4ADSA

Crystal structure of plasmodial plp synthase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
DYADNDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase/transferase
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
total genus 98
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4adsA00
3NVTA 3A22A 1OX6A 3NQ6A 3TFCA 1QMLA 1RV8A 3ABOA 4IPJA 3TU9A 3TC6A 2DZTA 2I9EA 5I3IA 1TPH1 2Y61A 3TROA 4MJMA 3OBKA 1LLZA 1VGAA 4NNBA 4Y9AA 4NVTA 3GAKA 2VOMA 3PAJA 3QM3A 3G1SA 1XI3A 1JCMP 3UY7A 2QCDA 1Q6LA 4MFEA 1TRDA 3GDRA 2HS8A 1R2SA 4N02A 4QJ1A 5D2WA 4XWUA 2VFIA 4ML9A 3R8RA 1GJPA 5CZTA 2V5LA 3LDVA 1KTBA 4UTTA 3N3MA 4IX2A 3FLUA 3PUDA 1F7BA 3MO7A 3W72A 2TYSA 4NU7A 4GFSA 4E38A 1VRDA 2OT1A 1VLWA 3L2IA 1A5BA 4GNJA 4UR7A 1FX6A 3QRHA 3W87A 3NQ2A 4PC8A 2Q3RA 1SSGA 3NQCA 3P61A 1QPQA 1W5MA 3NNTA 5D2YA 3M5ZA 3HG2A 4NT0A 4Y8FA 4O12A 3DFNA 4GWEA 1H62A 1EA0A 3DU0A 3P84A 2QJIA 2ZDRA 2YZRA 4FF7A 3W3OA 3QSRA 2QCGA 3A21A 4Q33A 1SPQA 1R46A 4LVBA 1I8JA 3SJ3A 1GG0A 3EXTA 3S1XA 3NZRA 3HGSA 2NV2A 3F4NA 5C54A 3TA6A 4M6VA 1M7PA 3GXPA 1H1YA 5D02A 3LOTA 3NQ7A 3W23A 3NAVA 1LOLA 2DZSA 4OHQA 4O52A 4L4MA 4JX4A 2Q3OA 3O16A 5AHLA 4X3ZA 1R2RA 2FJKA 3ELFA 1DKWA 1XC4A 2X1SA 1YLVA 3P5ZA 3W9ZA 4TX9A 1W3TA 3E0IA 4N9BA 3RLUA 4Z1BA 5CPLA 2GQAA 4PL1A 2Z6IA 2UV8G 4ZQOA 3L0GA 5D38A 2Z6JA 4DXVA 1F2JA 3GVGA 3PBWA 2O7SA 2AQWA 3W7CA 3QMTA 1GVSA 2V0TA 4QSHA 3T78A 5K7JA 2V81A 1MEIA 3BW2A 1FDZA 2A6NA 3NQAA 3CB8A 4LVGA 2VXNA 2G95A 1B4EA 4YCOA 5AOUA 4H6KA 3ZS4A 2JK2A 1XDLA 2C18A 1MEHA 2NUYA 1WQ5A 3W7HA 2X1TA 4JYFA 5E0KA 3EXSA 5G4WA 3UPBA 3FJLA 2X2GA 3LXCA 4FIQA 3O6DA 1SZEA 1VQTA 3TKFA 3W2LA 3W7IA 3B06A 1FCVA 2CZEA 5DXYA 3GR8A 4P61A 4JS3A 2FB2A 2Y85A 1TMHA 3C3NA 3LHWA 3M47A 3SSJA 2CLIA 4K8EA 3BG5A 2E6YA 3GAYA 2PC4A 1JCJA 2CZFA 2J9XA 1IIHA 4IJBA 2Q8ZA 2ZBTA 3C2VA 2A0NA 2NX1A 3ATYA 3W7DA 2Y7FA 3NOEA 1W5NA 3NL2A 1YDOA 3CHVA 4JTJA 3HMJG 2CLEA 2WV8A 1TV7A 3O05A 5AHFA 2OT0A 2OZ0A 3JR2A 3YPIA 3P62A 4LS0A 3FYOA 1FCBA 1W54A 4UTHA 3M7WA 4GUGA 2ABBA 3LHTA 2QF7A 3DFPA 5HR7A 3DFSA 5D2TA 4Z1DA 1QPRA 4HT3A 1RD5A 3U8GA 2ZA2A 4UTWC 1OF8A 1FWTA 3SGZA 4MPQA 1Z44A 5L9FA 3I7RA 4R34A 4UFKA 3O6YX 2CLKA 3RLVA 3QEZA 3W7PA 3GR7A 4NX0A 3TSMA 4GC4A 3M0ZA 3W1XA 3T7VA 2DJXA 4R7JA 1WBJA 4E2DA 3C2RA 2QUUA 2ZTKA 1SSDA 4JTFA 3L65A 5D09A 2DP3A 1NEYA 3O1NA 2C1HA 4CNPA 4MZYA 3TCEA 4WXYA 2A4AA 1DL3A 3UWVA 2VENA 3WK0A 4RZ5A 4MY9A 2Z0IA 1I45A 2BLEA 4A2SA 1KM0A 3M6YA 1N8FA 5A5WA 4O1BA 4ONVA 3IIZA 5AYYA 2ZRUA 1OFPA 5LHEA 2P1FA 5DCBA 3PG8A 3QJAA 2B0MA 3A23A 4BR1A 2E77A 4O4VA 4UTMA 1W37A 4P2VA 5K9CA 3LRKA 1X6UA 3E49A 2P10A 5I3HA 3LCXA 1MSSA 3KRSA 2J88A 3F1QA 4FXSA 3OEXA 1J5TA 2H90A 4LUJA 3TJXA 3S1UA 3W86A 4FB7A 2NUXA 1GZGA 1ZENA 1YXYA 1TB3A 4ADSA 1OX5A 1OX4B 1ZAIA 4JXCA 5D32A 4JY9A 1ZJIA 3H53A 3ZR4A 3WFAA 3PSVA 5I3JA 4I7VA 4RLIA 3T44A 1N7KA 2B7PA 4JYDA 4Z0SA 2EF9A 3IGXA 1BKSA 3QC3A 2GJLA 3O06A 5AHMA 4O17A 2CU0A 4M6QA 5CG7A 1ZHAA 3G1DA 1LOSA 3L5MA 4Q32A 5FF2A 4JICA 1WYIA 4MFDA 3VNDA 3SI9A 1IIGA 4LRSA 4UFIA 4MIMA 3CIWA 1F5ZA 2Z1BA 3KVMA 3SZ8A 4HIBA 4ZQPA 3R12A 2YW3A 2BXVA 3LHUA 1AW1A 2PRHA 3H54A 4JIQA 1ICQA 3PUOA 4UFLA 4JTHA 4OV4A 1IXNA 4K38A 3GXNA 5I3GA 4GRSA 3NQVA 2E6FA 1FXQA 2CLHA 2GVJA 1OG0A 1KM5A 3F4WA 4OV9A 3PBYA 1KFKA 3N2XA 2Y7EA 1W56A 2B4GA 3WJXA 1YADA 3GNNA 3C2OA 1M7OA 3G22A 6TIMA 1KTCA 1S5WA 4JDYA 4XBSA 1SZNA 2Y70A 1OX4A 1YDNA 1OFEA 1Z41A 1NFBA 2CLMA 4WZHA 3IIOA 1OFOA 3W7LA 3MI3A 4O28A 2ABAA 3W74A 5BNKA 3QFEA 3S5NA 4EIVA 1YTEA 1PL9A 3I68A 3PBVA 2A21A 3NPVA 2H8ZA 2QJGA 4HSNA 3NEVA 5K9XA 4IMEA 3M1ZA 4O19A 2P0OA 5HWMA 1BWLA 2QCNA 2O7QA 3FJ6A 2A1YA 1GVFA 2C3ZA 1EP2A 3QQ1A 2VFEA 1MXSA 1DOSA 1GVOA 2E6DA 5KZMA 3NL5A 1O60A 1O94A 4XKYA 3O6CA 5HJLA 4A22A 1KTNA 3G0SA 3QMRA 4KWWA 4DF0A 4GJ1A 1FCUA 5J5RA 2V30A 3TX9A 5EBUA 4I9AA 1WAUA 4KKXA 2V8ZA 1TO3A 4NZJA 1ONRA 1LRQA 3MBFA 4LV4A 3EX4A 1NSJA 4ORMA 4LS1A 1XBVA 4UTJA 1DJNA 5FF3A 3L67A 2VELA 4JX6A 4AMAA 3TJLA 3LCHA 3LXAA 3P7YA 1TV8A 3B8DA 3G1VA 5TQLA 4IMCA 2H8XA 3EKLA 3NQEA 1V5XA 4BK9A 5EY5A 1WOBA 3AO0A 3DENA 4HHPA 3W1PA 5F2LA 3LRMA 5G2WA 4WUIA 1VJIA 3G24A 4FNUA 5F2MA 3LHZA 1SW3A 3W75A 1GTEA 3I7QA 2ZQ0A 4O10A 5AHEA 4R53A 2C16A 3EB2A 4JTLA 1KM3A 4O57A 1Q6RA 3TXVA 4AHOA 3ABSA 1OFQA 5LKYA 1PV8A 4HPJA 2QCLA 4XBKA 3WK3A 1KBIA 1K8XA 4XTDA 3HPXA 5BW6A 2YCEA 4WY0F 4UMBA 1D3HA 3FOKA 4FX6M 4NXSA 2NXHA 3LI1A 2KZHA 1FWWA 1JQVA 4XZ9A 3C2EA 1CX9A 3W1TA 4TR9A 2NX9A 5ABTA 4I7UA 5FESA 1UUOA 1DVJA 3GB6A 4KFOA 2J6XA 5K9DA 3S1WA 3PC0A 1GYLA 5AB3A 5HWNA 3HJZA 1AL8A 6ALDA 3LTPA 2ZA3A 3B04A 2VC6A 3I65A 1F76A 3CPRA 1JCYA 2AAMA 2FTPA 3W2NA 1HL2A 3LCIA 3FA5A 4FX8A 1TTIA 3HGRA 1VPXA 5DY3A 2B7NA 4JX5A 1QFEA 2FLIA 3THQA 1W5PA 3L21A 3MHGA 1E51A 4JTGA 3W7JA 3W07A 3EWWA 1YXCA 2QDHA 4O18A 3KRUA 2QCEA 1ML1A 4K39A 4LVDA 3FIGA 2WSRA 1QO5A 1LDCA 2OMAA 5T26A 3P82A 5D03A 3T55A 4JTTA 4TMCA 4OWGA 3CWNA 3NQMA 1H60A 3OIXA 2QCHA 2NV1A 3INPA 3UQNA 1Q6QA 3G3MA 1IXQA 5K3VA 5EA9A 2YR1A 1RZMA 5I3FA 3UXAA 1YXDA 2FQIA 4YXGA 3W7NA 3W2JA 2C19A 4WQ6A 3C56A 3SGUA 2ZTJA 1SZFA 3DFTA 3LHVA 2YFOA 1EX5A 1ZAJA 