4ADSA

Crystal structure of plasmodial plp synthase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
DYADNDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDGVARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHINKHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSLDESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSGIFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE BIOSYNTHETIC ENZYME PDX1 HOMOLOGUE, PUTATIVE
publication title Assembly of the Eukaryotic Plp-Synthase Complex from Plasmodium and Activation of the Pdx1 Enzyme.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Transferase/transferase
total genus 98
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4adsA00
1O94A 5EYWA 3NL6A 2P0OA 4OE7A 3TH6A 3W9ZA 4HT3A 1ZHAA 3W1LA 3M7WA 3B06A 4MJMA 2ZZ3A 4AB4A 1ML1A 4MUZA 3SZ8A 5H2ZA 8TIMA 5K9XA 1LTDA 3W7GA 2VEKA 2NZLA 2H3DA 5AHIA 1GVRA 4O17A 5I3GA 1IXNA 2RDUA 1TO3A 4MY8A 3C2RA 1QAPA 3SGUA 1DHPA 3OVPA 4ZVJA 2VFGA 4IXHA 3TIMA 3W7NA 5KITA 4IPJA 2Y7GA 3I6RA 2YXGA 1MSSA 3Q58A 4JDYA 3C4UA 3C2FA 4JTGA 5CKSA 1AL8A 4WZHA 2YYUA 4TIMA 2HMCA 4TMCA 2ZZ5A 4UR7A 1GPWA 3EWUA 1NSJA 4UNKA 3TQKA 2V2CA 3SGZA 2YW4A 2Q8ZA 3HPSA 4UTTC 4N9EA 1G4TA 4GFSA 3T4CA 5K9CA 2NXGA 3HG4A 1MO0A 4PC8A 5H91A 3RF9A 2CLKA 4KFPA 5LKYA 4N9BA 3C2VA 1LZOA 1ZY9A 3OA3A 1VCFA 4YWIA 1KFKA 2ZTJA 3W7RA 3W7OA 3DFOA 3TJXA 3IIZA 5TIMA 4AEOA 4DQWA 4NNAA 2ABBA 3S9YA 5DBTA 2B7QA 1A50A 4JX5A 5E1QA 1QOQA 3M43A 4XKYA 1M6JA 3W1NA 1SZEA 2VEIA 1F6PA 4DF0A 3KFTA 4M6PA 5U7SA 3NDOA 4FEZA 2R14A 5DCEA 4AVFA 1H61A 2C14A 4UFMA 5T26A 4ADSA 4CNNA 3TSMA 3AJXA 5EA9A 4A2SA 4UTUA 2ISSA 3DH7A 4DO4A 5MHBA 1YXDA 3MBFA 2JGQA 4CCCA 3QSRA 3UD6A 1Q3NA 2V82A 2BXVA 4TX9A 2NUWA 1G69A 2O7QA 3CEUA 1OF6A 3VE9A 1XL9A 4JY8A 3O06A 1EWEA 1S3HA 1LROA 3N2XA 2CZFA 3JS3A 4FNTA 5K9DA 2A4AA 3LBMA 5CPOA 3WK0A 4BK9A 3W76A 3KX6A 1X6UA 1JCJA 2GVJA 3UNDA 1K3UA 1GT8A 1EA0A 2ZRVA 4LVGA 3HJZA 4XWUA 4TR9A 3QFEA 5D2WA 1A5CA 1KTBA 4HNNA 4AWTA 1SO6A 5FI8A 3BARA 3L0KA 3S5YA 3HMJG 1VRDA 4JDBA 2C18A 2PRMA 2ZZ6A 3TAOA 4DEFA 4DO6A 2J27A 2WV8A 3ANYA 3THAA 1WAUA 5BOOA 4W9TA 5AC7A 2A7PA 4NZJA 1SZFA 1GG0A 3KOFA 3IGSA 1YLVA 3KVLA 3DFTA 1YPFA 2CZEA 1GYNA 3LTSA 1VYPX 3PM6A 1QDSA 3VKJA 1OFPA 5HUOA 2NLIA 1C9DA 1K8ZA 5LSMA 3W83A 1JRBA 2DORA 5DELA 4UTLA 3QQ0A 4FX6M 5FF0A 3MP5A 3P7YA 3TSDA 1G67A 2ZYFA 5TQLA 3T7VA 5LNWA 1B9BA 1W5OA 4MPQA 3GYEA 3TROA 2Y70A 3ABRA 2NX1A 3P74A 1HFBA 1OFDA 3E96A 1PIIA 2WSQA 3KRSA 3P67A 3M16A 1XBYA 2ATSA 3A24A 1ZALA 3HPZA 3P5ZA 3HGOA 3SJ3A 4MLJA 1XDMA 5LGXA 4IPIA 3UZ5A 1R2TA 1X1OA 3W87A 3HBLA 3NGJA 4N6FA 2HS8A 2Y7DA 1SR9A 1Z48A 1Y0EA 2E5DA 3QYQA 3LCGA 2JKPA 1XM3A 1PV8A 3FEMA 3NL2A 2Z1BA 4WY0F 4ALDA 3UWVA 4ORIA 3DHDA 1C29A 4LS1A 1TSIA 2NUYA 3W7JA 1DQWA 2C15A 1RQEA 1GTEA 2GVLA 4QM1A 3DFSA 2CLOA 4FXRA 4KFNA 5A5WA 1FQ0A 4ZQRA 5DBUA 1VLWA 1LBFA 1XUUA 1O5XA 3MW7A 2TSYA 3NOEA 1JQXA 1LP6A 3H55A 4Y9AA 5HWMA 2HTMA 1QR7A 1H50A 4WY0B 3BVJA 3N19B 2ZQ0A 4R34A 3GDMA 3LB0A 1R2RA 2R8WA 4LUIA 3IIVA 1CI1A 2XN1A 1RVGA 1W3NA 1S5VA 1R47A 3EXTA 3OHIA 2C6QA 2ZZ4A 3WK1A 4LS0A 3LRLA 3M0ZA 3P8JA 4MY1A 1JCYA 5D2TA 4GUGA 1LRNA 3LTPA 1NF7A 2FPVA 2DZTA 4O52A 4K38A 2X2GA 5U4NA 1OX4A 2HS6A 4ZQOA 5DCDA 1D3HA 4HKPA 5LZLA 3G0UA 3LGEA 1KM0A 1EWDA 1O4UA 1TRDA 4KWVA 3U8GA 4YXGA 1YDNA 4RLIA 2RDWA 4UFLA 5FEPA 5SWUA 1ZFJA 4N9DA 1DBTA 3ZWTA 3UYCA 4FO4A 3GNNA 1VS1A 4Z08A 2JBMA 4AWSA 3PC0A 4O1DA 1QPQA 3EWYA 3ZR4A 4NJKA 4RX0A 1A5SA 3O15A 2EKCA 1JQVA 1ZCOA 1KM1A 2X16A 3O8AA 2NV1A 3MHFA 3A21A 4JTLA 5LHEA 2GQ8A 3M44A 4NVTA 4LU0A 1SFJA 4POCA 2CU0A 1WXJA 3IVSA 1KW1A 3N3MA 3A9IA 3UWYA 3HG2A 2E6AA 1I8JA 3FKRA 1KTNA 2WSRA 4K8EA 1TTIA 4YMZA 7TIMA 3QW4B 3VE7A 2AGKA 1VCGA 3BW4A 3PB0A 3L0NA 5FEWA 2FB2A 1L2UA 2GQAA 2A21A 2WNQA 3SFKA 2YDAA 2ISVA 1AK5A 1YTKA 5D38A 1M5WA 4QNEA 2TRSA 5FEZA 3G1DA 2DZUA 1ZAIA 3NQVA 2ZZ2A 4JTJA 3BW2A 4LVDA 5K4ZA 4OQVA 2B4GA 4WXYA 5HWJA 3O16A 3LXBA 2G95A 4RZ6A 3PS7A 4LC8A 3M47A 3W7IA 4NZFA 1H7XA 5CZJA 2C19A 1XBZA 3KHJA 4CNPA 4UTMA 1IIHA 3I7QA 1Z42A 2QCCA 1BKSA 2ZRXA 1TB3A 3W86A 4DF1A 5C5YA 1RZMA 3LRMA 3W7PA 3B0UX 3RU6A 3TQ0A 4Z1DA 3FFSA 1XBVA 3W1RA 2J9XA 5HWNA 3C2EA 3W75A 4K36A 4WY0A 1W8SA 2CFFA 3LCLA 1VHCA 4RZ5A 1JCXA 4GE8A 3EX2A 3CHVA 3LCXA 3NQDA 1P0NA 2FLIA 1UASA 1SO4A 3GX9A 5D04C 2FPYA 1K7EA 2NV2A 4LUJA 1ZAJA 5G1YA 3G1VA 1SSGA 3W07A 3PULA 4XKYB 3MP3A 1A5AA 4ORMA 2VFFA 3WJWA 4R53A 4EOUA 3W73A 3FIGA 5EY5A 4X2RA 5AYZA 2DZVA 2YFOA 1SUXA 1I2NA 4JX6A 3UXAA 2QDHA 4H3DA 4RK8A 1L6SA 4Q32A 5CZTA 4HSOA 2QKFA 2WSYA 1VZWA 3M6YA 5ABTA 4D2JA 2V8ZA 5EL1A 3GXNA 3WJYA 4JTSA 2VOMA 3F4NA 3TR2A 4O28A 1TV7A 1HO4A 2CLHA 1VH7A 2OJPA 2WO5A 3M5XA 1ME8A 3P62A 3G3MA 4M5PA 4HHPA 4UTWC 1VR6A 1W5PA 3NQCA 1L9WA 1O5KA 4H6KA 1ZNNA 3W2JA 2ZZ1A 2BLEA 1EUAA 3DBPA 3KXQA 1DJNA 3BPWA 2Y88A 3NZ1A 1ICQA 4XTIA 4X9SA 3BG5A 2PURA 4WQ6A 4ICNA 2PRLA 2X1TA 2Z0IA 4ADUA 5CG7A 3W7MA 1TV5A 4O57A 1EP2A 4JS3A 2I1OA 1Z44A 4AXKA 5KINA 3W2KA 3IRDA 1KBJA 1XC4A 1ZJIA 4FNUA 5EKYA 3S42A 4A3UA 3DKJA 3QRHA 2OZ0A 4RCXA 3CWOX 2GJLA 3TUUA 1E51A 1SZGA 3IEBA 2G5WA 1UBSA 4WOQA 3OEXA 3PBUA 3TU9A 2W79A 3DZ1A 1W54A 