8IA 3DERA 4NXSA 3ARXA 1A4MA 1QRQA 2E5BA 4DUVA 1C29A 1C7TA 1KGXA 1GNXA 3SRDA 4UQDA 1KGWA 4KRUA 1XISA 4F66A 3DDMA 3VNKA 4M8UA 1WX0A 3W75A 2VVNA 1F4AA 4PYSA 3PN8A 4CD6A 4GQQA 3LDVA 1W5MA 1MYRA 2FTWA 1UWUA 2OGJA 1FDJA 4LCSA 5XIMA 1NF0A 5JU6A 4YL2A 3YPIA 2ZX9A 3PPGA 3UR7A 1V0KA 1UHVA 2V5CA 2XISA 4K3ZA 3B0VC 1JR1A 4K1GA 5IRPA 1ZL1A 5MKGB 1Q65A 1TPFA 2YKKA 1XH0A 2CKRA 3WNMA 3URNA 5BOEA 4RNFA 2ZC1A 3RUBL 3BV4A 4UFIA 4O1FA 1I2OA 1Q6OA 1BXBA 1AODA 1M1BA 3R5EA 4GZJA 4H6RA 4J4KA 3SGZA 3W85A 3G6LA 1HO1A 2DPEA 2ANUA 3UY7A 1KLZA 1Q7ZA 3RXZA 3N04A 4NASA 5HR7A 1LG2A 5KINA 4H04A 3D0CA 3P5YA 4I3GA 3GYCA 5AYZA 3ONBA 4Z1DA 1VGAA 3DI0A 3FOKA 4NYUA 4WOZA 1TJRA 4Q8PA 1TZZA 4UQCA 4BEUA 5LNSA 1F76A 1U1HA 3UXIA 3CV2A 1JCTA 3AIRA 3AMDA 3BE7A 3BAJA 3DFPA 1HGWA 1US2A 1UUMA 3V75A 4LVDA 5I3GA 1Z89A 2MUCA 2ZZ3A 1WYIA 3PJUA 1V3HA 1G4SA 4AVNA 3ARVA 4QGCA 1XDLA 3BWWA 4CNUA 4GUHA 3MHFA 5E5CA 2WNWA 3II1A 5HJLA 1XIFA 1EB3A 4S3DA 4IUOA 3IPWA 4QDWA 5EMYA 3NA8A 3WEZA 3BANA 2AMGA 1XINA 1B9BA 4LVAA 3DXIA 2HPMA 5HWNA 1RCQA 4P7NA 2A2IA 3C5QA 6CGTA 1KBLA 4G9PA 3H22A 2I14A 2Q09A 4BF9A 2DIJA 5LNWA 1TWWA 3EMZA 4Y9NA 2YOCA 5AZ0A 2WSQA 3LNMA 1HW6A 1YE4A 3A4JA 3SBFA 2QGHA 1QFEA 4O0QA 3FAWA 4JFTA 4W87A 4CVUA 3S2CA 2VUYA 4LWWA 4EVZA 1HVQA 4QE1A 2BVTA 3KRUA 2HMCA 1OG6A 5DRCA 3TN6A 4FSAA 1YQ2A 1MNZA 1P6BA 4S23A 4QBXA 3PZGA 5A8QA 3FKKA 5DXXA 4J2MA 4F2TA 1WKFA 4PSRA 3L4TA 4E4PA 1SFJA 1BEUA 2YYTA 3RF9A 3N15A 1AG1O 3Q94A 1H7WA 4W4QA 1O5XA 4O0ZA 3LK6A 5GQBA 2A0NA 2XGZA 5LA0A 4XVEA 4JTIA 4WHBA 5EYWA 1XYLA 2E3ZA 4WY0B 3WL1A 3EX6A 4AY8A 2JGYA 4WKFA 1ESWA 1JUEA 3OA5A 4H8VA 4W7WA 1BQGA 1H7RA 2HK1A 3CH9A 2Z27A 5KZMA 3U7BA 4KWSA 4EWJA 5A6LA 1PDZA 1ADOA 3OIHA 2QNEA 3KOWA 3O6YX 4HA0A 3B0XA 1ICPA 2DZTA 5HANA 2Z00A 4FR1A 3EDFA 1S3HA 4GVIA 4HU0A 5M17A 1EWDA 3SY1A 4OBRA 1W3HA 5CPQA 5F1UA 3TA6A 3V7PA 1SJCA 5E1QA 3WF1A 3QLDA 2I9UA 3W1QA 3PAOA 