2ZRXA 4MVAA 3JRKA 5C55A 3L66A 1H7XA 4NJJA 4BI7A 2WKJA 1SR9A 3FYPA 5F1UA 4FXRA 1EWDA 4IX0A 1EP1A 4MOZA 3KVLA 4QAIA 3M41A 1ALDA 2JKAA 4NNAA 3BK0A 3DKLA 4BI5A 4K7VA 1TTJA 4A2RA 5DELA 2EKCA 4AWSA 2OJPA 4UC5A 4FO4A 2ZA1A 3G18A 4CCEA 1FDYA 2PRLA 4UFJA 4XUGA 3FKRA 3W84A 1L2UA 4O53A 2XFWA 1ZFJA 5BRBA 4XKYB 3THAA 4ZVJA 4GE8A 3MHFA 3IRDA 5CGQA 3MJYA 4I7WA 2BZNA 1JRBA 1ZALA 3TIMA 2VFDA 3FS2A 3R13A 4ZZ9A 2HS6A 1H51A 3OVQA 1OHLA 4MZ1A 3NA8A 2I1OA 4AF0B 3CTLA 4RXGA 2ISVA 3PG9A 1GG1A 1U5JA 4UFMA 1VHCA 4CLMA 2C14A 3A5FA 3B05A 1DJQA 3BG9A 2CWNA 4MKNA 3GDMA 3NPUA 1O5KA 3NXFA 3VCRA 4OU1A 2JGYA 1H5YA 3W1NA 3NYZA 2DZVA 3GDLA 3MUXA 4N6EA 4GUHA 1VYPX 1GVRA 1GYNA 2YYUA 2G96A 1XCFA 1A53A 1FQ0A 2GQ8A 4DPPA 4QITA 4O13A 5KITA 1OFRA 3UWQA 4FNQA 5CPMA 3WJSA 2J9YA 4HSOA 2A2IA 3IVTA 1H7RA 4CCDA 1YDVA 1TYGA 3RF9A 1NF0A 3R5EA 7TIMA 3NGJA 1TIMA 4FHAA 2ZRVA 1W1ZA 3IIVA 3MP3A 3HGJA 1TQXA 2YPIA 4LV9A 1LRNA 5HULA 3K30A 4KWVA 5C5YA 4NX5A 3IEBA 1XKYA 3SIZA 4JTUA 3HB9A 2R94A 4H4IA 3LCWA 4O15A 1LZOA 3TR2A 4MZ8A 1W3IA 4NNCA 3G8RA 3GKAA 4IGHA 1LBMA 3CC1A 4BI6A 3EWZA 4AWUA 3C2FA 1XDMA 2ZZ3A 2A7PA 2GOUA 3P80A 1KBJA 4NJHA 2WNNA 3T40A 1QDSA 4JR5A 2C0AA 4A3UA 1KV8A 5CPNA 5DCDA 1WA3A 2BWGA 4KFPA 4WOQA 4IXXA 3W2KA 3G0XA 3QW4B 1TPWA 1K7EA 1X1ZA 3L68A 1GEQA 4RZ4A 4UTTC 2HMCA 1P1XA 2QDGA 2NUWA 3EWXA 2DZPA 3W88A 4FNTA 3BLIA 3PULA 1H7NA 3TDFA 1H7OA 3PSWA 1WX0A 5CZSA 2Y7DA 8TIMA 1Z48A 2EAWA 4N4QA 3W83A 1J2WA 3HF3A 3NO5A 1TJPA 1DORA 5FEXA 4O16A 1XBYA 4UFHA 2VEKA 1BEUA 2WSQA 3PS7A 1EWEA 2JBMA 3PY2A 3IVSA 4WD0A 3MP5A 4K37A 3KOFA 1XFBA 4ZQRA 4DO5A 4Z1AA 1KFBA 2E68A 4PODA 3W7EA 2YYTA 3ABRA 4JTKA 1S3HA 2QAFA 1D3GA 3Q37A 3SECA 4YMZA 3L0KA 4UR8A 1WXJA 1WOAA 3BLEA 3OG3A 4NQ1A 1A5AA 5C6MA 2F7FA 2ZRWA 3HG4A 1KM1A 1EPXA 1FY6A 3N34A 5FF4A 3U2OA 5LNUA 2D73A 2CW6A 2NX3A 5K4ZA 5AN7A 1KLZA 4WY0A 4JNMA 2V2DA 5CSRA 2RFGA 4RXFA 4JTSA 1HG3A 3HGOA 4MLRA 1YYAA 2EHHA 5HINA 1DQWA 4JIPA 1TPB1 1G6CA 3KVKA 4EOUA 3V75A 1FWSA 2X1UA 4CNNA 1S5VA 1M6JA 4N4PA 5AC8A 3MP4A 4Z1CA 4UIOA 1G7VA 1QO2A 3CWOX 2ZRZA 2ZZ6A 4MY1A 4WJEA 3M5XA 3QF0A 5IBXC 3C52A 5LHFA 2VEMA 1VZWA 4FIRA 1G69A 3HIJA 1YTDA 2QUTA 3PB2A 5DCEA 4JGDA 2G5WA 1R30A 1JVNA 5HUPA 5MHBA 5AHIA 3S5OA 3TFXA 4NJKA 1ADOA 3WJYA 5KINA 2QAPA 4TO8A 3A5VA 1RVGA 4MY8A 1OJXA 4MLJA 2A7NA 3H55A 1ICSA 3W85A 4JEQA 4PL2A 2ZZ4A 3P8JA 2BSLA 4TIMA 1JUBA 1IGSA 2G97A 1JCLA 2VFGA 3QMSA 4O54A 3NPWA 1RPXA 3RMJA 2ALDA 1EB3A 5AC6A 1M5WA 4TMBA 2JKEA 3IGSA 3A24A 3TUUA 1TRIA 1SO3A 1G7UA 4LWWA 1C29A 1GPWA 4EVZA 5FF0A 1I2RA 4UXDA 2XN0A 2PCQA 3LCFA 5G2HA 1FCQA 3NG3A 4K6AA 2PE4A 1GQNA 1MZHA 5DXXA 1OFBA 3FEMA 4LRTA 5F4XA 5D30A 3B4UA 5HR6A 3OA3A 3TK7A 2E1DA 2V2HA 1VR6A 2CZDA 4UTIA 3NM3A 4PA8A 1GTHA 3TAKA 1SFJA 1FXPA 1S5TA 2WO5A 1L6SA 4QM1A 3VE7A 2DORA 3DFQA 1VYRA 2OCZA 2PRMA 1U83A 1EIXA 5DY2A 5EL1A 3BW4A 4JTIA 4UTLA 4BWLA 3I7SA 3UWWA 4GUJA 3W1QA 1W5OA 4CQ9A 3EKZA 2YW4A 1FBAA 1H63A 5CSSA 1SO5A 1LORA 4FNSA 5BOOA 5L6UA 1QAPA 4FNRA 4S2BA 3W7QA 1TPDA 3G0UA 3BV4A 1L6YA 2J27A 2WPBA 1XM3A 2E09A 2YDAA 3P5YA 2QCDB 5U7SA 1I2NA 1T99A 4Y6GA 1SUXA 1KFEA 4AH7A 4ICNA 1P0NA 3W6YA 1CI1A 3IGUA 1UB3A 3W22A 2JKPA 3ZWSA 4NZFA 3KFTA 4HNTA 4O1AA 2ATSA 4RZ6A 3DXIA 5FEWA 2Y89A 1UASA 4OGZA 4OT7A 2JGQA 1SW7A 4RR4A 1TPC1 2NZLA 1OYAA 5TBOA 2VEIA 3E02A 3MBDA 2DZUA 3EX1A 2Y7GA 4RV8A 2A6LA 2E5DA 3PR2A 5LNVA 3LRLA 1Y0EA 2TRSA 4BF9A 1F05A 3CU2A 3W7OA 4EF9A 1LBFA 3STGA 3TC7A 3HPSA 1KA9F 1KFJA 3NQDA 1IXPA 2WSYA 3EX6A 3M43A 1TJRA 4UMAA 4JDBA 2V2CA 1X7FA 3G3DA 1EEPA 5KZEA 4GUIA 5AFDA 1V7YA 1ME7A 1SO6A 4RX0A 5D04C 5F4WA 3ANYA 4AWTA 5F2GA 1OK4A 3CEUA 2C15A 1W0MA 2DZXA 1LROA 4OE7A 3LLDA 3TQVA 3LI0A 3NR0A 3LB0A 5J5DA 2WQPA 5F2IA 2GVLA 3FFSA 1JJKA 4DF2A 1LCOA 2E6AA 1OK6A 3PM6A 3MW7A 3U6WA 4LU0A 3W76A 2RHGA 1AG1O 2PURA 1HO4A 1HO1A 3W2UA 5E93A 5IBXA 4CQAA 5G1YA 5D33A 4WOZA 4M19A 3G8EA 1OF6A 1P0KA 4GBUA 4IMFA 1Q3NA 2B7OA 2C13A 4S1FA 5DN1A 2ATMA 3NQGA 4MJZA 3TW7A 2TPSA 3TSBA 2GUUA 1GWJA 2V5BA 3BW3A 3OVPA 1G4TA 2RKXA 3CT7A 5BMXA 2ZZ2A 2J9ZA 2E5CA 1ICPA 3STEA 3KHJA 4N9CA 4XQ6A 4CNOA 4M5PA 3W1AA 3R89A 1RR2A 3RU6A 4B5NA 3NZ1A 4IOTA 1YPFA 4HN4A 1VYSX 3BO9A 5EKYA 5DBUA 3C61A 1EP3A 2VFHA 3G1XA 3IVUA 4AF0A 1SW0A 3G1AA 3L5AA 3VKJA 1PIIA 3WK1A 2ZYFA 4GUFA 2GJNA 1LOQA 4DQWA 1JUKA 3LCLA 1JULA 2B7QA 2QJHA 1K03A 2R8WA 3M5VA 2BTMA 5KSWA 1D9EA 3VE9A 5EMUA 5D2XA 4ADTA 3TW6A 1JQXA 1XBXA 3B0UX 2FIQA 5CZ0A 3W1UA 1JUEA 2QR6A 4RK8A 2EPHA 3W7KA 5KZDA 2RDUA 4O1DA 4QIUA 3BG3A 3USBA 1JCXA 3PWAA 2XN1A 4X2RA 2RH9A 3GX9A 3HG3A 4U28A 1L6WA 4DF1A 4C1LA 5D05A 4AB4A 3LM7A 2W0UA 3DBPA 1UUMA 2NLIA 4ADUA 3VI2A 2GQ9A 3RK8A 1F6KA 1XL9A 4K7YA 4HKPA 3UPWA 3IIXA 3CQ0A 4LS2A 2TMDA 3KX6A 3G1FA 3M44A 4AAJA 3P8IA 3C4UA 3S5YA 1K7FA 3W7MA 1A5CA 3P60A 4CQ8A 1P4CA 5AC7A 1W8SA 1TV5A 3UZJA 5F4SA 1FWRA 2Q8LA 3EEGA 3CIXA 1R47A 2QCCA 3GYEA 3S5ZA 5D37A 3EXRA 1T8XA 1LLWA 3E96A 2V9DA 4K8HA 4S2CA 3SFKA 3FKKA 1QNVA 1GVQA 1SZGA 2QCMA 3C8FA 4C1KA 4LNYA 4ZQCA 1F74A 4N2YA 3N19B 4UNLA 4JY8A 3TXZA 5G2IA 2ZZ1A 4DBDA 3OVRA 5A8GA 2QEZA 1LM1A 4ORIA 3GKFA 3WJZA 1B3OA 1BTMA 1VHNA 4O50A 4QNEA 