1KM4A

Crystal structure of odcase mutant k72a complexed with ump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
212
structure length
212
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFAVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 83
structure length 212
sequence length 212
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1km4A00
3MYOA 4FNQA 1W56A 2ISSA 4Z1BA 5H91A 3UD6A 1ZNNA 1TB3A 2TYSA 1I2OA 1S3HA 1VLIA 3W73A 2P0OA 3VCRA 4M5PA 4XKYB 3W74A 2AGKA 3FS2A 2YGYA 2VKZG 1Q45A 2NWSA 3B05A 2NV1A 4N4PA 1KM1A 3TAKA 3NQAA 2PURA 3STFA 2P10A 3T78A 3NZ1A 3S1XA 3NM3A 4MLRA 1H60A 2DZUA 3TSBA 4DF2A 3W84A 5DN1A 2V9DA 2ZA1A 3FYPA 1FXPA 4ZVJA 2ZRYA 1PIIA 4FX8A 1WQ5A 4CCEA 3CIWA 1W5PA 4IJBA 1VC4A 2QCMA 2FFCA 1OFQA 2EGZA 5KSWA 2J9ZA 5D05A 1OX4B 3BG5A 3W7JA 4DELA 3E12A 3W75A 1KLZA 1JR1A 3NQGA 2OT0A 2DJLA 2A0NA 3RLVA 4UC5A 1TRIA 4RZ5A 3F4WA 3PR2A 3EX1A 2BZNA 4DEFA 1JULA 4RKAA 5F4SA 3KVKA 5FEXA 3FEMA 3NPVA 1LRTA 1M5WA 1AW5A 4O11A 5KZEA 3UWYA 3MI6A 4X22A 3MHFA 2ATSA 4IXXA 3TDFA 3IGUA 3UWQA 3NM1A 1QO5A 5U7SA 3STEA 5EPDA 1FCQA 3UPBA 4GUGA 1HTIA 4JD4A 4NNAA 1ME7A 5KMYA 1M7PA 2CZDA 3IIVA 1KFJA 1I2RA 3MBDA 4LVDA 2E5DA 1ZENA 3QM3A 2ABBA 5FF7A 2CLKA 3QQ1A 4LS2A 3VFLA 3C2FA 4JXCA 2Y88A 2Z1BA 4AWSA 3C52A 4N9DA 3OA3A 1JUEA 4HPJA 3VKJA 3LDVA 3JRKA 5D2YA 5FEWA 5DCBA 2VFGA 3QSRA 1PHQA 2Z6JA 1KM4A 2NX1A 4WXZA 1MZHA 3PB2A 4EF9A 3DFPA 1HO1A 2NXHA 4UTTA 4O14A 3EWBX 1G7VA 2J27A 1ADOA 4NQ1A 5AHMA 5BOOA 3FIGA 4NT0A 3S5YA 5I3KA 4NJGA 3MP5A 1R47A 1TCDA 3QYQA 4I7VA 2BTMA 4BWLC 3SY5A 5DBUA 3S1UA 4POCA 4WZHA 2VXNA 2RDTA 3AJXA 5FF3A 1OFEA 2BWGA 3ABOA 3O6CA 4PA8A 2X16A 3M44A 4LT9A 2A21A 3FFSA 1R30A 2PCQA 2NLIA 2YFOA 4IGHA 4JTJA 1SSGA 2XN1A 3W7IA 3WK3A 3RLUA 4KKXA 3LCFA 4AEOA 1Q6OA 3ZFHA 2TMDA 3ZWSA 2GQAA 4CNPA 5BW6A 2YFNA 4IQLA 2B7NA 4UTTC 2O7QA 3NVTA 1XKYA 4MY9A 1DV7A 2A7PA 1GYNA 2VENA 3NAVA 3CT7A 4UTJA 4CQAA 5F4WA 3QMRA 2QJGA 4O1AA 4GUIA 5C55A 4BK9A 1K8ZA 1AG1O 2DZSA 3R12A 1LBMA 4UR7A 3WJZA 2B0MA 3TXVA 3D0CA 3UXAA 4GUHA 4I7UA 1TIMA 1YXCA 5G1TA 1UCWA 5D32A 3GYEA 1H7OA 1XM3A 4N2YA 3E0IA 1MSSA 3LCIA 1WA3A 3VE9A 4AWTA 3PBVA 4M6VA 4AMAA 3CIXA 3QC3A 4JDBA 4K36A 3EX3A 2I14A 2HMCA 2Y7DA 3DENA 3QMSA 3DBPA 1PHWA 3GAKA 5KINA 4D2JA 3TU9A 2W0UA 2Z6IA 2JBMA 1BWLA 5CPLA 3LHUA 3P80A 4XKYA 2X2GA 1PE1A 2GJNA 3OVPA 2CLEA 4GNJA 1A5BA 4HSOA 4E2DA 4WY0A 1K3UA 1G7UA 2FLIA 1MEWA 4CNOA 3W1UA 1KFLA 1VS1A 5HJLA 1KBIA 1S5TA 3FKRA 4C1KA 1VRDA 1VZWA 3O16A 2QDGA 3IIPA 1LOLA 2ZRWA 1TPDA 3IGXA 2OZ0A 1VHCA 2YW3A 3S1WA 1ME9A 2NX9A 4O0ZA 3GB6A 1WX0A 4AF0B 2OMAA 3GDRA 1F6KA 3W1TA 3M6YA 5AC7A 3NO5A 2CLMA 2BSLA 5BNKA 3W71A 1OF8A 1OX4A 3R8RA 2E5CA 5LHEA 1VYRA 3ZWTA 1YDOA 1BEUA 1W8SA 2QCHA 5GVJA 1O5XA 1Q6QA 2Y6ZA 2J88A 3B0UX 3FA5A 3OVRA 2ZA3A 1PV8A 3RK8A 2ZYFA 4HNVA 1EPXA 4HN4A 2BX7A 1TPEA 3W22A 1RQEA 3WK1A 1JQXA 3I6RA 3W9ZA 4IMGA 4Y6GA 2QCNA 5FF0A 2BLEA 1QPNA 3KRZA 5CSSA 4GWEA 3BG9A 4UIOA 4ZQRA 1SW7A 4UTIA 4O1DA 3G0XA 4A2SA 2VEKA 3GR7A 4HPXA 4LUJA 2A1YA 2A6LA 1RVGA 5F2GA 3P84A 1GPWA 4CCCA 4GE8A 1N55A 1EUNA 4M7SA 3TFXA 1YPFA 4FNPA 3ABQA 4MJMA 3W88A 4E2BA 3A5VA 5HWMA 4PC8A 3PB0A 5C2XA 1X6UA 4HSNA 2WNQA 5D38A 1NSJA 3IVSA 4NNBA 1B9BA 1EWDA 5FEPA 4AAJA 3HPSA 3SSJA 1R46A 1H1YA 4IX2A 4QQ3A 3NQFA 3TSDA 1OFPA 1K03A 2ZFAA 4O1BA 3TAOA 5EKYA 2QUUA 1G4EA 1V5XA 5HUPA 1T0OA 1ONRA 4ADSA 2TRSA 3W1NA 1H50A 4Z1CA 5LNVA 3S5NA 4NJIA 5CG7A 1K8YA 3LRMA 1YYAA 1LLWA 3KAOA 5AYZA 3UNDA 3BG3A 3IVTA 3EWZA 1G4SA 1FCVA 3EXTA 4MIMA 3W7HA 4EWND 2H8ZA 3A23A 3NPUA 4DF0A 4KFOA 4UUIA 4ZQCA 3NQVA 3R89A 1NF0A 5FF2A 1DVJA 3GDMA 1OYCA 4PL1A 1YXYA 4IXHA 4DPPA 2J24A 3CU2A 3HQ1A 1HUVA 3TJLA 4RJEA 4Y8FA 1QWGA 2DORA 4CCDA 4HHPA 3OEXA 1LRQA 4Y96A 1Z42A 3W85A 1OYBA 5AB3A 4O15A 1W0MA 2NXIA 4JX4A 5D2TA 3HPZA 1EP2A 3BLEA 2RFGA 2VFDA 1OFOA 3TW7A 1XBYA 4LU0A 4AB4A 4GXMA 2CLFA 5FF4A 3L21A 2O7SA 3UY8A 2JGQA 4MZYA 2ZTKA 2JGYA 4WY0F 1TQXA 2YR1A 3USBA 2WSYA 2RDUA 3UY7A 2ZA2A 3NDOA 3B03A 4KFNA 5CZTA 1T8XA 3W83A 1UB3A 2EKCA 3EWXA 3GAYA 1B4EA 3C2OA 3I7SA 3ABRA 1XI3A 4M6PA 3GK0A 1WOAA 3DH7A 4ORIA 1H7XA 3WJXA 1G4PA 4R34A 1HO4A 3G1XA 2QKFA 3CHVA 3LXBA 1AW1A 3HPXA 4A2RA 5F2MA 2EPHA 4ZQOA 3OHIA 3PAJA 2NZLA 2VFHA 3GR8A 2B7OA 1JCJA 4JGDA 1SSDA 4FHAA 2DZXA 4UXDA 3LCGA 1HL2A 2X1TA 5AHIA 4Q33A 3U2OA 1KBJA 2AQWA 4IMDA 5I3GA 2QF7A 4XBSA 3SJ3A 1UJPA 6TIMA 4AF0A 2NXGA 1MEHA 3NNTA 2PRHA 5DXXA 2VOMA 3UZJA 2OT1A 3NYZA 3P5YA 2A4AA 2PRLA 4JTLA 3U8GA 3PS7A 1EP3A 1D9EA 2HS6A 3G24A 4ML9A 4BI6A 3KOFA 4W9TA 1KM0A 3TR2A 3IV3A 1SU5A 3IIXA 3LCLA 5F1UA 4Y9AA 3BVJA 1Z48A 3WK2A 4K8EA 1R2TA 1FCUA 1EA0A 4YCOA 4S1FA 8TIMA 1RQHA 3PUEA 4WJEA 2IQTA 1F7BA 4JYEA 4ALDA 3S9YA 1FX6A 4X9SA 2JKAA 3PBWA 1Q6LA 1SFLA 1KV5A 2V30A 1H51A 2OJPA 1TPUA 1PCKA 1S5WA 2CLIA 1OYAA 2B7QA 3UYCA 2E6FA 5LGXA 1QFEA 4UMCA 1QR7A 4NVTA 4NX0A 3W2KA 2YYTA 1ZCOA 4MJZA 1ZY9A 3CQ0A 4LS0A 2DZPA 1XDMA 3W76A 3NXFA 3P74A 3RU6A 5FESA 3MI2A 3M7WA 5DLCA 4IMFA 2QEZA 3WJYA 1GYLA 5G4EA 5L6UA 3F1QA 4KWWA 1X1ZA 3BW4A 4QISA 3L5LA 3W1XA 1W5NA 1VCVA 2V5LA 3L0NA 4JTSA 4WOQA 5G4WA 3NOEA 1A50A 1WAUA 3TUUA 1MXSA 