2IPWA 1LZOA 3DI1A 2Z4GA 2YDQA 6REQA 1BKHA 1ODZA 2IQDA 4TX8A 4NQ1A 4YLWA 4NI3A 4AEEA 4G2DA 3LM7A 3O16A 4PBEA 2GWGA 1MXDA 2OQHA 2C79A 2EO7A 2E1DA 1JD7A 4U2ZA 3PWIA 1T0OA 4MMWA 3NL5A 4DXKA 5FSDC 4NHVA 1CECA 2REQA 3RN6A 3IGXA 1HN1A 3NL3A 1Q3NA 2OYMA 1VFTA 1ZJIA 3RX4A 3CV7A 4FLSA 4OV4A 5H8PA 2VX6A 5FJOA 2E6DA 3NOYA 2ABBA 4AMCA 1E40A 3E0IA 4UOQA 4AVFA 1FHDA 4Z1CA 1R7OA 2DSWA 3T6CA 4MLRA 2Y5JA 1S2VA 2CNCA 3W37A 4QE5A 3U3HA 2Y85A 3N34A 4MZYA 2A7RA 3GNXA 3CZ8A 1XYMA 2VI0A 3CB3A 5DQPA 3VPLA 3AYSA 1TWZA 3WX7A 4UR9A 5HWMA 5AYXA 3DFQA 1PIIA 3C0QA 3CAWA 1X8FA 2W4XA 1XLFA 5U7SA 1XXXA 1Z3NA 3MI3A 3AXHA 4PMJA 3W82A 2WNNA 4QRNA 4OBSA 1PWLA 4REQA 3MB9A 1TREA 3W1TA 3QV8A 1OC5A 2P1FA 1WAUA 4DJFC 3ZOAA 3AHZA 2DZUA 3MMDA 3IIZA 4TTGA 3L5AA 5HQMA 4PL1A 1XYCA 1KKRA 1QPRA 4HPJA 3AYVA 1T5AA 3LS9A 2ODOA 1HTIA 3WLNA 3M0VA 3ARWA 1GONA 3U2ZA 3L4ZA 1UD3A 3T42A 4BJHA 3FIGA 5C55A 5H2ZA 3LHVA 5K3VA 3ZZ1A 2GJXB 3D5HA 5CPTA 2PU1A 1E1EA 4AVOA 2PP1A 3HGRA 1GUVA 2D3NA 3LCLA 5FF7A 3WD2A 4HMNA 2BP1A 1GJWA 1FXQA 3KTSA 3UZJA 1JXJA 5KZDA 1Q45A 2V2DA 1JNEA 1W31A 1UBSA 2GOUA 4MY8A 5KZEA 2VCAA 1HP4A 3ZMRA 1LTDA 3MP4A 1PPIA 1LUCB 2GK1A 2WCGA 4LVBA 3TXVA 5GPRA 2ONEA 3LV6A 3DFNA 3WQOA 1OB0A 4AB4A 4KEUA 2WLYA 1GQNA 2EG7A 3R8RA 1LRNA 1RCOB 3L12A 2GJPA 2WJZA 3NQVA 1D7FA 5C9ZA 2OSYA 3IJIA 1C91A 1M03A 1GK8A 4PCNA 2YX0A 1O94A 4LGXA 1VBHA 3VMNA 3PS7A 1XSIA 1ELSA 1HUVA 5I3KA 3I6RA 1JI1A 1OX5A 3IJQA 5BXRA 3T08A 5I79A 1VYSX 1W5OA 1OVDA 3H2MA 2REQB 1EWEA 4WZHA 4CQ8A 2UZ9A 4GQBA 3S2NA 3SQSA 2C1IA 4MJ4A 1ZENA 4UMCA 4W8AA 3E49A 3MUAA 4HPXA 4W86A 4AF0A 1H60A 3OODA 1VS1A 2D2OA 4NT0A 4W89A 2Y61A 2XH4A 2ISWA 1X6LA 2ALRA 3EWCA 4P7OA 3QHOA 2HE8A 2OEKA 2VL4A 4C6PA 2H90A 4D9PA 4WLCA 1KR0A 3O63A 4MUZA 1FWNA 3KRBA 1H11A 4KRTA 1ENUA 3KL0A 2V5BA 2C91A 2QCGA 2Y2WA 3P2VA 4BK9A 2RFGA 2HV5A 5HPCA 4H9TA 4JX6A 5HK4A 3R0DA 3LZ3A 1QWGA 5CPSA 4IPPA 1JPHA 