1CXFA

Complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 227
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxfA01
3CCHB 4JVUA 5D2LA 3WEOA 1NFDB 1JGVH 5IMKB 2G75B 5D7LE 1CL7L 5ISZD 3EFDL 3QUMB 4OI9A 4UQ2B 1AQKH 2ESVB 1MFUA 4OFYD 4EE9A 3FFCD 3WHE1 3W4RA 5L0QB 1MCCA 1CGWA 1X5FA 2ZCKH 3LMYA 3N9KA 3WEMA 1U8LA 2AK4A 1DQMH 2NXZC 4RFOH 2B1AL 5HHOE 4DZ8A 4CCDA 4ZS7H 4OTXH 4TXEA 2R4RH 1DBBL 3PDDA 2PB1A 5A2CA 4LPVA 1LL6A 1W9BM 3SE4A 2WMFA 3CFJB 4OUOA 3C5ZA 4NQEA 2V2WA 3MV9E 4FG6C 2HT4C 1QI2A 3WKML 4CMHC 1T7ZA 2VDML 3MGTB 3WFCL 2J6EL 5BRZE 1IMHC 3GJFA 5C09B 1OT1A 2P5EB 3KYMA 5D6DA 1RJLA 1GGCL 4ZPVA 1S7TA 1S9VA 3NIDF 3PGDB 3U4EB 1KIPA 5IGXH 4HZ7A 1A3RH 3AUVA 3WS6A 5IG7B 1OP3H 2FL5B 5M95B 2C3VA 1XT5A 3WUWB 4ZAKD 4R0LC 3GXMA 1LK3L 4JO1L 4JRYB 1TVBA 2VISA 3DX9B 4GI6A 4UFMA 3CFBA 1EK3A 1I8IA 5CEZE 4KHTL 1C08A 3WEXB 1FSKB 3P0GB 1JL8A 4PEEA 3RY5A 3MXVH 3HMWH 4M5ZH 5GJTL 3QJHB 1B0RB 2XZAL 5ANMA 5J1AB 1QSEA 1W2KT 4KPHH 1XC6A 1TNNA 3LKNA 4PJHB 4PRPD 1E5JA 3OGVA 3LOWA 3VXQB 4MMZC 1C12A 3QP3A 4GJTB 1CXEA 5C8JA 4MXQD 4UT9L 1PYWA 2I60L 3O8XB 3GKWL 1XCTB 5E2WL 1ONQA 1ZTXL 3NA9L 4XBGA 3F4VA 3WDJA 4YIQA 2DIEA 1NBYA 4NSKB 3Q5TA 2CSPA 5JIHA 1KB9K 5E4EB 3PWPB 4MXWH 4X9IA 1DANU 1KGCE 5EU6B 3SE3A 3KPOB 2GIYA 1I7ZA 1OARL 2DH3A 2A77L 4R7DB 5E2TL 2I24N 2FIKB 1JTOA 3C6LB 5CLTA 4UU9B 1U3HC 2CRMA 2WSPA 1OGAE 7FABL 3EFFA 4JO4L 2JIXA 1HHHB 1FVDA 4UFHA 2XZCH 1TCRA 3JV4B 4LVOC 4QRQA 1X6NA 3U2SA 5GGUA 1U2YA 1F3RB 3KYKH 1BZ7A 4HIHB 4GKLA 3DXAE 4C4KT 3BVVA 4KHXL 4Z95L 3KZSA 1D5BA 2ARJB 1GOHA 2XZQL 2DBJA 5GGTA 4QTIL 5D1QC 2EDKA 1A6AB 3FOMA 3DRTB 1MCJA 2VI0A 1W2VA 3QXUA 4PLJC 4R4FH 4C54A 3E6FA 2P24B 1NCWL 3VXPA 2FYYA 3HLAB 3P3YA 1W0YT 3MRFB 1F90H 2CK2A 2H2SC 5C0BA 3MUGB 3MOBL 4X4MA 5SWSE 2EZ0C 4JQXA 1ZJAA 2PW1B 4RE2A 4PJHF 2VERN 3I6KB 2GQHA 3TT3H 1L4IA 1A7QL 3HPJA 4NSBA 4NN6C 5SWQB 4J2XA 3OBAA 5IB1A 2NY0C 4E42B 2A3CA 1FNSH 4O02L 2DT1A 2ZZUT 3CDYA 3ZR6A 2BC4B 4RQQA 3LB6D 4I3RL 2CLRB 3FQUB 1FO0B 1AXSB 3S97C 35C8L 4S1DD 4BQ9A 4NWUH 2R2HA 3SKOB 1MHCA 4Z7QE 4Z76B 1IGFH 1DCLA 3RGVB 3VWKD 1QRNB 3HZKB 4BA8A 1NOWA 4NUJA 4QRPE 4MDOA 5D7LB 4WI3A 5EZIH 5SV3A 3ZHLA 1A5FH 3A5VA 1IL1B 3QHTC 1BD2A 3D18B 5I1LA 4PJDA 1P7QD 4JGUA 4PTTB 4HWNA 3LKNB 4PJHA 1IZKA 5EC1B 3QHFL 4NC0B 2B0SL 4TTUA 1WC7A 4WNQB 3SO3B 2GFBB 1XF2A 3EBVA 3N1QC 2JF7A 5I78A 4FQHA 1G0DA 5ITBL 3HR5A 4ZQKB 5EBLB 2PO6D 5HDQH 2Y24A 4QHUA 4OGZA 1I1AA 4UB0L 1RZ7H 1G9ML 3BZDA 1U8KA 1RP8A 4P2OD 3KL3A 1MHHA 2H41A 4AEIL 2FDMA 5HGDA 1X44A 3PIQA 3QJFA 3WF0A 5IR1B 1RZGA 2ZUYA 3VRJB 5ILTH 5I8EB 4LRIC 3OKNB 2EH8H 4BZ1L 4PJ9C 4LASH 2CNCA 3LIZL 4ALAH 1WWCA 4NRXA 3HR6A 4PCSA 3AHZA 1MFCH 3SDCC 2YKLH 1KTCA 3ZKND 2D7PA 5ESAB 4AZ6A 1Y18B 4Q22A 4UUJA 1G5AA 4Y1AA 1G7LA 1V02A 4Q6IB 4BZ2L 3PZIA 1M05A 4LSSL 4HXBH 1IAIH 2Y6SD 3PWUA 3D52A 1F4WH 2AJSL 4NCC1 1QI3A 5I79A 1CGTA 1VENA 5GNZA 1MCPL 2AABH 3D87B 4XX1E 1HXMB 1K4CA 1OCQA 3VUPA 4F79A 3MLSL 4KKLC 3MV7E 3LRGA 1GPOH 4JFYB 3VXPB 1UQYA 1UM6H 2L0DA 3E3QE 3SO3C 1PQZA 1VKXA 1WGOA 3FKUS 3NCMA 5GRJH 3ZKXB 4V28A 3OJ2C 3K1KC 1T20A 5GSVB 2WNGA 4IRJB 3IDNA 3VJ6A 3EJTA 3VFNB 5AZEL 5SX4H 2VLKD 3U82B 1ZT4B 1U8KB 4GRWF 2A6KB 2IALB 3QIUC 4Z7QF 3TWCL 4H41A 3TH3T 3BH9A 3OKKA 4QNPF 3QJFB 4ZEPA 2VLLA 5IWLC 2D1ZA 4WW1B 3KGRA 1SM3L 1GOQA 3BP6B 4AZIA 25C8H 1V3HA 3ULVC 1IAIM 5A6KA 3UAJD 3JV4A 5EO0B 3VM7A 4F7CA 3GNMH 5T5FH 2DMCA 4ZMAT 5DS8B 4HUUB 1I1YA 5IKCB 1BAFL 3DETC 3TYGL 4KMLB 4CGTA 3PWNA 1NKOA 5CGTA 1EEYB 2VXVL 2E9JA 4MXQC 3C60C 1GGBL 5K9QG 4Q6IC 3NOIA 2MKWA 5ELIA 1YNTA 1CDJA 5J1SC 5TE7L 4PJAB 3MREA 3W39B 4CU6A 4KRMB 4XMPH 3WL1A 4DOHB 1D6EA 4NF7A 4RZCA 4FFZH 4Y1AB 2EYRA 4PS4H 3DMMD 2VN7A 1JZ7A 5I2IA 3EOYG 4F15B 4LNVA 1XSJA 5KZ6A 1LO2L 2FIRT 3OB0K 4S1SL 4GBXC 5F9DC 3RHWF 3IGAB 1NCDL 4P48A 1MHCB 3G6JF 4OLYL 5EU3A 1W0VA 2VT0A 3BUQA 3DROA 4QF1A 1J9YA 5C0EB 1XGQA 4LLQA 1R3JB 1LP9B 1NJ9B 1A3HA 1KC5L 1U58A 3HAEH 4GH7B 1P6AB 4OLWL 4U1KB 4X4YA 2PR4L 4KHXH 3MROB 3PIQB 4U7KA 1TLKA 1MI5D 4K55A 1MQPA 3FQRB 2X7LB 3U9PL 4Q7DA 4NQCA 3S34L 5DFVC 4QXGH 1C3FA 1N59B 5CPQA 1A9EA 2AJXH 2QQQA 3BYYA 1J87A 1TQBC 5LBSL 1WAAA 2IANA 5JORB 1SJVA 2E9MA 1KG0A 1LQSR 2CJUH 2A77H 1LE5A 5DUPL 5F89A 3D85D 4P23A 4GI9A 2XY2A 3D3VD 1B2WH 4POUB 3D25A 4LYPA 4GMTL 2V2TB 1M53A 1GHRA 2V7HA 3IJSA 1MFAL 5A8QA 3RWEA 3U0WL 4C83A 4XV0A 3U5UA 3CFEB 4UOZA 1YYML 3DUSB 2WUCL 4PJHE 3UPRB 3KXFB 4TQEL 3ARRA 1Q1JL 3CGTA 3SOBL 4DKAA 3S3SA 3LQZA 5TDPA 3F5WA 5HGHB 4S3KA 1YJDH 2J88H 1S7RA 3D50A 1E4WL 1P2CB 3BI9X 4KTEH 3VM5A 1R47A 1KLGA 1ZHKB 1CDCA 3NFNA 3ET9F 3SGDH 3ZKMD 5I6XB 1IC4L 2V5MA 2ADIA 4NM8H 4ZOBA 3ALFA 1UB6A 2H2PC 3H53A 3DC0A 1R5IB 3KYNA 1XF1A 5I74B 5D2NE 1AR2A 1Z3GH 1GQKA 1C16B 4L4OA 2DTML 5GGTL 4DAGL 3BP4B 1EHLL 5FYKE 1QLEH 1BSIA 3CHDA 3HMCA 1P84K 4IRZL 3ECBB 3OB8A 5HD8C 2X7LA 2FX9L 3WN6A 3OF6D 4N1EA 1JN6A 4AD4A 1I1WA 4FQLL 3CUPA 1SBBA 4OM0L 5FKAA 1CI5A 5IJVA 5MEND 1UACH 3MNWA 1IEHA 1CXIA 1I8IB 3DMMA 2ICES 4X6CE 2D7TL 4OLVL 1IQWH 2O61A 1T1XA 3IK2A 3PABB 4K71B 5J7CC 2EEAA 2C3VB 1V6VA 5ICXB 5D7IB 