4ADSA

Crystal structure of plasmodial plp synthase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
DYADNDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase/transferase
total genus 98
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4adsA00
2RFGA 4WJEA 2OJPA 1LTDA 2PE4A 4OQVA 1WBJA 5F4WA 4A2SA 3MW7A 4O4WA 3BLIA 4AWSA 3RK8A 3QSTA 3MI2A 3M0ZA 1NVMA 3HG3A 1A53A 1WBHA 1QPQA 1L6SA 3W1RA 4RZ4A 2RHGA 2ZQ0A 3AJXA 1S5VA 1W3IA 4AHQA 3BG9A 3C52A 1QCWA 2C1HA 2NV1A 3BLEA 1W8SA 4UFLA 1ME8A 3HBLA 3S8HA 4O11A 1ZCOA 1YXCA 3NGJA 3PWAA 1WOBA 2WO5A 2QJGA 3LCLA 4CNOA 3W7PA 2V9DA 3HF3A 3MYOA 1UASA 4A22A 3EWUA 1N55A 1LCOA 4H3DA 4LRTA 1SO4A 4Z0SA 1T8XA 3G1DA 4Q4KA 4U4MA 4RKAA 1W37A 3DHFA 4UTIA 5U7SA 5AHMA 2Y62A 4ZQCA 2QAFA 4DXVA 5AHNA 2DZVA 3UNDA 5FESA 2TRSA 1F6PA 3LI1A 3VFLA 2HS6A 4GUGA 3UY7A 4JX4A 4UNKA 2FDSA 3S9YA 1P0NA 5FI8A 3N2XA 4TIMA 3LHWA 2CWNA 4N9BA 4BI7A 1ZNNA 3PVFA 4ZQPA 2Y7GA 2EKCA 3W6YA 1VRDA 2E6FA 4B5NA 4GUJA 4O16A 1OK4A 4K37A 1JRBA 3W7QA 1SW3A 1H62A 1LLWA 1XFBA 3LERA 1QMLA 1TQJA 4HIBA 2NUWA 5HNRA 2C13A 1UUOA 2F7FA 1KFLA 3G1YA 3LLDA 5DCBA 1T0OA 1EEPA 5AN7A 4AWTA 2DZXA 3VNDA 4AHOA 2OCZA 4JYDA 1R47A 3L2IA 3O63A 3G1AA 4MY9A 3IVTA 3E96A 3ABOA 4PC8A 3KOFA 3V1PA 2V30A 4UFKA 3TKFA 1IIGA 3RLVA 3GLCA 1O5XA 3DI0A 1TJRA 2VENA 1JCMP 1Y0EA 3STGA 2FPYA 3FLUA 1GJPA 3W74A 3O05A 3P62A 4N2YA 5LNVA 3NQVA 2W0UA 3ATYA 3HGJA 1KM5A 1XBVA 3P82A 3S6DA 3PBWA 3LM7A 3RNDA 1GYNA 2FQIA 3L0NA 2Y63A 2WSRA 2ZRXA 4NZJA 3TU9A 5DY3A 2C6QA 5GVJA 4ONVA 3THAA 5IBXC 4ORIA 4QQ3A 1KV8A 4YXGA 3I7RA 3DFTA 1SR9A 1W5MA 2J9XA 3G1XA 4XBKA 1S5TA 3R5EA 4UTWC 4ZL1A 3M5YA 2Q8LA 1J4EA 1T99A 1VS1A 1WYIA 1AW2A 2C0AA 1LBMA 2NUXA 4NU7A 1K7FA 4YWIA 4CQ8A 5G4EA 1NAL1 3WJSA 3SI9A 1RZMA 4IPIA 5F1UA 3EKLA 1JVNA 4GUFA 1KFEA 2V81A 3STEA 2E5BA 4WY0F 1K7EA 4QAIA 2E6DA 5HJLA 4OWGA 4NX5A 3W7HA 2CU0A 4ADSA 1PCWA 4JTLA 1P5BA 2Y70A 4JTKA 3S42A 3L0KA 1EIXA 1UBSA 4FX6M 3B05A 4I9AA 1KM4A 4HSOA 4NT0A 4YMZA 3QQ0A 4ZVJA 3CIWA 3TK7A 3TDFA 2WQPA 4GJ1A 3KAOA 1KFJA 5FF7A 1VHCA 2H8ZA 4DF0A 3W7JA 2DZTA 3W83A 2BZNA 3LTSA 1TTPA 3S1UA 3N9RA 3L5AA 4OHQA 2TSYA 1ZENA 1XI3A 4RV8A 4FNPA 3TV8A 4I7WA 1OYAA 2XN1A 1DOSA 1JUBA 1RQEA 1LZOA 2ISSA 3LCIA 3QW3A 4IXXA 4RK8A 2B7PA 3UQNA 5D03A 4XUGA 5HMSA 1C29A 5HINA 2A4AA 4O1AA 1SO3A 2A0NA 1X7FA 5L6UA 4S2BA 1LDCA 2J88A 1GVQA 3LBMA 1K02A 1KTNA 3E49A 3EWYA 2A5HA 1EP3A 4AAJA 5FF0A 4HN4A 5K3VA 2QEZA 4PCFA 2VC6A 3MO7A 1J5TA 2CLOA 1OJXA 5MHBA 2DP3A 4TU1A 4HNUA 2ISWA 3NVTA 4O50A 3W7IA 1SQ7A 3I6RA 4K38A 4HSNA 1LM1A 1QPNA 4JTSA 2GJLA 3W75A 3TFCA 3UWZA 3PS7A 2CZFA 2E6AA 1PIIA 1SW0A 5LNWA 1DL3A 1ZJIA 4LVBA 3W85A 4LS0A 3HGOA 2CLLA 2GPTA 2ZBTA 4DQWA 5AFDA 4O8RA 3W84A 4Q32A 1TV5A 3QMTA 3GKFA 3RF9A 5F4SA 2VFGA 1QO5A 3P61A 4NXSA 1S3HA 3E12A 4BWLA 4E0CA 3L66A 1R2TA 4MYXA 3NPUA 3MI3A 5AHIA 5EA9A 4FNSA 1K8ZA 1WQ5A 2Y7DA 5EBUA 1XBZA 3TXVA 1Q6LA 3HPXA 1EPXA 1VCGA 1DQXA 2R14A 3IIXA 4N4PA 4DF2A 4LU0A 5AYZA 1ALDA 1M7OA 1OX4A 2E68A 1B9BA 4QNWA 1K3UA 2FB3A 3LI0A 3H54A 1Z42A 3FOKA 1OHLA 1H5YA 3SGZA 3TSBA 2AAMA 5CZSA 5D04C 4UTTA 3HB9A 1JCJA 2X1TA 3QPYA 1FWTA 3KRZA 3W7DA 3GDKA 3O16A 1FWWA 4IWWA 1ME9A 1X1ZA 5DBUA 2VEKA 4HNVA 1OFAA 1N7KA 3UPWA 3GKAA 3U6WA 1H50A 4XWUA 2CLEA 3STFA 2J27A 3PB2A 5LNRA 2ZDRA 2IQTA 3P81A 3A24A 1RPXA 1LP6A 3PUEA 4KWVA 2TMDA 4PEKA 1QOQA 5KITA 3A5VA 3G1SA 1LRNA 3MP3A 5LZLA 3UWWA 1SO5A 2ABBA 2R94A 3W86A 3N34A 4RX0A 3GXNA 4FXSA 1FDZA 5DXYA 3GB6A 3W07A 4A3UA 2NX3A 4M6VA 3GDLA 4Z0JA 1U5JA 3TR2A 4EF8A 3MP4A 3KVJA 5HWMA 1TV7A 4E2DA 1VYPX 4X22A 3EWXA 3TQKA 3W70A 3IGXA 3P5YA 4UTUA 1JCNA 4OV4A 4CCDA 1ZALA 1NSJA 3P5ZA 3FS2A 3EX4A 1SSDA 3IIVA 4QIUA 4LC6A 5C6MA 3LXAA 3B0PA 2FFCA 3FIGA 3M7WA 3HMJG 5F2LA 2PCQA 1OF8A 5AC8A 4LVFA 1GTHA 4KFPA 2BWGA 2Y61A 3KRSA 3G0XA 1W5NA 1O95A 2YSWA 4FIRA 1OK6A 1QNVA 2ZRYA 3L5MA 4GFSA 3IIZA 1PHWA 1JRCA 4JR5A 5CZTA 3PBYA 4CNPA 1G7UA 5AB3A 5DXXA 3TW7A 3M16A 3PR2A 5G2HA 3TIMA 3QPZA 2H3DA 2Y89A 4DBDA 1AG1O 5D37A 1OFEA 3NG3A 5EKYA 1I2QA 2RKXA 2QF7A 3W1MA 4M19A 5KTLA 4LV4A 3PF3A 4XQ6A 4R7JA 1FQ0A 3D0CA 3F4NA 2PURA 1GOXA 1VLWA 3S0CA 3S1XA 3LB0A 1TTQA 3R89A 1CI1A 3A9IA 3G3DA 3NQCA 5H2ZA 4Y90A 2E5CA 4I7UA 4LVGA 3PY2A 4GC4A 2PRMA 4LV9A 4M5PA 3HO8A 3FYOA 3OHIA 1JCLA 1ICQA 3GNNA 3PBUA 3G24A 4O28A 2QCDA 4EOUA 4OBTA 3LBCA 3LCFA 4JTUA 3B03A 4ICNA 3W7NA 3WFAA 3TC7A 2JKEA 2EHHA 1GVRA 4RZ6A 5KINA 3EKZA 3JRKA 1O4UA 1PE1A 3DXIA 4I7VA 5E0KA 3BW4A 4MVAA 4N02A 3S1VA 4WXZA 1SUXA 2PRHA 3NQ6A 4A21A 3ABRA 2VFFA 5CPOA 5AHFA 4OU1A 4E38A 1TPB1 3CT7A 5D33A 2FLIA 1F2JA 1HO1A 2QCDB 1ONRA 3LCWA 4GXMA 1J2WA 2JGQA 5LSMA 1Z44A 3GVGA 4IX2A 4WY0A 1TB3A 1VR6A 1KFCA 3R12A 2WJZA 5D2YA 1WX0A 4O18A 5KSWA 3HGRA 1MZHA 1MSSA 5FF2A 3VKJA 2DZPA 1V5XA 2DJXA 5D38A 2NXGA 5G4WA 2ZRVA 1RVGA 3TH6A 2B7OA 3EWBX 4AB4A 4UUIA 2C15A 4WY0B 1F73A 1HUVA 2ZZ6A 2XN2A 2J6XA 3W1NA 4MYAA 3CC1A 1W31A 4WD0A 1K7XA 3BGGA 3KVLA 4MJZA 3Q94A 4CNNA 1O94A 4XZ9A 1OFBA 2O7QA 2R8WA 3NQ7A 2W79A 1OX6A 4AWUA 1Q3NA 5C2XA 3SFKA 2ZZ7A 4W9TA 2VEMA 1LORA 4Y6GA 3L0GA 1P0KA 4BF9A 2X1RA 4ORMA 4BK9A 3CPRA 3UWQA 3NM3A 1L9WA 