4ADSA

Crystal structure of plasmodial plp synthase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
DYADNDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase/transferase
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
total genus 98
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4adsA00
3O16A 3R8RA 3NNTA 3W86A 2YZRA 5AC6A 4LC6A 3MBFA 3P80A 3DGRA 1ML1A 1W31A 5FF2A 2A7RA 3E9AA 1HFBA 4OE7A 1H7NA 4GUHA 3G1DA 4MLRA 1VPXA 3HG2A 3W1MA 2VFEA 2V5LA 2Y6ZA 3A9IA 4PA8A 4QNWA 3TMLA 1ZALA 5D02A 5H91A 1V7YA 3SFKA 5CG7A 3W7PA 3THAA 3TJLA 4LY8A 4JGDA 4A21A 1KM1A 3EWBX 1VLIA 3MYOA 1GVRA 3SI9A 3TC6A 4A22A 3P60A 2ZRZA 1HTIA 2WJZA 1P1XA 3QW3A 3IVUA 4CQAA 4FNSA 2C3ZA 3N19B 5AN7A 1Z48A 3WK2A 4K38A 3STGA 3I7SA 3IEBA 2E6DA 2BLEA 3ANYA 5G4EA 3TROA 3R5EA 4UCGA 5J5RA 3P84A 1V5XA 4LUIA 5K4ZA 3N2MA 4AHQA 1FWSA 4JX6A 1GVFA 1TYGA 1YPFA 4CNNA 1Q6RA 1O5KA 4M6QA 3G24A 1XBYA 2QUUA 1ZNNA 2E5CA 2EHHA 1TPUA 3UZJA 1LRQA 1CW2A 2ZQ0A 1P4CA 3QM3A 4IPJA 1PCKA 2VELA 4DELA 4PEKA 2E5DA 5C54A 3TKFA 4KFNA 3BG5A 5I3JA 4JNMA 3UYCA 2WO5A 3IVTA 3UY8A 4NX0A 4IXXA 5F2LA 4QQ3A 5LGXA 1GPWA 1LBMA 3SIZA 1WBJA 2CFFA 2YYUA 5D03A 2Q8LA 3ZWSA 4KWWA 2QKFA 2WSYA 5TIMA 2Y7EA 1W3TA 4NNCA 4AMAA 5K7JA 1DBTA 1PVNA 3W2JA 4JDYA 2HSAA 1B4KA 2CU0A 1LP6A 3HPSA 1AW2A 3FOKA 1PHQA 1FCBA 1LOLA 3C2FA 3KVMA 2OMAA 2BWGA 3NG3A 1I2OA 5AOUA 3N3MA 3NQEA 4JIQA 3MI2A 1KFJA 2VFGA 1S3HA 3DFTA 2P10A 2V2HA 4N02A 2VEKA 1PHWA 3L5MA 4FHAA 3M5YA 3W85A 2J6XA 4NQ1A 3QF0A 3UWWA 4PFMA 4A2SA 5ABTA 4Z1CA 4FNQA 2B4GA 1BWLA 4CCEA 5K2ZA 3TFCA 1SO3A 2ATSA 2FPTA 5KITA 4GFSA 1VHCA 4FF7A 1FWNA 4P2VA 2VOMA 2F84A 2CLHA 3S8HA 2QJGA 5LNWA 2ZTJA 1VYPX 5I3HA 1PV8A 4O52A 2G5WA 1KV8A 3W2UA 3VE9A 4M6VA 2X1RA 3RLUA 3MP5A 5DN1A 1KTCA 5FEWA 5G1YA 3LRLA 4JYEA 2HS8A 2O7SA 2YX0A 1AG1O 2FQIA 4I7VA 1NVMA 4MFDA 5D37A 4AAJA 3NYZA 2ISVA 3P5YA 2PRMA 3GAKA 5FEPA 5HR7A 2DP3A 3GLCA 3HJZA 4K39A 3LRMA 2CWNA 2VFIA 2DU2A 5DLCA 1XDMA 3GDRA 2PURA 1H7RA 4GUFA 2TYSA 3QMRA 5I3KA 3F03K 2FTPA 4L4LA 1WOBA 3GKFA 3MJYA 3NL5A 5KZMA 3GXPA 3W7DA 3UWZA 3YPIA 1VLWA 1W5NA 1RQBA 1ME8A 3TQVA 2DZWA 1KFLA 3OVRA 3HGOA 4IMCA 4WOZA 4KFPA 4O19A 1SZFA 3QMSA 4OV4A 4JYFA 4JTTA 3B0UX 3RMJA 3NQ6A 1LDCA 1EWEA 1K8YA 3DZ1A 3GR7A 2QAFA 2OX1A 2QCLA 1H7OA 2V9DA 2F7FA 3KFTA 2A85A 3L65A 1MXSA 4ADUA 5D2YA 4I7WA 3GDLA 5DCDA 2GJLA 2NWRA 3GR8A 5DXYA 1VYSX 1O60A 2XN2A 4O57A 5DBUA 4BK9A 2FLIA 3TW6A 4Y96A 3QW4B 1OFPA 3W7EA 3LERA 4XQ6A 5EA9A 4U28A 2NXHA 4N9BA 2ZRXA 4RZ6A 1J4EA 1KFBA 3EWZA 2WV8A 1DJQA 3TR2A 1TB3A 3LCGA 2P0OA 2A2IA 5KMYA 1YTDA 1I2PA 2YFOA 4BWLA 2RDTA 3TX9A 4OV9A 1Y0EA 1UB3A 3LOTA 1ONRA 1R46A 4PL2A 5F2IA 4ZQRA 1VRDA 4LVGA 1XBVA 2JKPA 1OFEA 2C0AA 1P0KA 2PRLA 5D2VA 4A3UA 4B5NA 4BI5A 1SW7A 1S5VA 4JICA 1JULA 2A0NA 3T4CA 3G8EA 1F7BA 3W7JA 4LU0A 3U8GA 2V81A 1W8SA 1P0NA 2QCGA 1TPH1 4TR9A 2V2DA 2Q8ZA 3CC1A 4Y8FA 1KM5A 1HG3A 2NX3A 2Y61A 4OT7A 3WJSA 4QISA 3LM7A 4WJEA 5TQLA 2FPYA 3PULA 1W54A 4CNOA 1KLZA 2JK2A 4XWUA 1FWTA 3P8JA 2QAPA 2FJKA 3W7CA 4NZJA 2B7NA 1A5SA 1J2WA 1F73A 2H3DA 4FXRA 1JCJA 2HS6A 4YL2A 3W2NA 3LXAA 2Z1BA 2H8XA 4RKAA 1F5ZA 3OVPA 4CCDA 2C19A 1R2RA 4E2DA 4AVFA 1GTHA 2E6YA 1W0MA 4HT3A 3HGRA 1TPFA 1KFKA 3LBMA 3A22A 1GVQA 4MVAA 4ZQCA 4ZQNA 1SO5A 4HHPA 3LCFA 5IBXA 3G18A 4Z1AA 4LV4A 4UMCA 1TTJA 1W56A 1W3NA 2ZYFA 1IXNA 3ABOA 3GXNA 1D3HA 1G4EA 1G4SA 1OG0A 4RLIA 3NOEA 3THQA 3QQ1A 1LBLA 3NA8A 4O1DA 2V30A 3W7HA 2H90A 5LHFA 1KLYA 4YLWA 3RNDA 3O6CA 1FCUA 4IMEA 4LS0A 3PVFA 2ZRUA 3NPXA 3NL6A 3QH2A 3MW7A 3G1XA 1A50A 3MI3A 1GTEA 1PE1A 3ABQA 1K7FA 1WOAA 4AH7A 4IX2A 5A5WA 5H2ZA 3M16A 3NPVA 3GDKA 3BARA 3UWVA 4FEZA 1KM4A 3DI1A 3T40A 4P61A 5I3IA 1XKYA 5FF7A 3M5XA 1SZEA 3OA3A 2DJXA 8TIMA 4MUZA 3A24A 1I2NA 4Y9AA 3W2MA 1H1ZA 3OG3A 3NL2A 3R12A 3MMTA 3O8AA 3NQGA 3T78A 3AJXA 4DBEA 1TQXA 1ICQA 5D2TA 1N7KA 1Q6QA 3B04A 4UTHA 3NM1A 3NZRA 3ZR4A 4WQ6A 4UTLA 1S5TA 3IIVA 1DVJA 2VFHA 4WY0B 4BR1A 3N9RA 2I14A 3LV5A 2B7PA 5AHFA 1IIHA 3BGJA 1KM3A 3DENA 3O6DA 4O11A 5EKYA 4UC5A 1RZMA 3QFEA 3P62A 3KRSA 1QO5A 4Z0JA 1MSSA 1IXQA 5G1TA 5CKSA 1EP2A 2Y7GA 3EB2A 4HSNA 5A8GA 2A6LA 2QF7A 2XN0A 2XFWA 1JUBA 2E5BA 1I2RA 3M5ZA 4N9DA 3L5AA 2VKZG 3LDVA 1THFD 3QPYA 1SSDA 1NFBA 5HUPA 1LLWA 5FEXA 4ZQPA 2LLEA 3TE9A 3P61A 1G7UA 3W7LA 3UQNA 1FDZA 5AHLA 5L6UA 2ZRVA 3N2XA 3PY2A 4AWSA 3SY5A 1X6UA 1I45A 2AGKA 5C6MA 2FDSA 2QUVA 3S6DA 1I8JA 2Y7FA 5KZEA 1WA3A 3M41A 5HULA 4XTIA 2GQAA 2BTMA 3LHUA 1TREA 2FB3A 2Y63A 2CLIA 3CWNA 1SU5A 5T26A 1TJRA 4KWVA 3W74A 5HJLA 2ZBTA 5AYXA 4ZQOA 4JX4A 3D0CA 3SGUA 4XTDA 2JKEA 3IIXA 3B8DA 1KV5A 3KXQA 1EUAA 1QDSA 1ZHAA 4M6PA 4UTUA 4R7JA 5KTLA 4IMGA 1VCFA 1XL9A 4N6FA 1KFCA 4BFAA 4M7TA 4GBUA 2WSQA 3IVSA 1ZFJA 4ORMA 1OK6A 1PIIA 3PS7A 3W7MA 3BG3A 5DCEA 1FXQA 2ABAA 5D09A 4LWWA 3O06A 4IQLA 3KOFA 1QWGA 3S5ZA 4JXCA 2Q3OA 3HIJA 3W87A 3W7GA 1O4UA 1GJPA 4MJZA 4R34A 1SQ7A 1BKSA 2X1TA 3WJZA 3PSWA 3FA5A 3ABRA 4JX5A 1KTNA 2ABBA 2CLMA 5AHIA 5AHMA 3LGEA 3TDFA 1OABA 3OBKA 4WXZA 2CZDA 3SZ8A 1FXPA 4DQWA 3TSBA 4JDBA 5K9DA 2ZZ7A 1AW1A 3PG8A 1PS9A 3JR2A 3QYQA 4Y6GA 1JQXA 4MZ1A 2E77A 3L0NA 3OIXA 5AYZA 1OF6A 