1CXFA

Complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
source organism Bacillus circulans
total genus 227
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxfA01
4A3HA 5A94A 4U1GB 5D9NA 2XZQL 2JF6A 3TZVB 1TQUA 4R5EA 4BK4A 2X4PB 1V0KA 1GOIA 3I3EA 2CIKA 1W9DM 1D9KB 1JRHL 2A6KB 3KYKL 5C0JB 3BVXA 4GS7C 3MJ7B 4IDJL 5IMKA 1HXYB 1RULH 3DGGB 1GPOL 4OZGB 2JJTC 2YD9A 1QBML 2IG2H 3AREA 1HINH 5C3LD 4CD4A 2CMRL 3QYCA 4WI6A 1OSEA 2LU4A 5DI8A 3LVEA 4WI9A 4PGCB 4L3ED 3RTQC 5HD8D 1ISYA 1CD1A 1QO3A 4V1DD 4UQEA 3N1PC 3MMWA 4RGOH 5ANMB 3FB7A 3GFUA 4U1HB 1BBJB 4WRLA 1PG7X 5HYQB 3TBYB 3ARBB 3DV4B 4PTUA 2UY3A 4RGNC 5GS1C 1EA9C 4DN4H 5E00A 2W5FA 5A2JH 2WMJA 1T5WB 3B9DA 3QP3A 4UT9H 1H5BC 5D2LE 1WZAA 2CO6B 4TVCA 2XN9A 5DJ6A 4LCWD 1MHEB 3FQNB 1H3UA 4Y4FD 3OWEA 1D5MB 3G5ZA 3SDXB 3CVIL 2X4SB 1HKMA 3UTTA 1A9BB 4NQCD 5D7IB 1JWMA 4PY7B 3W0WD 5EFDA 1NLDH 4IM4A 3SE4A 3DXAE 4M7LL 4OLWL 2WW5A 1ITBB 4MJIE 4NKOB 1P4BH 1S7QA 5BQ7A 1ZT4A 2VDKH 3IFPA 1OSPH 4H88H 3HAEG 2XN2A 1XT5A 2GHWB 1ACYH 2YPLB 1A7RH 1OGAD 1ZHBA 2FATL 2OSYA 4XP1L 1ODAA 2RFXA 3HE6C 2DJ4A 1U95B 4D6HA 1AXIB 3OZPA 3IKKA 2X4NB 4NRXB 1CG9B 1ZBCA 3TN0D 1X5HA 4IEFB 1CDCA 4GRLC 3V5KA 2WNWA 4A6YH 2BNQA 4MDJA 4YDKH 4HAGA 5IQ7L 3EJTA 2EIDA 3ARVA 4G8GB 2OI9B 3MREB 4F3FB 3DIFB 3KLDA 4NQUA 4F7PA 3L3KB 2AXHA 3UG5A 4OCSH 2FRGP 3P4NB 1BLIA 5KVDH 5DSCB 4P4KA 2VZ3A 1JHTA 3HNSH 4ZUVA 5MERA 4JQXC 4ODSH 2AJXH 4F37F 1S9VA 4JQVC 1JYXA 3BZDA 3TV8A 1C12A 4FXLA 5F6HJ 4WTZG 3MO1A 5C8JA 5F7FA 3KLSA 3BZEB 4CD8A 1DWJM 1KN4H 4L3AA 1RIHL 1X5GA 1MUJB 4JZOB 3TO4A 3RX8A 2YD1A 5DMIL 1CGSH 3HB3C 1Q6EA 4HS3A 3UTQB 1MF2L 2EE3A 3S4SG 3EO0A 4MXQD 3T2PA 3SGDH 1TR1A 1BZQK 5GGUA 2FLBT 2Y8VA 1TZHB 1G7PB 4YHOL 1CDGA 1MQ8A 4X9HA 4M82A 2BXYA 2NLJB 5F9WC 1NCTA 1UGNA 4MB3A 3WDQA 2ESVA 4X9IA 2BVQA 5IG7A 1LEIB 3WO4B 4WFEE 1TNMA 2QL1A 4QLKA 4MQXD 3KYAA 5TQ0L 4R97B 4EKXA 4NHUA 2OQJA 1WLHA 4ZODA 1GC1H 1DTUA 2R39A 4LVHC 3LPOA 1RPQA 5JW5B 3BW9B 2HJFA 2VJXA 4DTGL 3SUVA 5SWSD 3VRIB 4DFIA 5IEHB 3UYOD 5HGDA 1Z9LA 1CBVL 2VDNL 5DJAB 2BNRD 3RAJL 3PGDA 2EKSB 1BAFL 2XRAH 5FGRA 1LWRA 1F58H 5DEGB 1DBKL 3VFPA 3Q1SL 4AMKH 4KK9C 3HFMH 2XKNA 2QMJA 4NN6B 1JAEA 1BF2A 4KKBD 2CKBB 2X7LA 3C6LB 1P7KA 4KAQH 2ZNWA 4JFTA 1T3FA 5L2KA 5D8WA 3TA3C 5I73B 2IANA 2LTQB 4N8VB 3NPSC 4TVSa 4J4PC 1KB3A 2VLKA 5T1KB 3EAKA 4ZSOA 3O3EA 4O4YL 4JY4B 4OV6F 2GAZB 3RWFA 2Y7QA 4L3EE 5FO7B 2GDVA 1HSBA 3PP3H 3S5LA 2HT2C 2OZ4H 1P5VA 4K23H 4ZFOB 1B6DA 1OIMA 4X6FB 2DM4A 1IFHH 4MJ2A 5I9QB 3UPCA 2G75B 2GCYA 3QXVA 4JG1L 1J86A 5E24E 2LV4A 4IS6B 3QHTC 1NWSA 2XVGA 4U6VH 1BGGA 2YOCA 4HXAH 3DRTB 4Y5XA 2IMMA 4YGVA 4GSDH 4QF1B 3ALXA 4F8TA 1TMCB 1Z2KA 4LCWE 2R69H 2WIIA 3O3DB 2AQ1A 2ZUUA 1C1EL 1P2CB 2I9LA 3GTNA 4X4MA 1TPXB 3O45B 4MA1C 1KCRH 4RAHA 4EBQH 1FZKB 2NZ9C 5H94B 3DPBA 3LN5B 2DTML 1SJHA 2HT4C 4XVJH 5E5MB 3QZWG 4OZIF 4I13B 4Y8DC 3PWUA 1M71A 3TH3T 1CLXA 3VFOA 4JZNB 3VXRE 2J2ZA 4ONFH 1GOKA 3QI9C 1AP2B 2CR6A 3AZSA 2AV7A 1BVKA 2VH5H 3GH5A 3GSRA 4JGUA 5LGHH 4F7CB 3DX8A 2ZCLH 5AD0A 1LJYA 2CSPA 1FC2D 1P6WA 3MNVA 1S7TA 3VGDA 2A0LD 1FN4B 4KK6C 1ZGLA 1X5ZA 5FO9A 3F7YB 4HKJB 4PJHF 4PRBB 3O2WH 4FXGB 1E6RA 2BP3A 3WJLA 3ET9F 1IBGH 4EJ1C 1A21A 2XYLA 4U6HA 1CT8A 4Y5YB 2XFYA 4G5ZH 2W65B 5MP6H 1S5IH 1OM0A 3VFVA 1DL7H 3WCYA 2EXWD 1Q0XH 4J3UA 5A3IC 5I19H 1IC7H 1OAKH 4NQEA 3MMUA 5IFPA 4UINL 3F12A 2R2BA 3BXWA 1JYNA 3BI9X 1INEL 2HWZL 1WEJL 3BGFC 3M8OH 2ZUTA 5DJ0B 1W72A 4BZ1H 3PP4L 1ORQB 1QRKA 4MZ3A 5CJ8A 3V8CA 1TA3A 2PYFB 4Z7WA 1X44A 2Z91B 5CMAA 2XFRA 1A0QL 3FQXB 5E09A 5H2BA 4GRMA 3QHMA 4RGMB 3K2UL 5F9DC 1NBVL 3GJFA 4O2EB 5C9KA 1I9JL 1NLBH 3MRJB 4PJGE 3GZAA 2YPVH 5DZLA 4JG0H 3M17A 1VFBA 3WS3B 2UY2A 1DQJB 1E6XM 1R86A 3PTQA 1NPUA 4ODXA 3RDTA 3W37A 4EE9A 1FO0A 1ZHLB 1WBYB 1JGVH 4W89A 4P5TC 3WNPA 2YWYA 2YD8A 5H37G 1XGUA 4CMHC 4W5ZA 4N42A 5KVEH 5JUEL 1F4WL 2MANA 4HC1H 2FSEB 1ZL1A 4GI6A 1BQLH 2OJEB 2WHMA 4DM1A 1JWUA 4P2OC 1A2YA 2HRPL 3AJ7A 5SWSE 5JLZA 5GS0C 2OK0H 5HYJD 2NY2D 5CBEB 4HMEA 4KROC 1HJVA 3CH1B 5GNZA 4HWZB 5T1MB 4X7TA 1J87A 1TUXA 3D85D 1V6WA 5CP7B 1EZVX 1LP9F 3S37X 4R7NA 4TTDD 1UH2A 3EOTL 15C8L 1CWYA 1DUZA 2J6EL 4R2GB 4OI9A 3SCMB 2UWEA 3QRGH 4FG6C 4MAYD 1X3DA 2MKLC 2NNAA 1VIWA 4XCEB 1XH3B 2HN7B 4YDVB 4X99B 1CFNA 3NUKA 3CLFL 4MD5A 2D23A 3LRKA 2W67A 4QCFA 4ZG1A 2ADFH 1ZSDA 2YUZA 3VSTA 2UV3A 5J13B 2BC4B 4Y19D 5CIPH 4PUBL 5JHDE 1U2YA 5DUML 1BQHA 1SJEB 1MFEH 3AB0B 4Q22A 1I3GL 1SY6H 1IGCH 4JY6A 3WBAA 2FWOB 1T7YA 4LLVA 2DYPA 5F96L 1E6PA 1DQLL 1I3RA 5JNYA 1RFDL 5HVHB 5SWZD 4J3SA 4W6XB 1TJGH 1UM6H 5I75B 2HFFA 2X89A 4HWEH 5IFJA 4E8DA 2VISB 1MI5E 2J7GA 3A67L 4PSRA 1U91A 1E4KA 1EAJA 1W0WB 4AEHL 5JDSB 4FQIL 1KB5B 3BN9C 2VO5A 3BYYA 3JWOC 1W9BM 4JFFA 3BP7A 3H3PH 4LCCB 3Q5YA 2O5ZL 5M7QA 2R1WA 4JFEA 2OW6A 2G9HA 4NZDA 5CSYA 3MNZB 3V4UL 3WUGA 2JCCA 3OJ2C 4FTVD 4MD0A 1HQ4A 1VESA 1IEAB 3SCPA 1I1AB 4YHPA 3CPLA 2W0FA 4GW4A 3R8QA 4HJGA 4X6EB 4XNYL 5D1QA 4HLZH 5CXPA 2FHFA 1HNGA 3RVWC 1KR0A 2DLHA 3GM0A 3FRUA 1V6VA 3MJ9L 4U1GC 2NY0D 4OKVA 4U2ZA 1NDGA 1S7RB 2HP4A 3L3HB 4D0BA 3WHE0 2GSIA 