3BDYL 2V2XB 5B38A 4OCSL 3WELA 3HC0A 4MTVA 3CJJA 5EBMA 3PBGA 1DWGM 2FX7L 5TQ0L 4MVBD 3STZA 4E41A 1E4XL 4OT1L 5D71H 3VXOA 2VDMH 1AC0A 5CSGA 1N26A 5FD0A 3ZTNH 1RU9H 2BVYA 4WIQA 3OPZL 2JEPA 2ZWZA 4S0TD 3QRGL 1MRCL 4HPOL 2DQUH 2J2ZA 4Z9KB 4M7LL 2K7QA 3ARDC 4FQJH 1I1FA 1A1MA 2GTZA 2YL9A 1WBXA 3QDJA 3HZ3A 5GRZA 1N6QH 1X5AA 4LOUC 4PJGE 5HPMB 3V4PL 1XV8A 1R5IA 3FO1B 3RTQC 1IGML 4OCSH 2YA1A 4PMNA 3DROB 4AT6B 4MWFB 2DBLL 2R2EA 3C8KA 5CLWA 3QFJE 4KXZI 3PP3K 3QIUD 1YPZE 3SJVA 5F7DB 2BY0A 1KYOJ 2DQXA 3MLZL 4FQQB 5TQ2L 2E9WA 5JIPA 4K7FA 2WB5A 4HKZB 4OJFH 5F7EH 2JF1A 3G6JA 5IB3A 3OZ9H 1N6VA 1VADA 3DIFA 4XPTH 3HLAA 2EKSB 3RJQB 1PZ3A 1A7OL 2K3TA 2WC3A 1EHLH 2YRPA 5E24E 1HH9B 3AB0C 5H35A 1IGYB 5MEQA 4M00A 5I73B 3RGVD 3QDAA 4NYLB 1QVBA 5CCKH 3V8CA 4D6JA 1IC7H 3DUSA 3P9MA 5C0CE 3F7YB 3O6LL 2YS4A 3A0OA 2ZXAA 4HKJA 4M4PA 3ARFC 3PE9A 1KN2L 5F1NB 1K85A 5A8PA 2X2JA 2UUDK 4P9HL 3QCTL 2WIMA 1XGZA 4LDLB 2IBZY 1JPST 2V7HB 1KPVA 1ZJBA 1TJGL 3ZE2E 1R0AH 3MNZB 4WTXA 1ADQA 3L3KA 5JZ7C 1KXTB 1CFSA 4R26H 4HJ0D 3TIEB 1JFHA 1BVNP 4DN3H 4I77L 4JY5H 4NHCH 4AT6A 1AR1C 1ZA3B 4PTWA 4ZUSB 1X5ZA 2R39A 1V6WA 2AJZA 4Q0XL 4HOZA 1D7FA 1B88A 1LO5B 2LQRA 4P5KB 1XGUB 5F7NC 1JTTA 1DEEA 3NZ8A 1YPZA 5T3ZL 2VRKA 2VCBA 2XGIA 1SYSA 5I66B 3GRWH 1PDKA 5LBSH 4R0LA 5DD1H 4URIA 4RGNE 3VXOB 5ID0B 2BVPB 1PBYA 1DSFH 3QNXA 4IRSA 1XFPA 1SYTA 4TSAL 1HQ4A 1UJ3B 3BPCA 5DJ0A 4F37K 5DEZA 3IDMB 2AKRA 1V3KA 3QUYA 4NKOA 1BJ1J 2JELL 5KS9E 2PR4H 2HFFB 3ZYJA 5A8OA 1S7WB 2PTTB 5EO0A 5F1NA 4KKLD 1EVUA 3FFDB 4S0SD 2Q6WB 4LSDA 1JVKA 2G8ZA 4LU5H 2VKWA 3LEXB 4H1LB 4JZOB 4WI4A 5DC9B 3WD3A 3RVWC 2R8SH 5KSAD 4HF5H 4OF0A 4OOZA 3UJIL 1HKKA 1RVFH 1F6FB 4X9FA 5AC5A 3QDJD 5FF6B 4F7PB 5BS0A 4PB9L 2YDSA 3BUYB 3SUUA 1HHKB 5CILH 2E6JA 4Y16D 1BIIB 2VDNL 3NZ8B 2GJZB 4Z7VF 3BPLB 4AIOA 3L1OH 4X6BB 4P5TA 3K7UA 1QBMH 4IOSD 3WNPA 4I8DA 1XCWA 4RMQA 1MQRA 1B4JH 5AC4A 2G5BB 3X12B 1ZVSB 4X99B 2I5YH 1FGVH 1SHMA 3FT4A 4I0CC 3N50A 4I1NB 4NN6B 2FHBA 1RUAL 5EO9A 4OZHF 2OX5A 4OZFG 4YHPB 1TQCC 5EPMA 4M8QA 3RJYA 3WJLA 3TESA 2DJSA 2EDEA 2D03H 3SEPA 4PJ5B 2DT0A 5DRZA 3PZQA 3RWCB 1ZL1A 1GGBH 2P5ED 1JCKA 4AEHL 3CV5A 2GY5A 5A16B 4PB0L 1FFNB 2FLRT 3SDAB 1NGXA 5EC2A 3QULB 1E4XH 1NC4B 3NIDE 3ULUE 1F58H 3UETA 3RZCC 3H9HB 1RZKL 4YIQB 5GIRB 4HC1A 1DWJM 1EJOH 2H6PB 3GRWA 1JHKH 2APWA 1DLFH 3E8UL 3FO0L 4JB9L 4BUHA 4A6YL 5C3LD 1NWTA 3GBLA 4KWUA 3ARBB 2F5AL 4HWZB 4M7KL 4G3YH 3MI6A 3DJ9A 5KN5A 3AREC 4EQ2A 2HA1A 1DUYA 5F7YC 2PWFA 1D5ZB 1W3LA 5BRPA 4OI7A 4OD1H 1UACL 2OCFD 3MA9H 4J27A 5A2KH 4LOUD 5KOMC 3MCLH 1HXYB 4JVPA 2GSGB 3KS0J 4O9HL 4TNWK 3KPSE 1C5DB 1UM6L 4P8XA 4OAWA 1QOKA 2JIXB 5A6SA 5FO7B 3LPOA 5D4YA 4Z8FH 2EPOA 3OLEA 4GOSA 1TZIA 1GGTA 2CDFB 1FYTD 4LAJH 4NGHH 4BQ4A 5FUZH 3JWNC 2PN5A 5BRZD 4JREB 2CR6A 2EPMX 1B9ZA 3IRPX 3KHOA 4XPHH 4ZSOB 1CFNA 3GJFB 3O6ML 4PRAA 4LRNL 1ZT7B 2X4QA 2FGLA 3M6DA 1MCRA 1G7MB 4HBCH 4Z7VE 1ZHNA 4JY6B 2YPLD 5E6YA 3WN5B 5DJ8A 3QQ3A 5ID0A 5CIPH 1EFXB 1BZQK 2VLRD 5FKPA 1CDIA 2MMXA 2OWXA 1CIUA 5C0JA 1V03A 1T89C 1UWQA 1WDQA 2XSBA 3CH1A 5I16A 3KXFA 4HK0A 1QVOA 4M03A 3W24A 1H5VA 3C2AL 2F54D 3VFMA 4MPKA 2V2TA 5KSAA 2Z92A 3NH7H 2XXCB 4PRIE 5AG8A 4PRID 3QIUB 4EDWH 4LXFA 1PG7W 3EYSH 4XP6L 3WFBL 4BQ3A 2P8LB 2VR9A 4OZIF 1INQB 1KJ2A 4NC1C 4E0RA 4HQQL 5EA0H 3WJJC 4FQ2H 1NFDF 3OAUL 4WWKB 1E0WA 2OQJA 1NCAH 1XRVA 4LEOA 1HHKA 1MIEH 1FC1A 2P5WE 1TE1A 3GZKA 3BCDA 3QR2A 4WY7L 1BQCA 1JPTH 5I1HH 1UKSA 3MOAL 3V95A 1A7BA 3O6MH 2I9LB 3UTSD 3HG1D 5D9SB 3DVFA 1TQTA 1F6AB 3WN5C 3D48R 5DRNA 4WCYL 1IARB 2VDRH 4NSKA 5ID1A 4NQCB 12E8H 4IDLA 2Z31D 8FABA 1A4KB 2CIIB 3FFCB 2ZSWB 1VJZA 2FO4B 1U58B 2ZKHL 2GK0B 3LN5B 1AD9B 4IDJL 4MNQB 5AYBA 1KIRB 2O5ZL 4MD5A 3GBML 4Y5XB 3MKKA 3CLFL 4FQQA 4L1HA 1OIMA 5GHWL 1QVOB 3UTTA 3BPOC 2HVJB 5HGGS 4GKSB 5BW7C 3QH3A 4C4KO 5DO2C 5IHUL 4ZAKC 2ZKHH 4PP1C 3RVUC 1HEZA 2FJHA 1KELL 4JPKL 3VRJA 3A6CL 3MLUL 4L4TB 1MXDA 1ES0A 3TV3H 2B31A 1FYTA 4JFOB 5DT7A 1S78D 3SCMC 4U5KA 4OGAC 5T5FL 2YUWA 2CUMA 3AMLA 3STLA 3X14B 3WE6A 2EDJA 5D2LF 3CIQA 5GGVH 3EW3B 2Q1EA 1IILE 4L4VD 1VBUA 5KVMC 5DJCA 2EDHA 4WI8A 2A6IA 5AYUH 1H3TA 1SBSL 4Z95H 1DUYB 2NW2A 2Z1SA 1HIML 3OG6B 4YXKL 4YDJB 2E6QA 4HZAA 2IC2A 2YEZA 5EG6C 2D31A 3VXSA 4JN1H 1S9WA 4WWKA 1B90A 3P4OB 5F7FA 1UA6H 4C7GA 2H6PA 1CQYA 1R5WA 2OTPA 2WWKO 4X6DE 2XA8L 5MENE 3ULUD 1UKOA 1DBJL 4OSUH 4XVUC 4OZHB 3CFJA 1QRNA 3HZKA 1OARH 2FNBA 2ERJC 3BGAA 2EIBA 4Z7NF 3WY4A 4PN2A 5DRXA 3RIKA 1NARA 2J7HA 2WAHA 3EJPA 1BZ9B 2YLAA 1GL4B 5LCVL 1CXFA 1E0OB 4U6HB 1CZ8L 4PJ9D 1KXQE 3QH3B 1AQHA 4D6IA 1F4WL 4NXSA 2OSLB 4H8WH 1KULA 1YMHB 1G6RL 1D9KA 3MFFB 5IT2H 3H54A 1QNPA 4YXHL 3DMMB 5DZLA 2DYPD 1KIRA 4Y4FD 4Y5XA 5SV4A 3K4AA 1Z0NA 4JFHD 4WDIA 1ZS2A 1AO7D 4ONHA 1BPVA 3WUGA 1YEFL 1VGKA 3HE6C 5FOBA 1G9HA 3GJEA 5E00B 3U0PA 4B3KA 5D1ZC 5FGCE 2XWBA 1HWWA 3ARXA 4IM4A 3LRSB 2BVQA 1DWIM 2OP4H 5C0GA 5ISZA 2Z35A 3NACL 4D6HA 3QFJD 3M17A 4NNXA 1IT0A 1OAQH 3TTSA 2FGWH 1I9IH 4OFYA 3BMVA 3PGCA 3SKMB 4ZFGH 4L9DA 5DZNA 4J3UA 2G41A 5D4QA 5I1CL 2J8FA 4UB0H 3VWKA 4XVSL 2EDFA 5AUMA 1ZU8A 1EXPA 