1CXFA

Complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 227
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxfA01
1OAUH 4X7DC 5CJQL 5DDHA 5JXAL 1OGBA 3SJVD 2L4OA 2BX5A 3MGTA 2ESCA 1QSVA 2AEPL 1KV3A 2A83A 1QSZA 4KMTL 4TOYH 1UZ6F 4PJGB 2IQ9H 2XKSA 1KIQB 5FO8B 2EH8L 1W32A 5MEOB 4L8CA 3UBXA 3KWXA 1K4DB 4XVTH 3CXDH 4J2XA 1RK1B 2BK8A 3DC0A 1EZVY 1EBAA 4H8WL 2F15A 4AEFA 4PJFE 1MH5A 3NFNB 4X9YA 1MCBA 1W0WA 5T3XL 3N1FC 1CD0A 2GI7A 4U1LB 4RMTA 3V6OA 5ABFA 1ZKAA 4YLQT 2WAHA 4LRNH 5IVXE 5TF1L 3DYPA 2VISA 3ZKNC 5D72L 4C4KT 5B38A 1M7DB 2CK0H 4NNPH 2PXYB 1C08B 1QRNA 3PL6B 4ZO7A 3SDAC 3GXMA 1ISXA 1WZ1L 4R97B 1U8IB 3T3PF 4FNQA 2FJGB 3CFEB 2GVYA 4UQ2A 2XWEA 4U7SA 1LO5A 4YC2B 5MEQA 2FDBP 3OGOE 3WS6C 1AQ0A 2B8OT 2IG2L 4HH8A 1DWGM 4ZPTA 3PABA 5IVZA 6FABH 2VXQL 1UB5B 4D6HA 1VFAA 3HPLB 1IZKA 1MJ7H 2FR4B 4PMUA 5HYJA 2HVMA 2CGRL 1SBSL 3AMKA 3VXOB 1GCFA 4H8WH 2A77H 1GOOA 2ZKHH 2M26A 1I7RA 5C2BL 4L4OA 1DQLH 5FYJE 4QY8B 1JPFA 3K74B 1VDGA 2E3ZA 4LSQL 5AYBA 4JPKH 5IB5A 2CXKA 2XN9D 2X4RB 5TPWL 3QRFM 4WV1B 4EVNA 2WMPA 2OJEA 3V6BR 2A6IA 1JNLL 5K9OA 3FXYA 4UZUA 1F3JB 2V5MA 4KRTA 1EH9A 5DJ6A 2VXQH 1GRWA 4ESKA 3PGDB 5GGRB 2EEXA 1WFTA 4F9PA 3VFVA 4GLRI 5AYUH 4D6DA 5IT2H 3VIOA 2JIEA 3OF6A 4I18B 4JO1L 4U0RC 1SBSH 5DK0A 2BDNH 2YKLL 4P8XA 4X6BA 4YPGB 2XQYK 4AD2A 3KYNA 5FO7A 3H0TB 4F7CB 1EHXA 1CLVA 1UCBL 3BVWA 1OP5K 1H8SA 5JHLH 3QEUB 3WKNA 5C0DA 4KWUA 5C3LD 4LSQH 3TYGH 4DWHA 2HLAA 3QDMB 2N1KA 1DE4A 4X9BA 2EXOA 3EJJX 4ZFGL 4AT6B 3W0KA 2F5AH 4HP5A 3KPOA 4XXDB 4BM7A 3HE6D 1A7PL 5D9MA 3NN8B 2MCG1 1HINL 4ODUA 4DM1A 3RIAK 4KV5F 3DWTA 4FQ2L 5GGUA 3FZUD 4LOUC 3ALFA 3ZDZE 1D6EB 3QJHB 1OQOA 1OGTB 3CNKA 4Q6YA 3PZTA 3M6DA 1B90A 1CE1L 5LXGL 2HN7A 3RWIB 2D20A 3AMCA 5DHVA 4U1MB 1BFNA 1GGCH 2YKLH 5GIRA 4EAMA 4NUGL 3EW3B 2XQBH 4N68A 5ADOL 3ARQA 4RNRA 1NGPH 2Z31A 2EDFA 4M1DL 1KCRH 3FRPA 3SGJA 4APQA 1OM0A 4XB3A 1RIUL 3F4VA 3F7VA 5E8EB 4MNMA 1MEXH 5EBMA 4X5WA 2MOVA 4CKQA 4PJIE 1BMGA 1DUYA 1L8NA 3HI5L 4IRSD 3RI5F 1HKLL 3AB0B 2VRQA 4IOIA 2PTVA 3TH3T 4RAVB 1HINH 3B2UD 1W9PA 2FHCA 3ZDXE 2WIIB 4FQ2H 2GTZB 3VXNA 3C6SB 3I6LE 5CEXA 4MCYB 3Q1SH 2XIIA 1JHKL 2X05A 3ELAT 2PYFB 2LVCA 1HXJA 4ONGH 3I50L 5FYJL 5LXGH 1XIWB 4F7EB 2L7UA 1KENL 4ERSL 3ILPA 3CMJA 5C0CB 1HWHB 2CDGB 4ETQB 3JWDH 1TMCB 3RBSA 1SYSA 4LCWA 4ZUWB 1JG9A 1I1WA 4GKOA 2D7PA 3BDYH 1T0MA 2QHRL 1QOKA 5DDHB 2FB4L 2KQMA 3ARFB 4PJAE 3CSBA 2X1PA 1RFDL 4LSTH 1FAKT 2P5WA 5T1LB 3VRIB 3MANA 2XA3A 1GHFL 2Q86A 4O2EB 1LLOA 4PGDA 2A83B 4YHYB 2PR4H 1TR1A 2CO7B 4OGYL 1HEZB 2XG5A 2BERA 4HD9A 2FATL 4HX1A 4PJ8D 5GGTL 2UY7A 1B3XA 4B0MM 1FSKC 3WJLC 3ZE1F 5H35A 4G5ZL 4XMKH 1S78C 4LFHG 1EXPA 3AU1A 3Q6GL 4FTVB 4QRSA 3T0AA 1CDBA 1U3YA 2FX8L 3I50H 5FYJH 5BW7C 3UDWA 2C3XA 5I1HL 1ZB5A 2Y8KA 1W0WB 1X5YA 4W70A 4WHYH 4ERSH 5ABFB 3TJHC 2FBOJ 4MDOA 1UR1A 5EFDA 2B5IC 5KZCD 1GOMA 2VISB 2IC2A 2ICWJ 1LEKB 5I1IL 4QAWA 5J12C 5ADPH 2D31B 4KHTH 3GNOA 1F4WL 3FT2A 2VX4A 3TNNA 2WUBH 1OWWA 3FB6A 3ZO9A 4ZSOE 4J6RL 3ILQD 4UQ2B 1S5HA 3EOBB 3CK0L 5MEQB 4M8VA 3IK2A 3MRLB 3OKMB 4YGAB 4OQTL 5EZIL 2QSCH 4PN2A 3HRZA 3D9AH 3L3DB 3CSGA 4NSBA 