1LOSA 1FX6A 1TTPA 3QMSA 4UXDA 3STEA 4UMAA 3MHUA 2ZA3A 1QOPA 3HGSA 5G5IA 1JVNA 1ME9A 1S5TA 5BMXA 1XKYA 3E02A 1IGSA 1OFRA 1Z41A 4FIRA 4K39A 3I7SA 1TCDA 1OVDA 3LHUA 1NAL1 3PVFA 2X1RA 3G1XA 3IGUA 4MVAA 4Z1BA 4S2BA 3MHGA 2QCDB 3S8HA 3R13A 3OVQA 3ZFHA 3F4WA 4P61A 3W1UA 3MP4A 3DI0A 3W1TA 1AW1A 1QPRA 3S1VA 1I45A 4BWLC 5AYYA 5F2GA 5D30A 3LCFA 3QSTA 1N7KA 4LV4A 1AMKA 4I7WA 4PCFA 3W1XA 1XI3A 2ZRYA 3NEVA 1R2SA 2BWGA 1UB3A 3QQ1A 3STFA 3RLVA 2Y7FA 3PB2A 1LCOA 3BK0A 1DV7A 3TMQA 2OMAA 1RV8A 2WNZA 4MJZA 3W22A 3HOJA 4BFAA 2J88A 2X1UA 4YLWA 1QPNA 2JK2A 2CLFA 1JRCA 4QNWA 2RH9A 3QMRA 4GBUA 2RDTA 5KZDA 1VPXA 5GVJA 4UTIA 2QCFA 5FF3A 4UMCA 4QITA 2ZDRA 2BZNA 4HNVA 2YW3A 4BI7A 1X7FA 3UPWA 5HINA 2EHHA 3VI2A 3S1XA 2VXNA 3S5ZA 4LY8A 4O12A 4TU1A 2DP3A 2P1FA 1RQBA 3B0PA 2GJNA 5AHNA 3LI0A 1GWJA 2V5BA 3M1ZA 1SQ7A 4LVBA 3GZ3A 5IBXC 5EBUA 1IXPA 2X1SA 3TE9A 4M7TA 3DENA 4M7SA 4UUIA 4O10A 2A5HA 1QNVA 3W7KA 4DBDA 1YDVA 5BNKA 4JTIA 4LVFA 1OYBA 4WJEA 1DOSA 1P5BA 2P10A 1EIXA 1O60A 2XFWA 2YPIA 1KFJA 2FFCA 3G8RA 3KAOA 2WNNA 4LVAA 4LC6A 5HNRA 4MYAA 1QO5A 2QUVA 1BEUA 4O53A 1J2WA 1WBHA 1OX4B 4IX0A 4CCDA 3TC6A 5D2XA 4IGHA 4BI5A 4CCEA 3IIPA 3EWZA 2CLEA 2YCEA 3LHTA 2A1YA 3EX4A 2VEMA 5CZ0A 5DY3A 3B4UA 3TW6A 3LBCA 5LNRA 1F7BA 1PHWA 2H6RA 3MBDA 4PTNA 1BWKA 1KM6A 4KFOA 1I2OA 3W2UA 3MO7A 2NWRA 3L5AA 1TIMA 1G6CA 4IMEA 4JGDA 5DY2A 2Z6JA 4DELA 3PUOA 1XBXA 5D09A 3NZRA 2EF9A 5C55A 5BW6A 4OHQA 4AHOA 1HUVA 1QMLA 4O15A 2FDSA 4QAIA 4OU1A 4UTJA 5F2LA 1MEWA 1I2RA 1OX6A 2QUUA 3TAKA 3THQA 4DPQA 2A6LA 1VJIA 3A22A 4XBSA 2Y85A 4I9AA 4DPPA 3GNDA 3N73A 4FX7A 3ABQA 3BG9A 4O18A 4OV9A 4BF9A 3O6YX 1GOXA 5F4XA 3ELFA 2QCDA 4PEKA 1LBMA 2ZA2A 2HSAA 1SPQA 3DKLA 3W7DA 1L6YA 3NPWA 3UZJA 4UMBA 4CQAA 3S0CA 3A23A 1GVQA 1W5NA 3BLIA 4RZ4A 1KFEA 1THFD 3DXIA 4U4MA 3UWWA 3CIWA 4FNPA 2E6DA 4MFEA 3H53A 2OX1A 4NXSA 1KFBA 1NF0A 3STGA 4JN6A 1QO2A 5LHFA 1KM2A 1TV8A 1H51A 2E5CA 2V9DA 5KTLA 1UJPA 2JKEA 3UY7A 1TREA 3LDVA 2KZHA 1WDWA 1O95A 5AB3A 4LV9A 1XDLA 2Q3RA 4B5NA 4EIVA 2ISWA 3EXSA 1FDYA 4MKNA 4N2YA 2R91A 4Z0JA 3TA6A 4LTSA 4ONVA 3EB2A 2B7PA 4XQ6A 4LS2A 4CNOA 3IVUA 1LLZA 1B3OA 2E68A 3NQFA 2C0AA 2BX7A 5F2MA 4UTKA 3DFQA 1WOBA 5AC8A 4JYDA 3ABOA 2Y63A 1PCKA 3LHYA 2DJXA 3LTYA 3Q94A 1JUEA 3W2LA 4X22A 1XXXA 3BW3A 4ML9A 3GKFA 3RMJA 1WA3A 4IMGA 1OHLA 4X3ZA 2Z6IA 4N6EA 5D32A 4E2DA 3W70A 3LCWA 5EMUA 1G4SA 2X30A 3NNTA 3BLEA 1KM4A 3WFAA 3MYPA 3S5NA 2QUTA 1HG3A 3R8RA 1FXQA 4QIUA 1TTJA 5D02A 1VCVA 5LNUA 1DL3A 1SW7A 5G2HA 4LWWA 4JYEA 1C8VA 2AAMA 3LHVA 1LOLA 3HG5A 4AF0A 3LV5A 1SW0A 1SW3A 1U83A 5AHLA 5K7JA 1GVSA 3W71A 2J9ZA 1TJPA 3Q37A 4JYFA 4EVZA 2ZZ7A 4WX2A 4K37A 1ZAHA 4GRSA 3O07A 2DJLA 4JY9A 1Q6RA 4MLRA 4BI6A 2VC6A 2Y61A 4OT7A 1EP1A 2QCLA 3QM3A 3ZWSA 2QJGA 5K4XA 3QPZA 4GWEA 2RKXA 1DKWA 2I14A 1T96A 3O6CA 3B0VC 2WJZA 3UY8A 2YZRA 6TIMA 4RXFA 3PG9A 1LRQA 2EPHA 1KV8A 4R33A 4HNTA 3EX1A 2DZSA 2C3ZA 2NX3A 4HSNA 4LW7A 3FKKA 4JIQA 4K7YA 3EXRA 1PL9A 2WKJA 4N4PA 1LM1A 5E93A 3KVKA 4JICA 4JTKA 1WOAA 1ICSA 2Y89A 1W56A 1W31A 3P61A 3I65A 1LLWA 1D9EA 4IX2A 1H7OA 1H7NA 3B04A 1CX9A 1JCNA 2JGYA 2C13A 3GDLA 1OK6A 4N4QA 4EF9A 2XN0A 3TMLA 3C8FA 1F73A 1CW2A 2FTPA 3NM3A 3L5MA 5CZSA 2Y7EA 5I3HA 3PAJA 2V0TA 1K03A 2QR6A 2C1HA 1WBJA 4J9JA 1PE1A 4GUJA 3L68A 3ZS4A 3G3DA 3IVTA 5AC6A 4A22A 2FPTA 2QCMA 3EX6A 5DXYA 1OYAA 4AAJA 2V2DA 4Z0SA 4O4WA 1H1ZA 1OFOA 4GUFA 5E0KA 4ZZ9A 5HQEA 4WUIA 1EUNA 3ATYA 4FB7A 4WOZA 1KBIA 1WV2A 3O63A 4O19A 4TMBA 3W7QA 4GNJA 4JXCA 3WJSA 3W23A 2PE4A 2OCZA 2QCEA 4MZ8A 5D05A 1IXOA 3IV3A 3FS2A 4H4IA 5HUPA 3QMTA 2QCNA 5D2YA 1D3GA 1OK4A 3KVJA 3G22A 1LDCA 3T78A 1M7PA 3C56A 2ATMA 2ZRZA 1G4EA 3RFAA 4ZL1A 3M5ZA 3PWAA 3CM4A 3G1HA 5F1UA 1FWSA 5FEXA 2DU2A 1TJRA 3ATZA 1GTHA 4JR5A 2W6RA 2NUXA 3L66A 1GEQA 5F2IA 4MOZA 1ALDA 2NWSA 3N14A 2E09A 3P5YA 2E77A 4QISA 3GB6A 3TCEA 1L6WA 3PSVA 1GG1A 3QH2A 3INPA 4C1LA 1NEYA 4IJBA 3GKAA 5D2VA 4MFDA 2A0NA 3G24A 5CSRA 1AL7A 5TBOA 4WD0A 1YXCA 3BG3A 3MI2A 1AW2A 1ME7A 3W2MA 4AH7A 4UTTA 1H5YA 1W37A 2NXIA 2H90A 3T40A 5D33A 4NX0A 3S6DA 4BWLA 2FIQA 2YSWA 5L6UA 3P81A 5C2XA 3PY2A 4UFKA 1GYLA 1GJPA 3USBA 3VNDA 3HIJA 2A85A 1ICPA 3NR0A 1A5BA 3LERA 1W1ZA 1EB3A 1OYCA 1W3TA 2PC4A 4O1AA 1YTDA 2LLEA 3BLFA 3W1AA 1VHNA 2A6NA 1FUYA 4CQ9A 1P4CA 2WQPA 1W5QA 4UFJA 3NL5A 2ABAA 1UCWA 3RNDA 3MMTA 2WPBA 1TQXA 4JD4A 4HPXA 1Q6QA 4NNCA 1H63A 1SFLA 2CLLA 1JUKA 1M7OA 5G2IA 3W74A 1W5MA 5K2ZA 1LORA 1ZENA 1A53A 2G97A 4NQ1A 4U28A 1IF2A 5HR6A 3NQEA 3W7EA 3VCRA 4MY9A 1DVJA 4ZQCA 4IMFA 3CPRA 1I4NA 3C3NA 2VENA 3UWUA 1R46A 3E9AA 2JKAA 5IBXA 3E0IA 5HULA 5F4SA 4HN4A 4IMDA 3NQGA 5LNSA 1HTIA 3GXPA 4NNBA 4O1BA 4O50A 2ZRUA 3CLMA 3DU0A 4RKAA 1QPOA 4PA8A 3LCHA 3TX9A 1FWRA 3TC7A 3EX3A 3Q2DA 4O0ZA 1VQTA 1KFCA 2QEZA 3NQ8A 5DN1A 1KLZA 2EAWA 4N9CA 4GJ1A 5BMWA 1H7WA 3W72A 4L4LA 4ZQMA 1FXPA 3C0JA 3G1SA 2A2IA 3BGJA 3DGRA 4O14A 2V5LA 5CPMA 4FHAA 3R5EA 5F1VA 2OT1A 2V30A 4CQ8A 4S1FA 2DZWA 2V2HA 4Y8FA 5EPDA 3N34A 2ZRWA 1TTQA 3LCIA 2WOQA 5I3KA 4Y90A 4HIBA 4AMAA 2A7RA 3RK8A 3WJXA 3GR8A 3O1NA 2QDGA 3CU2A 2R94A 2QF7A 4XZ9A 4JTUA 5FF4A 5FF7A 1F74A 1FWTA 4YL2A 3NO5A 3GDKA 3LXAA 5C54A 4JEQA 1TPWA 1EP3A 4IWWA 3HF3A 1PVNA 