1W37A 3CLMA 4C1LA 3NQCA 4YCPA 4JTIA 3TXZA 2E6FA 4FNUA 4O1CA 5LKYA 4RJEA 4NX5A 2ZZ1A 3MI6A 2DZXA 4AHOA 1FUYA 2VEPA 5CPNA 4HSOA 6TIMA 3G1VA 4WD0A 2A4AA 4DO6A 2YYTA 5LGZA 3LRKA 2E68A 5CZJA 2C1HA 3FKKA 3C8FA 4QJ1A 2AAMA 3E96A 4QITA 3I68A 1KM6A 3P82A 4JN6A 4LRTA 4GWEA 1L6YA 2W6RA 4O8RA 3L0KA 5K3VA 2C16A 3W71A 4NJHA 5D04C 3OHIA 3NO5A 2NLIA 3CEPA 5FEZA 3SW6A 3EXSA 3S9YA 1TTQA 1SW0A 1GZGA 4JR5A 3TC7A 3NL3A 4MKNA 1ZENA 3BLEA 4I9AA 4UTWA 3S5YA 4TU1A 4U4MA 3DU0A 3L9CA 5CPLA 3N34A 2B7QA 5CPMA 4WX2A 4LNYA 3C2EA 3VI2A 3RLVA 4UNLA 3K30A 2Y85A 1TRDA 4PTNA 3CQ0A 3TFXA 4QM1A 1JVNA 1OX4B 5C5YA 4FX6M 2CLLA 3NQ7A 1VC4A 1F74A 1RR2A 2VEIA 3PUEA 1LTDA 4MYAA 1PCWA 3ZS4A 1CI1A 3L21A 1T96A 4C1KA 5LNRA 4OGZA 5BMWA 1BTMA 3DFPA 3IRDA 3W7RA 4O13A 1WX0A 1AW5A 1TQJA 1OYCA 4MLJA 4NXKA 2B0MA 3Q2DA 1MEHA 3G22A 2YSWA 3B05A 3PR2A 1AL7A 3W73A 2ALDA 1SZGA 3UWQA 4CQ8A 2EF9A 3NQFA 3LCLA 4YWIA 4PL1A 4NU7A 2QCDB 1H63A 3PBWA 4MZYA 2GQ8A 4JTEA 1YTEA 4MZ8A 2FIQA 1EWDA 1YXDA 4UMBA 2QR6A 1P5BA 2J24A 3EXTA 1JCLA 3INPA 1UJPA 3TQKA 1R30A 1KBIA 4UR7A 1G4PA 4O54A 1SUXA 1K8XA 3CIXA 3W88A 1VGAA 3NZ1A 1R2TA 2JKAA 5EL1A 1OFRA 3DHFA 5F2MA 2PRHA 5DBTA 4JIPA 1JCMP 4LOCA 1ZJIA 4JTJA 5E1QA 1L2UA 3G1AA 2R8WA 3TQ0A 2FPVA 4OWGA 1T99A 4GXMA 1YADA 3KAOA 1VJIA 2CLEA 3FJLA 3RK8A 3LTPA 3W9ZA 3FJ6A 3GDTA 3TAOA 4LS1A 4RR4A 3KRUA 4UFMA 4WZHA 1GYLA 3UD6A 4LC8A 4A2RA 3O1NA 5CZTA 5U4NA 4XKYB 5E0KA 4O14A 5L9FA 2A21A 3C3NA 4UUIA 2J9ZA 2RKXA 3V1PA 1D9EA 4EVZA 3EKZA 2QCDA 1RQEA 3DKJA 1SFJA 4YMZA 3NVTA 5G5IA 4GUGA 5K9XA 2NXIA 1Q6OA 1NAL1 4IPIA 1K7EA 4ML9A 1MEWA 3UPBA 1H60A 3PBUA 1QCWA 2WNQA 4TIMA 5CZ0A 1TV5A 1LOSA 3QRHA 3B0PA 3B0VC 1ME7A 2J9YA 3DHDA 4JYDA 1GG1A 1L6WA 3NQVA 1OFBA 3DFOA 4IX0A 4ALDA 2FB2A 2YDAA 1RVGA 5EYWA 3G0SA 1TV8A 4NJKA 2DZPA 3N73A 3G3DA 3CM4A 2BX7A 4O4WA 1TTPA 2QJIA 4XBKA 1Z42A 3JRKA 1ME9A 2V0TA 4TMBA 1H51A 3PB0A 2CZEA 4TX9A 3MP4A 3P8IA 3U2OA 3UY7A 4AXKA 2ATMA 3BV4A 3EX2A 3HF3A 2J88A 3G1SA 3LBCA 5HUOA 1RQHA 2EPHA 5BNKA 4ONVA 1AK5A 1UCWA 2CLKA 1EX5A 1Q3NA 4MYXA 2E6AA 1SZNA 1EEPA 4ORIA 5FF3A 4DO5A 5U7SA 4K7YA 3LCWA 4LW7A 1ALDA 4MY1A 5EY5A 2NX9A 3CU2A 1YPIA 4N6EA 1H7PA 3MHGA 3DFSA 4Q32A 4CQ9A 1W1ZA 3MWAA 4DPQA 1YDVA 1JUKA 3LXBA 4LVDA 4UTJA 4O50A 5EPDA 3W1NA 1YYAA 3A23A 2GJNA 2GVJA 3C2RA 4K8HA 1TTIA 5AB3A 3IIOA 1EA0A 4X9SA 4ZQMA 4HNVA 2ZDRA 4DXVA 1J5TA 3HGJA 2Z2UA 2YFNA 3RFAA 4UTKA 2NZLA 3O6YX 1TPDA 4DO4A 4DF0A 5LNVA 4LTSA 1DV7A 3DFQA 4MY9A 5KZDA 2CLFA 1XCFA 4OQVA 4LVFA 4FNPA 2C18A 3HB9A 1MO0A 3W2LA 3FYPA 3F4NA 5FF0A 2ZTKA 5LSMA 2QCNA 3MBDA 4FIQA 1EP1A 2NUWA 1LRTA 1TIMA 4X22A 3W1LA 1FCVA 2A1YA 3HG5A 1H61A 3TJXA 1B57A 1O5XA 2GUUA 1DQWA 2Y88A 1OFOA 5F2GA 5DCBA 1M7PA 3W1UA 4AWTA 2IQTA 1XBXA 5CSSA 3O05A 2WNZA 2PCQA 4O53A 3V75A 2V2CA 3W6YA 2WQPA 4WY0A 3GNNA 3DXIA 1TSIA 3GKAA 1VCVA 3NPWA 4WXYA 1ZCOA 3S1UA 4RXFA 2YW3A 1M7OA 3IIZA 4HPJA 5TBOA 3R2GA 4GRSA 3PUDA 4HKPA 1UUOA 2Y89A 2H6RA 4OHQA 1GWJA 3FKRA 1F05A 4QNEA 1TCDA 1WBHA 3MHUA 3CTLA 3BK0A 1TPC1 1O95A 1DKWA 2TPSA 2CW6A 1GT8A 3NGJA 2ZRWA 3VNDA 1DQXA 4I7UA 3TIMA 1VS1A 4H4IA 3GNDA 4YXGA 2I9EA 3S1WA 1XFBA 2R94A 2VFDA 3I65A 1Z44A 3I7RA 1UBSA 1JCYA 2G96A 4HN4A 4GJ1A 3E0IA 3UWUA 3HO8A 4WY0F 4Z1BA 3LTYA 1A53A 1K03A 4UFJA 4EWND 3IIPA 3UZ5A 2PE4A 1QPOA 1KA9F 3BW4A 1VHNA 1YLVA 1UASA 1G7VA 1OX5A 2QCHA 4IMFA 1F76A 2ZZ6A 4PC8A 4RCXA 1UUMA 3VKJA 1EB3A 3GYEA 3LHVA 5KSWA 4EIVA 1JRCA 2O7QA 4YCOA 4DPPA 2ISWA 2B7OA 3LXCA 4XUGA 2DORA 2QDGA 4ZL1A 3LI1A 4DBDA 3S5NA 4NJIA 3GAYA 1KTBA 4IXHA 5LZLA 3STEA 2ZFAA 3LCHA 1LOQA 1FX6A 1FCQA 1X1ZA 5AYYA 1LORA 2DZUA 4MPQA 1H7WA 4RX0A 3NQAA 4Q4KA 5D38A 5CGQA 1H7XA 2ZRYA 2NUXA 4LV9A 5AHNA 1SW3A 3KHJA 3TH6A 5DY2A 3NPUA 4N4PA 4ADSA 1DJNA 1KBJA 1F6PA 3UXDA 3GZ3A 1WYIA 4JTSA 2QEZA 1DOSA 3TMQA 1YXCA 3GX9A 2W0UA 4JEQA 5D2XA 5DXXA 3W83A 3OVQA 3EX3A 3HMJG 1DORA 1EP3A 3C56A 3CEUA 1SFLA 3C2VA 1TPEA 3L2IA 3O07A 3EXRA 3NQ8A 4FNTA 5CZSA 1OJXA 3S42A 5DELA 5D30A 4GE8A 4XKYA 3EX4A 5HNRA 3G0XA 3QJAA 1TRIA 3VCRA 4K6AA 1AMKA 4QSHA 3ELFA 3PWAA 6ALDA 1JCXA 1QNVA 1HO1A 4BI6A 2C14A 3MO7A 3M5VA 1YDOA 1OFDA 1B4EA 3FLUA 2UV8G 3NEVA 3P74A 3S5OA 2VXNA 3NDOA 3W75A 2X1UA 1R2SA 4X2RA 4R33A 4OU1A 3TSDA 1SSGA 2V82A 3SR7A 2JGYA 4K8EA 5IM51 1A5CA 1XBZA 2HMCA 4NVTA 4TMCA 4NJGA 4UTTA 3BW3A 3RF9A 1VH7A 3P7YA 2H8ZA 3P5ZA 3LHZA 4UMAA 4POCA 3BG9A 2E1DA 2C13A 3DFNA 2NV1A 4RZ4A 3KVJA 4UR8A 3A5VA 2RH9A 3MYPA 4O18A 3SJ3A 3W3OA 1KM0A 4JY9A 1KFEA 2YW4A 3NAVA 3PSVA 4HIBA 3TA6A 4RK8A 3P67A 1I4NA 1TO3A 4IOTA 2CLOA 3ZFHA 3SGZA 1T8XA 4O4VA 1B9BA 1TJPA 2ZA1A 1EUNA 4D2JA 3M47A 1YTKA 3N9SA 5HQEA 3LHWA 3TSMA 4H3DA 3CHVA 2CZ5A 2RDUA 1FWWA 3W7IA 1VCGA 3LB0A 3RU6A 2TMDA 1GVOA 5CPOA 4UNKA 4ZVJA 3BLIA 3M43A 3EWUA 4UIOA 3G0UA 3LLFA 4IUOA 1PL9A 1M5WA 1VZWA 1WV2A 1MEIA 3Q37A 1VQTA 2D73A 3JS3A 3W7NA 3L66A 3F4WA 1B3OA 3U6WA 4O16A 3STFA 3VE7A 2PC4A 5I3GA 1R47A 4FB7A 2TRSA 4KFOA 3W7QA 2A7NA 4RV8A 3NQ2A 1IGSA 5D05A 1N8FA 5F4WA 2OJPA 3LTSA 5FI8A 1QPNA 2EAWA 1ICSA 1QOPA 2Z6IA 1OVDA 4MOZA 1RPXA 4E0CA 1JUEA 1JJKA 1SO4A 3M0ZA 1NF7A 3FIGA 5HWNA 3UWYA 3IV3A 3T7VA 1LYXA 4K7VA 4XZ9A 2ZZ4A 