5G2IA 5DEZA 2Q8XA 1ZU8A 2PODA 2C0HA 1DJYA 3HA1A 1R0MA 4NRSA 4FHAA 3OGVA 1PKLA 5LIWX 1RHCA 3HBLA 1MQPA 3NQFA 1PS9A 2ZUUA 4LBSA 4GJJA 1F2JA 3PUDA 4AZ7A 1XX1A 2J7CA 1MUMA 1I0BA 3SUUA 2V3EA 1DTNA 3MVIA 2WM0A 1CB2A 2YFOA 4V2XA 4FOKA 4C7GA 1YADA 5LIXX 3N14A 1RVKA 4UXDA 7XIMA 4WXYA 3TV8A 1THFD 3W7LA 4PMXA 5HOSA 3R58A 2I17A 1LDCA 5CAKA 4H9VA 3N9RA 4XAYA 3VZXA 5FESA 3QHMA 3F4VA 1S1RA 2NWSA 4U5KA 2BXZA 3CM4A 4DBUA 3CH0A 2GVJA 1KFWA 3C8NA 1B30A 1F61A 4PA8A 3ZLHA 3NZQA 1XKJA 1YXCA 1EH9A 2VXNA 1K1DA 2CKSA 1LRTA 5D9NA 2X30A 3F2CA 4RK8A 3BGAA 3SURA 3RILA 4R7OA 2PZNA 2FDSA 3KFTA 5D02A 1C3FA 1ZS2A 3CLMA 3T07A 2OFJA 3ZSTA 4HSOA 4IHCA 1QI3A 3C4UA 2J7HA 4JTQA 3QSTA 3PBYA 2WVTA 4LF2A 3P3BA 3VKAA 1Y8BA 5DFAA 1KWKA 3MYPA 1D9EA 4O18A 2J79A 7CGTA 3QMSA 5FD0A 4JEJA 1J0HA 3AUJA 2WKJA 4AEOA 3N2MA 4CQCA 2NW0A 1NSJA 4PUEA 4ENLA 5CBJA 5ENLA 1F6KA 5REQA 1E4LA 4XBKA 1IEVA 1XLLA 1HO4A 4RNIA 1EBHA 1YTDA 2J47A 4Q4RA 1ZP3A 3LCFA 1PKYA 1QJWA 1TPB1 2VFIA 5DRIA 5BYWA 6ALDA 4JKMA 2QCMA 4WGXA 4WCJA 1K02A 1HL2A 3CNYA 2OWCA 3AZSA 3A4XA 1I0DA 4GXMA 1PSCA 3TYDA 4PRRA 3CL7A 3NVDA 2GOKA 1TWDA 4AC1X 2PE4A 4U33A 4EP8C 3UG5A 1CGXA 4CD7A 3BG9A 3QW4B 1TJ0A 2NXGA 3LRKA 1TUXA 4EK7A 3GSMA 4F48A 3EPNA 4LCRA 1US0A 2CXEA 1Z48A 4MVAA 6XIMA 4P8UA 3A13A 1G94A 4XO6A 3HGJA 4BF5A 3H2AA 5K2ZA 4HOZA 3BOLA 2O9OA 4FNRA 2ZWYA 4HKPA 4Z2LA 2WMIA 4JHMA 2ZXQA 1XBVA 2FVMA 4MB3A 3M0YA 1NIUA 1YLVA 2FKPA 1V08A 1QNRA 3LPGA 2DUXA 1GQLA 5GJMA 1M7OA 3WJXA 1D8WA 2J75A 3VD4A 2EBNA 2J74A 1XYAA 1KA9F 4ACZB 3L7RA 1TMLA 2PMQA 3IWPA 4DO7A 1GZJA 2V3GA 1L6YA 3BK0A 2HE5A 1E5NA 2C6QA 3LY0A 3KDNA 1XRVA 4LUSB 1XRTA 1TYGA 3RO6A 2PDXA 4UOZA 2B7NA 1YDYA 4N6FA 4CN4A 3BW2A 4JTJA 1A5AA 3F4CA 4GA8A 4JZ5A 1T6MA 3VNLA 4HSHA 2VGFA 1XWYA 3F4DA 5D38A 2WC3A 1GZGA 3L66A 4R9OA 4GVFA 3VNIA 1T7LA 1MEWA 2EGZA 1H7NA 1OINA 3B03A 3A4WA 3HJZA 4I9TA 3TJ4A 4FALA 3A5VA 4ZO6A 4TX6A 2IKGA 