3GXTA 3N2MA 2J9YA 5KMYA 1PHQA 5AN7A 4E2BA 1FCUA 3BGGA 5F4WA 3W85A 1TPH1 4EF8A 1MEIA 3DFPA 3MUXA 3OVRA 2FQIA 1EPXA 3HQ1A 3NPVA 4DBEA 2VKZG 3LHZA 3E49A 3G18A 3NM1A 4FXSA 1ONRA 4R7JA 1OFEA 3NPXA 3V75A 4Z1AA 2GPTA 5CGQA 1G7VA 1I2PA 5DLCA 4UFHA 3U6WA 4DF2A 4DO5A 5AFDA 4QSHA 3L21A 4JX4A 1J4EA 1N55A 1FCQA 2J6XA 3I7RA 3UWZA 3MYOA 5HR7A 2QAFA 2CLMA 1FWNA 1TPEA 4OGZA 3LX9A 3M41A 2Y62A 1PCWA 3B8DA 3CEPA 1VYSX 3W2NA 3W88A 5AOUA 4FNSA 1PS9A 4HPJA 4QJ1A 3WK3A 1DJQA 1TPFA 4NJGA 2CW6A 4O16A 4AF0B 1B4EA 1UUOA 4AWUA 5KZMA 3R2GA 4O11A 1GVOA 4O54A 3C61A 4Y96A 3DHFA 2Y6ZA 3C2OA 2ALDA 3HPXA 1KLYA 1JCMP 1YXYA 1YTEA 4O4VA 4NX5A 4N02A 3PBVA 1VGAA 4HNUA 6ALDA 1RR2A 4Z1CA 4UIOA 3PR2A 1H7PA 1Q6OA 4NXKA 2GQ9A 3FJ6A 4UR8A 1H7RA 3UWQA 3TFXA 1XFBA 5K3VA 3NQ2A 3S5OA 4OWGA 3M5YA 3P84A 5AHEA 3R89A 3UPBA 2ZTKA 2Q8LA 4CLMA 1P1XA 2GUUA 3TV8A 3GDRA 3OIXA 4M6QA 3TFCA 3VFLA 5FF2A 5J5RA 2VFEA 5HJLA 4AHQA 2YR1A 2E6YA 1RQHA 1GQNA 3RLUA 3NVTA 1IXQA 1W0MA 3YPIA 3R12A 4IUOA 4ADTA 3NXFA 1T99A 5G1TA 4IXXA 3DAQA 3TNOA 3QW3A 2BSLA 1FDJA 3T44A 3V1PA 3N9SA 2QCHA 3TSBA 4RJEA 3LV6A 3FOKA 1IIGA 4K6AA 4ZQNA 4I7UA 5HMSA 1I2QA 2A7NA 1JUBA 2D73A 5D37A 1VC4A 3U2OA 2RFGA 1NFBA 3EKZA 3F03K 3GDTA 3DFNA 3GR7A 1FY6A 4MZYA 3L0GA 3IGXA 1X1ZA 1MXSA 3TXVA 4I7VA 4E38A 3N9RA 3NL3A 1K8XA 2VFIA 1JR1A 4FNRA 2XN2A 3EWWA 4JTEA 1AG1O 3CIXA 2GOUA 3KRZA 4FIQA 4WXZA 1OX5A 3FYOA 1GZGA 3NA8A 3GLCA 1EX5A 4KKXA 4LRSA 1LOQA 2G96A 3GAKA 1NVMA 1YDOA 5KZEA 2QJHA 3LM7A 5LGZA 4NUWA 1P0KA 3S1UA 5CPLA 2F84A 4LT9A 1B57A 5I3IA 4IMCA 2IQTA 3LLDA 3IIXA 1SO3A 1TRIA 3A5FA 3LRKA 4XUGA 1Q45A 1X8FA 3L65A 3W6YA 3FJLA 2ZBTA 2CZDA 2GVGA 4O13A 3KRUA 4YCPA 3CT7A 1WX0A 2B7OA 2C16A 3CQ0A 4M19A 3W84A 2VFDA 2QAPA 4NJJA 4UC5A 1TPUA 2V81A 3SW6A 3T55A 1RD5A 4UNLA 3G1FA 4A21A 4OV4A 4FF7A 3MWAA 1QWGA 2QJIA 1LBLA 3C6CA 2J24A 5C6MA 3MI6A 4K7VA 3QPYA 5A8GA 4S2CA 4Q4KA 4GUHA 4JTTA 2Z2UA 1QCWA 2OT0A 5I3JA 3HO8A 1SSDA 3CWNA 3GIYA 3W1MA 5AHFA 3QF0A 2NXHA 4O8RA 1MZHA 1UUMA 1H62A 3BO9A 4FNQA 2E6FA 1FCBA 1TPDA 2CLIA 3FLUA 2ZA1A 4UCGA 3W7CA 1AW5A 2FJKA 2QCGA 1MEHA 1TPC1 5J5DA 4GUIA 3P60A 2RHGA 4PH6A 1DQXA 1K02A 3PBYA 3NQMA 1TYGA 3G1AA 5BRBA 1T8XA 3UXDA 5CPNA 3NG3A 1WQ5A 2E5BA 3A5VA 3SR7A 4JTHA 1HL2A 3NQ7A 1RPXA 1BTMA 1H1YA 1HO1A 1K7XA 5G4WA 3M5VA 3K30A 3G1YA 1W3IA 2CWNA 1TQJA 3NPUA 3O6DA 1K7FA 4UTHA 3L67A 1J5TA 1B4KA 2O7SA 1FBAA 4PL1A 3LOTA 4RV8A 5DXXA 3STCA 1SU5A 5CSSA 2ZFAA 3PUDA 2EGZA 4XTDA 3PBWA 3W1PA 3EKLA 3O05A 4L4MA 4Q33A 3B03A 1F76A 1YPIA 3SIZA 5AYXA 1LRTA 2AQWA 2VELA 3W1QA 4XBKA 4DXVA 1GVFA 2I9EA 4LOCA 3NQAA 1XUZA 4K8HA 5KSWA 3PUEA 1TMHA 3ABSA 3OBKA 3OG3A 4ZQPA 1JJKA 2B7NA 3GK0A 4Y6GA 4KWWA 1VLIA 2YX0A 3W7HA 3F1QA 1OG0A 3CC1A 4GC4A 4IQLA 3GAYA 3HGJA 3C52A 3WJZA 2Q3OA 4UTWA 2VEPA 2PRHA 4P2VA 4UFIA 1QFEA 5LNVA 3TDFA 2PCQA 3EWBX 2TPSA 4RXGA 3QEZA 5D03A 3SSJA 3D0CA 3TJLA 4PODA 3PSWA 1OABA 1F6KA 1Q6LA 3TQVA 3LHWA 5G4EA 2H3BA 4NT0A 4JTFA 1YADA 3LLFA 5L9FA 4LRTA 1KV5A 2W0UA 3FA5A 4IOTA 3W7LA 4NJHA 3JRKA 3QJAA 3TKFA 1FDZA 1KFLA 3P8IA 1F5ZA 3HB9A 4MYXA 1JCLA 1TPB1 2YGYA 3M9YA 3TXZA 1OJXA 2YYTA 1OFAA 5I3FA 1K8YA 1SO5A 1FWWA 4ZMGA 3G8EA 1V7YA 3QZEA 2ZCGA 1WYIA 3NAVA 4OBTA 3AO0A 3EEGA 4M6VA 3GVGA 1BWLA 1OFQA 3H54A 4A2RA 3S1WA 1F05A 1OFBA 4O1CA 2H8ZA 3CTLA 4JIPA 3L5LA 1N8FA 2DZXA 1T0OA 2YFNA 3PF3A 4FX8A 3EWXA 2NX9A 1S5WA 3FYPA 4TO8A 5AHMA 1JULA 3I68A 3NYZA 1FCVA 3TK7A 1LYXA 3L9CA 4PFMA 4E0CA 1OF8A 2BTMA 4YCOA 2FB3A 4AHPA 2UV8G 4JNMA 3LI1A 1G4PA 4QQ3A 3LXCA 4LNYA 3UQNA 4O0KA 3W3OA 3QC3A 2TYSA 1EEPA 3SECA 2TMDA 2B0MA 3DI1A 2VFHA 3HG3A 3B05A 1VYRA 2H8XA 3TW7A 4NU7A 3L2IA 2E1DA 4G1KA 3NQ6A 3CB8A 4BR1A 1F2JA 3P82A 3WK2A 2F7FA 5FESA 3HGRA 1KM5A 4NJIA 1XCFA 1U5JA 3SY5A 1KA9F 4MZ1A 4PL2A 3PG8A 1TPVA 3MI3A 3E12A 1V5XA 1H60A 3JR2A 5IM51 1KTCA 1R30A 3P80A 4EWND 5G2WA 2CZ5A 3G0XA 4MIMA 3IIOA 3MJYA 4C1KA 1G7UA 2DZPA 4RR4A 3BV4A 1DORA 1SZNA 1KM3A 3KVMA 1ADOA 3G0SA 4GXMA 5DCBA 4A29A 1YYAA 3SI9A
chains in the Genus database with same CATH superfamily
3W9ZA 1RPKA 3WH8A 2DZBA 1WB0A 4WSJA 4AC1X 1J9YA 4HTYA 5CSUA 3N1AA 3W7GA 4C5ZA 1JDAA 2AAAA 2EPLX 2ZXDA 5AHIA 3VDCA 3WD1A 3WEMA 1IXNA 1RSCA 2RDUA 5REQB 1BQCA 1VENA 1QAPA 1I60A 3EZ4A 3W7NA 3EWDA 2OZ8A 1AH4A 4XVEA 3DYMA 4GC3A 5I24A 1P6CA 5ENLA 3SCRA 1FA2A 5DMMA 4IP5A 4F9DA 3M0YA 3AJ7A 3EWUA 2XINA 3F2CA 3EB3A 2PFHA 3TQKA 5HA7A 3SGZA 2YW4A 3HPSA 1EQCA 3EOUA 4Q8UA 3T4CA 5K9CA 4L1WA 1W1PA 2Z1KA 3TN6A 1GQLA 3RF9A 2CLKA 2PDKA 2O9PA 1VCFA 4KRZA 2BS9A 4EPBC 2J7FA 1X1NA 2CKSA 4FAMA 4MB1A 1VB9A 3W7OA 1CXEA 3BE7A 4XIAA 3TJXA 3CYJA 2J8GA 4DQWA 4NNAA 5DBTA 3DYOA 3KZPA 1QOQA 2YJQA 4XKYA 5G4HC 4L4PA 4PUNA 3UZZA 4M6PA 1FHDA 3GTFA 2PLCA 1J8VA 2G37A 3UZXA 2C14A 2VC9A 3TTEA 4CNNA 3GS6A 3AJXA 4DO4A 4EP8C 1IWAA 1UYQA 1E5NA 3QSRA 3UD6A 3ISIX 4X0NA 2Q6ZA 3PJWA 3VKBA 2O7QA 2V3EA 5FACA 1OF6A 4EWJA 1X39A 2Z00A 4Q8TA 1CB2A 1LROA 2CZFA 4HK7A 1EBGA 2A3EA 4E2VA 3GXMA 2A4AA 5CPOA 1BXCA 4LXFA 3W76A 5HMEA 4XUYA 1F3TA 1V77A 4J7RA 1EA0A 3EDEA 4S39A 4XD3A 2HQAA 3QKZA 1E6QM 3HJZA 4E4PA 2GJXB 3QFEA 3UR8A 2PWFA 3GVQA 5FI8A 3MDUA 3L0KA 3QYSA 3OLDA 3TAOA 2F6XA 4DEFA 4DB7A 2AKMA 4AX6A 2QMKA 3ITYA 