1QAPA 3WJXA 1NF0A 3WK1A 3ABSA 4AHPA 1OK4A 3QSTA 4KKXA 3TXVA 3DAQA 5EMUA 1JRBA 5SWUA 2QCMA 3QEZA 3HOJA 1C8VA 2EKCA 1EIXA 4LVAA 4RXGA 1QMLA 3ATYA 4R53A 2ZA2A 4IJBA 4AF0B 4ICNA 3W2KA 1SO6A 3EWYA 3O63A 3LV6A 3L5LA 4H6KA 3GVGA 4Q33A 3PBYA 1TPB1 1LCOA 3QPZA 4M5PA 3C4UA 2OT0A 3W1RA 3LHYA 5BOOA 1H50A 3EX6A 4NNAA 1OFAA 3KVKA 7TIMA 4FIRA 5BMXA 1X8FA 3GIYA 4UFLA 2Y70A 4S1FA 5HWMA 4MIMA 4O10A 3C0JA 3G8RA 2NV2A 1X7FA 4NZFA 3LLDA 1SPQA 1EPXA 1ZAJA 2QCFA 4DF2A 2NX1A 4DEFA 4EOUA 5CSRA 4FO4A 3W1PA 3Q58A 4CLMA 4MFEA 1W5PA 4N4QA 5IBXC 3O15A 2QUTA 1LZOA 3CPRA 4UTTC 3NM3A 4GUIA 3FYOA 3H54A 2JGQA 4RZ5A 4GC4A 4JY8A 1RD5A 4DF1A 5K4XA 1KM2A 4FX7A 3LCXA 3BW2A 1M6JA 4BWLC 2X16A 3EX1A 3C2OA 4OBTA 5MHBA 3TV8A 4UFIA 3W23A 4UFKA 3W22A 1WXJA 3FEMA 2C15A 3R13A 5AC7A 4Y90A 3KRZA 5DY3A 3HGSA 3ATZA 4IWWA 1XC4A 4JTUA 5AHEA 2YPIA 3EKLA 4K36A 2X2GA 3C52A 4JTGA 4WOQA 2RFGA 2ISSA 4J9JA 2A7PA 2FFCA 3S1VA 1XM3A 4GUJA 3N14A 4AWUA 2G97A 3DI0A 5G4WA 5HR6A 4O0ZA 4ZMGA 5HINA 1VYRA 5LNSA 3HPZA 3W1AA 3EWWA 1GYNA 4QAIA 1K02A 3EEGA 1ZY9A 2VFFA 3IGXA 3PAJA 1K7XA 1H5YA 3FFSA 5KINA 2J27A 4EF9A 2RHGA 2J9XA 1JQVA 1G6CA 3L68A 2E09A 3H53A 1QR7A 3W70A 2NUYA 1FQ0A 5C2XA 1L6SA 1X1OA 3NXFA 4AEOA 2QCCA 1C29A 3W1XA 4O1BA 4GNJA 2WNNA 4W9TA 5HWJA 4NNBA 1JCNA 3LCIA 3MP3A 1FY6A 3QSRA 4M19A 3M6YA 3WK0A 4JS3A 1ZAHA 2TSYA 4TO8A 2DJLA 1SR9A 3IGUA 3QZEA 2C6QA 1BWKA 2V8ZA 1Z41A 3I7QA 4LUJA 5F1VA 1FBAA 1K8ZA 3W7OA 1TV7A 5F1UA 2GPTA 4Z0SA 3R89A 1XDLA 5BRBA 1S5WA 4HNTA 1Q45A 3STCA 5I3FA 1XXXA 5D32A 3P81A 4QIUA 1TMHA 2GVLA 3SSJA 1IXPA 5GVJA 1U83A 4HNUA 1XI3A 3TAKA 1GEQA 1GOXA 1KW1A 2Y62A 3NR0A 2Y7DA 1OYAA 1HUVA 1DHPA 1W5QA 3G3MA 1QPRA 4LS2A 3QQ0A 4ADTA 4JD4A 5J5DA 1LLZA 4LT9A 4IMDA 3TU9A 3PBVA 2I1OA 2GOUA 2AQWA 1IXOA 3A5FA 4N2YA 3NQDA 3M9YA 2HTMA 5FESA 4O1AA 3TW7A 3W7KA 4PH6A 4X3ZA 1IF2A 3LHTA 2NWSA 2OZ0A 1TPWA 4O28A 4JTFA 3HQ1A 1W5OA 3LI0A 4NT0A 1FDJA 5E93A 3TCEA 3NQMA 1NSJA 1F2JA 1RV8A 3G1FA 3MUXA 4PODA 2KZHA 4JTHA 2BZNA 1QFEA 3C61A 1E51A 3GXTA 3KVLA 3M44A 3BPWA 1L9WA 2WSRA 1AL8A 1W5MA 5LHEA 3WJYA 2Z6JA 5D33A 2OT1A 4Z08A 2P1FA 2YGYA 3VFLA 2Q3RA 1OHLA 3E12A 1QOQA 1XUUA 1H62A 4AB4A 5AC8A 1G69A 3B06A 3PB2A 3HPXA 3G1YA 2V5BA 3PF3A 4S2BA 3KX6A 1OFQA 4K37A 3BVJA 2YCEA 1YXYA 3GB6A 1LROA 2DZTA 1GQNA 2WOQA 4PCFA 5EBUA 5F4SA 2DZSA 4UXDA 2A5HA 2OCZA 1G4TA 4NXSA 1XUZA 3WK3A 5K9CA 1ADOA 1D3GA 3BO9A 3H55A 3FS2A 4N9EA 3F1QA 4LRSA 3IGSA 5D2WA 1WAUA 5G2IA 1CX9A 4HNNA 3TK7A 3M7WA 1OF8A 1A5AA 4JTLA 3GK0A 4IGHA 3BGGA 3W07A 2JBMA 1LRNA 3GDMA 3PG9A 1QO2A 4Z1DA 3CB8A 2ZZ3A 3UPWA 4FXSA 5FF4A 3T44A 1QPQA 1ICPA 2X30A 4N9CA 4ZZ9A 1C9DA 3W72A 4UTWC 2EGZA 2YR1A 3LX9A 4MY8A 3W1TA 3CWOX 3USBA 3A21A 4NUWA 2BSLA 4HPXA 4NJJA 4M7SA 5BW6A 3DH7A 3BLFA 3MHFA 2Z0IA 1BEUA 3S0CA 1LM1A 1HL2A 1ZAIA 4UTIA 4WUIA 1LBFA 4O15A 3CIWA 2YXGA 4EF8A 4FNRA 1FDYA 3TUUA 4CCCA 4O0KA 4G1KA 1T0OA 1I2QA 1DL3A 1VR6A 5G2HA 4XBSA 2ZZ2A 3E02A 1JR1A 5F4XA 2W79A 2RDWA 4AF0A 3CT7A 5G2WA 5HMSA 3WFAA 3SECA 3I6RA 2R14A 1F6KA 5C55A 5LNUA 3HBLA 3G1HA 3W84A 3DBPA 4O12A 4S2CA 1Q6LA 4A29A 2QCEA 3Q94A 2NXGA 3EWXA 2CZFA 2G95A 3HG4A 3HG3A 3C6CA 1MZHA 4LVBA 2QDHA 1NEYA 1FWRA 4JTKA 2WKJA 4BI7A 3S1XA 4BF9A 3W1QA 3M1ZA 1WQ5A 2VENA 2QJHA 2ZA3A 4E2BA 4CNPA 3AO0A 3TNOA 2DZVA 3B4UA 3E49A 3OEXA 3WJWA 2WPBA 2ZZ5A 4FX8A 2ZCGA 2H3BA 3UNDA 1GVSA 3UXAA 5AFDA 2VC6A 4UTMA 4L4MA 4MJMA 1O94A 3ZWTA 1W3IA 1WDWA 2X1SA 4O17A 4UFHA 4E38A 3QC3A 1G67A 1TPVA 3L67A 1A5BA 2R91A 2XN1A 3T55A 1N55A 1K3UA 3PC0A 3B03A 3L0GA 2BXVA 1OX6A 1OX4A 2GQ9A 1HO4A 3QMTA 1IIGA 1YDNA 3PUOA 3DKLA 2GVGA 2A6NA 1H1YA 1OYBA 3PM6A 1U5JA 3W76A 2VEMA 1GG0A
chains in the Genus database with same CATH superfamily
3MMWA 2D23A 3N6JA 1TA3A 3N25A 5AC6A 2Z28A 3P80A 3DGRA 1W31A 5FF2A 2A7RA 2ZX7A 2CYGA 4PBEA 3F4VA 4OKDA 4OE7A 1EDTA 5IDIA 3WELA 1Q4NX 3W1MA 2Y6ZA 2V5LA 4YTQA 5CBIA 3ALGA 5D02A 3QHNA 3RILA 3W7PA 3IWPA 4LY8A 3HQNA 3W37A 4JGDA 2HROA 4Q4RA 2ZE3A 1GVRA 3SI9A 1RA0A 1S3TC 3P60A 3UEQA 1P1XA 1L8NA 4LYRA 3IK2A 2A3AA 1J0YA 3I4KA 1Z48A 3PWGA 3AS1A 1GOWA 3I7SA 3IEBA 1TZZA 1VP5A 3ANYA 5G4EA 5HNTA 3TROA 3H2EA 4DJFD 1XIFA 1ZRQA 4LUIA 1I0BA 4AHQA 1FWSA 3V5FA 4JX6A 1Q6RA 3BV7A 3G24A 2EHHA 2WMFA 2FVLA 2OVLA 1CW2A 2ZQ0A 5HATA 6REQA 1XLDA 2WKLA 5DT7A 3BG5A 4JNMA 2WO5A 2HXUA 1K9FA 4IXXA 3L2LA 4LH8A 5LGXA 1GPWA 2GOKA 4JOMA 5BU6A 3AIUA 4XVEA 1AJ2A 3SIZA 1S2VA 3OZOA 2HPMA 1V6VA 2QKFA 1Q8AA 3HN3A 2E0PA 4LSBA 3DIPA 3A47A 1W3TA 2PGRA 1C91A 3CHDA 1AA1B 1B4KA 1BG9A 1PHQA 4H1ZA 3S83A 3NZGA 5A94A 3MI2A 1KFJA 2VFGA 4DZ5A 2P10A 4IIHA 4GQQA 1PHWA 1EZ2A 3M0XA 3M5YA 4PMRA 1A4LA 3ITLA 3QF0A 1B2YA 1IT8A 3GIPA 4PFMA 3UWWA 4Z1CA 3R0KA 3H12A 2FGZA 2HXTA 4PCNA 4AZIA 3BAJA 1OT1A 1XLCA 4Q6XA 4IFOA 4GFSA 1VHCA 3GE7A 1FWBC 1MI3A 3S8HA 5CEWA 1PV8A 1UD6A 3RLUA 2XHYA 1KTCA 4IIGA 4KGJA 4PTWA 1AG1O 2FQIA 1WE5A 3MSYA 2PZ0A 3MUIA 4S23A 2ISVA 2VR5A 3GAKA 5HR7A 3AXMA 1FOBA 1J5SA 2VFIA 3UXLA 3N04A 2PPGA 3KBJA 2TYSA 5JXQA 1DIEA 2HISA 3GKFA 3MJYA 4H7ZA 3B8VA 4FI4A 3N2TA 3W7DA 3AISA 3WLHA 3YPIA 4HZMA 2ACQA 3RLHA 3OVRA 3HGOA 4IMCA 3S2MA 4WOZA 2DT2A 2H9AB 1UROA 