1QNVA 1GG0A 4OWGA 2A6NA 3W7GA 4FNUA 1DBTA 4A21A 3C0JA 4UMBA 3M0ZA 3N19B 5HMSA 4FO4A 3HIJA 3HJZA 5K4ZA 3DKJA 3NQMA 3W7QA 2RHGA 5ABTA 3G1AA 2YW4A 3SZ8A 3PBYA 3W7NA 2J9YA 2CWNA 2J9XA 3NGJA 4QIUA 3BW2A 3S0CA 3W3OA 3FJLA 3CWNA 1A53A 1VCGA 3G0UA 1XBZA 1F74A 1L6SA 1YTEA 5HINA 1ICPA 5CKSA 3ANYA 1FQ0A 2HSAA 4GRSA 4FXSA 2C19A 3T44A 4O18A 3DHFA 4UNKA 3LHWA 3E02A 2WV8A 2F84A 3DHDA 3F03K 3BO9A 3SW6A 2CFFA 3M43A 3STGA 4TX9A 3W2UA 1O4UA 1VH7A 5FI8A 3ATYA 2V2DA 4A22A 3W2LA 3FJ6A 4AHOA 3H55A 5EMUA 1LORA 3FYOA 1C29A 4JNMA 3KRUA 3L5MA 3STCA 2ATMA 4P61A 2ZCGA 4B5NA 2C13A 3IIOA 4RLIA 5AHNA 3HGSA 3W1LA 4CQ9A 3DGRA 3ABSA 2QCFA 1F2JA 2ZZ2A 1X8FA 4UFLA 3PSVA 4TMCA 1N7KA 2CLOA 3O6DA 1F73A 4H3DA 1ZHAA 4FIQA 3G3MA 5EA9A 1H63A 3B4UA 3L68A 2QCDB 3H53A 5J5DA 1JUBA 3S42A 4UNLA 1A5CA 5C54A 3P62A 3TW6A 1J2WA 1K7XA 3DFOA 3HGOA 4JN6A 4YMZA 5HWNA 1TREA 1OABA 4BR1A 5G1YA 1I4NA 5DCDA 1YXDA 5DBTA 3E96A 5LNWA 3G22A 4ZQMA 1EB3A 1JCLA 2QUTA 2ZBTA 4LVGA 3HGJA 3LBMA 1TPH1 2P1FA 4UTKA 4O53A 3L0GA 4RXGA 3TE9A 3DU0A 3UZ5A 3M5VA 3TC6A 2HTMA 1SUXA 3LGEA 4OV9A 4WQ6A 2Y70A 1BWKA 1M6JA 4PH6A 3LI1A 3C56A 1DKWA 3LTYA 3HO8A 1OK4A 3W2JA 3RMJA 3SI9A 1N8FA 2LLEA 2QAFA 3M5YA 4E38A 2WNZA 1W37A 3MHUA 5IBXA 1QAPA 2GPTA 3GLCA 4JEQA 1VJIA 3C4UA 3W7DA 2I9EA 1VYPX 4QJ1A 3QSTA 3TH6A 4I9AA 3GKAA 4BF9A 3S1VA 3LHTA 1Y0EA 3BGJA 3HF3A 4AVFA 1CI1A 1GVFA 1KM3A 4GJ1A 1O5KA 1DL3A 4LY8A 2ZRXA 3VI2A 5DY2A 3EXSA 3LV5A 3P7YA 3P82A 3IRDA 2Y89A 1TV7A 3I7QA 4OQVA 3L66A 1H62A 4GFSA 1SFJA 1OX6A 5G5IA 3UPWA 3A9IA 4CLMA 5BMXA 3MW7A 5G2WA 3N14A 5IBXC 4QNWA 3FOKA 1TJRA 2H8XA 1KM2A 3HG4A 3NL3A 2GVJA 4S2CA 3C2VA 4IOTA 3GXTA 4O8RA 1XCFA 3W07A 1O95A 4JTTA 4LV4A 1SZEA 1XUZA 4R7JA 1TTPA 3TFCA 1G4TA 4K7VA 3TA6A 3HBLA 4NJHA 1TPB1 2E6DA 4YL2A 1T99A 4HIBA 2X1RA 4R53A 2Y7FA 2E6YA 3DAQA 4XTIA 5KITA 1SO4A 1RD5A 2TPSA 3R2GA 1P0KA 4FX7A 5E0KA 4N6EA 5LNSA 4IUOA 2ZZ7A 4JTKA 1GVSA 1WBJA 4LS1A 1JUKA 1OFBA 3LRLA 1XBVA 4OT7A 2JKPA 4GC4A 4LWWA 1FWNA 4Q4KA 3TSMA 2FIQA 3C8FA 4UTWA 4WXYA 2Y63A 3ATZA 1AL7A 2ABAA 2HS8A 4LVFA 3MUXA 2VEPA 3PUDA 3TC7A 3B0VC 2YXGA 1QOPA 4MZ1A 4UTLA 1NF7A 1AMKA 1J5TA 3EWYA 3GDLA 5D37A 4K39A 3V75A 3LERA 2NUXA 1GZGA 4EOUA 2V5BA 3VNDA 1B57A 1FWSA 2Z0IA 3GXPA 5DCEA 5I3FA 1W5OA 4LV9A 4ZQNA 4ZQPA 4LW7A 1CX9A 3E9AA 1F5ZA 2ZRVA 4N9EA 4FB7A 2RH9A 4DQWA 4ICNA 1KFBA 2FTPA 1P1XA 2QCEA 3M41A 1B4KA 5HUOA 1GT8A 3LV6A 4RCXA 4O16A 4OU1A 1QPOA 5D2WA 4Z0SA 1KW1A 5D03A 1GVRA 2VEIA 4O12A 3GXNA 4UTHA 1TSIA 3BPWA 3PF3A 3TJXA 1GVOA 4JTUA 2Y62A 3Q58A 3H54A 4PCFA 3PG8A 5E93A 1UASA 2R14A 1JVNA 2DP3A 4LOCA 3QZEA 4N6FA 3K30A 3B06A 3QFEA 1QPRA 1FY6A 2C18A 3CC1A 3KRSA 1GVQA 4HKPA 3C2EA 3QEZA 3S5OA 3CWOX 4LRSA 5AHLA 3CLMA 1Q3NA 2FPTA 1G67A 4S2BA 1WXJA 3W87A 2H3BA 3LM7A 1SPQA 1UUOA 3ZS4A 4NXKA 4MPQA 4DBDA 1IXPA 5U4NA 1TPVA 2YCEA 3PY2A 3IIZA 1JJKA 1OF6A 3INPA 4P2VA 5LSMA 3LXAA 2FPYA 2WJZA 3TNOA 3M16A 3G3DA 3Q37A 5A8GA 1OFRA 3LCXA 5CPMA 5D2VA 4NUWA 3B0PA 3TQVA 1ML1A 4XTDA 4K37A 1D3GA 1GTEA 3G1FA 3JR2A 4MZ8A 1TV5A 4BFAA 4Z1DA 1W3NA 2DZVA 3MP4A 4LVBA 1XL9A 1SW3A 3KX6A 3N9SA 1TMHA 1ZAJA 4AHPA 2DJXA 1KTNA 1O94A 2C14A 2Y85A 2YSWA 4MUZA 1IXOA 3HG5A 1LP6A 3P67A 1D3HA 2BXVA 2WSQA 3EKLA 3GDKA 5D02A 1TJPA 3EX2A 4TO8A 3O1NA 5CZSA 3QRHA 2C6QA 3F4NA 4PEKA 4FIRA 4CQ8A 4OHQA 2WNNA 4U28A 3O07A 4CNNA 5LNUA 1I2NA 3LHYA 3N34A 2VFIA 3P8IA 3NA8A 2FJKA 4HNNA 2QJIA 2Y61A 3T7VA 3M47A 1KV8A 3T40A 1GOXA 2ZZ5A 3NPXA 3IGSA 4MVAA 4UTMA 4ZZ9A 4UR8A 4N02A 1E51A 1YTKA 3TMLA 1WBHA 2QUVA 2E6AA 3MWAA 4BI5A 4LNYA 5F4XA 2KZHA 5I3JA 3T55A 2PE4A 3G8EA 5CSRA 1JCNA 4OV4A 4KWVA 2E77A 3PBUA 4JY8A 5TBOA 2WKJA 5EY5A 4EF8A 4NJJA 1S5VA 3OVQA 6ALDA 2YYUA 3W7LA 3MBFA 1X7FA 5AC8A 4XBKA 1OVDA 1VQTA 1PVNA 4DXVA 2DU2A 1SZFA 3I7RA 5F1VA 4HNUA 1TO3A 1TYGA 3DI1A 1L2UA 3G1VA 3W72A 2W6RA 1W3IA 1IGSA 5F2IA 2GVLA 2CW6A 5KZMA 5EYWA 4MLJA 1ME8A 1LCOA 5D2XA 1JCMP 1BKSA 4WUIA 1R2SA 3UXDA 3L2IA 3MMTA 4XWUA 3WFAA 1TV8A 2GQ9A 3N2MA 3LCHA 1Z41A 3NQDA 5D09A 1SZNA 3M5ZA 4IPIA 1JRCA 3QPYA 3KVJA 5AOUA 3WJWA 5L9FA 4DO6A 5LZLA 2QAPA 3W2NA 2VEMA 3QH2A 3TQKA 3L65A 4H6KA 1J4EA 5DY3A 1THFD 3THQA 1QOQA 3NL5A 5C5YA 4O4WA 4O4VA 2WQPA 2NUYA 4AHQA 3CEPA 5KZDA 5CZJA 1RPXA 1SW0A 4DO4A 1GQNA 2WO5A 3M5XA 3BLFA 1VYSX 3FKKA 1LDCA 2H3DA 1DJNA 1LROA 2OCZA 2YPIA 3QW4B 2ZQ0A 2YDAA 5AYXA 3N2XA 4JIPA 1EUAA 3W7CA 4WD0A 3Q2DA 1F6PA 4TR9A 1FUYA 3G1HA 3HMJG 2B7PA 1IF2A 1PL9A 3VE7A 1FBAA 1OHLA 5LKYA 1XXXA 1XBXA 3PC0A 4OE7A 3GIYA 4FNTA 1H61A 1GTHA 2FDSA 4N9BA 5I3IA 4TMBA 2UV8G 2JK2A 4M6QA 4ONVA 1W31A 2EAWA 5SWUA 5K9DA 3PSWA 3NQ8A 3P60A 3GNNA 1KA9F 1OFDA 3NPWA 4PODA 3S5ZA 4XZ9A 4OBTA 3RF9A 1UUMA 3NQ7A 2E09A 3RFAA 1UBSA 2Q3RA 3M1ZA 2PC4A 3A21A 4GUFA 1P5BA 4KFPA 1MO0A 4TIMA 2QDHA 1FCBA 3HOJA 5K2ZA 3HG2A 3B04A 4Z1AA 1W1ZA 3QMTA 4WY0B 2B4GA 1IXQA 4NX5A 2D73A 5DXYA 4MFDA 4FEZA 1RQBA 5HR7A 1XDLA 4LC8A 3EWUA 3BW3A 1X1OA 3PUOA 4FX6M 1AK5A 3TIMA 4JS3A 2W79A 3R5EA 4ZMGA 4QSHA 4IMCA 2VFEA 2X1UA 3JS3A 3P5ZA 4QAIA 4K7YA 1KFKA 4O0KA 5J5RA 3IVUA 4UFJA 1LOSA 2YZRA 4IMEA 1KM6A 3TX9A 1P0NA 3W1AA 3G1YA 3DFSA 2C16A 4MY8A 1FDZA 5LHFA 1SR9A 5CZ0A 1XC4A 