4MY9A 3QY8A 4PR4A 1OYAA 4IXXA 1YW1A 1FP8A 4ALDA 1EJRC 1VCGA 1ML1A 2C15A 1QVBA 4JYEA 4G1NA 4DJFA 2QF8A 3MWCA 4NSBA 4D6DA 3TW6A 4JBRA 3DKJA 3VTRA 3PZMA 1S2TA 2EPOA 1KXHA 1MW0A 2CZEA 5KSWA 3ZSSA 3SW6A 3NOEA 5I23A 1Y7VA 3CT2A 3N2CA 1E9LA 1AK5A 3R0KA 3TEVA 1E56A 2FLIA 3LXAA 4XUGA 5FJRA 4CCEA 1JCYA 4HD5A 3MCMA 1H61A 4J3UA 2OTDA 3CBWA 4CNNA 3L4XA 1I4NA 2Y62A 3N6JA 3TYBA 5C0QA 3HG5A 1TPDA 3GH7A 1TE1A 1TPUA 4E2BA 2H9AB 4U28A 4BA0A 3OLEA 4OFCA 9CGTA 3RM8A 3DUGA 4W7VA 2V69A 3KBNA 5BWAA 4ORIA 3S9IA 2VX5A 4Q8OA 1V93A 2A3BA 4KETA 2PURA 4S3AA 5C8BB 3B9DA 2PDWA 2PDPA 1LJYA 3BDKA 4HN8A 4JYFA 5CBIA 4DXXA 2I7GA 3VUSA 1OZQA 1BSLA 1W54A 4LEQA 3RM9A 4BI7A 3W2NA 4C6CA 1GW9A 3HQNA 3MYOA 1PHWA 1W9XA 3FA4A 3STPA 1U33A 4GUJA 3HF3A 1IT7A 2AMXA 2OZ3A 2GSJA 3B97A 3MCOA 2J9XA 3LU2A 1RY0A 1QO5A 3G77A 3VKBA 4REQB 1XFBA 3VA8A 5L9FA 4YMZA 3DOPA 4UTWC 2A85A 2NQJA 2OX1A 3U7VA 4IMDA 4O12A 1TSIA 1AJ2A 1L6FA 1W3TA 2VC6A 4O0KA 3LSBA 1V03A 2C7FA 3G8RA 1U5HA 1K3UA 4HOXA 4GYKA 3B3DA 1XIMA 4G7FA 4WDTA 3L2MA 1XLMA 7PTDA 1LYXA 3SEPA 3TDFA 3SAZA 4Y9PA 4DX3A 4DBDA 3PJTA 3URAA 3UXDA 1ITUA 1SMDA 3SO7A 4F3HA 2YCKX 1IWPA 1BGGA 3R11A 3WQ4A 3DG3A 1SW3A 3DHPA 4LAOA 3I4KA 5EBUA 3EPOA 2ZE3A 1TA3B 3ZQ9A 1O4UA 2BWGA 5CPOA 2G95A 4LOCA 2D20A 1JYVA 1EF3A 1RH9A 4DVOA 1UH4A 3QF0A 2WMFA 3TOYA 1EP1A 1MEIA 4C6OA 1FWDC 1O60A 3QGAC 4D1JA 3UVIA 3FS2A 2Y7FA 4H8NA 1FWIC 1JZ4A 4GY0A 1NELA 2F9RA 4IX2A 1BVNP 3TTQA 2P53A 3MO4A 4XUYA 3HZ3A 1RA5A 1IHIA 3W72A 1UJPA 1JDCA 2Q01A 2F2KA 4CCZA 1Q63A 4ML4A 1VD6A 1UR0A 1WDRA 4TVDA 4GYFA 2NT0A 1OADA 2E28A 2V2HA 2ZA3A 2A6NA 1OX6A 3G0SA 3FXGA 2KZHA 4DWSB 1P0KA 4CD4A 3U6WA 1POJA 4BI5A 2DJXA 3LX9A 2C19A 4I5XA 3SCUA 5HJYA 3EYPA 4AZCA 3C2RA 1B31A 1IXOA 4A8LA 3BVJA 3K2GA 2H3DA 3WLHA 1UYQA 1ZBCA 3TOPA 4FI4A 4C6KA 2E8ZA 1LWIA 4JFSA 2RAGA 3GS6A 1E15A 5T9CE 1K8XA 3OO2A 4KEZA 2DORA 5D2WA 2QJGA 3W02A 2XYLA 5IXEA 5B7ZA 