1OWWA 4BF7A 5HGDB 4JY4A 4AYFA 4DOHE 1AQKL 1FG9C 4LVHB 2WVVA 1FHLA 1BLNA 4BFEA 3QZWB 4KRNA 1VESA 3UTTD 3QEQB 1NFKA 5T3ZE 1G9MC 3EZJB 1VIWA 2A9NH 2Z91A 2FH6A 2XPGA 3SKJH 3HE7A 2A0LD 3D85B 1X7QA 3UTSA 2P4AB 5KSBB 5JO5A 1W3HA 1A6ZA 3QPQC 4FZEH 4ZS7L 5GRVK 4AIZA 1AP2A 1K3IA 1LDPL 1KIQB 3VWJC 1J0KA 3QNZA 3HB3D 3RVXD 1AGEA 4XXCC 3X11A 5IESL 3REWB 4JFEE 4QRUA 3OKLB 1MH5A 1KN4H 1Q9OA 1NDMB 1K9FA 5FM5M 4KY1L 2IANB 5JORA 4LLUA 3VG9B 2QQKL 3O3BA 4MDIA 2LU3A 4GXUN 5I8KH 1D5MA 2XIDA 1JBJA 5AAMA 4PJIE 5J6HA 2PTTA 3I50H 1H3UA 3DLQR 1KN2H 5AG9A 5I1KH 2ZJSH 4MNKA 4JFED 1GZPA 1K6QH 1YY8B 1FFRA 4J4PA 4ZYKB 3G6MA 2G75A 1GAFL 1PZUB 4S1RH 3VFVB 5CJ5A 4TSBL 1T0NB 4WEUD 3QNXB 2WWCA 1OAXH 3FB8B 2V6HA 1AE6L 2VIRA 3P11H 2F8QA 5KTEH 1QA9A 5JHLL 4HJJL 2WHMA 5GS0H 2YSSB 4PD4K 4WUUE 3OIHA 3DDFA 5BXPA 5B3NA 4EOWL 5EOCH 1ADQH 2BVOB 2JCCA 5J9PB 3S4SG 3VWJB 1FP8A 2QADB 4TULL 1I1CA 1YNTB 4DKFH 2HT2C 4FABH 2DD8H 3QO1B 1PZ2A 1E72M 3MRRA 3RMEA 4HF5L 1QWUA 3LXBA 3O4OB 1E0XA 2OI9C 3P30L 1VRXA 1MIMH 3V5KA 4MJ5B 2MHAB 3HTLX 3DWTA 4JFXA 2WBJD 3MMDA 1X5YA 2UYLB 2A3AA 2Z93A 4IISA 3EFFB 4M6OH 4K8RC 4LPCA 2CMRL 1DQJA 3PXJA 3BEVA 5GRXG 3SCMA 5E2UH 3WDHA 2VAJA 2DYPA 5EU7E 3WHXB 3G5VA 2WBWB 3D51A 3I3DA 3OGCA 4MJ6B 4JAWA 3F8UB 1HZHH 2GK2A 1EZVY 5E8DL 3S35X 4HKXB 4OZHE 4HS8H 1MCQA 2DDQH 3TN0B 1MW1A 2X9XA 4LVNC 2B39A 4JFDE 3U7AA 4NO3B 5F70A 3U6RB 2JE8A 3KYAA 1ZHLA 1AY1L 4KMTH 1QA9B 2DSWA 4MJIA 3EJSA 3W2DH 2OR8A 4LLAA 1RAMA 3VXQA 3LXCA 1R3LA 3RBGA 1A6UL 1E5NA 3BVUA 1JK8A 4XZBA 1BMGA 1W2PA 1KN4L 1TMCB 1U8IB 1BBJB 1MXGA 2VABA 3AMKA 4PJ9B 3RWIB 3RRQA 5FHBL 4MA8L 5ABFA 2R1XB 1K5NA 1XMWA 4S2SA 2UVEA 4FZEL 5BOZG 4YHIA 1P4LB 4P3DB 1GJUA 1VGEH 5JMOC 4NQXA 4X7TB 1IV8A 1US3A 1MCOH 1T89A 3UPRA 2CRIA 5HOSA 1O0VA 1DQJB 1RUKH 1A7RL 1MREH 1UVQA 1W9PA 2NYYC 3SBWA 3FAXA 5LG1A 2EKJA 4FTVA 1D2KA 3V5KB 3MZTA 1FZKB 3WKMH 1KPRB 4HFUL 3BT2H 3UERA 5IXEA 5T1LB 1E6RA 4HIEB 5CCKL 1CT8A 1RZFH 4PJFB 3RM4A 2VDLH 3V4VH 4YXHH 1NKRA 4GFTB 4YBQD 4LSVL 5EORH 5FKAB 5HHMB 4R3SA 3RKDC 1TNMA 2NNAA 4QLJA 5IOPB 2EKSA 4I3GA 2JF6A 5ICYB 3DVGA 2WCGA 4IS6A 3NZHL 3PQYD 1EH9A 1G1CA 4KVNL 5ADPL 3IYLW 3VD5A 4MQTB 5IHBA 1LEKB 3G9VA 3L5WB 2R56H 4KMTL 2MQCA 3VFTA 4ZFZA 3VSTA 2CIKA 1BVLA 2R1XA 1PLGL 4O00A 4S2SB 5C09D 1S5HA 1YEHL 1UADC 5E94A 2OR9H 3AROA 1L9MA 5D96B 1NSNL 3V0WH 3S36X 1G6RH 3UTSE 3IXTB 3U0WH 2AEPH 3BSZL 1U6AL 4QXUL 4PMYA 3MO1B 3WD0A 4Z7WE 1NCCL 2P5WD 5I0DA 1B2WL 2CLRA 3FQUA 3HPLA 3D9AH 3QIWB 4LRIA 3DHUA 4C7FA 3K81A 4DUXA 2CIPA 3IJHA 1F42A 1FE8L 3BXNA 1A1OB 4L3EE 5ACZA 3U9UA 1UWUA 4YJZL 5SWZD 2F61A 3PGDA 3CZ8A 2FECL 1R8LA 2JALA 4M1RA 4GQPH 4UT7L 3FN9A 2R1YA 5HHOB 3RNQB 1YYLH 1JNEA 2CKBA 2XFRA 3IFPB 1FA2A 4LSTH 4FNRA 4NM4H 5HJ3B 5HDRA 3UG5A 3RVUD 4ZXBC 4XPAL 4YFDB 1R6VA 3QO0B 1QRND 4BK4A 3ZE0E 1UB5A 1WDSA 3MLXH 3BHBB 1CE6A 4DTGH 4X9GA 5DHVA 4V1DD 3A4WA 1S78C 3SCMD 4APQC 3MJ9H 3VI4F 4MJ2A 3NCYS 3RVTC 2BNRA 4F8TA 1J01A 2R1WA 1JRHL 3TN0D 3R06A 4I13B 5I71B 5GGQL 1RJCA 1ZMYA 2J5LC 5LWYL 4L9LB 1KFAL 3VXUE 5F96H 2VLLB 5SX4I 2CXKA 3CU7A 2VWEE 4PTUB 3WSUA 3BSGA 2GUOB 2WSKA 3AM8C 2FGZA 1CK0H 3N1PC 4E41D 1QSFB 5IROC 2ZXDA 3FOLB 4N8PA 1OWRM 2R29L 3II1A 2WINB 4Z2JA 2DQFA 3QIWC 1OINA 3OAUH 1D6VH 5HY9B 1UXSB 1FAIH 2XTJC 4N42A 1I7TB 3H9ZA 1OGAB 1A6TA 3QI9C 2GSJA 5I8KL 1DE4B 1AGBB 3RA7L 4L4TA 5KANI 2H45A 2X89D 1EGJA 1RUMH 2P8LA 2AEQL 1GJWA 4Q6IA 4JDTL 2VCAA 3FT2B 4Q2ZB 5CINH 1F3DJ 1V3MA 4YDLB 2A6DA 3QNYB 5D7IE 4PUBL 3VD7A 3O41B 1CE1H 3FMGL 5I8OL 25C8L 3L7FA 2MCPL 1SM3H 5DVMA 3GXNA 1R3JA 4RGND 5BYWA 4XHJC 1O7DC 3PQYA 1UZ4A 2C7UB 4WUUA 4U1NB 2RB8A 2E27H 1A0QL 3TO4A 5C86A 5EO1B 3P9WB 3MGOB 2ICWA 2AQ3A 3HZMA 1L7TH 4PJFF 1LEKA 1FZOB 3TTQA 3U4AA 2IH3A 5CJQL 1FNGA 5HI4C 3MRJB 5HYJB 4JM4L 4FXKA 4E41E 4IHOB 1AGEB 2Z8RA 3ARPA 4PGBB 5F89B 2C3XA 4P23B 3WUWA 4P2RE 1KCVL 2PYEB 4KJQD 4ODHL 4M93C 5BQ7B 2RR3A 3OQ3B 3GXIA 5BV7H 3MRBA 3OL2A 4YX2L 2UWEE 2OYKA 3BRGC 2AJXL 3OJMB 2IBGA 4NP4L 3VI4E 5BZDA 4QCIA 4IBLT 3LPFA 4BZ1H 4P7LA 4KJPD 3MA9L 5JXAL 5EZJA 4OLWH 1MCNA 3CUJA 1E43A 1T2XA 1VFFA 3MV9B 4H1LH 1B3WA 4MZ2A 5JUEH 3D0LB 3CC5A 4DWSB 5ISZB 3TO4B 4XGZA 4NN5B 5SWZE 3BLPX 4JGJA 3BZEA 2P49B 1OAKH 5DEFB 3DYOA 4DTGL 2EE3A 2R69H 1M03A 3T65B 1OTSC 4YHOL 3AIEA 3WH6A 1FL5A 2OR7A 3I6KA 2FSEA 4ZNCD 4WO4D 3SN6N 3HZYA 3AIUA 4XBGB 4X99A 3CFIC 2DM2A 1MI5B 4DCQB 3BAEL 4GG6B 2FBJH 1B0IA 2HTKD 2YD3A 4PRBB 4JIEA 1MRDH 1I3UA 1K2DA 1MNUL 3C6LC 2XXMB 3BWUC 3DSFL 2EO1A 3LQMA 3FY1A 3WQVA 4ODUA 3VG0H 2VYRE 3V6BR 1FE8H 1FO0L 3SCNA 5JXED 3H6JA 1TVDA 1W8NA 3G5VB 2V5CA 1KB9J 5KANG 4PR5A 2EDOA 4Z7VA 2VITB 4NKDA 1ZSDB 3BYTA 4O2EB 3OJDA 5F9WB 1D5BB 3CVHH 4Y1AE 4NRYB 2R2BA 5IB5A 3ALWA 1TVHA 3JTSA 4U1SB 2D03L 3WV0A 4Y7MA 3WIIH 5HSFA 2MFNA 4AYSA 2Y4SA 4Z7UB 3W81A 1DZBA 4ZFFB 3JV0A 4Y19A 3HZVB 2X89A 4JFYA 1JGEA 4RAVA 3ZMRA 4QXWA 2A2QT 3ISWA 1XD1A 4JDZB 4GAYB 2DKUA 2CR3A 4P8UA 2AABL 1GOKA 4YR6B 1HKIA 1JP5A 1FGVL 1G7QB 1HI6B 1UZ8A 4XBPA 1QEWB 1DUZB 5DVNA 1OBAA 1H5BB 1U2HA 3ZJKA 3HE6B 3MRKB 3HUJA 2HKHH 3BGFB 3UZVB 2SEBA 4M1CC 1RK1B 