1PKNA 2A7PA 1SZFA 4M80A 4QXIA 3KVLA 2CZEA 4GY7A 1VYPX 3PM6A 1QDSA 1NP0A 1UUQA 2NLIA 5TAOA 1C9DA 2OGYA 3U0HA 5REQA 4W85A 2SFPA 1JRBA 3A64A 1DEDA 3PANA 5DELA 4RZBA 4FX6M 1UJQA 4Q8VA 5FF0A 3MP5A 3P7YA 4IICA 2WVTA 2WC4A 2ZYFA 3PJUA 5TQLA 2XH0A 1W5OA 2CC0A 3EGJA 1VIWA 3ABRA 2VZTA 5BRPA 1PDYA 3E96A 4MB3A 1PIIA 3UCQA 3VCNA 1K1DA 4GXWA 2VC5A 4AY8A 2PWEA 1X1OA 3W87A 2ONEA 3VNIA 3QN3A 2O4QA 4N6FA 2HS8A 3R4IA 4FSAA 2E5DA 4PUEA 2XTKA 1AODA 1MWOA 2Z1BA 4WY0F 1NQKA 1H49A 1OCBA 3WF0A 4TTGA 2NUYA 1CGWA 3W7JA 2C15A 2WJFA 3V0SA 1GTEA 3UF9A 4QM1A 1ZS2A 3ICJA 3UZYA 4UQDA 4OJYA 1LBFA 2PDPA 3MW7A 3H55A 3U9IA 4Y9AA 3BVJA 3VKCA 4GK8A 4GHRA 5FA5A 3IIVA 1CI1A 2BB0A 4NHVA 2IMRA 3OHIA 1AZ1A 2ZZ4A 3VD5A 3WK1A 3AU6A 1UA7A 3M0ZA 3P8JA 1RA0A 3MU7A 5D2TA 3VYLA 2ZVRA 3VGBA 1NF7A 1S1PA 3MB9A 2D20A 4HOZA 2HS6A 5DCDA 1IGWA 5LZLA 4XZLX 3WD2A 3I4EA 3V16A 1UP2A 4GYFA 3V5FA 2GJXA 2BVYA 1EHNA 1W2PA 1DBTA 3ZWTA 1VS1A 4Z08A 2XUCA 4AWSA 3GY1A 1QPQA 4IFKB 4NJKA 3WL1A 3OP2A 5HPOA 3LPOA 1W32A 1R9XA 2BASA 1JYVA 3O8AA 3RM8A 1AQHA 3URNA 2DSZA 2ANUA 4BZYA 1HJQA 1XIJA 2J74A 2PZ0A 4DAIA 1GW9A 1NU5A 2J47A 5DANA 4ROPA 3M0HA 4B91A 1RVKA 1P6WA 1GJWA 4N7QA 4DUXA 3VE7A 1MQQA 3CPGA 1RLDA 4QGCA 4Y9NA 4RPPA 3PB0A 5D9PA 3G77A 3MUIA 5FEWA 2FB2A 2A21A 1HW6A 1OINA 4AD4A 1VFLA 4JHZA 2J6VA 4D1IA 2ISVA 3ZOAA 2XSAA 4FALA 4FLOA 1M5WA 3GTIA 4QNEA 1T8QA 1ZAIA 2DZUA 2VR2A 3NQVA 1GZJA 3CHEA 4WXYA 1XGDA 3ZMRA 3LD5A 4NZFA 3GHUA 5CZJA 2C19A 3WLJA 1XBZA 4CNPA 1FHLA 2W5FA 2J7CA 3QC0A 2QIWA 2OB3A 2I5QA 1NDWA 2ZRXA 2O9OA 2Z24A 3W86A 3VC5A 4PTVA 1GVEA 3NUKA 1F3WA 3F5LA 4GZ7A 1A5MC 3N3TA 4QEEA 3A4AA 4AC7C 1JNEA 3W1RA 1W1IE 1BSLA 2J9XA 3C2EA 4GD0A 4K36A 1W8SA 2Y24A 3RXZA 4D9PA 1ZB5A 3ZJKA 3N4AA 1JYXA 4TVDA 2VI0A 3WY1A 4MNMA 1P0NA 4ZOEA 1JYNA 1UHVA 3XINA 2E9LA 5D04C 1R38A 3WNPA 1ZAJA 2E0PA 3GG8A 3DEQA 3G1VA 1SSGA 3WQ5A 4LNCA 1FHUA 3SUWA 1AH3A 3MP3A 4GY1A 4EOUA 5DRCA 3FIGA 3OHMB 4X2RA 5AYZA 2AQOA 1I2NA 2QJMA 2CERA 4PEEA 3HQOA 4JHOA 2PD9A 1L6SA 1WKEA 1Z89A 4TX8A 4D8ZA 2HDJA 2VJXA 3FXYA 4D2JA 5DF0A 1ZU8A 3WJYA 3QY8A 3F4NA 2ZXQA 4B15A 1EJWC 4O28A 1HO4A 2EKGA 3T0AA 3PZQA 2WO5A 3M5XA 1ME8A 4LSBA 4AZIA 4M5PA 1VR6A 4H9ZA 4XZIA 3W2JA 2ZZ1A 1ISYA 3BQ5A 3KXQA 4XVDA 1JAEA 3UJ2A 4PULA 2BY1A 3E6EA 2QDEA 2YA1A 3ZXWA 2PURA 4WQ6A 4ICNA 1M68A 4C6EA 1TV5A 1Z44A 2YBUA 3WCZA 3P3BA 3IRDA 5EKYA 4A3UA 4KIEA 2OG9A 3DKJA 3UJFA 3QV7A 2ZOXA 4PTDA 1SZGA 2YKKA 4DJFD 3P0XA 4QLJA 3D5HA 3S9ZA 2CBIA 1UBSA 3PZMA 1W54A 1LOSA 5FJOA 2BNJA 4H9TA 4Q8OA 5G5IA 4YTQA 1ME9A 1TE6A 2XISA 5BMXA 2WLZA 3E02A 3NO3A 1Z41A 4K39A 5TF0A 2DUXA 2VCBA 3SURA 4KQNA 3ARPA 1TCDA 1OVDA 2WKLA 2VCCA 3ZJ8A 3TYBA 4PSPA 3W37A 3PVFA 4KRTA 3IGUA 4IQEA 2FTYA 2DVXA 3MHGA 3S8HA 3AZSA 1OD0A 1NFPA 3GW3A 1AVAA 1M04A 3W1TA 1AW1A 1FH7A 3GU9A 1J93A 3S1VA 3II1A 3GW0A 3H4WA 2GL5A 3T0BA 1AMKA 4I7WA 3F5KA 1DJIA 1XD1A 1DWGM 5DMNA 4LYRA 1EFZA 3QQ1A 4C65A 3STFA 1PWLA 5A6MA 1DIEA 1U33A 1RV8A 2PZNA 3E0LA 1HF6A 3HOJA 3H8AA 4BFAA 4C7GA 1FWJC 2X1UA 3HQNA 3VUPA 3S2NA 3VGEA 3WQ6A 3JZEA 4UTIA 4NZ5A 4UMCA 4WDTA 5GJPA 2ZDRA 3R79A 2YW3A 1X7FA 3UPWA 1BYDA 3S1XA 3EA3A 4W5ZA 3S5ZA 2P1FA 3RR1A 2GJNA 3LI0A 1Z69A 4LVBA 1IXPA 2CESA 3TE9A 1QNVA 1WKFA 4LVFA 4XD5A 1E71M 1JEZA 1DOSA 1P5BA 2GUBA 1K9TA 4I5RA 1Q85A 1EIXA 1EGZA 3G8RA 3V4BA 3WDJA 9XIAA 5HNRA 4MYAA 1QRQA 4GO8A 4O53A 4G9PA 3AYVA 4IX0A 3FVDA 5M2FX 1W1TA 5D2XA 4QS6A 3GHTA 1IEQA 4BI5A 4Z2IA 2VEMA 4ZOAA 4FF5A 5DY3A 3CZEA 3TW6A 1W2VA 5H8PA 5LNRA 4F9JA 4PN2A 3GNRA 2WC7A 3RDKA 4NILA 4FMVA 1TIMA 1IQ8A 1M3UA 2QUNA 3B8TA 3VOCA 2Z6JA 3PWIA 4D71A 1JI1A 5C55A 2PGFA 5BW6A 4DJDC 4AHOA 1HUVA 3VVGA 1QMLA 1QNQA 3MZ2A 4GG9A 3VIPA 4PTMA 2Z7GA 4H9VA 1V51A 1V3IA 4RE2A 4FOJA 3ITLA 4JTQA 3WLRA 1J6OA 4I9AA 1UD8A 1CGXA 4FX7A 1RJRA 4GOAA 4LQ1A 3BG9A 4OV9A 1K4HA 3O6YX 1O66A 3IJLA 5H8UA 3BURA 2ZA2A 2HSAA 4Q6JA 3DKLA 4HMDA 1RXOB 5EMYA 3NPWA 2IPFA 3SQLA 3VZZA 3RO8A 4C6NA 1FWCC 1W5NA 1THFD 3UWWA 3N29A 1PWMA 3AS3A 3CIWA 1U5VA 2B81A 3TJIA 4A3RA 1EX1A 4NXSA 1TVLA 2F61A 4MWAD 1TZZA 4A4AA 1QW7A 3HURA 1K9FA 2V9DA 1N2VA 2KZHA 5AB3A 1KKOA 3XISA 4EIVA 3EXSA 3CHCA 5D9MA 3GFZA 4XQ6A 1B3OA 1MUMA 2E68A 2BX7A 4UTKA 4TQTA 1C91A 2Y63A 1NJJA 5ECVA 2PDQA 3WQVA 2R1LA 1U5HA 1B3VA 1XXXA 1O6IA 1GORA 3GQYA 4WEVX 4XZWA 3L4YA 4P7QA 4E2DA 3LCWA 1KRCC 1UC5A 4G8TA 4QFUA 3ABXA 3RX3A 3FYYA 2PDJA 4Q7IA 2CBUA 3S5NA 1V79A 2BMBA 2EPKX 2WHJA 4ZO7A 1G0CA 1US3A 1ELSA 4CUCA 4C6LA 4DNMA 3LN3A 2GFTA 1E6RA 1GVSA 3W71A 1XGEA 3THCA 5BOEA 5KEZA 4EVZA 3IJQA 4WX2A 5LIXX 4K37A 4LAUA 3FGCA 4OKDA 3VAVA 1FFRA 1H09A 4JKMA 4D6CA 3PTMA 1JZ7A 2PDFA 3IUDA 3ZWSA 2QJGA 3DDMA 1DKWA 4Y9PA 4A8RA 3O6CA 1V6YA 2EPHA 4HNTA 5DFAA 4LUYA 4P7RA 1JPIA 2DZSA 1E70M 4LW7A 3FKKA 5A95A 3VABA 1Q8JA 1US0A 4N4PA 1LM1A 2CCRA 5CXPA 4JICA 1N8WA 3KTCA 1EJ7L 2HXTA 2W91A 4TV5A 5A8QA 3MWCA 3T0CA 1W56A 1F4AA 3DYPA 1LLWA 1D9EA 4PRRA 1HJSA 4IX2A 1H7NA 2ZX6A 4QR6A 1Q63A 1XIFA 3GWQA 3O3RA 1YNYA 4PUDA 2XN0A 2FGZA 3CUFA 4TXEA 3NM3A 1QPKA 2Y7EA 2V0TA 3B8SA 3W00A 1W1A1 1K03A 2C1HA 1WBJA 4J9JA 2G3JA 2QMJA 1PE1A 1LQAA 1RCQA 3L68A 3N25A 4AY7A 3LMYA 3G3DA 6REQB 3L4UA 1WZKA 5AC6A 4A22A 3WUEA 4NYUA 4Z0SA 1H1ZA 