1K02A 4UTWA 1K3UA 3LBMA 3B0PA 4HNUA 4JN6A 4RKAA 1QR7A 2DJLA 1OFDA 4X9SA 4JD4A 3LV5A 4M6PA 3W1LA 2EGZA 3MYPA 1PVNA 4YL2A 4DPQA 1I2OA 1KFCA 1NVMA 5LGZA 3GNDA 1SO4A 4LOCA 2WOQA 4PH6A 3C0JA 1WDWA 1XUUA 4MUZA 2IQTA 1C8VA 3E9AA 4IXHA 4O8RA 3DI0A 3HBLA 4KFNA 5KTLA 2E5BA 3I6RA 1LRTA 1KW1A 2RDWA 4Z0JA 4QQ3A 3TMLA 4YLWA 4AHQA 2YFNA 3DH7A 3JS3A 1KV5A 1LTDA 2FPVA 1VS1A 3HO8A 1I4NA 4LTSA 4WX2A 5IM51 3S1VA 3GK0A 2ZCGA 1SFLA 3PBUA 1KM2A 3UYCA 3LTSA 4FNPA 3P67A 3IIPA 2DU2A 4NJGA 2FFCA 5LNSA 3NDOA 1O95A 1K8YA 1H7PA 3TNOA 1B4KA 3V1PA 1DQXA 5FF7A 1QWGA 3PUEA 5HQEA 1K7XA 4D2JA 3S0CA 1SU5A 3DFOA 1WBHA 1C9DA 4RCXA 4O1CA 4ZQMA 2CLFA 2ZZ7A 1LYXA 1X1OA 1QOQA 3L5LA 3TH6A 3UD6A 5K2ZA 1LP6A 3NPXA 1RQHA 1AL7A 1DHPA 3DI1A 3N9SA 4WXZA 1OVDA 3GDTA 3NQFA 2CLOA 4LT9A 3DHDA 2HTMA 2ZRYA 4NUWA 2WJZA 1Q45A 4HPXA 3TQ0A 2CFFA 1Z42A 3TMQA 4PCFA 4TU1A 3RNDA 3KVJA 3W70A 4UNKA 2HSAA 4YCPA 2CLLA 2R14A 4IWWA 1G4SA 2QKFA 3W1RA 1EUAA 4AVFA 2BX7A 3GDKA 3W2MA 1RQEA 4IMDA 4JTEA 4HNVA 1PCWA 2RDTA 3WJWA 1QPOA 4GXMA 1HUVA 2H6RA 4PFMA 5SWUA 1XXXA 2FPYA 4H3DA 2A7RA 2WNQA 1SQ7A 1VH7A 5CZJA 3TE9A 3STFA 3N2MA 3ZWTA 3S6DA 4AHPA 1PHQA 1YPIA 2ZZ5A 3UXDA 4M7TA 3M5YA 1ZCOA 5KMYA 4LUIA 1JR1A 4QISA 4EF8A 4EWND 3R2GA 3W71A 3LXBA 2VEPA 4LC6A 3O07A 3ABQA 2A85A 3W73A 4A21A 2R91A 5AYZA 1H61A 3SW6A 3GLCA 4N9DA 1K8ZA 3NL6A 1TPVA 3B0VC 4QNWA 4LW7A 1JCNA 4O0ZA 3LV6A 2NXGA 5G5IA 1R2TA 3A9IA 1FDJA 1L9WA 1KFLA 2NXIA 3BPWA 4MYXA 5D2VA 5F1VA 3NQ8A 3QPZA 3N14A 4IQLA 1EUNA 1JRCA 4OQVA 4Y96A 1NF7A 2LLEA 3EX3A 4NXKA 4ZQNA 3LX9A 2I14A 1ZY9A 3KXQA 4DBEA 1PE1A 2H3DA 1H50A 3LTYA 3MMTA 2Y63A 4E0CA 1J4EA 1THFD 3TAOA 4DEFA 2FDSA 1TREA 2F84A 1TPEA 4ZMGA 3DHFA 3GXTA 1OFAA 3MI2A 4O0KA 4YWIA 5LNWA 1QPNA 2Y88A 1AMKA 2Y6ZA 1GOXA 3M9YA 3W7GA 3B03A 1B57A 4Y90A 4M7SA 4PEKA 3BLFA 1PS9A 3EX2A 5EYWA 4Q4KA 3KAOA 5I3KA 5HMSA 1QCWA 3QH2A 1PHWA 2J24A 4DO6A 3SY5A 1HTIA 2H3BA 3DAQA 4R33A 3T4CA 4L4LA 4UMCA 2QCFA 4DO4A 3QW3A 1O5XA 1TQJA 1VCGA 4AXKA 3QZEA 2WNZA 5C2XA 3BARA 3CLMA 4IPIA 3GIYA 4K36A 1ZNNA 3BGGA 1A5SA 4BWLC 1G4PA 3UWYA 3N9RA 4IMGA 1AW5A 1IXOA 5BMWA 3ZFHA 1W3NA 5FEPA 3VFLA 4UUIA 1G67A 1XUZA 3MYOA 3L9CA 5DBTA 3PVFA 1FWNA 1I2PA 3G1HA 3DGRA 1HFBA 4FX7A 4NJIA 4LY8A 2VKZG 1W31A 1GT8A 4BFAA 3LGEA 1TPFA 1BWKA 4ZL1A 3ATZA 1OYCA 2DZWA 3UWZA 1NAL1 1DV7A 4Z08A 3OHIA 5LSMA 3W7RA 2X1RA 2ISSA 2XN2A 2QUVA 3Q2DA 2C6QA 3O63A 5U4NA 2YSWA 3TSDA 1OYBA 1UJPA 3AJXA 3MWAA 1O4UA 3M16A 1VLIA 5HWJA 1DBTA 1W5QA 2YXGA 4POCA 1OABA 2FB3A 1TSIA 2X16A 1XBZA 3BVJA 3RFAA 2FPTA 5HNRA 3S8HA 3F03K 1KM4A 1A50A 3HQ1A 2V82A 4WY0B 2W6RA 4G1KA 3IV3A 1X8FA 4LC8A 4X22A 3S42A 1ME8A 1P5BA 4XTIA 4ALDA 1VC4A 3LERA 3TQKA 2TSYA 1ZAHA 3STCA 1H1ZA 3G1YA 3N73A 3QYQA 3HOJA 5LNRA 4LVAA 2AGKA 2ISWA 4CCCA 5AHNA 1UBSA 2CZ5A 1YTKA 5EPDA 3WK2A 4UTUA 3LLFA 3MHUA 3NM1A 1TTQA 3E12A 5H2ZA 3O15A 5H91A 4A29A 5DLCA 1PCKA 1QOPA 3EWBX 5CPOA 1F6PA 5G1TA 1RQBA 4E2BA 3Q58A 2A5HA 4PTNA 3P74A 4AEOA 3Q94A 4UCGA 5HUOA 3P81A 1B9BA 1LBLA 4N6FA 4O11A 5E1QA 3GZ3A 2GVGA 4FEZA 1T0OA 5AYXA 1TCDA 3SR7A 1G4EA 3C6CA 1TPUA 2GPTA 1KLYA 5LZLA 1Q6OA 1F73A 3QSTA 3UNDA 1H7WA 3MI6A 4J9JA 4N9EA 3LCGA 1CW2A 5GVJA 4IUOA 4RJEA 3UY8A 1VCFA 3KRZA 1T96A 3S9YA 1UCWA 2Z2UA 4LVFA 5G4EA 3PB0A 4U4MA 5K4XA 3LBCA 3EWYA 3D0CA 5FEZA 4HNNA 4JYEA 3UWUA 3CEPA 3QQ0A 4OBTA 1ME9A 2VFFA 5CKSA 3DKJA 3EWUA 4DELA 3HPZA 2OX1A 1AK5A 5LGXA 3BGJA 5FI8A 1IF2A 1I2QA 3TV8A 2YGYA 1AW2A 4MYAA 2NWRA 3W1MA 3O8AA 2Y62A 1N55A 2NWSA 2ZFAA 1VCVA 2X30A 1KM6A 1MO0A 4O4WA 2YX0A 4O14A 2W79A 1WV2A 3NL3A 1TTPA 3DZ1A 3HG5A 3L0NA 3CM4A 3PF3A 1FUYA 3UZ5A 4W9TA 5TIMA 3LHYA 3QPYA 4UTKA 1MEWA
chains in the Genus database with same CATH superfamily
1UPPA 3PHAA 4LEQA 1QMLA 2BBFA 3T6CA 1NU5A 1UWUA 2I9EA 4KWSA 4C5YA 4MJMA 2DVUA 4Y9AA 4DJFC 3GAKA 2EPNA 1NOFA 3QM3A 3G1SA 2PDUA 1Q6LA 1TRDA 5CEWA 3LK6A 4XZNX 3CHCA 4IPNB 5D2WA 7XIMA 4ML9A 3R8RA 3U57A 4F0KA 1XG4A 3PZGA 3EMZA 5A1AA 1JDAA 2VRJA 3XINA 4I5XA 4H9VA 1F7BA 4FZIA 2HZGA 4NU7A 4GFSA 5E0CA 4E38A 3RHGA 3PTMA 1VLWA 4F3HA 2Y8UA 1A5BA 3D6NA 5A8MA 4K3ZA 1L0PA 1ZGDA 3WQ5A 3ZQ9A 1V7AA 2KAUC 4ASTA 3U2EA 3ALFA 3HFYA 4DLMA 2QJIA 1R3TA 2EKGA 2YZRA 3M0KA 3W3OA 4WF7A 1U1JA 3QR0A 4LVBA 4XG1A 2WVTA 4DLFA 2XZ9A 1E55A 1GG0A 3EXTA 3OHMB 3TA6A 1E4LA 2WCAA 3QTPA 1QBBA 2VNCA 2PD5A 1W3HA 3GXPA 4KWOA 5D02A 3LOTA 1M01A 4DUWA 3IJQA 3NAVA 1WKFA 1GKRA 4JX4A 3IJDA 1E70M 2Q3OA 4YTUA 3EDEA 1TE6A 3LG3A 4J3SA 4LUTA 5CCZA 2VR2A 3MUY1 4TX9A 1KR1A 3RLUA 4N9BA 4ZTXA 3SCQA 2OU4A 1E9LA 1F2JA 2O7SA 5A2CA 5K7JA 3L2LA 3BW2A 3AU2A 2W91A 2UY4A 3S4TA 3ARRA 2WHJA 2A6NA 3CB8A 1M03A 1E40A 3RR1A 2VCCA 1YE6A 3GHTA 4W86A 4DZIA 3Q67A 1PZ1A 5BU9A 4V27A 1R87A 3OQ8A 1WQ5A 2DV0A 4ZO9A 1J01A 1QVBA 4JYFA 3WLQA 5G4WA 4ILSA 2BY2A 1YRRA 4YYCA 2EG7A 3O6DA 1SZEA 1VQTA 3PNZA 1QOXA 2GJPA 4J3ZA 1GQIA 2EO7A 3IK2A 3B06A 2CZEA 3KE0A 1TUFA 4JS3A 3LHWA 2Y85A 3C3NA 3M47A 2FFIA 4L1XA 4ZODA 3GAYA 3AJ7A 1XPGA 2J9XA 1A4LA 3NIYA 1TZ9A 2NX1A 3A4JA 3DC0A 4ZR8A 1E3XA 4EE9A 1W5NA 3CHVA 3O0FA 4J35A 2OT0A 2OZ0A 4H9ZA 4RDWA 4ZA0A 1W54A 2BOEX 6CGTA 3HMCA 1M3UA 3DFSA 2I57A 1IZJA 