5A1AA 4OGYH 1WC7A 3HG1B 4MNQA 5BV7C 3BZEA 3WF2A 4HV8A 2FATH 4KKNA 5GNZA 1I1YB 4XRCA 4G9DB 3TT3L 4NO3B 3E6FA 4UFMA 3MXVL 5ALBL 3V5DB 1RMFL 3PDOA 1A14H 2CXGA 4P2QD 1W9UA 4ZFZB 3HMXA 4UTBH 3K2MC 4YXKH 1GGBH 1QI0A 3SDDA 4S3KA 4CBPA 3EJUA 2WB5A 3TO2B 1M71A 1DTUA 1JPFB 2HP4A 2NY5L 3ZSSA 1IARB 1XH0A 3S5YA 3GGWB 4PJ7A 5F7NC 4BZ2L 4EVNB 3CFCL 2AEWA 3NCCB 1E1FA 4KTDL 4J7RA 5HGGS 1I3RA 3BVXA 4CUCA 3WUWA 2A6IB 4MQXC 5DJ6B 3FHQA 2ZUWA 1UH4A 3MYZA 1AGBB 2V2XB 4HJJL 4JFDD 4MZ3A 5FM5O 1XGYH 3VFVB 3ULUC 1B0WA 4KI5F 3KXFE 1XD0A 2VDRL 5DK0B 2GFTA 2Y8VA 1NAKL 4WUKL 2CPCA 3NDZA 4K3EH 3KYNB 2LVEA 4OFDA 5E00A 3RGVA 4U1GC 5ABEA 2PF6A 2A74B 4ELMA 1I4FB 4WU5B 1HVXA 2XGBA 3V0VA 2X40A 3LQAC 4I4WA 4PJ7F 1RZIA 4PJHB 4QRRD 2HLAB 4UIKH 3IDIB 1DE4B 4KKCD 4MNLA 4AZ7A 5HJ3A 2H26B 3QUZC 8FABB 1ZBWA 1PJ9A 1T4KA 2MNUA 1DWIM 2XT1B 1D6VL 4PGEB 2VKWA 4RQQB 2NCMA 5KVDH 4M62H 1BOGB 3QO0A 5EFFA 4P5KA 4P5TC 3PIQA 5CIPA 2OZ4L 4EZMA 4IRJC 4I5BA 5F3HA 1QEWB 5MI0C 3MMUA 4QFUA 4LMQE 2VAJA 4RX4D 3TZVA 1U3ZA 4KKBD 3VFTA 5HVFB 1YYMH 1V5JA 4NQCE 1UZ8B 4HZ7A 2PBOA 4KJPD 4UNIA 4PRHD 3VXUB 1GC1C 1C92A 3ZQ9A 4PGZA 5DHVB 4NKMB 5BXRA 2ZCHL 1NC4D 2WWKO 3QUYA 1RI8A 1WBXB 5F71A 4RNRB 2Z31B 1HKFA 2RJMA 4FXGB 1BZ7A 5A6KA 4APQB 4LPVA 2DQUH 4XAKE 4JO2L 2BMKB 1G7PB 4PLKC 1KR1A 2G9HB 1DUYB 2AP2A 1SBBA 1XEDA 5TQ0H 4HKJB 4WLCA 3JWNC 4QLRA 3EYQC 1A8JH 1CLZH 1RZJL 5D1XC 3VD9A 2CR6A 2WANA 3MRMB 3WHE0 4JDZB 4NHCL 2BRQA 2E7CA 3AC0A 3TLRA 3FONB 5DVKA 4FNSA 2VR4A 1KXQE 1D7FA 2W9LA 5J1TC 3GXTA 2J6EA 1V0NA 4L3EB 1WAAE 5LBSL 2ICWA 4RGNE 5IW3A 3ARPA 1DEEB 4NWTL 1GPFA 2MHAA 1G7IA 2IBZX 1T83C 3UZQA 2JJWA 3HI6L 4KXZI 1T03L 5DYOB 5J6HA 4UAOC 1EFXD 1QVOA 4MDPA 1WFNA 3OZ9L 3VXME 5C0AA 2YRZA 4OIAA 4IPNB 2WNGA 1T2JA 1WNOA 5EOQL 1MVUB 2V9QA 4IHOB 5C0EA 1F58H 5TE4L 4CW1A 4FLSA 3WBDA 3MV7D 5B8CA 1DBJH 3BI9X 1JWUA 5HVGB 4NZJA 2R23B 1CICA 4HX1B 3CFKB 3PGFH 4HFUH 3U7WH 4P7QA 5DMIL 2A2QT 4NQDE 2V9TA 4RDQG 3SCMD 2IBGA 3QEGH 3MJ6A 4Y4FC 5DJ8B 2D7MA 1HHHA 2I07A 5H35B 5J1SC 3RY6C 3O4LD 1BM3L 3MBXL 4GW4A 2EDKA 1S7WB 1Q9WB 3F62A 4LGPB 2EABA 4PP2B 1HH6B 1H5BC 2NY6B 1NP2A 5IB1A 1QPXA 4OJFL 4WY7L 5AZEL 3IDNA 3LKQA 5DC4B 1XF3A 5C0RL 4BSVA 3OL2A 5D7IE 3WIIH 1V6VA 2FIKA 3W9EA 5D1ZD 2RHEA 1R3KA 5LA2A 3V0WH 2J75A 5HGHA 2ORBL 1XYFA 4L4TB 1ORQA 4Q0XH 4Y5VB 2EDQA 5CD5D 1S5HB 1ZV5A 3ZZ1A 1Q9KB 2FSEB 2F61A 4Z7VA 1D5IL 3WUBA 4OJYA 1JGVH 1IEBA 3BP7A 1J1XL 4CCEA 1MVFA 3BGAA 1EHAA 4DZ8B 3L3OA 4XRCB 4ACPA 5I16B 1YMMD 2IPUG 3E6FB 3PDOB 1JYNA 3BMVA 1H2JA 3VRJA 1MQKL 4XNXL 5FOBA 4H20L 1E4XL 3ARGB 1CDCA 3IFPA 2J7LA 3FFCD 4OCSL 3ESVF 3BAKA 5AZEH 2R0ZL 4DO5A 2ZP0T 3ZMRA 2QEJA 5J56B 2BFVL 4O2CB 4PJ7B 4QRPD 4YHIA 5GSVB 2DLHA 1ZVYA 2YPVL 4Z7VF 3IDXH 5FGRA 5EZJA 3GIZH 3AIWA 5FL1A 4M6AA 3WDJA 3O6FC 1LK3H 3LPGA 3S4SG 2AQ1A 3EYFB 4C83A 1HHKA 4Z6AT 1MAMH 3WIFA 2P24B 2F5BH 1AGFB 3PP4H 1MWAA 3EZ8A 3MMDA 2AK4E 1CXIA 4JY5H 3SURA 5T3XD 1MW0A 4PRPB 2WBJC 2Y5TA 4R8WL 2BVPA 3DARA 3SO3C 2VJXA 3CH1B 5IB4A 2BNQA 2DQJL 2OK0L 2OYPA 2LU7A 1WE5A 4H20H 4QLLA 1XCXA 2RCSL 1Q94B 1U93B 2EC9U 3DOSA 3RGVB 4WUUB 2F8VA 1BAFL 5H94A 3WL9A 2ADFH 5GGSA 