4U0RB 1EIBA 3EBVA 3ALPA 2ZIDA 1LEGA 4AZGA 2NY5H 1HKKA 3EYFA 2EYSB 5DRZA 3O6FD 5DJCB 5GHWH 2NY3B 5C6TH 3V0WH 5I1CH 4MHHI 3OKMB 5TDOB 5E6IB 5GXBB 5BMFL 3C5ZB 1R8LA 4M8QA 3CFBA 1LL4A 3GMOB 2A9MH 1IKNC 2QR0A 1P6AB 3WUEA 4OBSA 5KSUA 3RNKB 4G6MH 1JD7A 4DN3H 2NT0A 5EPMA 1T7WA 4LNRB 4R4NC 4RIRA 4N0UB 5C7XH 5A8OA 2WK2A 3V2AR 1HKJA 3ARBC 5MEPA 2F8OA 1JYWA 3L4UA 4JM4H 2JFEX 2M1KA 1AO7D 1FFOB 4WKFA 2P8LA 3WS6A 1GIGL 2RB8A 4WEMB 3CFKA 4R7DA 2VC9A 2JIXB 3ESUF 2FDMA 4PLJD 3LPWA 3KYNA 3N11A 2VLRB 1VDGA 4W7UA 3L5WB 4RZCA 5IW6B 1HNYA 4FQCL 4PJXF 4LSDA 4WHCA 4WKAA 1GZJA 3HHRB 4MNHA 4PBGA 4NZFA 3HZKB 1KPRB 4YQXL 1MJJA 3MRCB 4PGDA 5CLTA 5F7UA 2EDDA 3EO9H 1FCCA 3IRZA 5IB2B 1IAKB 3RUGE 1E4LA 1Q6DA 3ZT7A 2EC8A 2QSTA 5FHAH 4J8RB 1PAMA 2PW1B 1ZBVA 3MA7A 3QQ3B 5CEZH 3MBEC 2DIJA 3QA3A 1H8NA 2OLDA 4M1DH 3X13B 4ATDA 4XPHH 5TE4H 3OZ9L 3SCOA 4FQ2L 2VQTA 3DO3A 3SDCA 1KENH 3RBSA 2AJUH 4HTYA 1MFUA 4OF5A 2R4SH 4OI8A 3VIHA 2WZIA 4K3HA 3O6LH 4F7EA 4GXVH 1N6VA 2W9DL 4IPLA 4G80B 1SVZA 2DQDL 4QXGL 4IOIB 5DJZB 4PJ5D 3U30B 1E4NA 1A3RL 2OI9C 4M5ZL 3WMSA 1I8KB 1WBXB 3BP4A 1XGQA 5TJWK 3MANA 2D2OA 3RP1A 1LWHA 4S0SD 3BSZL 1HXJA 3SDDA 1G6RA 5TFSH 2DSZA 1NFDB 3IKCA 5ALBH 4FQQB 4OI7A 2BVPA 2CRMA 3K0WA 3Q5OA 3IDGB 3MLUL 2ITDA 1F3JB 4I5BA 4Y19E 3PHOA 1ZA3B 2ED7A 1UA6L 5M94B 5DHXB 1BLNB 1SYTA 3MMEB 3VIKA 4YHML 1A14L 1AQDB 2OL3L 4G8IA 4APQB 3IDXH 3P4MB 3G5VA 5DRWB 5JPNB 3MRHB 3OLDA 4PGBA 5ID1A 1EEZA 2H1PL 5SWZE 3WFEL 5ECJE 3VMOA 4LRNL 1GAFL 4HUMB 2KUTA 3VH8B 1DUYB 1KULA 5INCB 5F9JA 4IMLA 4GKLA 3CIVA 4EN3D 4F66A 2E9BA 2MCPL 1I9IL 3NJ3A 1RJYB 4RAVA 3S34H 4X8JB 4LOUD 4R97C 4D3CL 3VX0A 2Y9RT 4MWFA 1LNUB 1G9NH 1ZT1A 3CZFA 1V0MA 3PWPB 3CFDB 5CJ5A 1PSKH 2OP4L 5D2LA 3PWNA 2BOBA 3HKFA 2V38A 4NUJA 4E41E 3CSPA 4UDUA 4ZAKB 4D9QD 5LBSH 2DQXA 3SBWC 3TCLA 3WKMH 4DGVH 3NCEB 3NABL 4TULL 3WLBB 1X5FA 2WLYA 3DXAA 4X9GA 1EVUA 5ITFB 3C5JA 4MJIA 1B30A 1Z9OA 3CCHA 1US3A 5A69A 4NN6C 4XBEH 3JVGA 3THDA 2DDQH 4OQTL 4ONHA 4GBXA 4P4RB 3C6LC 3JWOL 4H25B 5AYUH 1GXEA 1E6SM 4OZHB 5J3HD 4ALAL 3AZRA 1KJVB 2LTQC 4N1EA 4PP1D 5J4MA 2R0WL 4LVEA 1QSEB 3BWAB 1NQ6A 1CFSB 4DUXA 4LHJB 1XHGA 1E55A 3TBSB 4P59H 3BKYL 7A3HA 4Y5VB 4ACYA 2R2HA 4H1LA 3NFPB 4WI4A 3SCVA 3DYPA 2W60A 2J75A 4GG6B 4GZJA 1YUHA 1WT5C 5T5NG 5I9QC 2E9LA 1OAUH 1X6LA 3FW6A 4XP9H 4X7FC 5JUVA 4GXPA 3MPCA 1XZ0B 1R5VB 4BQ5A 4GAYB 3BDXA 1AO7E 5JXAH 1RVFH 1WF5A 3EIFA 1CWVA 3KLHC 3GBNL 1VGKA 2DOCA 1CD9B 2J8UE 3B2VH 4PJ9A 4OIFA 4DO5A 2X70A 4FNLH 3CX5K 3SCWA 1UT9A 3QUZD 5H8DA 4DKEL 1IEBA 3R0NA 4PUDA 3PZMA 4ONGL 1DDHA 1AKJD 3TCXA 4KTDH 2FJHB 5DWUH 1TPXC 4OLXH 5F7HA 2PF0A 3JV6A 3TONA 4HCRH 1NUNB 3P40A 3VFRA 4L4TD 3OA5A 1JN6B 2ZSVB 3DSFL 4YO0A 3W11D 3GBDA 1D6VL 5D71H 4N0FA 4QHNA 3KPLB 4NWTL 3OKLA 4TX6A 1KLUB 2WLZA 2F1AA 2JEQA 3OF6D 3EYQD 3FO1B 4Y1AE 5KS9B 3ULVC 4U0QB 1LE9A 3LKNB 1WZ1H 1Z3GH 3IJ8A 5HGBA 3T0EC 3G6JE 3MOAH 4EDWL 4AT6B 1O7DC 2X9XA 2O9TA 5A6KA 4J7RA 4LU5H 2AK1H 4HXBH 2P48B 1QPXA 2GK0A 35C8L 4R3SA 3GNPA 2A6JA 2V7NA 3QQ9D 4XZBA 3VDAA 4GZIA 3GXTA 4GJTB 3TPUA 3MLWL 5D9SA 5TD4A 1H15B 3CLEH 4PJEF 1DSFH 2BSRA 2FE0A 1HZHL 4LLQB 2BSTA 2HJKB 3WY1A 4ETQA 5AEAA 1C16B 3U1SL 1VADA 2ZUQB 4Y5YC 2O9RA 3P30H 1MHHB 4PB0H 1I7UA 3U0PB 1W2KT 3OGCA 4NO2B 1YEHH 5DK2B 1XIWB 1ZE3C 3ARFA 4HV8A 1V08A 4WW2A 4PJ5E 1FYTD 4WUUD 3ECBA 3F58H 1DQQB 4QXUH 5C08E 1TCRA 4LAQL 4QOKD 4HBCH 1JNLH 3LEXB 1KLGB 1W3LA 4AIXA 5I1EL 3BEWA 1HHGB 4X6CF 4YEFA 3T4YA 4ELMF 3NIDF 3BKJH 2VQUA 5J6GB 2UY7A 5GISH 1BFOB 1ZTXL 1V3IA 4Z7QE 5C2BL 1RURL 2XWTB 5IFHL 1UWRA 3OB0H 3OIHA 2AP2A 5JOFA 2FO4A 4RGMC 5C0BB 4DGYH 1OBAA 1HHHB 1V7NL 4XX6A 3C08L 1FV1A 1NEUA 2VC2H 2VL4A 4JN1H 3IXAB 3F8UB 1BBDH 1NCCL 3MI6A 3I9GL 1F3DH 2P5EE 1HVXA 3BAJA 4WGVB 1CLOL 3VIPA 5I17B 5C07E 1G94A 5ICXB 3A24A 4UUJA 2Z93B 1AH1A 2D31B 4X6DB 1B3JA 2ICEB 5EBWB 1HDMA 2XQYK 6FABH 2V2XA 1OQOA 5EIVA 3QEQD 4Q9QL 3B9KD 5D7LB 3MJ8A 4DQOL 8CGTA 1K6AA 1ORSA 4AEIH 5IVZA 4YHGA 1VKXB 3CVHB 2GJZB 4FQXB 1IAMA 4EI6B 2RBLA 2I27N 2CCRA 2WP3T 1A6ZA 3IDMB 4FZEL 3OAUL 3VXRA 4WEBL 1X6NA 4NQXA 3EYOB 4U1KA 2YUVA 5A2FA 4WIWA 2JALA 5HHMD 2DQFA 3WQ5A 3S98A 2J8OA 4R2GC 3T65A 3H7BA 3PJSB 5EU4A 5KVFH 1A02N 1BGAA 5B4MD 5I1DB 2IPUK 5I1AA 3WNNA 4ZTOH 3VD9A 5IQ9A 3BGAA 1QLEL 4KTEH 4EUPB 1RIUL 1GORA 3VPLA 5LA0A 3Q3GA 3HZMB 2NW0A 1ZLUK 1BTCA 3D5OF 4QCIB 4X7SL 5DJYA 3QHOA 2DQHL 4DWHA 2A3HA 1LK3L 1LDSA 4L8CB 1CENA 1MY7A 1KIQA 1QOXA 5F1IB 3ZOAA 2RR3A 4HBQA 3NTCL 4P46B 2J4WH 1UXWB 2CKBL 3MU7A 5GGRA 3LKPB 5HVHC 2OXGA 3F6IA 4S2SB 3SE9L 5L6YH 2HG5B 4R96A 4N8CL 4H8VA 1U42A 5I75C 4ACZA 5CJQH 1BQCA 1DJSA 4O2CA 1OTSC 3U2SB 4L8BA 4NJ9H 3MCKA 5BZWB 5FYKE 4YHNB 2GJXA 3VXNB 1QVOB 3MRKB 1EJOL 2DSWA 4U6YA 4W88A 2BCKA 4L4TE 5FYLL 1K6QH 2WCGA 1FVEB 1VGEH 1O7AA 2D7OA 4LCCC 2PNDA 4NC2B 2FR4B 2KPNA 4ZFOL 1UWSA 5DFVC 4PJGA 1HI6B 4XT1C 3LMJL 43CAA 2ZUMA 2CXKA 2YRPA 1UZ6E 4LFHG 2VVNA 2G3JA 3EDEA 1XGRA 2VB5A 4Z9KB 1GCFA 3HG2A 4XCCL 4L3CB 1I1AC 4NBZB 2ED9A 4XI5C 3UYRH 5KAQG 5JW4Q 1K5NB 5D1XB 1PKQB 3AGVA 1JGIA 1KB9K 2VAAA 5IBTL 4DN4L 3RTQD 5A8NA 4U0RC 2APTA 2IPTL 