4RZBA 3WO8A 3QMSA 3WUFA 4B90A 1QHZA 4HJWA 3NQ6A 3N13A 1K8YA 1EWEA 2R9RA 3CH0A 4HHMA 4YN5A 3GR7A 2QAFA 2VX6A 3QR1A 1H7OA 2V9DA 2E4TA 2A85A 3GFYA 4I7WA 3GDLA 5FAJA 4DM1A 4YTSA 5IRPA 4A6GA 1GOMA 2FZDA 2NWRA 1SJBA 5D9MA 2WKGA 1HJQA 3N4EA 1F6YA 3RPTA 3ALFA 1XYMA 4PTDA 3W7EA 3LERA 2NVCA 4U28A 4RZ6A 1J4EA 4R3UA 1KFBA 1D8CA 1TB3A 3ZOAA 2A2IA 1XSIA 1W1TA 4C7FA 4BEUA 6REQB 1V6UA 3KBMA 3TX9A 1R3TA 3F5LA 2OELA 1ONRA 4PL2A 4S3EA 3EKGA 2JKPA 1GPFA 5D2VA 2D20A 3PJUA 1ONEA 2A0NA 1XD1A 3E6EA 5A6BA 1HKMA 1B3XA 2W4XA 1MWOA 3OYZA 1EJTC 3VD9A 2Y8KA 3H4GA 1I0DA 4EACA 2V2DA 5JVLA 4Y8FA 2NX3A 2WMGA 4OT7A 3U2CA 1A0EA 3GUWA 3LM7A 4WJEA 1SJAA 1W54A 1NDVA 4CD8A 1KLZA 3P8JA 2VQTA 4LAKA 4C7GA 1UBPC 2HS6A 3CHCA 3OODA 4CD5A 4RKAA 3NO3A 5IOBA 3H23A 4CCDA 2BP1A 2Z29A 4QG6A 3RMEA 1TWSA 1B9ZA 3NSNA 3UA4A 3QR3A 2GJRA 1W0MA 4JKKA 2BY0A 5D9OA 4ZENA 1KFKA 3B8IA 1JYXA 2XIBA 1XRTA 1FH7A 1DWFM 2QMJA 3LCFA 4Z1AA 1A5KC 1TTJA 4AY7A 3U3HA 4LEFA 1JCTA 2YBVA 4PEEA 1K8CA 3NA8A 4XIMA 4XD3A 1H1NA 3W7HA 3MSRA 2PP3A 4YLWA 1JDAA 1HQTA 2IS7A 1DIDA 3QH2A 1A50A 2VDHA 3DERA 4I8DA 4AH7A 5XIMA 1EJVC 3BARA 4GKTA 2WMIB 1FFQA 3OQEA 5LA2A 1KM4A 3CV6A 3T40A 3CV7A 1XKYA 5FF7A 1SZEA 3OA3A 2QMKA 1IZJA 8TIMA 3A24A 1I2NA 1JYWA 1EJXC 3OG3A 3CS2A 1CLXA 1M7XA 3ENLA 4PMDA 4W5UA 3IJ6A 4HCHA 2DQWA 3ZT6A 3NQGA 1I1XA 1ICQA 3WIJA 3IJ8A 5D2TA 5C9ZA 1N7KA 3WH5A 5JIWA 3CGTA 5T9BG 3NM1A 3DG6A 3EBVA 2QQ6A 5CAHA 2WM0A 4WY0B 3RAOA 4AIOA 1KM3A 5EKYA 3GUGA 3WBAA 4UC5A 4XZBA 3QFEA 3P62A 1XLKA 4Z0JA 2HBVA 4L6HA 1EP2A 1FWEC 3VNMA 4HSNA 4INFA 2D3NA 1WDRA 3DG7A 4D71A 1YBQA 1JUBA 1GYMA 1TMQA 3M5ZA 4AD4A 1BYBA 4L1GA 3TYCA 2NW0A 1D2KA 1KWGA 1ONWA 3CHFA 3QPYA 4L9ZA 1SSDA 1BGAA 1NFBA 4CD7A 5HUPA 3UU0A 3TA9A 4H7VA 1KXVA 4FA3A 3OOQA 1GONA 4FR6A 1G7UA 3KZSA 3ZMRA 1V77A 1EJ7L 2OODA 5AHLA 3MVIA 2PP0A 2ISDA 2CZVA 1NY1A 1I45A 4YJ5A 3IUDA 2AGTA 3KBWA 1I8JA 4O0QA 5C9WA 1TREA 3MVTA 1CWYA 2Y63A 4HCDA 2CLIA 1SU5A 1KD0A 3W74A 1PZ0A 1CGYA 3GHTA 5C71A 5AYXA 2XIIA 2F9RA 2VRKA 1KV5A 1QDSA 1ZHAA 4N6FA 4GBUA 3HPAA 2E8YA 4HMCA 1JEZA 2OEMA 3U5YA 4QDMA 3W7MA 4IJCA 3CMJA 4I6KA 1KNWA 4ENLA 2ZC8A 2AL2B 4UQBA 3WLKX 2Q3OA 1GZJA 3W87A 1O4UA 1GJPA 1K77A 1S2AA 1KKOA 2W62A 4D6DA 3SEPA 2X1TA 3PSWA 1ZLPA 3QFWA 1KTNA 1S1PA 3WNLA 3OBKA 4WXZA 2CZDA 3SZ8A 3TWAA 1D3CA 2ASHA 1JYNA 4CNTA 4JDBA 2ZZ7A 4OBSA 3QYQA 5D9PA 3OIXA 2CERA 4KBXA 1FP9A 2DSZA 4JTIA 2XVKA 3TXZA 4DX3A 3AYTA 1QJWA 5EMMA 5E9AA 2ZZ1A 3MI6A 2EJAA 2VX7A 4E2OA 2REQB 2RGLA 3T08A 4V2XA 3A13A 2I56A 1FWIC 4GI9A 6TIMA 2A4AA 4UTFA 5BROA 4I9MA 5LGZA 2C1HA 3FKKA 2AAMA 3UWEA 3E96A 3SCUA 3I68A 3VD7A 1IWBA 4GWEA 2W6RA 4J35A 4NJHA 3IUIA 1QK2A 3OHIA 3K8KA 4IM4A 4L9YA 3CEPA 3NCOA 4IFRA 3NWRA 4KQNA 3NL3A 3VYLA 4UTWA 3S5YA 4TU1A 1ZBCA 4REQB 3LNMA 2B7QA 4TV5A 3RLVA 2PWDA 1KCLA 4MB4A 3ZT5A 4QM1A 4FALA 3NQ7A 4LNCA 1F74A 4ZO7A 4MYAA 1F8IA 1PCWA 1PJ9A 1CI1A 4OGZA 1JDCA 2NQ9A 1NOFA 3AHVA 1XLBA 3FN9A 4QS5A 1HKVA 2DQXA 3GC2A 2YSWA 2ALDA 1RAKA 1I75A 4CKQA 4PRRA 3NQFA 2QJNA 3LCLA 2NVDA 4NU7A 4LANA 3TYBA 1YTEA 4MZ8A 3WFZA 1BKHA 1EWDA 1YXDA 2QR6A 1P5BA 2J24A 4L7ZA 5CJNA 4UR7A 1G4PA 3AHTA 1JFXA 5C70A 1K8XA 3CIXA 3LQLA 3QZ6A 3W88A 3VOIA 2O92A 1C8YA 1J0IA 4CN1A 3WH8A 3SCWA 4RNJA 3DHFA 4AZ6A 1NIUA 2WVVA 2TODA 2PTXA 5FJJA 2J74A 1ZJIA 5E1QA 3TQ0A 4OWGA 4MAZA 2IKJA 3FJLA 4US6A 3RK8A 3A9BA 1EL3A 3WQ4A 3ZJ7A 2WHJA 3LTPA 2WBKA 1SVDA 2HK1A 4RR4A 5A6JA 4HK7A 3O9NA 3WBEA 1GYLA 4XKYB 5E0KA 4ILSA 4L9XA 2J9ZA 2IXUA 2RKXA 3DHUA 3EKZA 4RDYA 4U3CA 4M1BA 3E2RA 3VNIA 4NAEB 4JN7A 4GC3A 1NAL1 3AZTA 4LUTA 5J04A 5CSYA 4ML9A 3PBUA 3ZSSA 1LG2A 1QCWA 2WNQA 3AAMA 4TIMA 1TV5A 1LOSA 4JQ2A 1IT0A 2J9YA 3TZNA 4J40A 4A05A 2WVVB 1JNEA 4F0HA 4GYPC 2XINA 2ZUTA 1OFBA 3DFOA 4WDWA 2W92A 2YDAA 4U2YA 3ARTA 3ZJKA 2V38A 3SADA 3G3DA 2BX7A 4O4WA 1Z42A 5A6AA 1REQA 2BG5A 4MWAE 4TX9A 1DJYA 3CL8A 3MP4A 3I6TA 3SRDA 4AXKA 3EX2A 3HF3A 3K13A 5B7YA 1P6BA 2J88A 2EPHA 3H2NA 3ITCA 5A6MA 1YIXA 4K7YA 3KBVA 4LW7A 2NX9A 1IGWA 3QZAA 3DFSA 4DUXA 1JUKA 4UTJA 4O50A 5EPDA 3W1NA 5KETA 4R27A 1UIPA 5CLWA 2YB4A 3UPMA 4IFKB 2XG9A 1J5TA 2Z2UA 4UTKA 4DO4A 3O6YX 1TPDA 3VNYA 3FHQA 1DV7A 2VZOA 3K4AA 4PUNA 4JQ4A 5KZDA 1PZ2A 3L4WA 4KEZA 1A47A 1MO0A 3QBUA 1HVXA 1EP1A 1LRTA 1TIMA 4GQRA 3HG5A 2OWCA 1X6NA 5A6SA 3UXIA 1UH2A 4W84A 3KDNA 2XH4A 1AD1A 5BCAA 1O5XA 3HPFA 1VEMA 4DJDD 1DJZA 2Y88A 1UKSA 5H8UA 1XBXA 1XPGA 3MY9A 4HPGA 3O05A 5DX7A 4O53A 4NAFA 3V75A 2V2CA 4MWAD 2WQPA 3KS6A 2WB5A 4NKCA 1TSIA 1O7AA 3GKAA 3NPWA 3QGKC 3S1UA 4PMXA 2YW3A 4NYUA 1JI2A 1V8EA 5TBOA 2C79A 2PDBA 3PUDA 2H6RA 1BFNA 3WDHA 3BK0A 1TPC1 1DKWA 3NGJA 1DQXA 4I7UA 3TIMA 4M81A 4YXGA 3S1WA 2VFDA 3I65A 2WMKA 2FVMA 4PB4A 2BXZA 5C2CA 4JNYA 3I7RA 3K8LA 4HN4A 4WY0F 3LTYA 1UW9A 4QEHA 4REQA 2QUMA 4UFJA 1TX0A 1VPYA 3T0CA 5ECUA 1VHNA 1DJWA 3A4AA 1EB3A 1WDSA 3LHVA 4WIWA 3ZVHA 3AS3A 1MQRA 3IJ9A 3K4DA 4DJFC 8XIAA 2F6KA 1VAHA 3USZA 1AQ0A 4ZL1A 3LI1A 4HPHA 2WQDA 3S5NA 4PCSA 2V5CA 2DUXA 5LZLA 2XZ7A 3STEA 2NSXA 3ITYA 2ZXDA 1X1ZA 4MPQA 3NQAA 2ZUWA 3R0UA 1B31A 4X60A 4LV9A 2NUXA 4DYKA 4S3FA 2JE8A 3KHJA 3N2OA 2YXOA 3KWXA 1LQ2A 5BZAA 3AC0A 3UXDA 