2VLRE 1X3DA 4I4WB 3R4DA 1PFCA 3P11L 1FCGA 3CX5J 3KPNA 3VGAC 2O5ZL 1A3LL 5HPCA 4U1KA 3U2SA 3BGMA 4PCTA 1KF9B 2XPKA 2YPLA 5CGYC 3OMZA 1FVEB 3VSVA 3WJJC 3PIQB 5CIPB 1QI3A 3EZJB 4I5BB 4HJ0D 5F3HB 4RE4A 3GXIA 1WWAX 4ZUVB 2YRPA 1FH5H 2BVTA 2LE9A 5GHWH 1FAIL 2OQJA 4E4PA 4R8WH 5CPSA 3QUYB 1F4YL 2AXGA 2OK0H 2VXVH 4MJID 1L0QA 1H3TA 3CMGA 2Q76A 1KIRA 4H26B 1KJ2B 5BVJA 4PGCB 3SBWC 3C6LB 3GYCA 4JHBA 3P11H 1JWSB 4U1SA 3QI9C 4UR9A 4HWEL 4HUWB 4L5FL 1ERNA 4OGZA 5B3NA 1E6XM 4HC1L 4P9HC 1QSEA 3BPOB 4IMKA 4CRPA 3SE8H 1M7XA 1FNHA 1IM9D 4R90L 3F65A 3TA3A 4J1UB 1DANT 2IAMA 5IBTH 4FQCL 3GBML 4POZC 1AXIB 4X7TA 1LQ0A 5JNYA 4P23A 3F8UB 3GSNB 4ZFFA 4U1JA 1C1EL 4G6JL 3E3QC 4FFVC 1FAIH 3CUGA 2DKSA 1G7IB 3O6LL 5FA4B 4OF0A 2RGSA 1PZ3A 4XWGL 5J6HB 3VWJC 3MRGB 2X42A 1QVOB 4TUKL 4W68A 3UX9B 5D6DA 1U42A 5C0AB 3MJ8B 4IRZL 4LNRA 3BRFA 3DMMC 4ZTPL 1BGXH 3RPIB 3LH2L 4JL1A 5C0EB 4CW1B 5CBAB 4L5FH 2CDEB 3QAZC 4XP9H 5L8KB 5B8CB 3OG4B 4JRXD 4P4RB 4HWBL 1PIFA 5FM4A 1MAKA 2B0SH 2WWKT 1IGJB 4I0PB 3GBMH 5I75B 1MLCA 1ZA6B 2BOBB 3WFEH 12E8L 1RJCA 4JVUA 1AGDA 4PJBE 4ZYKB 1MI5E 2OSLA 1OLZA 3HZKB 3DVNA 1C1EH 3HNTH 4GW4B 1LWHA 5KAQG 3QH3A 3QQNA 4K8RL 1E56A 3U0WL 4X83A 3LN5B 4TRPH 4HBCL 3CJJA 5FD0A 3KVQA 3IDNB 3MLRH 1ZHKB 1GNXA 2FIKB 1R3KB 1F45A 4H88L 4D3CH 3VD4A 1OP3K 3WSUA 4HA3A 5HGHB 1NCWL 3LH2H 3EIFA 1ORQB 3ALXA 1A6TB 4D1IA 5DD1H 1DDHA 1A2YA 2K1MA 1ZLSL 1ODUA 2D3LA 2R8SH 1UWSA 4Z7VB 3GSOB 5DS8B 2UY4A 3UZVB 1RZKC 5DQ9B 3A67H 5MP6H 4HMEA 2ESVE 1NGYA 5FYJD 4PLJC 2D7TL 3JWOC 2OS7A 1OGSA 2QQNH 3E1F1 1QSFE 4E0RB 3VXSA 4PBVC 4E8CA 4M56A 4LCCA 3LDBB 1BYBA 2J78A 2W60B 4OCXL 3IFPB 3RNQB 3HNVH 1MW1A 4XXCC 3PP3H 5J11B 1YECL 1W2PA 1ISYA 1R3IL 3B5TA 3WNKA 1CL7H 2ENYA 3UPRA 3VIIA 4H88H 1UWEL 3GBDA 1EAPB 1ZS8A 1NCWH 2YD3A 3SKMB 4NZRL 3MUIA 5JBEA 2DDQH 1ZLSH 2GJJA 5HYSA 1VIWA 1K2DA 4ZO6A 1T1XA 5DUML 3WIFB 5EO1A 4C54A 2P45B 2YKKA 4I9WE 3EKCA 1MWAB 2YL9A 1P5VA 4GMSL 1WQVT 3QDJD 3OPZH 4PD4J 4DAGL 2Y5TB 3EDEA 3HLAB 3MS8A 5IB4B 4RA0C 2E9MA 3VW3L 4F57H 4JFUA 4DKFL 2NY0D 3WL9B 2D7NA 3KPMA 2BY2A 4PJ8B 4QNPF 4N42A 4MVBC 3NIDE 1MYRA 1LGVA 3WFHA 1N5AA 4GBXA 4IPLA 3QZWB 4UT7L 5B39G 3KPNB 1D5XA 5CSYA 1OAYH 1FZKB 1KLGA 1QLRA 2NW3A 2FHBA 3H42L 4U1KB 5C07B 2Z91A 3U2SB 2ZJSH 1NANH 5DSCA 2A6KA 3QA3B 2IGFH 5CZXC 4ALAL 1MXGA 1FP5A 2VKXA 3BJLA 4O58H 5FDWA 4KROB 3AROA 2OXHA 5F97E 1UB6A 3FQRA 4ISVB 1ZSDB 3D69B 2C9AA 3N06B 1BFVL 1A6AA 4J4PC 4RAHA 2XSBA 5BZDA 2PXYC 2BHZA 1DLFL 3PL6C 2EIEA 4PGJA 3C5SA 3HN3A 4R97C 5L2KE 1TVDA 2Q76B 4B9ZA 4TX6A 4S11A 4Z7WA 4X0NA 1IGYA 4Q22A 5D2NE 3WH5A 3AIRA 4YC2C 1U8NA 2QQLL 8CGTA 4U1SB 5D70H 1WCQA 5C7XL 4QXTA 4V2CB 4OCYH 3MROB 1YZZA 3TTYA 3W25A 5AUMA 5GS2H 2DH2A 1ZU8A 2OL3A 4PJDA 4P23B 3ZJKA 1RJLA 3IU3A 1JFQH 1C5CH 3GZAA 3IVKA 3RWEB 5E24E 4XPAL 5DI8B 1K9DA 4FXKA 4Z7WF 1BFVH 3OJDA 1YA5A 1R5WB 4GAFB 1PX3A 1FVCB 5I15H 4WV1C 5M7QA 4CAGA 3PWNA 3V4UH 4PJ9A 1U8LA 4LNRB 2VURA 5L8JB 4O00A 4JFDB 3EDDA 1U6AL 4OF6A 5CJXA 3ZTNL 3TYFA 4G3YL 1HYRC 3TBVA 5HI3D 2IBZY 1MLBA 2DM4A 1ZT7A 3JV4A 4GKSB 2OP4H 3STZB 1E4KA 5IBLD 3HR5B 3DI2B 4X9IA 4LLQA 5DRNA 1ULVA 5EUKA 