3PG9A 1TPEA 1XS2A 2HQAA 3WK1A 2BVDA 4L9YA 1M04A 4G5DA 1H7XA 3WQ5A 2C13A 1HJUA 3JS3A 2MNRA 2ZYFA 4IP7A 1TRDA 1TV4A 3H7VA 4GGBA 1E5JA 4IMGA 4ES4A 4R7JA 5E93A 4LRSA 4FA3A 1R9XA 3USBA 2B81A 2OB3A 4HTYA 4ATDA 2GGJA 1DEDA 4JIEA 3STGA 1VB9A 2DEPA 3G2GA 2YA2A 1QASA 4IISA 3HG3A 4CCCA 2PDKA 2HS8A 4H7ZA 4C90A 1EJ7L 4QSHA 3O07A 3BSMA 4C91A 1W5QA 1AL8A 3EWYA 4HNNA 4YS1A 2NX3A 4R27A 1JGIA 2HXUA 2HZGA 1M65A 4LC8A 5K7JA 1W5PA 1GG1A 4RX0A 1IWAA 3TTYA 2WBGA 4GFIA 2ZRVA 4LB4A 1UWTA 2D2HA 1ISXA 1TPC1 3QZ6A 4OKDA 3IV3A 3QBUA 3WD4A 2PWEA 1MFVA 3C56A 3CUJA 4RE2A 4JHZA 4AHPA 3W1LA 1UR9A 2G4JA 2WCSA 4UOJA 3VGHA 4C6JA 4NZCA 4DLFA 1S38A 1T40A 4J3VA 1VBJA 1RK6A 1EL3A 3MSDA 3NQBA 4IXHA 3N25A 1FTXA 2PDIA 4YHGA 1DJHA 4PTNA 4LS0A 4POCA 1R3RA 3W53A 3G3DA 1FWBC 2FZBA 4WKHA 4O28A 4U31A 4ERAA 1V0MA 1GCYA 3XISA 4MWAD 1PWMA 3FEMA 1EBGA 2C1HA 1IT0A 1SW7A 1M9HA 3FJ4A 1ZNNA 4R3UA 3BGGA 1VBGA 3A6OA 3TJLA 1OFOA 3RNDA 4N9CA 3TYUA 4H2CA 2C14A 2NVCA 5F2IA 1ZPTA 1REQA 2QPXA 4KEVA 1E51A 3PPCA 1QXLA 3N3TA 3IJ8A 3WFLA 3M9YA 3MW7A 2ZE0A 5C54A 1Q7QA 3VFLA 2J7BA 5HR6A 4DF0A 3B4YA 2ZQ0A 5HULA 3W22A 2R82A 5AN7A 1LOQA 3V1HA 3WEOA 2XFWA 4UFKA 5CKSA 1A5CA 4PSPA 3OGRA 3RPMA 3ABXA 1GOXA 3TCSA 1IXNA 3INPA 2P0IA 4X22A 1CB7B 2TRSA 4DBWA 2EPLX 4ZEPA 4L65A 1EX1A 3THQA 3C0SA 4Q8VA 5BMWA 4MFDA 1OIMA 2IPFA 3UPMA 1JCMP 1LL7A 3RK8A 3QQ1A 3C86A 4C7FA 3AZTA 3UG8A 4JDYA 3GG1A 3GAYA 1HJSA 3OG2A 1SO5A 1WA3A 1L8PA 1QMLA 2XH7A 4XD6A 4AIOA 3WJWA 3N6QA 2TPSA 1BD0A 4HCDA 4IL0A 4JY8A 3AXKA 3EWXA 3W2JA 4C7DA 3VNZA 1V5XA 4C1NA 5D30A 4MAVA 1IYXA 1CXEA 3R94A 1LQAA 1A53A 1OT1A 4NJIA 4IIHA 3S1GA 2YL5A 3EWUA 5DXYA 4S39A 2NLIA 2E25A 4ICNA 1SFTA 4AZ5A 4XKMA 4NVTA 2GJLA 4IL2A 3MI2A 1SR0A 3KBMA 5F4XA 1VYRA 3ARPA 3UXLA 3TC3A 4KRZA 5HATA 1V3MA 3LPPA 4AYSA 4W88A 2IXUA 2VZVA 1AFSA 5C9XA 4ZMGA 4LYKA 2DT1A 3MUY1 5ECUA 3W6YA 4N9BA 1N2VA 1BRLA 1B4KA 1NWUA 5FEZA 4E4FA 