5B3JE 3DARA 5BXTA 1OWQA 2F9BT 4HEPG 1MUJB 1P53A 4U6VL 3UO1L 5HHXH 2WCAA 1GOIA 1U41A 2CDFA 2NY2C 4NQDE 5E09A 5IROA 1FO0A 4HAGA 1KJ2L 5ACLA 1L0XA 1TQVA 3L4XA 5MERA 5ABGA 4HOWA 1I9RH 3LAFA 4HOXA 2A6DB 1NMBL 5BZWB 4QRSB 1GHSA 1EFQA 1B3YA 4PGDA 2M26A 3MRNA 3PWPE 5EU6E 4NQUA 1OSPH 4U7SA 3TJEH 1RZ8A 1KGWA 5JW4R 3EUUA 4M7ZB 3SCRA 4H5SB 2LFGA 2PTVA 3F6LA 4RDQG 5F21B 1FN4A 3CZSA 4M1GL 4KXZH 2OMNA 3HCVB 1VB9A 2TAAA 3DHPA 3O3UN 2E40A 2VWEC 1HKLH 2D3VA 3FAWA 3QCUH 3ULUF 3MCKA 1WC7B 1MWAL 4WNQA 3GKWH 1PIFA 2BNUA 5CP7B 2B0SH 4BUGA 1BLIA 3DGGB 4QTHA 3QCTH 3UTQA 1WDRA 4YGAB 2X70B 4PJ7A 5CSBA 1C91A 4GKNB 4QOKA 1CD1B 1W72A 2OXGA 3OWEA 4U3CA 2X5PA 4MQXC 43CAB 1GONA 4ZO8A 3VFMB 2XWTA 1Q72L 4FZ8L 3NGBC 3O6LH 3HMWL 3MXVL 4M5ZL 3TFKC 5GGSY 5FK9A 3CMOH 2YC1B 1YY9C 2CKBH 1FFPB 4M3JA 5CINL 1JPGB 4ODTL 1XIWD 3ZSSA 5EMYA 3KLKA 4JO1H 2PKDA 4G8IA 2J7FA 2ESCA 3A67H 4JANA 5ABFB 5DFAA 4WSKA 2A3HA 5JBDA 4CVXB 5C9JA 1YC8A 1QUNA 3C6LA 3IFLL 2GUYA 4Z8FL 3CFDA 3DVIA 3MPCA 1MI5E 4PLJD 3BVTA 4UQ2A 4Z77A 3WQ8A 5HI4D 4MNGA 4XXCA 3WD1A 3FB5A 1ZVSA 3QXDB 4GW4B 3VWJA 2YPLA 5E2VH 4IMLA 2V9QA 3KJ4C 1J1OH 1ZA3A 1PKQE 3OJVC 3L6FA 3SDXA 4DJMA 3WIHA 4Y4KB 1Q9LA 4N5ED 4Y19B 4LQ1A 3JTTA 4V1DA 3K46A 2N56A 4UNUA 5INDA 4YHGA 1QI4A 3BWAA 4IOIB 3TN0A 5DJXB 4JKLA 1QLRA 1B3ZA 4JG0H 3CSYB 3GSXB 1HP5A 1V3JA 3VFTB 3L5XH 2X4PB 2H1PH 2VITA 4H8WC 3LB6C 2KL6A 3BAWA 4NZDA 2DH2A 2F5BL 4F3FA 2JJSC 5DGRA 2XWEA 2FB4L 3O3AB 5EUOA 3CHFA 4BSVB 5I1KL 4KKBD 3ZLQC 1MFBH 2VISB 3QOMA 1QI0A 3OKDA 4H26A 4QRRD 4J1UA 2XZCL 4KDVA 1RP9A 1VAHA 3TVMB 1ND0A 3THML 1UFUA 2R56L 1H2JA 4FQXD 5CGMA 2ZNXA 2HRLA 4GQRA 4UQDA 4AIZB 2A74B 3FQXB 1E73M 4TVPL 4RQQB 4QRPA 5TF0A 1P4LA 4KY1H 4H88H 4PYSA 3X11B 4QLRA 4GBXD 3IFPA 2VABB 2OTWA 4P4KB 5E6IB 4TVPH 3JTTB 4V1DB 1XYFA 4Y4HA 1IT9H 1JGDA 4F15C 1DBKL 4PRIB 1XGUA 3AJ7A 4CAGA 2EC9U 4OZGF 2BRQA 3V79C 4MB3A 3ZTNL 4OCRL 4OLXH 4UT6L 4C7DA 1IEAA 1A6VH 5BZWA 4QCEA 4K2UH 3KXFD 5DQDH 4OLZL 4X98A 4B41A 5SX5H 4RA0C 4WEBH 5I3DA 4XCEB 2BNRB 3C5SB 4YHKL 4ODVH 5E08H 1VGKB 2BSRA 2F54E 5FB8A 2XWBB 1H49A 4XNZC 3U0PB 4NQDD 1G7JB 4TVSa 4ACYA 2OL3B 3CMOL 2VVSA 2QSTA 2V9RA 3LSOA 2ADFH 3DV6A 4RNRB 3GSUA 4LPTA 4ONHB 3WFCH 2X70A 4PJ7B 3SUSA 1ND0B 1YJDL 4UIMA 2F54B 3WH9A 4W70A 2DF3A 1N0XH 3F5WB 1E6OL 1SJXA 1GOWA 3WLBB 5JBFA 4U6XA 1DVFC 3HJEA 4HS8L 4QDMA 5T3ZH 4Z5RB 3A3HA 3WIFA 2N7AA 3QEQA 4WUUB 5CQ1A 1LEIA 4K7FB 4PJBE 2X4TB 3D0VB 4KUCD 4NHCL 3VDBA 3PZUA 5JPMB 3BRFA 4K94L 2AGJH 3GMMA 3VWKB 3MBXH 2I25N 1WT5A 4GRLA 4QWWD 5KSUA 2XZZA 2J88L 3CFKA 4ZENA 4HHAB 1ORQB 4HUXA 4LNRA 5IIEB 3CH8A 3GSNL 1UA6L 4IOFD 4R96B 2COQA 5F9OH 1ZA6A 2X4NB 1CD0A 4N90E 5JW3L 3I6LD 4FXLA 2X2IA 1OF2A 2DD8L 2ICEB 3ILPB 1I1FB 3N17A 3G6AB 4M48L 4L9LC 3D39D 4MLIA 1KBGL 4U6VH 1WEJH 4NQTA 5ADOL 4B53A 3WO4B 3SKNA 1KIQA 3EJZC 1GORA 1GSMA 1WTLA 3ARGA 4ELKA 4UZUA 5E08L 3MLVL 3U7WH 1BX2A 1S8DA 1H09A 5JA8B 3TCLB 4TSCH 3TO2B 4R5EA 5F6IC 5BWFA 3HC0B 5L7XH 4OV5B 4WWKD 4XCCH 4XMKL 3VD3A 1AVAA 1SEBA 5T1DH 5L0QC 2WWMD 3N85L 1HILA 3IAPA 4CL7A 3PDGA 1VFAA 1YY9D 4NPYB 5E1QA 3MV11 3S5ZA 1P4BL 3UG3A 5I9QC 3I50L 4G9DA 2J5LB 2D0FA 5DMKB 1DFBL 1ZANH 5FDWA 1U2CA 5TD4A 2JCCB 1GCFA 5I17B 3IJYB 3UPAA 3W5NA 3T2NL 2QHRH 5TFSL 3QO1A 3P11L 1O7VA 3DXAD 1ZGLP 1QFPA 3V0AC 1IGMH 1NFDA 5EIQA 6TAAA 4JM2B 5E6IA 2W9LA 1FO0H 1ORSB 5CIPB 3MROA 1FL5B 4XPBL 5DK2A 5F7MC 2Z31A 3A22A 1GZQA 2G9HA 3BW9A 4IHOA 1BOGB 3GJFH 2X4NA 4M8VA 1U8MA 4U1MB 5KS9F 2VDPH 4OCLC 2JK5B 2WMHA 3LHPL 3PHQB 3IETA 1UH4A 4PUEA 1FSKC 5JOPD 3GYCA 4MJ4A 2B5IB 4WFHD 2NT1A 6CGTA 1FCCA 1BOYA 3MO1A 1CCZA 2BRRH 3G08A 1HQRA 2X1PA 1FNLA 3S88H 3CH1B 5I16B 2C4XA 4U3XA 3GGWB 2CIIA 5D1XC 4PRPE 3T0VA 1E28B 1RFDH 4K3DH 1OB0A 3DI3B 3O6KH 2F74B 2DS4A 4IIQB 2LU7A 4XRCA 3SE9H 4NN7B 4L4VA 2AK4E 3GH7A 2YOCA 1E0VA 4PV8A 3AU1B 1NWSA 4OIIH 15C8L 5EBLA 4MAVA 3VXMA 1UQSB 2EH8L 1FZJB 5T3XD 5HI5C 5IFJA 2DSVA 2OQJB 1N0LA 2P8MA 1KBKA 3P4MB 1INDH 2VNCA 1BLNB 3OSKA 2R0KL 3O9WC 4P9HC 4YK4C 5D7KE 4MCZA 5J13C 2CYGA 1OQOA 4QGTA 4DAGH 3KPQB 2V5DA 3WY2A 1AGCB 4HIJB 1XIWA 3CXHK 1PKQB 1H0DA 3TNMA 4WLCA 5E9DA 1BGXL 4K68A 5JUEL 4MAZA 2DIAA 4G8GB 1Q9WA 1XGQB 4G9FD 2HT2D 4YZFE 1NLBH 4L3CA 3SDXE 3IGAA 3MCLL 3I2CH 1A22B 1S9KC 3CSGA 5DSCB 4OIIL 1F00I 4NP4H 3HNTL 2EXWC 2D23A 1JNHA 1EERB 4PYGA 3BD5A 4PRBA 4TPRH 3KYOA 4BSWA 4P3CH 3EYPA 2YHGA 1XGYL 2LVCA 4XH2B 3GMLB 3LN9A 2FE0A 1ZLSH 2PYFB 3DXAA 4HT1L 1F4XH 2J47A 3TA3D 1QSVA 3L7EB 2OSLA 3KAAA 5E1AA 4GKNA 4QOKB 3P4NA 3EJRA 4PMVA 4M1GH 4G7VH 4X7CC 2G3MA 4LLDB 2R0LL 5DJAB 4ZFFA 2E6PA 4F9LA 3KXFE 1IVLA 5FM5O 2I07A 5TE6H 4DQOL 2ZOLB 1Q9KA 1XGTB 3L3OA 1ZGLA 3O9WB 5ICZA 4XP5H 2R2BB 2DEPA 4UQCA 3VIMA 1NMBH 3O6FD 5B8CA 2WVUA 1KGCD 4MA3A 2VLJB 4ZPTB 1IFHL 1JDAA 2DSUA 4DM2A 1FAKT 1MJ8L 3D25B 1TVPA 3VA6A 1BFNA 1WZLA 1J8HD 4PLKD 3ABZA 5A1AA 3VGHA 3MOBH 1RUAH 4FTVE 5GGVL 4HWBA 4QWWC 1A02N 3QDHA 1F5WA 1G9NC 5JLZA 3BLBA 3L5JA 2I5YL 1E4XI 4P3WA 4JDTH 4UOQA 4LCCA 5FKPB 5LKNA 3POCA 3KPPA 4S1SH 3REVA 1QFUL 4PMDA 1CICA 4GO9A 5CPSA 3MLRH 3QRFM 5J56B 2F74A 5CILL 1DBMH 1EO8H 