4DO5A 1R2RA 1LYXA 3QQ0A 3TKFA 2ZRUA 1TTQA 2V2CA 4O10A 3GX9A 3IEBA 4O28A 3CEUA 3NQ2A 2V2HA 4YCPA 3LTPA 4QNEA 4NZFA 1V7YA 1H7RA 2R91A 1EEPA 3PULA 3SGZA 3BLIA 4AXKA 1L6YA 3TK7A 5HULA 1L6WA 2VC6A 3LB0A 1OJXA 1JCYA 3W7EA 1FWRA 1WOBA 1ZALA 4RR4A 2DZWA 1LTDA 3DFQA 3NG3A 3AO0A 4DPQA 2ISWA 1T96A 4BWLA 4O17A 2X30A 2QR6A 3KHJA 4U4MA 1SQ7A 3G1DA 1U83A 3E49A 1FDYA 1SO3A 4O54A 1GJPA 2FB2A 1VLWA 2I1OA 3MI3A 4K38A 5G2IA 4X3ZA 2VFFA 1NFBA 5HQEA 1O60A 1KTBA 4C1LA 1I45A 2V81A 3DKLA 1G6CA 3DFTA 2CZ5A 3LHVA 4R33A 2A7RA 3NQEA 4LTSA 4IWWA 4RK8A 3NZRA 3DXIA 3OBKA 2GJLA 2Q8LA 3KFTA 3L0KA 4UTUA 1H7WA 2R8WA 4WX2A 5AHFA 2EHHA 1SO6A 2NV2A 3I68A 3BK0A 4E0CA 2RDWA 3GKFA 1JCXA 3MO7A 4GBUA 2G97A 5EBUA 1A5AA 2YX0A 3C3NA 4L4MA 4QITA 3MP3A 3N9RA 2FQIA 4O57A 3TV8A 4JDYA 2OX1A 3CPRA 3P81A 1IIGA 3LCWA 2V82A 2A2IA 5K3VA 3PWAA 5BRBA 3HG3A 2CZFA 4H4IA 1KFEA 4A29A 3PVFA 4AWUA 2JKEA 4RZ6A 3EKZA 3U6WA 2CLLA 1IIHA 1K7FA 3KXQA 1GG1A 1H7NA 1ZAHA 3HGRA 4NJKA 1QDSA 2GQ8A 3OG3A 3MHGA 4LRTA 5T26A 2H6RA 3EX6A 3I65A 1JRBA 1VR6A 1QCWA 3CB8A 3BARA 1MEIA 3L67A 5TIMA 3LLDA 3W6YA 4JTIA 1YPIA 4O1CA 2DZTA 1JQVA 1TPFA 1FXQA 3UWVA 4MYXA 5FEZA 2E68A 5HNRA 3S8HA 5D04C 5AYYA 3WJSA 4BI7A 1QPQA 4N4QA 1W5QA 1W5MA 3UQNA 1OK6A 4Q32A 3R13A 3W7PA 3BGGA 1PCWA 4PL2A 3SFKA 1W3TA 3Q94A 1FDJA 1GEQA 1K7EA 3O05A 1W54A 4NU7A 5K4XA 4ADTA 4Z08A 3N3MA 4EVZA 3O8AA 3DI0A 1DOSA 4O13A 4K8HA 1H1ZA 3G0SA 3W2MA 3OIXA 4GUJA 4MYAA 4MFEA 2Q3OA 5I3HA 3LHZA 2WPBA 1YDNA 4UMAA 3UWUA 1ZAIA 4UTWC 3G18A 4MKNA 2XN2A 4X2RA 5LGZA 4YWIA 1VGAA 2C15A 5F2LA 1DHPA 3N73A 1WDWA 1Z44A 2G96A 3TQ0A 2GVGA 3QF0A 4UCGA 1TTJA 5HR6A 5E1QA 5AC6A 1EIXA 1WV2A 2GUUA 2ZTJA 4XUGA 2Y7GA 3KVMA 3W70A 3CTLA 1ALDA 3P61A 1YTDA 2QCDA 1F05A 3W1QA 1B3OA 3C2RA 4O50A 1FWTA 4K6AA 3LLFA 2ZDRA 1LBFA 3DZ1A 4DF1A 2G5WA 2ZZ1A 1TTIA 2A5HA 1NAL1 3EXRA 3V1PA 3PG9A 4JTFA 1TQJA 4O19A 2G95A 1I2QA 3THAA 3EB2A 4QM1A 2V0TA 1IXNA 3A24A 3EX4A 4M7TA 3B8DA 2J6XA 4PTNA 1CW2A 2C0AA 2Z2UA 3LOTA 3A5FA 3SR7A 3A22A 3BV4A 3W7KA 3L5AA 1KM5A 2QCGA 1U5JA 3QPZA 3FLUA 4N9CA 4Y90A 2ZZ6A 5LNRA 2ZZ4A 2E5BA 4WOZA 4UFMA 5CPNA 1BTMA 2ZZ3A 3MYPA 3SGUA 1QO2A 1XUUA 3NEVA 4LC6A 1LZOA 4NXSA 1I8JA 3NL6A 3YPIA 4UFKA 1RR2A 1OFAA 4UFIA 3SECA 3GZ3A 3LX9A 3PM6A 5H2ZA 5DELA 3TXZA 3EEGA 5HWJA 3C61A 1OG0A 5TQLA 2RKXA 2X1SA 2CU0A 3QW3A 1WYIA 2NX3A 1ICSA 3LI0A 3W7OA 2FB3A 1KLYA 4EIVA 1H5YA 4FF7A 2PRMA 1VPXA 1SO5A 1YADA 4JR5A 5K7JA 1H7PA 3TCEA 3GVGA 1GWJA 4YXGA 3TROA 3RNDA 1NVMA 4G1KA 4LUIA 4M19A 2XFWA 2C3ZA 3G1SA 4JX5A 3L9CA 5K9CA 3T4CA 2FPVA 2QJHA 3CM4A 1K8XA 2ALDA 3GNDA 2ISVA 3W1MA 5G2HA 4AH7A 1AW2A 5D30A 3UWZA 3W7RA 3ZR4A 3W7MA 2Y7EA 4L4LA 5AFDA 3LXCA 2NWRA 4FNSA 1TRDA 2XN0A 2F7FA 3O06A 3NL2A 1FWWA 4I7WA 4MOZA 1NEYA 4JTHA 4RX0A 4XQ6A 2EF9A 4UFHA 2Q8ZA 4JTEA 2ZRZA 5MHBA 4HT3A 3O63A 2A7NA 2C1HA 3KVLA 1ZFJA 4MY1A 1Q6RA 1C9DA 2TSYA 4LVAA 1QMLA 3MJYA 1XFBA 5BMWA 4IX0A 2QCCA 3TMQA 4J9JA 2CLHA 4JICA 3S6DA 3DFNA 3SIZA 3W1RA 1KFCA 3LRKA 4JX6A 3M9YA 3UWWA 2CZEA 4ADUA 3W86A 1DJQA 5D33A 1HG3A 1DQWA 1PS9A 5AN7A 3NQ6A 3NR0A 1EP1A 4JIQA 1YLVA 5A5WA 1AL8A 1L9WA 4JTGA 1G69A 4RZ4A 5KTLA 3GDTA 1C8VA 1EX5A 1YDVA 1RZMA 3O15A 4JYFA 1DORA 2H90A 3HB9A 3O6YX 4JY9A 4RV8A 2WOQA 3QJAA 2GOUA 1I2PA 1EWEA 5AHEA 5EL1A 5CGQA 2E1DA 1F76A 3W23A 1LLZA 5IM51 4PFMA 3W1PA 1ZJIA 2AAMA 4TU1A 3EWWA 2R94A 4YLWA 3P8JA 3LTSA 3LBCA 1KTCA 1LBLA 2V8ZA 3G8RA 2NUWA 5C6MA 4HNTA 4NZJA 1LOQA 1LRNA 4FNRA 4IPJA 2VELA 1P4CA 5K9XA 2WSRA 4FXRA 4ORMA 4RXFA 1K02A 1RV8A 2A85A 1VCFA 1ICQA 3WK0A 1TPWA 4NNCA 1LM1A 1A5SA 4OGZA 1OX5A 4DBEA 4ZL1A 1VHNA 2QCLA 4JYDA 1HFBA 1SZGA 1DQXA 3NQCA 5CPOA 4A3UA 7TIMA 1M7OA 1TPC1 3C6CA 4Z0JA 3ELFA 4O52A
chains in the Genus database with same CATH superfamily
4U3CA 3MYOA 1A0EA 3EDJA 3F5JA 1GZJA 1KB3A 1TB3A 3AWOA 2A3HA 1S3HA 4NAEB 3VCRA 1E6RA 1DWFM 3W74A 3R0KA 1BWVA 2YGYA 2Q01A 4WCJA 2NWSA 4EPBC 2QNEA 2XSBA 4N4PA 4F3HA 3WN6A 1KM1A 3GQYA 5M03A 4J27A 3VNIA 3OLEA 4W4QA 3TYAA 3MUCA 3NM3A 5DN1A 3W84A 5ABGA 3IJ9A 1W5PA 4IJBA 1MFVA 5KSWA 4NI8A 2OGYA 4LYPA 2VX5A 3TYEA 5GJNA 3W7JA 3AJ7A 4TV6A 1VAHA 2DJLA 4UC5A 1TRIA 2XDFA 2HISA 1JULA 1E43A 1LRTA 1OY0A 1UWQA 4O11A 4H8UA 5KZEA 4S3JA 3MHFA 4J5NA 3TDFA 4CUCA 1E1CA 3UWQA 4G7EB 5U7SA 5EPDA 3GDBA 3WL1A 5KMYA 3WMBA 1VP5A 1KFJA 2E5DA 1KRBC 3KOZA 3QM3A 1CXLA 4GQRA 2DSWA 3C2FA 1V02E 2Y88A 4MNLA 2QDEA 1PPIA 3C52A 1DJHA 4N9DA 1JUEA 4DN1A 3VKJA 2A3CA 5DCBA 1GVYA 2VFGA 2Z6JA 3VABA 1KM4A 3MCOA 1YMYA 1EC7A 4C6NA 3PB2A 4EX4A 4EP8C 3E0VA 1F3XA 2PPGA 1ADOA 2FTYA 3ABZA 5CQ1A 2PDQA 3S5YA 1AZ2A 3GXIA 1TCDA 2Y8UA 1AQ0A 3AMGA 5DBUA 2Z7GA 4POCA 4XZBA 2RDTA 3AJXA 2BWGA 2JEPA 3BJTA 3M44A 2NLIA 3AAMA 1Q6OA 8XIMA 4WKFA 3ZWSA 3W53A 2GQAA 4EXBA 4UTTC 3LG3A 1ZRQA 1W9BM 1DV7A 4GIYA 4KGJA 4C6LA 4ERGA 1UZ1A 2HDJA 3VNZA 3WQPA 3QMRA 4D8ZA 4O1AA 3GW0A 1UKSA 4BK9A 5C55A 3W24A 3F5LA 3R12A 1FH8A 5IFTA 4MKVA 3TXVA 2XZ9A 4Q7NA 5D32A 1MUWA 5FSDC 1H7OA 1V3MA 4F0HA 1UKOA 1S2UA 4TUFA 4M6VA 5EMJA 4AMAA 5BZAA 1YE6A 4K36A 3VNYA 3EX3A 4WR3A 4UZUA 5TAOA 2BGNE 3T1GA 2J77A 3GU1A 3DG3A 4D2JA 3S47A 1XICA 2W0UA 4NAEA 5CPLA 4AXNA 