4PJDF 4EXKA 2AK1L 5JUEH 4I18C 1TQUA 1KN4L 1T5XB 4LDEB 2DL2A 2XZAH 4N9GA 4Q9QL 1KGCE 1KTKE 1MLCB 3BHBA 4PEEA 3OGCB 3IU4L 2DTSA 3WH7A 1HWWA 2OSLB 2ZXBA 1CD1A 3NMEA 3SCSA 3DVNB 1NCDH 5KSAC 5B22A 4GG6F 3A6BL 5CFHA 4NO0A 4LCYA 5FCZA 5JPMA 4Y2DD 2ZUVA 4JLRB 4PG2A 1X5LA 1JNDA 4E41B 4J3UA 3UXFA 3Q3GB 2E7LC 1D5BA 5IQ7L 3DIFB 4MHHI 4RFNB 3DXAA 7TAAA 1U6AH 5IOPA 5D7JD 3U30B 1XF5B 2HA1A 2HH0L 1UR9A 4NDMB 3U7VA 5MENA 3GO1H 2VC2L 4KJWC 2O9OA 2J8UE 1EEYA 1FG2A 2AK1H 4J28A 4MMZC 1NGYB 3VGBA 2X4NA 4A6YB 4Q9QH 4IEFB 5EBWB 4URTB 2AJYL 4YHEA 4YFDB 2LU3A 2XZZA 3W38A 1RD6A 3LRHA 3D18A 1CLCA 3O45A 5K59E 2ZWLT 2XHYA 3AB0C 1JPGB 2F1BA 3GH4A 2FX9L 4QOKD 3ZHKA 4OGAC 8A3HA 3UPRB 3G6AA 3IJ9A 3D52A 1ZS8B 3VA6A 1IRAY 3WD5L 2B2XL 5IHBA 3PHSA 3A4WA 3X12B 1NGQL 2X89A 2V3FA 3UERA 4OLWL 2HT2D 4Q7DA 4CD8A 1KELL 5ACZA 3WLWD 4PJXE 4M43H 1HILA 1K2DB 3UBXG 4R7NA 1IAKA 1SZNA 1WICA 1XIWC 1BF2A 2NR6C 3LEYH 3UTTA 4GAGL 1X5AA 3LB6D 5TDNA 2DQEL 1JNEA 4PJFA 4NRYB 1HNGA 3MV7B 1C16B 4EUPB 3MLZH 1TJGH 3CPLA 4GAYB 1UENA 4GW1A 5B38G 4AIOA 5IVXA 5TE7H 3ARFC 2HG5B 3QNXA 2YSSB 1A1NA 3HG5A 1HYSC 2FX9H 1DL7L 1FZMB 4MX7A 1ITCA 4UQAA 2D23A 4YHYC 1D5XB 4Z8FL 1A3QA 1KLGB 3W0WD 2NMSA 2NW3B 2B2XH 1H15B 2Z91B 4X98B 5CJOH 4N5UA 1QFWM 1UWGL 3QIWD 5DSCB 2W9EL 3WUZA 2A6KB 2YL6A 1FZJA 5BXSA 3BCDA 1KELH 3BAIA 4Q58C 43C9B 2ALWA 1UA7A 5D9OA 5BXTA 3O8XD 4N0FA 3CDGA 1L9MA 3V6OC 3BT2L 4PJFF 5JXED 2XSAA 1AKJA 2FWOA 4JZOB 1QNQA 2V7NB 1I1AD 4N8CL 3CFBA 5L7XH 2AJVL 2HT4D 1C8QA 5IVXF 1IKFH 3ZKXB 2VDLL 5EO9B 3TJEL 1SYTA 4Z7WB 1IGYB 2IEPA 1FG9C 5J13B 1JZ5A 2BNJA 3C5ZA 3QHOA 3PHQB 3MRQB 1U8NB 4YX2L 1I9IL 4RWYL 3B4NA 4WHTB 3LV3B 4BQ9A 4Y1AE 3B9KD 4QXTB 5ICZB 1W72A 3QEHA 3SKNA 4KRLB 3G5VB 3MRCB 1ZVSA 4IJ3B 3AJ7A 1KGXA 5LGJA 2W9EH 4EI5A 4LXFA 3VXRD 1RULL 3NZHL 2EBNA 1KIPA 4OV6F 4AEHH 3EYVA 3MV9E 4PJDB 5DD0L 2DM2A 4LNVA 1EGZA 1RJLB 1E4IA 1INEL 2DT1A 1T04A 5IIEB 3IVKB 3BAXA 1LO0H 4F7MA 1URLA 4CJ0A 1ZLVH 3NUKA 1O7VA 4FFWC 4GG6B 2XI9A 2A9ML 4BK4A 2GJPA 5F72S 1JGLH 1A47A 4PJ9B 4B3KA 4KUCF 3MODL 4GG8A 4QHLB 1I9IH 3TYFB 1LE5B 4HA4A 5IG7B 1YDPA 1DSFL 4ZOCA 4RISL 1I8MB 1MIEH 1XCWA 1UM6H 4LAJH 4NOFA 5DRNB 2HFFB 1EOKA 3CC1A 3LRSB 4CVUA 4D9LH 1A7QH 1JPSL 3BHBB 4C57C 3OKKA 5DD0H 3MKKA 4QHUB 1BVNP 4Z0BL 2OTPA 2YD5A 3MGOA 3PWLA 3OKLA 3QNZA 2GDVA 2F54B 3FRPG 4LCYB 2IADA 4LMQI 1T6VN 4S1DC 4PRIB 2ITCB 5A16A 1CFVL 3DROA 2E9BA 2GFBB 5C0FA 1D5BB 1X5XA 2R2EA 5CHNA 3CZFB 3DXAB 1U92B 3VMNA 4OV5A 1I7TB 3VH8A 3OKNB 4F9LA 1ACYL 3IRPX 1U3HD 3RL1A 5I1DA 3VFWA 2CSPA 2RFXB 3AXLA 4M7KL 3P0YH 3V5HA 1FNLA 5GS0C 2XRAL 5IJKA 5D9NA 1HKMA 3A21A 5INDA 2OWCA 3ZDZF 1W9VA 1AO7E 4LEOA 4DGYL 1EEYB 2IANE 1DBKL 2X4NB 2VH5L 2VB5A 2VE6B 4JG1L 2Z31C 4R4BA 1VERA 1BX2A 5CP3A 4Z0BH 3BAYA 3SGJC 4APQC 1ZMYA 2XWTB 2YC1A 1J9CT 2A1WL 1A1OB 3AAZB 2NY3D 4MDJA 3D18B 2VDML 1IEAB 3MUHL 1YEIL 4U4BA 3FB5A 4PJIF 3AXIA 1SEBB 4QHMA 1W2VA 1BJ8A 1IGIH 4FQJL 1KB9K 4QHNB 1EMTH 2BVOB 4NQEA 2QHAA 4PJAA 4HUXA 1ND0B 3ZDXF 5L6YH 5ACZB 4FP8H 1DVFA 3O11B 4M7KH 1HILB 2GCYA 3F58L 1IAKB 2G60L 2ZG1A 3DBXB 3QO1A 1IAMA 2IPTH 4DUXA 5ECUA 4K8RD 3FO2B 3IAQA 4UI2A 