4Y9AA 1MXSA 3I3DA 4WJEA 1NTHA 2Z25A 1UD2A 2WM1A 4EPBC 4C6QA 2TSYA 3P62A 4RW5A 1DQWA 4L64A 3EBVA 1VIZA 2VMFA 1Q6CA 1XSKA 3LHWA 1ITXA 1KV8A 2A3CA 2ACQA 1Q2RA 5GNXA 5I7GA 3QGVA 4B90A 3MZ2A 4ZBCA 5ABTA 4QROA 3S2LA 3SQLA 4WR3A 4JN7A 2W6RA 3P8JA 1I75A 2W62A 3ABRA 2INZA 4UMAA 1B3ZA 3N6HA 3W26A 3WNPA 1XLIA 4RZ4A 1CLKA 2KAUC 3APTA 2XIJA 4QJ1A 1W1ZA 5BOFA 4CVWA 1MQRA 2TMDA 3R4IA 2BHUA 3LGEA 3WLOA 1B54A 1GJPA 3TTOA 1RQEA 2QMJA 1KM3A 3HQPA 4TXEA 5GJNA 3P5ZA 3L4YA 4O4WA 1F3WA 1S5TA 3AWNA 4DJEC 1OYCA 4RDVA 1CXIA 3UWZA 4ICMA 3FJ6A 2Z26A 3WL0A 1K7FA 3VU2A 1J01A 3MSRA 3VGEA 4MNKA 2D24A 3HIJA 3LCWA 5JVLA 5JIWA 3LSCA 4EPDC 4NU7A 2GVEA 4JPGA 3FGCB 4DUWA 3F5JA 3SQMA 3W1NA 1KLYA 2PGEA 1XD0A 4E8GA 3H24A 3GVWA 3P93A 5JUVA 2QKFA 3N18A 4D6GA 1TZ9A 3UCQA 4JFVA 5BXTA 4D6JA 5FJJA 3TVAA 2INFA 1IZCA 3IACA 4FX6M 1EJXC 3F03K 3H26A 4ZXLA 4XZLX 3WYZA 3NL2A 3RCYA 2PDUA 3S42A 3PZQA 4EWND 3P8IA 3ABSA 1QNPA 5DF0A 1LLWA 6ENLA 3CS2A 5CBBA 4UTJA 4AHOA 3ZWSA 5M3WA 3CASA 1XIGA 1WNOA 3O1NA 3GHRA 5A6MA 1N82A 1PZ1A 2R1PA 3L68A 2VTFA 1U30A 3C8FA 3NNTA 3GHTA 1UD8A 2Y7DA 3MDWA 1EOMA 1JZ6A 3LMYA 2FHFA 5CZTA 3GYEA 2XPKA 1DQUA 4FXFA 3N29A 2VUNA 4JQ4A 2RDUA 3MCNA 1PX8A 3VZYA 3H8AA 3M47A 4XBJA 2WZEA 1NM9A 2EPKX 3HFYA 3TSBA 3RAOA 1NP2A 4K2SA 1GOWA 2H6RA 4DZAA 5I0DA 3BZGA 4RCXA 4YTQA 3T40A 4AZBA 4ZQOA 4O19A 2VR4A 2DZWA 4ASTA 3H2FA 1IEXA 2V2CA 3TH6A 4GX9A 2HJPA 3FHQA 5EGRA 4OBTA 4LALA 3URQA 3RFAA 3B9OA 1J6PA 5HBFA 4M80A 1FKXA 5CH9A 3P14A 3B0PA 3WJSA 1XYFA 1TWSA 3VIJA 3U9IA 4B9YA 1SR9A 4DJFD 2ZRZA 4MKVA 3O3RA 3EMCA 3T4CA 2IQ0A 1KW1A 2GGGA 4PUKA 1TTPA 1O5QA 1TVLA 3LTSA 2OODA 2O4MA 3KVMA 2NQHA 4IUGA 4FX7A 3UYCA 4LY8A 1J9YA 2JEPA 1EPXA 2P3EA 2YLLA 3BMXA 1C8QA 3MV01 4E5TA 4PZVA 1A50A 3VM5A 4PMVA 2DZBA 1W1A1 5J8LA 4A05A 5I3IA 3EMQA 1JDDA 1ADSA 2J25A 2Z24A 4GABA 1PAMA 3EOLA 2GUBA 3P7YA 1DV7A 1A5NC 3TW7A 1NFGA 3VKKA 2CLPA 1GOKA 2G3JA 