1K9EA 2E3ZA 3H4XA 4L64A 3OVPA 3WQ6A 4FLRA 1YRRA 4E2DA 3S83A 1K3UA 1G7UA 3H2NA 2WMIB 1W1TA 4CNOA 3W1UA 1GJUA 4H04A 3NQBA 1VRDA 3FJ4A 1VZWA 5JMUA 1BRLB 3IGXA 4FP1A 2YW3A 1VHCA 3P2VA 4M24A 4AF0B 1B31A 2OMAA 3VGHA 3W71A 3R8RA 3WF3A 1Q6CA 2DSUA 5GVJA 1KRAC 2X40A 1O5XA 3GG8A 2QHAA 5A6TC 1AA1B 1Q6QA 1U5VA 2J88A 1H49A 3B0UX 3QZ6A 2ZA3A 1PV8A 2DT0A 1MQRA 1V79A 4HNVA 1EPXA 3O9NA 1XRFA 2BX7A 4AFYA 4G7EA 1H11A 2VCBA 3W22A 5I79A 1RAKA 2GGGA 3W9ZA 1S2VA 3V5CA 2QCNA 1QPNA 1FA2A 4XG1A 2J62A 3VZYA 4L7ZA 1PO9A 1WB0A 4Q8PA 4ZQRA 4UTIA 2YB4A 4HA0A 3G0XA 4DM2A 2Y8VA 3PAOA 1GPWA 4CCCA 1KXHA 1EUNA 4JQ2A 4HNLA 3N13A 4WKAA 4MJMA 1Z69A 3PB0A 3CGTA 3IVSA 4HP5A 4NNBA 5DRIA 1E6ZA 6XIMA 5LIKX 4O1BA 5BOFA 5FAGA 1G4EA 5HUPA 3H12A 1H50A 5I23A 1A5KC 3S5NA 3VOFA 2HWGA 5AYZA 2EQDA 1UIOA 4MIMA 1G4SA 3EXTA 4L9ZA 1ZP4A 4AD5A 2CHRA 1XIIA 4DF0A 4XKMA 2EPLX 3S2NA 4UUIA 3N29A 3AWNA 3NQVA 1NF0A 5FF2A 5FSEC 1QWKA 4ATDA 6PTDA 1K77A 1UMLA 4EKJA 3TJLA 4Y8FA 2PGEA 2DORA 2BY0A 3OEXA 2QGHA 3AXXA 1E4NA 1EA9C 5A6AA 1HGYA 4O15A 4S23A 4GKLA 1W0MA 2J7BA 2XVNA 2Z25A 4JX4A 3AXHA 3V36A 3BLEA 1BQGA 5T9CE 3T09A 4AB4A 4GXMA 4QS6A 2FJUB 3WUEA 3QKEA 1ZBVA 4DYJA 2WC3A 4IFKA 2J75A 2O7SA 3SCUA 2GUYA 4MZYA 2X0SA 3N2BA 1O5RA 5CPSA 2HK0A 3BCFA 4ML4A 4KRZA 2WSYA 3UY7A 3ZQ9A 4CD6A 5CZTA 4W7VA 1W32A 4M8UA 3WQ8A 2FZBA 3RMEA 1TIWA 3COTA 3I7SA 4M6PA 3GK0A 1GORA 1WOAA 4ORIA 5A8NA 3WJXA 3UESA 3GU2A 3CASA 4ZCWA 1JYVA 1UP0A 1RJRA 5I6SA 2WMIA 5ABHA 3DCPA 4A2RA 2IKHA 2ZKMX 3IK4A 4Q6JA 1C8XA 3WBYA 4ZQOA 3H2CA 2D0GA 4GXPA 2VFHA 3GR8A 1NDVA 4FHAA 1AJ2A 4W8LA 1JZ7A 5AHIA 3QGAC 4YIWA 1BRLA 1X6NA 5JQ9A 5CPQA 3WD2A 4IMDA 4DLFA 4GO9A 2QF7A 1XW8A 2J7DA 2HE5A 3M0XA 5I3DA 1MRAA 4AF0A 3H70A 1MEHA 5DXXA 3VDHA 4BHYA 2A4AA 1KR1A 1L6GA 2WLZA 1OG6A 4F0SA 3H23A 4HZ8A 3IIXA 3AHYA 4Y9AA 3G1RA 4DUOA 5BCAA 1BD0A 1TX2A 3TOYA 3UZYA 3VUPA 1SFSA 1JYXA 4H8NA 4US6A 3PUEA 2CESA 2BDQA 3XISA 3S9YA 1FX6A 4X9SA 3UNTA 1P0EA 4Z2KA 4HPGA 2V30A 3F2CA 1H51A 1LUCA 4C6CA 1TPUA 1KRMA 3VZZA 3DFHA 4W84A 1UW9A 2CLIA 3UYCA 5LGXA 1QR7A 1A5LC 4P7RA 2D3NA 4Z42C 4UWMA 1QVBA 4QRNA 2OLAA 2PLKA 4LS0A 2OZ8A 3AXMA 3W76A 4NF7A 2WNWA 2YKKA 3MI2A 3KM8A 4IMFA 3LMYA 1OSEA 4QP0A 3PZQA 3BW4A 2AMGA 4QISA 3L0NA 1EQPA 3K1GA 4JTSA 4WOQA 5G4WA 3NOEA 5T8GA 1QNVA 1GG0A 2A6NA 3W7GA 2BVYA 4OJYA 2GVYA 3TCSA 3UZWA 5EFFA 1AJZA 1QNSA 1FRBA 3R0UA 1F4AA 1AQHA 3KZPA 4YN5A 3DC0A 5KETA 3G1AA 3SZ8A 2J9YA 2Z1WA 3S6TA 2J9XA 3MU7A 3S0CA 3BW2A 1XYZA 3W3OA 4ACZB 1A53A 1Q5MA 3BURA 2X8RA 2DVTA 1L6SA 2WC4A 3PFMA 5HINA 1UD3A 4FXSA 2C19A 3PFRA 4O1EA 3E02A 3DHDA 3GM8A 2WVTA 2BP1A 1TV2A 4DJED 5CJ5A 3WNLA 3POCA 4QAWA 4A22A 2XYLA 2F2KA 3HN3A 1O1HA 1JZ3A 4GY1A 4S39A 2QUNA 3MSRA 2VQUA 4YVXA 1UR9A 1LORA 4EPDC 2G8ZA 3STCA 4AQLA 4DJEA 2C13A 4PMDA 3IIOA 4RLIA 6CGTA 4IG2B 5AHNA 1EXBA 3KDOA 1GQJA 4KEMA 2DIKA 3APYA 1HP4A 4PBEA 4HVXA 4TMCA 1N7KA 3O6DA 1F73A 7PTDA 4Q7IA 4FOJA 3SCQA 3CUHA 3B4UA 5CGMA 5J5DA 1M3UA 1JUBA 5C54A 3P62A 1JYNA 4WVXA 2OO0A 4YMZA 3UR8A 3KL3A 1TREA 1OABA 4YWSA 5G1YA 3B0XA 3EB4A 5DBTA 3G22A 1JCLA 2NVCA 2ZBTA 4LVGA 4BQ4A 4B92A 2P1FA 4O0QA 3L0GA 1Y8BA 5DMMA 3DU0A 2HTMA 4Y9PA 3PNUA 2VGFA 3CQHA 2WVUA 4PH6A 3C56A 1E40A 2B31A 3RMJA 1TVLA 1V0NA 1J96A 6ENLA 1WP6A 2DSVA 3M5YA 3WZ0E 4LNCA 5A2CA 2WWCA 3CJPA 2UY4A 4UQBA 4ERAA 3GLCA 3W7DA 2Z24A 3L4TA 4QJ1A 1FWEC 4I9AA 4BF9A 4F8XA 5MKGB 3SQMA 1Y0EA 1IE7C 1QRQA 1Q6GA 3HF3A 4PUJA 4AVFA 1GVFA 1WKYA 1O5KA 5CC5A 5DY2A 3LENA 3L4WA 2Y89A 4XD3A 4HHLA 3UR7A 3I7QA 3BSHA 3L66A 1QXLA 1BVZA 4GFSA 1R5YA 5I2UA 1SFJA 4H6QA 3A9IA 5BMXA 3OPSA 1W1B1 1ZBKA 2D2GA 3QKZA 3NL3A 2WMHA 4JZ5A 3GC2A 3GXTA 3RLGA 4O8RA 3GTFA 1O95A 2BS9A 4LV4A 1XUZA 4R7JA 3CAQA 1TTPA 3ARTA 3HBLA 1TPB1 4H7ZA 4YL2A 3FN9A 3EPMA 4R53A 4G5DA 2VT0A 2Y7FA 3VDGA 1PUDA 1SO4A 1UOKA 3PZVA 3R2GA 4X2PA 4C6OA 5E0KA 1YHTA 4JTKA 1GVSA 3CV6A 1WBJA 3F4VA 4LS1A 1JF5A 1KWGA 4WHBA 5D9NA 1FWNA 3C8FA 2YOCA 4PB3A 3ATZA 3V0TA 2C1GA 1AL7A 3BLLA 1FFQA 4ZO7A 1UZHA 3B9OA 1WZKA 5IDIA 2YXGA 2WLYA 5A94A 3EDKA 4MZ1A 1J5TA 3FA3A 4K39A 3PJTA 2RAGA 2IQDA 1B57A 3CHCA 4IFRA 1DTUA 2XJ7A 4AZGA 4ZQPA 1AJ0A 3NUKA 4AEFA 1CX9A 1TA3B 4FB7A 2XU2A 4DZIA 1KFBA 2RGLA 2EPNA 4D6EA 3T4WA 4Z2HA 2J66A 4IG2A 1O68A 5HUOA 4AZ6A 2ALRA 4HMCA 2R82A 4RCXA 2DIJA 4OU1A 4H9ZA 4D6CA 4AWEA 4Z0SA 1GVRA 4BA0A 1WPCA 3U0HA 4F79A 4LCRA 3FX4A 3TJXA 1GVOA 1WNOA 4JTUA 2BVTA 2XWDA 3Q65A 2QLYA 4PCFA 3CS2A 1QUMA 3E3HA 2YDQA 1UASA 4E5TA 3FVDA 4ATLA 4C6FA 4N6FA 3K30A 3QR3A 2CLPA 2C18A 3CC1A 4PMYA 3WDIA 3KRSA 1DYSA 1GVQA 4HKPA 3S5OA 3CWOX 1AVAA 1VFSA 1CGTA 2VEFA 4S2BA 1YIXA 3EAUA 1B1YA 1SPQA 4R9XA 3ZS4A 4NXKA 4MPQA 1IXPA 5U4NA 4WJXA 3D3FA 3PY2A 4UCFA 2VRKA 1JAEA 2HXUA 3M0JA 1KGWA 3WH6A 1FOBA 4F40A 3URAA 4W5ZA 3TNOA 1BPLB 2PLJA 1BQCA 3FYYA 4C6JA 4PSRA 1D3GA 2WVSA 4GZEA 1O12A 2GLKA 4MZ8A 4Z1DA 1W3NA 3H4WA 3TTSA 1TMHA 2GSHA 1ZAJA 1N82A 1RBLA 2W63A 1J0ZA 1IXOA 4RE0A 1CLVA 1LP6A 1CTNA 1UIPA 1D3HA 2WSQA 3EKLA 3V3WA 3GS6A 3VKBA 3H22A 4XAYA 2J4GA 1KCZA 3EX2A 3S9IA 4TO8A 1OM0A 3FV9A 1JPDX 2BHYA 1OCJA 4V2XA 3ARPA 2ANUA 1S3TC 3ARSA 2PDJA 4U28A 2RUSA 3E2VA 3O07A 1CT5A 5FOOA 