5H94B 1IAKB 3OMZA 1P7QA 3L3HA 1KTLA 2C4FT 4QRRE 5JDSA 1MIEL 4XMPL 4HKZA 1S7VA 1H15B 1IFHH 2DTSA 1HNFA 2O5ZH 3AS2A 3NJ3A 1NGYA 2XG9A 2YD2A 4YBQC 1W0VB 4UQBA 3E2HB 3GIVB 3D5HA 4G43B 2YL6A 1AQDB 3TNNB 1GNXA 2V17H 1NCWH 4KKCD 4GRMA 5D2NA 1HXKA 1T7XA 1U93B 5KZCD 4DM1A 1RZKC 4OZGB 5E9DD 4RGOL 1JNNL 1JWMB 4H2CA 3HPJB 1V6XA 5DURD 1WWAX 2XQBH 3EAKA 3OLGA 1WEJL 2ITDA 3EBAA 3M07A 1J88A 3F7VB 1NSNH 3V0WL 4BKLB 4KQ4H 1RMFH 2KPNA 1ZEAH 2QPSA 1DEDA 4JJHA 2YZ8A 3G04A 3GSNH 1KXQA 4DVRL 1E6QM 4JE4B 1U9KA 4OKDA 3MRQA 4OCYH 1U3JA 1FL3A 1UA7A 4HFWB 4MAUH 3V6OE 3EDFA 2GTWA 3VMNA 3QYCA 4Y7EA 4QHNA 1VFOA 1DQTA 2JB5L 5FUZL 4X6FB 4I18C 3ZE0F 3WHXA 2IH3B 4QT5B 4WIWA 1QFWI 3B2VL 4LSSH 4WFEE 2XG4A 1YEHH 3AREA 3MJ9A 3T0AA 5D70L 4D72A 5EWIL 2OYMA 4P46A 1OAYH 1T20B 2C7UA 2AXJA 3B9VA 1DJSA 2NY3B 5DSCA 2CD0A 3MRDA 3QWRD 4ALAL 1YEIL 1H0GA 4FFWC 4MLSA 2Y07L 5FYLL 3VGGA 1ODZA 4NKOB 1UA3A 3U7YH 3BJLA 3HC4L 2Y5TA 5ILTL 2EH7L 4YX2H 1VGEL 4ZO9A 1BGXH 4WO4C 3WS3A 5C0IA 1KXVA 1H41A 5I1DB 4XP4H 5AEAA 1U8IA 4NGHL 4DGIH 5FHBH 1FZMA 4MJIB 2YPKA 3W9DB 4HZ8A 1DL7L 3UTOA 5IHLB 2ZG3A 5MEOB 4HAFA 3S88L 4QCFA 1NAMH 1MWAA 4JZJB 1A6UH 1TQUA 3VXUB 4ACPA 5DRXB 2UZIH 2D24A 1ZHLB 4NBZB 4WW2F 2P7TB 3RUGB 1LE9A 3VFPA 4FNSA 5DMKA 5KZCB 5ITFA 1NLDH 1IT9L 5KAQF 2MHAA 4JPIB 1XGRB 4P2RA 3WDQA 4QRQB 7CGTA 2ZX8A 3AIBA 3OLDA 2HLAB 3PN8A 1MFDL 2M2DA 1E55A 4DZBA 1C7TA 1E71M 5DJCB 5J0BA 3VGEA 4RWYL 4RMTA 5IOPA 4HEME 4F7TB 4ODBD 4HX1A 4M61B 4I2XA 5DJDB 3RM8A 3GB7B 3VXSD 1F6LL 5E9DE 1IRAY 4X80L 3QR3A 4AM0A 3KLHC 3WL9B 1ZT1B 2BSTB 3K2MC 2AJZB 2NXYB 3CPUA 4LPXA 1Q94B 3TBTA 5DO2D 1WTGT 1KUMA 2QR0B 4OIFA 3UJIH 1SFSA 3DDGA 1P9MC 2DIBA 5IBLD 2DIJA 4PGJA 4TUJB 1DEEB 1MY5A 3OAZH 5TDOA 3VFGL 3G5ZA 4CVUA 2W9EH 3ESVF 1US2A 4POZC 2BVUA 3BPOB 3TA9A 3MQIA 2ENYA 4D6FA 4HUVB 4XC1H 1QSEB 5D7SL 4WU5A 1OAXL 2LU4A 2EEDA 2FZ3A 4OZOA 3B9DA 3VFGH 3MLXL 1MRFH 1RVFL 2IQ9H 5C1MB 4JZNB 4FABL 4W8LA 3WBAA 1SR0A 4X6CB 4HWBH 2JIWA 5DD6A 2HFGL 1QLFB 5FA3B 2E7LC 2WVSA 5H35B 2XYCA 2P45B 3BKJH 1KLGB 3O2WH 4XNZB 1YEEH 3BHBA 3GB7A 1PIGA 2E9BA 2Z4QB 4PG9B 4R4NC 5K59E 3MLVH 1W8OA 3HG5A 1T3FB 1M7DA 3PTKA 1BZ7B 1V7NH 2NXYC 2PUQT 5IVXE 5BJTB 4QGYA 1HDMA 1U6AH 1KBGH 4HLJA 2AK4B 4YHZL 1HNGA 1RV6X 1YQVL 1WNOA 3WBDA 2PYED 4YHMH 5DD0L 5FCUH 5IUSA 1RHFA 1V0LA 2QQLH 2Q8AH 2IG2H 2WMIA 1E4KA 2X44D 5KVFH 4LPUA 5T1KD 1ECEA 5T33H 5D8JL 4ZFZB 4OZIB 5HI3D 3BP7B 5C07E 4ZNEE 4GG6E 1O6IA 3G5ZB 1L7IL 5E7FA 5BROA 3PTQA 1JN6B 4N0YL 3V2AR 4MMXC 3QZWG 5D7JB 5HYSA 3WUBA 3ARSA 2Q76A 5BCAA 4EXKA 2Z35B 4KAQH 2OMBA 4ZFGL 3FRUB 2Q7NA 5DT5A 1A6TB 1OGAA 1C1EH 1JE6A 4JKPL 3QI9A 4TYUA 4OLZH 4I2XB 2MCG1 4W86A 2BHZA 4NN5C 1ZHKA 3QJHA 1R75A 3MRMA 5DQ9B 5EOQL 1JPGA 4P5MA 2JJTA 3T3ME 5FECA 1A64A 1EBPA 3ARQA 4OCRH 1GZPB 1YY8A 3FZUD 4OKVB 4UT6H 1G9NH 3UO1H 5GS0C 4WHTB 4Y5YA 3WUZA 2VX6A 1JWUA 4XVSH 5M17A 3RVXC 4YDIH 5HVFB 5J3HC 2FGWL 1EUTA 3NABH 3QHOA 2IXUA 3QUML 5DC4B 5B8CC 5HHNA 1KTRL 5GRYA 3HMXH 3RNKA 4OJYA 5IW1A 1HJWA 5DYOA 4ZXOA 1KACB 3I75B 3H3BC 2C8NA 2AI0L 3QUYC 1PEZA 1UWGL 4FQHB 4ZOCA 1BYBA 3WF2A 3K0WA 3C8HA 4LLWB 3T2QA 3OR6A 1KB5L 2G2RB 1QKZL 1VCAA 2RQ8A 3RWIA 4IOIA 2QSCL 4W6YB 4YO0A 3NCJL 1PX4A 3EHBC 4KC3B 1RU9L 1ZS8A 1RULL 2RBLA 2APTA 4PBVC 4RMVA 2D7OA 3PWJB 4WI5A 5I74C 1HYRC 3CUGA 4WF7A 4AZCB 4K9EC 1Y0LB 4LCUB 4Z7NE 3CD4A 3KPLA 1UM5L 1OGTA 3HNVH 2DBLH 2WMJA 5AYUL 1IKNC 4WKAA 4UI2A 3STLB 3X14A 2XPKA 1T0NA 3S5LA 1WFUA 1NC2B 1INEH 2CH8A 2XVLA 4PGEA 4KK8C 5HDBF 3P0VL 5BXSA 4Z7UE 4GXPA 4P9ML 3RWCA 1GOFA 1X9QA 3MLUH 1ZLUH 5GJSH 3OAYH 2BOBB 1I8MB 3MMEB 1I4FB 5I1IH 1WBXB 4PP2A 4PJDE 1RIVH 4HKJB 1MEXL 4UCFA 3HE6A 5I24A 5BV7C 1NM9A 1CXLA 1T7YA 4U0RC 2UZIL 5LAXB 5KS9B 4CBPA 4H7VA 2BHYA 3WMCA 5A3ID 3CLFH 3MRRB 1JYWA 2WIIB 1KBBA 4QNPE 4QY8A 1RUQL 5F88B 3CH9A 5B22A 5C8BB 1Z32X 2J74A 4W4OA 2D4FA 4ZE4A 3M1BB 2WAGA 1FCGA 3GK8H 3IFLH 4JG0L 3UDWC 2HTLD 1ACZA 4XNYH 4UOW1 1A4JB 2VDRL 5E03A 1WFTA 3WXWL 5EBWA 4NM8L 3RZCD 2EACA 1EX0A 5HYQA 5IJKC 1NQBA 4ACZB 2PYEA 3MANA 5GS1C 1KTKE 4YHNB 4F66A 4JN2B 4YEFA 3HG4A 4AY1A 4X8JA 2JJUA 3ALXA 1WAWA 3PL6B 1BGAA 5F7DA 1J1OL 3NMEA 5GHWH 3HNSH 4G7YL 3SGKC 3T4AB 2NW0A 2DQJH 4U1IB 2IADA 1UD5A 4IRZH 3HI6H 4GO8A 4CDHA 4N0CC 3MRCB 4AEIH 3MFGB 4HCRH 1OP9A 2D20A 4QRPD 2HVJA 1VPOH 3BP5A 3R1GL 1JAEA 2J6EA 3HR5B 2DQTL 4M7JH 3QOKA 1SEQH 4NFCA 4EI6B 4WEMB 4GKOA 1A7PL 4M6NH 4WI9A 4N0FB 4CW1A 4U3HA 3KPNA 3QQ9D 2R0ZL 4B50A 1VFMA 2FJHB 3QT2A 4P5TC 2YKKA 2VXTH 5INCB 1U92B 1UB6B 3MRLA 2X1OA 4CMMB 3H2WA 1QG3A 4PJAA 3SOBH 2VC9A 2IPTH 1C8QA 1CL7I 4M62L 3DO3A 4AL8L 5A43C 2MPAH 4XNMA 5HHXL 3FO9B 3SGJA 3P0YL 5FYLE 5IVXB 2WUBL 2IMMA 5BS0E 3VXNA 1T1WB 4PUBH 3L3KB 3UEQA 1JNNH 2WZHA 1QTYT 4NIKB 1JDDA 1G7IA 5E56A 1SYVA 4A3YA 2O61B 3BSHA 4CKVX 4LHUA 2ADGB 5JHDB 4I2XE 4H20H 3BZ4B 1EHXA 3IKCA 3T3PE 1ZE3C 1LE5B 1A6WL 2F53D 1H3VA 4QXGL 3INUL 4XAKD 3ROLB 1IGCL 3JUZA 5GGRY 3OKEB 4AZBA 1DBML 2FYYB 5DUBA 4HJGB 1OCWH 5FYJE 3OHXA 2ESVD 4H5SA 4GQ9H 2CO6B 4LFHD 3WXWH 3C60A 4QOKE 3T0WA 3UESA 4YR6A 3TVMC 1HCFX 2CPCA 1CLZL 4K8RD 2VB5A 3ZHKA 