1YTEA 2C14A 1F05A 1R2RA 4N6FA 3EXRA 2FB2A 5AC6A 3OVRA 4FNTA 2E6YA 3DI1A 4QISA 1TPWA 2WOQA 5EL1A 3OA3A 1XKYA 1YXDA 3T78A 1NF0A 4JD4A 2C18A 3Q58A 4XTDA 1TV8A 5EYWA 3TQVA 1KA9F 2DZSA 3W1PA 3E02A 5LHEA 1F7BA 5C55A 4AXKA 3BGJA 3DFQA 3GYEA 3CB8A 4KFNA 1W56A 4UTMA 3EX6A 1HTIA 1AW5A 4NJJA 3BPWA 1ZAJA 1TREA 2OX1A 3EXTA 3NO5A 4IMEA 5D02A 3R8RA 4PODA 4AH7A 1M6JA 3B0VC 4NZFA 4ADUA 2GQ8A 3LTPA 2PRLA 2Q3RA 2I14A 2VFHA 1EUAA 3B06A 5T26A 4IPJA 1VHNA 1OFDA 3P84A 1AL8A 1XBXA 4IMDA 1SZEA 4A2RA 4BI6A 1MXSA 3NQAA 1W54A 3W2LA 4RZ5A 1GPWA 4WZHA 4FHAA 3G3MA 4JTEA 3GR7A 3NOEA 1H7WA 3RLUA 1KFKA 5K2ZA 2YYUA 3NL6A 3W7KA 5A5WA 1YPIA 4Z1CA 4MZYA 4O1DA 3W88A 1D9EA 3NQFA 4HNNA 4UTTC 3T40A 3M9YA 5KMYA 1DQWA 3F1QA 2D73A 1VJIA 4JYFA 3DHDA 4MJMA 2V2HA 4FNQA 4CCCA 2JGYA 2Z2UA 1EA0A 3O6DA 2YFOA 3TMQA 3P8JA 3SECA 2P1FA 3MMTA 1LBFA 1GVSA 5BMXA 4NJIA 1R30A 2CLKA 1A5AA 4IMGA 4QM1A 4ZQOA 3NQ8A 4FX7A 3UPBA 3WJXA 3L21A 3BO9A 4GBUA 1LOQA 4TX9A 3MJYA 3CTLA 4LY8A 2FPTA 4DELA 4JIPA 4RXGA 1EUNA 2HS8A 5LNUA 3OEXA 3NNTA 1I45A 1F6KA 3G1HA 3QMRA 4X3ZA 1EB3A 4M6PA 2CLIA 2AQWA 4LOCA 4NJGA 3GXPA 4FIQA 4MY8A 3W1UA 1BWLA 4M7TA 4TMCA 1JCYA 3K30A 3IGUA 4Y9AA 3G0UA 2Y7EA 4UMBA 4D2JA 4X2RA 1XBYA 1WOAA 4OGZA 1D3GA 5L9FA 1H61A 2ZTJA 4YCPA 5E1QA 2RDTA 1SO6A 2VOMA 3WK2A 1QPRA 2RDUA 4JTHA 3W2UA 5CGQA 4MZ8A 3LDVA 1F5ZA 5G2IA 3UZ5A 3VCRA 1SFJA 2BX7A 3KVMA 4IMFA 3DENA 3CIXA 3EX2A 1H60A 1G6CA 3HG5A 4JN6A 1KBIA 3KVKA 5HUPA 4JY9A 1ZAHA 4JTFA 4K8HA 4Y96A 4JS3A 4EVZA 3EWZA 4JYEA 3C6CA 4C1LA 1GTEA 2DZUA 3TC6A 4TO8A 4JTIA 3BLFA 3ELFA 5F2GA 1MEIA 3W2NA 3FKKA 3P80A 3B4UA 1OFPA 2JBMA 3MHGA 3S5OA 2ZA2A 4UR7A 4IUOA 5HQEA 4XTIA 1JUEA 3QRHA 5TIMA 3TW6A 1SW7A 1IXOA 2ZZ3A 3NQGA 4NNCA 3DKJA 1KM0A 1WXJA 3W9ZA 4L4MA 2NXIA 4KWWA 4AHPA 3HOJA 8TIMA 3P8IA 3CHVA 3TFXA 4PL1A 4AMAA 5KZEA 3BW3A 4O1CA 3THQA 2TYSA 3LRKA 3PSVA 5HR7A 1CW2A 4HHPA 2QR6A 5TQLA 3GDMA 2ABAA 3C4UA 2A1YA 4O52A 2YCEA 3WJWA 2QCLA 4JDYA 1YLVA 4LWWA 4NXKA 2I1OA 1PV8A 2WV8A 3T55A 3W73A 1R46A 5K7JA 1EWDA 1LOLA 3GX9A 3TUUA 4Z1DA 1ME7A 5F4XA 3W2MA 4K7VA 5E93A 1UB3A 3CEPA 4JX5A 4NQ1A 7TIMA 4RXFA 1VC4A 3QMSA 3S5ZA 1FDYA 5I3IA 4LVDA 2VEPA 4WOQA 3WJYA 2BSLA 1KFBA 2X1UA 1XDMA 1BKSA 5U4NA 5FEPA 2Q8ZA 1NF7A 4QSHA 4JNMA 4Q33A 2Z1BA 1V7YA 2V2CA 3CLMA 4RJEA 1H51A 3EB2A 3NQDA 3TSDA 1ICPA 2YW4A 1AMKA 4JEQA 1WV2A 2Z0IA 2CLFA 3SSJA 2Q3OA 4PH6A 3JS3A 2ZFAA 3FFSA 4O17A 3TJLA 1YTKA 1P4CA 4NNAA 4NJKA 1JCXA 3L67A 1F76A 2YPIA 1HFBA 1K8XA 5SWUA 3H53A 3LHVA 2B4GA 1TPUA 1LRTA 3M41A 3MP5A 4MUZA 3CWOX 2A7RA 1SFLA 1OFRA 5H91A 2H90A 4UFMA 2Y88A 3L65A 3S5YA 2NWRA 3NL2A 3O06A 4Y8FA 5LNSA 3L9CA 4KFOA 1VYRA 3HG2A 5HWJA 4WX2A 2OMAA 3FA5A 4RR4A 2ZRWA 2C3ZA 2VXNA 3RFAA 3AO0A 3HQ1A 3HG4A 2RDWA 2GVJA 3FYPA 1IF2A 1OX4B 2J9ZA 3P74A 1W0MA 2B7QA 1TPC1 1F74A 2E1DA 3DFSA 1EX5A 4MZ1A 1L6WA 1MEWA 3HPSA 2QCMA 2FJKA 3M5VA 3SW6A 1VCFA 5EY5A 3N9SA 3KXQA 4O1BA 3I65A 1KTBA 3MWAA 5F2MA 4IGHA 3TX9A 5K9CA 3UWUA 4K39A 3M1ZA 1VCVA 4O13A 1C8VA 4K8EA 4JY8A 1SSGA 3S1WA 2V8ZA 4S1FA 1YYAA 2CZEA 5IBXA 1JUKA 3GNDA 3PB0A 3DKLA 1LRQA 3GXTA 4AF0A 1AW1A 2QCHA 1W5QA 1AK5A 1H7RA 2ATSA 3NZRA 2ZZ4A 1ZY9A 2XFWA 5I3JA 2X16A 1XXXA 1G4TA 1QR7A 3TAOA 4X9SA 3TA6A 6ALDA 1YADA 3C8FA 5K9XA 1XC4A 3C2FA 3LRLA 4MY1A 1G4SA 1FX6A 3ZWTA 4FX8A 1C9DA 2WNQA 4N9DA 3PC0A 1B4KA 2LLEA 1Z41A 3FKRA 3MBDA 2GVGA 4DBEA 2FPVA 4L4LA 3P60A 4R53A 4IMCA 4OV9A 5AHEA 1KV5A 3KRUA 3LOTA 5G1TA 4GWEA 3G1VA 1BWKA 3B0UX 1CX9A 2JKAA 4R33A 3LHTA 2HTMA 2JK2A 1WDWA 2GQAA 3W1AA 1GZGA 5FEZA 6TIMA 1G4EA 1DBTA 2QAPA 2YX0A 1LOSA 1OABA 3C0JA 4O54A 3CQ0A 2QKFA 1PHQA 1N8FA 1XUUA 5FEWA 4GRSA 2ZYFA 3C2OA 1ZAIA 4BFAA 4UTLA 4YL2A 3OIXA 3SR7A 4NNBA 2EAWA 5AYYA 3LCGA 2V82A 4TMBA 2VFIA 3FJ6A 4GE8A 4UNLA 4N4QA 4DF1A 2YR1A 3QJAA 3NQMA 1KM3A 2G97A 4C1KA 3B8DA 1ADOA 2ATMA 3NR0A 4O0ZA 2R91A 4DEFA 3UD6A 1B3OA 2XN0A 5K4XA 1K8YA 5CZ0A 3W2JA 1I2NA 1TO3A 4H4IA 5FEXA 3W7RA 4BR1A 3LHYA 1OX5A 1HO4A 3TSMA 1TPH1 1LYXA 5LGZA 1TYGA 4UC5A 2CZDA 1IXQA 1YXYA 2BTMA 4O12A 3EX3A 3ZWSA 4GNJA 3T7VA 1VYSX 1GG1A 5I3KA 4BI5A 3MHFA 1VQTA 2Z6IA 2ALDA 4Z1BA 3BV4A 3OVQA 3HPZA 3UYCA 1OFQA 5C5YA 1P1XA 3DFNA 4LW7A 3ANYA 1THFD 2Y7FA 3I68A 4NVTA 5EMUA 4FF7A 3VE9A 3EEGA 2VKZG 3O1NA 1KBJA 2P0OA 3MYPA 4MIMA 1I2RA 2GUUA 3LV5A 1SU5A 1QAPA 1OYCA 4JTJA 4R34A 1TPEA 1TCDA 3W7EA 1KM1A 3TMLA 1H7NA 1ZHAA 5AHLA 1H7PA 2C16A 5CPMA 1QDSA 2CFFA 3C2EA 1A5SA 3VI2A 3C61A 4LRSA 3IVUA 3CWNA 1XL9A 1R2SA 4GUHA 1HG3A 3TCEA 1YPFA 4QNEA 3C56A 5AYXA 2DORA 1SZFA 2VELA 2C19A 1E51A 3WK3A 1M7PA 4MFEA 3N2MA 2ZZ5A 4O57A 1OFOA 3F03K 1KW1A 1GG0A 1UJPA 3EWWA 3IIPA 3TXZA 3G22A 3GZ3A 1KLYA 1L6YA 3BVJA 5EPDA 2QUVA 1VGAA 5AOUA 1DVJA 1W3NA 3QYQA 5LHFA 2WNZA 1YDOA 4CQAA 3NQEA 3TAKA 1QWGA 1A5CA 3INPA 4EIVA 2ZCGA 3UZJA 3KHJA 3NXFA 2NV2A 3L5LA 4CLMA 1TMHA 3N73A 3UXAA 1XUZA 3WJZA 1TRDA 2WPBA 4PA8A 3W72A 1Q45A 2CW6A 3O8AA 1SZGA 1YTDA 3W22A 1TPDA 4FO4A 3R13A 2GOUA 3CEUA 1VLIA 3M44A 2PC4A 2ISVA 2ZRUA 5D30A 4CQ9A 3W87A 1YDNA 4BWLC 3EX1A 1EP2A 1OG0A 3W1XA 3PSWA 1GVFA 2QUUA 4EF9A 1GWJA 2Z6JA 4Z1AA 3DZ1A 1FCQA 3BK0A 4MKNA 1TTIA 4TR9A 2BLEA 