2OR2A 2I17A 3CUIA 3BAWA 1RHCA 3P0XA 2ZC8A 5J8LA 3TVAA 1BAGA 1KV8A 3W6LA 3RAOA 1EJVC 3TLQA 3IJ6A 3BLKA 3REQA 1E51A 2QUVA 2E6AA 4LNYA 3RO8A 5I3JA 2YCLB 2PE4A 5CSRA 1QATA 3LGDA 1U1HA 4OV4A 3PBUA 3PP7A 4NZ4A 1KO0A 1R86A 1F3TA 3SRFA 3TYDA 2AL2A 3GNRA 4X61A 1OVDA 4PFHA 2HNEA 2DU2A 4HQVA 1SZFA 3ZLFA 5F1VA 4ZE4A 3I3EA 3DI1A 2GJRA 3WF2A 3W72A 1PTDA 2W6RA 3W81A 3TZFA 5XINA 1VJSA 3PNZA 4WSJA 2D24A 2EEXA 1ME8A 5D2XA 1JCMP 1BKSA 3RCNA 3MMTA 1W3KA 1ZJHA 4AU0A 3N2MA 2GQ9A 4Q4MA 5M2FX 3AMLA 3NQDA 2ZX7A 2ZUUA 2VR2A 1E9YB 3AYRA 3IWPA 3TQKA 3RO6A 3UJEA 3CQIA 1OD0A 3GNPA 1DIKA 5DY3A 1BGGA 5C5YA 3EDFA 1BF2A 2NUYA 3VO0A 1G9HA 1V6WA 3GTHA 4DO4A 1GQNA 2WO5A 3N2TA 3BLFA 1VYSX 2FVLA 1DJZA 2IUZA 2ZQ0A 3QW4B 1R3WA 4QGCA 6TAAA 1ISYA 3W7CA 2ZE3A 3UZXA 1E55A 2OYKA 1F6PA 4TR9A 3QY7A 1FFRA 1D7FA 1K70A 1IF2A 1RLCL 5LKYA 3VAVA 4IISA 3M7SA 3UW6A 1XBXA 3GIYA 1FWHC 4CN4A 4PMXA 1H61A 3UXKA 1GTHA 5LXXA 1GYMA 5I3IA 4TMBA 2XISA 4LB4A 3V1HA 4ZSTA 2EO7A 3GNNA 1KA9F 3FSUA 3ARVA 3S5ZA 3UWEA 2DSKA 1C90A 1NFPA 4OBTA 1W6TA 3VIPA 3RF9A 3NQ7A 5IXEA 3TW9A 3WNPA 4C1NB 4P7OA 4KH2A 4MB4A 1OADA 4GUFA 3MY9A 1MO0A 2Y2WA 4TIMA 2QDHA 3HOJA 3HG2A 4KEVA 4Z1AA 4WY0B 2B4GA 1IXQA 5M3WA 1ZBCA 4NX5A 2F38A 3UJ2A 3H7VA 3BMWA 4HCHA 1RQBA 4I9MA 5M5DA 3BW3A 5LA1A 4YVVA 3V0SA 4WDXA 4QSHA 3T0AA 4O0KA 5J5RA 3JVAA 4NRSA 1KM6A 4HMEA 1P0NA 3UG5A 4L9YA 2YXXA 2VGGA 4K1WA 1SR9A 2WCGA 1TJ1A 1NWRA 3TKFA 3CAVA 1G01A 2JQXA 5FJOA 4O10A 2GYIA 2RGMA 3GR4A 2GGEA 3CEUA 1D7KA 1ISZA 1V0KA 1SJAA 3LQLA 3BLDA 3KCOA 1POKA 4D6HA 1Q8AA 1H7RA 1EEPA 1YBQA 4E3TA 3SGZA 3BANA 3TK7A 4YTQA 5HULA 2EJ1A 3LB0A 3WLKX 1JCYA 1Z9AA 1NOFA 3U57A 2IKIA 3VGBA 4G8TA 4J3TA 3W38A 4DJEC 1DWIM 3NG3A 3DG6A 3DYPA 4GYPA 3A4AA 4O17A 2X30A 1LL7A 4FZIA 3QOKA 4KCTA 3WH9A 3ZYZA 1EZ2A 4M1BA 1CGVA 1GJPA 4CVUA 2I9UA 3HTWA 4C90A 1E9ZB 4J1OA 1XRVA 4GGBA 1S5MA 2VFFA 1KTBA 4LYKA 2V81A 1G6CA 2WHKA 1J8VA 3KW3A 4AX6A 1Q6FA 2Z2AA 4QX4A 2A7RA 2J7FA 2FH6A 1Q13A 4M56A 3NQEA 4LTSA 4JL1A 3B8VA 3OBKA 2WXDM 3VX1A 2QIWA 4WX2A 1SR0A 2EHHA 1NU5A 4JQ4A 1O5QA 3UR2A 4E0CA 2PDYA 1OIMA 3K13A 1M68A 4REQB 4LAZA 4QLJA 1ITQA 3C3NA 4Q4PA 3WD0A 2FQIA 2PU0A 3TV8A 1UR4A 2OX1A 5I02A 1C7TA 4ZTXA 1QHZA 3O3RA 3NXLA 1M03A 1V0LA 2CZFA 3RR1A 1CGUA 4U2ZA 4AWUA 1MW3A 5KZ6A 2NW0A 4AD4A 4GNVA 4CQBA 4KQNA 1SMDA 1AD1A 3B3DA 2VD9A 4XBJA 3KXQA 1EDTA 1GG1A 1M65A 1DJGA 7XIMA 4NJKA 3OG3A 2PZ0A 3MHGA 4J3VA 1E71M 5T26A 2VJXA 1HKIA 3C8NA 5E70A 1QCWA 3AQUA 4YHEA 3SQLA 4PE8A 3W6YA 3LLDA 4JTIA 4GQBA 1YPIA 1V6UA 2VMFA 5HNRA 2E68A 4QS5A 1QPQA 5HOSA 3UQNA 3W7PA 1WKDA 1E6NA 1JG9A 1JDAA 2VVSA 3Q94A 1GEQA 5LYRA 1K7EA 2PB1A 4IQEA 3O05A 2VR4A 3QBUA 1HKVA 1DIEA 4BJHA 1O7AA 4K8HA 3CUZA 3VTRA 3E6EA 1GZ1A 2O9OA 4BCEA 2WSKA 3II1A 1US2A 5I3HA 3R25A 3UWUA 2XN2A 1P0BA 1JDDA 4CQCA 1R87A 1FWCC 3TQ0A 3UETA 2OWCA 2GVGA 1T5AA 5HR6A 4PCTA 2GGIA 5E1QA 3AXKA 4S3BA 3G77A 1WV2A 2ZTJA 4XUGA 1E5JA 4DM1A 1YTDA 1KGUA 2QCDA 3GG7A 4F48A 3E2SA 4AZ5A 2FGBA 2ZDRA 1ZU8A 1LBFA 4EANA 3DZ1A 3T07A 3ZT7A 2G5WA 2ISFA 4A3HA 3SCRA 2A5HA 4WGHA 4YU1A 1FWAC 3TYCA 2Z00A 4DBWA 4FR1A 1ZUAX 3THAA 3EB2A 4QE4A 5HXMA 1PYMA 3A24A 1KCLA 5XIMA 1H2JA 1MDRA 3B8DA 4Y9OA 2C0AA 2Z2UA 3R10A 2QPXA 3ITGA 3OYXA 3QPZA 3FLUA 3RGTA 3CZLA 2ZZ6A 3DECA 5C8BB 1E0WA 1W1IE 3BOLA 3KP0A 4E2OA 3GHUA 1LZOA 4F2UA 1ZCCA 1OFAA 4DIAA 3LX9A 1IV8A 3PM6A 3RJYA 5DELA 3TXZA 3QQWA 3C61A 2R6OA 4HCDA 4AVNA 3LI0A 3KTCA 4OECA 2FB3A 2G3FA 4FF7A 3CUXA 4RE3A 4J4KA 1SO5A 2CC0A 3RLHA 1H7PA 3CQJA 1NARA 3BAKA 5IHSA 4JFUA 4YXGA 3RNDA 3MKCA 3ARUA 3KL0A 5LIUX 6REQB 3CH0A 4L6HA 2OSWA 4AZIA 4H6RA 5K9CA 1VJZA 3T4CA 3CM4A 1F07A 2VTFA 2EPOA 1CDGA 2ISVA 3KBVA 3W1MA 1R0MA 1CEOA 5JIWA 3W7RA 3VKDA 1UH3A 3W7MA 3IAQA 1XCWA 5AFDA 1ZQ5A 3LXCA 4D71A 3UA4A 1JD9A 4ZB5A 2QV5A 3NURA 1CECA 4XQ6A 3IPWA 2HPMA 3WX7A 3GVVA 1GW9A 4JKKA 1VBRA 3MC5A 4K2SA 4GVHA 5MHBA 4L5ZA 2FFIA 1ZFJA 4GY0A 3UYIA 3RN6A 1W1PA 2O4QA 1A80A 3LUTA 2VI0A 2PI6A 3SRHA 5M17A 5BMWA 2QYGA 4IX0A 3TMQA 4MWAD 4JICA 4AG0A 1ELSA 1EIBA 1LL6A 3FXYA 3SIZA 2PF8A 1DWHM 1KFCA 3VIMA 3M9YA 1W1A1 3GBEA 4H2HA 4QFUA 3CAKA 1E3XA 3W86A 3VOCA 3RILA 2W5FA 1DQWA 4GH3A 5CEWA 2GGJA 1HJVA 4HSHA 3WO8A 4MWAA 3TONA 4L80A 4UQCA 1AL8A 2O55A 4GKTA 5I77A 1C8VA 3TJ4A 1YDVA 1KRCC 3ARZA 3THDA 4M80A 3MQTA 4RV8A 5CAKA 3M0LA 1XLEA 3EWWA 5E0CA 4YLWA 1EO7A 1MMFA 3LTSA 1KTCA 2V8ZA 1I1XA 5CC6A 3BMXA 3GNXA 1NP2A 4L1XA 2PWDA 2CBVA 3VIGA 4IPJA 3FW6A 5HAOA 1XYLA 4ORMA 1YDYA 4GY7A 2CBIA 1K02A 1VCFA 1TPWA 2VVNA 4NNCA 2BBFA 3GHSA 1YKWA 3M64A 4JYDA 1DQXA 4A3UA 1MFUA 4Z0JA 2YCJA 2D0FA 8A3HA 5ABFB 3GH4A 1G94A 4DX3A 1XSKA 3N12A 4ES4A 2TYSA 2ZUTA 5I78A 1VLIA 2F9RA 5EMYA 2P0OA 2EKGA 4XKYB 3OZPA 2AGKA 3D6NA 2X41A 1Q45A 3ISIX 3F2DA 4GBDA 4RW5A 1CXIA 5I5RA 7REQB 1B5TA 2INEA 1Q8JA 3NQAA 2RJGA 3NZ1A 1DP0A 3TSBA 4DF2A 2D1ZA 1XCXA 4YTRA 4S3EA 2FVMA 2ZA1A 1K9DA 3FYPA 4ZVJA 1PIIA 4FX8A 4DLMA 1WQ5A 3CYVA 3CIWA 2YBVA 2CERA 1OFQA 3C86A 1X8CA 3BSGA 1K6AA 2FGZA 1OIFA 1EDGA 4AIBA 6REQA 3EMCA 1FH9A 1OX4B 4UQEA 4PB4A 4NL1A 3W75A 3UVAA 3N6JA 1JR1A 3ES7A 2OT0A 3VOIA 3RLVA 1S2TA 4RZ5A 1EZWA 3EX1A 4DEFA 9CGTA 4RKAA 