4DFIA 4PCTA 5DFTA 5T3XH 4PS4L 4GRLD 3NIGF 2BXYA 1BPLB 1TZGH 2X1XR 2BC4A 5EB8A 2XRAL 2VRJA 3PJSA 3NSXA 1EAJA 2Z31C 1MQQA 2H8PA 5HHVH 2XQYG 4GAGL 1EXUB 3S36H 3S5LB 3VFSB 3UPCA 1W0WB 1BECA 4P4KC 3QDGB 2HMID 1JHTB 4NQEE 3ULVF 3VX0A 4JN1L 4KK5C 4D6CA 1FJ1A 1X5LA 3QDME 5BRQA 2MOVA 2F53E 3KPMB 3PWVA 5TGBB 3TBSB 3BW9B 4BYHA 4NZUL 3FO0H 2DLEA 4M1DH 3RZCA 1YN7B 1L0YA 1WLHA 5ESVA 1WBYA 3QAZB 1F4XL 5KVEL 4NDMB 2VOTA 4JM2A 4QXUH 5HYQB 2LAAA 3CPLA 1WZMA 3T2NH 4JHOA 2XVPA 1M4KA 4OGAD 4E8CA 2GFBA 1CGUA 1FOBA 1AIFA 1WWWX 2VE6B 3CDCA 4LBEB 4ONGL 3C8DA 1KGXA 4OBRA 2WZIA 2WWKT 5IP4A 5T1KA 4P7OA 4PG2A 5GIRA 1OB1A 4U2ZA 1CFTB 5FGSA 2AJ3B 1N7ML 4H0HB 2J77A 3L3OB 3B5GA 1ZGLB 5A16A 2YA2A 1A6WH 4L4VE 2C7FA 1VEMA 4XMKH 4Z78A 2BX5A 4H25B 4H20L 4NOFA 3CSBA 5EOTA 1JYXA 2F54A 3QUMH 1I7UB 4OCNC 4GINA 1D5ZA 1IEBB 2NXYD 2YBRB 3NN8B 4WWKC 2D3LA 3AU1A 2YD7A 4HXBL 4PJIB 3GSQB 4KQ3L 4JG1H 5GZND 3QI9B 1EPFA 1RZFL 5DI8A 2W0LA 5BXRA 2CK0H 1PW3A 1INDL 2GEEA 2DKSA 3FFCE 2NY5C 1IAKA 1MFEL 4RRPG 1GC1C 2HAZA 4PJ5E 1YMMB 1AMYA 1C8YA 1ZVYA 2LE9A 3ZJ8A 3LS5H 1YMMD 3MMUA 4LEOB 1YPZB 2XUCA 1W1YA 2F1BA 2ESVA 2ID5A 1X4XA 4OB5H 1OGGA 4HHAA 3P40A 5IIEA 3CC5B 4DWSA 2X4UB 4JL2A 5CD5C 4E0RB 4ETQB 4MD0A 1ZKAA 4FF5A 2Y2WA 4G8FA 3SQBA 3NFNB 2B8OT 4JO2L 4PGBA 1PKQA 2V7NA 1XF5A 2E8ZA 3S7GA 3I3EA 1MCWW 4PJGB 3ZYIA 3U46A 4R26L 4JQIH 4ZAKA 3OGCB 4MJ6A 2Y25A 1FIGH 4G8GA 3E0GA 3GMQB 3ORJA 5D1ZA 4KROB 1FNGB 2GJXB 3DUUB 4GUPB 3U0TB 3FRPA 3IDUA 4JRXB 4N9OB 3AIVA 4WO4A 1TJGH 2ZUXA 2V3EA 1B4RA 5A2AA 5KVFL 2C1PA 4YAQA 5B39B 3LHPH 4K9EH 2D3NA 1XEDA 3ZTJH 5JOEA 1ZT1A 2P5EA 3HNSL 3KYMB 3BKYL 4GMSL 1G7HA 3TIDA 4M93B 3B6SA 4NFDA 3TT3L 1P9MA 3QPXH 3VWKC 3C60D 2A1WH 3BZ4A 3DV6B 1JV5A 4P2OB 4DKEH 1B2YA 2W92A 2QV4A 4NO5B 3HUJF 4YDKH 5EZLB 3BN3B 3QUXB 4GS7B 4AQ1B 5J6GA 4WKHA 4OLUL 3ZO9A 4X5XB 5I9QB 4XCNB 5DD6B 1U8LB 4POYA 2PBOA 1UUQA 5CJXC 3W6LA 4X7SL 3MXWL 2DQJL 1J05A 3OXRB 2UY6A 2QBWA 4TULH 3W6MA 1VF8A 4Q7NA 1K5NB 1J1PL 2XSAA 4N8VA 4MS8C 5D9MA 1WWBX 3Q1SL 3KNBB 5DK2B 1WDPA 3LRLA 3O3DA 2DQDL 4HXAH 4UT7H 1ONQB 1FH8A 1R85A 5LWYH 1LO5A 1QBBA 4NRZA 2O5XL 5A6LA 2GTZB 1ZOXA 4U1MA 1HXJA 4F80A 5KTEL 3HHRB 2J7BA 4A6YH 4M7LT 1U8NA 1KXHA 3D9AL 3G6LA 4ESKA 1IKFH 4YHNA 3ARGD 4KJWD 4A4AA 4H1LG 1N6QL 4URTB 2EXWD 4FNPA 1S9VB 1YDPB 4HPGA 5HYJE 4LLWA 4KKAD 1JPFA 3GMOA 1OTUD 3S98A 3FTGA 5I75C 4HSQA 4G6ML 2JIXD 2RGSA 3CFBB 3QDGD 2W66A 2NXZB 3UROR 4O2CA 2ZNWA 4NWTH 1S7XB 1EO7A 1KB5H 4G9DB 4P4RB 2W65B 3EJYC 5F9WC 4LLVA 1FH7A 1M6OB 3JSSA 3LZFL 4U6XB 4PP1D 1N8ZA 1C7SA 2HTLC 4C56A 5CBEB 1G01A 5MP6L 1KT2B 1MHEB 1NCCH 3QXAB 3HAEB 1BD2E 3EYUH 1N3NA 4BQ8A 1ZTXH 3NA9H 1XF5B 1MPAH 2UWEF 2E7LA 1C8PA 3THCA 32C2A 1FP9A 4I5BB 3W0WE 2R1YB 5HHOA 1RULH 5B4MC 3KE0A 3M17B 5E1HB 5JR1L 2NY2D 4QOKD 5C07D 1QNZL 2ZP0T 3BGFC 5IB4B 3L4YA 4EUPA 4D0DA 1QNQA 2QR0A 4K23H 3O3DB 2PWHA 1A7RH 1MREL 2ADFL 1OD8A 4CD7A 5A2JH 2AI0H 5EDXA 5ECJE 3PZ9A 1XR9A 1KQZA 3SURA 3MNZA 4D9QD 3J7HA 2IH1B 2I9TA 3AYRA 2G2RA 4JANB 2BXZA 5HHPB 1SZNA 4LHUB 3EMZA 1CPUA 3V4VL 1CDYA 4W4NA 3U7VA 5CP3A 2WMGA 1DQQA 4HS3B 2D7TH 4JKKA 5DDHA 4MD4A 4AZCA 2F53A 4AXNA 2ERJB 4C83B 1Q72H 2VAAA 3VKKA 3N1FC 1FVDB 1EHNA 1NCBH 2F7OA 1YEIH 1T0PB 4NWTL 3GDBA 4FLSA 4OLXL 1OTSD 2YPLE 3FT3A 4LF3A 1X6LA 2WC4A 1CS6A 4CADB 4WJXA 3CUFA 5EFIB 2D2OA 2YWYA 4YUEL 2DB8A 3C08L 4AMKL 2BNUB 3DO7B 2AXHA 4PY8I 3FQNB 1S7QB 4KK9D 4PJEE 4R8WL 3KLHD 1WE5A 1CICD 4LVOB 3O11B 5EBMB 1AJ7L 2OM5A 3ILQD 1QSZA 4Z76A 5KS9A 5EUOB 3AQUA 2VXSL 5KW9H 2O5XH 2NY1C 1NAMA 4BQBA 3RKDD 4N90D 1BVKA 1NGQL 1WSST 4P46D 4EIZC 1KB5A 1T21A 1PZ5A 4FHBD 2J8UA 3VH8B 4MNQD 3UTPD 4WFGD 4GSDL 3SY0A 4L8BA 5IM7A 3RY4A 5FCUL 3QWRA 3QDGA 3OGRA 4M80A 5HBFA 4HC1H 4WVRA 2DL2A 4S1QL 3MNWB 5D5MB 3GM8A 3TTYA 5J4MA 4GBXA 3KJ6L 3WH7A 4LSQL 3L5XL 4NO2A 2WMIB 5E2UL 1TA3A 1H15A 3BEVB 2EZ0D 3QISA 4U1HB 3MJ6A 3VXRE 1MAKA 2RAMA 4D0BA 2H3NB 4OLYH 5BV7B 3D5OF 4JKMA 3TBTB 5C9KA 1ZWIB 3MUIA 1AE6H 5IJKA 3AI0A 2BSTA 4U0RB 4MJ5A 1ZLVK 1I3RB 4XPFH 1MIML 2HRPL 5HHOD 4DKEL 1FFOB 1M1SA 3RVVC 4J8RA 4CRPA 2A1WL 5DJYB 4QO1A 4R4ND 4E41B 4Q9RH 1AHWC 2Y7QA 4WUKH 4A6YA 3U9PH 2J7DA 3HZVA 1OIFA 1OTTD 2EABA 5IB3B 3OKEA 3RGVC 3QUZD 5CEZL 2VLKA 4PJ7E 5EOCL 4EOWH 5CD3A 1V7MH 2GSIB 2A3EA 1UWSA 4D9LH 1SMAA 1R24B 4KI5E 5I76B 1PG7X 2ED9A 4E4PA 5BZDB 2XACC 3NUKA 5TPWH 4W85A 4RRPA 4TUKL 2WVTA 5FAAA 3BUPA 2R15A 5IK3A 3VNZA 1HE7A 1A3LL 2W07A 4Z2IA 2GTWB 1SVZA 4OQTH 3DVNB 2NTFA 5EU4A 4OD3L 3P73A 4FMVA 3GXFA 3L2LA 3AS1A 1HKMA 3PZVA 1AGFA 3ZDXE 1BJMA 1GOGA 1G6RA 5F7UA 2MNUA 4KV5E 2Q87A 3U30C 4ZS6D 4JFFB 4PRPB 3QFJA 1GYAA 2FSEB 1ZBVA 2HLFC 4XI5C 1T66C 3HZYB 2BOCB 4JFFD 1OT2A 2EDQA 4PBWD 5D7LA 5FOBB 1MFNA 4DGVH 1KEGL 5I1EH 3DX6A 3DHMA 4KTYA 4GIAA 4UV7H 3O8XD 3FNDA 5GGVY 2Y06L 1I9IL 1JWMA 4LLQB 4DO5A 1IAIL 1F97A 2B1HH 4ZUWB 1NLDL 1W3KA 2ZSWA 1F4YL 1IQWL 1AD9A 4MNQA 1NMAH 3C5ZC 5E8NA 5E0QA 2A9NL 5JNYB 4YPJA 1T2QH 5CBAB 5F9JB 1T5XB 1KIUA 4EBQH 2G3IA 4QRTA 3PZTA 1P4IL 1JV5B 4UILL 1MJ7H 2P8PA 1T0MB 1UWEH 2IPUK 4N8CL 2IAND 4NO5A 3VRLE 5JDJA 5L6YH 3TN0C 