5JUVA 1S2VA 3QN3A 4C1NA 4B5WA 4DXKA 4IIGA 4JTAA 3O6YX 3WD1A 2PDWA 3CL7A 2J7HA 4NX0A 2QPSA 3WF4A 2OEKA 3ALGA 1J18A 3GD6A 5KZ6A 1JYVA 1MW1A 3GU2A 3NZQA 4W8AA 2DP3A 5DMYA 3W26A 2VWSA 4CNPA 4WXYA 4E8GA 2A4AA 3R0KA 3WK0A 1I45A 4GACA 3PTKA 2OODA 4A2SA 3M6YA 3VIOA 1CT5A 1N8FA 1NARA 5AYYA 1QNOA 4OTKA 1KCKA 4JIEA 4BR1A 6ENLA 1JZ3A 4F2UA 1M53A 1XLIA 1TMLA 3W25A 1X6UA 2X0SA 2PWVA 2J88A 3E0VA 4WGXA 1V79A 4FXSA 3SSZA 3UR8A 1JI2A 1Z32X 5IFPA 4DUOA 3W86A 3GWQA 3HFTA 1ZENA 4HNOA 4S23A 3ES7A 1YXYA 1XIHA 4JXCA 3GG1A 2PWFA 1JPKA 3H53A 3CZ8A 4H2HA 3S9ZA 1GW1A 3UR2A 2ESCA 4KRUA 4JYDA 1XCWA 4P8XA 1BKSA 4IHCA 6PTDA 2F2HA 1SJCA 1UD6A 1UUQA 5GJMA 5CG7A 1ZHAA 5PTDA 3G1DA 1XINA 3MVIA 3VNDA 3EDKA 1LJYA 2J74A 1PYFA 3CIWA 4B5XA 3KVMA 2V3EA 5LYRA 3GH7A 3NJ3A 3WD3A 3VNMA 3V16A 2A3EA 3TWAA 1S1PA 3QHMA 3BANA 4JIQA 4BQ4A 4JTRA 1ICQA 3WF0A 1XYZA 4K38A 3E2SA 2CLHA 5T8GA 2XVNA 3MCMA 3WX7A 1OG0A 4GH3A 3H7RA 1DIKA 2JALA 4OV9A 5FL1A 6REQB 3N2XA 1V3MA 4CD8A 3IGHX 4HCLA 3GH5A 3C2OA 5GNXA 1M7OA 5JMUA 3LNPA 1S5WA 3H23A 4AIUA 3KBVA 4FPSA 1KXTA 2YOCA 4Q4OA 3U2ZA 1YDNA 1OFEA 1Z41A 4W88A 2ZADA 1J10A 1OFOA 2ABAA 3W74A 1L8NA 5BNKA 4JN8A 1GOKA 2J47A 3I68A 5HPCA 1LL4A 3NPVA 2GDVA 4F4RA 5I09A 4HSNA 3NEVA 2WVVA 4O19A 1RPKA 4D6EA 1BGAA 4WRHA 1OCBA 1XLCA 1FHVA 4IH3A 4L1GA 1DOSA 1O60A 3RRXA 4LCSA 5D8ZA 1B3ZA 3O6CA 3PZMA 4GO9A 7CGTA 3G0SA 5C7VA 4I9TA 4DF0A 4YYFA 3NVDA 2V30A 4KKXA 7A3HA 3U4FA 4NZJA 1PJ9A 4LV4A 4PMNA 4QQUA 1NP2A 2VELA 4Z2KA 1O6IA 3TJLA 3QV9A 1DE5A 4BK9A 5EY5A 1WOBA 4Q8QA 5C2CA 2QMJA 3FHQA 4HHPA 3W1PA 4WR3A 5G2WA 4WUIA 2Z1WA 4RDVA 4ML4A 5DANA 4FNUA 3LHZA 2V5JA 3I7QA 2YL9A 4DI8A 2W61A 2EEXA 2JEPA 5AHEA 4ZB5A 3EB2A 1PKMA 2VYOA 2P0IA 5LKYA 4HPJA 3V5FA 2QCLA 3GC5A 3TQPA 1AQFA 3OBAA 4PUWA 2ASHA 3O3RA 3AWOA 1P6WA 1JPIA 2RUSA 4NXSA 1BLIA 3GIPA 3SY8A 1UUOA 1DVJA 5HJYA 3PP7A 1RCQA 1GOQA 5K9DA 3TLLA 3S1WA 1A5MC 3HURA 3PC0A 1AL8A 4HD5A 2AAAA 3GC4A 3CPRA 3WLLA 3CYVA 1J8VA 5H8MA 1EDQA 2AAMA 2ZUMA 4FX8A 3NZPA 3HGRA 1VPXA 4LUSB 2QDDA 4JX5A 3THQA 3L21A 3E38A 4EPDC 3T8LA 3NOYA 2QLYA 3UYIA 3AUOA 4TVUA 3MWCA 4F2TA 4ZOCA 4K39A 3FIGA 2WSRA 3UJFA 2OMAA 2Z7GA 4A3RA 1UP3A 4HK6A 1FTXA 1TE1A 3VPLA 1HIZA 3UVIA 5JIPA 4JTTA 5C9ZA 3FXYA 1H60A 3NQMA 3FK4A 1OBAA 2OELA 1OADA 3E2VA 5EA9A 1RZMA 4LUYA 4ATWA 4B5SA 2C19A 2IXUA 1OSEA 1LWIA 1LF1A 3LHVA 1EX5A 1ZAJA 2BV9A 1H7XA 3VDGA 4HU0A 5F1UA 4FXRA 2R1MA 3NEHA 4IT1A 4XZIA 4L9ZA 1PDYA 4QAIA 3AC0A 1TJ0A 2WZTA 3M41A 3WQ8A 5FCZA 4NNAA 4UWMA 1S2WA 3WELA 1CPUA 1R3RA 2OJPA 1BG9A 2ZA1A 5MF5A 3VFCA 2Z2AA 4YWSA 1YEYA 1W8GA 2TAAA 4UFJA 1WDPA 4O53A 4H2CA 2XFWA 4XKYB 3THAA 3R43A 4ROPA 4GE8A 3GTNA 3MHFA 3IRDA 3MJYA 1UD4A 3CZEA 3OGRA 1H51A 5A6SA 1XRVA 2ISVA 3PG9A 4QSFA 2DY3A 1VHCA 4US5D 2E4TA 2Z2BA 3VCRA 3VKAA 3W00A 1UD5A 1E9YB 1H5YA 2WKGA 5I03A 3K8LA 1HJXA 4CU8A 3WQ4A 2DIEA 3Q4DA 4F79A 3DBNA 1GYNA 2XINA 3NXLA 1A53A 4QDMA 1Q7QA 4C7DA 1FQ0A 2PB1A 2OGYA 4O13A 5KITA 2J9YA 4HSOA 3VD4A 1CGYA 1TYGA 3RF9A 1NF0A 4INFA 3QQWA 3ZMRA 3K30A 1XR2A 3A6OA 3THUA 5C5YA 3AZSA 3T2OA 3IEBA 3SIZA 3TYBA 4XO7A 4E4PA 3GU1A 1UQYA 4LGXA 2EPMX 4B91A 4PBEA 2R94A 1MMFA 2QPXA 1FWGC 5H8PA 4J28A 4MZ8A 4NNCA 4YVVA 4F0RA 3LQGA 3CC1A 4BI6A 4I9MA 4GYPA 5E5CA 4RNJA 2PF0A 2A7PA 3P80A 1KBJA 2Y1HA 4JR5A 4F40A 1BGGA 5ABEA 1WA3A 2BWGA 4MTVA 3VNKA 1OCJA 4IXXA 3W2KA 1TPWA 1K7EA 4GYKA 3QVQA 3VIIA 4E6MA 3L68A 4R7WA 4RZ4A 1SGJA 2NUWA 3ZLHA 4S3KA 3BLIA 1HKIA 3SN0A 3RM8A 1RJRA 3BSGA 3MZ2A 4Z2GA 1TV2A 5DMMA 4F0LA 3BSHA 4GYJA 2CETA 8TIMA 3ARWA 3OOQA 3RX2A 4N4QA 1K8CA 1PTAA 1CGXA 4DY1A 2DQXA 3RIKA 1V3KA 1XBYA 4PMOA 4AYGA 3GW3A 1QTWA 4K37A 1XFBA 3BICA 2E68A 4KBXA 4ZO6A 4K1WA 3RLHA 3L0KA 3CL8A 3W28A 4UR8A 1WXJA 2VZUA 1P0EA 1P7TA 2VEFA 3T1GA 3L4WA 1KM1A 3H7UA 3URAA 2F6XA 1FY6A 1EJRC 3N34A 1WZKA 3RO6A 5FF4A 2CW6A 1XSIA 4WY0A 4FALA 5CSRA 3U5YA 3BJSA 3P0XA 1UOZA 3HGOA 2EG8A 1YYAA 4LEFA 5HINA 1DQWA 1G6CA 4EOUA 3SAZA 4JHOA 1FWSA 2X1UA 4CNNA 2VOTA 1X6LA 3L4ZA 4N4PA 3URBA 1RA5A 4B3ZA 2D2HA 3MP4A 4Z1CA 1G7VA 2P76A 3K2GA 2ZZ6A 4NL1A 2O9TA 3MTWA 1PAMA 1VEMA 3C52A 2WMKA 1FFRA 1YTDA 3TONA 4JGDA 1R30A 3SCOA 1E15A 5AHIA 2P53A 3TFXA 4NJKA 4LF1A 4W93A 5KINA 2QAPA 3A5VA 1HZYA 2E9MA 4MLJA 4IP4A 1U5VA 1MZRA 1EDTA 1IGSA 1AJ0A 3NPWA 3RMJA 1BPLB 4QGCA 1PX4A 1EB3A 3WLSA 1M5WA 1W9PA 2VDIA 3LA4A 1GJUA 5JVLA 2ZX9A 4HA3A 1WUFA 5HXMA 4LWWA 4EVZA 3D3FA 3MT1A 1DJIA 2XN0A 3LCFA 3WEOA 2FDMA 3NG3A 4K6AA 1GQNA 1VFTA 3FEMA 1AA1B 1XX1A 1W32A 4AY8A 1T40A 2YDSA 4QE5A 3UZZA 1SFJA 4UNIA 4QM1A 1W1A1 2OCZA 2PRMA 4JNZA 1EIXA 4WSKA 2NQ9A 1S5NA 2Q6ZA 1H09A 4BWLA 1ISYA 2GOKA 1GUVA 1XLAA 4GUJA 1GNXA 1W5OA 1O1HA 3MUAA 4FNSA 4UBPC 1N8WA 5HAOA 3CHFA 3P5YA 4JHMA 3ANVA 4C6KA 1QWKA 4WGHA 4AH7A 3W6YA 3MMDA 2JKPA 1WUEA 4HNTA 3IAPA 4ACZB 2WB5A 2PWHA 3UVAA 4ENLA 1MDRA 4QAWA 1EBHA 5FEWA 2PPGA 1Q4NX 5TBOA 2A6LA 2FKPA 2I16A 3D47A 2TRSA 4AD0A 1FHDA 4RDZA 1QPKA 1S2CA 4GK8A 3W7OA 4EF9A 1LBFA 3STGA 1EQCA 3N4EA 4HA0A 1KFJA 3ABXA 4C65A 4IUGA 4XIMA 3SADA 1X7FA 4GUIA 4RX0A 5F4WA 2CKSA 4PUJA 4AWTA 1OK4A 1XYLA 5FIPA 2DZXA 4I3GA 2ZX6A 1BRLB 2J6VA 4MF4A 4XAZA 2WQPA 3K13A 2GVLA 