4Q3MA 3GZ3A 3BSMA 3GX9A 1ZJBA 1JPMA 3RITA 1B90A 2BOGX 3HMJG 4PMOA 3BJSA 5E70A 3B0XA 3CEUA 1WDQA 4H6EA 3AZRA 3B4YA 3EXRA 2WVSA 3EMQA 2P88A 1OJXA 1A5MC 5DELA 4C6EA 3QGAC 4GE8A 4GIYA 3EX4A 2ACUA 2VOTA 1TRIA 2IW0A 4PCTA 2OO6A 4GYPA 1HJVA 1HO1A 4BI6A 2C0HA 2C14A 4HU3A 3BZGA 3M5VA 1XWYA 4NAFB 1YDOA 4O1FA 3L4XA 1CB7B 1H3GA 3FX4A 2VURA 1KC7A 3S5OA 2CWXA 4BQ5A 1WZMA 4OECA 4M8UA 4P7QA 1ZB5A 4IL0A 3N29A 3WNOA 3SR7A 3NYDA 3PFRA 5IM51 2VHLA 3MA8A 4E3TA 1VH7A 2GGEA 4WDTA 3LHZA 1CPUA 4KW2A 4KS0A 4W87A 4UR8A 4O18A 3SJ3A 3W3OA 3OG2A 5D4YA 2YW4A 3E5BA 2BY1A 3TA6A 4RK8A 1TVNA 1I4NA 3ZR5A 4IOTA 2CLOA 3T6CA 3ZFHA 4KPLA 2J77A 1B9BA 3PZTA 2ZA1A 1EUNA 4WHBA 1YTKA 5HQEA 3VKBA 2IMRA 1OB0A 2V68A 1CB2A 1TWDA 2E9MA 4O8AA 3W7IA 3LB0A 1EJUC 5FJPA 3EWUA 1X6LA 1DXEA 3MQTA 2D73A 4R7OA 5JH1A 2YOCA 3W7NA 3K5XA 2UBPC 4B91A 3VX0A 3STFA 3B9OA 3NVDA 2TRSA 3TTYA 5A1AA 3W7QA 2A7NA 4RNHA 3NQ2A 5FI8A 4HMNA 4MUPA 1UPMB 3WD2A 4MOZA 4E0CA 4DNMA 1JUEA 1JJKA 1E5JA 3BURA 1YMYA 4EPEC 5ABFB 4MWAA 4J4KA 3FIGA 3P0XA 2QV5A 1DHKA 2GGIA 1RVKA 1LYXA 3G2GA 4XAGA 1QAPA 1E6ZA 3R7MA 5M2FX 4GO9A 1OK4A 4RL3A 2J8TA 3UGVA 2SFPA 3UW6A 3TXVA 1X1NA 4EAYA 3O7UA 2WANA 1EIXA 2QVHA 2ZXQA 3U7BA 3UFYA 3WF2A 4QDPA 4DBUA 3ATYA 3C2YA 3CZJA 1X7IA 2AOSA 3LGDA 4IJBA 2FZ8A 1W1VA 2WPGA 4TVDA 3TTQA 3QV6A 5I7GA 1C8XA 4QE1A 4ZGYA 3PK7A 3PBYA 3WNKA 2OT0A 1H50A 3EX6A 2OYLA 1EIBA 3KVKA 3TN5A 5BMXA 1X8FA 4KESA 2P76A 1HL8A 4MKVA 3UJEA 1DJIA 1X7FA 1X97A 1XISA 2PDIA 2QCFA 1RY8A 1KCKA 4EOUA 2AQOA 1W5PA 5IBXC 3GTNA 2JFEX 3NM3A 3BJTA 3FYOA 3H54A 3K1DA 4HJFA 4RZ5A 4JY8A 4DF1A 4FX7A 1UD2A 3LZ5A 4WF7A 1J93A 3W23A 4UFKA 3DESA 4Y90A 5AC7A 5DY3A 3AIVA 3D46A 3HGSA 3WBWA 3MB9A 3ATZA 4IWWA 2FTWA 1TWWA 4BCEA 1UH3A 4WOQA 3R10A 2WAGA 2E7FA 2WVTA 2A7PA 3T07A 1XM3A 3AIWA 1WO2A 1KGXA 2VZVA 4ZMGA 1VYRA 1Y5WA 3PN8A 3HPZA 4XZNX 3CUHA 4PUEA 3BAXA 2PODA 4MAVA 1E0UA 3EEGA 4B2DD 1ZY9A 2VFFA 2XFFA 3N6HA 3OW1A 3LYEA 5KINA 2OQHA 1AH3A 2J27A 2VUYA 4XUYA 3M64A 3H26A 4NSBA 4W85A 4EF9A 2CXEA 1DTNA 4F2UA 2RHGA 4D8AA 2FYMA 3UA3A 3UP8A 3WQ6A 1K6AA 1PWMA 1DJHA 5C7HA 2YCLA 3W70A 5C2XA 1L6SA 3NXFA 1A3XA 3UR8A 3AMLA 3W1XA 1A3WA 4GNJA 2PDXA 4W9TA 4C7DA 4IP7A 1FY6A 5I09A 2YCIX 4H2HA 1ZAHA 1N2VA 2PTWA 2PB1A 1BWKA 2V8ZA 1IEVA 2DSUA 2VGBA 3I7QA 4LUJA 4YVPA 4Q4MA 1FBAA 3IAQA 3SAZA 1YNQA 3KE0A 3F7JA 4Z0SA 1KQZA 4HNTA 3SCNA 5I3FA 5D32A 3VD4A 5BXRA 4QIUA 3U2ZA 3ARRA 3OO2A 2NSOA 4FLQA 2DUAA 4M6UA 1XI3A 1PAMA 3EB3A 3AMDA 1F4AA 2Y7DA 5CXPA 1E1EA 4GY1A 1UR3M 3G3MA 3SJNA 4AG0A 5J5DA 1YKWA 1TVPA 2I1OA 3E0FA 3T4WA 2GOUA 1MUWA 3A5FA 4N2YA 3NQDA 5FESA 3TW7A 3M0MA 4X3ZA 2PMQA 1QT1A 3LHTA 2INZA 5I5RA 1K1DA 2WMIA 3LI0A 3RJYA 3SCTA 5E93A 5AYBA 1F2JA 2C8NA 3GC4A 3MUXA 2KZHA 4PUMA 3QY6A 2B81A 1E51A 1R5YA 4H8VA 3M44A 1A49A 2PAJA 3WJYA 3VIKA 4I9TA 1ITUA 4Z08A 2ZWYA 2YGYA 1XJBA 1OHLA 1XIDA 4Y7EA 1XUUA 3CO8A 2KAUC 1H62A 3B06A 3R8GA 1XG3A 1QNOA 4B16A 3PF3A 3KX6A 2KX9A 4AD5A 1OFQA 3ITVA 4U2ZA 1YXYA 2BMBA 2WOQA 1GQNA 1Q2RA 1O6IA 3TYUA 3UCQA 2HE5A 3VIPA 4XD6A 4DZIA 3WK3A 5JBFA 2J13A 3GTXA 4AEEA 3CASA 3URBA 1OQFA 1OC7A 3BAWA 1KXHA 2O9RA 4A3RA 1DPMA 4Q8QA 1PX3A 2VEGA 3M7WA 1E56A 5J8LA 1EQCA 1QUMA 4ACZA 4IGHA 4RUBA 1V3MA 3UESA 1XYBA 2QIWA 1E0XA 1RK5A 3EDJA 2JBMA 4HU0A 2VX4A 3CB8A 2ZZ3A 3IJ7A 3UPWA 3T44A 1JGMA 2X30A 4N9CA 4ZZ9A 1V08A 3RHGA 2IPWA 4EPDC 1CLKA 1BVWA 4J3SA 3W1TA 3A21A 1B54A 4NJJA 5HNNA 2JIWA 3AIEA 1MQQA 4AD2A 1QTWA 3WLJA 4F66A 4HNOA 4ICCX 4UTIA 4WUIA 1K4GA 3PHAA 3CIWA 3FAXA 1BAGA 1OG6A 1FDYA 3UCDA 5I77A 4O0KA 1T0OA 3ZSTA 3QC0A 4J7RA 2ZUUA 3PWIA 3AROA 3OBEA 5F4XA 5C9RA 3O3RA 3VDCA 5LNUA 2OEJA 3HBLA 1XRSA 3W84A 2VCAA 1W6TA 2EO7A 1ZQ5A 3VD5A 1WZAA 2WZIA 4B5XA 1ECQA 4R9OA 5REQB 4LBUA 4JL2A 3HG4A 4KCTA 6CGTA 1NEYA 1FWRA 3VVGA 1W3KA 4DLMA 4BF9A 1W91A 2QJHA 2ZA3A 4MMWA 4CNPA 1KBBA 1JF6A 4PMYA 3OEXA 3WJWA 4GYJA 4C5YA 5HNUA 2H3BA 3PPHA 5AFDA 3KS5A 4CD4A 1O94A 3VFCA 4MPKA 4RNFA 2X1SA 2HVMA 4E38A 4WSHA 1TWIA 1TPVA 3KOXA 3L67A 4RE3A 1AODA 3FNDA 3T55A 1OCJA 1VJSA 2BXVA 1OX6A 2BGQA 3SQLA 1YDNA 3QMTA 4Q4PA 1TR1A 4LAUA 1U5JA 5CAKA 1R3RA 4S3CA 3O16A 1UPPA 1VFTA 3ES7A 3W86A 4C60A 1ML1A 1XIGA 3E9AA 3F5JA 4J28A 2X0YA 4YS1A 2DSWA 2G4JA 2VUNA 4GO8A 3HG2A 2QZRA 4NZCA 3TMLA 4F48A 5H91A 1ADDA 3G5EA 3PZVA 3THAA 3QKZA 4HA0A 4IG2B 4DBWA 1KM1A 3KCOA 3CMGA 3MYOA 3B97A 1DJGA 4HHHA 3TC6A 5BXTA 4XIAA 4KMQA 4P5UA 3MZNA 1HTIA 3CL7A 4X9YA 3N4AA 1AH4A 4QDWA 4FNSA 2VL4A 1M68A 1M1BA 1A5OC 4K38A 2BLEA 1MUCA 1BG4A 4KEUA 3R5EA 4UCGA 3P84A 1V5XA 2OWXA 5K4ZA 1N82A 1JYVA 1J12A 4CNNA 3WNPA 1SMDA 3NZQA 2B31A 4DVOA 5EU9A 1CGWA 4IPLA 3AXIA 1S1RA 3WX7A 3ISIX 1LT7A 3QM3A 4V33A 1PCKA 2VELA 4LFYA 2E5DA 5CH9A 4CEXC 4KFNA 5I3JA 1A5NC 3BMVA 3UYCA 3UY8A 3S5SA 2ALRA 2GLKA 1CNVA 1HKKA 2I17A 4QG8A 1LBMA 1GK8A 1BYAA 4S3DA 1WBJA 2YYUA 2Q8LA 3ZWSA 4KWWA 2WSYA 5TIMA 4QROA 1ODZA 2Y7EA 5K7JA 2AL1A 3TVAA 4JDYA 3W2JA 1XIMA 4FP1A 3WMCA 3HPSA 3RX3A 2DIJA 3FOKA 1LOLA 4CU7A 4A8IA 2BWGA 3NG3A 4XAPA 5AOUA 4JIQA 1S3HA 3GXDA 4PUDA 2VEKA 1AZ2A 2C7FA 1G01A 2J6XA 1TE6A 3ARPA 2HEJA 3LPOA 4A2SA 2D3LA 1EGMA 1BWLA 2OLHA 4FLOA 1Q6DA 5K2ZA 