1NFPA 4V28A 1HL8A 4AX6A 3NPWA 2ZTKA 3RLGA 3B4UA 3VCCA 3HGSA 2PDCA 3SUVA 3LGDA 4S3FA 3HTWA 3CPGA 4XTIA 3OZYA 4FO4A 1K9FA 2CEQA 3RJXA 1JCXA 4L6DA 1XLCA 3GVRA 3H21A 1DWHM 2XIMA 3AQUA 4KT2A 2P3ZA 3LHUA 1HL9A 4NF7A 1V6TA 1JGMA 4ZENA 3DGRA 1QNSA 2ZXBA 2DQXA 2YCLA 4QQ3A 3PBMA 3AAMA 3JUGA 1UZ1A 4YNGA 1OABA 2QDGA 3O8AA 1UR8A 3G1SA 2VFHA 3GW3A 4JNMA 3ZXWA 4Z2IA 3SSZA 3VAVA 3SN0A 2YIHA 4Q22A 2JKEA 2XIOA 2ZZ5A 3JW7A 4A3UA 2CBUA 5A95A 3M5XA 1UP3A 3HMJG 4PCFA 4K39A 2BMBA 4NNCA 3UJ2A 3USZA 4IFKA 1VBUA 5F7UA 4O50A 4C6MA 3QR0A 4DZ5A 1J2WA 2ZC8A 3ZVIA 2WSPA 1YDVA 5LIYX 4HJWA 3WQCA 3WELA 3M7SA 5XINA 3A12A 5EMUA 4AQLA 2ZICA 2CBJA 4Z2KA 3C2OA 4GINA 4QG8A 2WW5A 3NYZA 4UQ9A 4YN5A 4Z08A 3UZYA 3SDOA 2IKJA 2YBTA 2WQDA 3VIOA 1C7SA 4GC4A 2QCNA 3RX2A 2YCIX 4DELA 3WLPA 5FAGA 4HHMA 2GDQA 4ZOBA 4QDMA 2NX1A 4HJFA 4LRTA 4FIRA 4MWAE 5ABFA 1IEIA 1VFMA 3UY8A 1KFCA 1OF6A 4JL1A 2VC7A 4MF4A 1MI3A 3L21A 3RPTA 4S2BA 2DP3A 2OOGA 1XLBA 3WH6A 4I7WA 4G8TA 3TONA 2CYGA 2CBIA 2JBMA 2O9PA 4DYJA 1W1TA 1VFUA 2P10A 2QR6A 5AKQA 4MNMA 3ANUA 3VZZA 3LMZA 1ZY9A 1YNQA 4R53A 3W7PA 2ZRYA 5FJUA 1RJPA 2EHHA 3ARZA 5F1VA 4F40A 3W7DA 1O7AA 1FHUA 3M0MA 3V0UA 5F4WA 4H4IA 1U1UA 1XLDA 1ZBVA 3BSGA 4BHYA 1RALA 3P0WA 4AF0B 7A3HA 1HKVA 4XISA 1XC6A 4BQ2A 3BUVA 3WLTA 4UTUA 1WPCA 2QIWA 5DT5A 3IJDA 3UR5A 1TB3A 3WG6A 1VCVA 3NSMA 4LYRA 4HHHA 3UZXA 3SCVA 3KAOA 1H1YA 4GISA 2ZVRA 1TJ1A 3DBPA 3W1RA 1US3A 3NZGA 3ITGA 4IP4A 3TIMA 1XV8A 3LCGA 1KFKA 4FNTA 4KW2A 3QQ0A 4HNOA 2C71A 3PJXA 1EPVA 1SZGA 3AOFA 3OBEA 3E96A 3GTHA 3UT0A 4F0HA 3P60A 3IS4A 1LP6A 2XSBA 3VIFA 3CB8A 4NXKA 3EWBX 3SECA 2WBKA 1CT5A 2GQ3A 3GTNA 2ZUTA 2GSEA 2GUYA 3IRSA 3WBAA 4JTGA 4ZQPA 3VC5A 3EKGA 4H83A 2NSXA 4ZE5A 2E9LA 4H00A 1OFRA 3TUUA 1HZYA 2ISFA 3GIQA 3UR8A 4S3JA 4ECLA 1B3VA 2OEMA 4LAMA 2UY3A 2PWVA 3B8TA 4L1XA 1GVYA 4CEXC 2Z7GA 1X6NA 5MKGA 4FB7A 3B8WA 3F4WA 5HMDA 3LCXA 1HXJA 2DT0A 1S5MA 