3FFSA 1CECA 2AL2A 1OK6A 2E6AA 1L6GA 2QPUA 1ONEA 3U6WA 3GNOA 3SCRA 1ENUA 2RHGA 4KEZA 1V0LA 3NSNA 4AX7A 2NLYA 4M19A 1PXGA 3G8EA 3T07A 4KRTA 3KBJA 1HKMA 1K6AA 1IHIA 2VC9A 4S1FA 5DN1A 3NQGA 3TW7A 1XIMA 5BMXA 2ZZ2A 4MMWA 2E5CA 2DSVA 4QR6A 1HVXA 1ZP3A 4XQ6A 3ZM8A 3WMBA 2V67A 1RR2A 3LGDA 3B9OA 4B5NA 1EGMA 2G3JA 1O12A 4IOTA 4V15A 1YPFA 2WM0A 4Q6JA 3GSMA 3T0BA 1J93A 1G0CA 5DBUA 2HE5A 5HMDA 3IVUA 3VOHA 4AF0A 3ITXA 1SW0A 3G1AA 3KS6A 4RNHA 1BAGA 3HZ3A 1DWFM 4GQ0A 3L5AA 3R11A 3VKJA 1BFNA 5CSUA 2GJNA 1LOQA 1YBQB 4HMEA 3VYLA 3LCLA 2VMFA 2B7QA 3BSMA 4NZ3A 2QJHA 1H3GA 3FAXA 2C79A 3B9NA 1GOWA 4WHBA 2GLKA 3V3WA 4IG2B 4Y9NA 2C0HA 1AH3A 3UU0A 4LANA 2UWFA 1AFSA 2J7DA 2EPHA 1V93A 3W7KA 5KZDA 3COTA 4O1DA 3M0IA 2XN1A 2POTA 4HK5A 3GX9A 1R9YA 2VRKA 1Q7ZA 4DF1A 1BYBA 3DBPA 3B0YA 3FAWA 1XL9A 3IIXA 4LS2A 3P8IA 4WEVX 3P60A 1JXJA 1Q6EA 5AC7A 5XINA 4KCUA 1WZMA 3C0LA 3OLDA 3H22A 3EEGA 1XICA 3CIXA 3SCVA 3S5ZA 1T8XA 4FOUA 1JD9A 1FKWA 3WNLA 3ARTA 2PAJA 1SZGA 2X40A 9CGTA 1WDSA 4IM4A 3K8MA 4KRZA 4N2YA 2G41A 5G2IA 3WH5A 2WVUA 3FJNA 1RK6A 2JEQA 3OVRA 5C70A 1G01A 4P7RA 5A8GA 2QEZA 5IOBA 1LM1A 4W8LA 3GKFA 1K02A 1K3UA 7ODCA 3B0PA 3OPSA 1LT7A 3IJ7A 4X9SA 4DHGA 3DYPA 3SM0A 3RCMA 3MYPA 4YL2A 1E0UA 3PZQA 4P7QA 2BVYA 3CQIA 4LOCA 1JPMA 3C0JA 3T8QA 2CBJA 4PRWA 3L12A 4B9ZA 1YKWA 4IXHA 5HPOA 3HBLA 2E5BA 2F2KA 4Z0JA 3A3HA 3H2EA 2D2JA 3TMLA 1HJWA 2FPVA 1E56A 4JN7A 3CK5A 4GPNA 1CWYA 1UR2A 5IM51 4NRRA 3PBUA 1VFLA 3AU6A 4FNPA 4NZ5A 4YS1A 3WD4A 3HV8A 1H7PA 2PA6A 1RVKA 5FF7A 2DH3A 3PUEA 1C9DA 3RGTA 3TR9A 2WSPA 3U7VA 3PK7A 3PAOA 4RW5A 2MUCA 4E4FA 3TH6A 2PD9A 3KL0A 5K2ZA 5B7ZA 1WDQA 4NYYA 3AXKA 4I6VA 3NPXA 1AL7A 3CQHA 1Z3NA 3GDTA 5EU9A 1V3IA 2CLOA 2WMIB 4C6EA 4ZSTA 1D7FA 3II1A 1Q45A 4WDTA 3TQ0A 4QS5A 2GGGA 1CXIA 1XQKA 4UNKA 1ZLPA 4YCPA 2CLLA 5DFAA 1S3TC 2DSUA 2INZA 4GIYA 4JEJA 1W2VA 3EPMA 2BX7A 2XZ7A 4C6MA 3W2MA 2X2YA 2CZVA 3SDOA 3NFUA 4U3CA 3KZPA 4CN1A 4A8RA 1P48A 4HYWA 5SWUA 1XXXA 5FJPA 1US0A 4H3DA 2PDJA 4PE8A 1VH7A 3ARSA 5DO8A 1W3KA 2HDJA 1RCXB 3G6LA 5CZJA 3F2CA 2PDKA 3N2MA 3S6DA 1ZJHA 5J8LA 1YE4A 4G7EA 3FX4A 3FXGA 4D8LA 3M5YA 5H1WA 1Q85A 4LCRA 4LUIA 5LIKX 3R2GA 3LXBA 3W73A 3K8KA 3N15A 1DQUA 3NUKA 3PJXA 4N9DA 3D3AA 4QNWA 4QXIA 5C8BB 1JCNA 5CLWA 4O0ZA 2SFPA 3E5BA 1HKVA 3VXGA 1FDJA 2NXIA 4OECA 3BPWA 3BQ5A 5GNYA 5F1VA 3EOEA 3MU7A 2VC5A 1JRCA 3WQ6A 4NXKA 1AZ2A 1EJVC 2FVMA 3S47A 1S2TA 3SRFA 4E0CA 1THFD 4DEFA 4FXFA 1T8QA 1BHGA 2FDSA 5B80A 2VDHA 3GXTA 1OFAA 3CYJA 4YWIA 3FYYA 4GJIA 2Y88A 3KBNA 2Y6ZA 1GOXA 1F6YA 1B57A 3BLFA 1VIZA 2O9PA 3EX2A 3KOYA 3KAOA 2DUZA 5I3KA 1O7AA 4CQDA 4DO6A 4M56A 4R33A 2UBPC 1EHNA 3N2OA 2FZMA 4RV3A 4OVXA 1EX1A 4AXKA 3QZEA 2HK0A 4MNMA 4K36A 3BGGA 3RJYA 1BYAA 3ONBA 4QBXA 3N9RA 4IMGA 4C6CA 1IXOA 2I56A 4PTDA 4MKSA 3OZMA 2XH7A 3MYOA 3L9CA 5DBTA 3PVFA 1FWNA 3DGRA 4FX7A 2WYSA 2VKZG 1GT8A 2CBIA 1TPFA 1BWKA 4L65A 4ZL1A 4F9DA 3B9DA 1DV7A 4QFUA 1XWYA 5LSMA 3GNPA 1VEPA 3SGGA 2ISSA 2GVYA 2XN2A 2QUVA 2C6QA 1CDGA 1Q8JA 4RL3A 5KEZA 3MB9A 1E4NA 5HWJA 2VD9A 1DBTA 1W5QA 4UB9A 3AYRA 1OT1A 2DPEA 1D7KA 2GK1B 4LFYA 4POCA 5ABFA 3TC3A 1TSIA 2DDXA 4DXXA 1XBZA 4DI9A 3R4IA 5CPTA 3CV7A 1X8FA 1ME8A 3VD5A 1P5BA 2YB4A 2OWCA 1VC4A 5FJUA 3CO4A 3LERA 4A35A 5J04A 2EPOA 4IF2A 4BS0A 1H1ZA 3N73A 4TX8A 3HOJA 2HCVA 2CZ5A 4UTUA 2RDXA 1X98A 3NM1A 1TTQA 4M24A 4L9XA 2F61A 5H91A 2GJXB 5DLCA 1PCKA 1E9ZB 1F6PA 1V0MA 2YIHA 5BXSA 2QUMA 3E74A 1WXZA 5BRPA 2ANUA 3DX5A 4WKHA 4LUTB 3P81A 4O11A 3LMYA 3T42A 2XSXA 4FEZA 5AYXA 1T0OA 2JE8A 2EXOA 3WDJA 1TPUA 1S2UA 1F73A 3UNDA 4JPGA 1DJHA 1XLEA 3UXLA 3GXIA 1CW2A 3FVMA 4GH1A 5GVJA 4IUOA 3TJIA 4LAKA 4PMDA 1UCWA 4HMDA 4LVFA 4PB4A 5K4XA 1K77A 3CNYA 4JHZA 3T0AA 3CEPA 2I5QA 2VFFA 1QBAA 4KW2A 4DELA 3HPZA 4AD2A 4HSHA 5LGXA 1V6TA 3EMQA 3WD2A 4ZXLA 5FI8A 1R7OA 1IF2A 2VGBA 1L6FA 4JIRA 1O66A 2AL2B 4O0QA 1N55A 2PZNA 1MO0A 1XLJA 2YX0A 4O14A 2Y5SA 3EDDA 5LA0A 3DZ1A 3HQOA 3BOXA 3BJTA 3CM4A 4HOWA 3NTYA 2WWDA 5A6LA 2XYLA 4F0HA 1DYSA 3GZAA 2GDUA 3A22A 4GZEA 3GVRA 4H83A 3ABOA 5DQPA 3TU9A 1TPH1 2Y61A 3WQGA 3EEZA 4MADA 1VGAA 2VOMA 1VIWA 1YIXA 4DBSA 2QCDA 3KWXA 3ONCA 4S3DA 2HS8A 1R2SA 3V5OA 1W6TA 3PPFA 4PN2A 1GJPA 1S5MA 1CENA 4A05A 1T6MA 3UJRA 1XGDA 4LXFA 3N3MA 1H4PA 5CLTA 3NSXA 3MO7A 4IP7A 3W72A 1V8EA 3VNIA 3PZVA 2Y8KA 5JBFA 4S3CA 2OT1A 1CXFA 1K4GA 4GXWA 3ME3A 1FX6A 4GQRA 3QRHA 3L4YA 4Z1YA 1W5MA 2WNWA 1K9EA 3NNTA 2WJFA 3VM7A 4KCTA 2A79A 5JQ9A 4H9XA 3UW6A 3HG2A 1H62A 3N2TA 1S1RA 3DU0A 2YZ5A 3N25A 4FF7A 2ACSA 3QSRA 2QCGA 1GVYA 4NIRA 3KM8A 3TTOA 1LQ0A 4GZJA 1XSKA 1WAWA 2IKJA 4HU3A 4I9JA 5EMMA 3HGSA 2NV2A 5C54A 3N04A 1M7PA 2PDBA 4UOZA 1J0JA 4Q6XA 3G2GA 3KUMA 1H1YA 3PJUA 3NQ7A 1UIPA 2GUYA 2HVNA 1ZS2A 5AHLA 2DH2A 2BFGA 3O9NA 1U1UA 2ZUSA 1TV3A 1ODUA 1YLVA 3AHVA 4AZGA 3E0IA 4Q8PA 4Z1BA 4A4AA 2GQAA 2UV8G 4HMCA 2G3IA 5DRCA 4ZQOA 3L0GA 2Z6JA 4DXVA 3GVGA 2AQWA 4E2OA 4TVCA 3T78A 3WUBA 1KGUA 1MEIA 1UOKA 3VOIA 4CD5A 1FDZA 1F61A 4FS9A 2F6UA 4JKLA 1I75A 3O0KA 4GQGA 4ROQA 2VXNA 2ZKMX 4AIBA 3F2BA 4H6KA 3FW6A 1XDLA 1MEHA 2VR4A 1OY0A 4F9JA 1R5YA 3W7HA 2CCRA 2Z28A 3UPBA 1WKDA 2E8ZA 3KLLA 4FIQA 4AD1A 