1Y8BA 3VGBA 1SO3A 5KITA 4P2VA 2VOMA 3E0VA 1GZ1A 2QJGA 1EDQA 5A8NA 5LNWA 3LZ3A 3N11A 4NRRA 3I6EA 4O52A 4S3JA 3W2UA 4U5IA 4M6VA 1J01A 5G1YA 2O7SA 3SN4A 3TW9A 1UP0A 1KRMA 4I7VA 1UMYA 2TAAA 2W66A 4MFDA 5D37A 4AAJA 1OD8A 2QPXA 4GNKB 3NYZA 3P5YA 4WJ8A 4YHEA 5G1MA 3ZLFA 2HNEA 5CBBA 4NG3A 3T2PA 1XG4A 1KXTA 3EOSA 3LRMA 1IWPA 3QV7A 2FHBA 2DU2A 5DLCA 4F9JA 3GDRA 1H7RA 1UZ4A 3FJ4A 4J3XA 3QMRA 5M3WA 3F03K 3O2LA 1WOBA 4ZO6A 4S3BA 4Q7BA 2PDGA 2VQUA 3IANA 1RQBA 3TQVA 1KFLA 1PZ3A 3N12A 3V4BA 3GU2A 1X96A 4Q8PA 5A95A 2DFAA 3PZOA 4A3YA 3WQPA 4KFPA 2ZWZA 1P0DA 3F2DA 4OV4A 4JTTA 3G77A 3RMJA 1V03A 4LF2A 5EBAA 3DZ1A 4O1EA 2ZX8A 1KRAC 4EXQA 8XIMA 2X09A 3QLLA 4ADUA 1JD9A 2EKGA 5DCDA 3BQ6A 1P7TB 3RR1A 1EJSC 3GR8A 5DXYA 4PUJA 4GGHA 4UOJA 2PA6A 2XN2A 4O57A 4BK9A 7REQA 3TW6A 4C6NA 2YCJA 4AW7A 4US5D 4V28A 4XQ6A 4ZSUA 2ZRXA 4PMVA 1EEXA 4KRZA 2ACRA 2WV8A 4ZBCA 1DJQA 3SGGA 1E4LA 1EDGA 4AWEA 4HZ6A 3KM8A 2GWNA 3BQ5A 4OV9A 1HGYA 1Y0EA 1UB3A 5F2IA 5B7ZA 4ZOBA 2DT0A 4PMQA 1AUSL 1CXKA 4S3AA 2GSEA 1W17A 4H9MA 3T4CA 3G8EA 4LU0A 4PUKA 1OC5A 3GSMA 3M0KA 1W8SA 3L4YA 1EO7A 2P0IA 3AMKA 1VBRA 3G6LA 1TPH1 5C0QA 4MSSA 3QVQA 4RE4A 2Q8ZA 3CC1A 1E70M 3ARWA 3WJSA 3L2MA 3FHAA 3VUSA 2J75A 3LN3A 4V15A 1Q6GA 3W4RA 3ICJA 2FPYA 1R3WA 2JK2A 1FWTA 3W7CA 2FJKA 4TVCA 3FYYA 2PEVA 4HA4A 3W2NA 2H3DA 4YL2A 3MCMA 4AZBA 4J3ZA 3OVPA 4IJRA 4M3PA 2C19A 1H4PA 1RUSA 3BLDA 1GTHA 3CUIA 5JBDA 3EMZA 1TPFA 1DIKA 2OLAA 2CBIA 2XVLA 3A22A 1GVQA 4OVXA 1KRBC 1SO5A 3GVVA 4A8RA 2Z2AA 3DFYA 3EB4A 2I7GA 4Y2WA 1XIIA 4H04A 3B8WA 3ABOA 1G4EA 3TYEA 3MPGA 4LUYA 2XIMA 4RLIA 5ABHA 2XTKA 2NQ5A 2A3LA 1DWJM 2H90A 5LHFA 1KLYA 1FCUA 1S2UA 2ZRUA 4C91A 1L8PA 3MI3A 4LB4A 4Q8VA 3BAIA 4OFCA 1WOAA 2R1KA 3C0LA 5H2ZA 3NPVA 2J62A 2YL8A 5C7VA 2QDDA 4P61A 5I3IA 4V1XA 4C6MA 1P6WA 3AJ7A 2BOFX 5HANA 2QXWA 1EC8A 1MW0A 4AD3A 3F4DA 4MDPA 4IMAA 4Y9AA 4R9XA 3MUZ1 1M65A 3R12A 1PX4A 2R82A 3GTIA 1TQXA 1E9IA 4DJEC 4AEFA 3IIVA 4DAIA 4C5ZA 2CNCA 7REQB 4ZFMA 3N9RA 3ZLGA 4YTRA 2B7PA 5AHFA 3DENA 5DRCA 4NYYA 1PBGA 5AZ1A 4JKLA 4IIBA 3KRSA 1PUDA 1QO5A 1J11A 2CHRA 3EB2A 3DFHA 1XPYA 3PTMA 3NUKA 4PB5A 1FHLA 4HYWA 4BA0A 2A6LA 4L6DA 3WBYA 1Q4WA 1XKJA 3WNNA 2QV4A 2E5BA 1I2RA 2D2HA 4N9DA 2VKZG 3LDVA 4YPJA 2IUZA 4IUGA 3DOPA 1Q65A 4JIIX 4GKLA 3WSUA 4ZQPA 1IV8A 2LLEA 3BAKA 3HV9A 1WAWA 1E0VA 1UC4A 3MDUA 2O55A 3IUHA 3UQNA 1FDZA 3EDDA 2ON3A 3CJPA 3PY2A 1XH1A 2VO5A 1H41A 1XGDA 4ZOEA 5EFDA 2FB3A 1CIUA 1W3JA 1Z69A 3EOLA 2X0HA 3M0IA 4KWVA 1NFPA 4IIEA 1CT5A 4XZHA 1E55A 4M6PA 2NT0A 2IQ0A 1XLEA 4D6CA 1HT6A 4R7JA 1JNDA 1U33A 1XX1A 1ZFJA 4ORMA 1OK6A 4PTXA 3BG3A 5IXEA 2ABAA 1CGXA 4GI6A 1DE5A 5A8OA 3S5ZA 2FVKA 4JXCA 4MF4A 5T8GA 4Z2KA 4XKMA 1QHOA 1AD4A 1BKSA 4WKHA 5LA1A 3TTSA 3FA5A 3VOJA 3SQMA 5PTDA 2FMNA 3LENA 3AS2A 2ABBA 5FA5A 3LGEA 4JBRA 3CPGA 3TDFA 1OABA 3WH9A 4EPBC 5H8PA 1HVQA 5T91A 4DQWA 3GU9A 4K1GA 3HMCA 4H9UA 5K9DA 1AW1A 3PG8A 4OZOA 1PS9A 4W89A 4Y6GA 1JQXA 2E77A 4C1LA 4YCPA 1C7TA 2E6FA 4XZWA 4FNUA 5LKYA 4RJEA 1KWKA 4AHOA 1O5QA 4J27A 4ZFCA 1RJQA 1FUYA 4HD5A 4NRSA 2CEQA 4HSOA 4MNKA 4DWSD 3G1VA 3EZ4A 1K70A 4DO6A 3LRKA 5CZJA 3C8FA 4QJ1A 4XK2A 1DJXA 5E9XA 4JEJA 5FJTA 1KM6A 3P82A 4JN6A 5TD4A 1L6YA 4KWUA 1ISXA 3EOOA 5D04C 1ITCA 4HGXA 1ISVA 5XIAA 4ZA0A 5HJYA 3GH7A 1FVPA 1Q8JA 1OD0A 4GVFA 3KBNA 3IAPA 3EXSA 1Q6CA 6A3HA 3S9YA 4JR5A 1ZENA 4X61A 4ZTYA 5M03A 1EOKA 1NJJA 1BSLA 1VEOA 1WKDA 4U4MA 3WY1A 3L9CA 3N34A 2VGIA 3NDZA 3CZEA 3VI2A 3KHDA 4UNLA 2Y85A 4PTNA 3CQ0A 4BF5A 2WSKA 1OX4B 5C5YA 4H9YA 3R1ZA 2PWUA 3T9PA 3R94A 3S6TA 1RR2A 1LTDA 5CBJA 4QGCA 3T8QA 2HWGA 3L21A 2CETA 5BMWA 2OU4A 3SRFA 1H49A 2HZGA 1DEDA 4O13A 1IHIA 2B0MA 2PP1A 1MEHA 1O12A 4MADA 1SZGA 3UWQA 3WQGA 5A6BD 3CHEA 4CQ8A 5D8WA 4B3LA 1H63A 2GQ8A 3LD5A 1XYCA 1SFSA 4B9YA 4AYGA 3NSMA 3LM3A 3EXTA 3INPA 3VNLA 1HJUA 1LUCB 3WDIA 5FL0A 4O54A 4AVOA 1SUXA 1NWTA 1BF2A 4YHGA 3ONBA 3VDHA 3HV8A 4PE8A 1R2TA 1YDYA 4X63A 3UYIA 1FA2A 5DBTA 3PPGA 1UWAA 1E43A 4D6EA 3SUTA 4PULA 1J6OA 2FPVA 3W24A 1YE4A 1VJIA 1OINA 2Z27A 3FJ6A 1YE6A 3GDTA 2PWVA 4U3AA 3TAOA 4H19A 3UD6A 3POHA 3O1NA 1BF6A 1QK0A 1JL8A 2EJ1A 3WLQA 4PMZA 3BDKA 4GBDA 4ZODA 3V1PA 4KCVA 2YA0A 2AAAA 4LUSB 1RJPA 3NTYA 3DKJA 3MSGA 4GUGA 1PEZA 3R0DA 1Q6OA 2J6VA 3MJMA 4GJJA 3W00A 3TP4A 3EMCA 2G37A 2YB1A 1MEWA 4Q8NA 2R6OA 5EMYA 1DTUA 3EOUA 1XIJA 2ZVRA 3DHDA 3GNOA 3TTOA 5JU6A 1GG1A 3NQVA 4ALDA 3OZYA 1TV8A 3U5UA 3N73A 2D2JA 4AZ5A 1TA3B 2QJIA 2D24A 1REQB 2G8ZA 1GKQA 3O0FA 1H51A 4UB9A 3V36A 1BD0A 3U2OA 2ATMA 4FMVA 1JD7A 1PO9A 1RQHA 2IKIA 1UCWA 3PJXA 4MYXA 4C6JA 1PPIA 2Y0FA 1N8IA 4ORIA 4EP8C 3TYZA 7PTDA 4GZIA 5U7SA 3LCWA 5EY5A 4J2MA 4AZHA 3GO2A 1YPIA 2OYMA 1GHRA 3MHGA 4ZE5A 3UJ2A 4QLLA 2QUNA 3LBOA 5HPOA 1CGVA 3GNRA 2OR2A 4JNZA 2ODOA 2GVJA 3C2RA 4K8HA 3H7VA 4V1YA 3TNBA 4RV3A 4X9SA 2ZDRA 4H9ZA 4MJ4A 4DXVA 4E8CA 2XPKA 3A6OA 2YFNA 3RFAA 1KGWA 3GTHA 4LTSA 3DFQA 4LCRA 1E3ZA 4HZ7A 5A2AA 4OQVA 2D22A 1U30A 3HB9A 3CV2A 3QYSA 4GACA 1DQUA 3FYPA 2CITA 3A3WA 1GJWA 2ZTKA 3MBDA 1OC6A 2NUWA 1AQFA 1FCVA 1W1YA 1B57A 2FGBA 3G1RA 2FHCA 5I03A 5FJOA 1DQWA 3RR4A 1JZ6A 4DRSA 3U2EA 1OFOA 4GA8A 1HJSA 