1VZWA 4KKXA 5KZMA 2YXGA 1WAUA 4ZMGA 1KLZA 3IGSA 3JR2A 3G0SA 2OT1A 3FJLA 1BEUA 3TROA 5CSSA 4JGDA 3SGUA 2GJNA 1QFEA 3W1QA 3E0IA 3EXSA 1LROA 3G8EA 3PUOA 5CSRA 1W5OA 2CZ5A 4ZQMA 3LV6A 2QJIA 1GT8A 3HGSA 3NA8A 4UTKA 2NX9A 3A21A 2QDGA 4K36A 3PM6A 5DCDA 2GQ9A 2P10A 3W23A 4DPPA 3QM3A 4UIOA 1O5KA 1H1ZA 2QUTA 2EGZA 3DBPA 3I7SA 1JQVA 4O15A 4RCXA 3IRDA 3TJXA 1T96A 3TE9A 4HPXA 3QEZA 4IXHA 4UFJA 4P2VA 5F2IA 4PTNA 5I3HA 4UMAA 1QOPA 4AVFA 2QCFA 4LS1A 3LCXA 2FTPA 3VE7A 2H3BA 2V2DA 3QSRA 1S5WA 1BTMA 3I7QA 1KTCA 2X30A 4O14A 4ZQNA 3ATZA 1JQXA 2EF9A 3R2GA 2E5DA 3QC3A 4LC8A 3ZS4A 2KZHA 5G5IA 1PL9A 1RQBA 2YZRA 5F1VA 3HIJA 2OZ0A 2DU2A 1DHPA 1EP1A 4WQ6A 3KX6A 1DJQA 1DKWA 1LBLA 5KZDA 5D2VA 1FXQA 1KM6A 3WK0A 2JKPA 4O53A 1AL7A 2YW3A 1RV8A 1A5BA 3STCA 3SJ3A 3GK0A 4IQLA 3UXDA 5C54A 3UY8A 4UMCA 4A29A 4FB7A 4GUIA 3LXCA 3ABQA 4O10A 5DN1A 4YCOA 5HWNA 1NEYA 1H63A 3PG8A 4J9JA 3F4WA 1XCFA 1Q6OA 1FUYA 3PUDA 2J9YA 3DU0A 1JJKA 5D2TA 5LGXA 4POCA 5DELA 2CLMA 5IM51 4EWND 2ZTKA 4JTGA 5BNKA 3QF0A 3W7CA 4IX0A 4FXRA 3M6YA 2A2IA 1TPFA 3NQ2A 3NPWA 3M5ZA 4IOTA 1ZFJA 4QITA 4UFHA 3NDOA 1MEHA 1TJPA 3QW4B 5K4ZA 3CU2A 3QZEA 3ZFHA 3LCHA 4JXCA 1G4PA 5FF3A 3FEMA 3LGEA 2BXVA 3SZ8A 4MFDA 2VEIA 5J5DA 2DJLA 1TSIA 4JDBA 5HULA 2YGYA 5CG7A 4PFMA 3CM4A 5D09A 2QJHA 4AEOA 5DLCA 3NZ1A 3GIYA 4WOZA 3MUXA 3Q37A 4E2BA 5FF4A 5I3GA 1UCWA 3NL5A 4JTTA 3T44A 1SZNA 4LNYA 3H55A 3DAQA 1UUMA 3PAJA 5LKYA 3DGRA 1DV7A 1TRIA 3UWVA 1JULA 2QCCA 1FDJA 5DY2A 2V0TA 4HNTA 2A21A 3BG5A 2NUYA 4LVAA 1ML1A 1Q6RA 5D2XA 3RU6A 4FNRA 3A22A 2NX1A 4DPQA 1G67A 4K6AA 1Z48A 4HPJA 1W3TA 3E9AA 4JIQA 3LRMA 3PG9A 3SIZA 3NM1A 4MLJA 4UXDA 4WUIA 1OYBA 2NZLA 4ALDA 1RR2A 5BW6A 3BG3A 3N3MA 2ZA1A 1I4NA 2X2GA 1GYLA 3DFOA 2NWSA 4UR8A 3GDRA 1L2UA 4JX6A 4LUIA 3OG3A 3ABSA 4ZZ9A 2H6RA 4N9EA 3GAYA 3USBA 4UTHA 2QCNA 1W1ZA 3HJZA 4XKYA 5D2WA 3W1LA 3DFPA 3NPVA 2AGKA 5G1YA 3NYZA 3W71A 3U2OA 2V5LA 1FWRA 3G1FA 5CZJA 1RD5A 2UV8G 1FWNA 3IEBA 2QCGA 5BRBA 3C2VA 4UTJA 4UCGA 3A23A 3L68A 1TPVA 3T4CA 1TQXA 3LHZA 2DZWA 4XBSA 1YDVA 4OT7A 3O07A 4XKYB 2E09A 3Q2DA 1PCKA 1IXNA 1RQHA 5BOOA 2A7PA 2YDAA 4OE7A 1FWSA 1O60A 4O4VA 4Z08A 3M5XA 3LHUA 2X1SA 5TBOA 3W1TA 1FXPA 3W7MA 2YFNA 3W2KA 1IXPA 3NAVA 1PS9A 1FCVA 2A6LA 4UTWA 4LT9A 1GQNA 1M5WA 5D05A 2Y85A 4DO4A 1QPOA 1ICSA 1LLZA 2GVLA 2B0MA 3M47A 4S2CA 3MI6A 4HT3A 3P67A 1MO0A 4YLWA 1H7OA 1SPQA 4NUWA 5A8GA 1HL2A 4LUJA 2Y6ZA 4QJ1A 3MBFA 3PULA 3W3OA 1W5PA 3GDTA 4MLRA 3G8RA 1WA3A 4G1KA 3LXBA 2VFEA 4CCEA 3IIOA 4AF0B 3LX9A 2WNNA 4ADTA 2RH9A 3BW2A 3PBVA 3IVSA 3MHUA 1H1YA 4P61A 3UWYA 1OVDA 2H8XA 2G96A 3W7GA 2WSQA 1VH7A 1FBAA 2G95A 3S5NA 1IIHA 2J24A 3ZR4A 4HKPA 3W7LA 4LTSA 4M7SA 3KFTA 4N9CA 3NPXA 4U28A 4ZQRA 3O6CA 3QQ1A 3V75A 3W76A 2A85A 2WSYA 3RMJA 2QCEA 5CPLA 3IV3A 1TIMA 1I2OA 1FCBA 1U83A 3U8GA 1TTJA 5J5RA 3QH2A 4UFIA 1I2PA 3GR8A 1B4EA 1G69A 3M43A 5CKSA 3NL3A 3P7YA 4MOZA 5CPNA 1XM3A 2O7SA 1I8JA 2W6RA 2NLIA 2VFDA 1QO2A 2NXHA 4O19A 3WK1A 5I3FA 1GVOA 5HUOA 4IJBA 3O6YX 2OT0A 1IGSA 4MPQA 3QFEA 3O15A 4M6QA 1KM2A 3G18A 1GEQA 5D32A 5G2WA 1G7VA 1X1OA 2TPSA 4RLIA 5DBTA 2WKJA 3OVPA 2ZRZA 2ZZ2A 2A7NA 2V5BA 1Q6QA 1DORA 1X8FA 2CLHA 2E77A 3N19B 4LS2A 2I9EA 1K03A 1JR1A 4N6EA 4DO6A 1EWEA 1XDLA 4K7YA 2HMCA 2QDHA 5AC7A 3W7OA 5BMWA 4O0KA 4JICA 2YYTA 2ZA3A 2ZZ1A 5HR6A 3SY5A 4NJHA 1OF6A 2B7NA 4FNUA 3DH7A 3GAKA 4FEZA 3N14A 1H7XA 3YPIA 3B04A 2HSAA 2G5WA 2A6NA 3C2RA 2FIQA 3BARA 1D3HA 5DCEA 2F84A 3NEVA 4PL2A 1B57A 4NX0A 5K9DA 1X6UA 3TNOA 4H6KA 1DJNA 2EPHA 1FY6A 4WXYA 1A50A 3LTYA 4ML9A 3OBKA 4DO5A 5ABTA 1VPXA 3A5FA 3LLFA 1FCUA 3TQ0A 1PVNA 3C3NA 1NFBA
chains in the Genus database with same CATH superfamily
3KRBA 4WJEA 2OJPA 3N2BA 2O4QA 2SFPA 4XAZA 5D4YA 3TOPA 3BLIA 3UJSA 2C1GA 3R0UA 1XRVA 1NOFA 4GJJA 2XIOA 1XV8A 3ZYZA 5HDRA 3GWQA 1S5VA 5JBEA 4FLOA 1UOZA 1QCWA 2VRQA 1QT1A 4UFLA 1S2TA 4YWSA 1LUCA 3POHA 3KEHA 3S8HA 5LIXX 3NGJA 3GTHA 2JQXA 3IUHA 4CNOA 2X8RA 2X09A 1DYSA 4IIDA 1TVLA 4P8XA 1N55A 1H4PA 5FJIA 4LRTA 4Z0SA 4Q4KA 2CHOA 4RKAA 3DHFA 2QAFA 4DXVA 4DI8A 3WO8A 1W8GA 3APGA 4GUGA 3UY7A 4UNKA 5CQ1A 1P0NA 2DSVA 3UXLA 3H2EA 4ZB0A 1TCMA 4KGJA 1SMDA 4B92A 3M0LA 2ZXQA 4PMYA 4ZQPA 3QR1A 2EKCA 3M0IA 2E6FA 2VD8A 3WBWA 1XFBA 4AMCA 3URQA 2I17A 1UUOA 3LLDA 1KFLA 5E9AA 3ARVA 3AI0A 4MB3A 1VKFA 1VEMA 2YA1A 1AFSA 3VNDA 3UG5A 3UETA 3NZGA 2OCZA 3U5YA 2OSYA 1UJQA 3ABOA 1ITQA 3C0LA 4BHYA 1FH9A 2R1PA 1ISXA 1X6NA 4Q22A 3AIWA 3L4VA 1CGXA 4QGCA 2VENA 1JCMP 3PWGA 4GYPA 3A64A 2HPIA 3FLUA 4YNGA 3W74A 2W0UA 4MWAB 2VNCA 3ATYA 1XBVA 3FGCB 3S6DA 4XZLX 2FQIA 1ONEA 3L0NA 4X0NA 2WSRA 1KXTA 3TU9A 5DY3A 2C6QA 1HKMA 4ONVA 5IBXC 4ORIA 4QQ3A 1HW6A 4AZ7A 5CH9A 2FHBA 1SYTA 1ODUA 2J9XA 3G1XA 3KBVA 3QGVA 1JZ3A 4J3VA 1VS1A 2NUXA 4L61A 2NVCA 3EBVA 3EB3A 2HCVA 1NAL1 3WJSA 3SI9A 1R3VA 5F1UA 1O6IA 1JVNA 2XZ7A 1KFEA 3VDGA 1K7EA 4QAIA 2E6DA 4TVUA 1OBAA 3GH7A 1PCWA 1F07A 1P5BA 4AZIA 3L0KA 4MNLA 3GH4A 4HNLA 3F5LA 4US6A 4N7QA 4I9AA 1KM4A 4NT0A 4ZO6A 4YMZA 4G7EB 3T0DA 4UQCA 1MUCA 3EA2A 5REQA 3KAOA 2H8ZA 4DF0A 1KQZA 3W7JA 3MV11 2DZTA 3W83A 2BZNA 4LUSB 3LTSA 3B8UA 2VR2A 2WHLA 1R6WA 4RV8A 