2APFA 4EK7A 2QJDA 4JO3H 4N5EC 1Z3GL 3P4OA 4Z7UA 4RX4A 1IGJB 4DUWA 2AJVL 3D85A 3NACH 1Q0YH 4L3EB 1GVYA 4J6RL 2NQCA 2VO5A 3WFHA 2R0KH 1FBIL 2FEDC 3TT1H 3X13A 3F7PC 1CU4L 1N7MH 5FYLH 1K8IA 2Y07H 3K80A 5CJQH 3AHYA 4FXGA 1G6VK 2VRQA 1MVYA 2PC8A 4XWOC 5GGUB 1JF1B 4JFQA 2AV7B 1CDBA 1JHTA 5EWIH 1A5FL 3G6DH 4QF1B 4W88A 1MUJA 2WBJA 1WICA 2HN7A 2FR4A 4RSVA 3B2VH 1NBZA 3F5KA 3VD4A 1AQMA 3L3DB 1KOAA 4MD0B 4G43A 2YD6A 3DI2B 1BTCA 2VQUA 4GMTH 1EJOL 4LAQH 5FUCE 5A6JA 2F7RA 5ITBH 2J7GA 4G8EA 1HSBB 4X5WA 1F58L 4LLYB 1ULVA 3F62A 4NO0D 1XCQB 2A83A 3RWDB 1O7SA 4OF3A 4JPKH 4QHKJ 2P48B 2HFTA 1FAIL 4GBXB 1EOKA 4BS0A 1D6VL 3HA0A 3Q48A 3BVXA 2VUOA 2OLHA 3S34H 3QAZC 5HY9A 2YXFA 2JCCF 1AR1D 2BK8A 3DX7B 5L9DH 1S5HB 1U8JB 3VFRA 1AFVH 2OSWA 3GSOA 2ESVE 4APQA 5A2FA 1XGRA 4P2RB 2V2XA 5A6MA 3BKCH 5IB5B 2CEQA 1HHGA 1ETZB 3KL0A 2FATH 5DO8A 5GNYA 1R7OA 1T04B 1ZANL 4UTBH 3RFZC 2HVKA 2WUBH 2W9DL 5C07A 4ZNEA 4LQFL 2GAZA 1P4BH 3WNMA 1Q6EA 4PSPA 3WIHH 3O41A 4NBYB 4ZUTB 1FP5A 4LSTL 3TCXA 1NBYB 2WBKA 3HG3A 3Q0HA 3MLRL 4AEEA 2R4SL 4FXKB 1A7NH 1L9NA 4TSCL 4Y4HC 1KQYA 5FA4B 4Z77B 3H9SE 4UOW0 2G4FA 4CD6A 3LKSA 4RBPH 2ADIB 5CEYB 5B21A 3V5HA 4WV1B 4G8EB 4X5WB 2VURA 4HJGA 2NY4B 4WTWA 3AHXA 4WI2A 3GMRB 4RGMB 5IV2A 1QR1A 3FCTA 2C3HA 2QV2A 3MV01 4PTUA 4YGVB 4LFHG 3MBEC 4U6YA 3BP5B 5I6XC 1AGDB 1LMKA 5A40E 4FQ2L 4LL9A 1RIUL 4QCIB 1QSFE 3MR9B 1A6AA 2J78A 1TTFA 5AZEH 1PG7L 5D2LB 4Y1AD 2WXDM 1QD0A 4LGPB 2VRAA 4E2OA 5KEZA 4UDTB 1T6VN 2R0ZH 4HG4K 4Q0XH 3N11A 4MXWL 1EDGA 2H32A 1JZ6A 4UAOB 4ZTOH 1SY6L 5EU7C 3UTTE 4X6DB 5DMGD 5MENB 1H4PA 4UQ3A 1HXMA 1K4CB 2C0HA 1FZJA 3PZMA 1HTYA 5SWZA 2ZOLA 4XNQB 2KUTA 2X10A 1U30A 2X2YA 3MRJA 2IJ0C 4JVWA 3BAYA 4F7EB 3CVHB 1TXKA 3O6FA 4G7YH 5DJ8B 1QLFA 5FA3A 3AXXA 1AXTL 1T4KA 5HHQB 3UMTA 3MRGA 3TM6A 4OD1L 3WBEA 3WSQL 5C0BE 3LY6A 3BDBA 2E7MA 1BQLH 1U3ZA 2P5WA 3FO9A 3L3DA 1WT5C 4GRLC 4C55A 3ZOAA 4KK9C 4V1DE 4XCEA 3RM9A 3ARGB 4ELKB 2CBJA 3NN8A 5FYJD 2F5AH 2CIKB 1MLCA 3CHEA 4JFHE 4N9GB 4AH2A 1UCBH 4HUVA 4NI3A 2HMIC 1KJMA 3MJ9L 2B4CC 1MVUB 4QXTA 5ANME 3NCBB 3FO2A 5C0NC 3V7AG 3WF4A 1NUNB 1MCLA 3OZ9L 4K23L 4OCMC 1ZGLM 2Q76B 3CFCH 4AEHH 4JFTA 1XR8B 2BZDA 2XWDA 3NCJH 1GOOA 2J8UE 3O11A 3VFUB 3U57A 4PTTA 3PWNB 3ZDZE 1FVEA 1OD9A 2CBVA 3ALGA 5J12B 5J1AA 4NQSA 3Q5OA 2EC9T 1YEJH 5BW7A 3DOSA 3V4PH 3TOPA 2YR3A 4H88L 2PXYC 4OOUA 2N7BA 3DTXA 3MRPA 4PJFE 5IMLA 5F6HI 1TCMA 2WBGA 4LMQI 1RJLB 3SIMA 4NQXB 1FNAA 3HG2A 4Z5RA 3TO4D 1I8LA 4MJIE 4ODSL 3B9KA 3MV7B 5CKAA 1R7AA 3LEYH 4LSUL 1F13A 2APXA 3GI8H 3IFNH 1I7ZB 3HI5L 1FFQA 4Y4FC 4S11A 4WW2C 1NUGA 1N64H 2AKRB 3O4LD 3U48A 2C1PB 2X09A 4LIQH 4YAQB 5B39A 4W87A 4J8RB 2O26U 3MS8A 1BG4A 3L4ZA 1HKFA 2KKQA 1K4DB 2Z9TA 4F58L 5IVNA 5D8ZA 2F19H 4L4PA 5IFAL 3G6AA 5I2UA 1KWKA 3P9LA 2OYLA 3E6FB 1LP9E 2VZ1A 3PWJA 1DFBH 4TUOA 1OLLA 1PX3A 1UG9A 2UZYB 2XA3A 3BT2L 3MJ7A 1ZVHA 4WJ5A 3GH5A 1I4FA 2JELH 4EVNB 4X98B 3IF1A 3QXVA 1MQKH 4PTXA 3WUWG 3R4DA 3TA3B 4GXVH 4GW1A 3H9SA 1CG9B 2JCCE 2QQLL 1T66D 2Q8AL 3NCCB 2VLJD 2PF6A 3NIGE 1NH6A 2CCRA 5CS7A 1BQHA 5I76A 3RKPA 4G9FB 3ZHDA 1YQVH 3BAXA 2WK2A 1B0WA 4RX4D 2J4WL 4Z2KA 1ZXQA 4UU9A 1EEZA 5ECUA 2VC2L 4L3EA 4OUEA 4HIXH 5FOOA 2VLKB 1TITA 3MRPB 1RZIA 1H5BA 3S6CA 3CK0H 4M9PA 4DN3L 4OF5A 2XWTB 1NPUA 1UD3A 3LKOB 3U4BH 1LDPH 4FZ8H 4CU7A 2EPNA 4QHMB 1A3QA 4JFDD 3RIAF 1LWJA 2VKXA 3QNZB 1UD8A 4L4JA 4TNVK 4YC2B 2NSXA 1ACYL 5HGBA 3RDTC 3HE7B 4YHML 1FPTL 3X3FH 1Q9LB 3BOVA 5HDBE 2ARJQ 3RHWK 1RPKA 1TZ7A 1NAKH 4P2RD 3OXSB 1URLA 1KTDA 1YPZF 4HIXL 1UR0A 2X4PA 2ADJA 3SDCB 4IRSB 4B5EA 3K8LA 3QHNA 4JAMA 5C09E 4OB5L 5BVPL 4WKFA 3P30H 2NR6D 1UKPA 2Q3AA 1E6OH 1M01A 1UR2A 1UXWB 4Y16C 4E5XB 1DE4A 2WMKA 4WI6A 2WP3O 4XPTL 3T8XA 3I3BA 3T4AA 3B9KD 5JQ6L 1S7UB 3AXIA 2DSKA 2IGFL 4LCWA 5EZLA 4Z2GA 4LP4A 3ZM8A 1A14L 3IDGA 4NNYB 4ZUVA 4GRWH 1R3HB 5IFJB 4GW5B 1YEFH 3RX5A 2Z8VC 4I5BA 1T1YB 2H26B 4WU7A 4QHMA 5IW3A 4CVXA 5ALCL 5C9JB 2DAVA 4JZJC 3WENA 2E9IA 2W38A 5H37H 3ARWA 4RFOL 5LA2A 1RZIB 3I9GH 4H8WL 2FBOJ 4PMUA 4RMSA 2J7LA 2XVGA 3HG1A 3DBXA 1DN0B 4JR9L 2ZCKL 3UZQA 2Q20A 3QUKB 4FOMA 2HT4D 3OG2A 1H8OA 5GRUH 4JFXB 1JJUA 3B9AA 1V08A 3WF1A 3PDOB 5F7EL 7A3HA 1WJ3A 4NT6B 3N15A 1DBJH 4PR5B 2W91A 2GKIA 5IB2B 2APBA 1HHHA 5ACMA 5CD5D 3QEHA 1KCRH 3QHMA 3PHOA 3PXHA 4NO0B 5ABHA 2A6KA 2IALA 2YD1A 3H9SB 1MFBL 1J7VR 3QEGH 1C92A 1RSFA 1MWOA 2X1WL 2F5BH 1MF2H 2Z31B 3A23A 4KZDH 5BOPA 4NQDA 1IBGL 2ADGA 4GW5A 1UR8A 1ITCA 1PSKL 2XNAA 5ISZE 1DVFB 3MGAA 1QRNE 5KSAB 2C9AA 3SDAC 4QRTB 2PYFA 3GUTB 4NZRL 2R0WL 2VXUH 1HI6A 2N4IA 1BQLL 3WLWD 5C0AB 3Q1SH 2EDBA 3SKJL 2OYPA 5KSBF 4HK0B 2I26N 2G3JA 1V3IA 3TVMA 3N1MC 4JFVA 2CLZA 1EV2E 1OQXA 2Z0BA 4PJCE 5ESQB 2LABA 1PKOA 4OCXL 4L3ED 3EJZD 3S5YA 3ARZA 3B8YA 2PO6B 3SO5A 3PNWA 2XQYK 5CSZB 5CHNB 3OR7A 5I8EA 4EDXB 3R0NA 5I1CH 2O93L 5DR5L 4OLUH 3IS1X 3LKRB 4R7NB 4KZEL 3VFWA 1ETZA 4KI1A 4KJYA 1CVRA 4GQ9L 5CXPA 3K8MA 3TPUA 1TQBB 4D6DA 4MAYC 3TBWB 1DHKA 3CVHA 3MOAH 2FHFA 1LG1A 3QWOB 4DWHA 5CMAA 3FB7A 4WY7H 2YFOA 1JG9A 3VH8G 3UJJL 4OCWL 4RIRA 4OZ4A 3CLWA 2GCYA 3CVIL 1WBYB 4HW6A 4LCCB 