3SJNA 3TKFA 1OB0A 4P7NA 2DT1A 3SSJA 1VJSA 1UMLA 5M5DA 1TVLA 3MY9A 2PC4A 2FH6A 3ZXWA 3C2VA 4LB4A 4AVOA 1HJSA 3ATYA 3PZNA 2Y7FA 1GGOA 4JTJA 3OW1A 4AG0A 6REQA 4NAFA 5AHFA 4M1BA 3FYOA 4KMQA 1BVWA 3M7WA 2QF7A 4MDPA 5HR7A 3IWPA 5D2TA 5FJOA 4HT3A 4Z1DA 1RD5A 3U8GA 4QLLA 3SGZA 2EG6A 4B92A 4MPQA 1US3A 5HK4A 2G3NA 2WJEA 4YTTA 3CQKA 3I7RA 4C5ZA 2CLKA 3M0MA 3W7PA 3WL0A 3TSMA 1K9FA 5FJJA 2H9AB 1PO9A 3T7VA 1J0ZA 4E2DA 3FA3A 3C2RA 1QNRA 2OLSA 2CESA 4JTFA 5D09A 3C0SA 4LBUA 5TD4A 1XFCA 2VX7A 3LNMA 3WQFA 2Z0IA 2PWUA 4R9OA 4R85A 4GGBA 5I24A 1UKSA 5M03A 4PCTA 4O1BA 4ONVA 4AU0A 5BU6A 2ZRUA 1OFPA 5DCBA 4B5VA 4W7VA 4X61A 4O4VA 4P2VA 3LRKA 6XIAA 1B2YA 2E1WA 1V3LA 3LCXA 1MSSA 3F1QA 3P3BA 4W7UA 4Q7NA 5HOSA 3OEXA 3APTA 4RPQA 4GKLA 2H90A 3WNNA 4PMYA 3TJXA 2REQA 2XIOA 4MSSA 2BMBA 2PTDA 1RBAA 2BASA 1A4MA 1TB3A 2I9UA 3AUJA 4S3AA 4ADSA 5IRPA 2WPGA 3SBFA 3W27A 1XIFA 3CUGA 4W87A 2WK2A 3NYDA 3ISIX 3EWDA 4IGMA 4JKKA 1M41A 3OLEA 3QBUA 3WZ0E 4Z0SA 5JIWA 3JVAA 3IGXA 5BCAA 2GJLA 5AHMA 4O17A 4BQ3A 2CU0A 4J5NA 2IS7A 1VBUA 2D0HA 2Y24A 4Q32A 4AIEA 4MIMA 1CEOA 1F5ZA 3SZ8A 4HIBA 4J3XA 4ZQPA 3KDNA 2XH0A 3R12A 2YW3A 2BXVA 4XX6A 2B81A 1IR1A 1NJJA 1K6WA 3GXNA 4KEUA 5F7UA 1P1MA 2PODA 2RJHA 3EZ4A 3PBYA 1WKYA 1PBGA 3TLQA 2B4GA 3UG3A 3GNNA 4O8AA 2UY5A 3GUGA 3G22A 4IMAA 3B0XA 1OX4A 1NFPA 8A3HA 2BHUA 4X60A 4PUUA 3GTIA 3MI3A 2OXNA 3S6OA 4XUYA 2P8BA 3QFEA 5FL0A 2A21A 1MQQA 3B97A 3U9IA 5FKYA 1QHOA 2H8ZA 2XIIA 4HN8A 4E8CA 4IMEA 5C0QA 4YU1A 1XYMA 1XISA 2P0OA 1BWLA 2O7QA 2QDEA 5CC5A 2OYLA 1MXSA 2DW6A 3TZFA 4EXBA 1XGZA 1EJSC 1KTNA 5EMLA 1FCUA 3KBSA 3TX9A 5EBUA 4I9AA 4DJEA 1JPHA 2O4QA 1LT8A 1LRQA 5ABHA 3EX4A 1B3VA 1K1DA 4H6RA 3L67A 3NWRA 4JX6A 1EC9A 1XGEA 1U30A 4AMAA 3LCHA 3V18A 3B8DA 4IMCA 2H8XA 4QP0A 1MNSA 3W82A 1WB0A 3SQLA 3RMEA 4PCPA 2OOGA 1VJIA 1GPFA 1JNDA 3AMKA 5I02A 2G3MA 2FGLA 3T2PA 3H4GA 2ZQ0A 5FAGA 3R79A 4ES4A 3A3XA 1NDZA 2Z1KA 4PUMA 4R53A 1KM3A 1E6PA 1Q6RA 3TXVA 4AHOA 1R0MA 3C5QA 1OFQA 4R5EA 3WK3A 1V02E 4GIEA 3M0YA 4XTDA 3CUZA 5BW6A 2D69A 1O1ZA 1D3HA 2QJNA 5A6TC 4XD4A 2GGJA 1TJ2A 3O7UA 3LI1A 1FWWA 2QV5A 1JQVA 1NDYA 4IL2A 4J40A 2RAGA 4TR9A 3TN6A 3OA5A 2WMJA 2NX9A 1JZ8A 4NZCA 3GHUA 1E6ZA 3OYXA 2WC3A 6ALDA 2ZA3A 1Y5VA 1XP3A 3MKKA 2CWXA 4Z17A 3WIJA 1FWCC 2FTPA 1HL2A 4DM1A 1J9YA 3LS9A 1DJXA 1MFUA 1FA2A 3FA5A 5A69A 4MM1A 3BJFA 1TTIA 2B7NA 2ZUWA 3KOZA 3MHGA 1F8MA 3C2YA 1E51A 1A5KC 3O6AA 3W7JA 4CQCA 2PP0A 2QCEA 4P7LA 1ML1A 1K9TA 5AZ0A 3RM4A 1C8YA 3VM5A 4GY0A 4XAFA 2XIMA 2X7WA 5T26A 3P2VA 1JPDX 3B8UA 5D03A 1IE7C 1UKPA 5JU6A 1GZJA 5FACA 2NV1A 3UQNA 1Q6QA 3VMNA 5AC4A 1F9CA 1IXQA 5K3VA 4CUCA 2YR1A 5I3FA 3PN8A 3UXAA 2PLKA 3W7NA 5A8NA 1OWQA 3SGUA 1SZFA 1OCNA 3VDCA 2OX4A 2VZTA 1MFVA 2YFOA 3VZZA 1N2VA 4MVAA 5LXXA 3L66A 4NJJA 2IPWA 1R3SA 4DWSB 5HNNA 4TXEA 3LZ3A 4IX0A 2GSHA 1C7TA 4MOZA 3VD3A 3KVLA 5A6BD 1KRBC 3VIFA 2Q71A 5DEZA 4BI5A 4K1GA 4K7VA 4A2RA 3GVVA 1E1CB 4FO4A 1R7AA 4GO8A 4CCEA 1FDYA 3WLIA 1DEDA 4XUGA 4C7GA 1TMQA 3SEPA 4I7WA 1C8XA 5M2FX 1JRBA 4WDWA 4ZZ9A 4M0XA 4V1YA 1OHLA 3MC5A 3RM9A 3K4DA 3CTLA 3NZGA 1HKWA 4PULA 4UFMA 2G4JA 4HPNA 5G1MA 2XVKA 4H9TA 4H9UA 1REQB 1Y5XA 2P50A 2VUYA 2E3ZA 2Y8VA 3ZIZA 1ZU8A 4Y9OA 5CPQA 4PZVA 5GNZA 2J78A 4KS0A 4PMUA 4LQ1A 3RXZA 4IIFA 3QY8A 1RP8A 3MUXA 1XHGA 2VX5A 1AD4A 1VYPX 3NO3A 4HPGA 1GVRA 2YYUA 1GQJA 2ZDSA 1I9CB 4DPPA 2W92A 3GTXA 2XU2A 4FNQA 5CPMA 4XSMA 4MPKA 1GQLA 3F4DA 5CC3A 3BCJA 4HGXA 2ZIDA 3APGA 7TIMA 1KC7A 3NGJA 4DB7A 2PUZA 1KCXA 3M46A 1W1ZA 4YHGA 1DWAM 3MP3A 1YNQA 3HGJA 2Z26A 1TG7A 4L4OA 4LV9A 3WUEA 1LRNA 5HULA 3QOKA 4WSJA 4MB4A 3DFYA 5CJNA 1FFQA 4OBRA 4PTVA 3REQB 4PRTA 3HB9A 3OZYA 4UQAA 3N29A 3TR2A 1CGWA 1W3IA 1B3XA 3KTCA 4IGHA 4D6JA 4JTCA 4AWUA 4D71A 1XDMA 2GOUA 1J79A 1TZZA 1IQ8A 4NJHA 3T40A 3VMOA 1KWGA 2BY1A 3VD7A 3PZOA 4A3UA 3N6HA 1WDDA 3AYSA 1X1ZA 1HQTA 1HF6A 5EMKA 1Q4WA 1TFVA 1GEQA 2HMCA 1P1XA 2DZPA 4FNTA 3AMLA 9XIAA 1K9DA 3PSWA 2I7GA 2R9RA 5HNTA 1KKOA 2EAWA 3CLWA 1L2QA 4RE4A 3MKCA 5IHSA 3NO5A 3V36A 4S3FA 5FEXA 3OBEA 2CXGA 4UFHA 3CAQA 1KGWA 1BEUA 2WSQA 1HL9A 1EWEA 1E3ZA 4HK7A 4WD0A 3VKKA 4HPHA 3KOFA 1KFBA 2YYTA 1S3HA 3NO1A 5DRIA 2WBGA 3WH9A 3UG5A 3SCUA 3UERA 1WOAA 2Z24A 3OG3A 3CXOA 1A5AA 4HTBA 2F7FA 3EDJA 3M0VA 4EPKA 4CD6A 5CC7A 3OO2A 3H2AA 3VGDA 4LAZA 5LNUA 2D73A 2NX3A 5K4ZA 1KLZA 2XVGA 3POHA 4Q8NA 1XYAA 2FHCA 4BA0A 1XH1A 2CHOA 1POKA 1ZBVA 3V75A 3UJEA 4L64A 1KR0A 1M6JA 1FHUA 4MJ2A 4L80A 4UIOA 1QO2A 1SFSA 2B31A 1QK0A 4GZ7A 3P0WA 2CPUA 1TIWA 4YHEA 3ICJA 3VNYA 2VEMA 5LHFA 1W9XA 1WNOA 4FIRA 3HIJA 2QUTA 3WDPP 1IWBA 5DCEA 2J4GA 3GFYA 1EH9A 5HUPA 1TVPA 1U5HA 1E1EA 1JYWA 3POCA 3QGAC 1ADOA 3HQPA 3BZGA 3VDAA 4MY8A 4EPEC 3H55A 1ICSA 4JNYA 4JZ5A 4ZO7A 3ZZ1A 2GL5A 3PPCA 4V28A 2HROA 2Y0FA 1RPXA 2OVLA 1LWHA 1CGUA 5AC6A 4TMBA 3GS6A 3W4RA 5C9XA 3CUIA 3URQA 5C9UA 3FY1A 1G7UA 3C0QA 1C29A 3M0HA 1R9ZA 1T41A 5FF0A 3TW9A 1I2RA 4M81A 5T9CE 3JUGA 5G2HA 1FCQA 3VIGA 2PE4A 2Q09A 3IS4A 5EGRA 3UJSA 1NDVA 1UP0A 3AOFA 3B4UA 5HR6A 4MAVA 1ZPTA 2FZNA 3AS2A 2V2HA 3G6MA 4PA8A 5A2BA 1UZDA 1Z6KA 2YL8A 1FXPA 2WO5A 3VE7A 2DORA 3DFQA 1H2JA 4H9MA 1VYRA 1U83A 