2WB5A 3V16A 1X97A 4IPPA 1OYAA 1VF8A 2XGBA 1DOSA 4GI9A 2ISSA 3QW3A 4RK8A 3TVAA 2BXZA 2XVKA 4R9XA 4KWSA 5D03A 3V3WA 2XZ9A 1LF1A 2A0NA 1KXVA 1X7FA 4PMJA 5FJTA 4ACZB 1GVQA 3XIMA 1K02A 3DCPA 1EO5A 4M56A 3MO7A 6CGTA 4MMWA 4HNUA 3WH7A 3NVTA 2WCGA 4PFHA 1GK8A 4K38A 1QPNA 1BLIA 3BAXA 2GGJA 1YPXA 4IUGA 3UWZA 5CBIA 1QU4A 1X1NA 3PS7A 5KETA 1SW0A 2GK1B 2W66A 3ITTA 4LVBA 4M0XA 4JQ3A 3T81A 2ZBTA 4REQB 2WZHA 4XIAA 3QMTA 3WN6A 3R79A 1UD3A 1NOWA 1QO5A 5BU9A 3HFYA 3QZ6A 4MYXA 4YVXA 1OADA 1R38A 1RVKA 1PKLA 3SCRA 3TXVA 1Q6LA 3N13A 2ASHA 4IIGA 1VFLA 3ONBA 4E2VA 2R14A 4JNYA 1ALDA 1T5AA 1K3UA 1Z42A 1DJZA 3CL6A 2D2JA 3F7JA 1EYWA 3TSBA 3R25A 5D04C 3HB9A 3W81A 3PTMA 3O16A 1FWWA 1Y7VA 1EX1A 4XD3A 1OFAA 3TTYA 2YDRA 3GKAA 4FPSA 5AYBA 3ZIZA 2V6AA 3CHEA 2A3LA 2J27A 3LNMA 3PB2A 1K9EA 2NQZA 4PMQA 1VFTA 2IQTA 1RPXA 3IPWA 1PEZA 1OT2A 3SUTA 3WG6A 1E6ZA 5LZLA 3H2CA 3W86A 3OZMA 4XD4A 3W07A 4M6VA 1POJA 1U5JA 1C8QA 4E2DA 1UR2A 3IJIA 3UJFA 1CEOA 3QV7A 1CT5A 4KCTA 2DV0A 4LXFA 3GTNA 4NI8A 1DTUA 1MRQA 5AVNA 4IH3A 2YIHA 3M7WA 5ABGA 3HMJG 1AQMA 2BGQA 4IG2A 3VC6A 2J7GA 1OF8A 3MU7A 1NH6A 4LVFA 1GTHA 4KFPA 4LYKA 5I3DA 1TR9A 3UBPC 3QN3A 1J0YA 3UCQA 1OK6A 2E28A 1AJ0A 2ZRYA 3L5MA 4GFSA 3IIZA 2R1NA 3LLXA 5ABFB 4WDUA 3A9BA 1O66A 4Z17A 1QNOA 1ZP3A 3PZTA 1R7OA 1C7SA 3QPZA 1JPDX 5A6TC 4AZ5A 3LQLA 3V0UA 1U2YA 2C0HA 5CBJA 4B5TA 2RKXA 3W1MA 4LV4A 3PF3A 1QXLA 2JE8A 3S0CA 7PTDA 1YW1A 1W9XA 1MDLA 1CI1A 3A9IA 3G3DA 4Y90A 5BWFA 2E4TA 4JFUA 3H22A 1J96A 4LV9A 2ACSA 1TKKA 1ICQA 3L4WA 4OBTA 3LBCA 3LCFA 3TC7A 1TMQA 1MVYA 4KRUA 1QI4A 3DXIA 4H9TA 3EZ4A 3QPEA 1C91A 3K1GA 5C71A 5AYIA 5EFFA 1QTWA 4WXZA 1KBLA 4A21A 4RDVA 5CPOA 1ONXA 4ZA0A 3CT7A 3GG8A 5D33A 1HO1A 3GZAA 2XVGA 1PYFA 1JFXA 2VC7A 1IWBA 1U33A 1WZMA 5I78A 1YMYA 1WX0A 5KSWA 3QR0A 3HGRA 1QATA 2I7GA 1MZHA 4JTRA 5A2CA 3VZXA 5FF2A 2ZC1A 4DJDC 3NEHA 3GW3A 2DJXA 2OEKA 2UY5A 2NQLA 1V6TA 4AB4A 1NARA 1PKMA 1UZHA 2INFA 2ZZ6A 3W1NA 1V3JA 4TV6A 4JHZA 1IZKA 1E9ZB 4W84A 2OB3A 2O7QA 1GGOA 3NQ7A 2WK2A 4F0HA 1BVNP 1OX6A 1PWMA 1PZ2A 1BVZA 1LORA 4Y6GA 3PNUA 3Q67A 4AC1X 1VD6A 1JYWA 1FH7A 4ZOBA 1R2RA 1E6QM 3OVRA 1PAMA 4H9UA 4DJFA 1A5NC 2BOGX 4JD4A 5FIPA 3KWXA 5HOSA 5A2AA 3TQVA 2FYMA 1KA9F 2DZSA 3E02A 5C55A 4AXKA 3GYEA 1W56A 2OZ3A 1S5NA 3PK7A 4NJJA 1ZAJA 3Q4DA 2OX1A 4IMEA 2R82A 2YKKA 3R8RA 1BG9A 4AH7A 1KBKA 1M6JA 4NZFA 2GQ8A 3D3FA 2G3MA 2I14A 1SFSA 4IMDA 4AD4A 1DXIA 1UP2A 3BAIA 4UZSA 1W54A 3W2LA 3BZJA 1FWBC 4RZ5A 4H9MA 4FHAA 4G8TA 3G3MA 3NOEA 1H7WA 3NL6A 1TV2A 4AISA 4Z1CA 5M5DA 3AYSA 4J5NA 3BMXA 1VB9A 3QGAC 1KR0A 3M9YA 5KMYA 4JYFA 4PCPA 3DHDA 4WDXA 2O9RA 1V6WA 4W93A 4U3CA 4DYKA 1Q2SA 1B2YA 1EA0A 3M7SA 1JNDA 4Q8UA 3OYZA 4GNKB 2DT0A 3GC5A 3GFYA 3UPBA 1LJYA 1R86A 3QY8A 3SUUA 1WKDA 2FPTA 2VQTA 1JD7A 2TODA 3S6TA 1DJGA 3TZFA 1W2VA 5D8ZA 2HS8A 1FWJC 4ZFCA 5LNUA 3NNTA 3FXGA 1I45A 1IEQA 1MRAA 5H1WA 3PZIA 1V6VA 4PCSA 3WDQA 3QMRA 1EB3A 5HJYA 3GXPA 4FIQA 3W1UA 1BWLA 1XYZA 3K30A 3G0UA 5PTDA 5JXQA 2H9AA 4D2JA 4AD3A 3QHNA 5GJPA 4PB5A 5L9FA 2Y5SA 2GQ3A 2ZWYA 2NT0A 3N18A 4L1WA 1EBGA 3A4AA 2HQAA 1ONWA 2P3ZA 4C7GA 4CQBA 2G4JA 3W2UA 2NT1A 4O0QA 5EB8A 3VCRA 2QPUA 1FOBA 1H09A 3DENA 3CIXA 3QQWA 4GINA 1H60A 1EFZA 4Y96A 4EVZA 4F66A 3CZEA 2DZUA 2D1ZA 4H6QA 2JIWA 2PLKA 4H7ZA 3T6CA 5CC3A 1MFVA 1PX8A 3MUY1 4AU0A 4UR7A 3EPMA 5REQB 5HQEA 4ZXOA 1JUEA 3PJXA 3W37A 2AL2A 2ZZ3A 2OYKA 1WZLA 4RNFA 3W9ZA 4EKJA 1C7TA 3GFZA 3HOJA 2R1MA 3PNZA 3R11A 3TFXA 4AMAA 5KZEA 3BW3A 1J11A 5XIAA 4HHPA 4J3UA 2WCAA 2VCAA 4MKSA 2QDEA 3C4UA 3WD4A 4O52A 4CD7A 2QCLA 1QHZA 1PUDA 4BQ2A 1Z7AA 2I1OA 3CK5A 1R46A 5K7JA 4JKMA 2XVPA 1CXKA 1Y65A 1J0JA 2O9PA 1J79A 5F4XA 4ZOAA 3W2MA 1V0KA 3QMSA 1B3WA 1J10A 4DIAA 4WOQA 4A3HA 3N2CA 4KBXA 1KFBA 3RG6A 4QS5A 5U4NA 2BY2A 4TUFA 1UR3M 4Y7EA 2INZA 4WK9A 1V7YA 4LCQA 3VKKA 4V28A 3TSDA 2P50A 1WV2A 3SSJA 4WGHA 3H2MA 1GW9A 1XGEA 5AKQA 1P4CA 3UNTA 1M9HA 1JCXA 2EG6A 1F76A 3L67A 1AD1A 5SWUA 2B4GA 1QNSA 1LRTA 4JL2A 5M1TA 1O68A 1PYMA 2H90A 4HTBA 1UPPA 3OGSA 2QUMA 2X7WA 1XLKA 2NWRA 3K2GA 4PUKA 3ARSA 1VYRA 1EDTA 2VC5A 3HG2A 2WAGA 2QDDA 3ERPA 4GVGA 2E67A 4HZ6A 2C3ZA 3G2GA 4R9OA 3HQ1A 3U48A 1W3JA 2W63A 3M0XA 3T8LA 1G1YA 1N82A 2PF0A 3BCDA 1W3LA 3VA8A 1ODZA 1F74A 3NJ3A 2E1DA 2FMNA 3T0AA 1L6WA 1X8CA 5B7ZA 1JGMA 1DWFM 3KXQA 4O1BA 3OYXA 5F2MA 4LBSA 1OSEA 5GJNA 1LLOA 1S1RA 1VCVA 1XF0A 2GJXB 4CGTA 2QIWA 3GVRA 4O13A 1C8VA 1R3SA 2OVLA 2VUYA 3EEZA 1SSGA 3EB4A 4XZBA 3MUAA 3A12A 2CZEA 2WSKA 5I02A 2KAUC 1JUKA 3TCSA 4FR1A 3DKLA 2PB1A 1W5QA 1H7RA 4GO8A 3NZRA 2XFWA 5I3JA 4ATDA 1UROA 1XXXA 3WH5A 1QR7A 4MWAC 2VHLA 3OO2A 4QJ3B 1YE6A 6ALDA 3BXWA 1YADA 3WQ4A 3TQPA 3U3HA 3LRLA 1G4SA 3ME3A 1RA0A 1BHGA 2WNQA 4N9DA 3D47A 1OCQA 3GNXA 1B4KA 2XM1A 2AMXA 4L4LA 3IUDA 3ZJ7A 1SMAA 2IXUA 2IKHA 3KP0A 3KRUA 3RM4A 3MMDA 3VIKA 1GNXA 4K3ZA 3B0UX 2EG7A 1WDWA 4WKHA 2GQAA 1VBJA 1CGVA 3GHUA 1HL8A 3TYAA 3C0JA 1XD1A 4ZBCA 3N4AA 3CQ0A 2NW0A 2NQJA 2GWGA 5D9OA 1XUUA 5FEWA 1Q7QA 4BFAA 2YL5A 1OZMA 2CBVA 1PTDA 3OIXA 4GNVA 2WNWA 3PZQA 1W1PA 2V82A 4TMBA 4GE8A 4KCUA 3VPLA 4DF1A 2YR1A 4KRZA 2YLAA 1Z9AA 1ADOA 2FZ8A 1V4YA 1B3OA 1VFHA 