4F57H 5D6CB 3C6SA 4FTVB 3SDDD 1FRGL 2ICEA 3ILPA 3TV8A 1N82A 5F6IB 1YUHA 5I19H 5D70H 5FB8B 4MD4B 4Z7VB 4P7NA 3LVEA 5GRVL 1RMFL 1VBRA 1HNYA 4Z7WF 4P46C 3AIQA 5HI5D 1BYDA 3K74B 5J11C 3EIFA 1MLCB 4FN0A 4MXVE 4OZGA 5DTFA 4X6DF 5C0CB 4HD9A 2IH1A 5JW4Q 3OAYK 2ITCA 4RGOH 4PJ9A 3P0YH 3TNNA 4JZJA 4ENEC 3MODL 2KDGA 2GK0A 3C2SA 4P2OC 5IMOA 1PD6A 5C0JB 3P4LA 5I1GH 4AIEA 1FFPA 4DVRH 3QBTB 4NZCA 1NGPH 2HH0H 3HUJB 3A6BL 2XIIA 1J5OH 2FECI 2XFXA 4TTDC 1M7IA 1HIMH 5I6SA 4EQ3A 3ULUH 4HBCL 3I02B 3S4SA 4AJ0A 1V6YA 1DVFD 2KBGA 5CJOL 4ELMF 5B3JF 1RHHB 4JG1L 3T0EE 4NWUL 5DVOA 4J12A 2FH8A 3LMJH 3AZSA 1NCDH 1QFOA 1Y6NR 3QCVL 4XB3A 1AD0A 3CZKA 4O02H 2WMPA 2HVKB 1B3JA 1I9EA 4O9HH 1KJ3L 1VEOA 1DQDH 3D2UB 1WAAF 5LA1A 1FN4B 1KJ2H 5FYKU 4X6FA 3FQRA 1UD2A 2MJWA 2W61A 3PWLA 4YDLC 5HVWA 3LD8B 5D1XA 3EHBD 1DR9A 1E3XA 2AAAA 4KV5F 5DHVB 4UQEA 4ETQA 3W29A 1BFOA 4PSRA 5GGRB 3IDJB 5HHME 1EVTC 3WMSA 2XKSA 3LRSA 3NPSC 4U6YB 1PBGA 1NGZB 1JRHH 5DJYA 2R0LH 1GJIA 1P84J 3BKCL 2Q8BH 4RDQF 1WZ1L 3AMGA 3PUCA 2GJ6E 1MJUL 4Z7WB 4UFIA 4JDVB 1M7IB 4R4BA 2HKFL 1I7RB 3JVGC 5IF0A 4JQVA 1I75A 4YK4B 2OW7A 1MJ8H 3KLSA 3D3VE 3VXMD 1J5OL 1BQHG 1KJMB 1I8KA 7FABH 2X1IA 4GAGH 1TTUA 5GS1A 2YK1L 2R23A 3CVHL 4RFEB 2F1AA 3QUYB 2IFGA 4ML4A 1CICC 5FO7A 1FL6A 3QEQD 3GNML 5BRZA 5BMFH 1TQWA 5J6GB 1H0DB 4JRWA 1BOGA 5T1LD 1MCPH 1ROWA 1G7QA 1UZ8B 1MW2A 3WDPP 2VLRE 1Q9WB 3JBG7 1T4KB 5HHQA 2WANA 3SJVE 3BLKA 4B15A 4WFFD 5IEHB 5ITFB 1ZT7A 2X4QB 2BOCA 1A2YB 1S9XB 4PRPA 5I18H 1CGSL 2VLRA 3DVNA 2GCYB 4KRPC 3WDIA 2CRZA 1AGFB 3HS0A 5ADPH 4OZIA 4WSJA 1A4JA 3RJXA 4YHOH 1QBLL 4F9DA 3WFDH 1GPOL 4I3SH 1U3HB 3RWJB 5LXGH 5D7KD 5CMAB 3S4SB 1LO0L 1KEML 1WBZB 1ZHBA 3VDAA 1QFHA 4ODHH 4LIQE 2DYPB 3OA5A 1NEZA 1QZ1A 2CGRL 2EDNA 2MTPA 3GNRA 3KYOB 3U2SB 2G5RA 4KFZC 1FC2D 4X8XA 1Y18A 5IMMB 1G0XA 4LLVB 2YRLA 4HIIA 4KGJA 4GLRH 1HH9A 3BAJA 2BJMH 3HI1A 4C58B 4M62H 5FECB 3O81A 4TSAH 3OAZK 3UP1A 3EYFA 4PJEB 4FLRA 1MCOL 2ITCB 2BVDA 4I9WD 1C1EL 4KUCF 4OD3H 3WF3A 4PY7B 5EZIL 2Q7YA 2EEBA 1MAML 1PSKH 4PJGF 1G7LB 2X4SB 3TONA 1VJSA 3PP4L 1K6AA 4M6NL 2GT9A 5IW6B 3TJHD 3VMPA 1IGJA 3HG1E 4DGVL 1F4HA 2WINA 4XMLH 4PV9A 3SBWC 5KVGL 4OZGE 32C2B 5A8MA 1VPOL 4Y4FB 5AD0B 5FCSH 2QHRL 5TFSH 3F5JA 4K3GA 2B7DT 4XNXL 4D9LL 5DHYB 5JUVA 3IKCB 3QI9D 3U83A 5GRWA 3BDXA 5IB2A 3TP4A 3WKNA 1P5UA 1TVBB 3DX9A 4XTRD 1GVIA 3VXRB 4X7FC 3UYRH 3HU7A 2GSGA 4WENB 4RISH 4ORZC 4DGYH 2FHCA 2IFFL 2OZ4H 3O3EA 4AG4L 4PRHB 2XFFA 4HU8A 5L88H 4W93A 1F90L 3LN4A 3PF2A 3LRHA 4PRHD 4XCYB 4D8PA 3WQ4A 3RBSA 3RO8A 3UYOD 5I1LB 1BEYL 3TA3C 1DBAL 5I0ZA 1CGVA 4HWBL 4PJBA 4M1CD 3RAJL 1EEZB 1EXUA 1JGEB 4RAVB 4MNLA 2A73A 1NGPL 2HH0L 3WNKA 3FRUA 1U8QA 3JV6A 2GJXA 2QQNL 4LKCB 4LSRL 2PO6A 3N18A 4XPFL 1IGIH 3GMMB 2H2PD 4NKIH 4OF7A 5KW9L 3BXWA 2UY7A 4XHQA 1XR9B 5D2NC 1BBJA 4PLOB 4CN1A 3IETB 3QA3B 1JI1A 4L8BB 5FXCH 5IM7B 4HZ6A 1UEMA 3RX8A 5JW4M 3I6LE 3BH4A 4PREA 4ISVA 2BY3A 3K8KA 3QFJB 4CDGC 3RTQD 3CZJA 3WLWC 3NGBB 1JXJA 4S1QH 5E2WH 1V3LA 5I30L 4HC1L 2OR9L 5ICYA 2G5BA 3X12A 4M81A 5TE4L 4M56A 3FQWA 3QRGH 5I15L 3VO0A 3TO2A 43C9B 3V52H 4K8RH 4OD2B 3N12A 4ZPVB 4DWSD 1ZAGA 3VGBA 4YFEA 3GSVA 4PJFA 3RPKA 3LEXA 4U0QB 2FX7H 1EGZA 5A3HA 4OFDA 2H3NA 3H0TA 2VC2H 3ZE1E 5I1AA 3HE7C 2J62A 1I3RA 3BSZH 3QIWA 4G8GD 3U36B 5D1ZD 4ZUVB 4I18A 5EORL 2NYYD 1D9KC 2VDLL 4PTMA 2J3SA 4ODWA 2NY3D 2BOBA 3CHCA 3T0XA 5DQDL 1F4AA 1DQLL 2J75A 1N0XL 2FIKA 1S7WA 3SDDC 1RY7B 1JZ5A 3VIHA 2D7NA 2XY1A 3MR9A 2FWOA 4W6XB 1SJHA 5IBLC 4LKCA 4S3JA 3GUTA 1C08B 3WEXA 3VXUA 5JR1H 4GG8A 1K8IB 1YDPA 5DRWB 2QLYA 3A21A 2XN9B 4ZTPH 1MFVA 3WD4A 3QFDB 3CLEL 2MKLC 2R4RL 2OK0H 1E6XM 2GITB 5DEGA 4XCFL 3FHAA 3IDXL 3WIFB 2YJQA 4PBXA 3MUAA 4NO2B 5HI3C 3HPLB 1XF3B 4LK4A 4P2YA 5CUSL 3WY1A 4LLUB 1A7OH 1QFWM 2C3GA 3O6AA 4ZUSA 3V0VA 9CGTA 4MNGB 1N64L 5D96C 3QDJE 3P73B 4KTEL 4Y89A 1CT8B 4XBEL 4OJFL 5KG9B 4GKZA 4PJDF 4DZBB 3QXAA 5D8JH 1QNZH 2QPUA 1YNLH 4N8VB 4NZJA 2KZWA 1L6XA 4G5ZH 4I18B 4BK5A 3O3BB 4QKXB 2WUCH 1X5IA 5FO8B 4PRHA 2DDQL 3TZVB 2B1AH 4OGXH 1FH9A 1CD9B 1R24A 4PFEA 3N9GH 3CSYA 3GSXA 2YD9A 1QSEE 2DICA 5FGCB 5MI0C 4PJXF 4AD2A 2EDWA 2JJVA 1G7HB 4PGZA 3TIDB 4NQVB 2CJUL 4MNQE 1HYSD 2B2XL 3NFSH 1G84A 1DWFM 1RURL 4OSUL 2E4TA 2DQGH 2WHLA 3LQAC 4U6TA 1E4MM 4MB1A 1S5IL 5F1KC 2AXFA 2CKSA 3CUIA 3FQWB 1UXSA 4QHKI 4FNQA 1KSRA 2E7CA 5E6IC 1NC4D 4TNVF 3SDXB 4CN4A 4XNUH 4AK1A 2GITA 1IKFL 2XM1A 4C56D 4EN3B 2WM0A 1SY6A 1FORL 1J8HB 2WQ8A 4AMCA 2JTDA 4Z2HA 1HJXA 2V17L 2WHKA 1U8QB 1YEDB 4XTRC 4HXAL 5C71A 4GRMB 3MLWH 4MVBC 5DFWH 1BFTA 1ED3A 1HJVA 4MNMA 5JIKA 4OQ1A 4DGYL 3DXAB 1GUVA 3SCMB 3GMLA 5J11B 2WHJA 4Y19E 2QF8A 4P7RA 3RUGE 1K4DA 4QRUB 2NY4C 4Z7OE 2CDEB 5T3ZD 4UTAH 3W26A 1QFUH 4XNXH 3GIZH 1DBAH 1EEYA 5HDOA 1EMTL 3I6GA 5F7LB 1I7UA 1BAFH 4ZO7A 4FQIL 4PTVA 1AP2B 1MWAH 4QRPB 2ZUQB 2N1KA 2CKBL 3P2TA 2EPKX 1NEUA 2HYMA 1CWVA 3MOQA 5L88L 1IGTB 2Z1KA 4ZXBA 4UDTA 1NOFA 1ZSDA 1JZ2A 2AV1A 1JIBA 5K9KB 2BFGA 2ZWYA 1QOXA 1NCAL 4G6AD 4JFOA 4EN3D 4QHNB 2HJKA 1C5CH 1FYHB 4XX6A 5DQJB 4LEXL 3UDWA 1QLRB 5HHMD 5BXFA 1B3VA 2YD5A 2X4UA 2QQKH