4GUFA 5E0KA 4WUIA 3IACA 2G0WA 3ATYA 4PMRA 4WOZA 1KBIA 3VKAA 1WV2A 3O63A 1ENUA 4TMBA 3VOGA 1PB0A 4GNJA 1NWUA 3IUIA 3WQGA 4MZ8A 3T2OA 3IV3A 4H4IA 2ACSA 1JZ8A 2QCNA 5D2YA 1OK4A 3SRDA 3T78A 1LDCA 5E70A 3V1HA 5IHSA 1SMAA 3C56A 2WSPA 1X6NA 2ATMA 2ZRZA 1VIZA 1GKRA 1U30A 5F1UA 2ON3A 3V18A 1X96A 3WNNA 1R3WA 2W6RA 1EC9A 5D4YA 3K1GA 2NWSA 3MKKA 4WR3A 3GB6A 4Q4QA 1QK0A 4W84A 5CBIA 4C1LA 4IJBA 4MFDA 4PRWA 5I23A 4NIRA 5HJXA 1ZUAX 1DPMA 3L2MA 4WD0A 1YXCA 1KRBC 1IZCA 3L12A 1HX0A 4AH7A 2O9RA 4UZUA 4P7OA 3T40A 4I9TA 5D33A 2WC3A 4GZEA 2FTWA 2I16A 2YSWA 2KAUC 1IZJA 3L4VA 3CH9A 3WLHA 1EIBA 3VNDA 4H1ZA 2NV9A 1A5BA 1JDFA 2XDFA 3W25A 1W3TA 2PC4A 3J7HA 2PDCA 3TJ4A 4IIHA 1DWFM 3W1AA 1VHNA 4PMNA 3PAOA 3W38A 4CEXC 4HGXA 2WPBA 4IIGA 1E1CB 1Q6QA 4HPXA 5CC7A 3WBYA 2VZOA 1QI3A 5G2IA 2GQ3A 5K2ZA 1LG1A 3FJ4A 3H26A 2D2GA 1ZENA 1R3TA 2PP3A 1E4LA 3W7EA 1UD3A 4F66A 4NI8A 3VCRA 3SUVA 2PLKA 1UP0A 4F0HA 1ZCCA 1XYBA 1W9BM 1WDDA 2INEA 4AZCB 1PYFA 2QZRA 2FGLA 1S38A 4HJFA 5CC3A 6CGTA 1AD1A 5HULA 2VL4A 4XK2A 1IR2A 3GH4A 3NQGA 3ZO9A 4OUEA 1HTIA 3S2LA 4RKAA 4XO7A 3KBSA 3LCHA 3AC0A 3WLIA 5FCZA 1VEMA 4KETA 1IEWA 3DC0A 4QROA 1KFCA 1V08A 6REQA 3NQ8A 1VFOA 1JZ5A 4N9CA 4GJ1A 4AX7A 5BMWA 2CZVA 4L4LA 3DUGA 1M9HA 3C0JA 2P5NA 5I3DA 4O14A 1EDGA 3AXKA 2V30A 2GDVA 1E6PA 4YVXA 1V0KA 2FVLA 4QP0A 4AZ6A 3MCMA 2NT1A 1J01A 2WOQA 5I3KA 4HIBA 3GR8A 2QF7A 4LBUA 5FF7A 1F74A 2XFYA 4Q7BA 2JEPA 2ICSA 3R10A 4PMYA 1UP3A 4JEQA 1TPWA 5LIUX 4IWWA 4PTWA 1OGBA 2JE8A 2WCAA 1FCUA 3BGGA 2YB4A 1TPH1 4EF8A 4IF2A 3DFPA 3KBNA 4QDWA 1Y7VA 2VGGA 2FQIA 1EPXA 3NPVA 4K8GA 1K6WA 1CECA 3G18A 1OFEA 3IGHX 4NP7A 3V75A 2EPOA 4Z1AA 3RMEA 4H19A 1I2PA 2G8ZA 3LPFA 4A8IA 5DLCA 2FVKA 4KMQA 4QSHA 1UWUA 3EEZA 2D0FA 5I5RA 2PB1A 3OW1A 2R6OA 3H7UA 4PCPA 1FTXA 4FLSA 1GPFA 1YRRA 3I3BA 4MB5A 3B8DA 3R8GA 1VYSX 3DHPA 4FNSA 3N4EA 4MAVA 1DJQA 1TPFA 2CW6A 4RNFA 3B3DA 4AF0B 3CMGA 4PSRA 4O54A 1GVOA 4UB9A 4Y96A 3RCMA 2ZE0A 2JIWA 3HPXA 2V5DA 3H7VA 1YXYA 5IFPA 3VOFA 4N02A 1OY0A 4C5YA 2QJJA 1VGAA 3RRAA 4HNUA 6ALDA 3TTYA 4UIOA 1Q6OA 2GQ9A 5CCZA 4ASTA 2EQDA 3C3UA 1OC7A 3GM8A 4WGHA 1GKQA 3S5OA 3CO4A 5AHEA 2ZTKA 1REQB 4GGBA 4U5KA 2Q8LA 2XIMA 4D6IA 2GUUA 1O5QA 3OIXA 4M6QA 3K4DA 5J5RA 2VFEA 3PZVA 1GQNA 4EXQA 1IXQA 1D2KA 1HXJA 1Z7AA 1PPIA 3N2CA 4F40A 1TX2A 3NXFA 1V6XA 1T99A 2VTFA 3GXIA 5G1TA 3LENA 3QW3A 2BY0A 5AYIA 3VNJA 2WVVB 2PC8A 4RUBA 3V1PA 1QHZA 3TSBA 4RJEA 5HNUA 2GVEA 2FH8A 1A4MA 4ZQNA 4I7UA 4WKHA 4MJ4A 2DSKA 3U2ZA 1I2QA 2D73A 4MB4A 5KZ6A 3GDTA 4DJFA 1VFSA 3GR7A 3L0GA 1GZ1A 3MC5A 3SCOA 3BAXA 1JF5A 3V36A 2PTYA 3T0DA 3MDWA 4NZCA 4MJ2A 1NP2A 3PFMA 2D69A 3NA8A 1EX5A 3H24A 2NQLA 3ZR5A 1Z32X 3FJNA 2G96A 5KZEA 3NDYA 2OQHA 3LM7A 5LGZA 3A4XA 3BLPX 2MUCA 4LT9A 1B57A 2VZUA 4JNYA 1TRIA 2C1GA 4XUGA 3MKVA 1X8FA 4J3VA 1KGUA 5EGRA 1G1YA 2GVGA 4O13A 4YCPA 1WX0A 4HPGA 1JDCA 2C16A 3W84A 3IWPA 3T55A 4Z1YA 1QK2A 4A21A 4MWAB 4OV4A 3AI0A 5HNNA 1LBLA 1RHCA 1BXBA 1F6YA 2YCLA 4B9YA 5LIYX 2X42A 4ZOCA 1E9YB 1POJA 1QOXA 3SCPA 4GUHA 2OT0A 3HO8A 4CCZA 1SSDA 3W1MA 2YOCA 3N13A 5AHFA 4O8RA 1MZHA 1UUMA 1H62A 3BO9A 1JDEA 5CJ5A 3WF3A 4UCGA 1AW5A 4LCQA 1YHTA 4JFUA 3KL3A 1QI4A 3WEZA 4AMCA 2IPWA 4IGNA 5J5DA 2VD9A 3N9KA 1VBGA 1K02A 5XIAA 1KWGA 1FRBA 3AS1A 3CPUA 3T4WA 1ZZMA 1J18A 3NG3A 4JTHA 1GKPA 3EA1A 3VDGA 5CAKA 1XLMA 4PZVA 4D6GA 1REQA 3CL6A 1H11A 1RBOB 1CXHA 4CGTA 3UVIA 3K30A 5BU6A 4W7UA 4UTFA 1OG6A 1J5TA 5LIKX 2GYIA 1FWIC 1Y65A 2NQHA 1G5AA 2PODA 2ZFAA 5EMLA 5LXXA 3QV8A 4JCLA 2WVVA 4G7EB 4UQEA 3PBWA 4DM1A 1CXKA 1F76A 3N15A 4XBKA 3NQAA 1XUZA 5KSWA 4KCVA 1R0MA 3CQKA 5C2CA 1Y8BA 4DLFA 3ABSA 3OBKA 4DVOA 1UD5A 1E3XA 4IP7A 4Y6GA 3KS6A 4KWWA 1AQ0A 2YX0A 3W7HA 4XAPA 1KR1A 4W8BA 4GQRA 4FP1A 1XIHA 5E0FA 2WJEA 2D2HA 1CXFA 4RNJA 4G1NA 4GC4A 1DE6A 4IQLA 1KBLA 3C52A 3UBPC 3WJZA 2Q3OA 4UTWA 2PRHA 3MQTA 5I00A 3OOQA 5LNVA 4GMEA 3TTOA 3WLPA 3PZOA 3NSXA 3QLLA 4TX6A 4LEQA 4H9MA 5HNTA 1NWRA 3PSWA 4V1YA 2OSWA 2ZDSA 1UG6A 4MTVA 4QSFA 3MA8A 1A47A 3MUZ1 1XLHA 2CKRA 2E25A 4FR6A 4H00A 2WXDM 3TKFA 2O56A 3OZPA 1FDZA 2PGRA 1F5ZA 1BKHA 4MYXA 4HA4A 1JCLA 4KWUA 5AZ1A 5MKGB 2Z2AA 2XIOA 1OFAA 2ZICA 4GA8A 3A13A 1QBBA 4MWAA 1SJCA 4NI3A 3QZEA 3SM0A 4PB4A 3NO1A 1ZJHA 4GVFA 1GJUA 5AY7A 3GVGA 3R6IA 2EG8A 3S1WA 1F05A 1OFBA 3BDKA 5T9CE 3AHTA 4Q4PA 2W92A 1UWRA 2P3EA 2VP8A 1T0OA 1IT8A 1VBUA 4NRSA 5JQ9A 3EWXA 4AD5A 1SVDA 4MHBA 4I6VA 3I68A 1KCXA 1JFHA 1LYXA 1XICA 2BTMA 4YCOA 1E4IA 1GVIA 2Q02A 2D23A 4JNMA 3LI1A 2DSWA 3ZT6A 3GC5A 2Z1WA 3W3OA 3FA3A 2TYSA 4A3YA 1EEPA 1M1BA 3EPNA 4RNIA 3B05A 3HG3A 3RILA 2E1DA 3VIIA 3P82A 2F7FA 3HGRA 3PPHA 4U2ZA 1GEHA 1U5JA 5EBAA 4MZ1A 4Q3MA 3QZAA 4WLCA 4PL2A 3SQMA 1TPVA 1SM9A 3MI3A 4L6HA 3BMVA 5IM51 4Q6XA 1R30A 1KXVA 4XSLA 3KWSA 4G7EA 2X09A 1CTNA 4MIMA 2XZ9A 4CU7A 1G7UA 2Y4SA 3MSDA 5A8MA 3TYZA 1B54A 1DORA 3SCVA 3HTWA 1YYAA 1QASA 5D8ZA 1O94A 3VGHA 3NL6A 2QDDA 2P0OA 3BLLA 3W1LA 1XIMA 1XYAA 2BOGX 1EO7A 3M7WA 4GFIA 4AB4A 1ML1A 1ODUA 3DGBA 3SZ8A 3UW6A 8TIMA 2XVLA 1RJPA 1JCTA 1O7AA 4J35A 3Q67A 4U31A 2H3DA 1TO3A 3C2RA 1AMYA 3SGUA 1DHPA 3OVPA 4IPJA 4EXAA 2Y7GA 3ZLHA 5HJYA 3RUBL 4LANA 5CKSA 4WZHA 2J7HA 1MQRA 2YYUA 4TIMA 3W24A 3TOPA 3UA4A 