1SM9A 1M5WA 1AW5A 3TYUA 4K8GA 3MI6A 2ATSA 4U3AA 1NQKA 4H2CA 1QI5A 1J11A 3NM1A 1WZMA 3FY1A 4C60A 2UY2A 4NNAA 1ME7A 2DEPA 2OOFA 1M7PA 3PZGA 3RR4A 1ZENA 4UOQA 3EBVA 2ABBA 1RALA 3GBDA 4HA4A 2CLKA 1V7AA 4JXCA 2PS2A 2YXOA 1Q4NX 3LDVA 1IT8A 5JBEA 1B54A 3JRKA 5D2YA 3AZSA 4HU0A 1F9CA 3GVQA 4K1GA 3NYDA 3KZSA 4EF9A 1HO1A 4PCSA 4LH8A 4O14A 3DUGA 4HN8A 1G7VA 4GG9A 3ITLA 3U9IA 3B9EA 4PTDA 5BOOA 4NT0A 3N04A 5I3KA 1H4PA 4NJGA 3MP5A 1ENUA 1KGXA 4I7VA 4XD6A 1N2VA 3SY5A 4LYQA 3S1UA 4INFA 4B5XA 5FF3A 3O6CA 4PA8A 3T05A 4JTRA 3WLIA 1R30A 1PBGA 2I56A 2YFOA 4IGHA 4JTJA 3W7IA 2Z1VA 5CGTA 3RLUA 2J25A 4JHOA 3LCFA 4IUGA 3MVTA 5BW6A 2YFNA 4A4AA 4XK2A 1LT8A 3GD6A 3KCJA 2A7PA 5F7UA 1J6OA 2CXGA 3NAVA 4M1RA 4CQAA 2QJGA 4AC1X 1H5VA 4PTVA 4YPJA 1LBMA 4UR7A 4Q4SA 5A1AA 2B0MA 1WUEA 1PAMA 3UXAA 3L4XA 1BYDA 4ZR8A 5I7GA 1XH1A 1MSSA 4GGHA 1WA3A 3H2MA 1VEMA 4AWTA 3PBVA 4URIA 4FALA 2VDGA 3GIQA 1T40A 3CIXA 4JDBA 1Q6DA 1W17A 3KEHA 3WDRA 3DENA 1QOXA 3BAYA 3ICJA 3UZZA 2Z6IA 4L56A 3LHUA 4XKYA 1ITCA 1PE1A 2GJNA 3OGSA 2CLEA 1J79A 1A5BA 3JZEA 2FLIA 3S2CA 5G1MA 4IT1A 3MCMA 2WZHA 4XO6A 4OOZA 1E1EA 3RCYA 1K9TA 1KBIA 3FKRA 3ZVHB 4C1KA 1UR3M 2PWEA 3CHFA 4JNYA 4JKMA 3FAXA 3A3WA 1FHVA 3O16A 2QDGA 4FR6A 1FHLA 3IIPA 2ZRWA 1XHGA 1E9LA 3S1WA 2VDHA 1ME9A 3GB6A 3C0QA 2I5IA 2PU1A 1OWQA 1UZ4A 3GDRA 2ISDA 3W1TA 3UPMA 3NO5A 1E0VA 2NQHA 4CGTA 1AZ1A 2HBXA 1OX4A 1A5UA 2NQZA 2E5CA 1W8SA 2VZOA 4RW3A 2PBGA 3K4DA 4PCNA 3JU2A 1CXKA 3E5PA 1MDLA 2P8CA 3I3DA 3RK8A 1JNEA 3O7UA 3KBMA 4RUBA 3WK1A 3SFWA 2QGYA 4IMGA 1QT1A 2J78A 4HMNA 2R9RA 5A3HA 3DX5A 3BG9A 3VILA 2VC7A 3QHOA 2A6LA 4GISA 4JTDA 4I90A 4GE8A 3KUMA 3EWCA 4JFWA 1Q63A 2P88A 4FNPA 2YDSA 3VNMA 3P0WA 1E72M 3GW3A 3W88A 4JAWA 4E2BA 5C9WA 1X6UA 5D38A 2NLYA 1LG1A 4UQAA 5D9OA 4AAJA 5GNYA 3SSJA 1R46A 2D69A 3NQFA 4MADA 4QR6A 1JD7A 3RCMA 7A3HA 5EKYA 4FI4A 1FWFC 4A3QA 1T0OA 4ADSA 1ODZA 2TRSA 1IHIA 2OQHA 2OODA 3LRMA 1L8PA 1LLWA 3EWZA 4EWND 3NPUA 2RJHA 4AW7A 4ZQCA 3BAXA 3ZZ1A 1YXYA 3HQ1A 2YA2A 4PRRA 3E0WA 2XH0A 4CCDA 3NSXA 1R85A 4E8CA 1LRQA 4UQDA 1XF0A 2NXIA 2CZVA 2RFGA 1MWOA 3GTXA 3EDDA 3MA8A 1GQKA 3JZUA 2CLFA 2VOTA 3V35A 2JGQA 2ZTKA 1KKRA 3NZPA 1WCGA 2JGYA 1TQXA 2RDUA 2P76A 3IUHA 4F4RA 1UB3A 1GHSA 1QNPA 1DHKA 1B4EA 2G3NA 1V3KA 2V68A 1MUMA 1H7XA 2CITA 1G4PA 3NZQA 3QHNA 3G1XA 2QKFA 3LXBA 1JPIA 5F2MA 3WEZA 3QY6A 2A79A 2NZLA 2W91A 1S38A 2VQTA 5REQA 1JCJA 4LAKA 4TOQA 2DZXA 4UXDA 3LCGA 2X1TA 3MVIA 4ERIA 5AYBA 1KBJA 2V3EA 4D6JA 3Q45A 2AQWA 3ZLGA 5D4YA 3HJEA 3TLLA 1TV4A 2PRHA 1IZJA 2OT1A 1W1YA 3HFTA 1DTNA 4JTLA 1S2WA 3KOFA 1OC5A 3TR2A 4LBUA 2X7VA 3M0KA 5F1UA 2G50A 3BVJA 3RUBL 4NIRA 1XIDA 1ZZMA 4AZCB 1FCUA 5XIAA 1RQHA 4WJEA 2IQTA 4H9YA 1F7BA 1EJ7L 3PBWA 1E9IA 2G3MA 4LCSA 2OJPA 1NWSA 2C8NA 4I6VA 1TWWA 1KCXA 4UMCA 1KXVA 4GK8A 1UC5A 1O1ZA 3G6MA 3CQ0A 3B8IA 1HW6A 1Q7MA 2AGTA 2YCIX 2IS7A 2QDDA 1HF6A 5FJJA 5M1TA 3VU2A 3M7WA 5DLCA 1PKYA 2UY5A 2XG9A 5DF0A 1GYLA 5AC5A 3W1XA 3BH4A 3L5LA 1Y5VA 4GYKA 1VCVA 4I3GA 2WYSA 3WLPA 1WAUA 3TUUA 1YNQA 4NZ5A 4J28A 1TX0A 3NDZA 1O6IA 1MXDA 3FSTA 3WFZA 4ZFMA 3LYEA 3M0ZA 9RUBA 3N19B 1ESWA 3HIJA 3DKJA 4GACA 2PP1A 3WUFA 2PAJA 5AZ0A 1KC7A 9XIAA 1TR9A 2C1IA 3WDJA 3CWNA 3VX0A 1VCGA 3PPFA 2OG9A 4U5KA 3G0UA 1F74A 4LXFA 4IPLA 1ITXA 1ICPA 1FQ0A 4GRSA 4M82A 5LIYX 3TTQA 2PDLA 3T44A 4O18A 1I60A 2QW5A 3BO9A 4MJ2A 2CFFA 1HJQA 3UJFA 1UQYA 1VH7A 2HV5A 4EK7A 1S46A 4V28A 1HIZA 3W2LA 2DZAA 4RPPA 3WSUA 5EMUA 4QSFA 4CU6A 4ECLA 3FYOA 1R3YA 3A64A 2ZOXA 4E8GA 4ZFCA 3KRUA 2ATMA 3HV9A 2E9MA 4RPQA 2Q8XA 2WZEA 1UH4A 3GFZA 3W82A 3K8LA 4UFLA 2X09A 3RRXA 3PSVA 1E1FA 3SN1A 4YYCA 1LWJA 1WUFA 1H0GA 4M51A 3PTQA 4PZVA 4FIQA 3QTPA 3SADA 4PTWA 1H63A 1M7XA 4MHBA 3L68A 4LUTB 3ZJKA 1AODA 2CHOA 3WLSA 4LJ3A 2O9RA 3WNNA 4LY4A 3HM7A 2YJQA 5HWNA 1I4NA 2KAUC 5LNWA 2QUTA 3URNA 1TPH1 4N7QA 4JCMA 2FGLA 2PCEA 3TE9A 3OYZA 4GYJA 3M5VA 1SUXA 3LGEA 4OV9A 4X63A 3LSCA 1PYFA 4QE1A 1DKWA 3HO8A 1DE6A 3W2JA 2LLEA 4DBUA 4I8YA 1REQA 1TVPA 2WNZA 4F66A 3UERA 4GOAA 4AZCA 3A3HA 3MO4A 1FWBC 4JEQA 3SCVA 2I9EA 3QSTA 3T42A 1UG6A 2P3EA 3AIEA 4HTBA 4GJ1A 1CB2A 4LY8A 2ZRXA 4J3ZA 4GD0A 3LV5A 3P7YA 3ZR6A 2PFHA 3IRDA 3S46A 4IGMA 3NEHA 3WDHA 4KPLA 4OQVA 4Q8TA 1UWUA 1HKMA 1OX6A 2BODX 2YA1A 3AS2A 4PB5A 4DUVA 3MW7A 5G2WA 1VKFA 3N14A 5IBXC 3FOKA 2H8XA 1KM2A 4QCFA 1VFHA 3AI0A 4S2CA 4H9VA 5I09A 3W07A 1NDWA 4JTTA 3OO2A 3APGA 4DJDD 2QT3A 3WEMA 4H1ZA 5HPOA 1ZJBA 4RNFA 4HIBA 2PDUA 2HE8A 3GO2A 3THUA 5LA0A 1VFUA 3OJGA 4XTIA 5KITA 3UCDA 2TPSA 3H2OA 4JIRA 2ASHA 2OWXA 1IYXA 2ACQA 4OIFA 4DJDA 3NFUA 4YNGA 5A6KA 1XBVA 2JKPA 4L6DA 3TSMA 2FIQA 1RD6A 4WXYA 4CEXC 1RBOB 4HCLA 1KD0A 3ZJ8A 5LA2A 5BYWA 5C70A 4KETA 3GZAA 3K4WA 1NF7A 1GPFA 3OZOA 4ZXLA 1VIWA 4HOWA 2V5BA 1HL9A 1FWSA 3S4TA 2EXOA 5CBIA 1EPVA 2Q09A 4WSHA 5DCEA 3HQPA 1W5OA 3L2LA 5I3FA 4J7RA 1EJSC 1RVKA 2WAGA 4WDTA 3IJIA 2VL4A 1M9HA 5TD4A 4DQWA 4ICNA 1ZGDA 1ISVA 1KKOA 1P1XA 1ZS2A 3PANA 4PUWA 3GVRA 4O16A 2FZ9A 3L4UA 2XIOA 1QPOA 5D2WA 2UBPC 2Z4GA 3C0LA 3BQ6A 1TSIA 5H8UA 1QTWA 2Y62A 3WMCA 3H54A 3TN4A 4ZO6A 3WIJA 3PG8A 3GFXA 4LAOA 4DUWA 3ANVA 3AHZA 3QYSA 1JVNA 4DHGA 3QFEA 