2DDXA 5E9XA 4B15A 3LQGA 1OX5A 2YCJA 1P6CA 1ZPTA 3MT1A 3TSMA 3DOPA 8RUCA 2FHCA 3XISA 5LGZA 4H00A 1IXQA 4DJEA 4QG9A 3GHSA 4KCVA 2QGYA 4KGLA 1UD4A 4HGXA 4W8BA 4F48A 1GG1A 3T9PA 5I3KA 1FRBA 1OGGA 3W6MA 3O9NA 2IMRA 5G1MA 3BV4A 1V3LA 3NWRA 4BF5A 1W9VA 3I68A 2QULA 1RPKA 2VKZG 3W6LA 3THUA 3LZ5A 4UWMA 1EOKA 1SU5A 1UA3A 1OYCA 1J0HA 2ZVRA 1VFFA 4H2CA 3AWNA 1FP8A 5A69A 2PZ0A 1H2JA 3EKGA 3IVUA 4DZ5A 1XL9A 2Y5JA 1XG4A 4MNKA 5BRPA 1XLMA 4OOZA 1YPFA 3PBMA 2DORA 1M7PA 2OU4A 2VL4A 4DHGA 2ZZ5A 3VOCA 3V36A 4ROQA 5CPQA 3FJ4A 1KW1A 1UD2A 1GG0A 1V0MA 3WD3A 3GZ3A 2GDQA 5C2GA 5JIWA 5AOUA 5HA7A 5LXEA 4AX6A 3TAKA 1QWGA 1IYXA 4KEUA 3IJDA 3UU0A 2DSWA 3CV2A 3T4WA 4UQAA 4KRTA 1E9LA 4ZE4A 1T41A 2VZUA 4XZIA 1JZ4A 3AUOA 1UKSA 2X0HA 1V8EA 1YTDA 4HTYA 2QLYA 1AZ2A 4G9PA 4F9JA 4O8AA 4A8RA 2D0HA 4ZENA 2WBGA 3M44A 3N11A 2XWEA 1QNQA 2PU1A 1YX1A 1EP2A 1OG0A 3UERA 1KCLA 4RUBA 3M0KA 4HCLA 3DYPA 3GR4A 3BK0A 4TR9A 4KKXA 5KZMA 1ZJBA 4CU7A 2YL6A 2V3EA 1Q66A 4KS0A 3OQ8A 3IGSA 1AODA 3JW7A 4JIRA 3SN4A 5FJOA 4ROPA 1JDAA 3GUWA 3TYEA 1BEUA 3TROA 2DUXA 4AEFA 1KXHA 3SCVA 2WSPA 1EGZA 3KW3A 5LIYX 4C6KA 1CYGA 2CBIA 3L4YA 1KNWA 3LV6A 4CCZA 1GT8A 1QBBA 2NV9A 1A80A 1IR2A 1GQLA 3PM6A 4ICMA 3SJNA 3VM7A 4DPPA 4CD6A 7ODCA 5CJMA 3SFWA 4UIOA 2OKOA 1V3KA 5GNYA 4BEQA 1IZCA 1H1ZA 1UR9A 1UWTA 4DUWA 1YIXA 4GYFA 2YB4A 4KESA 1ADSA 3TJXA 1T96A 4IXHA 3QEZA 3NFUA 4P2VA 5F2IA 4OOUA 5I3HA 2GGHA 4U5KA 3LCXA 1Q13A 4NSBA 3ZQ9A 1FP9A 3ABZA 4O14A 4ZQNA 3CQKA 3ANUA 2HBXA 3R2GA 1GOQA 2ZOXA 3QC3A 3NURA 1H0IA 4P8WA 3ZS4A 1QJWA 5G5IA 3ZLGA 3VNYA 4GACA 3LEPA 3HIJA 2WXDM 4Q8PA 3KX6A 3WQFA 1LBLA 3MSGA 4WR3A 1NWRA 1KM6A 4IFKB 1D8CA 4O53A 3UWEA 4C60A 1SJCA 1WDDA 3KOWA 1W9PA 4GABA 3GK0A 3M0HA 5HAOA 2OX4A 1B3VA 3ZT5A 3PZMA 4FB7A 3LXCA 4JNZA 5HWNA 3HM7A 1POKA 1E71M 4GZ7A 3PUDA 3W26A 3WYZA 2W5FA 1YKWA 3GBEA 5LGXA 2WANA 1A5UA 3N04A 4OBRA 2Z29A 1DWAM 4FALA 3BMVA 4C6PA 4DB7A 1I75A 1CDGA 2D23A 1A0DA 1OCBA 3NQ2A 3WDPP 3WELA 1MUWA 4IOTA 1ZFJA 4RNIA 3NDOA 2Z1SA 5TNVA 1JZ5A 4GI6A 3LCHA 1JI1A 3UZXA 2FZMA 3H26A 2PODA 2VZOA 4Y9NA 4G1NA 1RAKA 5HXMA 4HD5A 1UWAA 4MFDA 1TWDA 3UGRA 4C7DA 4PFMA 5D09A 5A8QA 5MF5A 5DLCA 1H49A 2VX5A 3MSYA 2Z4GA 5EMJA 3NZ1A 4LAKA 3QTPA 3VO0A 5I3GA 1F6YA 5FJRA 1UCWA 4E3TA 3HQNA 2YB1A 3WQWA 1SZNA 5XIMA 4QS6A 3EGJA 5LKYA 4UCFA 4AC7C 2QCCA 5BXPA 4IP4A 4QG6A 4EXBA 4G2DA 4FNRA 3A22A 3WBXA 2NX1A 2PP0A 5CC5A 4HPJA 1NOUA 1W3TA 4JIQA 2PDPA 1HN1A 4UXDA 4KF1A 3DC8A 3PN8A 1KFWA 5BW6A 4GLEA 2GFTA 3S2LA 4JKKA 2VCBA 1DJYA 3E74A 2XYLA 2J62A 1FWFC 2VYOA 4A8LA 5T9CE 2OFJA 2H6RA 4N9EA 3NCOA 4NHVA 3JVAA 1XLGA 1I1XA 2ZUMA 1AJ2A 1P0DA 4PGLA 3HJZA 1UH4A 3ARTA 3W1LA 4HZMA 2ODOA 2UV8G 1FWNA 4PBFA 1ZU8A 2QIIA 5AECA 3A23A 2GSHA 3OZPA 1Q8AA 3T4CA 1W3HA 4AZ6A 1YDVA 1IEWA 5TD4A 2PEVA 4J35A 1O60A 3N12A 2EPKX 3UG3A 4F8XA 1RD6A 4I8DA 2ISDA 2YFNA 3W2KA 1O12A 4CNUA 3EOUA 4D6IA 4TTUA 4UTWA 4LT9A 3CMJA 3S2MA 5D05A 2Y85A 3MY9A 1W32A 4DO4A 3D6NA 1QPOA 5EU9A 2GVLA 3M47A 4HT3A 3LM3A 3WENA 3P67A 1Q2RA 3CAQA 4LUJA 4QJ1A 1W5PA 1PTGA 3HN3A 1U30A 2BXYA 4G1KA 1WA3A 2CHNA 1W1IE 2HWGA 3LX9A 1U22A 3PZ9A 4J2MA 1ITXA 2ZADA 3PZVA 1OVDA 6ENLA 3MCOA 2G96A 3SN0A 1UWSA 1K6AA 3ARPA 3S5NA 2FZNA 1IIHA 1EJTC 4GKLA 3AXXA 4LF2A 1BYDA 4GX9A 1XDJA 3WD2A 1LL7A 4U28A 3S47A 2CKRA 3V75A 3GSMA 1LQAA 3TLLA 2WSYA 3RMJA 2QCEA 1W3KA 1LT7A 2XIBA 3QFWA 2O92A 1FCBA 4MB5A 3KZPA 3CZ8A 2X2YA 4UFIA 1MQQA 4J27A 5EFDA 2PLJA 3GVWA 1IZJA 3A4WA 2RJHA 4DLMA 1NTHA 1S2AA 5CPNA 4QE5A 1XM3A 5C9XA 3TWAA 2F61A 1GOMA 4HHHA 6XIMA 3H23A 1GVOA 4IJBA 4L80A 3FJNA 2Z27A 1IGSA 3CYJA 2ALRA 1GVEA 1JG9A 4JBRA 2CKSA 4NZCA 3WH8A 4M6QA 5G2WA 1G7VA 2XHYA 5BWAA 2TPSA 3FHQA 4H41A 4RLIA 5AZ1A 1EBHA 2YCLB 2ZRZA 3AMLA 3BAKA 2V5BA 3BSMA 2VZTA 1S2VA 1Q6QA 1DORA 3QV8A 2W92A 3PZUA 2VGFA 3N19B 4LS2A 2VMFA 1QNRA 1IR1A 5HJXA 1UMLA 4DO6A 1V6YA 4ZTYA 5A1AA 5AC7A 5BXRA 2VI0A 2PUZA 5BMWA 3FYYA 4JICA 5A8PA 5HR6A 4NJHA 1OGSA 3MCMA 1E0VA 1R3RA 3ZLFA 4FEZA 2DVTA 1H7XA 3YPIA 2A6NA 3BARA 3BV7A 5D8WA 3VNLA 1JL8A 5K9DA 1X6UA 3TNOA 4QJ5B 5HQMA 1DJNA 2EPHA 3MVIA 3PPFA 1UWRA 4HOZA 3OBKA 2XFFA 1FCUA 7CGTA 4LH8A 4XKMA 4YPJA 2RFGA 5BU6A 2PE4A 3DIPA 4IQEA 4UZUA 4H7CA 1WBJA 3MW7A 4AWSA 3RK8A 3KHDA 1UBPC 3WKZA 3M0ZA 4OZOA 1A53A 1L6SA 2OOFA 4QQUA 1W3IA 3BG9A 1LL6A 3C52A 2NV1A 2Z7GA 1DHKA 1C93A 3WMBA 3VK5A 2FMOA 1SFTA 2X42A 5LXXA 1B0IA 2WO5A 4M24A 1F3WA 2NQ9A 2V9DA 4QAWA 5A6LA 3EWUA 1LWHA 1CBGA 3IK2A 3FAXA 1EC8A 3G1DA 1BXNA 4B5SA 5U7SA 4ZQCA 1RCQA 5AHNA 3UNDA 5FESA 2QJMA 3LI1A 4HCHA 3VFLA 4UBPC 2HS6A 1YNYA 4GG9A 5E6ZA 3CZKA 2FDSA 3S9YA 5FI8A 1CPUA 2FGLA 2CWNA 2D3LA 1E5NA 3PVFA 4HA1A 4JQ4A 5A6BA 1CLXA 2WMKA 1BKHA 2ZE3A 4C7FA 4AVNA 4H6RA 1XIFA 4O16A 4MUPA 1SW3A 1TQJA 5MKGB 4HIBA 1HJWA 3G1YA 3GUGA 3R6IA 3CS2A 1EPVA 2DT3A 3VMNA 5AN7A 4GPNA 3WDIA 1NU5A 1UKTA 4XVEA 1WKEA 1R47A 2WKGA 3GW0A 3OLIA 2V30A 5GNXA 2A3EA 4UFKA 1QK2A 1C3FA 3TKFA 1O5XA 3WLIA 4Q7NA 3STGA 2FPYA 3O05A 4N2YA 1OGBA 4GO9A 1KM5A 3W29A 4GCAA 1GYNA 4L1XA 1EYEA 3LK6A 2WLYA 4F79A 4QDWA 5I7GA 1Y5WA 4RPQA 1KV8A 4YXGA 5A6AA 1FHVA 1REQA 3BL3A 3DFTA 1W5MA 4HJWA 4XBKA 