2HMCA 2ZZ5A 4UR7A 4GZJA 1QHOA 4IJCA 3DFHA 3F7JA 4UNKA 4J2PA 3B8WA 1VFHA 3GTHA 4HNOA 1UMLA 1ZBVA 1MRQA 3SY1A 1PAMA 5H91A 5MKGA 3RJYA 1ZY9A 2D0GA 1V0LA 4PMXA 3OA3A 1E6SM 3GE7A 2ZTJA 4GIAA 2Z27A 3DFOA 1EZWA 3TC3A 3R7MA 6ENLA 4X0VA 1QI5A 2E8YA 1SZEA 2Z26A 3ZVHB 3KFTA 3GVRA 4V33A 3B8IA 1K9EA 2R14A 4FEZA 4IJRA 4HA0A 3JZUA 1XG3A 4ADSA 4UTUA 2YDSA 1VPQA 2JGQA 1V02A 3RR4A 1BAGA 4HCDA 4TX9A 1TCMA 2GZXA 3ONBA 3S5SA 2HRWA 4MADA 1XL9A 4JY8A 3N2XA 4HZ7A 1EQPA 1AA1B 3JS3A 1NOFA 4FNTA 4C6FA 3LBMA 4A3QA 3SO7A 3OZOA 1X6UA 4JQAA 1XV8A 1Y5VA 1LJYA 4IGMA 1V3HA 3APGA 4XWUA 4TR9A 2O0TA 5D2WA 2VZVA 5FJIA 1JAKA 4C6KA 4LBSA 1DXIA 1EJRC 4AZBA 5I07A 3RCNA 5MF5A 3QOKA 3HMJG 1YE4A 1XW8A 4DO6A 2PRMA 2ZZ6A 2WV8A 1W3HA 4O8AA 3POCA 3THAA 1WAUA 5BOOA 3TCSA 3VO0A 5AC7A 2BVDA 1CB7B 4G6CA 1XRFA 4Q22A 4E8GA 3DFTA 2P88A 3BANA 3VKJA 2Y8KA 2HPMA 1OFPA 3IV8A 4LAMA 3T0TA 1V8EA 3OYXA 3W83A 5D9NA 3B8VA 3QV6A 1J0KA 4P8VA 3QQ0A 4ATDA 4BY3A 1OC6A 4P8WA 4AQLA 5LNWA 3GG0A 1ZP3A 1TWIA 2GJPA 3CQIA 3WLLA 3WLNA 3AIUA 4QLKA 4BQ3A 1HFBA 2DZAA 2WSQA 4ZA0A 3P67A 3OYZA 4EK7A 2ATSA 1EF3A 1ZALA 1M03A 3SJ3A 1IT0A 3PPGA 3AICA 1XDMA 5LGXA 2RDXA 3CH0A 2CEQA 3KTXA 2DH3A 3B9EA 2Y7DA 1IEVA 1FWAC 3V0UA 2XVNA 1GUVA 1AFSA 2JKPA 1OCNA 3FEMA 4LAOA 2QV4A 3UWVA 1KCLA 3DHDA 1C29A 2EPMX 4LS1A 3ALGA 3FCPA 1S5NA 7XIMA 4B5VA 1PZ1A 3ZVHA 2PDNA 1FFQA 4YYCA 1J12A 4KFNA 4M1RA 2VD8A 2OZ3A 2V63A 1O5XA 4CN4A 3GSMA 3VMOA 3NOEA 2BGSA 4MSSA 2QPXA 3N19B 4KF1A 3GDMA 1HKWA 4LUIA 3UG4A 1W3NA 2REQB 3EXTA 2C6QA 2JQXA 4LS0A 3LRLA 4MY1A 4KRUA 1JCYA 3O2LA 2WM1A 2VRJA 3NDZA 4GUGA 3R58A 1UH2A 2DZTA 2X2GA 5U4NA 1OX4A 1D3HA 3JVAA 2CWXA 1KBBA 1KKRA 1O4UA 2QHAA 4W7WA 1Y5XA 5FSDC 1TRDA 1WO2A 4KWVA 1P0BA 3PZIA 1WPCA 3V5OA 4XZHA 4S38A 5FEPA 5SWUA 3GU1A 2I56A 3UYCA 4FO4A 3LZ5A 2X7WA 2JBMA 2ZADA 2Y5SA 2QYGA 3PC0A 3ZR4A 4E6MA 4ZO9A 4XAZA 4RX0A 2YIHA 2AL2A 3O15A 2DVUA 2EKCA 2WJDA 2X0SA 4C6OA 3EKGA 3RLHA 2X16A 2ZX5A 2PA6A 2FH6A 1SFJA 4LU0A 3KBMA 5BXTA 2CU0A 3KDOA 3IVSA 4A8LA 1BVNP 3N2OA 5C8BB 1CXLA 3QPEA 2E3ZA 3UWYA 3HG2A 2E6AA 4QE5A 2WSRA 5C71A 4AU0A 2V3GA 4JAWA 3TWAA 2PDUA 1I75A 2GQAA 3BUVA 3W82A 3QTPA 3NSNA 1YTKA 4V27A 4E8CA 2EJAA 2PBGA 3G1DA 1PX8A 3SQSA 4ZO6A 4OQVA 2YCJA 4ZTXA 3LXBA 2P8CA 3WBWA 5LXEA 3G5EA 3WMBA 5JBDA 1GOWA 1XDJA 1HKMA 1FWBC 3N11A 4NAEB 4GJJA 4UTMA 4UNIA 1Z42A 3TN5A 5CJMA 1ITXA 3TZFA 1TMLA 3LG3A 1RZMA 2XH7A 3LRMA 4IIFA 3M7SA 1W9XA 5HDRA 2GWNA 3TQ0A 4Z1DA 3B97A 5HWNA 1MDLA 2WZIA 4PMVA 1JCXA 1DTNA 2PTXA 3EX2A 3W27A 3NQDA 4RE0A 1GK8A 4G5DA 2PTDA 5CAHA 1KB3A 5IDIA 4XZMX 3E38A 1EZ2A 4ORMA 3CJPA 4R53A 4Q8WA 4DM2A 3WNLA 2DZVA 1J6PA 1SUXA 3AIWA 4RK8A 4H6QA 3UVAA 4PMZA 1MMFA 3UU0A 3CUJA 3GXNA 2NQ9A 1J0YA 1U1JA 1HZYA 3IJ8A 4JQ4A 1S1RA 1TV7A 3L4WA 1VH7A 3ID7A 3DBNA 2ISDA 3MVTA 3SIMA 4WSKA 4HA3A 3VNYA 4H6KA 1FKXA 4KEZA 3DBPA 3FEQA 3WQDA 3S2JA 1DJNA 3BPWA 1HVXA 1ICQA 4DUWA 1IHIA 3KP1A 1B3XA 3B40A 4HU0A 3BG5A 3DHUA 1EYEA 2UY4A 4WJXA 4O57A 4JS3A 4EAMA 4PFHA 2DT0A 4AXKA 1R85A 2PSNA 1RD6A 1PEZA 3T42A 2GSHA 4G56A 3S42A 3BH4A 1V6VA 1XSKA 3Q45A 4H8UA 4PUJA 2FGBA 4N42A 3VKDA 2EBNA 3A4WA 3HFTA 3PBUA 1KD0A 1F8IA 1H1NA 3STEA 1PZ3A 3EMZA 3HGSA 1TE1A 1YKWA 1OFRA 4FIRA 4F2UA 1NAL1 3K8KA 1QNPA 1P0DA 4AEEA 1Q2RA 4NAEA 2CYGA 4C6DA 1EDQA 3VNZA 3R13A 4U2YA 3ZFHA 3F4WA 1PO9A 1QUMA 4P61A 3Q4DA 3MP4A 4AD2A 3DI0A 4GPNA 2YCKX 3EBVA 4BWLC 5AYYA 2PF8A 1UWAA 3LCFA 4PCFA 3W1XA 1OT1A 1UOKA 2IS7A 1UB3A 3E2QA 1O1HA 1BD0A 2Y7FA 3WH5A 3BK0A 3W22A 4MJZA 3WUGA 4R27A 2ODOA 1OSEA 4L7ZA 4YLWA 2JK2A 2BHUA 7TAAA 2DQXA 2C79A 2Q71A 2RDTA 5KZDA 5GVJA 3UA3A 5FF3A 4QITA 4DJEC 4BI7A 3RO6A 3ITOA 5CEWA 3CZ8A 2XIIA 4NZ4A 4J40A 1KR0A 2WHKA 1IYXA 2DP3A 1RQBA 2V5BA 5IBXC 5EBUA 3GTXA 2V5KA 3F4CA 2W63A 5BNKA 1EH9A 2FHBA 2QVHA 4JTIA 4GGHA 3NQBA 4HZ6A 3BCDA 4IT1A 1ITQA 1X38A 2YPIA 2FFCA 3KAOA 2WNNA 3VDAA 4LC6A 5M1TA 5FAGA 1BEUA 4URIA 2PDYA 3N2TA 2BOFX 1WBHA 1XH2A 1XIEA 4OTKA 3EWZA 3TW9A 3LHTA 2A1YA 3WDIA 3EA2A 3BMXA 1XKJA 1QI0A 4PTNA 4KFOA 3RLGA 3W2UA 4U5IA 4IIEA 3H70A 2HWGA 1E5JA 1CZ1A 4IMEA 1DIKA 4LALA 3LUTA 4DELA 1XBXA 4BJHA 3MO4A 1E0VA 3GNXA 1ZRQA 4WRHA 4O15A 4QAIA 5FOOA 4IHCA 3C8NA 2OYMA 1UWSA 3TTSA 3FA4A 1MEWA 3M0XA 4M6UA 5CH9A 1OX6A 3MY9A 3THQA 4ACYA 3UEQA 2PU1A 4DPQA 2A6LA 2V3DA 2CETA 2XWDA 2Y85A 4MF4A 3GNDA 1TWZA 3N73A 2IKIA 1UZHA 2QV5A 3IS4A 4Y9MA 1LBMA 3HV8A 1SPQA 3W7DA 3H4XA 4UMBA 3ENLA 4D6DA 1OGGA 2WMJA 1V0MA 4H41A 3HPAA 4UBPC 1BTCA 4PUMA 4RZ4A 4XAYA 2UY2A 1GHSA 4J3XA 2E6DA 2HPIA 1TX0A 1S2TA 3H12A 3PBGA 1M53A 1WE5A 4GNKB 1NF0A 3PWGA 1W9PA 3STGA 4NG3A 4JN6A 5LHFA 1KM2A 5FIPA 4GYJA 2PDMA 2E5CA 1W3LA 3UY7A 1TREA 3KRBA 3LDVA 1VFUA 5A6AA 3OZYA 1WDWA 3W29A 3KCOA 4MKNA 4Z0JA 4Q8MA 3GH5A 3W6MA 1E72M 3EB2A 3S4TA 2ACRA 2C91A 3FXGA 2XJ7A 1LLZA 2DV0A 4C6MA 3NQFA 3BCJA 1RY8A 3AS0A 5CG0A 1WOBA 3QZ6A 4CU8A 4JYDA 2ZIDA 1AQFA 2VGIA 2XGBA 3T05A 4CNUA 3CUHA 3LHYA 2DJXA 2WYSA 3FHQA 4CEUC 3Q94A 1JI2A 1UQZA 4IPNB 3RMJA 4AZGA 1WA3A 4IMGA 1OHLA 1JPKA 4IFRA 3O9NA 2Z6IA 5D32A 3VCCA 4WK9A 3NYDA 5DRIA 5EMUA 4XZNX 1DXEA 2X30A 2BV9A 2WWCA 3BLEA 5A6TC 4W7VA 3GDBA 2WM0A 1XRVA 1TTJA 5D02A 1VCVA 4E8DA 5LNUA 2OLAA 5LA0A 5G2HA 3AMGA 