1ISZA 1IC5L 4FFZH 2VLMD 4HIXH 5AC5A 4NT6A 1A64A 2W92A 3U4EB 5SWSA 4ODTH 4PTXA 4CD6A 3ULVL 3VXSE 1FYTE 5EN2A 2C4FU 1CYGA 1GHFH 4KQ3H 4RGND 4ZO6A 4PJFE 2A6DA 4G42B 5E6IC 3C5ZC 4YHEA 5EC2A 2FIKB 3I75B 2XVPA 1HEZB 3KYOA 4OD3H 4UDTB 3MZTA 3O6ML 1FNAA 3DGCR 1AD0A 1QQDB 3WFDL 1PLGH 5BXTA 5IWLC 5FK9B 5JQ6H 3UEQA 1BQSA 3TZVA 2WP3O 3ZE1E 5KSBB 1GZQB 2XGBA 3AM8A 1N0LA 4UMGA 5BXFA 2Z92A 4WDIB 3CD4A 2OYPA 3HMWL 1F6AA 2CBIA 2EJ1A 2V2WB 3P9LB 3QIBB 4W70A 4W4NA 3RVXC 4JPVL 3TNMB 2B1HH 4QHUA 1II4E 5JHDA 4GMSH 5ISZE 4A6YL 5MEOB 4YDKL 4PGCA 4OFYA 2D0HA 1I3UA 1PYWB 3KPPA 1YEFH 3HE6D 3BXNB 3L1OL 1U8OB 5F7KC 2J47A 3WXVH 1L6ZA 1UB6B 4KVCH 3V4VH 4OCSL 3H9HA 1X4XA 3GH7A 1KTLB 4J28A 1UKOA 1YEJL 4XZWA 4GRLD 1NAMH 1AJ7H 1NQBA 1ZS8A 5KSVA 4UAOB 1FL6A 4LCYA 4F9LC 4WV1A 5DT7A 1MI5A 4OCRL 2M26A 3QQ4A 1MXDA 3EMQA 3RWHA 5ESVA 4MJ6A 4JPIB 5DJ8B 2ALWA 1Z0NA 1YQ2A 3L5HA 3VFWA 2X4SA 4URIA 1M7XA 4HUXB 1NC4B 1OT1A 3LKOB 5HHME 1J18A 4W93A 4JL2A 2YDSA 8FABB 3D39B 3MRDB 3S97C 3N50A 4ZYKB 1H4PA 3U30C 5CJXA 4YNYA 4JVPA 4BA0A 3WNMA 4DVBA 3GB7A 4PRPD 1A1MA 3KS0J 4M6NH 3HB3D 2FD6H 4Y89A 4WU7B 1NKOA 4NSBA 4KDTA 4GZEA 1YYML 1UH3A 1OGTB 1CXFA 3LQZB 2WCSA 3C8HA 2UY4A 4ORGB 3KPOB 1EEYB 4Q0XH 2PWDA 3BAEL 2CNCA 3BO8B 2NW2B 2AXGA 3WH7A 4NSKB 2PC8A 4HZLA 4LQ1A 3W27A 2O9OA 5IROA 5GZOC 4FFVC 2EO9A 1F58L 4XAKD 3DROA 3B2UC 4MSWB 3VW3H 3MUZ1 5C0CB 2Y2WA 2V3GA 4YR6B 3M7SA 4Z7OF 2JE8A 1Q38A 4OGZA 1ONQA 1IM9D 3AS3A 4NKIH 1KNOB 1J7VR 3QDME 1ADQL 2O5XL 1KQZA 2OM5A 4NZUH 5I8CA 3QXDB 2P7TA 4KK9D 3QEGH 3VWKC 3BAIA 1KBBA 3WENA 4LSRL 4JZOA 4Q2ZA 3TA3D 4JFDD 3E6FB 4PRID 4K23L 4WSKA 3DVIA 3ARTA 4I48B 4J4PD 5J11B 4GMTL 1G7PA 4IHOA 5E8NB 1T89A 3RUGA 4F2MB 3V79C 4U6VL 2FB4H 5HYEA 3MRBB 2HMIC 2V9QA 1LL6A 5CILH 5JOPD 1DVFB 2HT2D 1XR9B 4Z7NE 3CUPA 2D73A 1KCUL 2VLME 2ZWLT 4JHZA 4Z0BH 3HR5A 3NCJL 2R69L 3OKEB 4GRWH 1NARA 4R8WL 4KRPB 1MEXH 3QIUB 2ITCA 4EBQL 1D5BA 3KPNB 2CLZA 4Y4HB 2Q7YB 1LE5B 4NQDD 4HEME 4NNXA 1SYVA 1WFTA 4HKBA 2GJ6D 4RAUB 4KY1H 4KPHL 3PGCA 5BV7H 2ARJB 2VKXA 4XP4H 1WDRA 5AYIA 3PWVA 3OKDB 4MNGE 4U1JA 4PR5B 2J8HA 2VH5L 2JB5H 2EKSA 3INUH 5LGHL 4QT5B 4KZEH 2P45B 2J77A 4KJQD 2NZ9D 4MAYA 2HT4D 1IJ9A 2AABH 4YHKH 4K94H 2PI6A 3OKNA 4QTIL 1BIHA 3QB7C 1FG9C 2WKGA 5I76B 3QI9D 3TFKC 3PXJA 5MEND 4XVTH 1RZJH 2VDRH 3VFSB 4NYLB 5HY9A 4WW1A 2VXUH 4X4YA 4ZUWB 1A1OB 4Y19A 4FQPA 5C0EA 4AYSA 4ZFMA 2V3EA 3NCMA 5MP6L 1S5IL 4LHQB 5HI5C 3GSQB 4L8SA 5CKAA 1YA5A 3K7UA 4KK6D 2VUOA 3ROOA 1JNNL 1GZPA 5JOEA 2BK8A 2ZOKA 4N90D 1OAKL 2IADA 4X6FA 2W0PA 1MW2A 3UG4A 2PETA 1KG0B 4U1NB 1MFDL 4M24A 5EB9A 2PWEA 3D2UD 1MCHA 2ZWYA 4JDTH 4JLRB 3GSOA 5MHSE 1VB9A 1U8QB 5A3ID 5BRQA 1TIUA 3AAZB 1AGEB 2DB8A 4XVSL 4LFHD 1MCIA 4QHMB 1T03H 2XWJA 3O9NA 4G7YH 2F74A 1N0XH 2CKSA 1EUUA 1LO5B 4CCDA 4E41A 3T04D 3UO1H 4LX4A 4XC1H 3VFMB 1SMOA 1XIWC 3JV0A 5I3DA 5IHUL 3GMMB 4XBPB 1L0YA 1OAZH 3UAJC 2YFNA 3FO0H 1OCQA 4HZ7A 3WXWH 4U5IA 2F8QA 1AY1L 4BZ2L 5IOPB 3GSWA 1PBYA 3KWXA 2Z4QB 2R4RH 4DJMA 3WSUA 2A3EA 5CZVH 1FG2A 4EEEA 1I1YB 3VXME 1H3TA 4HC1L 3SCSA 3CMOL 4HDIB 5C2UB 3QXAB 4GAJH 4FLRA 3THML 2NMSA 4P5TD 4FXGA 5D1ZC 3VI4E 1JUFB 1A6WH 3MO4A 2YBRB 1JNHB 2IH3A 2AAVA 2HFGH 4H8WH 4P0DA 5DMKA 5EOCH 3VMNA 3H9SD 5E4EB 1E0VA 3MFFA 1BGXL 3KGRA 3AMGA 1RK0A 4LLUA 2P43B 5JBDA 2QHRL 5I79A 1LEKA 1S7WA 4P9HC 4HKXA 2KH2B 4P2OD 4WJ5B 4RFNC 4ZPTB 5SX4H 4I8DA 4IIQB 4YFLF 3I6LD 4PJIF 5GS0D 2I24N 4KROD 3AXLB 4L1DA 5BXPA 5A1AA 3VXUB 1KCVL 4ZUUA 2Q8AH 3BH9A 3UTZA 3LXBA 4N8VG 2AAAA 1QKZL 3NAAH 2J8UA 1E27A 3ZHKA 3HG1E 4YK4B 1RZKC 1OCWH 3KYMB 5GGSB 2OX5A 3LEVL 3QCTH 3TO2B 4QLJA 4E9LA 4GLRI 1FRGH 4BUHA 4FG6D 2E7LC 4HJ0C 1G9NC 3EHBC 3MCG1 3BHBB 1RP8A 4KMTH 2OWXA 1HH9B 1W2PA 1CE6A 1Q6FA 4Y1AA 5ITBL 1BJ1J 4DM2A 2CXGA 2ZG3A 3O4LB 5KOVC 1E6JH 4F33B 4B7IA 3G6JA 4YHYC 4L1HA 4MNLA 4HWEL 4LKXB 1WZMA 2F5AH 3TV3L 1GW1A 1JZ5A 2OJEA 5HGHA 5TGBB 5A6BD 5AAWA 3LZFH 3BUQA 3LQAH 1N64H 4L5FH 5IIEB 1PPIA 4XMLH 4RMRA 1ZANL 3VX1A 4GRWB 2CBUA 1IAOB 4PJGF 4RBPH 4JO2H 5IUSA 2E3VA 3IETA 1YDPA 5J0BA 1JGEB 2OTWB 2QSCH 4I0KA 5D6DA 3RIKA 1OIFA 3OZOA 1D5XB 2V7HA 1JHLH 4U4BA 4Z5RA 4YHLL 3BN9D 5E8PA 4V2XA 3IGUA 4P46C 2EZ0C 1MPAL 4CVUA 1R75A 1KIPB 5GIRB 5C08A 4RMTA 3S9DB 4WFFD 3CHFA 1DFBH 3BDBA 4XNMA 1GGCL 4KI5E 1GQJA 3K2MC 3AXIA 2EEAA 4PUEA 1JZ2A 1F6LL 5DRXB 1UD5A 2D03L 3U36A 1KTDB 4TVUA 3QFJD 2PYEE 2QADB 3VFGH 3DI2B 2VE6B 4OQ1A 3G5YB 3NVQA 3RVWD 2EO7A 2ZX8A 1UWGL 3L3IA 4M03A 3SDYH 1QA9A 2UYLB 2R2EA 4N90E 2YD2A 5KN5A 1R24A 1SJEA 3GSVB 1I1FB 3DHPA 4G6ML 1T5XB 3OJDA 2P5WA 5F88A 3MXVL 2XTKA 3ULUE 4BQ6A 4EN3A 1WDSA 2P5EA 2DQJH 4HOXA 3QAZB 1OP5H 2G2RB 3QBTB 4OUOA 5CGMA 3WL9B 5C07A 1GPFA 4GKNA 3OKOB 1EHNA 1BZ7B 5D1XC 5ERWB 3VRLF 4DKAA 2WYSA 3KXFB 2ZWZA 5E9DB 2R9HC 3IDNB 3S88L 4BJLA 1KB5A 1RD6A 4R4ND 3N85H 2IAMB 2Q20A 4LGXA 3C60A 3GXPA 3ARBD 2X5PA 5EUOE 4PIRF 2FGZA 1A6PA 3GNRA 3OAZH 3X14A 3GIVA 1TDQA 5CCKL 4E4PA 1C91A 3KWWB 4AZBA 1NCDL 5FB8B 4M9OA 3ARDB 2VDOH 3ECQA 3U7VA 1T22B 4S10A 4CU7A 4YX2L 1YZZA 3SGDI 4QHLA 4M1DL 1GOOA 1FNSL 2K1MA 5TDPA 2G41A 1YNLL 5FYJE 4E5XB 5FDWB 