4MNLA 3U4FA 4M82A 3VOFA 3BICA 5HMFA 2PCQA 1JPHA 1EF2A 3W6LA 1XLLA 4GNVA 3VDBA 2C71A 5ECVA 2GK1B 5JIPA 4C1NB 2XU2A 4WXYA 4GVIA 5DT5A 3GWQA 5LIYX 4UR9A 4HNLA 1LJYA 1R0MA 3BCFA 1GWJA 4QNEA 2Y4SA 1TCDA 1OY0A 3MHUA 4H41A 4EKJA 1KR0A 1GT8A 3VNDA 1MUMA 1KR1A 1OEPA 1Z7AA 4RDZA 3CUJA 2XFRA 1ZTVA 2I9EA 2W67A 1U1UA 2PF8A 3F4CA 4Z1BA 1A53A 1K03A 2VCCA 3BSHA 4BKNA 3UZ5A 2NT1A 3H2CA 1YLVA 4IICA 1UASA 1G7VA 4PUUA 2QCHA 4IMFA 4B5WA 1UUMA 3GYEA 5KSWA 5I24A 5FD0A 2VC7A 4AC1X 3F2BA 1EC9A 4XUGA 2DORA 2QDGA 3PPCA 3ZJ8A 4IG2A 4J3WA 4NJIA 2RJHA 5C9UA 3FCPA 1KTBA 1T8QA 4LJ3A 5FACA 4QJ5B 2ZFAA 3OP2A 1FCQA 3HM7A 5E0CA 1W9PA 5ABEA 4Y9OA 5D38A 4F0SA 1SW3A 3GQYA 4LB3A 1TX2A 2V6AA 5DY2A 1K6WA 3TH6A 4KERA 2WHLA 3DN5A 1VFFA 1DJNA 4C6QA 4ZR8A 4JKMA 4JTSA 2QEZA 2J47A 3TMQA 1YXCA 4HU8A 2NVAA 4JEQA 3WQOA 3FSTA 5HMEA 3GH5A 4J2PA 3SN0A 1EP3A 4GH1A 3C2VA 3D3AA 3O07A 2GVEA 4FNTA 3S42A 5H8MA 5HNRA 1JPIA 5MKGA 3G0XA 1VFUA 1ZBKA 3D6NA 5HOSA 1AMYA 1X98A 4QSHA 6ALDA 2E8ZA 2FH8A 5CC6A 3BC9A 1QNVA 2J7HA 2FKPA 1TE1A 4BQ3A 3MO7A 3RXZA 3LEPA 4N42A 5CC3A 1V0NA 1G1YA 1EOMA 4W5ZA 4MG4A 2VP8A 2QPUA 3TSDA 4YWSA 1SSGA 2V82A 2CXGA 4JN8A 2JGYA 2WK2A 2L5HA 4K8EA 1A5CA 1NARA 1XBZA 3RF9A 2Y8UA 3DYPA 3SCPA 2DGAA 4UMAA 1HX0A 1OGSA 1FKWA 4POCA 2E1DA 3APYA 2C13A 1CZ1A 4EAMA 4MB3A 3VIHA 3ITXA 4Q8WA 3V35A 1WUFA 1NWRA 1J0ZA 2GJXA 4HIBA 3WUEA 4Y9PA 4DJEA 1T8XA 4H00A 3VPLA 3M47A 2WC3A 2XVPA 3TSMA 4QJ4B 3CHVA 2CZ5A 1E4NA 4TOQA 4AXNA 3WQ5A 2TMDA 1V7AA 4ZVJA 3M43A 1WCGA 4UIOA 1M5WA 1O66A 1VZWA 2D0FA 5H6HA 1VQTA 3GW3A 4Q4QA 4JFTA 3AYSA 4O16A 4JL1A 4FR1A 3H22A 3VE7A 2PC4A 4JIEA 5E5CA 1POJA 1YEYA 3H21A 3GG7A 1HN1A 1IGSA 3LTSA 3VILA 1ICSA 2C1IA 3DGBA 3DHPA 1RPXA 4EE9A 4GQ0A 3UWYA 2O9OA 3ZVHB 4K7VA 4DAFA 2BHUA 4GINA 3WK1A 4PMNA 4AHPA 1KCZA 4H83A 4KKXA 1NOWA 5EMUA 3D3FA 1JRBA 1LL4A 5SWUA 1C8VA 3OVGA 2P3EA 1R38A 4LVAA 4IZGA 4WLCA 2G4FA 5GJPA 4M51A 4ICNA 2P5NA 2YLLA 1SO6A 4ZE4A 3L5LA 4H6KA 3GVGA 4Q33A 2OPJA 1TPB1 1LCOA 1WXZA 3QPZA 4M0XA 3LHYA 5BOOA 1MQPA 1ZGDA 3CB3A 5A2CA 2BY2A 2OGJA 3WD3A 1OFAA 1R9ZA 4C6BA 3CUGA 2PTYA 1S46A 4P8WA 4UFLA 4MIMA 3FJNA 1BQGA 2NV2A 4XSLA 4ECLA 1ZAJA 2NX1A 3W0KA 1WXYA 5HA7A 1ECEA 2CESA 3W1PA 3L12A 2QUTA 2DT1A 4UTTC 3E2SA 2J66A 3MV11 1DXIA 3V7PA 1UWRA 2PWEA 1KM2A 1M6JA 4BWLC 3EX1A 1S2TA 1VRXA 3TTEA 3QV9A 5GJNA 4GOAA 2XZ9A 3FEMA 2Q01A 4LYKA 3TEVA 4JTUA 2X05A 4AIBA 3EA1A 4JTGA 1UQZA 2BV9A 4XO6A 3TOYA 3N14A 2G97A 3DI0A 2EPOA 1UHVA 3VNZA 3A3HA 3N9KA 1EPVA 4Y8EA 1OZMA 1QNRA 1HF6A 5LNSA 3UERA 1GW1A 3W1AA 4HVXA 1ISZA 4QAWA 1E73M 3IGXA 3PAJA 5A69A 3JUGA 1TR9A 3FFSA 1TIWA 1E72M 4F3HA 2HK0A 4H01A 3P6LA 2PZNA 3H4XA 5D9NA 1V6XA 3S4TA 2FMOA 4P7OA 1BQCA 4UWMA 5KZ6A 3S2CA 5EMKA 1C29A 3DCPA 1BWVA 4NNBA 2I5IA 4M19A 1H2JA 2TSYA 4TO8A 2ZICA 4DXXA 2ONEA 3U48A 5GNYA 1E9LA 1K8ZA 3W7OA 3OLDA 1TV7A 5F1UA 2GPTA 5BRBA 4OIFA 4C90A 1TMHA 1IXPA 1R3YA 2Q02A 5GVJA 4HNUA 3GVWA 3MMDA 5A6LA 3RCNA 1IT7A 2OYKA 3OGSA 4PGLA 4WJXA 2XWEA 1HUVA 1DHPA 2WWDA 4LS2A 1EGZA 4ADTA 2ZOXA 4LT9A 3SUSA 1MZRA 3LU2A 4PBGA 3VKCA 2AQWA 1KCXA 4FXJA 1IXOA 3RPDA 3V1HA 3M9YA 4CNSA 3W7KA 5A3HA 1UUQA 1M03A 2F38A 1ZS2A 1UYQA 2PDHA 4JTFA 1W5OA 1E5NA 1FDJA 3H2OA 1I60A 4JTAA 2PCEA 4LF1A 2VR2A 1IQ8A 4JTHA 3VIGA 1HKIA 1UD5A 3KWSA 3C61A 2XSBA 1L9WA 1W5MA 3NGFA 1XQKA 2OT1A 1XH0A 5EGRA 1TJ1A 3TJIA 2ZDSA 4KH2A 2G0WA 3E12A 2Q3RA 1XYLA 3PZ9A 1ZUAX 5AC8A 4PSPA 2V67A 1ITQA 3R25A 3W29A 4TUFA 4YTUA 3BLKA 3GB6A 3AALA 1F4HA 2DZSA 2A5HA 2VRJA 4CCZA 3K4WA 2C91A 2OCZA 4NASA 3E0WA 1WUEA 1XUZA 5K9CA 1RJRA 3MO4A 1RCXB 1ADOA 3BO9A 3KW3A 4N9EA 4LRSA 4Z2LA 1HZYA 3KOWA 4QHRA 5G2IA 4AFYA 5IFTA 1A5AA 3GK0A 2PDCA 3MV01 5I23A 3W07A 4HMDA 3WUGA 1QO2A 2HDJA 4FXSA 1QPQA 1ICPA 3AI0A 1RCQA 3W72A 1LF1A 2PDYA 4FAMA 3USBA 2BSLA 3GHUA 1FH8A 4OOUA 3DH7A 3BLFA 1J0HA 2UY2A 4GQBA 3QV8A 1BEUA 2HVNA 3S0CA 2F8QA 1LM1A 4E4PA 1ZAIA 1B3ZA 4G8TA 1LBFA 4EF8A 1EZWA 4DHGA 4DUWA 1X8CA 3TUUA 2INFA 1LT8A 1Y7VA 1B3WA 1I2QA 1DL3A 1VR6A 5G2HA 4XBSA 2ZZ2A 4I3GA 1K4HA 1OBAA 4BS0A 4FSAA 4AF0A 3WMLA 3CT7A 1EX1A 1RP8A 1FHDA 2E67A 1EKOA 3I6RA 2OOFA 1F6KA 2BVTA 5CCZA 1ZJAA 3WDPP 1NDWA 3ZLHA 4S2CA 4OBRA 3WL1A 4A29A 1E0WA 2O9PA 1CECA 4RW5A 3S46A 4ML4A 4I90A 2OTDA 2QDHA 3FGCA 5AYIA 4H8NA 2CPUA 4JTKA 4JHOA 3NURA 1C8QA 2XISA 3M1ZA 1E6SM 1JDDA 1C9WA 3AO0A 4LY4A 2J78A 3B4UA 1V6TA 1CLVA 1YPXA 3QXBA 4FX8A 2ZZ5A 4Q8OA 2ZCGA 4NHVA 1UP3A 1GVSA 2VC6A 4XX6A 1NWUA 3ZWTA 4TV6A 2ISFA 1BVZA 3M7SA 2XVGA 4O17A 1DWIM 4UFHA 5DF0A 1Q13A 1A5BA 2R91A 1N8WA 1N55A 2I57A 3AS0A 3FW6A 2HQAA 1D7FA 3EPMA 1OX4A 2NQHA 2GQ9A 3GXMA 3OGVA 3LPPA 1UIOA 3PUOA 3WMSA 4CD6A 3W76A 3MWCA 4GMEA 4QJ3B 2VYOA 5IFPA 2RUSA 2YDSA 3OB8A 2YZRA 1GOIA 2HJPA 4AVNA 1UZ1A 3AU2A 3VOGA 2E28A 4B15A 2OFJA 3ONCA 4GUHA 1UKOA 3G1DA 1E15A 2VFEA 3A9IA 4PA8A 2PTDA 1ZALA 3SFKA 1BPLB 2XJ7A 4A21A 2NLYA 1VLIA 4H7CA 4IT1A 2ZRZA 3QW3A 3IVUA 4CQAA 1L0PA 4CU6A 1UR0A 4GGBA 2X8RA 4AD1A 3H4WA 3N19B 3STGA 2PDMA 1LL7A 2GUYA 4GQGA 4PSRA 1T41A 4PTMA 4JPGA 2VVSA 3SB0A 1DIOA 4D6HA 3ABXA 4IP4A 3A4WA 3N2MA 1YPFA 4GIRA 1CDGA 2OQYA 3VMPA 1O5KA 1OWQA 1XBYA 1ZNNA 1OIFA 1TPUA 