3VX1A 4LX4A 4JYEA 2AAMA 3LHVA 3LV5A 1SW0A 4ILSA 1JPDX 1SW3A 5AHLA 5K7JA 2J9ZA 1TJPA 4KCWA 4NZ1A 3Q37A 4JYFA 2PUZA 3K4AA 3SN0A 1WZMA 4CQCA 2BBFA 1ZAHA 4QG9A 3CBWA 2DJLA 5JVLA 1KCKA 1NDYA 3H4GA 5JXQA 2Y61A 3ZM8A 2QCLA 5K4XA 3QPZA 1WZLA 2RKXA 3LQLA 5J04A 3UY8A 2MANA 2DGAA 4R33A 1VFTA 1MXDA 3EX1A 1CBGA 2NX3A 1XHGA 3WNMA 3EXRA 4YHGA 2UWFA 1LT8A 1PL9A 4PMQA 2EG6A 3WLTA 3CHFA 1LL4A 2PTWA 1BF6A 3KOZA 4B4FA 1WOAA 4RNHA 5AC4A 2VMFA 3ARZA 1W31A 3W53A 2GOKA 3PZUA 2HVMA 2VGBA 3AHXA 3B04A 1CX9A 4PUUA 2C13A 2VCAA 1H3GA 1CT5A 1MZRA 3WF2A 3PZTA 4CD7A 3TMLA 3C8FA 3DOPA 2FTPA 1OT2A 1MFVA 4BEQA 2QR6A 3H2NA 1DHKA 1OB0A 3QY6A 3UR5A 1PBGA 2A3AA 2OZTA 4XD4A 4IM4A 3ZS4A 1OIFA 4IG2B 1EC7A 1O1ZA 2FPTA 2CHRA 4V2XA 3EX6A 3I3EA 4MUPA 7PTDA 1OFOA 1VBRA 3AU2A 4R85A 3CYVA 1S2CA 1EUNA 4FB7A 1DWJM 1XD0A 4O19A 1J96A 4JXCA 3W23A 4HHMA 1K4GA 1YEYA 2WBGA 2OCZA 3VFCA 1BG9A 4LYKA 3VIFA 5B7YA 4ZTYA 2E67A 3UWEA 4DBWA 2DVTA 3G22A 4H8VA 3RYSA 2P3ZA 4CNSA 2O92A 4QBXA 1G4EA 2F38A 3PNZA 3M5ZA 3CM4A 3VIGA 4J3UA 3ATZA 2J77A 5AECA 4JR5A 2NUXA 1FWDC 5F2IA 5A6JA 3SDOA 3N14A 1K77A 2E77A 1ISZA 3PSVA 3INPA 4ROQA 3UG5A 3LA4A 1AL7A 3H22A 5E5CA 3MI2A 4UTTA 4ZO8A 1H5YA 1W37A 1HIZA 2JF6A 2EO7A 4NX0A 1ZQ5A 2QGHA 3S6DA 5E9XA 2VT0A 4BWLA 1M01A 5L6UA 3RIKA 1ITUA 4UFKA 1GJPA 3DG3A 2WZHA 3HIJA 1ICPA 1BVZA 4HHLA 4HNCA 1OYCA 1E6NA 4O1AA 4EPDC 2LLEA 3TN4A 1UWTA 2A6NA 1FUYA 4JN7A 4CQ9A 1P4CA 2L5HA 1PIGA 3B9AA 1W5QA 4UFJA 2G3FA 4JD4A 3SUTA 3OGVA 3S46A 1SFLA 3HU7A 4IISA 4E3VA 1DJZA 4J3TA 1LORA 1A53A 4U28A 2WZEA 1C90A 3VK5A 2OLHA 1Q6GA 1MYRA 3CPRA 1JIBA 1QNRA 1R46A 1YX1A 3MKCA 4HU8A 5IBXA 2RJHA 3IJ9A 2QPUA 1Q4WA 5F4SA 5BROA 2CLPA 5I02A 3ZLFA 4NNBA 4O1BA 2D2OA 3CLMA 3DU0A 4PB5A 3U3HA 2GK1A 4PA8A 1FWRA 3EX3A 1JDDA 3EOEA 1VQTA 5DN1A 1KLZA 4IG2A 3WL0A 4JBRA 3AMDA 3GU2A 4J4KA 2DIJA 2A2IA 3BGJA 3DGRA 4GI4A 3L23A 2V5LA 2DW6A 4FHAA 5F1VA 3RX4A 4Y8FA 1ZGDA 3W0KA 5EPDA 4JTDA 3MCOA 4ZB2A 4AMAA 4YTRA 3Q65A 3GC4A 1H4PA 4JTUA 2VZSA 1HGWA 4A6GA 1IR1A 1FWTA 2INFA 4YL2A 1B5TA 2ZUTA 3NO5A 3GDKA 3I6TA 4DNHA 4L64A 5HPCA 1EP3A 3HF3A 1J0HA 2WLYA 1NDVA 3CZKA 1C8QA 5AN7A 1XH0A 1VEPA 1MXGA 1V6UA 3PJTA 5F4WA 2QIIA 1MEIA 3MUXA 1UD6A 1M65A 3LHZA 3E49A 3PZ9A 1UD2A 2GPTA 5CGQA 2PWDA 3FK4A 4FXFA 4DO5A 2D2JA 3CQJA 3QKEA 2HNHA 2QF8A 4JX4A 4ML4A 1S39A 3ITTA 2WWDA 3I7RA 4LAKA 1NTHA 2CLMA 1FWNA 1US2A 4OGZA 2Y62A 1A3WA 1PCWA 3W2NA 4I5XA 4G2DA 3SRFA 2W67A 4NJGA 4GCXA 3LQGA 1XLAA 3WH6A 4AWUA 3T09A 3R2GA 4O11A 3C61A 3DHFA 3QR0A 4W89A 2W9MA 3WFZA 4FI4A 1JCMP 1B90A 3PBVA 3TEVA 3PR2A 1LQ2A 4NXKA 1WDRA 1IEIA 1KGXA 3VUSA 3TFXA 2IKGA 4AG0A 3NEHA 3NQ2A 4OWGA 1TV3A 3R89A 4L80A 4CLMA 1XLFA 3TV8A 1RCOB 1O5RA 3TFCA 5FF2A 3UNTA 5C0QA 2C8NA 5HJLA 4AHQA 3EPOA 1RQHA 2PWGA 4M24A 3RLUA 1W0MA 4HVXA 1DYSA 3SY8A 3BAYA 3LLXA 3DAQA 3TNOA 3GG7A 3R94A 1B2YA 1XIIA 4JCMA 3CLWA 3KL5A 2WHMA 1JFXA 3FOKA 1IIGA 4O1FA 4K6AA 5CSYA 3SN1A 2RFGA 1AJZA 1K8CA 3EKZA 3DFNA 2YA0A 1FY6A 1SJAA 1MXSA 3N9RA 3NL3A 3OA5A 1PIFA 4I3GA 3EWWA 2FZMA 1NM9A 1GQJA 2GOUA 2F2KA 4FIQA 1OX5A 3FYOA 4HYRA 1GZGA 1E0WA 4LRSA 2WHLA 3GAKA 5IXEA 1YDOA 3NZGA 4GKLA 2QJHA 4QE4A 4DZHA 1P0KA 1JZ4A 2NVCA 4GVGA 4IMCA 3IIXA 5C9UA 2XM1A 2X2YA 1Q45A 1PZ2A 2E4TA 3L65A 5CGTA 5BXRA 3W6YA 3FJLA 3RPMA 2ZBTA 2CZDA 3COTA 4O0QA 3CT7A 5I09A 2B7OA 2VFDA 4UC5A 1TPUA 3OODA 3CMFA 4GX9A 3HMCA 2EXOA 2PLMA 1CLXA 4QJ5B 4UNLA 4FF7A 3P93A 2PDBA 4L9XA 2JALA 4BQ4A 1A0DA 1Q13A 2AOSA 4JTTA 1V7AA 4GABA 3E0VA 4REQB 3TTQA 1FHVA 1ISXA 4P7LA 2NXHA 3VGDA 4FNQA 1FCBA 3FLUA 1JZ6A 3W7CA 2FJKA 1MEHA 5IDZA 3KOYA 3NOYA 4GUIA 2W27A 1A49A 2VDIA 3BSHA 1DQXA 4MWAE 1UROA 3E3HA 3PPFA 3OBEA 5PTDA 1R86A 3SR7A 3QQWA 1HL2A 1UZ1A 1ECQA 5BWAA 2W66A 1H1YA 2OWCA 2XHYA 4A3HA 3NGFA 5CC5A 1K7FA 2G4FA 2OOFA 3VOHA 4GI6A 4YWSA 1B4KA 4L4OA 4KCUA 3S6TA 4RV8A 3STCA 3VZXA 3W02A 3WNKA 3CAQA 1VPYA 2P0IA 3W1PA 1QT1A 4B5XA 4EACA 4Q33A 1FH8A 1SYTA 5AYXA 1LRTA 1E0XA 2I9EA 4K1WA 4FLRA 2GGEA 3OVGA 3AOFA 1UPMB 1J0JA 4GYPA 1TMHA 4DIAA 3OG3A 5C70A 2B7NA 3AIBA 1EJVC 1Q2SA 3A12A 3CS2A 4AD0A 3F1QA 1UA3A 4GO9A 5HQMA 3CC1A 2XVGA 4HQVA 1TFVA 4RV3A 4AUBA 3BTNA 4DWSB 3DECA 1G01A 2VEPA 1WXZA 4P2VA 1EF2A 2XH4A 1GNXA 3OLIA 2TPSA 3WQPA 3ALFA 1F4HA 2OO0A 3BAJA 3QEZA 4Q8QA 1CGYA 1EKOA 1M7XA 3IARA 1OABA 4W8AA 3LHWA 5CC6A 4XD6A 3SAZA 3P14A 3LLFA 1DWIM 2ZUSA 3WDQA 4LRTA 4IOTA 2W0UA 4QEHA 3JW7A 4B2DD 4V15A 3VC6A 1BHGA 2BG5A 1KFLA 3P8IA 1T40A 3HB9A 4HYVA 1C7SA 1TPB1 2YGYA 3M9YA 3NZPA 2FZ9A 3TXZA 3G8EA 2PGWA 2ZCGA 3B9DA 3VD3A 3H2CA 3EEGA 1MNZA 4GJIA 4H83A 1Q8AA 1IWBA 4WGXA 3CQHA 2ZUMA 4GIEA 1TA3B 4REQA 1ZTVA 8XIAA 2BP1A 2DZXA 3R0UA 1R9ZA 3CV1A 3BZJA 3PF3A 2A3CA 4FX8A 3MT1A 4TUFA 1POKA 3R1ZA 2NX9A 1RK5A 3PTQA 2R1NA 4QDMA 4HMNA 4TO8A 3G6MA 4N0RA 4F2BA 4NL1A 3TP4A 4GYKA 2P50A 1BVWA 3U4FA 1DIOA 2UV8G 1J79A 1CEOA 4QQ3A 3S47A 4PE8A 1R87A 3LSBA 1HT6A 3QC3A 1BYCA 3F5JA 3SECA 3W01A 3MTWA 2B0MA 3UFYA 4RW3A 3DI1A 1VYRA 4IFKA 4G1KA 3TVAA 3B8UA 8RUCA 2EJ1A 4Z2HA 1L0PA 4E5TA 1PUDA 1CGTA 4KEVA 1D7KA 4NJIA 1XCFA 2GGHA 1V5XA 1H60A 5IHRA 3W6LA 1EXBA 3WMCA 5EMJA 3ZVIA 3P80A 1W8GA 2CZ5A 2G4JA 1V02E 3HJEA 5I79A 3MJYA 1DP0A 3TYCA 4RR4A 3BCFA 1KM3A 