4EOWL 2GIYA 4FZ8H 3O0RL 2EDRA 3QIBC 5KZ6A 4S11A 1LLOA 32C2B 4TUOB 5JIPA 4OUUB 2OSLA 4HP5A 3MBED 2Z9TA 3LV3A 3W82A 1XV8A 4MDPA 1FNGA 4J12A 2QQLH 4YE4H 3WIHA 2ATPB 3BE1H 3I6LE 1CLZH 2QHLA 5DVLA 5CJOH 4GKZA 2MSPA 2F5BL 2JF1A 4U6TA 2ZG1A 3K46A 3DRQB 1P9MC 4FF5A 3GRWL 3IRPX 1E5JA 2DSKA 3CZSA 1ED3A 1A1NB 3RL2B 5ALBL 4TN9A 4UAOC 2D7TH 1LF1A 5E2UL 4LVNB 3M46A 2GT9B 1YY9C 1U93A 2GYSA 1PS3A 4JAWA 1G7JB 4UCFA 4WO4B 1E71M 3GBML 1W0VA 2FLRT 4P9HL 4AK1A 3EYPA 3IDXL 1BJ8A 2XGIA 1T1WB 1XF3A 4TNWK 3GXDA 5BS0A 3HMCA 2C9AA 1BVNP 5FHBL 1QSZA 5FECA 4P2RB 2F53E 5HHPA 3QSKB 1A3QA 3DHJA 1X7QA 3N06B 1F90H 5GGTH 1EDGA 4P7QA 1JCKA 1KACB 5DFTA 2APXA 1UXSA 5DMGC 2BVDA 3BUYA 1RZKL 2R0LL 3VGHA 5HHQA 1JG9A 3J7HA 1DANU 3OXSB 3SKMB 1UVQB 3MZGB 4HS6B 4NZRL 5CKGA 4TQEH 3F5JA 3CVHL 4P2QE 5D72H 1Y6KR 3ILPB 1FL5A 5M95B 3VKKA 2OR9L 1XEDA 1HCFX 3MLXL 3JTTB 4PJCE 4ZTPH 2Y24A 4QXTA 3WEMA 2C8NA 3BIAX 4FQ1L 5CPQA 3VXSA 1FYTA 5ICZA 1XC6A 3L3GB 5C09E 2Y5TB 4PJFA 4WFFE 1FC1A 2C7UA 4M7KL 4LARL 3RUGF 2ICWI 3MSDA 5IHZB 3PZVA 3RO8A 3BPCB 2FYYB 5HHOB 1REIA 5L9DH 2JB6B 2NSXA 3HPLA 3AU1A 5AYUL 1B0WA 3QR3A 2WANA 1HP4A 3GMQB 4KRNA 3IDUA 4MMXC 1EO7A 4NUGL 3H55A 1AQKL 1JMZA 2YSSA 4UOJA 5F9OH 4KQ4L 1C5DA 1TTGA 3ZLQC 5LQBL 3C6LD 3OV6A 3P4MA 3MCLL 2YA0A 4WVRA 1A6AA 5ISZA 3Q6GH 4JQIL 3MROA 1OAUL 5EZIL 1IGTA 5J11C 3WD1A 4XP9L 5T1KD 2PTTB 4WCYH 4P23C 1T1XA 1NC2A 2CRZA 1QFPA 1TVDA 5JXAL 2Q86B 2GQHA 3CC5A 1JZ8A 1ZT7A 5FYLD 3V6ZA 4DGIL 3LDBB 1T20A 1E3XA 5A3HA 2P8PB 4OZ4A 3B9KA 3ZDYE 1OTUC 2NY4B 3SE3A 3TBTA 1ODUA 1Q4NX 2CGRH 3QIUC 1E6QM 3EZ8A 3G5XA 3MUJA 4M7LT 2OR7A 4OLXL 4Y4HC 4HCRL 1GOWA 1A3LL 2C1OA 1AQMA 4ZAKA 3KLHD 5GRUH 1BYDA 1V03A 4Z78A 1E4IA 1W9XA 1EBPA 3FFDA 3PG2A 4E2OA 3O3AA 4PD4J 3AVEA 4QGTA 1OT2A 3S36H 5F97E 4H8HA 5C0FA 2DI7A 1Z3GL 2EH7L 3RPIA 3MRQB 4HGKC 4Z95H 1U41A 3B5TA 4GUPA 4QY8B 2AK1L 4HXBL 4PLKC 4X0VA 4M81A 5DQDH 1UM5L 1MCSA 4PV8A 3D3VE 2V17L 4H0GA 1I7RA 1LMKA 3KPSB 3L5XL 3L7FA 5FM5O 1WTGT 3ULVD 4YIQB 2GY7B 2XACC 3T0ED 1UQYA 1CGUA 1QSEA 2DTSA 2ZOLB 5EU5B 2WZPD 5B3JF 3P30L 2HFTA 3VXPA 5I1LA 3FFCE 1YEHL 7TAAA 2QPSA 4FXKB 3LEYH 1CLYH 1CGXA 4JAMA 5GS2H 4U3HA 3F58L 2XWEA 3G6AB 2VXQH 4AH2B 2I26N 1JNLL 2EDKA 4EQ3A 1OAYL 1Y7VA 1EXUB 3EYSL 4G6JH 5DK0B 3STZA 2DQUH 3FQUA 3OR6B 4GAYA 3SHSA 4AG4L 1PGRB 4NF7A 5EMYA 1KTRL 5EZOL 3SKNB 5GISL 4NBXB 5DC9B 3GMLA 2Z31B 5I16A 3HJEA 3QDMA 2WQ8A 2Z8SA 4EIGB 2XOTA 2K7PA 3EJZC 1VHPA 4E8CA 1SEQH 1NL0L 1PZ5B 4HPOL 4POUB 3L3DA 3DBXB 5I8EA 2D3VA 4KKLC 1NMCB 1U8MB 1I7TA 1TQWA 5IMOB 1K3IA 4LCIH 1H8SA 4TSBH 3U7YL 3VH8G 3H0TA 4MNQB 5FKPB 1BBDL 1KLUA 5DHVB 2NW3A 1WKYA 2JJTA 3I02B 2YMXH 5IW3A 4DVRL 4R26H 3M1BA 3LH2H 1F2XK 5C9JA 1P7QB 5EUKB 4J3OC 4X0KA 3NIYA 3RTQA 3VXOB 2Y07H 3BISA 2K9UA 3IJSA 3LKRA 4Q74A 1OTTC 2YA2A 5I0DA 4FS0A 4PJDE 4H41A 3IS1X 1UEYA 4UOZA 5E4EC 3QRFM 3HMXH 3FOLB 5IB5A 1S3KH 2I60H 4JY5H 3T77A 5ESQB 2BRQA 3V5HB 4MNGA 4B9YA 4LLMA 1KT2B 1US2A 4ZFGH 5HBFA 3G6JF 3NFNA 4WWKB 1HH6B 3CXHK 4M1GH 1XSKA 1YYLL 1MJ8H 3WNLA 2YPKB 3BH8A 5EO0B 1TJIH 1RUPL 2PWGA 3GKZA 3VRJB 4KTEL 4NFBA 4XCYA 3S6CA 2OWCA 1J01A 2DQGL 2QEJA 3IANA 2X4OB 2MQ0A 4LHUB 4YK4C 3OKYA 4XTRC 3IJYB 5DYOB 4R2GD 2EYRB 4RSVA 4OV5A 2K3TA 3WD2A 1FZJB 3QG7H 1QW9A 2CK0H 4P7LA 2DKUA 3PDDA 4QLRA 5ALCL 3BZFB 4PJ8A 1X5IA 1JV5B 1ZHNB 3PWJA 4QGYA 4UNUA 1KPUA 3TJEH 4XBGB 1A4KA 3KL3A 4LYPA 1J1OL 2J88H 3DOSA 5L6YL 5GJSL 4JM2A 5I17A 3WDHA 1UB5A 3ZJ7A 1AGDA 5CJQL 1J0JA 1YMMB 3MNWA 1NFKA 4D94A 4F8XA 2CD0A 4Z7QF 3W26A 1BIIA 3QDAA 2AEPL 1R5IB 4JPKL 3SDAA 2LVEA 1VGEL 3QDJD 1QRNE 2WQRA 2JKXA 1NGZB 3FQWA 3NZ8B 4TVPE 4QHKI 4M8UA 3EFFB 3I2CH 4K3GA 1OTSD 2X4RB 5DD0L 1KXQE 2R2CA 5IJVA 5BZDA 1QHPA 1NGPH 4JFHE 2EH8H 3UTSB 4PG9A 3PJSA 5JA9A 1NUFA 2V5SA 5DFVD 2WVVB 4PMXA 4D0DA 3MGTB 1GGIL 1MJ7H 1ZHKB 3VXMA 4QRRB 3L9RA 3FT2A 4PEEA 5T1LD 3T0EE 2CPUA 3GJEB 1MRDH 3MUGB 3QOMA 2ESCA 3BVNA 3VFTA 2J74A 3I50H 1I1AD 4XI5D 1E15A 5DJXA 4XP6H 3EUUA 2JK5A 2IQAA 1T0PB 4JDZA 4OT1H 1U3ZA 4JKPH 2PWHA 4OZFA 1A7NH 1EPFA 1DQDL 3CFJB 4NDMB 1IC4H 2IGFL 1Q9WA 1E6OH 1EZVY 1YEIL 3QUMH 1PLGL 5D93B 1NGXA 4N8PA 3QAZC 5ACLA 3RIFK 5TE6H 1RU9L 1S9XA 4JB9L 5E6ID 3C5ZD 5EZJB 3MA9L 5ABGA 3QCUH 3CFEB 5BZWA 3VXNA 2XXCB 1WDQA 4CVXB 3HG1A 5IK3A 5IM7B 3ARQA 1A6UL 2R23B 1EQCA 2IAMC 1UASA 2WMGA 5TPWH 1CLVA 3IDJA 5IEKB 5JDJA 1I1XA 4S1QH 5CS7A 1XCWA 3ZE0F 3D6GA 3DI3B 4BFIA 2ATKA 1OQXA 3DX2A 3S35H 3VFUB 3WXVL 2V5RA 3D0LB 3GK8L 3HLAA 3Q6FA 1ZV5A 4NWUH 3RVXD 1KJ2H 4WY7H 1MWAB 2DPEA 3MXWH 5DK3A 3WFZA 1K5NA 4IJ3B 2I25N 2KQNA 3QH3A 1TQCB 2PCPB 1RZ8A 3AROA 3K1KC 2WVTA 3QIWA 2H32A 1S7UB 1WFUA 3REVB 1PX8A 4M62L 2CH8A 3VDCA 1B31A 5ESAB 3QUKA 4LYQA 1BFNA 4H8WC 3IXTB 4S1RH 4Y16C 4GO8A 5IJKA 4G42A 2I9TA 4LASL 5C0IB 4U6XA 1IARB 1V3LA 5DJDB 1A7BA 2AXFB 3T0WA 1QEWB 1U6AH 5EBMA 1KIRA 3RZCB 4EUPG 2CLVA 2FD6L 2DQCH 1F6FB 1HT6A 3PNWA 1CE1H 3REWA 4R0LC 2X2JA 4ZXLA 4DFHA 4AMXA 4HPGA 4M43L 1FL3A 4LVNC 2WUBL 4XMPH 5A16A 5EG6C 4KUZH 4WO4C 4WUKL 4LPTA 1MFVA 3ZSTA 1A7QL 2PYEA 5JZ7C 2YL6A 4G8EB 5FF6B 1N5AA 3MOBH 1Q9LA 4PJFF 1YN6B 4G9FB 