1S5TA 3ALGA 4UTWC 5IHRA 2Q8LA 4HP5A 4DZIA 2PWGA 1PSCA 4PCNA 1WYIA 4IL2A 3FVMA 1LBMA 1K7FA 4YWIA 4BJHA 4OECA 1CB2A 3M6DA 1UOKA 1RZMA 4IPIA 1GHSA 1SR0A 5C9RA 3QOKA 1RBOB 4QHRA 2E5BA 1P7TA 1UQZA 5HJLA 4OWGA 3W7HA 2RAGA 4RDWA 4JTLA 2Y70A 3O0KA 2BFGA 1EIXA 1UBSA 2VT0A 3U7VA 3V35A 1ZBKA 1RK5A 1KD0A 3MS8A 3QQ0A 3VOHA 4Z42C 4Z2KA 1RA5A 5C8BB 4ZVJA 3TK7A 3VGDA 3RO8A 3TDFA 1ESWA 2WQPA 1N2VA 4INFA 1VHCA 4DJDD 3GU2A 3B9NA 3E0FA 2ACQA 1TTPA 1EEXA 3N9RA 2O9OA 3BCJA 1M7JA 3V1HA 1ZENA 3LPPA 4FS9A 3MVTA 3I3EA 4BQ4A 1TZZA 1LZOA 3LCIA 4CUCA 3BZGA 3ZVHA 1JXJA 2B7PA 3UQNA 3WL0A 5HMSA 1C29A 5HINA 4EK7A 3R43A 5A8MA 1SO3A 2ZUWA 4EPKA 3GNPA 5L6UA 4S2BA 4URIA 2ZXAA 3E49A 3EWYA 3ENLA 2A5HA 1XC6A 1K9TA 2QEZA 2EXOA 3M07A 1J5TA 5MHBA 2Z2AA 3W7IA 2PDBA 4UTFA 1B3XA 3BOXA 4HSNA 1RALA 1LM1A 3ZR5A 1T7LA 4JTSA 4GXPA 3W75A 3TFCA 2CZFA 2E6AA 3AMCA 1PIIA 1YBQA 4F0RA 5LNWA 1A0EA 3V0SA 3W85A 1OINA 1ZUAX 5JQ9A 2CLLA 2GPTA 5AFDA 5A95A 3W84A 4Q32A 4PTXA 7REQB 3THDA 3GKFA 4IIBA 4F0SA 2Z24A 2VFGA 4GGHA 3P61A 4RW5A 2QPSA 1VFSA 3IARA 3EDJA 1BXBA 4BWLA 4EACA 5EBAA 1PB0A 3NPUA 3MI3A 3R58A 5C7VA 3C0SA 4XB3A 1XBZA 5I24A 3S9IA 3IIXA 4DRSA 4C6IA 1V08A 2E68A 4L9ZA 1MYRA 2BGNE 4NAEA 3T07A 1ZL1A 2DFAA 1OHLA 4MNMA 2Y8UA 2FZDA 1JCJA 1S46A 1FWTA 3N2OA 3GDKA 4W8AA 3QOMA 4S3KA 1UKQA 2EQDA 5DBUA 3EA3A 3UPWA 1HKVA 1OIMA 4DXXA 1MW1A 4XWUA 3STFA 3VCCA 1HJXA 7TAAA 1VIWA 3P81A 3RLGA 1LP6A 4QE4A 2VWTA 3PUEA 1UC5A 8XIMA 2TMDA 4D6FA 3AU6A 1EHNA 1F8MA 3VZZA 1TWZA 3OVGA 4GY1A 3G1SA 3RITA 1C9WA 4GHRA 8XIAA 2ABBA 2R6OA 3N34A 1EJXC 4HU4A 1XKJA 2I5IA 3ICJA 2NX3A 4ES4A 3MZ2A 3FW6A 1VYPX 4JHMA 3SRFA 1QWKA 3EWXA 4UTUA 5CBBA 3FS2A 3RX3A 2PDJA 2FVMA 5C6MA 2GGIA 3FIGA 1E0XA 2JALA 3FY1A 5AC8A 2XSXA 2BWGA 3WEMA 3WNLA 3G0XA 4FIRA 1IHIA 2P8CA 1KRBC 2G3JA 3ORWA 1FHDA 4JR5A 5CZTA 4HPGA 1HKKA 2TAAA 1UH3A 3UR2A 4U5IA 3L4XA 3PR2A 2Z1VA 4D8ZA 4HYRA 2A79A 2QJNA 2QF7A 4I9TA 3WD1A 3D0CA 4GXWA 3R8GA 4PTVA 3IJ6A 3C3UA 4DBSA 3S1XA 2BVYA 3TTOA 3AZRA 3H70A 4Q8TA 5H2ZA 2E5CA 4LVGA 1E1CA 4MAVA 2V5KA 4TQTA 3URNA 1YHTA 4Q8MA 3VTRA 3AZTA 1X7IA 4ICNA 2B81A 1GVRA 3JRKA 1UHVA 1PE1A 4TX6A 1T8QA 4QCFA 4F9DA 2J7CA 1SUXA 2PRHA 5AHFA 4S3GA 4OU1A 3PPHA 1TPB1 3VOGA 3TN4A 2FLIA 2QCDB 3W24A 1J2WA 2JGQA 3SQLA 4R85A 4LB4A 1BWVA 5LSMA 2WYSA 4IX2A 3TLQA 2XISA 3GRIA 2ZDSA 3GIQA 2GVYA 1GJUA 1NY1A 1V5XA 1D2KA 5D38A 3LBOA 3AHTA 3EA1A 1RVGA 3TH6A 2XWDA 1V7AA 4AZHA 2FTWA 4WY0B 3EOSA 1JZ8A 2XN2A 4MYAA 2FZ9A 3CC1A 3RUBL 1K7XA 4OFCA 3BGGA 3COTA 4H83A 1WE5A 3AIUA 4AZCB 4LF1A 2E9BA 2R8WA 2DW6A 4TOQA 4AWUA 2ZZ7A 3CZLA 4CQCA 4CNTA 1BYAA 1ZJAA 1XD0A 3L0GA 3R10A 2X1RA 3T2QA 4ORMA 3N29A 2QMJA 3IV8A 3NM3A 1L9WA 2CXGA 3EXRA 3E1F1 3VGBA 3NXLA 2E6YA 3DI1A 2D2OA 1PX4A 1MWOA 4QISA 2WOQA 2C79A 3PTQA 3P2VA 1YXDA 4CD5A 3Q58A 2BVWA 5LHEA 1F7BA 4KFNA 3CB8A 4M81A 1AW5A 2D0GA 1TREA 1TFVA 3NO5A 1SJAA 3B0VC 3TN5A 4MNJA 2VFHA 3TTQA 1VHNA 5T8GA 4IHCA 2YXXA 2FGZA 1V51A 4QX4A 3OODA 1MXSA 3NQAA 5EMMA 3AHZA 3GR7A 2W91A 1KFKA 2YYUA 1UYQA 1JEZA 2YZ5A 1NJJA 1K77A 3WUEA 4O1DA 1D9EA 3NQFA 4R88A 1DQWA 2D73A 3VIPA 3GD6A 5DMLA 1WXZA 4PMXA 2V2HA 3K8MA 1U5VA 3OGVA 4LAMA 1NQ6A 4DNMA 2JGYA 2Z2UA 2YFOA 3SECA 3ZJKA 2P1FA 3N6QA 3KLKA 2PDIA 1LBFA 5E70A 3TA9A 5CGTA 4IMGA 4DUOA 3NQ8A 4FX7A 4KEVA 4MB1A 4TX9A 2AQVA 2OQLA 4JIPA 4RXGA 4DZAA 1V6XA 3OEXA 3RJXA 4P7LA 1MW0A 4MKVA 4LOCA 4NKCA 1J8VA 3PUGA 4NJGA 3OLDA 4MY8A 2HDJA 3IGUA 4Y9AA 2QNEA 1ZLPA 3OOQA 4X2RA 1XBYA 5EMLA 4OGZA 1KO0A 2YCIX 1H61A 1TZ7A 4YCPA 3H7RA 3EDDA 2CERA 5E1QA 2RDTA 2INEA 4HZ7A 3IRSA 4J3SA 4P7OA 3T8QA 2PCEA 2RDUA 5CCZA 2V3DA 4JL1A 4JTHA 4MZ8A 3LDVA 3FK4A 1F3TA 5LYRA 3UZ5A 3ARXA 4EE9A 2BX7A 1FTXA 2PDHA 3EX2A 4LPCA 3ZLHA 3HG5A 1TA3A 3KVKA 1DWHM 5HUPA 4JY9A 1ZAHA 4JTFA 4ZOCA 3GTXA 4JS3A 3EWZA 4Q6XA 4JYEA 3C6CA 4C1LA 3PANA 3QZAA 1VPYA 2Q01A 3ELFA 3CIVA 3W2NA 3FKKA 3P80A 1TVNA 3B4UA 1J0KA 4PULA 2XG9A 1GHRA 1GORA 2JBMA 3MHGA 3VZYA 3TC3A 4IUOA 3QRHA 3TW6A 5TIMA 1BGAA 2XGZA 3NQGA 4PUWA 1DWJM 3WFZA 4FSAA 1B1YA 3UP8A 2NXIA 3AHXA 1NIUA 1XIMA 5DRCA 8TIMA 1JAKA 3P8IA 4KWOA 5HANA 3THQA 6REQA 3LRKA 5FCZA 2QR6A 5TQLA 3GDMA 3U4FA 4ZE5A 4JDYA 4NXKA 3T55A 3W73A 4H6EA 1LOLA 1Q4NX 3LGDA 2WC4A 3SN1A 1ME7A 4CQDA 3VXGA 3CEPA 3WMCA 4NQ1A 4I6VA 7TIMA 2VUNA 3S5ZA 4R7WA 5I3IA 3WJYA 1UR1A 2CBUA 2VEFA 1XH2A 1XDMA 5FEPA 1GYMA 2J75A 1A3WA 4IJRA 4QSHA 3LD5A 4JNMA 2XINA 4Q33A 1GZJA 1MUMA 2V2CA 4Q4PA 3AIBA 1H51A 3NQDA 1XSKA 3CB3A 4JEQA 2V38A 5EGRA 3BJSA 3FFSA 1KCKA 3TJLA 1YTKA 3WLKX 4NNAA 4NJKA 1QI0A 2I5GA 4D72A 2YPIA 3H53A 1TPUA 7XIMA 4D9PA 3CWOX 4XD5A 4HU8A 2A7RA 1L8PA 3L65A 1WO2A 2J6VA 4BEUA 4GIRA 1US0A 4R5EA 4B9YA 3ZT7A 4LCSA 1KQYA 2OMAA 5KEZA 4LYQA 2ZRWA 4O1FA 3RFAA 3VINA 4Z1YA 3AO0A 3E5BA 2J9ZA 3TOYA 5DMYA 1XIGA 5C70A 2B7QA 1EX5A 4MZ1A 1MEWA 4EWJA 2FJKA 3M5VA 1XYAA 3N9SA 1KTBA 3MWAA 3AOFA 3UWUA 1UW9A 4K39A 4GK8A 2POZA 4K8EA 3DDMA 3GXFA 3UJ2A 4JY8A 3VILA 1V3MA 5IBXA 3GNDA 4AF0A 3OLEA 3BSGA 2ATSA 1ZY9A 3AHVA 2AAAA 4B3LA 3TAOA 3TA6A 4ZOEA 4IQJA 5K9XA 4DAIA 3C2FA 4MY1A 3F4CA 3WLSA 1FX6A 2HVMA 4FX8A 1E6PA 1MQRA 3FKRA 1S2WA 2OLHA 2QV5A 4R53A 