2GUYA 1GZQB 3EDFA 2G3IA 4G9FD 1GPOL 1G5AA 4PJFB 3SKJL 4NX0A 5C09D 5DVNA 5KSUB 5CS7A 3AS3A 3CPLB 1TQBB 3WIHL 5EG6C 3T09A 1BVKB 2VDMH 3MRRB 3D3AA 4PS4H 4MD5B 1A1NB 1MY5A 2NY1D 3RI5K 1NLBH 4NI3A 1FJ1A 4J8RA 3VXTB 1LL4A 1T7VA 4B53A 4PJAF 3NABH 1HXMB 3SCVA 4Z9KB 3O6AA 4XPTL 2EDBA 4JO3H 5EH1A 4ZSOA 4PB0L 5T1DL 5GRWA 1OSZB 5DA4A 1FZJB 2ZUQB 4Y19E 3CFIC 3MFFB 3B9DA 5KOVC 2J88H 2G60H 3GNML 4P59H 4DVRL 1PLGH 4UILL 3PHOA 4PRNB 2NY6C 4EKXA 3OJVC 4N90E 2BV9A 1V3JA 2FWOB 3B9VA 3DDFA 4HOWA 2WWCA 1GPOH 1MCOL 3CFBB 2C7FA 3QPXH 1U2YA 1TQCB 3QCVH 1QW8A 1OB1B 3GI9L 5HHOD 5HDQL 5AEAA 1SR0A 4Y5VC 4PJ5E 4M24A 3BUPA 3C5ZB 1N4XL 3ARBB 5BVPH 1VAHA 2JIXD 5FKAB 5DD3H 4ACYA 3RWGB 2AJXH 3WMSA 2IALB 3T0WA 4ZS7H 3WUWG 3HB3C 5HHXL 2BY3A 1I85A 2AAVA 3I9GL 3CIQA 1JGDA 1ZVSB 2Y23A 3O3EA 2EPNA 3RVTD 4EI5B 1LDPH 1OF2A 3PNWA 2RR3A 2VN4A 3LCYA 1IZJA 4PTTA 2CIIA 1FCCA 5HBBA 4WRLA 3ARGC 4KI5C 1E3XA 1G7QA 4NT6B 3W53A 4UILH 1T04B 4QTIH 3NIGE 3GB7B 4F7MB 3KXFA 4KMLB 1MJJA 2XXCB 3T0DA 1V8HA 4IS6A 1AGCB 1MCOH 2P44B 5F1NB 3ZYIA 5IV2B 5FECA 3KEHA 1T89A 3S7GA 3LS5H 2DQDH 3QULB 5JBDA 1N4XH 6TAAA 1BQHB 1UVQA 1W2KT 1T3FA 2R1YA 5KANG 1BPVA 4GH7B 4OZHB 4ZXBA 4MNGA 2VCCA 3I9GH 3Q2CA 1TVPA 2NY0B 4UV4L 3DX0A 4HW6A 1S7RA 1EGJL 5F7DB 3W24A 1CL7I 3RGVC 3P4MB 1HSBB 2QPUA 1AI1H 4NQCA 5F96H 4D2NA 2A6JB 4I2XE 4RRPA 3QNZB 2ZOLA 1P69B 3EJYD 2XWBA 1ZA3A 2GTWB 3OKEA 3CD4A 4ZOEA 5CEZE 1Y0LB 3BPLB 3UR7A 5ESQB 3WF3A 5A16B 5MEPB 3L7FB 1IFHL 1SFSA 3IGAA 4WSJA 4Z7OE 3MLWL 3RCNA 2X1OA 4LLAA 2DPEA 4PJIB 3OAUL 1D5MA 2X2HA 3WY1A 3BISA 1X6NA 3QUKA 5I1DB 2AABL 2GJXB 3TZVC 2XICA 1WFOA 4Q7NA 2XGIA 4YQXL 2QQKH 4EANA 2ICEA 1EGJH 3QUYC 1S9VB 3VVGA 2W63A 1MFDL 3BQUB 5KBNC 2D73A 3TC9A 1BFTA 3O9WA 4LHUA 1WAAA 3U36A 3G5YB 3K46A 5D6CB 2X70A 5C0JA 2VLME 2JLLA 5IWLC 3JV6B 3F7YA 1GOQA 2YC1B 1CECA 1WGOA 3C6LC 3WF4A 2W07A 4MAYD 4PY7A 1NANI 4S1SH 1QNPA 4L9LB 3BKYH 3NAAH 1TJIL 1H41A 4Q9RH 5AC4A 3QQ9C 4F7PB 4ZEPA 2KZWA 3BPOC 3FB5B 3T77A 3N1AA 4XNYH 5HGBA 3VXMA 4QHMB 1IL1B 4G8IB 1HP4A 3LIZH 3ULUL 3ZOAA 1GAFL 2DM3A 4KK5C 1PSKH 1XCTB 2WLZA 4PJAB 3OAUH 1ZEAH 3HCVB 2O5XL 3IKCA 3QEQD 5GRUH 3EJRA 5TH2A 3GRWA 3AHTA 5KVGL 3LEXA 1CEOA 3LQAL 2VABB 15C8L 4JFED 4MNHB 2CKBL 3A47A 1WAAF 1YN7A 2D0GA 4NQDA 4HPOL 5A3IC 1CYGA 5DJCA 3VI3E 4ODHL 4JDVA 1I8LC 4AJ0A 5HOSA 1OD7A 2NNAB 3GMOA 2XXMB 1G0CA 5SX4H 2WKLA 2DYPD 3ALWA 5B8CC 5D7IA 4QP0A 3M1BB 4PFEA 2X9WA 1GC1L 3SCPA 2X6MA 2X4PA 4PB9L 3MACL 5E4IA 4BH8A 1CICC 4FZEH 2F7PA 1E5JA 4I0PC 4ZSOB 1IAIL 4K3DL 3NFSL 1U33A 1FGVH 3MV01 1CLYL 2O5XH 3FQNB 1AP2B 5DO2C 4JO4H 3BIBX 2PYED 15C8H 1I9JL 2CKBH 3TN0A 4QEGA 5D93B 4R4ND 1MCKA 4U1NA 4XCEA 3S6CA 1H3GA 5DRXA 5D7JB 3RWCB 3ARVA 1F4HA 1OWRM 3WF1A 4AZHA 1P6FA 2ZG3A 3FHAA 1EBPA 3MJ7B 3GSXA 3O2LA 3A6CH 4HA1A 2CBIA 3PWUA 1EDTA 5E1AB 5D7IF 2V5SA 3BLPX 4YDLC 2W59A 3SJVA 1K8IA 3CLWA 1X5GA 3NA9L 1QFOA 3BIAX 4DWSB 3EJZD 3RUGE 1NCUA 4X99B 3Q48A 4XNZB 1JGEB 1AFVH 2GK0A 1QTYT 4W4OC 2F53D 1YY9D 1JGDB 1IAIH 5DZLA 3NFSH 3SY0A 5EZLA 4HZ6A 2ZOKA 2AI0L 4K2UL 1JPST 2FO4B 3UAJC 5KSVA 3AUVA 3FAXA 1DQMH 2A0LC 4QOKB 3PV6A 1CXHA 3LDBC 3OR7B 1JNNL 