3V4PH 3DDFA 1XF1A 1F4XH 2NPLX 4ZUSA 12E8L 2YS4A 3WUWB 3GUTB 1WUNT 2QV4A 4NRYA 4XWGL 2ADGB 3F7RA 3VGBA 3BEVA 5FOBB 4F57L 4WTWA 1W3KA 1NUDA 3D2UA 2WBGA 3DVNB 2IBBA 5IW1A 1T4KB 1LP9B 1UWIA 4OLUH 5L8KB 2JJSA 3D3AA 5GZOD 3ZE1F 4FFVD 4UV7H 4CD5A 2A73A 3B2UD 2VX5A 5F1KC 2VWEE 2HLFC 2NY7H 3QDJE 3CDGB 3QHZH 1ZLUH 5CD3A 1UR0A 3OLIA 3AISA 1KELH 2R0ZL 4XB3A 4RMVA 1UQZA 3P11H 4NXSA 2QKIB 1U58A 1KGXA 1G0DA 4FNRA 5EUOA 4DKDC 1JGDA 2B8OT 5I71B 3ARUA 1MVUA 1U8HB 5TQ2L 3MLRH 3VWKD 3LRHA 3O9WB 4RMUA 5F89B 4ZDHA 3G08B 1BEYH 2FB4L 1TZGL 2A3AA 2H3NB 1KXVC 4LEOB 4PLOB 4MB5A 4HKZA 1HSAA 4K2UL 4L9DA 4UU9B 5F7DA 4Z0BL 1VBUA 1EUTA 1F4AA 2JJWA 3VE0A 3VIGA 2E3ZA 3OB8A 2FBJH 2DQIH 1CF8H 3VGGA 2E27L 1DN0A 1IT9L 2HMID 4OF0A 4D9RD 4C56E 2WZEA 2D3LA 5IMKB 3LMYA 2CK2A 3ZL4L 4LSVH 4P2OA 5E2WL 5DDHA 1N4XH 3AREB 4XV0A 2JB5L 2VZ1A 2VRAA 1TG7A 3UBXI 5DI8B 4XX1G 3ZZ1A 2AABL 4GW5A 1CD1B 1QO3B 1JZ6A 3OGOE 3GSNH 1ZA6A 4RRPA 5H37H 2VZUA 3FB7B 3MRMA 5E7FA 3LDBC 2ZUYA 4XVTL 3HZVA 1HJUA 1QFUH 4XMKH 2VYRE 2VXUL 4PTUB 4AZ8A 1IAIL 2MNUA 5BRZB 5E00B 5I1JL 4UFJA 3RL1A 2XY1A 3GNMH 1N7ML 1CGWA 1SBBA 2XN9B 5DJ6B 3TFKD 3MV11 2IFFL 4JDVA 2BY1A 3G5ZB 2DI9A 3RBGA 3UTTB 3WE6A 3O3UN 2YD5A 3LHPH 1NOFA 3L2MA 1AE6H 2F53A 1ITXA 1KBGH 3WQ6A 1LO4L 3SN6N 5I8OH 4D6EA 5HI5D 4RE2A 3PGFL 1MVFA 5ADPL 4JDTL 1S7QB 5BQ7B 1G0YR 1ZT4B 4JHBA 1HIZA 3IFPB 1MCDA 3P9WB 4U2YA 2FJFA 5DVMA 5KJRH 5CZKA 2XZQH 4P2QA 1ZHBB 2J5LB 1GOQA 2NTFA 5IFTA 1I8IA 2VIRA 2X09A 4PJCA 1JRHH 2RFXB 3OMZA 4EIZC 1JNDA 4IDJH 2D22A 5DEFA 1GPOH 1XCTA 4HUNB 2IEPA 3VXTA 1AMYA 1QBMH 1RHHA 5C09A 2CMRH 1JF1A 1MFCL 3V5KB 1LD9A 5EH1A 5INDA 3ZDZE 2BNQB 4MDJB 2EECA 2R4RL 3C6SA 3E8UL 3WY4A 3LRSA 5I1IL 1UZ8A 5JMOC 1U3HC 1XIWD 4F7PB 1EGJA 1FQ9C 1W72H 2XFXA 4TRPL 4Z7NF 3MQIA 3IDIA 3UAJD 2Z31C 4OKDA 3TNNA 1JHTB 5I2IA 1CS6A 4ZUVB 5MERB 5EOCL 3IFNL 3AIBA 3GJFH 1C12B 2VR9A 1NMCC 3MO1B 5C8JB 4LXFA 4IRSC 2RAMA 2Y72A 5D1ZD 2V9RA 5DT1L 4Z0XA 3CVIH 3TO4B 2Y25A 4HA1A 3EO0B 2R1XA 3SGJC 4M7LH 5GGUB 5C0BD 4OLWH 5LWYL 4H20L 3BCDA 1HKIA 2BSSA 4ZOEA 3AS1A 5D96B 4XXCC 1IKNA 5T3XL 1RI8A 4JLRA 3RJYA 5FUOL 4PJAE 2VOTA 2ESVB 1HXKA 5MEQA 5E2JA 1OCWL 5IG7B 1NFIA 3X11B 5CAYB 4EDXA 1AGEA 5T5NF 2I5YH 2Q1EA 2MOVA 3LRGA 2FL5A 1FRGL 2FATH 2J7EA 4XP1H 4NHUB 2OQJB 4W6YB 4RX4D 3AHVA 4P7RA 1LO5A 2DEPA 4UZUA 3BKCH 4IOFC 1HHIA 2HJFB 1R46A 1LILA 1V05A 5CFHA 3DC0A 4JKKA 1MCRA 4GXUM 2EE6A 4JHAL 2F7PA 5D7LD 5HGDB 4MVBC 1FLTX 1G7IA 2WKLA 4HJ0D 4WWKC 5DGRA 4MA7L 5IQ7H 3EHBD 1YQVH 3VFPB 1K8DA 6A3HA 2XKNB 3C87A 4WLCA 3RGHA 3D3VA 3MRGA 2X7LB 1P7KB 2GY5A 1T3FB 1OGBA 2NCMA 4ATWA 4LSTL 3MBEA 2IANB 4RDQG 1URLA 3O8XA 1WITA 2VLKB 3WL1A 4ZSOB 3O3EB 2UZYB 5FGBC 1BFVH 3FFCA 2PR4H 4YDIH 3RWFB 2Y7QB 5I5RA 3HE7A 1FA2A 1RIHH 2FX7H 1HSBB 4ZD3L 4IIQA 5JIIA 1DEEA 43C9A 3S5LB 1J8KA 3AHZA 1MF2H 4RMQA 2AVGA 3JV5A 3D18A 4HHAA 5KZCB 2GCYB 1JL8A 4GG6E 2EIEA 3TH2T 5IDIA 2AEIT 1DP0A 4Y5XB 5ETUA 1BM3L 3VI4F 4YGVB 4P46D 2EZ0D 5J12C 3U0TA 4AL8L 2A74A 1FCGA 1OLLA 1TLKA 3TO2A 3FN9A 2D7PA 5TQ0H 4NN5C 4JFYA 4AMWA 2E9JA 2WIIB 4HWNA 3BOVA 2I9LB 4S3JA 1SJHB 1GCYA 1FH9A 3PWUB 1M71B 4UNTA 4ZPVA 4DTGH 1T2JA 2ADIB 2DLIA 1MVYA 1WIPA 3VFOB 1U33A 2APVA 2DQJL 1CBVH 2VDNH 2GFTA 2E6PA 4V2CB 2BNJA 2AV7B 1BVKB 4P3CL 3RAJH 3GSRB 2WWKT 1BAFH 2PO6A 3CH9A 3DX8B 3J8F7 5C0AE 2GSJA 4BQ4A 1DBKH 5AD0B 3MBXH 3MNVB 4P9ML 2J7BA 2DWEA 1HP5A 1S7TB 1MH5B 1P6FA 5B8CA 1ZGLB 4RCAA 4HX1A 1WAAE 3NACL 5FO9B 1AQHA 1W0YT 4PJDA 3ZR5A 1R7AA 4TUFA 2EEBA 4U6HB 1CT8B 5D1XD 5GPRA 5CEZE 4RFOH 5EU6E 2XPKA 2R9HD 1UFUA 1J9YA 2Y36H 1JDDA 4HG4K 2B31A 3VFVB 4P5KA 1IQWL 1XH1A 5DTFA 3VD5A 5GGQL 4OAWA 5D93C 4NQEB 3WH8A 4CVZA 1R3IL 2VXTH 3F12B 2R2BB 4FRWA 2X9YA 1YY8A 1ND0A 4X4XA 3SO5A 4ZNCD 1AHWC 1HIML 1G0XA 1L9NA 2DIEA 1W72B 3QWOA 2RHEA 3OHXA 2P24A 1CBGA 5FCUL 3N1MC 2C3VA 1TA3B 2H45A 4Z7WB 3GNOA 3MR9A 1G9MC 1QR4A 5GZNC 1GQKA 4P8WA 1YEKL 5C3TA 1XGYL 2A6IA 4GRMB 4KVNL 5H2BB 1IGYA 1UEMA 3NSMA 4UFLA 3GJFB 1UA3A 5CHNA 1IGIH 1CLZL 2WBJC 3HZYA 3M17B 1A8JH 1VFBB 4IRJC 1GL4B 4ZUTA 4ODXB 3RDTB 1AC0A 4L9LC 1FO0B 5KSAA 3QIBD 3AIEA 1XGUB 3MV7B 1RQ5A 1BYCA 4IJ3C 3RNQA 5B38A 1ZEAL 1TQCC 4AD4A 3EDKA 1B3VA 3B6SA 5F1NA 3QO0A 5FV1L 1I8LC 4QTHA 1CICA 1JWUB 2FZ3A 4Q7DA 1A2YB 1QRNA 1KYOK 1ES0A 3RU8L 5JLZB 3CZJA 4AD0A 1FZOA 5D7LE 1YY9D 3SUSA 4X7TB 1KXQA 1GGUA 1FHLA 3BC9A 2ZUVA 1L8NA 4TNWF 4CW1B 2CPCA 3PHQA 1B0RB 4R7NB 1RUKL 1MNUL 3LIZL 4M7ZB 3RZCC 4A3YA 1V6UA 1DUZB 2FECI 2CDFB 1NC4D 3IGAA 4UINH 4CAGA 2UWEB 1INEH 3AFLA 2HWZH 1WEJH 3QWRA 1G1YA 3T0EA 5JXEC 4MA8L 3D39D 1CFNB 3BP5A 2NX5B 3PP4H 4MD5B 5A40E 3VDBA 1YMHA 3ARGB 4ZTPL 2BMKA 4LP5A 5DMGD 4W4OC 2WWKO 1ZSDB 2VXSL 1A0QH 1YNKL 5ACMA 4ZFZA 5EUOF 4ORZC 3DSNA 3K2UH 1H3PL 3RWIA 1VJSA 3OGVA 4JVWA 3ZMRA 1BX2A 1T6WA 3DX7A 3CHCA 2A2QT 3W81A 1BQHB 3PQYD 3QUXA 1KTBA 4MAZA 4JY6B 2Q87A 1BYAA 5EIIA 2DYPB 1I3RB 2OBGA 5JNYB 3I3BA 3BFOA 3BWUC 5DFWH 3DV6A 2HFFB 4ZQKA 3X3FL 2DLEA 4A6YA 5JUEH 1G7JA 1CU4L 5IFJB 2X2HA 4AISA 5GGSY 3BD4A 5C0CD 4G3YL 4JHOA 1U91B 3UJIL 5FKAA 4DEPB 2ZICA 3MUHL 4X80L 5M5DA 2Y5EA 1T6VN 1Z9SA 