2Z1XA 4L65A 1KV5A 3LOTA 2WMGA 2VRJA 3K8KA 1BWKA 1K9DA 4ERGA 3LHTA 4J3ZA 4WGXA 5FEZA 4NF7A 2J79A 3VVGA 4FOJA 3B8SA 4H9XA 1SGJA 2QKFA 2PP3A 3REQB 3TYCA 5JU6A 3LMYA 2EAWA 1Q85A 3LCGA 3CH0A 2VFIA 4UNLA 1SVDA 2ZVIA 4J7RA 4HU0A 2QYGA 1G5AA 3NQMA 1VFUA 1KM3A 2OOGA 1ZGDA 1RUSA 1R7AA 2R91A 3UD6A 3H2FA 1R85A 1LG2A 3CBWA 1E72M 1I2NA 4H4IA 3NYDA 4K8GA 4BR1A 3LHYA 4GOAA 2PWDA 3M0JA 1LYXA 4PUDA 2CZDA 3UA4A 1MXGA 1VYSX 5A6KA 1BQGA 1MNZA 4FLQA 4BI5A 2WVVA 3GNRA 3HURA 3WBYA 1L6FA 3HPZA 5C5YA 3ANYA 2ZX5A 1WDQA 1THFD 5T91A 2FH8A 2Y7FA 3VD9A 4FF7A 3URBA 3VE9A 1QW9A 1KBJA 3L23A 2BB0A 4MIMA 1GQKA 1I2RA 3LV5A 3NQBA 3DG7A 1TPEA 3LYEA 1KGWA 2F8QA 3W7EA 2ZXBA 5AHLA 1QDSA 3VNIA 3C2EA 4OIFA 4AZGA 3C61A 1S38A 3CWNA 2IPWA 4JHOA 1HG3A 3SRKA 4LSBA 2GUBA 5AYXA 5BCAA 3DEQA 3NIYA 4P7QA 1Q6CA 3KBMA 2C19A 1E51A 3S46A 1JNEA 1LWIA 1IT8A 3KUMA 4JOMA 2WZIA 1EA9C 3WLNA 1VJSA 3F03K 5G4HC 4MAZA 3EWWA 4IF2A 1VJZA 3TXZA 2Q02A 3G22A 2QMKA 3FV9A 4Y9PA 3V4BA 5BZAA 2HV5A 2C7FA 2Q71A 1YDOA 3SY1A 3NQEA 1DXEA 4EIVA 2ZCGA 3QC0A 2GSJA 2PDUA 3KHJA 3EWDA 3H7UA 3ISIX 1TWIA 1MI3A 4P8VA 5FJJA 1XUZA 4AZBA 3W72A 3VD7A 3CQIA 3M64A 4TXEA 4PUMA 2DUAA 4TX8A 1SZGA 2CHRA 2BBFA 4CU6A 4FO4A 3OG2A 3CXOA 3CEUA 2OGJA 1VLIA 2PC4A 2ZRUA 5D30A 5ENLA 1E6RA 3W1XA 4HK5A 1CGTA 3PSWA 1EJ7L 1J0ZA 5E6YA 4YTTA 4MKNA 1AMYA 1EC9A 1TTIA 2BLEA 1NDYA 1VZWA 1PZ3A 2YXGA 2CITA 5TAOA 3IJQA 2PDNA 3ZR6A 3JR2A 4E4PA 2OT1A 2D0FA 3FA4A 1QI3A 1JDEA 3PZNA 2GJNA 1A5KC 1QFEA 2O9TA 3W1QA 4YN5A 3HQPA 4M8UA 1UWQA 3EXSA 4K68A 5JH2A 1NWSA 2JFEX 5FA5A 3HGSA 3F2DA 4K36A 5DCDA 1CZ1A 3WF3A 2P10A 3W23A 4HHMA 4TVCA 3P93A 2IXVA 2PDFA 3F5JA 5I06A 1TE1A 2J7FA 2EGZA 4O15A 4RCXA 1IE7C 3BLDA 4JQ2A 6TAAA 4C5YA 3FX4A 3NSXA 4HPXA 4PTNA 4US5D 2GZXA 3J7HA 3V5FA 4AVFA 2QCFA 4YYCA 4LS1A 3CMFA 3WX7A 3WQDA 4ZTXA 2V2DA 1DP0A 3QSRA 2I9UA 4GFIA 2CZVA 1KTCA 2BODX 2YA0A 1JQXA 2EF9A 1YRRA 2E5DA 4WSJA 3AQUA 4LC8A 4IFOA 4OTKA 1RQBA 2OZ0A 4KCWA 4KIEA 4XZNX 3QGKC 3UG4A 1Q7MA 4W87A 1XX1A 3EYPA 1F3XA 2MNRA 5KZDA 4GYKA 1UD6A 4YTQA 4UOZA 3IS4A 4H9YA 3XINA 3WK0A 2JKPA 1TR1A 4UQ9A 3AROA 1RV8A 3TEVA 2Z26A 1HXJA 2HVNA 4DO7A 4IQLA 3B3DA 1T6MA 1RJRA 3ES7A 2GJPA 5DO8A 3ABQA 3BAYA 4YCOA 1GQJA 3PG8A 2CXEA 4GQBA 4RNHA 1S2UA 1JYXA 3RRXA 2A3CA 4U2ZA 3QLLA 4S3EA 4RV3A 4L64A 5DELA 5IM51 4J4KA 3VIJA 3BDKA 3L7RA 4JTGA 4QXIA 5EMKA 3QF0A 2IPFA 3WBAA 4DJDA 2A2IA 1TPFA 3RILA 3NPWA 3T05A 2WMFA 1J12A 1TJPA 3CU2A 3U0HA 4AY1A 4MG4A 5ABEA 1G4PA 3PAOA 3B97A 3WQ5A 5IOBA 3N2TA 1GKPA 2PMQA 1J6OA 2DJLA 3AYRA 1TSIA 4HVXA 2NLYA 2YGYA 3UZZA 4LAUA 1PZ0A 2QJHA 3GQYA 4AEOA 3QTGA 4WOZA 4DWSB 3VIMA 1CGUA 4E2BA 2BY3A 4Q7BA 1LL4A 2PGFA 3VNZA 3T44A 2PDYA 4LNYA 1WCGA 3DAQA 1GONA 1UUMA 4GQQA 1TRIA 2Y8KA 4AD1A 3UWVA 1W6TA 3GY1A 1GPFA 1H1NA 1ISWA 4HNTA 2A21A 3S4TA 3F4VA 3LU2A 3QYSA 3IJ7A 1G67A 4PE8A 1Z48A 4V27A 3SIZA 2W27A 4QG8A 1OYBA 3MKKA 5A2BA 1ZCCA 4BQ3A 1BRLB 1RR2A 4JIIX 2ZA1A 3RIKA 2X2GA 3DFOA 1OCJA 1RLCL 4UR8A 5B7YA 3ABSA 5E09A 2JIEA 2QCNA 4J28A 4WJXA 3GG0A 1E1FA 3L2MA 4XKYA 4LUTA 3USZA 3B8WA 1PX3A 1FWHC 1U1JA 5A6SA 2REQA 3QR3A 3U2OA 2V5LA 4PMUA 5BYWA 2UY4A 1I60A 4C6LA 4UTJA 2Z1KA 4C6QA 4XAPA 3EPNA 1R3QA 1TPVA 2PBOA 4HMDA 1GUVA 4OT7A 1KXQA 3KTSA 3UVAA 5AZ0A 2OG9A 1ZP4A 3Q2DA 4NAFB 1GQIA 5BOOA 2A7PA 2I56A 4OE7A 1D8WA 4FXFA 1VBGA 2X1SA 3AYVA 3W1TA 1G01A 4DZHA 4LNCA 1E15A 3H2NA 2A6LA 1RK6A 4PMDA 1I6NA 2PGRA 1GQNA 3QHMA 1X6LA 1GVYA 4RZBA 4ZB5A 1LLZA 4AD5A 1V79A 5LIUX 1B5TA 3MI6A 4H7VA 2AOSA 3OZOA 4LYPA 1VP5A 4NUWA 5A8GA 3B40A 3LPGA 2Y6ZA 1QUMA 3PULA 3W3OA 2DEPA 3ZOAA 2PTWA 4E2OA 2ZX6A 3LXBA 3WNNA 1YDYA 2VOTA 3NSMA 4AF0B 2QW5A 2WNNA 4QRNA 4ADTA 2RH9A 3BW2A 4F3HA 4Q4RA 4P61A 4A3YA 3TR9A 2WSQA 3WF4A 2G95A 3W7LA 2E1WA 4LTSA 1QBAA 4M7SA 1XIIA 3NPXA 3QQ1A 4FZIA 2XGIA 2A85A 2CPUA 1FKXA 4D6EA 3KDNA 3IV3A 1TIMA 1U83A 3TWBA 1OM0A 3SDOA 2ZUVA 3V5OA 5J5RA 3E2RA 2OPJA 1I2PA 4EAYA 5AVHA 4ILSA 2Y1HA 1B4EA 1G69A 3FXYA 3NL3A 3TTSA 3WDHA 3ZSSA 3SB0A 3W38A 4MOZA 2PA6A 3TYUA 2J13A 4NI3A 2V3GA 2VFDA 4JQAA 1QO2A 2NXHA 4O19A 1OG6A 4P7NA 1E43A 1V3HA 3C2YA 5HQLA 1HP5A 4S3FA 2OT0A 3V0TA 1NWTA 3RYSA 1LWJA 2PU0A 1TWSA 1XICA 4C1NB 3NZPA 1EJVC 2PDWA 3FHAA 3VDHA 1JR1A 4HMNA 4EX4A 4K7YA 2HMCA 1WDRA 2CWXA 3W7OA 2UBPC 4O0KA 4JTDA 4KWUA 2ZA3A 2ZZ1A 1EF3A 3S6OA 3UF9A 5IFTA 2B7NA 3B9DA 3T2PA 5LA1A 3N14A 4G7FA 2HSAA 3VFCA 2OYLA 4RE2A 5DCEA 2F84A 1WNOA 3BQ5A 3W4RA 1LT8A 4WXYA 3LTYA 2HJPA 5ABTA 1V03A 3LLFA 5BXTA 1PVNA 1LTDA 3H4WA 1ZJHA 1SZRA 5F4WA 4A2SA 4O4WA 2HISA 1UKOA 1Y8BA 4I3GA 1B30A 2HXTA 1XHGA 5H8PA 3MI2A 1NVMA 1WBHA 4FF5A 4ZFMA 3K1DA 3W1RA 3WQOA 3WL1A 3ITVA 2ZQ0A 1GKQA 2V67A 3AJXA 4EPDC 1R9XA 2C1HA 3BLEA 2ACRA 1W8SA 3HBLA 1DQUA 2G50A 4L1GA 3BOLA 1ZCOA 4O11A 1HVXA 1YXCA 3CJPA 3PWAA 3WF1A 4D6GA 1DWIM 2VDGA 4PRRA 3T0CA 3W7PA 3HF3A 3MYOA 1UASA 3VNJA 3GTFA 3GC4A 2OTDA 4H3DA 4B3ZA 1UD8A 1SO4A 1T8XA 4U4MA 4UTIA 5AHMA 2Y62A 3BJFA 5I07A 1LUCB 3BANA 4BQ5A 5A6BD 4JX4A 4Q4SA 1O5QA 1P43A 4H8VA 1UZ1A 3VAVA 5M2FX 4ATWA 3N2XA 4TIMA 4BI7A 4DM1A 3HV8A 2EG8A 4AVOA 2YCKX 1VRDA 4CNSA 1M7XA 4GUJA 3UGVA 1OK4A 4K37A 1JRBA 3TYDA 