2B7PA 5A5WA 2CHRA 2I1OA 1AVAA 1C9WA 3B8VA 1ONWA 2D3LA 3TA9A 5KMYA 1UMLA 3AFBA 1R5YA 2NQ5A 4BZYA 3UCCA 1E70M 5AHIA 4W8LA 2I16A 3TROA 3W07A 1R87A 1VYPX 2DSVA 1A5UA 3ARYA 3EOSA 2VZUA 1E6NA 2X7WA 1UCWA 2GQAA 2PTXA 3SCQA 4CNTA 2CBVA 1BWLA 3KOYA 2JIEA 4GACA 4J5NA 2BTMA 2PLJA 4K8GA 5CSYA 4IG2B 1XYBA 3WLQA 2EF9A 2GQ8A 3SY5A 1J11A 1RZMA 4QHRA 2OYLA 3D6NA 1XLGA 5K9DA 5A1AA 4WSHA 4R33A 4ADTA 4GBUA 1Y65A 2FGZA 5CJNA 4J9JA 3VNJA 3IGHX 5AOUA 1BWVA 4GQ0A 4I8DA 4PTDA 3WUBA 1VEMA 1X97A 4AW7A 1A5OC 2RJHA 3PTKA 3FYPA 3CIVA 5CLTA 4DWDA 5EL1A 2ZA2A 5PTDA 1NARA 1K4GA 3VK5A 3MTWA 1FWSA 4PMDA 2H8ZA 3CZGA 4PMNA 3KP0A 1D7KA 1N7KA 3PZOA 3W1UA 3H4WA 1I2NA 2Z2BA 1VFSA 4NJHA 1XQLA 3S1XA 3SCNA 4AYGA 3RIKA 3C2EA 4QCFA 1VF8A 2ZADA 3AC0A 3DKLA 1B1YA 5HNTA 3CPUA 1TCMA 4NP7A 2ZZ7A 4LBRA 3OB8A 2QUMA 4GVGA 1PJ9A 2F8QA 4Y90A 3P61A 4AEFA 4BWLA 1DJNA 1Q6EA 4GCAA 2PU0A 4OV9A 3VE7A 1JZ3A 2ZUWA 3VIIA 2YCLB 1Q6FA 4UTFA 5I06A 1WKYA 4N7QA 1XDJA 4Y9MA 3WD3A 3PBWA 1XIDA 2WMGA 5CEWA 3IVTA 2Y7GA 5TIMA 2ACRA 1B3WA 1OJXA 4TUFA 3H6OA 4Z1YA 3HO8A 1ZLPA 3GXPA 2Z1WA 4FS9A 4AZ6A 3G3MA 4JKLA 4K7YA 1A5SA 1KCZA 4ZSUA 3RPDA 1UOZA 2A3AA 3TN4A 3IAQA 1QT1A 2XFYA 1JZ7A 4WDWA 2GJNA 4NJKA 2DY3A 3VD7A 4DY1A 3RR1A 3QN3A 3EB2A 4CNPA 3IARA 5HPOA 2FTYA 3S47A 2Y24A 1W3LA 1Q6GA 4GRSA 3G1YA 2Z1XA 1REQB 4HNTA 1W9VA 1N55A 1ICQA 4IQJA 5I77A 3ME3A 5A6SA 4H7CA 1EGMA 1TMQA 5FACA 1XGDA 3N13A 5AFDA 2AL2A 2EPNA 3KVJA 4IJBA 3RG6A 3L9CA 3SSJA 1OYBA 3TSMA 3FNDA 2HBXA 2PS2A 4OT7A 4B16A 1XHGA 5CG7A 3M46A 1VZWA 2NVAA 5RUBA 1BVWA 3BLDA 2D23A 2C18A 1ISVA 3E2RA 2HVOA 4RNJA 3WEMA 4C6IA 4XV0A 2RGLA 2BNJA 2GVLA 3UG4A 2FH6A 2VOTA 2DZXA 4I7VA 3LGGA 4G56A 3A9IA 5LKYA 3BQ5A 4I8YA 3TNOA 4CGTA 4UB9A 4PN2A 5EMJA 1FRBA 1WDDA 3BW4A 3LI1A 3S6OA 3TC7A 1C90A 2RKXA 2YBUA 3I6TA 4K68A 2JIWA 3V0SA 2W9MA 3NTYA 4ZVJA 3CK5A 4HCLA 2BDQA 4RZ5A 1EO5A 5BWFA 1UWAA 3KL5A 1VBRA 2ALDA 1FQ0