1H3VA 4JFFB 3BP7B 4NQSA 3TP4A 3Q6GL 1MRCL 2R1WB 2WC7A 1HHJA 3DURA 2VI0A 2N1KA 4JFEB 5I71C 2G9HB 4P2RA 4LDOB 4HK0A 2WHJA 1D5ZA 1KJ3L 2JTDA 3P0YL 2PF6A 3O9WC 3NA4A 2JCCB 3VJ6A 4JL1A 4MD0B 5I0ZA 3EOTH 15C8H 4YJZL 1E6ZA 4YHPB 3CPLB 4GW4B 2J6EH 4HZAA 4HJGB 3IJ7A 1A22B 5D1QB 3WD5L 1S7VA 1MAKA 1D2KA 4W84A 3FRUB 5TH2A 4FK9A 4MQ7A 4OKVB 1CVSC 5DURB 1NDGB 4P23D 4D0BB 3VCLA 2GSIB 3SGEH 3CLFH 3KLLA 4LSSL 3AMCA 5GRUL 1LEGB 3LPGA 1C8YA 1RJLA 3EYFB 3VWJD 3G6DL 1GHSA 1QNRA 5DRZB 1MFBH 1OTUD 1QFWM 3WHE1 1K2DA 4V28A 3AREC 2YL8A 2DIBA 3QIUD 4M8QB 5DUMH 3ZTJG 4I2XE 3CFBB 4MLIA 4UIKH 3I6KA 4Y4HD 1I3GH 2APBA 2QR0B 4RL3A 4JR9H 1NCAL 5KSUB 1AGBA 1VJZA 4OLZL 5EPMB 1DQLH 2ICES 1RFDH 2HJLA 2K7QA 5I1GL 4RIRB 3APGA 3QNXA 2XZAL 3ZR6A 4M5YH 1KCLA 2DSVA 4XZUA 2OMNA 2BOCA 4XAWL 5MEPB 1H0IA 4XX1E 2P8LB 3W5NA 4PLKD 1GGYA 3CFKB 4R7DB 4AEHH 1VSCA 1UJTA 4FQIH 5IV2A 3KYNB 5E8OA 4CVWA 1CLYL 2PXYA 4RZCB 1FP9A 1A6TA 2O5ZH 1VEPA 1ZJBA 1F02I 4MNHB 2ZX5A 1WK0A 3JXAA 1MJJB 4JRYD 2PTTA 4HIHA 4PGDB 2AOSA 3SE4C 4BQ9A 3V4UH 1X1NA 1OOAA 1LGVA 5CWSA 3MRFA 5SX4I 3RPKA 1L7TL 4ATLA 5LG1A 1ZVSA 1G9ML 1J8HB 2OZ4A 3MA7B 2FGLA 1R3JA 3QA3B 4POZC 2FYVA 3IFLL 2Z1SA 1ACZA 1F97A 2HRLA 2J5LC 3GMRA 3W5MA 1FP8A 4N0RA 3O2DL 4JFWA 2MHAA 3JWDH 1F4HA 1W2VA 3SDCB 4TSBL 1GJUA 1M7IB 3WIJA 1OB1B 4DZBA 4F7EB 1MWAL 3EJZD 2RQ8A 5BMFH 3LH2L 3D25A 3HI1A 3HS0A 4KKLD 4BFBD 2UVFA 3P2TA 1U8LA 5LXGH 2DBLH 1S9WA 5T1LA 3BP4B 4NCC2 1XGQB 2XYCA 4HULB 4P4KC 3ZDYF 1C90A 3SDDB 1G6RB 2X4TA 3IKCB 4FMFA 1I8MA 2ZOLA 4Y8AA 4NXKA 1R85A 2BVPB 4OBRA 1GIGH 4PRHE 2ITDB 4I5BB 4Y2OA 3PHOB 4C56A 5TE7L 4J6RL 4H7VA 3PQYE 4FQCH 4YHIA 1OTTD 1P84J 2AEWA 4G8IB 3G5VB 3TO4C 4ZFGL 3WD4A 5CUSL 3SDXF 4YQXH 3GM8A 4PGBB 1EEZB 1N59A 2P47B 4NC1C 1OWQA 5F9JB 2D24A 4IMLB 5D96C 2VN4A 4YXKL 1MCCA 3B3IA 4OUEA 4OZOA 2O26U 4U7KA 4RAVB 4H0HB 4U7SA 4RWYH 3U5UA 3LKQA 4MWFB 3OZ9H 2AJ3A 3IS0X 4FQ2H 1ZT1B 2CK0L 3KZSA 3CZFB 3C5SA 3VXUD 1LVEA 5D2LB 3PWNB 2BOBB 2EDQA 4NUJB 4ACPA 3PZUA 4UDUB 5BXRA 4MQTB 4L4VE 2VR4A 4UTBL 3TCLB 3EDDA 4XTRD 3AFBA 5IVOA 4Z2IA 3I84A 2W9DH 3DJ9A 3JWNC 1R0AH 3DXAB 4QXGH 3C5JB 2A3BA 4MJIB 5L2JB 3NCYS 4EKJA 3PZIA 3VXOA 4MJ5A 4M5ZH 5IGXL 1HKLL 3P77A 3CCHB 1TQSA 1JXJA 1VEOA 4UU9A 4CDHA 5F7WC 5C71A 4ONHB 4GBXB 3A4AA 1WJ3A 3S36X 1NDMA 1C8PA 4N68A 1CNVA 2QPUA 3C8KA 3FOLA 2ARJQ 4I0PA 3VNYA 1EHAA 5KANI 1UA6H 4XHQA 4O5LL 3V5HA 4QNPF 2R2HB 2OL3H 4H1LB 4ISVA 1R6VA 5IR1A 2W60B 5CJBA 3RVVC 1YUHB 2H1PH 1QLFA 3B9EA 3WFEH 2R1YA 3S6TA 3MRRA 1GAFH 4LRNH 4MDIA 5C92A 4LPUA 2R29H 1RJCA 1I9IH 2EDBA 4Y5XC 4TUJA 5HI4C 1VGKB 3T1WA 4JKLA 3RZWA 3AOFA 4PJDF 3I50L 2X70B 4D3CH 4PJEE 5FOOA 5EU7E 1DDHB 1FIGL 2OP4H 3VFRB 3N9KA 4JRYE 2WINB 4YO0B 4Q7NA 4NFDA 4F9PA 3QNYA 2J7FA 3NABH 1C5BL 4TULH 3OKLB 3UEZA 3ZO0A 1LE9B 1QFWL 5L8LB 5HGBB 3AHYA 5CIPA 1F2QA 3QCUL 4H5SA 3E3QC 1ZBWA 1E1EA 4PJAA 4M48L 2GK0B 5HHNA 2UY6A 4R3SB 1SY6A 2A6JB 2V7NB 4UT7H 5EB8A 4AYFA 2C5DC 3TPUB 2AQ3A 3NOIA 5D9SB 5IT2L 3L95A 3NZ8A 3WJLC 2BSRB 5IVNA 4NO0D 5JBEA 1B4RA 3DX9A 2BSTB 3AZTA 2R0WH 5IVXE 4ETQB 1NP0A 5D4YA 3PV6A 1VADB 4FFWC 5C1MB 2ZOXA 3N13A 2AK4E 1I7UB 3KXFD 3VWKA 3OGCB 1J1XL 5E9DD 5E94A 3BKYH 4O58L 3ARFB 4HV8B 2HT3C 4WW2B 3P4OA 4EI5C 4ZXBA 3K8MA 2ZKHL 3ECBB 3HC3L 2IAMD 1TENA 4WY7L 4K68A 4R4BA 1XSIA 3JV4A 5FGSA 4DUWA 1TCRB 4UTAH 5IF0B 2UWFA 2YHGA 3BEWB 5D70L 3L4XA 1B4JL 1UR1A 2BHZA 3MV8E 3T4YB 4CDGC 4HAFA 3GBNH 2LABA 1HJWA 5EC1A 1K4CA 1CQKA 4DKEH 2AKRB 3RWGA 3IDYB 2VQ1A 4ONGH 4QO1A 5JOFB 1A4JA 2FO4B 1C7TA 2GTZA 4PCSA 3MTRA 3O2LA 4OZIA 1MRFL 5JW4M 1D6VH 2VTFA 1P53A 5T1DL 4NWTH 3RDTC 5AWNL 1BD2E 1EFXA 4A2MA 2DQCL 2Z35A 4F7TA 4Y16D 4LHUG 4J1UA 4EDWH 5DMJB 5FIEA 5ADOH 4UUJB 1U8NA 4GO9A 4Y7MA 2BNUA 5CINH 35C8H 4WENB 4KUZL 3RWCB 1HDMB 1RAMA 1FGVH 4PSPA 2V2XB 3AQUA 4PJHA 3SKJL 2LAAA 1OAXH 3MLWH 3MJ8B 5HPOA 1HZHH 3KPRD 5JPMA 1ORSB 5IVZB 3FO2A 5DD5L 4YPGA 3V4PL 1DLFL 4PMDA 4TOQA 4QRSA 5I66A 5I78A 1SR0A 3QR2A 4ELKB 1A6ZB 5T3XD 5I24A 4WO4D 3OLEA 3VMPA 5MI0B 5JZ7D 1J05A 4HMDA 3VXRB 4NQXB 4Z76A 4U1KB 3VIJA 2J12B 4Q9RL 2UVEA 2XTLA 4IRZL 4M7ZC 2DQFB 5C0AA 5BYWA 4LAQH 3T65B 1YN7A 3H7BB 5EU4B 5HJ3A 5I1EH 1IKFH 3G6LA 3S7GA 1IE5A 3QHZL 5IQ9B 5F6HI 4TYUA 5A2AA 3BIBX 3REVA 1WAAA 4FN0A 3NA9L 4NC0B 5C2BH 1RURH 5IFHH 4KGJA 3Q3GB 5AZEL 3WY2A 4CUCA 4NO3A 2VZTA 2XJ7A 3HC0A 5HYSA 2HLFD 5EU6A 5DJYB 5F8QC 2H2PC 1V7NH 4OOUA 1K9DA 4GRWE 2FH6A 3DUSA 1KIQB 5SX5K 2UZIL 1NOWA 1NCCH 2WNGA 1E4JA 2F8XC 5GGRB 1U8KA 3RWJA 1CLOH 4R96B 4ACZB 3SE8H 4O2CB 3VG9C 4L8BB 3MCKB 3DO7A 1Q0YL 1XYFA 2GJXB 1E4KC 2C0HA 3MRPA 1DEDA 4U6YB 4Q9QH 2BCKB 1E4XL 4DQOH 5IMLA 4KZDL 4OOZA 3E2HB 4LSVL 3B43A 1N4XL 1QP1A 1CIUA 4PJGB 4OCYL 4LBEA 43CAB 2OR8A 2VSCA 3RY6A 4FZEH 3OAUH 2P46B 5E2VL 1XGRB 3NFSL 5IBUB 5T33L 4KJPC 4MCYA 5DD3H 2EIZA 5I6SA 3BUTA 3JUZA 5D1QC 1QFUL 4LRIA 4XMKL 2W1NA 3LPFA 1C8XA 1ECEA 2O5YL 5CGTA 5HDBE 2VAAB 3S35X 2DDXA 3FKUS 1QSFD 1N8ZA 1QLEH 5DUBA 4HIIA 1MIEH 3ZE2F 2YEZA 2ZPKL 1RIUH 3VINA 5ABHA 1EHLH 1LO2L 4Z7UE 2XZCL 2QKIA 1BJMA 3EYVA 3NZHL 25C8L 5SWSB 3IK2A 1OM3L 2COQA 4ZNEE 2VX7A 4HZ6A 