3EBVA 5EL1A 1OZQA 4HTYA 3I7SA 4WJ8A 3W1QA 4WCJA 3AHXA 4H01A 3ZVHB 1GVIA 3SQSA 1UR1A 5CSSA 5BOOA 1IEWA 3ARZA 2YDAA 2E09A 5FOOA 5I79A 3WY1A 1W91A 4A6GA 2PS2A 1Q6CA 2QCDB 3KCOA 5HMFA 5LIWX 3V0SA 1P0NA 1CI1A 4JL1A 1UB3A 4NZFA 4HA1A 1CXKA 5CBJA 1MXGA 4RZ6A 4NZ1A 3DXIA 1V6XA 1YDYA 2EBNA 2POZA 3CZGA 3SRKA 1UASA 4OGZA 4OT7A 2JGQA 1SW7A 1TPC1 1NP0A 3OLIA 2V3FA 3MBDA 3E02A 3EX1A 2Y7GA 2ZXBA 5LNVA 3WL1A 2OKOA 1RBOB 1Q6DA 3H4WA 2Y4SA 4BF9A 4CVUA 1Q7MA 1E73M 1B54A 1F05A 1FRBA 1JYNA 1IT0A 1O5RA 4D72A 1E43A 2WW5A 1KA9F 2OO6A 3NQDA 4ZOBA 4QCFA 1EYWA 3EX6A 4NAFB 3R10A 4JDBA 2V2CA 2HBXA 1AODA 1EEPA 3RUBL 5I0DA 4ICCX 3VX1A 1ME7A 4QEHA 1QJWA 5LA1A 1VPYA 1TUXA 5IFTA 3LLDA 3H2NA 2NQ5A 5FD0A 2IKHA 3LI0A 1M68A 3NR0A 3LB0A 5F2IA 4B2DD 4DF2A 1W17A 1LCOA 3ITCA 3D5HA 4WSHA 1DWGM 3MW7A 1ZJBA 3W76A 1HO1A 2HK1A 5E93A 5IBXA 4C90A 5D33A 2R6OA 1OF6A 1P0KA 4IMFA 4PMJA 2C13A 2XWEA 5JBDA 2TPSA 3TSBA 2V5BA 1G4TA 2RKXA 3AQUA 1V0KA 3AICA 3STEA 3KHJA 4N9CA 3QOMA 4CNOA 4M5PA 3RU6A 3F7JA 5GPRA 2YA0A 3AHYA 4XVEA 1IGWA 4HN4A 2NV9A 3HJEA 1AZ1A 3BO9A 3GUWA 4KGLA 3TZNA 1EP3A 2VFHA 2ZWZA 3G1XA 1NY1A 2J7EA 3GXDA 4K8GA 4LCQA 4Y8EA 2GJXA 5A8QA 1KB3A 2EJ1A 3BQ6A 2BDQA 1K03A 1ISXA 1CLVA 2BTMA 3VE9A 1OEPA 1E6NA 3UEQA 3TW6A 2V5CA 1JQXA 4RNIA 5BWAA 3C3UA 1PDZA 1UC5A 2YCLB 3H70A 1E5JA 3SURA 4QIUA 3UCDA 1UH4A 3USBA 1JCTA 2YA2A 2RH9A 4PTMA 2FVKA 4NY2A 3LM7A 1UUMA 4ADUA 2GQ9A 1F6KA 3PZIA 4C7FA 2WZIA 4ZGYA 4HKPA 1GKQA 4TTUA 3UPWA 2VCBA 4Q7IA 1UKOA 2TMDA 3KX6A 3UR7A 5BXRA 3S5YA 1K7FA 5GQBA 1XDJA 2BODX 1WDRA 4CQ8A 3S83A 2PLCA 3UZJA 2C71A 2Q8LA 3EXRA 1LLWA 3TN5A 2HISA 1XS2A 4S2CA 4J27A 1H5VA 3FHAA 3SFKA 4AY7A 1Q6GA 3SCPA 4ACZA 2QCMA 4I5UA 3C8FA 4C1KA 4LAOA 1F74A 2J7CA 1EA9C 2H9AA 3N19B 2DVXA 3TXZA 2NVAA 2ZZ1A 1ADSA 4TV6A 1V6YA 4W5ZA 3DCPA 3WNMA 4ORIA 2VQUA 4GYPC 1B3OA 4O50A 1FWBC 3LBMA 3CHDA 4HNUA 4JN6A 4YVXA 5JH2A 1QR7A 3GDBA 4JD4A 4X0NA 3LV5A 5ECUA 1BD0A 4S3JA 4M6PA 4XD3A 4AC7C 1BVZA 2FZ8A 1I2OA 2WC7A 5LGZA 3WBXA 1PZ2A 4BF5A 4DZHA 1WDWA 1GW9A 3H12A 4E3TA 3E9AA 4O8RA 4XK2A 2IW0A 5KTLA 3KHDA 1VPQA 2RDWA 1K4HA 1A5UA 2A3BA 2ZXAA 4YLWA 4AHQA 2YFNA 3JS3A 5GJNA 3HM7A 3TYZA 4PUEA 3I4KA 2NT0A 4H6EA 1BYDA 3UYCA 2BG5A 1H0GA 3E6EA 3IIPA 4XZLX 1P7TB 3NDOA 3H8AA 1C9WA 3TNOA 1DQXA 3I6EA 2QW5A 2E8YA 5HQEA 1K7XA 4D2JA 3N6JA 1SU5A 3DFOA 4FLRA 1ITCA 4GCAA 1LYXA 1X1OA 1QOQA 3OVGA 3VTRA 1EKOA 4IISA 4UOQA 1W1B1 2PGFA 1A3XA 4GINA 3DI1A 1IEXA 1OVDA 1QW9A 4C1NB 2HBVA 3BAXA 4BEUA 2VEGA 4URIA 4NUWA 2WJZA 1Q65A 4HPXA 1XLMA 1Z42A 3W70A 4U2YA 1X39A 1PX8A 1FP9A 3RU8X 4IWWA 1G4SA 3W1RA 4AWEA 2BP1A 3PZ9A 3GDKA 2X1IA 3A12A 3AIVA 3PJWA 4G7FA 3RN6A 4IIEA 4HNVA 2BVTA 3HA1A 3WJWA 1QPOA 4GXMA 3OG2A 4DVOA 3IJ6A 5C9WA 1KBKA 4D8AA 2W63A 1ESWA 3ZVIA 3HU7A 4OZOA 2GK1A 3TE9A 3ZWTA 4AHPA 4RPPA 4G8TA 3IUHA 1XSJA 3BOFA 4E8DA 2BHYA 2ZZ5A 4M7TA 2BHZA 1VBJA 4Z42C 1UMYA 1JZ5A 1ZCOA 1IZCA 3DESA 2HVOA 3W71A 4C6LA 4IP5A 1E0WA 2A85A 4QJ3B 4A21A 2R91A 3RYSA 1H61A 1OC7A 1JI1A 5A3HA 4CD7A 6A3HA 1UKQA 1TPVA 3B0VC 3WBWA 3EGJA 3KTXA 1FWIC 1G94A 3TN3A 3LV6A 2NXGA 5A8OA 4AD4A 3A9IA 2IQ0A 1YNPA 1V3JA 1KFLA 3L2MA 2O4MA 4MYXA 1KCLA 5D2VA 4QE1A 2ON3A 3QPZA 2NQLA 2W4XA 1H0IA 4QE4A 3AIBA 2PTZA 3KXQA 1C93A 7REQB 2VCAA 3LTYA 3MMTA 3TAOA 1Q13A 4QX4A 3QV6A 2F84A 5HANA 3MI2A 4NI8A 4O0KA 1QPNA 3F4CA 3AWNA 1AMKA 1LG2A 2E40A 5CC6A 3B03A 4M7SA 1QCWA 2PLJA 3QH2A 3SY5A 5CGTA 3UXKA 2ZWYA 3B8IA 1N8IA 1J0IA 2QCFA 4DO4A 4QJ5B 3QW3A 1X96A 3BARA 3CLMA 4IPIA 1NH6A 1ZNNA 4BWLC 1EZWA 3UWYA 4IFRA 4IJCA 2ZXQA 3GG7A 3ZFHA 3AS3A 3VFLA 3OIHA 4D1JA 1G67A 1XUZA 4PTXA 1ZUAX 5FSEC 1AJ2A 4AZCA 4JFVA 2W9MA 1ELSA 1W31A 2PDMA 1NWTA 3WMSA 2QS8A 4G5DA 3ATZA 2X42A 2DZWA 3UWZA 2XSBA 1F3XA 1F4HA 4Z08A 3W7RA 2X1RA 1BRLA 3WD0A 2WMIA 3O63A 4CEXC 1Q5MA 3H6OA 1UJPA 1KGXA 2REQB 1O4UA 4W4QA 5JH1A 3S46A 3DERA 1IWAA 2QGHA 2X16A 3BVJA 2FPTA 3USZA 5HNRA 3F03K 3HQ1A 4WY0B 2W6RA 3BLDA 2ZC1A 4OFCA 4DWSC 5LIXX 5E9XA 4ALDA 4H00A 4EANA 2G0WA 1C90A 5LIYX 1ZSXA 1ZAHA 2GFTA 1R85A 3STCA 4H7VA 1JAKA 4HU4A 3UZYA 3WBEA 2FHBA 3G1YA 1IWPA 4CCCA 5AHNA 4UZUA 3O15A 4U10A 1DIEA 1HP5A 4PTNA 4AEOA 3Q94A 1VBRA 3ENLA 5AY7A 5E1QA 3GZ3A 4FR6A 1V51A 1CGTA 1G4EA 2JFEX 2YB1A 3WEMA 5M17A 1B5TA 3QGKC 3BAIA 4RJEA 4C6FA 4XZBA 2XTKA 3S9YA 3CMGA 4L5ZA 3VK5A 3PB0A 4U4MA 2PI6A 4G56A 1I0DA 4GY1A 5FEZA 3B3DA 4UQDA 3TTEA 3DYOA 3QQ0A 2XFYA 3DKJA 4GJJA 3EWUA 4P7OA 4ZCWA 1HKJA 1CLXA 4Q4SA 2Z1XA 4X2PA 2VZSA 2W66A 2DVTA 2YGYA 3GRIA 1AW2A 3AXIA 3OGSA 1KWKA 5REQA 3U7BA 2NWSA 2OZ8A 4LYPA 2X30A 1EJWC 2KX9A 1KM6A 1M65A 2F38A 4GQQA 3NL3A 3GYCA 4LALA 3L0NA 2QULA 3OODA 4Y7EA 2QIIA 3UZ5A 1EEXA 2ZX5A 3EMCA 3UZXA 3A47A 4L1WA 1MEWA 3NVTA 1OX6A 3NQ6A 2OSXA 1RV8A 3WQVA 3TC6A 4M29A 5I3IA 3KBWA 5FJTA 1BSIA 4MNLA 3KBMA 3OBKA 4NNBA 4NVTA 3PAJA 2A3AA 1XI3A 1JCMP 3UY7A 4MFEA 3CMFA 3KP1A 4N02A 4QJ1A 4XWUA 2VFIA 2FZDA 2YCJA 3K46A 3RAOA 5CZTA 3L4TA 2V5LA 3LDVA 3ARUA 4UTTA 3V7PA 3R0DA 3FLUA 4GHRA 2DZAA 3BXWA 4MKVA 1SJAA 2YL5A 3GR4A 2XH2A 4P8WA 3DG3A 3ZOAA 4PC8A 1SSGA 1QPQA 1XC6A 5D2YA 3M5ZA 4FA3A 4NT0A 2FVLA 3P84A 3S9IA 4KESA 3LN3A 2ZDRA 2NW0A 3A21A 