2GSIB 1JAKA 1BBJA 2AK4A 5CEZH 5J11C 4UFHA 4CCDA 1I1RA 3H7BA 1Z9OA 5EIVA 1EVUA 4MB4A 5E2UH 3CH9A 4K9EC 4M93B 1PBGA 3X14A 3WS3A 3MMEB 2VLRA 3NA9H 1YY8A 1PEZA 2O61A 3RNKB 1U95A 3V52H 2R1YB 2DT3A 5I1KH 5L88H 4NO2A 4N0YH 4OKVB 4DW2H 1CF8H 1RZGA 4ZUTB 1PVHA 4AL8H 5JO5A 4BZ1L 4HH9B 3RZCA 1CXEA 3WHXA 3WH8A 1D9KD 1ZBKA 3TBWA 2X1WL 4K2UH 4LCIL 4OFYA 3N18A 1CDHA 4FQLH 1NUNB 1F42A 1P7QD 1MUJA 1PKOA 3L7EA 4K71C 4NQCB 2TAAA 5IQ9A 2J7GA 5IB2A 2XN9A 4HIIA 4MJ5B 4K94H 3GBLA 4KJYA 2VQ1B 4WW2A 3WEMA 1GIGH 1B0RA 3P9WB 1ITBB 3ZLQC 3S2CA 4UDUA 3O8XB 5ENWB 4Z2GA 5IGXL 3EMQA 4QRTA 1E27A 3QIUD 2CKNA 5T1KA 2YXMA 2J4GA 5GRZA 4UDTA 1JD7A 4KROC 5HDRA 2BP3A 3LQZB 2IH3B 4N5ED 4QRQB 1FGNH 1NWUA 2YLAA 4BQ4A 1A0QH 3LOWA 3FOLA 4Z5RA 2VZ1A 3ILQC 5T5FL 4LCIH 1NPUA 2ICEB 4XCYB 1KGWA 5DTFB 4WNQA 5DJAB 4WFGE 2GYSA 5T33L 1QFHA 3O9WB 3G5ZB 4LHUB 3U36B 4OLXL 3WFLA 5C0JB 4RGNB 5HGDA 5CJ8A 3QWOA 3RIKA 4K7PL 3DNKA 4OLEA 4AZCB 3AZTA 1HH9B 3RJXA 1KFWA 3GK8L 2HFGH 5ICYA 5IJVA 1KB5A 4RGOH 5E8OA 4QXGL 3VXMB 4M7LL 3T0ED 4R4FH 2IAMC 1F4XL 1FNGB 1WWBX 3IJSA 4M6ML 1G9HA 3ARRA 3P73B 4NZTL 4Y16A 4MCZA 3ZKND 4W8AA 5DO8A 4P23C 3IKCB 5EUOE 3H9SE 3MA9L 5GGSY 3VRLE 2XVGA 5TH2B 1U0QA 5FO9B 3SGDH 1I7UA 3WUEA 2Y25A 3GMPB 4RZCB 5CLTA 3VOCA 1IM3A 1N59A 5D96C 3WE6A 4C7DA 4NQDB 3BVTA 3BDXA 5T5NG 1GSMA 4B9YA 4OOZA 1V0MA 4XCCL 4OZ4B 2VOTA 4PJBA 4YWGL 2G3MA 4LVEA 4OLXH 1G9NC 4YNYB 5HHQA 1QNZL 2DSKA 4HFWB 4ZAKB 3WN5B 4LBEB 3GEWB 1J8HE 4IRSA 4MAZA 3GK8H 3K7UA 2CRMA 3QHFH 2VAAA 4LSRH 4DUWA 1UQZA 2N4IA 5I8KH 5CUSH 1OSPL 2DQGL 1BECA 4GUPA 4AK1A 1B3JA 1F4XH 2CUHA 4X8JA 2EECA 2X4QA 5CINL 4M6MH 4WFHD 3U9PL 1YPZA 4KKCC 5CP7A 1UADC 1ZHLA 3SUWA 1A6VH 3G6JE 1UH2A 5DWUH 1UXWA 1F8TL 3DTXA 1WPCA 3SUUA 2NTFB 4ZXLA 1XGTB 2ESVA 3D0VB 4PJBF 5E5MA 3TN0B 4MD0A 4YAQA 2FE0A 3IDYB 3GNPA 3QUMA 1QSFA 1T2QH 5DRXB 1G6RL 4P9HL 1GQKA 2AMGA 4KKBC 1QNZH 2EYRB 3GSXB 4UNVA 1V6UA 1T5WA 2ID5A 1WITA 4RFNC 2Q8XA 1XCQA 2YD7A 1FO0H 4Z78B 4TX8A 3U30C 4KZEL 1KXHA 2FEEL 2XZQL 3BVVA 5F9WB 3MV9D 3T08A 5FUZH 3RRQA 1OGAD 1OSPH 1C8PA 4JR9L 5AAWA 2YBRB 2C7UB 2EEAA 3W27A 3VCLB 3A24A 1FA2A 5HYSG 5JOEA 3VE0B 5C0NC 3GM0A 1A6UH 1B1YA 4LIQE 4Q6IA 1IGCL 2NY3B 5EZLB 3P9LA 2VLLB 1ZJAA 5KSVB 4OM0H 1FH8A 1NC2A 1C90A 2PF0A 1F8TH 4MXQC 4HS6A 5FKPA 2LQRA 1BBJB 3GSVA 3WFCL 3X3FL 1J8KA 2GJ6E 1T1YA 2X4OB 4XGZB 1CPUA 2Z92A 2CLRB 3IDUA 3WXVL 5GJTL 2BFGA 1S7QB 4LOUD 4FFZL 3WEXA 5JIWA 1BQSA 4O5LL 1G7HA 3X14B 3SE4A 3PF2A 3INUL 3ROOA 2ZCLL 1E6PA 2R9HC 3P77A 3SHSA 1YY8B 1KWKA 1RJYB 2H3NA 3WSQH 2MQ0A 5DJDA 1BSIA 2YDQA 5I1CL 4AWEA 4NC1E 5M3WA 3RZCB 4P2QA 3DRTB 4CMMA 5A6MA 5DJ2A 1QA9B 5FYKL 1SMDA 4EIZC 3D85D 4LCUA 1BOYA 3TTOA 2JKXA 1S7UA 2VR5A 5GISL 1MUJB 2PI6A 3D5HA 3ORJA 1QKZL 3VFPA 2VLJE 5E2TL 5E0CA 4HK0B 4HIIB 4FQHA 1JF5A 1MCPL 4GBXC 5GJTH 3WXVH 1UHVA 4TSAH 5IHZB 1OCWL 5DJ0A 3NIDF 2YUXA 5I78A 1SJEA 1N64L 1B2YA 4UDUB 3MRKB 3ECQA 2ZCLH 3JWOL 4P46A 5D2NA 4HGKC 3MCKB 3MLXL 4IIQB 4P3WA 1C12A 4XNUH 3WKML 5K9JL 1BVLB 1TA3B 5T1KB 1HWGB 5ELIA 1CGVA 1LMKA 5E2VL 5C1MB 4NZCA 1UD5A 5FGSA 5CJ5A 5DK2A 2AOSA 3CX5K 3KPLA 2VR9A 3ESUF 5E2WH 2W0KA 