3H7RA 1LRQA 2DZAA 4KF1A 1E1FA 1A0DA 2FJUB 3OLGA 1W9BM 4TVUA 4PEKA 4JFSA 3TKFA 4PTVA 5XINA 4LYQA 3IVTA 3L4TA 3KDOA 4D6JA 5F2LA 3SCRA 4XD5A 4IQDA 1XSJA 3U0HA 3V16A 1EO5A 2GYIA 3OGRA 5D03A 1XHGA 1V51A 4AMAA 3W82A 2CU0A 1LP6A 1JDFA 1AW2A 3QY7A 2POZA 5DFAA 3C2FA 2OMAA 1ZCCA 1I2OA 3N3MA 3VZYA 3NQEA 2BGNE 4XZLX 2V2HA 4N02A 2QNEA 2VGFA 4DUVA 3C86A 3EYPA 3WLIA 4AQLA 2IKHA 1LQ0A 3TFCA 2FPTA 1HIZA 4LAMA 2WJEA 3BXWA 2OG9A 4W7UA 4FF7A 3RRXA 1FWNA 2F84A 3PZMA 4E2VA 1UWQA 3R4IA 3C0SA 2FHFA 2EEXA 1LWJA 4E4FA 1MXGA 3V5OA 3UXKA 1KV8A 1XQLA 3VE9A 2X1RA 4NY2A 1V0MA 2WHMA 2PLCA 1UWUA 3LRLA 2JEPA 1E9YB 3SCSA 3WFLA 2E25A 3T0TA 4LBSA 5FEPA 3VC5A 1UH4A 3VIJA 3AUJA 2DP3A 3FVDA 3GLCA 4K39A 4LAZA 1BHGA 3WZ0E 3H2MA 1XDMA 2OZ8A 3SY8A 3CZ8A 2V3FA 1G0CA 5I07A 1AJ0A 2FTPA 2WMHA 1WKEA 2VDIA 3GHRA 3GTFA 2P50A 2YBUA 3GXPA 2R1LA 3UWZA 1RP9A 1VLWA 1W5NA 1ME8A 4WVXA 3S9IA 1XS2A 1GOKA 1R3QA 4XZIA 3SDOA 3DEQA 2BOEX 4JYFA 3PZNA 3GFXA 8CGTA 4AY8A 4Q8TA 1ONXA 4WRHA 3JZUA 2OX1A 4G5DA 1XIBA 2BNJA 4N7QA 3WF0A 1G5AA 5D2YA 1Q7QA 4AISA 5I3DA 2ZC1A 2GJLA 4ZEPA 1NOUA 1VYSX 1Y5XA 2OSYA 4NAEA 3PTKA 1KKRA 5DBUA 3BH4A 4H9TA 4XVDA 3QW4B 1TCMA 1UA7A 2YIHA 3E38A 4N9BA 3LK6A 1QVBA 4JQ3A 3N2BA 1VF8A 1ZP4A 4HCLA 3V0SA 3IPWA 3WDRA 1DWGM 3TR2A 3BTNA 2PLJA 3CPUA 2HV5A 1YTDA 3CBWA 4Z2HA 1I2PA 1AQMA 3LOTA 5GJMA 1R46A 4MWAC 3CL6A 4KGLA 3CZGA 1OFEA 2C0AA 1QASA 4Z2IA 4IP5A 4B5NA 4BI5A 1SW7A 3Q45A 1S5VA 4JICA 1JULA 3NXLA 1R7AA 3GHSA 4K2SA 4TTUA 2V81A 1P0NA 2BHZA 2GGJA 2OLSA 4I6VA 2V3EA 5BXPA 1KM5A 2Y61A 3RM9A 4QISA 3H2AA 3VXGA 3E5PA 5TQLA 3PULA 1WPCA 2WWCA 3AMGA 4CNOA 4RDWA 4XWUA 2QAPA 5C8BB 2DZBA 1EFZA 4NZJA 3M07A 1A5SA 3L4UA 4FXRA 1JCJA 2DH2A 3AOFA 4US5A 2Z1BA 2H8XA 1C3FA 3KTCA 1F5ZA 1BSIA 1R2RA 4E2DA 3WQEA 4AVFA 2E6YA 4HT3A 3DC0A 1YW1A 4UZUA 4AX6A 1BXNA 3HGRA 4MTVA 2ANUA 1E4IA 2UZ9A 4GISA 3TN3A 2Z1SA 1RLDA 4MVAA 4ZQNA 3GNXA 3R58A 5IBXA 1B5TA 3G18A 3TN6A 3W25A 2PSNA 4LV4A 4UMCA 1W3NA 2ZYFA 1IXNA 1BRLA 4F0MA 1HGWA 3THQA 1LBLA 2WJFA 4NI3A 1NQ6A 4O1DA 3SFWA 2V30A 5RUBA 4X0NA 3DUGA 3CNYA 1E40A 1XR2A 4IMEA 4LS0A 2FZBA 3MW7A 3KTXA 7A3HA 1GTEA 1PE1A 1K7FA 3RG6A 1DXFA 1PTDA 1OM0A 3GDKA 2J8FA 3UWVA 3VABA 1TJ0A 1J10A 1Y5VA 2XH2A 3KL3A 3CZKA 3ZR6A 2Y5EA 2DIEA 3TCSA 2DJXA 3CQJA 4FXFA 3NZPA 3W2MA 4QSFA 3WDJA 8A3HA 1R6WA 3AJXA 3BWWA 4DBEA 4F0RA 2QJJA 1CGTA 4UTHA 4WQ6A 3BJFA 4UTLA 1NWSA 3EEZA 3SIMA 1DVJA 3BE7A 1QNQA 3R6IA 3LV5A 1IIHA 3BGJA 3O6DA 2CBUA 1RZMA 4I9JA 3W81A 1C90A 1MSSA 1IXQA 5CKSA 2CHNA 1F07A 3J7HA 3PZIA 4GIEA 2QF7A 4GYFA 2OWWA 1GOQA 2XN0A 1S2CA 1TMLA 3CIVA 3L5AA 2XUCA 1LL6A 1Q85A 1THFD 4Y9NA 3EA2A 3TLLA 3XINA 4IGMA 3S2JA 3TE9A 4EK7A 3P61A 2DT3A 3W7LA 2D0HA 4GI4A 4W4QA 3EWCA 4AWSA 1M53A 3SY5A 1X6UA 2AGKA 5C6MA 2ADAA 1M9HA 1G9HA 3RO6A 3JZEA 1WA3A 2ACSA 3M41A 1SFTA 5HULA 2GQAA 2BTMA 4HTBA 1NQKA 1QI0A 4W86A 2E40A 3L7RA 1Q2SA 2RGMA 3T42A 4HOZA 1QU4A 2ZBTA 5HJLA 3W27A 1A80A 4JX4A 2E9BA 3D0CA 3WF3A 1JF5A 1NFGA 3SGUA 3VK5A 5BOFA 3QN3A 4XTDA 2JKEA 2UWFA 3IIXA 3P14A 3ARYA 5BWFA 5LXEA 3AXHA 4UTUA 5KTLA 3IVSA 1VB9A 1HJWA 2EBNA 2VMFA 3R43A 3PS7A 2BGSA 2PDPA 1GNXA 3IV8A 5DCEA 1FXQA 1AQHA 5D09A 2ZX5A 2ZX9A 3O06A 3ERPA 4IQLA 1JFHA 1QWGA 5BRPA 3HIJA 3W7GA 4MJZA 2AKZA 3SRKA 1DWHM 3B8UA 3QGVA 3OA5A 3UJRA 5I2UA 2FTYA 4JX5A 3UGRA 2CLMA 2ZVIA 4ERGA 5DMMA 4U31A 3VKKA 2H9AA 4PMUA 1XLFA 1UOZA 5FJRA 3B0UX 4MZ1A 3L0NA 5BOEA 1MMFA 3NQCA 1SR0A 4L4OA 4MGGA 3VGEA 4O1CA 3TJ4A 5F7UA 1B1YA 2DZXA 1AJZA 2WZMA 1UWSA 3M0LA 2BASA 4AIEA 2YBTA 4WD0A 2YYTA 1UD4A 3OPSA 2E68A 4D6FA 3GY1A 2AMXA 3WDQA 2YXXA 3GBDA 5GNXA 2GZXA 1EBHA 1RK6A 5CZKA 5AY7A 3L0KA 4E6MA 2C16A 3W71A 3VM5A 3OBAA 3HQOA 3KP0A 4WDUA 4OJYA 2OX4A 1TTQA 1SW0A 1GZGA 4C6DA 2HNHA 3HZ3A 4Q6JA 3BLEA 1TZ7A 1LWHA 1JG9A 4LEQA 4TX8A 1P1MA 1GW9A 2G3MA 3STPA 5CPMA 4WX2A 3FV9A 4LNYA 3I3DA 4HU4A 4L5ZA 2XM1A 4ZXOA 2IPJA 3WEOA 2POTA 4FX6M 2CLLA 1VC4A 2R24A 3GC5A 2VEIA 1SYTA 4BQ2A 4D6GA 4DIAA 5LNRA 4BF7A 3DFPA 4Q7IA 1WKFA 3W7RA 1AW5A 1OYCA 2QJMA 4NXKA 1XDJA 3N6QA 3OYXA 4JHZA 3B05A 4Q7NA 4B4HA 1EC7A 4MDOA 2ICSA 2EF9A 3GM8A 4YWIA 3Q67A 4E3VA 4D1JA 3BAYA 3PBWA 1PIFA 4MZYA 3TLQA 2FIQA 4DJDC 4HYVA 3QR0A 3HA1A 1UJPA 3TQKA 3LNPA 1KBIA 2YL5A 3BZJA 3NZ1A 1M04A 2JKAA 2DEPA 7XIMA 2PRHA 3ZJ6A 4JIPA 5DQPA 4P8XA 1JCMP 3G1AA 2F6XA 3KUMA 2OSXA 1GKRA 1T99A 1YADA 3KAOA 2CLEA 4AMCA 3T0DA 2OKTA 2GJPA 2QGHA 3UJFA 2QYGA 4UFMA 4HBKA 4WZHA 4Z1YA 4LC8A 2MUCA 5CZTA 3FGCB 3T0AA 2A21A 4ZCWA 3UCCA 4A35A 5AVNA 5HQMA 2CC0A 3HJEA 1PYMA 2QCDA 2DW7A 1FTXA 1K9EA 4A8LA 5I78A 1SFJA 4YMZA 5G5IA 1UP2A 5K9XA 7TAAA 1K7EA 4B5UA 3HURA 3QRHA 3B0PA 1ME7A 3PUGA 1TV3A 4JYDA 1L6WA 1TJ2A 1NDYA 4LAOA 2FB2A 1BRLB 5EYWA 3I10A 2INEA 3W26A 4CVWA 4NJKA 1B0IA 3CM4A 4JFWA 3JRKA 1GEHA 1ME9A 2QW5A 4WSJA 3PB0A 4J3VA 1XLIA 4B5TA 3PPFA 1FWCC 1F3WA 4DZHA 4WKFA 3UG8A 1XGZA 3LQGA 4L1WA 1QRQA 2G3JA 2VTFA 2DH3A 2OOGA 4X2PA 3BV4A 3MUAA 2HCVA 3LSBA 1Q6FA 3LBCA 5HUOA 1T5AA 5LIKX 5BNKA 4ONVA 1AK5A 1XINA 1EX5A 2E6AA 1SZNA 1ESWA 5FF3A 3PP7A 2Z7KA 4MY1A 1Z6KA 3BMXA 4N6EA 4Q32A 5HQLA 4ACZB 4CQ9A 3FXYA 3IACA 3MWAA 4DPQA 1YDVA 3W6MA 3LXBA 1MDRA