3AYSA 1FY6A 3NO3A 4OTKA 1MXGA 4LRSA 4AIOA 5AHLA 1FKWA 1XIGA 1D8WA 1TWIA 5IFPA 3U4AA 2WZTA 2FZNA 5AZ1A 3UF9A 1T7LA 1Z7AA 4AZHA 4C6MA 1FKXA 4HZ7A 3FGCB 1W8GA 2Z29A 3UG4A 2OSXA 1BGAA 3L23A 1S5NA 1UOZA 2WANA 4ZA0A 1BXCA 2WJZA 4QQUA 5DFAA 3M16A 3G3DA 5A8GA 2R1NA 3B0PA 4MG4A 9XIMA 4XTDA 4K37A 1TZZA 1GTEA 3G1FA 4L1GA 3JR2A 4BFAA 2W62A 4PRTA 3LEPA 1T41A 3N6QA 1R6WA 2DZVA 3MP4A 1XL9A 4MJ4A 3N9SA 4AHPA 3RPMA 1JIBA 4ACYA 4EWJA 1O94A 2YSWA 4QEHA 4MUZA 3B4YA 1NWUA 2BXVA 1Z3NA 1TJPA 3FHAA 3A9BA 4EPKA 5CZSA 2GDUA 1OGSA 2VX6A 2C6QA 4GINA 4IGSA 1Q2RA 4FIRA 3WLHA 1W2PA 2WM1A 1A3WA 1VPQA 4CNNA 5LNUA 2QF8A 3N34A 1X39A 3CAWA 1P6CA 4HNNA 2OYMA 2QJIA 2BY2A 2Y61A 3D46A 4IGNA 1EX1A 3T40A 3L4YA 3CO8A 3MSGA 2ZZ5A 3IGSA 1UR8A 1UD4A 4UR8A 3ARYA 4ZGYA 1YTKA 1MW0A 3MWAA 4BI5A 5F4XA 4WDUA 4QXIA 2KZHA 1E1CB 1HJSA 4WRHA 1XLDA 2VRJA 3TJIA 2H9AB 4Q8UA 2FZMA 1EBGA 5TBOA 3UXLA 1ZLPA 1EYEA 4NJJA 5EY5A 3BZGA 4EF8A 2YYUA 3W7LA 1IEIA 2HZGA 3KHDA 3AU2A 4XBKA 4P8VA 1VQTA 1OINA 4J3XA 4P7QA 1X96A 4RNJA 1TO3A 2CEQA 3S5SA 4JFVA 3HMCA 3AHVA 3I6EA 4W93A 4W8BA 2WHLA 3EOLA 3PPHA 1DE5A 4XAZA 1QK0A 5F2IA 1EHAA 5EYWA 4MLJA 1LCOA 3KCLA 1RUSA 4ENLA 2WK2A 1R2SA 1H0IA 3QPEA 1VRXA 4XWUA 4FXFA 1QPKA 1Z41A 1JAKA 5D09A 3KVJA 3WJWA 2QAPA 1TJ0A 3R11A 2VEMA 3L65A 3THQA 1QOQA 4O4WA 2I57A 3LY0A 4AX7A 4AHQA 1SW0A 5FACA 1BYAA 4BKNA 4HNOA 4B4FA 3IJDA 4AY7A 1LROA 4XAFA 2ACUA 5AYXA 3UVIA 3EB3A 4JIPA 1UMYA 2OGJA 3VD7A 3ZJ7A 1EUAA 2WKGA 3A12A 3G1HA 4GMEA 2B7PA 4LBRA 1UD2A 1J2BA 1PL9A 1FBAA 4J35A 2VEGA 2FDSA 3A47A 2YB1A 3WEOA 4HHHA 4ONVA 4HU4A 3B40A 3P60A 4JHMA 3NPWA 3FGCA 1PIFA 3GH7A 2CHNA 4PODA 1J0YA 2VP8A 3TWBA 1UUMA 1I75A 5FJIA 2A3LA 3NSNA 2E09A 1UBSA 2E4TA 3OU8A 2PC4A 3A21A 4Z2IA 4KIRA 2WVVB 4JPGA 4Y7EA 4KFPA 2Z1SA 1HN1A 3HQOA 2NQ5A 1R3RA 3AMKA 1W1ZA 3QMTA 3MZ2A 4S3KA 5EGRA 3ARQA 3KBWA 3FHQA 5D8ZA 1V6XA 5KEZA 5HR7A 2PC8A 3EWUA 1X1OA 3TIMA 2W79A 1OB0A 1XISA 2V63A 1KFKA 1YNPA 5I03A 3CB3A 4UFJA 1LOSA 2PDBA 4HK5A 3G1YA 1XV8A 3DFSA 4W89A 4MY8A 3N4EA 1EGVA 4C65A 1NH6A 4V33A 4X0VA 1XC4A 4A6GA 2VURA 3J7HA 4KGLA 1UP2A 4JQAA 2XIQA 3UP8A 3DG7A 4UR9A 1TZ9A 2X05A 2E9LA 2V2HA 3LTPA 4NZFA 3SDOA 2R91A 3PULA 1RXOB 2VYOA 3BLIA 3JW7A 2QJJA 1UUQA 2H9AA 4AXKA 2XINA 1LF1A 1XYCA 2BXZA 2OEJA 1ZALA 1J0IA 2DZWA 1LTDA 3DFQA 1DJIA 2ISWA 1NY1A 4I9TA 4BWLA 2QR6A 1CZ1A 3KHJA 2PD5A 3H26A 1WDSA 1P6BA 4XIAA 4AY1A 3G1DA 4NP7A 3E49A 1FDYA 1QU4A 4O54A 3URBA 2FB2A 1VLWA 1R8LA 3ITXA 4K38A 4MSSA 4FLQA 2R1MA 3V5FA 1VEPA 5EMMA 1OQFA 1R3QA 1X38A 2CZ5A 3FJNA 3LHVA 2Y8KA 1KNWA 5BWFA 1EHNA 3DXIA 3ARRA 2GJLA 2VZTA 2R8WA 4E3VA 2G3JA 3BK0A 2RDWA 4CEUC 2Y5EA 3ES8A 2WJDA 4N42A 2PDIA 2G97A 1RBAA 5EBUA 2YX0A 4GPNA 3N9RA 1XD0A 1YPXA 3KP1A 1NDYA 4MWAE 4O57A 3TEVA 3U4FA 3CPRA 1XLHA 1IIGA 2V82A 5GQBA 4S3CA 3WQVA 3HG3A 3C3UA 1KFEA 4NSBA 3PVFA 1A0DA 3EKZA 3U6WA 4ZO9A 2MUCA 4PCPA 3RX4A 3T0TA 2R1KA 4S3AA 2G41A 1QDSA 3G5EA 2WHJA 4M81A 4IFKB 3HA1A 4LRTA 2H6RA 2OEKA 3EX6A 4DI8A 2VHLA 3I65A 3ORWA 4Y9MA 1EH9A 4LAMA 1MEIA 5GNZA 2FHFA 3L67A 2DT1A 3RXZA 1RA0A 4GA8A 1K4HA 4O1CA 1JQVA 4OFCA 1FXQA 5D04C 3WJSA 5CH9A 2WVVA 3LNMA 4N4QA 1W5QA 2XVKA 3LPFA 3RYSA 2ODOA 4GIEA 2IKJA 3LM3A 3TR9A 4IJCA 4JN7A 1UR2A 3SFKA 1C92A 2NSXA 4YTTA 3E0LA 4ROPA 2VDIA 1GKRA 2W61A 3DBNA 3N3MA 3OHMB 3DI0A 4S3GA 4A8NA 4EVZA 1H1ZA 4M3PA 3GU9A 1K9FA 4KCUA 4DJDC 3T0DA 1VF8A 2Q3OA 2YDRA 1VB9A 4I5XA 3AIQA 4MKNA 2WMFA 3P93A 3ITVA 2BY3A 1W1VA 5F2LA 1JZ8A 1ODUA 2G96A 4PMNA 5HANA 1HP5A 4C7FA 3PWGA 4IH3A 3ZXWA 1KR0A 5AC6A 4S3DA 1EIXA 2DH2A 1EYWA 3MCNA 3U2EA 3AIWA 5ABEA 3PTKA 3T2OA 1GVIA 2X0HA 3EWDA 2ICSA 1PKMA 3KVMA 2D20A 4HHMA 3IUIA 1ALDA 5FL1A 4NZCA 1TCMA 4DWSB 4E4PA 1UZDA 1FWTA 1PDZA 1LUCB 4L61A 4DF1A 1PX8A 1V51A 3ALGA 1TTIA 5LIWX 1C91A 1TQJA 1I2QA 1B3ZA 4HMDA 1Q7QA 2V0TA 2E0PA 3A13A 3EX4A 3OGRA 2XGBA 3S6OA 3G6LA 1Q85A 1CW2A 3DEQA 3N2CA 3LOTA 3A5FA 3VMOA 3W7KA 5HPCA 1KM5A 2QCGA 1U5JA 4Y90A 2ZZ4A 5DT5A 4FMVA 1IWAA 5CPNA 3ARWA 2ZXDA 2TAAA 2ZZ3A 1DIOA 3NEVA 4LC6A 3SCTA 5FCZA 4OBSA 2WCSA 4Z1YA 3GXFA 3QV6A 3YPIA 2GSJA 4UFIA 1LLOA 2VZSA 3WFLA 2PA6A 5TQLA 1W9UA 3QW3A 3W4RA 2NX3A 1KLYA 4EIVA 4U10A 1H5YA 2CCRA 3KTXA 2DSZA 3BC9A 2QIIA 1VPXA 3GYCA 4DXXA 5K7JA 4W86A 3TCEA 3VNLA 4PBGA 1GQIA 4G1KA 4M19A 2XFWA 3RPDA 1BFNA 4JX5A 3L9CA 1BKHA 2PBOA 1K8XA 2ALDA 1JZ5A 3MWCA 3ABXA 1AW2A 1CGXA 3ZR4A 4J40A 4L9XA 1TRDA 2F8QA 2XN0A 2F7FA 5C2GA 3I4KA 1QNOA 4UB9A 1FWWA 2CPUA 2J74A 3QHMA 4RX0A 1JPKA 2EF9A 2JEQA 3F4CA 4KRUA 3E0FA 2Q8ZA 4JTEA 1F61A 3KWXA 2ZRZA 3VMNA 2ONEA 3WH5A 2FHBA 3RIKA 1L0PA 1X6LA 1Q6RA 4H9TA 4D6DA 5A8OA 1XDJA 4E6MA 4IHCA 2JIWA 3TZNA 1XFBA 5TF0A 1XYBA 1U30A 1FWGC 4W88A 1A5MC 2CLHA 1PIGA 2D0HA 2QJMA 4U2YA 2A3AA 1RK6A 4RNHA 4YJ5A 3UWWA 3AS3A 2FH8A 4NAFA 4ADUA 2PDCA 3GUWA 3W26A 2XHYA 3FA4A 4WKHA 3NQ6A 4DWSD 1EP1A 2W66A 4JIQA 5HJXA 1PTAA 1MRQA 4JL2A 4JTGA 1L9WA 1G69A 3TN5A 2GOKA 1ADDA 1RZMA 4JYFA 2H90A 4JY9A 3MUZ1 4ROQA 1DEDA 3WLLA 1I2PA 1EFZA 4KWSA 4DWSA 4B5VA 1VIZA 3BOXA 1LLZA 4ZEPA 5IM51 4PFMA 4TU1A 2AAMA 3UFYA 3MUIA 4KRTA 1HKWA 1NP0A 3A4XA 3QGKC 1LBLA 3KTSA 4NZJA 2QS8A 3XINA 2HBVA 1LOQA 