1YEGL 3U57A 1AE6L 2DQHH 2A6DB 2WMFA 1G9HA 2E7LA 3E1F1 1MCOL 5EC2B 5I6XB 3BSGA 4AZCA 2XKSA 3BQUC 3KYOB 3QDGE 5FEBA 3FTGA 1KGWA 1R33A 2CKBH 1AD0B 1NJ9A 3SE9H 5KJRL 4GLRH 4KJWC 4N8CH 4O02H 2H2SC 3GSUA 1QBLL 3DNKA 4HIJA 2XTJE 5BXFB 2Z92B 2EC9T 3DMMA 2I07A 4PTMA 3WS6C 1GJIA 5HYIA 3AY4A 1F6AB 1KIUA 4XVUC 1EJOH 2DT0A 3WF3A 3NDZA 1A6VL 5FYLH 3KPSD 4Y88A 2GUYA 4OLYL 4QHUB 5JHDB 3CUGA 2VKWA 2E7MA 3LMJH 2JIEA 2X10A 3CPUA 3KPPB 5F3HA 5IESH 4RE4A 4H26A 2NXYB 4MD4A 4Q58C 4AQOA 4AW7A 3CZ8A 3H9HB 1W72L 1XR8A 4XCCH 2VDQL 1NWUA 4MXWL 1ZS8B 4NIKB 5KSVB 3MJGX 1S9KC 3E6HA 1FL6B 4LCYB 1LO3L 5IBLC 4WV1B 5IBTH 5CP3H 5BRZA 1MI5B 3KPRE 5BJTA 3QQ4B 4G43A 2IPTH 1IC5H 3RWHB 1U3HD 5ESVB 4MJ6B 3WUWG 4H2CA 4XWOC 2VL5A 3SDCC 3WN5A 2YKKA 1FO0L 1XF5A 2Z31D 3VFWB 1DWGM 3ABZA 1JPTL 3ULVH 1FH8A 2QQQA 3S3PA 4W7VA 3FRPG 1EQPA 3AHTA 3N1GC 4ODVL 5EO1A 1TJHH 4IRSD 3O6MH 4YNYB 4Z7OE 3WFDH 3BPNB 3GB7B 1RJZA 4MNQD 4DVBB 4V2BA 1A1MB 2RGMA 4GT7A 5ABEA 2I5YL 4OCLC 2L0DA 4TSCL 4RA0C 3S96B 3ZJKA 3ARXA 3EZJB 1LK2A 2ZE0A 3TBWA 5I77A 3L3JA 2X1OA 1P7QD 3THCA 3HMWH 3BKCL 4UOW1 5J9PA 2G5BB 4QRPD 3D5HA 3CX2A 2GKIA 3H54A 2AXGB 4JPVH 3SQOH 4PJXA 4HZLB 2V3DA 4AZHA 3ZKSD 4WFHD 4I2XA 3O81A 1WFNA 5D7JC 3DROB 3CDFA 1DE4A 1OW0A 3L1OH 3UBXA 1YQVL 4OF7A 3TT1L 4IOFD 2EAEA 4LGPB 4NFCA 1ONQB 3WUZA 4CN1A 1YEJH 1CDBA 2BFGA 5E0CA 4MVBD 1B9ZA 5I8KL 3L7EA 2C1PA 3KDMA 1CZ1A 2EDTA 3NGBB 1JFQL 3W53A 4WWKD 1P4LA 4OCRH 5I8CB 2P7TB 1BFVL 2KZWA 2E9IA 4JRWA 2PR4L 1G9EA 2ZG2A 4Z7VE 4YDIL 2X40A 3K74B 1KJMA 1PZ2A 4PTWA 2FX7L 1J11A 4Q2ZB 3KE0A 2QQNL 4LHUD 5CEXA 4I4WA 4JO1L 3ZDZF 3FO9A 4DW2L 4MNKA 1JPSL 4IHOB 2OTUA 2F54D 3RUGB 2DIAA 1JWSA 3CTTA 2FH8A 1G1CA 5F70A 1PEWA 1UCTA 1QSFE 2E40A 3RM9A 4HU8A 2CKRA 2W66A 3JVGC 3X11A 4GBXC 3EGSA 3CUPB 3SPVA 1JI1A 1QFWI 3HR5B 1UACH 2GEEA 1YYMH 4U1MA 3RGVA 3ZHLA 4U1IA 2D7MA 3HUJE 4AIEA 2ITCB 2XWBA 1D5BB 2OYLA 2CLZB 3BAEH 5JBFA 4NNXB 1SYVB 4HKBB 4UILL 3PGCB 3HAEB 2J7DA 3P9MA 3HNVL 3PWVB 4U1JB 1SEBA 4YDJA 3MLVL 4QXWA 4I9WD 4W8AA 2F19H 4MCZA 5FA4A 4Z2KA 4MAYB 4EVNA 3MBXL 2CUIA 4PJAF 3MV9A 4M6OL 4AZ6A 3OKNB 2IXUA 2D3NA 5FO8A 1Q6GA 3KPMA 2MKWA 2YN5A 5D6CA 3OAYK 3UTSD 4PJ9C 1G6VK 1ADQH 4JFVA 1GVIA 2O5XH 5HY9B 4WW1B 5DVOA 4PRHA 3UR7A 4X4YB 4QRRD 4Y19B 4BSWA 5C0EB 4RFOL 1AFVL 1QOKA 4KXZH 4L8SB 3A22A 2Y36L 1MSPA 3PQYA 3ROOB 4LSRH 3BD3A 3MODL 1GZPB 4RBPK 2JIWA 2ZOKB 4V1DE 1FE8L 4PMRA 2IADB 4GMTH 2VXTL 4U3AA 5SWZB 3B5HA 5KVMC 3MLPA 4HD9A 1RH9A 3NCBB 1IL1A 1WAWA 1KB5H 3GSOB 5GS2D 4F15B 1KCUH 1ZLWH 1HX0A 3NCJH 2B5IB 4HK3N 5C6PB 4R8WH 2XWJB 2QMKA 2F74B 2AJZB 4NQCE 3W0WE 1IGIL 4E41B 1UYQA 1DBBL 1PY9A 3JWDC 4HS8L 2ADIA 2C4FT 2EDOA 4KPHH 4L4VA 5BW7A 3ARFC 4WW2C 1KR1A 3GEWB 4NP4L 5GZND 4ZFFB 4PJIE 3GSWB 2W9EL 3WV0A 4GG6F 4LIQE 1FDLL 3OX8A 1FG2B 2XIDA 1X5AA 2WBJD 1OGAE 4IRJD 4QTIH 1OP5K 1MH5A 4C4KT 5EO9A 1NEZA 3SCRA 4D9LL 1V5JA 4BM7A 5E1HB 4QRPE 3TIEA 3VWJA 2G60L 2IH3B 4K7PL 3UR8A 3O6FB 3IDYC 4O51B 5DMKB 1UD4A 1UJ3A 3EJJX 1S9YA 1PQZA 3MFFB 3AIWA 1RK0B 4WFHE 4LLUB 2XNAA 4AIZA 1JNNH 1LEKB 2Q7NA 4EQ2A 2Z8WC 1S7WB 1W9UA 4HKXB 4XC3L 3IJ9A 1OGSA 4OIBA 3OAZK 1PZ3A 1G6RL 1MFDH 2AEQL 4Z2LA 4XCFL 5I30L 3EMZA 4ZUUB 2ERJB 3L4ZA 3BH9B 1QSVA 1XCXA 3UTZB 3TVMA 3WN6A 4UT6L 1WAAF 2J8UB 2KL6A 1E27B 5LJYH 3VSVA 3WEZA 3F62A 3RZCD 4X98B 3ZIZA 3PDOA 4PJEA 4Y4KC 5DD1H 4XVSH 5JW3L 1LO0H 4DK6A 3S5LG 1B0GA 5JXED 4JRYA 1ZVYA 4PJBE 4OFVA 1CL7L 4M9PA 4TOYL 2F54E 5MI0C 3FCTA 4JEGB 1CE6B 5IHUH 4MNJA 4Y1AB 4KK5D 2YD3A 3FT3B 2JF7A 1AY1H 3KJ6H 3MV7A 4YLQT 4BZ2H 3UYPA 1O5DT 4G9FD 1JTOA 1C7SA 1WWAX 3G6JB 5I15L 3SCTA 4X6CA 3CMOH 1JZ7A 4ELMA 4OM1H 3P3YA 5LAXB 4CRPA 5HGHB 3THMH 3C8DA 2VLJD 5DR5L 1OP3H 1SYSA 1ZB5A 1NAMA 5IVXA 5B21A 1JTTA 1UH4A 3T0VA 1BGXH 1FLRL 2BNRE 3N0PB 1E4MM 2AK4A 3IETB 1YDPB 3OXRA 2VDPL 4FQLL 2QHRH 4CW1A 3ZKNC 3U83A 2V7HB 5A8QA 4Z5RB 5ABFA 1XH0A 4AZIA 4U3XA 1B0RA 2GFBA 5E8PB 5HPMA 4QCEA 3QOKA 4IBLT 3T3PE 5C08B 2CDFA 5DUPL 4JZJA 4XNMB 1AIFA 4OLVH 3Q0HA 4HLJA 1KCVH 4KKCC 3ZYJA 3MV8A 3P73A 3TBVA 1QKZH 2E8YA 3O9WD 2NX5A 3VRLE 5SV4A 3ARGA 3U36B 2EDLA 1HILA 4X6DF 3PL6A 4HUUA 4XNXL 3KLAA 3LEVH 1YPZE 3T3MF 1MFBL 2HA1A 5IHRA 3E2HC 1Y18A 2VLLA 4FFYL 1F11A 3L3IB 1QA9B 2R2EB 5HPCA 2ZP0T 5KN5B 4OF3A 1R24B 4UIKL 1JRHI 1RY7B 4JR9L 1MELA 2J1KA 3OJDB 2B0SL 2P5WB 5F88B 1EO5A 4DWSC 4UFHA 5ITBH 1BD2A 4EN3B 1VFAA 2P5EB 5F21B 3UCRA 4XNQA 1FFQA 1BOGA 3ETBF 4M5YL 3BDYL 5C07B 4GKNB 2W9LA 4IDLA 3TV3H 3KHQA 1CPUA 4I18C 1BG9A 4AD1A 4NKDA 2CHNA 4RISL 1ZANH 2PW2A 4CBPA 4S1DC 3IU3A 5DZOA 3C60B 3HRZA 5JIKA 5FYKU 2FHCA 1VACA 1I7ZA 1UKSA 5GRWA 3X14B 1J5OL 3GIVB 5I6XC 4YHLH 4MA3A 4I77L 1FH5L 3GBEA 1MPAH 2XN9D 3EOAA 4WWID 3W9DA 3V7AG 1H5VA 2WMIA 3RKDC 3UTTD 3ARYA 2LU3A 4Y2DA 1GGCH 3TZVC 1PKOA 4QHLB 3HI5H 5TDPB 2L7UA 2D03H 5EZLA 1D9KC 5GSRA 2QQKL 3JWDL 1NGWA 5DRNA 1JPFA 2AJVH 3CZKA 2OSLB 3DVGA 3LV3B 3WO3B 5HYFA 4POZD 1G01A 1UWGH 4LCUA 1FNGB 2QHAA 3W29A 2NR6C 2FNBA 3D69A 2F2HA 3EO1A 4YZFF 1PD6A 4M1CC 3STLA 5LXGL 4GKZB 2DBLL 1MHCA 3MXVH 2NXYC 2XI9A 4BKLB 4WJXA 3QULA 2E6QA 4P5MA 1KUMA 2IQ9H 1ED3B 