1HSAA 3L4ZA 2JIXB 2LTQB 1UR8A 4OCLC 4V1DD 3ZKXC 1PKQE 4PV8B 1MHPL 3S3JA 2X4UA 2PO6A 4QRRA 5E5RB 4YR6B 1ETZB 5J13C 4NNXB 1INQA 4DFIA 4Y5XA 3DX6B 3GI8H 1AD9A 5F88B 3BRDA 4XP6H 1H4PA 1A5FL 4Z76B 3HUJE 1S78D 4NRXA 5HGAA 5GNXA 3SKOB 4PBXA 5E6IA 2CD0A 4JY4A 4IJ3C 4XAWL 3DX1A 3SDXB 3MZGB 2BNUA 2CITA 3HZMA 5F93C 1WFUA 3WKMH 1KCUL 3TJHD 1GJUA 3FFDB 5D8JL 1AD0A 1FL5A 2HLFC 3I6GB 4NNYB 3GMRA 4P3DB 2K3TA 4MCZB 2ATPA 4PRHA 5CD3B 3KYOB 1ONQA 3LRKA 4JKPL 1I7UB 3HHRB 4JB9L 1IM3B 5I1EH 1QVBA 4YHKH 2BNRE 1EO8L 3F5LA 4C7FA 4PJBB 4XH2A 1HDMB 1MI5B 4H8WC 4HIJA 5F1OB 1MSPA 2C1PA 2WWMC 4PJ9C 3FT3B 2QBWA 4WI6A 4X0KB 3HZVA 5CJXC 4KY1H 1RK0A 2H32H 5SWZE 1G0XA 3JVGA 1MJUH 3UEZA 3DX7A 1NFIB 2SEBA 1NCAH 4JFYA 5FHBL 2P8LA 3IXAA 2YUVA 3F12A 3VD5A 4Q2ZA 1EERB 4HGWA 4LIQH 5DT1H 5DQDL 1T2XA 4N1CA 3UEQA 1KCUH 3CVHH 3GXFA 4O02L 1QPKA 1RUAL 4P3CL 2Q7YB 4AIEA 1BD2D 1F3DH 4XX1G 1Q9LB 3MXWH 4ZFOB 3FW6A 3B5GA 4ZNEE 1M7IA 4JKPH 2J8UA 3V8CA 5KVFH 2ESVB 3CZJA 4NUJA 2EICA 1WT5A 3MCG1 5JW4N 3CX2A 3CLEH 5JOFA 3TPKA 4S1RL 2YJQA 1EFXA 1PGRB 4S2SB 3U4EB 1QSFB 4GW5A 4QKXB 4YBHA 5E08L 3MUAA 1G1YA 4DZBA 5CGMA 1OBAA 4MQXD 4FQQA 1ZHNA 5K33A 4KRUA 2AGJL 2AV7A 2Q6WA 5FV1L 3BGFB 4N8VA 3HC0A 4H1LA 4JFFE 1XCQB 3R1GH 3ULUD 1CG9A 3VU2A 4LASH 1O6IA 3V7MA 2CK2A 3DX2A 4NRZB 4HUVA 1MHEB 4XBPA 5HI4D 4HKBA 3W2DL 3BPCA 4WI7A 5TJWK 1OTSC 2XZCL 4MAYB 4LLDB 4OD3L 4PR5A 4Q6IB 3PWPD 4Y4KB 2J8UF 3P9LB 4P7NA 1OM3L 4P4KA 2P49B 2V5RA 5GGVL 4NSKA 4PJXA 2OLDA 5L2JB 1NMAL 3QUZD 4NN6B 4CVZB 1KEGH 3HAEH 3MV8E 4HS6B 4ATDA 4ZE4A 1Z5LB 4Y8AA 4YHML 3MLTA 1VFMA 3GSVB 3FO0L 3TESA 3CIVA 2R4SL 1OTUC 5I8EB 4HAFA 5E08H 5D1ZA 4P5TD 1F6AB 2FJFA 4IRJD 1VGKA 1PDKA 4LHJB 5K59F 3WEXB 4HPHA 3Q0HA 5BXFA 3A23A 4WCYL 4NFBA 3RWHA 4N0UA 5F9OL 5L0QB 3HC4H 1RHFA 2F58L 3PJSA 1IGMH 3L3KA 4QCIB 4NO5B 4OUUA 5FB8B 3KAAA 5I30L 2H3NB 4MAVA 4AIZB 4AM0B 3NACL 1UXSB 5DJDB 2W66A 5C0BE 4YJZL 3L4XA 2XN0A 1YMMA 5DZOA 4PJXF 2EXYC 3UTQA 2JEQA 3WXWH 3WQ6A 5C08E 4CMMB 4PLKD 3DJ9A 4PSRA 5HYQA 3FN3A 3IS1X 2ZXQA 1YNLH 4G80B 1SJHA 3C5JA 1XGQA 1S7UB 4X5XA 4LDLB 4PRBB 3FFCA 5D1XD 1TQBC 4S0SD 1I1FA 4UT6L 5D1QB 3H2WA 4QRPA 1BBDH 1QHPA 1YNKL 3JWDC 3L5XH 1SJEB 4U49A 5L2KB 3OKDA 3U7BA 2H41A 4P46B 1NQ6A 2F58H 4M7LT 3L1OH 5D2NB 4HIHB 1QBMH 4FNUA 4MDIA 4WFFD 5HYJE 5EU3A 3T1FB 2ZUQC 2VUYA 5LCVL 1RZ7L 4XPGL 5BS0D 5KG9A 3D39E 4YXHH 4OUEA 3ET9F 1OB0A 4W84A 1GYAA 2CJUL 3TF7C 2LFGA 5CPTA 2NXYC 5F3BB 1H3PH 3S5ZA 4MSWA 5JORA 1IQDA 25C8L 5SX4I 3OAYH 4JFQB 1TQCC 4RMQA 4AENA 1VACA 3LMJH 4FA8A 4UTFA 2ZPKH 2PO6B 4KVCH 4M1CC 5D7SH 2F53B 5BZWB 1XSIA 3C5ZC 4UT6H 4Y5XB 1YNTB 3ARBC 5GRXG 1TNNA 5JW5A 2UZXB 2ADIA 5SWQA 2YPKA 3TV3H 1BZ9A 1NSNL 2OMNA 4RBPH 3E0GA 4HXAH 1JHLL 4PUBL 3QHNA 4HIXH 4XCFL 3CBWA 5C86A 2BNUB 2GHWB 4EI5C 2DEPA 1J0JA 3RWJA 5LCVH 1WWCA 1AD0B 4XPGH 3LKNB 5DEGA 3DUUA 5AWNL 1ZHBB 3DGCR 3JV0A 3AY4C 1BFOA 5TFSH 1S9WA 4LLVB 4NKDA 5JDJA 2P46B 4I0KA 2OR9L 4MJIA 1AHWA 3KL5A 1BAGA 3QFDA 3TIEA 1FIGH 4Z2IA 1GGIL 1NMBL 4LU5L 1UM4H 4L8DB 3UC0H 3QG6B 3SDCA 2C1PB 4DN3L 2ZX8A 2N7BA 3K4DA 1IAII 3LPOA 5IKCB 1TVNA 1Q0YH 1OARL 3W82A 3DX7B 1T1ZA 1IM9A 