5C7VA 1K6WA 2Z1XA 3BJFA 3IAPA 1P4CA 3ID7A 3WQWA 4FXRA 4CNUA 1SJCA 2PEVA 1ICQA 3CV1A 3LMZA 1A5SA 2GWNA 2V5JA 4OGZA 1W9DM 1TUXA 4ZL1A 1PEZA 1HFBA 3VIKA 1TPC1 2E1WA 3ITYA 4O52A 4IPNB 4FNQA 3VOGA 1GONA 1W56A 2ISSA 4Z1BA 4XSMA 5H91A 2HCVA 4TXEA 3W73A 2ZVRA 2PDGA 2REQA 3I10A 3FS2A 3NO1A 1GKQA 2WM0A 1HKKA 2VKZG 4LQ1A 1C3FA 3B05A 1E0XA 3N2OA 1NIUA 3WNMA 2PURA 3STFA 3T78A 3AYTA 2DZUA 2XSAA 2V9DA 2ZRYA 3QV9A 5HQLA 4M29A 3BJSA 3L7RA 4LUSA 1VC4A 2QCMA 2FFCA 5EFDA 2EGZA 7CGTA 3RRAA 2J9ZA 5D05A 2C91A 1TELA 3BICA 5J04A 3N11A 1XLCA 3BG5A 4DELA 3E12A 1KLZA 4MTVA 2RDXA 5C7HA 3IJ8A 2AKZA 4OOUA 3F4WA 3UBPC 3PR2A 5AECA 4UTFA 3KVKA 3FEMA 5HK4A 3WH7A 5CXPA 3UWYA 3MS8A 1V8EA 2PWHA 1KXQA 1TWZA 7ODCA 3UPBA 5DQPA 1D8CA 4GUGA 1HTIA 4NZ1A 8RUCA 1AQMA 3WL0A 4HJFA 4LVDA 5I24A 4LS2A 3VFLA 5CJNA 3PPGA 4J2MA 2P0IA 4MKSA 1A5OC 1GQLA 3OA3A 4HPJA 3WQOA 1PKLA 4IP7A 3IUDA 4GCXA 3E74A 4CNSA 2ZE0A 1PHQA 5TNVA 3AMDA 3R8HA 2NX1A 1WE5A 3N1AA 1DQUA 4F9JA 2G4FA 3DFPA 2JF7A 2NXHA 4UTTA 3N6HA 2VGBA 3TTOA 3LPPA 4TQTA 3EWBX 4IQJA 2OO6A 2QV4A 4NQ1A 3WLJA 1R47A 3QYQA 3DYMA 5BRQA 3SY8A 4BWLC 4XUYA 3VPLA 3K46A 4WZHA 2VXNA 4RDVA 1OFEA 2OFJA 3FDKA 3GC4A 1HJXA 3ITTA 4Q6XA 4ILSA 1S1RA 3MJMA 3FFSA 1PB0A 3SM0A 2PCQA 4B3LA 1XX1A 3A6OA 3D5HA 3ZFHA 5FKYA 1NWTA 2TMDA 3W28A 4IIBA 3WYZA 2IPJA 4IQLA 3QLLA 3NVTA 2OOGA 1GYNA 4P7LA 3CT7A 4UTJA 1UPMB 5F4WA 4GUIA 3G2GA 3LPOA 1K8ZA 1X7IA 1AG1O 2DZSA 4MNKA 1P48A 5DRCA 3WQ4A 3WJZA 3D0CA 4GUHA 1AQFA 1F8MA 3THCA 5G1TA 3ALFA 4GXWA 3GYEA 1XM3A 2NSOA 3E0IA 3MANA 5AY7A 4AZBA 4HYWA 2IPFA 1QI3A 4R3UA 2CBJA 4JTQA 3ITOA 5A8MA 3SAZA 2HMCA 2Y7DA 3QMSA 3DBPA 4PYSA 1PHWA 3GAKA 5KINA 2JBMA 1BWLA 2BHUA 4GZIA 2X2GA 3REQB 2WB5A 2BOEX 1XG4A 4L1WA 4HOZA 1CLKA 1H41A 1KFLA 1UWAA 5HBFA 1S5TA 4DI9A 3RM8A 2AL2B 4FAMA 2C71A 1LOLA 1C9WA 2OZ0A 4W7UA 4BEUA 3RX2A 2Y4SA 2NX9A 1UKTA 2YL8A 1T8QA 5GJMA 1WX0A 4RDYA 1V6YA 3SCSA 5AC7A 4I6KA 1WDDA 2E67A 1DJWA 3V5OA 5AVNA 5LHEA 1SZRA 3BWWA 1EQCA 3KE0A 4V15A 2QCHA 4MM1A 3VDAA 3EOOA 2Y6ZA 3D47A 3FA5A 3OVRA 4E4FA 3BLPX 4V1XA 1XPGA 4HN4A 1TPEA 1B90A 4W7WA 1JQXA 2VX7A 3W6MA 1F4HA 4Y6GA 1BYCA 5FF0A 4GWEA 4NASA 4NYUA 4Y8EA 1SW7A 1ZBWA 4O1DA 2O92A 1W3HA 4GLEA 4HPXA 4LUJA 2YLLA 1IT0A 5FAJA 5F2GA 1A4MA 3P84A 3ZR5A 2WQDA 4HU3A 4M7SA 2CETA 3TFXA 1YPFA 3ABQA 2DT3A 1Y7VA 3SJNA 1WO2A 2X2YA 3A5VA 3RJXA 5C2XA 3OZYA 3WQCA 2WNQA 1NSJA 1XRTA 4A8IA 1GOQA 1EWDA 3HPSA 3W02A 3GSMA 1H1YA 3CZJA 4IX2A 1EJWC 4QQ3A 3TSDA 1OFPA 3VKKA 2HVOA 2YA0A 3FDGA 2FHCA 2ZFAA 3TAOA 4HU8A 5C9ZA 1V5XA 1V77A 4Z1CA 5LNVA 4NJIA 5CG7A 1R7AA 4C6DA 3VGDA 3UNDA 3BG3A 3IVTA 3W7HA 1FCVA 3WBXA 2H8ZA 4KFOA 4E4UA 1A3HA 3N4AA 1QW7A 2P5NA 1OYCA 4PL1A 3B9DA 1PZ0A 2BGQA 2PDFA 2XUCA 3IV8A 1GUVA 2J24A 4XAPA 3CU2A 4RJEA 2J8FA 1Q7ZA 1QWGA 4CCZA 2P3ZA 2GVEA 4HHPA 3CMGA 1M01A 1UA7A 4Y96A 5FJRA 4NZ3A 1Z42A 1GCYA 4F0KA 3VOHA 4MUPA 4H41A 5D2TA 1EP2A 3K5XA 2VFDA 1AD4A 1GHRA 1OFOA 3ME3A 4LU0A 3SCNA 3SUTA 2BV9A 1XGZA 2DUZA 5FF4A 3L21A 3UY8A 1M41A 4JHZA 3KOWA 1VFLA 3AROA 1AFSA 2ZA2A 3NDOA 5C2CA 1WAWA 1MVYA 2EKCA 3W37A 4GIRA 3XIMA 1CWYA 5C9XA 1XI3A 4PMQA 4R34A 1HO4A 1KQYA 1UH2A 1QHPA 1YBQB 3CHVA 3HPXA 4WEVX 3IANA 3OHIA 2B7OA 4JGDA 3H24A 3AZTA 1XINA 1EJTC 1HL2A 1B3XA 4Q33A 4A8LA 2PD9A 1RCOB 4KF1A 1UKQA 4PBFA 1OZMA 1UJPA 3MV11 2NXGA 3NNTA 2UZ9A 3MDWA 4K68A 2VOMA 1J01A 3UZJA 3VFCA 3NYZA 3P5YA 2PRLA 1H3GA 3U8GA 3WMLA 1C93A 3PS7A 1EP3A 1D9EA 2HS6A 3G24A 4BI6A 3GH5A 2OQLA 1F3WA 4W9TA 4C7GA 1MQQA 1KM0A 2IKGA 1V3JA 3LCLA 1Z48A 2DH3A 3WK2A 4K8EA 1R2TA 3PK7A 4YCOA 3AUJA 3L4VA 2WPGA 2BOFX 1UWSA 3AICA 4JYEA 4J3SA 4ALDA 3ZT5A 1Q6LA 4A35A 1SFLA 1KV5A 1WKEA 1US0A 1MW1A 1X98A 1TV3A 2GGHA 2QQ6A 1KQZA 3W2KA 3IK2A 4NVTA 4NX0A 2YYTA 1ZCOA 2J7GA 4HNCA 1G1YA 1OC7A 2VZVA 3NXFA 1SMAA 3P74A 3QLDA 3RU6A 5FESA 3C0SA 1UD8A 2CXEA 3K8KA 1US3A 3CV2A 1RY8A 5G4EA 1HJUA 1E15A 3F1QA 4KWWA 1X1ZA 5JH1A 4DWSC 1AH3A 2BVDA 4G9PA 2X42A 4OUEA 1A50A 4RE4A 5C9UA 3BTNA 1DBTA 4A21A 4CQDA 4UMBA 2AQOA 2ZVIA 1PZ1A 3HJZA 5K4ZA 4L6OA 3EOUA 3VNJA 1V93A 3W7QA 3NSMA 2RHGA 5ABTA 2CYGA 2YW4A 4PMUA 3W7NA 2CWNA 4QIUA 1IWPA 1XLBA 2PTZA 1XBZA 4ZOCA 1YTEA 4DWDA 3ANYA 2HSAA 1JFHA 4UNKA 3LHWA 2WV8A 4JIIX 1XLGA 3BV7A 3M43A 3MSDA 3T0CA 4JKLA 5A6JA 4B4HA 3ATYA 2YBTA 2G3IA 2V2DA 1NOWA 3FJ6A 3RU8X 4H7CA 3RHGA 5A2BA 3K1DA 4HTYA 4QHRA 1FWIC 4OZOA 1C29A 4JNMA 3M46A 4P61A 4PEEA 1Q2SA 2XFRA 4D6IA 4CQ9A 3DGRA 3SGGA 1EOKA 2QCFA 3M07A 4ZO8A 1LL4A 2CLOA 2TODA 4H3DA 1ZHAA 2OU4A 3G3MA 5EA9A 3CNYA 2QCDB 3USZA 3CUJA 3S42A 4UNLA 1A5CA 4RDWA 1EF2A 4JN6A 3VGGA 1PX3A 1DJXA 5A6SA 4D1IA 1P7TA 3TQPA 5DCDA 2ZWZA 5ECVA 4PRWA 4MAZA 3VM5A 3WLTA 1Z89A 3CL6A 3HGJA 4JQ3A 3VCNA 4UTKA 4O53A 3UZ5A 2C79A 4DYKA 3B0YA 2DT2A 3LI1A 5B7YA 2CKSA 3LTYA 1OK4A 3SI9A 1F8IA 1UHVA 4GX8A 3NTYA 1QAPA 2OLHA 3OP2A 4D72A 4FOUA 3C4UA 5H8MA 1VYPX 3GKAA 3CPUA 4FOKA 1TKKA 3BGJA 1KM3A 1DL3A 3VI2A 3EXSA 1XSIA 3U5UA 3GIPA 3P82A 3VUSA 5FIPA 2FMOA 4UQ9A 3E38A 2J8TA 3PTDA 4Q8QA 2Q02A 5G5IA 2CBUA 2DZBA 4CLMA 1RJQA 1JPHA 1TJRA 3HG4A 1L6FA 3PN8A 3V18A 1XCFA 5AC4A 4FPSA 1G5AA 1SZEA 2WBKA 3TFCA 1G4TA 1MW2A 3IS4A 3TA6A 4NJ