1SM3L 2X1WL 2A83A 1OARH 2WZHA 4WV1C 1U93B 2Y23A 3VA6A 5ENWA 1XYZA 4F80A 3S88H 3U9PH 1AGFA 1W0VB 1HTYA 2R8SL 1BQHG 1CFTA 4Q6IA 5JW4R 4P4KD 1DBML 2A77L 4LKCA 1XF3B 5BS0B 1SBSL 4G9DA 5FECB 5CCKH 5L88L 4G9FE 5HHPB 3LN4A 2CEQA 2F58L 3HNTL 1OPGH 4HSQA 1X7QB 1WISA 4M8VA 5GS3A 1NCDH 2E5EA 5EA0L 4N1HB 4X9BA 3V6FA 5CJXC 2B20A 3PBGA 1K8IA 4R9HA 1UXSB 3BUYB 3BPNC 1J8HA 4U33A 4U05A 3TO4D 5HHQB 4RWYL 2VLJE 4YX2H 4PFEA 1Q9KA 1FNSH 3BZ4A 4KDTC 3W39B 4NO0A 4CNIA 4P48A 2BZDA 2X4QA 4FMKA 1U8JA 1YNLH 3IF1A 5HYJE 5KSBF 1FL5B 5GSVB 4B50A 4GFTB 4EOWH 4Z7UA 3PWLA 5C6WH 2D0GA 2NY1B 4JRXD 3O0RH 4QXTB 3GH4A 2WBKA 1M7IA 2HTKC 2ESVD 1VF8A 1OB1A 4ZNEA 3PDGA 3VXSB 1FYTB 3V7MA 2X1XR 3ARSA 5FCSH 1AC6A 2R56L 4GW1A 5ICZB 5IROC 4PJFB 1R0AL 3T2QA 2C7UB 3BGMA 2YRZA 5K9KA 3QDGA 4N1CA 1FSKB 3SJVD 2CDGA 2F5BH 3LS5L 2B4CH 3GRWH 3HPLB 4PY8J 1KN2L 2BHYA 2IH1A 3AU1B 5IB3A 5HDRA 1EDQA 1JYVA 1PX4A 5F7MC 2WMPA 5EFIA 1AGCA 3A4WA 4UQ3A 3QG6A 5E2UH 3TT3H 2YSSB 1MCWW 4JFPB 2DL2A 1C5DB 4LLDA 3GBMH 1I4FA 4P9HH 1OD0A 3MLTA 1Q94A 3ISWA 5L2KD 5ISZB 1A6AB 3L5JA 4HGMA 2AJYL 3FQTA 1ISVA 1C08A 2XICA 5FHBH 1QWNA 2IAND 3MROB 1IGTB 4Y16A 2VLKD 4LF3A 3WIIL 2YC1A 4B0MM 5FIPA 1T89C 1T1XB 1NC2B 2FGWL 2R29L 3QHFL 3V5DA 5BOPA 3CC5B 1MW0A 2YDRA 1RZKH 1TZIA 1ZT7B 5SV3A 2R0LH 3V6ZB 1GGBL 1T20B 3S8WA 3WO4C 3GGWA 4OZ4B 5D2NE 3B9KB 4NZRH 3RVVD 1B3XA 3TBTB 3KPRA 3CVHH 2FX9H 5KZCD 1FGNL 3SEPA 3BH4A 4R0LA 2OMBA 2D7QA 2OR9H 4WI2A 3G5XB 5B3JE 2EACA 3MLXH 2WAHA 2C3XA 2C1OB 3WMBA 4PN2A 4K71B 3BRGC 5HI4D 4F58L 3QDHA 4NGHL 4Z78B 4FQ1H 3FFDB 7CGTA 4FTVE 3O3AB 4OLEA 3CHEA 1QZ1A 1WFOA 5HHMB 5C0FB 4M7KH 3RPIB 4LARH 2VCBA 5L2JA 4GUPB 1MFAH 3OTTA 3BP6A 4K3DL 4EUPH 5J06A 2XV6B 3WBEA 4PV8B 1RUQL 1I7RB 3L7FB 1LG2A 4UT7L 5I73C 2XWDA 4NUGH 1OSZA 4G6FB 1AQKH 1GOHA 1N5YL 2WV3A 1MAML 4KQ4H 3V52L 4DAGL 1M7DA 3VXPB 5I1LB 3ALWA 5LQBH 1FIEA 3MCLH 4JAMB 5DO2C 3RI5K 1Z5LA 5K9JH 4UTAL 4JQIH 5EZIH 2MQCA 2IPKA 1HE7A 4FFWD 1YC8A 3V8OA 2DLFL 3STZB 2AERT 3FQUB 5GGVL 1XGTA 4WK9A 3CK0L 3WKZA 2A9NL 3QQNA 2WVUA 1I1RA 2P1YA 2HT3D 3TPKA 4EI5D 4DGIH 3R06A 3GMLB 2EC9U 1DCLA 2QLVB 5I16B 3QDMB 4QAWA 1UCBL 3UDWA 2YLAA 3WIFA 5B22A 4F15C 4L4PA 1ZWIA 3OJVC 4HW6A 1WIOA 2B5IC 3A21A 3L3DB 3RIAK 5I8EB 2VABB 4Z7VA 1KPVA 1A3LH 2WINA 1TFHA 1I7TB 3KR3L 4BUGA 1W1TA 2EDFA 3QUYA 3NN8A 5GRJL 3H0TB 3AIQA 3FMGL 4FLSA 2NW3B 1BMGA 4RDQF 1T04A 2EH7H 3M1BB 1CFVL 3NIFE 5BO1L 5C9JB 2E9MA 5ADOL 1UENA 2C7FA 3CBWA 4X0KB 3RTQB 5TDNA 5CINL 3K3QA 1CL7I 1QSFA 4NC1E 1UM5H 4OIAA 1FGVL 2V17H 3RDTD 2DWDA 3L5XH 4HPYL 3IJSB 1S5HA 3LKRB 1OAXL 3O6KH 4JRXE 3PHSA 3QXWA 4JJ5A 1QI2A 2VXVL 4EANA 5FA3A 3BVWA 1V8HA 3T2NL 5BCAA 1MCWM 1GOMA 1O7SA 5GS1B 5HVWA 5FDYA 5IB5B 3VM5A 7FABH 4M29A 4K7PY 3T77B 4UBDC 4HFUL 1XCQB 4OM0L 4MNGB 1AI1L 4W68A 3SJVE 4LLMB 4MNMA 5ID0A 5J8OA 3VSUA 5IF0A 1VPOL 2C4XA 3NFNB 1BQUA 1OAYH 1IKFL 3EYSH 4ZOAA 3WDJA 3BH8B 4AG4H 3C2SA 4I3SH 2DQEH 2ERJC 5EZOH 4XCYB 3ZYOA 1OY3B 3BUPA 5JA8B 2MJWA 3NIGE 5DT5A 5HGAA 1UQSA 4KHTL 3NCCB 4B16A 2F7OA 2AKRA 1XGPB 4XPBL 5HBBA 4J27A 3RJXA 1MJUL 5IVXF 2VR5A 4OV5B 4H1LG 1NL0H 5E4IA 4HPOH 5L2KE 4F7MA 1HJQA 3CGTA 3SGEI 3A6OA 4L3EA 2IANE 2VX4A 4PJ8B 1H8OA 1ESWA 3U7YH 3U4BL 4ZSOE 3WEOA 3PWJB 4V1DA 1KPUB 1QUNA 1HYRC 1AXTL 1A4KB 4DVRH 2DGAA 3TEUA 4JM2B 3WFHA 1UB5B 3QISA 5CGYC 2H2PD 1KFAL 2Q8BL 1AGDB 3SE8L 1EXPA 3Q2CA 4PYSA 3MNWB 4POYA 5EOQH 1DANT 5C0DA 3RMEA 3RWCA 4I3GA 4U5KA 1UD6A 1BIIB 4LCWA 2DYPD 3SDAB 1WTLA 4D9QE 3H8NA 4Y4FA 4GQ9L 4FQJL 1DBJH 4ZS6C 3V0AC 3L4YA 1I1WA 3FQWB 3QO1A 1EJ6A 4NQCA 3W0WA 3EDJA 2X89D 4EXKA 4B3LA 4H8UA 4ELKA 2WW8A 4P7OA 3WQWA 4W86A 3OR7A 5D6DC 5IJVB 3VI3E 5BZDB 4XUYA 4IRSA 5DD3L 1BYBA 4PBWD 4UQCA 4PJIA 1HCVA 4QDMA 3F7VA 4PG9B 4W5UA 4JFFD 5IB1A 5KW9L 4D6IA 1YYLH 3SCMC 3TYGL 4D0DB 4AZ7A 2XIIA 3VXMB 1OGAA 3L9RB 1UR8A 1RUPH 3FT2B 4C7GA 1FBIL 1MIEL 1FVCA 3HU7A 2YFOA 1EHLL 2DQGH 1MHPL 5GGTA 4QRPA 3BVNB 2NTSP 3C9NA 3VFTB 3SUUA 3WQ8A 3IT8D 4G7VH 3JZ7A 5D1QD 3TN0A 3ZDXE 1VFOA 5DJXB 3QCVL 5J13C 2JK5B 2IQAB 3RVTC 4JDZB 4PG2A 3ROLA 1EO8H 2YZ8A 5DURD 4OZFB 1EOKA 3U9UA 3ZE0E 5ALCH 4CU8A 4WI5A 1AD9A 1Q9WB 3AB0C 3MRLA 4PTTA 1J1OH 2GITA 1BPVA 1NGXB 5GJSH 1WBZA 3A5VA 1HYSC 4O02L 3NH7L 2VMFA 5FM5M 1LWJA 4PB9L 1S9XB 3AHXA 4NRZA 4FHBD 3BQUD 1QLRA 4PS4L 3HG1B 1JP5A 2AEPH 5IK3B 1QNZL 4JPKH 3W4RA 2IC2A 4KJWD 4MAVA 1RUML 3GXIA 3IDJB 2VDMH 3C60C 5E6ZA 1UR4A 4Z7WE 2H2SD 4GRWF 5JO5A 5DD0H 2H6PA 4PJBA 3UMTA 4BFIB 5I2UA 2ATKB 3EW3B 5IESL 2F54A 3HN3A 4XVUD 1D5IL 2DL9A 3HLAB 3Q6FB 3MRNA 5AZ2L 3GSXA 4D71A 2V9TA 1GGIH 2UY5A 1EVTC 2IALA 1WQVT 4M61A 3QH3B 4JIEA 1RZ8B 4HU0A 5JHLL 2DMCA 3QIWB 2H32B 2ENYA 1W3JA 1NCNA 2XN0A 3QUKB 2NY3C 5IBLD 4NCDA 4WUUE 2BNRA 5GQBA 2I9TB 2F61A 1DQDH 4QOKE 4U6XB 3BPOB 2IGFH 1YEIH 3A6BL 1IRAY 1TJHL 4UV4L 4XWOD 1QPKA 4IPNB 1X4YA 4GKSA 5EBMB 3SDCD 2SEBA 1KIRB 1P69B 3LOWA 4X5XA 5LKNA 3VFNB 2CLVB 4LSQH 3PNWB 3REWB 4NJAH 5HDBF 2RCSL 1RU9H 4DKFL 4JB9H 1GOFA 1QYGL 1JK8B 3MA9H 3NCYP 3ULSA 1FL3B 4DOHE 5K9QG 5A16B 4QRUA 2H26A 4Z7UF 4QEGA 1PBGA 1JGLL 2PYEB 4HUVA 2ZCHL 2MMXA 1YPZA 1A6UH