3VU2A 1H62A 1LLWA 3LERA 1QMLA 2PFHA 5JMUA 4L6OA 2NUWA 4MJ2A 2C13A 5HNRA 2F7FA 2J74A 3AXHA 1CLVA 4I5XA 5FSDC 5FKYA 3E6EA 1EEPA 4HA4A 1BPLB 1TVPA 4AWTA 4MWAA 2DZXA 1W9DM 3K13A 3FGCA 1UP0A 1XGDA 4AHOA 1R9YA 3O63A 3G1AA 4MY9A 3IVTA 3IUIA 4PC8A 3KOFA 3V1PA 2IPGA 4YVPA 3GLCA 1Q7ZA 3OHMB 2BHZA 2PTXA 1Y0EA 3CUHA 4Q4QA 4QLJA 1GJPA 3H2OA 1AA1B 3HGJA 3LNPA 1M01A 4BKNA 3LM7A 4MJ4A 3RNDA 1FH8A 2Y63A 2L5HA 3FSTA 4NZJA 2OGYA 5GVJA 3THAA 1JDCA 5CPTA 4PR4A 3OJGA 3I7RA 1SR9A 4ACYA 5A94A 1HKJA 1RJQA 3M5YA 4HJFA 3GYCA 3MUIA 1J4EA 1MDRA 2C0AA 4NU7A 1X38A 4A3RA 1Z32X 3BOFA 2WVUA 3ZJ8A 2WHJA 2X40A 2EPNA 5A6MA 2O4MA 2XIMA 4CKQA 3MSDA 2PI6A 3WNMA 4GUFA 3SRHA 3GH5A 4XZHA 2V81A 3WBEA 3STEA 3FEQA 3RPTA 3A3WA 4NX5A 2XIIA 2CU0A 1ZBVA 2F6XA 1XW8A 4E4FA 1CGWA 4JTKA 3S42A 4LUSA 5F7UA 1FKWA 4WSKA 3N4FA 1F9CA 4XSLA 1E3XA 1FHUA 1EDGA 3B05A 4HSOA 4C6FA 4IISA 1UR4A 1J18A 4GJ1A 3SSZA 1KFJA 5FF7A 3T2OA 2YXOA 3CYVA 2GGEA 2J7DA 3BH4A 1KCXA 3WY1A 3BAJA 5TF0A 3SADA 1AVAA 1JAEA 2GDVA 1GVIA 2TSYA 4ACZA 4UQBA 4DWDA 3DUGA 4I7WA 5IDZA 4H8HA 1XPGA 1QHOA 3OP2A 1TX2A 4MM1A 1JUBA 4DY1A 4CN6A 2Q09A 3JU2A 2O56A 2BVDA 3IWPA 4MADA 1DXFA 1MMFA 3EOLA 2A4AA 5BRQA 1NDWA 1LDCA 1CNVA 4LAOA 1P0BA 3S83A 1KCZA 3TN3A 1RY0A 3UZYA 1AQFA 4PB4A 3LBMA 4GI8A 1KTNA 2QF8A 1WDPA 1TJ2A 2GK1A 5K3VA 2VC6A 4IGNA 5CLWA 1UD5A 3WQEA 1OJXA 1XH0A 4REQA 2DP3A 4TU1A 4W88A 4O50A 1SQ7A 3I6RA 1GZ1A 3R7MA 3ZXWA 4MWAE 1IEVA 4C6DA 2IKJA 1DL3A 4LS0A 4RDZA 3HGOA 4DQWA 1D7KA 3AIQA 4J40A 2PWHA 2J7EA 1TV5A 2HK0A 1XYMA 3CHCA 4L4OA 5F4SA 1QI2A 4NXSA 2JEPA 3WEOA 3E12A 4LGXA 1WB0A 3JZEA 3K46A 4E0CA 4RW3A 3L66A 1OB0A 1R2TA 2BNJA 5EA9A 1R3YA 2Q8XA 1HJSA 5ECUA 3BJTA 4AIBA 3HPXA 4DF2A 4LU0A 3PZOA 4IGSA 3H8AA 1CB7B 4D71A 5FL1A 4Q8WA 1P0EA 4QNWA 4R7OA 2E25A 1NP0A 3FOKA 1H5YA 1ZB5A 1IGWA 3GVQA 2G3NA 3CUZA 3QPYA 4UTTA 2X1TA 4GC3A 1PDYA 4IWWA 1HJVA 3KL0A 2VZSA 1ME9A 4XV0A 2VJXA 1N7KA 3T1GA 4HN8A 3U6WA 4YYFA 3BSHA 2REQB 2VDIA 2W9MA 1QOXA 2VWSA 3F4DA 4KWVA 4PUNA 3TTEA 4XX6A 4PEKA 1QOQA 1VBHA 3A5VA 2WM0A 3UWWA 4B5UA 3WQPA 4RX0A 4FLRA 4FXSA 4AEEA 1FDZA 4PRTA 4A3UA 4Z0JA 1ZRQA 4PSRA 4EF8A 1RSCA 3MP4A 3KVJA 5HWMA 4HZ8A 3TJIA 4X22A 1VFOA 3PTKA 3IGXA 3P5YA 1WKFA 1R9ZA 1NSJA 1ZALA 5BOEA 5I77A 1SSDA 3IIVA 3MSRA 4A05A 1XRSA 2Y4SA 5E0FA 3Q45A 4W89A 5ABFA 3ITXA 3BCFA 2PCQA 2UWFA 3DESA 2Y61A 2WZEA 1O95A 1EF2A 2G4FA 4A3QA 3CV1A 4YHEA 4C90A 3OA5A 4M29A 3S2NA 1SJDA 4DAFA 1PHWA 2YDSA 1JRCA 4ZO7A 4B3KA 4IL0A 4CNPA 2A3BA 4IG2B 5DXXA 2PPGA 3TW7A 3THCA 3KDOA 3M16A 3TIMA 2H3DA 1QVBA 1XYCA 2Y89A 4NP7A 3QY7A 4JN7A 1AG1O 5D37A 1OFEA 5EKYA 1F4AA 1VFMA 2XH7A 5KTLA 4XQ6A 3N17A 1XH1A 2PURA 3IAQA 1XLCA 4PMRA 3EMCA 4V33A 9XIAA 1VLWA 1OWQA 1TTQA 3R89A 3FVDA 4H9VA 1IV8A 1XIBA 3PY2A 4I9JA 4ZEPA 3GNNA 5DT5A 3PBUA 3G24A 4EOUA 2PDLA 3B03A 3GU9A 3UYIA 3QXBA 3W7NA 4XSMA 5J04A 2JKEA 2ACUA 2V68A 1DIEA 4JAWA 1HNYA 3AAMA 4WJ8A 4XIMA 4X61A 5KZ6A 4I7VA 1XYLA 2IQ0A 3KBSA 5E0KA 3BW4A 3WSUA 5GPRA 4N02A 3S1VA 5JH1A 1M3UA 1OIFA 3NQ6A 2VFFA 3VIHA 3QV6A 2R1LA 4QLLA 1ONRA 3LCWA 4GZJA 4GXMA 1FWIC 2HEJA 3N4EA 3GVGA 2XPKA 3WLRA 3ITLA 1TB3A 1VR6A 4UOQA 3R12A 1XLAA 2ON3A 4O18A 3O6AA 1KWGA 1ENUA 1MSSA 4LCRA 3VKJA 4GI4A 2HXUA 1J6PA 2NVDA 2QZRA 2ZRVA 2DIEA 1J93A 2B7OA 3EWBX 2WJFA 2YBTA 4DWSC 3BC9A 1W31A 4MJZA 3Q94A 2IS7A 2JEQA 1TIWA 3IACA 3F2CA 4D1IA 3MUCA 1O94A 1OFBA 2VR5A 2W79A 4S39A 3UZWA 4WVXA 2D24A 1Q3NA 4HQVA 4W9TA 3ECQA 3IJLA 2VEMA 2WBKA 2XH0A 4BF9A 3SCOA 1QI5A 3SO7A 4CD4A 4D1JA 1YTEA 3OB8A 1KB3A 1W17A 2C14A 2QHAA 3B9AA 4XAYA 5AC6A 4FNTA 3LA4A 4PZVA 3OA3A 3S9ZA 4QROA 4XTDA 1TV8A 4P5UA 2X1IA 4HNOA 3BGJA 4WRHA 4DX3A 3EX6A 1HTIA 4J1OA 3QVQA 3BPWA 2HRWA 1XLLA 2FTYA 3EXTA 3HV9A 1RCOB 4ADUA 2PRLA 1IEIA 2ISFA 1EUAA 4IPJA 1AL8A 1XBXA 5IDIA 4A2RA 4NILA 1NFPA 4JIEA 2DW7A 3GBDA 3VKCA 2VZVA 1BQCA 2DQXA 1PDZA 2EPMX 3RLUA 2J66A 5LIKX 1WAWA 4BS0A 3SUWA 1YPIA 2E40A 4MZYA 4GZIA 3AYTA 1I0DA 1XLHA 1TJ0A 4HNNA 4UTTC 1E55A 1C92A 1JZ6A 1MW2A 2PWVA 4Y2WA 3WLLA 4M51A 4MJMA 5T9BG 1FVPA 4FNQA 2CETA 4CCCA 2ZXDA 3N3TA 2HVOA 2FKPA 4AIEA 3P8JA 3MMTA 3L2LA 5BMXA 5CZKA 1R30A 2CLKA 3UCCA 1KRAC 4X60A 3BO9A 4A8IA 5FL0A 3ALFA 2BMBA 2WZTA 4LY8A 1OT1A 1EUNA 5GJMA 4LBRA 3G1HA 4X3ZA 2CLIA 1XLEA 4L4PA 5M03A 1I0BA 1JCYA 4ZODA 1L6GA 3IANA 2Y7EA 4UMBA 1WOAA 3KLLA 1US3A 4DNHA 4US5A 4PUEA 1D3GA 1OY0A 3B4YA 5I0DA 2J77A 2OSXA 2YOCA 1JI2A 3OPSA 5FJUA 4LJ3A 1BTCA 3WK2A 1QPRA 3M46A 3QKEA 2H9AB 3VC5A 1F5ZA 5G2IA 2PWUA 1SFJA 3LGGA 4G6CA 1R3WA 4IMFA 3UJRA 4DYEA 1UG6A 1G6CA 3I3BA 1MZRA 4EPEC 1BAGA 3N1AA 3UR7A 4K8HA 1TV3A 3KZSA 3H4XA 1GTEA 4MHBA 4NASA 1A49A 3BLFA 3VGHA 4M1BA 4TVDA 1H0GA 1OFPA 3RR1A 3DG3A 4N42A 3RPMA 3PJUA 5LA0A 1EOMA 3S5OA 4Q8QA 2ZA2A 4ECLA 2E7FA 3CHDA 1CXIA 1EZWA 1UA7A 1SW7A 1IXOA 4FOUA 3H7VA 3DKJA 1WXJA 3DFYA 5HPOA 3KP1A 4KWWA 4AHPA 4P7RA 3SBFA 2X0SA 2OZ8A 4PL1A 4KETA 1CW2A 2GJRA 3R94A 2XH4A 2A1YA 1JPIA 2AL2B 2BHYA 1JDDA 2YCEA 3WJWA 4AG0A 2QJJA 4QJ4B 5CPSA 4LWWA 2ZX9A 4C6OA 1PV8A 4U2YA 2UZ9A 4EPBC 4B2DD 5CJ5A 4WCJA 1EWDA 3GX9A 2CC0A 3PWIA 3TUUA 4Q7IA 1UP3A 5ABHA 2ANUA 1VC4A 3H21A 4KH2A 3V5CA 4W85A