4ES4A 2OLSA 4GXMA 4C91A 3SI9A 3IJ7A 5EYWA 4OE7A 1V3KA 3ERPA 3M4HA 5JIPA 9RUBA 1ZHAA 4AZ5A 5E09A 3B06A 4MJMA 3N4FA 2C7FA 4MUZA 1W3JA 4C6QA 3UJEA 3FSUA 2ASHA 4KESA 4LUTB 3OQEA 3OLEA 3REQB 1YIXA 4RDYA 1GVRA 3FNDA 5I3GA 5E9AA 4LAZA 4H8HA 1UZ4A 2VFGA 4IXHA 4ZVJA 3TIMA 5KITA 1MSSA 3Q58A 3W81A 4JTGA 2CXEA 1AL8A 5JIWA 2D22A 2INZA 4JPGA 5T91A 3SB0A 7REQB 4DI9A 2Q8ZA 2P8BA 4N9EA 1PTAA 2E9MA 4GFSA 1TV4A 2FMNA 3F4VA 3U2EA 1MO0A 1VBJA 3QVQA 4GI8A 5LKYA 4M1BA 4N9BA 3C2VA 1XRSA 5C2GA 2FHCA 4IGSA 4W5UA 4YWIA 1H5VA 5DX7A 3UPMA 3W7RA 1EGMA 2J7EA 1LWHA 1XPYA 1Q6FA 4ZXOA 4LCSA 3IIZA 5TIMA 2ABBA 3WD4A 3S9YA 4EE9A 5G1MA 1TA3A 5AVHA 1W17A 1HNYA 1X6LA 2B7QA 4JX5A 4M0XA 3M43A 5FJTA 4QJ3B 3W1NA 3NDOA 5DCEA 4CD4A 3GYCA 2VEGA 2PF0A 1ZSXA 4I9JA 4WDXA 3TSMA 2ISSA 2RGLA 1EYWA 2XGZA 3AWOA 4TOQA 3IJDA 1Q3NA 2V82A 2BXVA 2NUWA 2HZGA 4W4QA 1BG4A 2BHZA 4BS0A 1ESWA 3NURA 2H9AB 3NVDA 1BF2A 3M0LA 2GWGA 5ABGA 4AZHA 3KX6A 1OM0A 4QCFA 1JCJA 4RDVA 2GVJA 3UNDA 1K3UA 1IE7C 2ZRVA 2PTZA 1LLOA 1NQ6A 1A5CA 2O55A 3RCYA 1KTBA 4HNNA 4AWTA 3UP8A 2HJPA 3BARA 1OD8A 1DWAM 2TAAA 4ZE5A 2J27A 3ANYA 4AEFA 2VNCA 4NZJA 1GG0A 1NWSA 3KOFA 1YLVA 2CPUA 1YPFA 3LMZA 4WF7A 4LUTA 3C5QA 2HBXA 1XJBA 1Q7ZA 5LSMA 1EC8A 3KW3A 3PZNA 1XLEA 1G67A 1SFTA 3CK5A 3T7VA 4XAGA 1B9BA 2QQ6A 4MPQA 3AYTA 4YJ5A 2Y70A 2NX1A 1V6WA 3WDPP 3M0MA 3M16A 1E6ZA 2IUZA 3HGOA 4MLJA 3HFYA 4IQDA 4IPIA 2BXZA 1R2TA 2WSKA 5A94A 3HBLA 3SEPA 3VD9A 1V3LA 1QATA 3LCGA 1HL8A 3ABZA 4ALDA 5BCAA 2NQJA 2HE8A 3AUJA 4HBKA 4H9YA 4X61A 3U7BA 1RQEA 3AIVA 3I3DA 1Q4NX 1JXJA 4LH8A 5RUBA 1MW3A 1V03A 4FXRA 2X7VA 5A6BA 5A5WA 1B3WA 5DBUA 2JF7A 1XUUA 3IK2A 2OTDA 3VOJA 1JQXA 1LP6A 3FAWA 4LY4A 3N6HA 1H50A 2ZQ0A 3LB0A 1R2RA 2X1IA 4GKTA 2XN1A 2W3ZA 3R0DA 3UCCA 1S5VA 1R47A 1BGGA 1S3TC 4NASA 3M64A 4GX8A 5A8NA 3EMQA 2H9AA 5BZAA 3LTPA 4BEUA 1A0CA 1A80A 4O52A 1EL3A 2ALRA 4JIRA 1E0TA 4HKPA 3LGEA 4QX4A 3KCLA 4Q4RA 1KM0A 1EWDA 1XG4A 3GTNA 4YXGA 2WMHA 2RDWA 1UR8A 4DJFC 3AHZA 1ZFJA 5DQPA 4XAFA 2NSOA 3GNNA 4O1DA 1YNQA 3TQPA 4RL3A 2ADAA 3NTYA 4ZENA 4DWDA 1WNOA 4I8DA 1JQVA 1ZCOA 2NVDA 2BGNE 5CQ1A 1R6WA 2NV1A 4GH3A 3ZT5A 3A21A 5LHEA 2GQ8A 4NVTA 2XIBA 2ZC1A 5M03A 1WXJA 3APTA 3N3MA 3RPDA 3ZR6A 3A9IA 1I8JA 3FKRA 3CTTA 4K8EA 1K9DA 1TTIA 7TIMA 3QW4B 2XZ7A 3N04A 2OEMA 3AMLA 1VCGA 3BW4A 4PMJA 1RALA 3L0NA 1ZJBA 3ARSA 1A4LA 3FHAA 3PZGA 4GQGA 4HPNA 4LEFA 4KIRA 4C6BA 3SFKA 1LL7A 3WD0A 4W8LA 5D38A 4DUOA 4EX4A 1OWQA 3WH9A 3CV7A 4B5WA 3WD3A 2TRSA 3SSZA 4KH2A 3TYDA 1OQFA 7ENLA 3WDRA 2B4GA 3VIJA 3ZJ7A 3K4WA 5HWJA 3O16A 2GGGA 4RZ6A 5BYWA 1CNVA 1UMYA 3W7IA 5ABHA 2YL8A 5A3HA 1JPHA 2E28A 1IIHA 1DTUA 8XIMA 2QCCA 2XYLA 3D3FA 4DF1A 3B0UX 3RM4A 1Q65A 4R88A 1UR0A 2OPJA 1WAWA 1WUEA 1NH6A 2WQDA 3BJSA 4B16A 4PMOA 5T9BG 2CFFA 5BU9A 1F3XA 4RZ5A 4UQCA 3GG1A 3CHVA 2UBPC 3RPTA 1UKOA 3E0FA 3MSYA 1SO4A 3GX9A 1K7EA 3IANA 4ZXLA 2BY3A 2OOGA 2DT1A 1U2YA 5G1YA 3GRIA 3OLGA 4XKYB 1A5AA 2VFFA 5AC5A 4IH3A 4EPEC 1I1WA 4F8XA 4ZSUA 4JX6A 5CZTA 1MNSA 4HSOA 3WQ8A 2QKFA 1VZWA 5ABTA 1AQMA 3EMCA 2V8ZA 5EL1A 4JTSA 2VOMA 1BLIA 2CXGA 2UY5A 5GNXA 3FX4A 3IAPA 2VC7A 3WDHA 1HJWA 3OQ8A 2CBVA 1KCZA 3USZA 3VTRA 1GGOA 3P62A 2J7GA 4UTWC 3VIKA 1W5PA 3K46A 3NQCA 1L9WA 3SCWA 1ZNNA 2Q8XA 4JQ3A 2CITA 2Y88A 3NZ1A 1W91A 1A5KC 3VGGA 4L6DA 2VOTA 2PRLA 3AIEA 4S3EA 3W7MA 3GHSA 5FD0A 2I1OA 3FAXA 5KINA 3W2KA 2DT2A 5HOSA 1KBJA 3L7RA 1XC4A 1ZJIA 3WNOA 1RP8A 4DZIA 2OZ0A 1PKYA 4MDPA 2YDQA 2OWWA 2W62A 3CWOX 3IJIA 1E51A 3SUSA 4PCSA 3IEBA 2G5WA 1QVBA 4NAFB 5C9ZA 3BL3A 1XCWA 4H6RA 4MWAC 4WOQA 4DY1A 5AYBA 2W79A 3VNLA 3DZ1A 1FX6A 1TV2A 1XWYA 4D1JA 3S9IA 4UXDA 4UMAA 2ZA3A 3KP0A 1JVNA 1A3XA 1RP9A 1XKYA 2WVSA 3M0IA 1IGSA 3I7SA 4WKFA 2DDXA 3LHUA 1P0EA 4MKSA 2E8ZA 4C6IA 4MAZA 4YTSA 3OPSA 3RGTA 5I06A 3CV6A 3GO2A 1W9DM 2I5IA 2Q01A 4S2BA 4F0LA 3OVQA 3VMPA 2J8TA 1KWKA 3OO2A 3W1UA 1XYMA 2OSXA 4YN5A 3CV2A 1QPRA 3ARVA 1W9UA 1I45A 2HCVA 5F2GA 3QSTA 4LV4A 1Q6EA 1XFCA 2ZRYA 2CHNA 3NEVA 3H2MA 4K3ZA 1GOKA 3ZZ1A 1MRAA 1R2SA 3QHMA 4UQBA 4FK9A 3RLVA 1LCOA 1ZBWA 1DV7A 3TMQA 1ZP4A 5GNYA 2OMAA 3EDDA 4R7WA 2WCSA 3VM5A 1QPNA 1ADSA 4Y9OA 2A3BA 1JRCA 4QNWA 2RH9A 4LYPA 3UJSA 1T5AA 5HXMA 4ZB5A 4KWOA 3GBDA 3BWWA 2XM2A 4RW5A 3WFLA 4H7CA 1R3QA 4DXKA 2EHHA 2P76A 2YDRA 3VI2A 2BXYA 3WF4A 2VXNA 3BC9A 4O12A 4TU1A 3B0PA 4B2DA 1SGJA 5AHNA 2JFEX 1GWJA 1SQ7A 3APYA 2X1SA 2A5HA 4U33A 2OYKA 4DBDA 3C0QA 2PI6A 3BSGA 3LNPA 1GOQA 1O60A 2XFWA 1KFJA 4XSMA 3U4AA 3KWXA 3L4TA 1UZDA 1QO5A 2FYMA 1J2WA 1J0IA 3TYEA 3FY1A 4CCEA 3IIPA 2CLEA 2YCEA 2G3MA 1YMYA 2WPGA 1PSCA 4BQ5A 1F7BA 1PHWA 2X0YA 2J7BA 1GONA 4LUSB 1UKQA 5A1AA 1RAKA 2NWRA 2YXOA 1E1CA 4L65A 4US6A 1T7LA 3BZGA 5KETA 4MNLA 4P7NA 4JGDA 1UH4A 3PUOA 4OBSA 5D09A 3NZRA 2EF9A 4NAFA 3VIHA 1ODZA 4EXBA 5M3WA 5TD4A 1RA5A 1TG7A 2FDSA 1JG9A 4OU1A 3TR9A 1GCYA 5F2LA 1DJHA 3QTGA 1I2RA 3GNOA 2OQYA 2QUUA 3TAKA 4AZCA 3MV01 3N2BA 1HQTA 3ZIZA 4XBSA 4JFSA 4JOMA 3CL8A 3AAMA 1V4YA 1TR9A 2EG7A 5F4XA 5I6SA 3JUGA 4PEKA 4HSHA 1XIBA 4IMAA 1L6YA 1SZRA 1Q6DA 6PTDA 3THUA 3QLDA 4CQAA 5D8WA 5FL1A 3S0CA 1ZBKA 1MVYA 1GVQA 3TOYA 4U4MA 2OQLA 1QNSA 4MFEA 3PBMA 4CN1A 2VQUA 5HANA 3OBAA 1QO2A 2Z28A 1TV8A 1H51A 3T08A 4ERAA