4UQBA 1RA0A 1FOBA 3CHEA 2Z27A 3CTTA 3GG8A 1I8JA 3SJ3A 1CNVA 1HNYA 4BY3A 2D23A 4EK7A 4DX3A 2XHYA 3GXMA 3S1XA 3F4NA 3UCQA 1JF5A 2D2GA 1JYXA 2RGMA 3DECA 5CQ1A 1I0BA 4OHQA 4FR1A 4HA4A 3WQWA 4C6QA 1DKWA 1XC4A 2X1SA 1KKRA 3P5ZA 3SY1A 2R82A 2WZHA 3LENA 4M80A 4DJED 5I7GA 4PL1A 3TP4A 2Z6IA 2QT3A 5D38A 3W7CA 5AKQA 4Q8MA 1GVSA 4RUBA 4DJDA 4QSHA 4UOJA 4XSLA 4IGNA 4AUBA 1PB0A 1XRSA 4ZTYA 2JK2A 2C18A 2J7FA 1TR9A 5AC5A 1DJGA 2VO5A 1A0CA 1VF8A 5E0KA 2V6AA 3EXSA 3GFZA 1G5AA 2BVDA 3FJLA 3LXCA 3HN3A 2ALRA 4M82A 2G37A 1FCVA 5DXYA 3AIWA 3GR8A 4P61A 3DYMA 2FB2A 1EBGA 1TMHA 4V2XA 2CLIA 4K8EA 1FWFC 1UR8A 3SRDA 2E6YA 2CZFA 4R88A 1IIHA 4IJBA 3UG8A 2A0NA 2PU0A 5LXEA 2WMFA 3N17A 3T08A 3W7DA 3NOEA 1YDOA 3HMJG 3C86A 2GYIA 2WV8A 1TV7A 3O05A 1KBLA 3YPIA 3JR2A 3DUGA 4LS0A 4GUGA 3LHTA 2Z00A 2HPMA 1QPRA 4DAFA 3LEPA 1BXCA 4UTWC 1A5OC 1LUCA 1EJUC 1FWTA 3KWSA 4R9XA 2ADAA 4F66A 1Z44A 3VGFA 3VU2A 3IUIA 4IL0A 3THDA 4R34A 3M0XA 3GR7A 4GC4A 1ZP4A 1JZ7A 2FTYA 4O1FA 4CKQA 2DJXA 5IDIA 4GVFA 4J3TA 3CAVA 1UZ4A 3ZR5A 3QC0A 3QXBA 3L65A 1XD0A 3O1NA 1W9VA 2C1HA 1EJXC 3TCEA 3ZJ7A 3IACA 2INEA 2BLEA 1GKPA 2YBVA 3VCCA 1DP0A 4MB5A 4PFHA 2BXYA 2ACQA 1E0TA 1VP5A 3H2CA 4B3LA 1IEQA 2XFFA 2P1FA 3PG8A 3QJAA 4QG8A 3A23A 1A5NC 1DJZA 2UY2A 1RY0A 4G1NA 4Q4QA 2WMGA 4IICA 4OJYA 2NVDA 4PTWA 3E49A 2P10A 5FAJA 5I3HA 3KRSA 4C60A 4HJWA 3IV8A 3BAWA 4LUJA 2DFAA 3CWHA 2HNEA 4FB7A 2ZUUA 5I07A 1J0KA 3WLHA 3AIUA 4WLCA 1RXOB 5D32A 1RJQA 4JY9A 3DHUA 3ZR4A 2XIQA 3N1AA 3AFBA 3GO2A 4AISA 1G9HA 1TELA 4XAYA 1EOMA 5A6JA 3T44A 1N7KA 3W53A 4ATDA 4PYSA 4CQBA 4BCEA 3GNRA 4M6QA 2VJXA 4AZBA 3L5MA 5LIUX 3EWCA 4NG3A 5AYIA 2OG9A 1WYIA 3MSDA 4A3QA 2VX4A 3E2QA 1ZBWA 3SI9A 2VT0A 3AMGA 3ARXA 4ERAA 2D3LA 4ZEPA 3LHUA 1AW1A 1HVQA 3H54A 2AMGA 4YJ5A 5JXQA 1NTHA 3PUOA 4UFLA 4OV4A 1ZL1A 5I3GA 4GRSA 2E6FA 1FXQA 3WQEA 3U3HA 3F4WA 1KFKA 2Y7EA 4X0VA 3WJXA 1YADA 3L7RA 3ORWA 4FMVA 4YVPA 4JQ3A 1KTCA 3WNOA 4XBSA 1WPCA 4OBSA 1NFBA 1BSLA 3BL3A 3WNPA 2CLMA 3IUDA 4O28A 2NVCA 4I90A 3EKGA 3PNUA 1P6BA 1E0XA 2A3CA 4HQVA 4EIVA 1PL9A 4GYFA 5D9NA 2EJAA 2MNRA 5BXPA 4ZSUA 3CAKA 5K9XA 4JFUA 4YIWA 4JTQA 1F3EA 3JZEA 2C91A 4IGSA 5HWMA 3RO8A 2VM8A 4KQNA 2QCNA 3FJ6A 5BROA 3L23A 3H21A 2OYMA 3CUHA 1GVFA 2C3ZA 1EP2A 3TOPA 3QQ1A 3T0DA 2VTFA 1EIBA 4H8NA 4EXAA 3ARQA 3NL5A 3PTQA 4MHBA 5HJLA 4A22A 3ERPA 3QMRA 4GJ1A 2X0HA 5D9PA 4B90A 1UQZA 1WAUA 1OQFA 2YCKX 3QKEA 3UGVA 4TQTA 1M7JA 4ORMA 2OR2A 3F4VA 1DJNA 2R1NA 5FA5A 3F5LA 3OP2A 3E1F1 3W01A 1TV8A 5TQLA 4X9YA 3EKLA 4C6DA 1V5XA 1EYEA 3DENA 5A6AA 5F2LA 1FH9A 3LRMA 4Q3MA 5AECA 3QHNA 1P0BA 4NI3A 3G24A 5F2MA 4H19A 4IQJA 1KXHA 4PRRA 4DJEC 2VX6A 3VGEA 2ZUVA 4O10A 4O57A 3QFWA 3ABSA 1MUCA 1PV8A 4ERIA 4FOJA 4XBKA 1E1FA 4ACYA 4Q8UA 5ECVA 1KBIA 2PZ0A 3CBWA 4UMBA 1XV8A 1UPMB 3FDGA 1OD8A 3FOKA 4B9YA 2NXHA 3FSUA 2KZHA 5D8WA 1GORA 3AHZA 3VNJA 3C2EA 1CX9A 1JDFA 3THCA 3W1TA 4XO6A 1PUDA 1GYMA 2O0TA 1NIUA 5FESA 2Y5EA 5M1TA 4B5TA 3GB6A 3S2MA 4HZ6A 4XBJA 1PWLA 1GYLA 1VRXA 5HWNA 3VUSA 3T4WA 4CGTA 4HJFA 1BVNP 2P3EA 3I65A 1F76A 5KETA 5CJMA 1JCYA 1UYQA 1Q66A 3AALA 3ZT7A 4E4UA 1HJQA 3EOSA 3LCIA 4M3PA 4AZ5A 4BEQA 1VAHA 4UZSA 3DG6A 3N13A 1A0DA 3GU9A 2J13A 2GZXA 2J8TA 4JTGA 3W07A 3EWWA 2QDHA 3QLDA 4DYKA 3KRUA 4NAEA 3A9BA 4EXQA 1P0DA 4LPCA 4LVDA 5TF0A 1QO5A 1LDCA 2WQDA 1A80A 1HGYA 4OWGA 3CWNA 2Z1SA 3OIXA 5FJIA 1HT6A 4Q4MA 3CZJA 4QRNA 3VIHA 2ZUNA 4FI4A 3GY1A 2YDQA 1YQ2A 3ARVA 2Y2WA 3K4AA 4YXGA 1F07A 3PBMA 4WQ6A 2HPIA 3C56A 2ZTJA 3DFTA 3NCOA 3BAJA 4M51A 1EXPA 3PPGA 4MWAA 2ZRXA 3JRKA 5C55A 4BI7A 2VGFA 3FYPA 2PDYA 1D2KA 2IPJA 2IKGA 1D3CA 1EP1A 1WZAA 2OO0A 1JFXA 3GG0A 3M7SA 4PCNA 1ALDA 3BK0A 1FKXA 4JCMA 4ZXOA 5DELA 3ZSTA 2EKCA 1JFHA 3B8VA 2OWWA 2J77A 1XPYA 1L2UA 4JQ2A 1VJZA 1ZFJA 5BRBA 4U5KA 3VILA 3QZ6A 4CNUA 4QTGA 1MRQA 2O56A 4QHRA 3FS2A 8CGTA 2HS6A 3OVQA 4MZ1A 3NA8A 4GBDA 4AF0B 2X09A 1GG1A 2YLLA 4CLMA 2C14A 5TAOA 2E25A 1E0VA 3KZSA 2CWNA 1GOOA 4MKNA 3GDMA 1O5KA 3VKDA 4DM2A 3RITA 1X1NA 3BTNA 4REQA 4OU1A 1T5AA 4AC1X 1E4MM 3MUIA 2DZVA 3LU2A 1MW0A 2YL6A 2DT2A 3GC2A 3BAKA 5HMEA 2ZXDA 2G96A 3MV01 1EO5A 1XCFA 3JW7A 1QNSA 2GQ8A 4JQ1A 4QITA 3LYEA 1OFRA 1XKJA 1E72M 3EB4A 2A2IA 4HHHA 3IVTA 4ZE5A 1H7RA 3WLJA 2V68A 1QASA 5I06A 2D2OA 1DTUA 3PWGA 1TIMA 2IQDA 4FHAA 4C6JA 2R1PA 3T9PA 1TQXA 3VZXA 5AVNA 4JIIX 3WQCA 3WDQA 2X8RA 1W1TA 1NQKA 1ITQA 1XKYA 1QATA 1RK5A 3ID7A 4JTUA 1MUWA 2IUZA 3EA1A 4O15A 1LZOA 3LPPA 1RJPA 1V4YA 4DWSD 3GE7A 2PDCA 1LBMA 3EWZA 5CZKA 4KPLA 2PBGA 3E0LA 1HL8A 1LG1A 1REQA 2WNNA 3IJ9A 5DMNA 2C0AA 1KV8A 2HQAA 5CPNA 4J2PA 4WOQA 1UP2A 5XIMA 3S2JA 5E70A 4DUXA 4TV5A 2VI0A 2VP8A 4UTTC 1NELA 2QDGA 2DGAA 3W88A 1UWQA 2GJRA 4MNKA 4KWUA 4MB3A 4HOXA 2I5IA 1CXHA 1JD7A 3BURA 4IFKA 4PUKA 1Z48A 4GA8A 2WBKA 3W83A 1CGVA 2AKMA 3NDYA 3U2CA 4D6DA 1DORA 1XLHA 4O16A 4Q8OA 1CTNA 2VEKA 3CB3A 3FJ4A 1DJWA 1PEZA 3PY2A 1KXVA 4NHVA 3IVSA 1IT8A 1AH4A 2O92A 3MP5A 1RLCL 3M0LA 4DO5A 3KEHA 4Z1AA 1HJUA 3M6DA 1TR1A 3W7EA 2VR5A 2QAFA 1D3GA 3Q37A 4MB1A 4H8VA 1O5QA 5CJ5A 4Q4PA 5C6MA 3HG4A 1WXYA 2YDRA 1GHSA 5I6SA 3GHRA 3U2OA 2ZVRA 4XV0A 5AN7A 2V2DA 4E3VA 3UWEA 2RFGA 4AYSA