5LQBL 1U2CA 1MFAL 3F12B 1JHLH 5F6IB 1GOGA 4HGWB 3VH8G 2NY0C 2VL5B 4WWKA 3AHYA 3VX1A 1U9KA 1ECEA 4G8GD 1TVBB 3CUIA 2V5CA 5AWNH 4P8UA 1JPTL 2J8UB 4NUJB 3MNZB 2V2TA 5JOFB 3UTSE 2IANA 4PP1C 1WDRA 4U3AA 3S36L 4DO6A 4FLRA 3QIBD 1E71M 2NX5D 3O6FD 1NMBH 5IEHA 2J12B 4PMYA 1VPOL 2YXFA 4XC1L 2W38A 5HI5C 1JV5A 3ZT6A 4HQQH 4MXWL 3G04A 4Z2KA 3GSRA 4ODXA 4FHBD 2Q6WB 4M00A 4O4YL 5DJYA 4XT1C 2WMIA 3PZUA 4WK9A 3HC0B 2WBJD 4F9LC 1JF1B 3PDDA 4OB5L 5DQJB 3I3BA 5LQBH 5A2CA 2DTMH 3F5JA 3ZKQD 1KSRA 5DGRA 5L9DH 2DBJA 1TTFA 5M5DA 2ICES 1MJ8L 2P8MA 3CZNA 1P7KB 4AD3A 3ZT5A 5A6BA 3BQUC 4M3KB 2D22A 3GH5A 4P4KB 3E6HA 2Q3AA 2D7QA 4LCWE 3MUGA 1O7DC 5EWIH 3MNVA 1XR8A 4M5YH 4HU8A 5DD5H 3ZYOA 2ZSWA 5D2LE 4R6UA 3MLTB 1CGSH 4L9LC 3T0EB 4PMQA 4MD4A 3BH9A 3QDHA 3L5WB 5CGYD 3RGHA 3T8XA 2VXTH 3D87B 4OSUL 3RA7H 4BFIA 1VGKB 4OCRH 1VPOH 4KRPB 1NAMH 1JTPA 1FN4A 1EK3A 2EXWC 1EA9C 2H9GB 2EDXA 4HDIA 4ELKA 2XVPA 3U4AA 5J89A 4O4YH 3WN6A 3QJFB 5DRZB 3LEVL 3VFMB 1U36A 2YBTA 3L3KB 5JR1L 4FQPA 2P43B 1DVFC 1Z9MA 4I3SL 1QI5A 4EN3B 4MA3B 4NN7B 2VLKD 4G8EA 3KPSD 1MFEL 3BE1H 5DFAA 3QI9D 5TGBB 4Y19A 5B3JE 4HIEB 3D50A 3C5JB 4U5IA 3LKOB 4CKVX 1TZGL 4TVPE 4ZUSA 3T65B 5ISZD 1ZJBA 1FV1A 4X5LA 1V3HA 5GJSL 5HHNB 5DMKA 1I1FB 4KK9C 3KLSA 3BUYB 1TZHA 4D9QD 4POZD 2C3WA 1W9BM 1RZFL 4C7GA 4NIKB 5GS0L 2Q8AL 1UWIA 4NYLA 5DC9B 3SGDI 2BVYA 4ZTOH 1NBZA 2XWJB 4MNQE 1U8OB 1NCCL 5E70A 2E6QA 3LEVH 4PJ5A 4FFVD 2V2WB 4FMVA 3N04A 3SUVA 5JPNA 1B88A 2A6DB 1A02N 1RIVL 3FMGH 3PV7A 4R3SA 5A6JA 2FEDD 4JN2A 3IF1A 5CMAA 4W87A 4Y1AB 1N5YL 1E4WH 1NUFA 5A8MA 5I1JL 3VWJD 5D4QA 3ZJ7A 4BKLB 5D93C 2EDEA 3DMMD 4OCWH 4MSWB 1MFEH 4HMCA 5JORB 4DQOH 3D3VD 1E6SM 3PE9A 2DAVA 4F3FA 4IISA 1RURL 2Y36L 3L9RA 3MV9B 1Z32X 4GFTB 4GQ9H 1OGAB 4MWFA 3BEWB 1TZGH 3PZIA 1WCBB 3SO5A 5LAXA 2D1ZA 3RTQB 4DWSC 1QRKA 4U6XB 5IMOA 1QFWH 5JW5B 3GSWB 2HTLC 4XNZC 1HNFA 1KTDB 5IP4A 1RZFH 2YPKB 4X7CC 1CE6B 4OQTA 5FA3A 4YDJB 1KN2L 3BZ4A 4CNIA 1G7JA 1I85C 1KXTB 1Q0XH 1T1WA 5FIPA 3KJ6H 3J7HA 4LARH 3WDRA 1J05B 5DR5H 3IAGC 1WZMA 4K7FB 3QHZH 3HZYA 3O6KL 1FC2D 1FNEA 5EFIA 5DXWA 4D9RD 3CCHA 5FYKD 5DEGB 3QFJD 4X80L 2W5FA 4KTEL 4NQSA 5I1JH 1LE9A 3VFUB 3AMLA 4LLUA 4ELME 2FYYA 3WKZA 4JREB 4JN1H 4GZEA 1AXSB 1S9WB 4NKDB 3BKCH 1EOMA 3EFDH 5J6GA 1I3UA 4JFHE 4PYGA 5LGHL 3WBAA 3SCUA 3NIGF 3WLWC 3FB7B 3QFDB 3TIEB 4LKXA 4M93C 3BZFB 2FO1A 1U58A 1T89C 2Q7NA 4XBGA 1S9YB 1QO3B 2DQFA 4PLJD 2E6JA 3DHJA 1BVZA 3K80A 2IXUA 1NCBL 3D85B 2WVVB 4EDXA 1H3WM 3DO7A 2VIRA 3QQ3B 3CZLA 5IB3A 2ZCKH 4WWKB 2WNWA 4JM4H 4I1NB 3AVEA 4TUOA 1ZANH 4M7JL 4D6EA 1NDGB 3REWA 4N0RA 1NFKA 1E6JH 1FFOA 4TVPL 3SGEI 3KLHC 4LGRB 3U0PB 1UEMA 5HHMD 1AO7B 3MRFA 4LKCA 4HEME 3THML 2ZIDA 3NPZB 4NQVA 2FEEI 4U5KA 1FL3B 3O3DB 1S5IH 2HRPH 3O41A 2W92A 4KDTA 3IDJA 6A3HA 5KZ6A 3HNSL 4P49A 1RUKL 3O8XC 1OVZA 4OAWA 1JV5B 4JFOA 5AYQA 2D0FA 3O6MH 1Q38A 3GDBA 2WMIB 4LQFL 4Z7OF 3RIFF 4MS8C 3HG2A 3HMXL 3VGFA 1T21A 1QBBA 1HE7A 1NCBH 4I77L 5A69A 3PBGA 4M1GL 4OIIL 4TUFA 4JM2A 3K8LA 1VENA 3RJYA 1MPAL 4ZD3L 3GBNH 1JHTA 3O4OB 1XYZA 1P4IL 3KPRE 4MVBD 4X7SL 4ETYA 3HFML 1IGTA 4GKNB 2OYLA 3O9WC 4TVPH 3PXHA 5JQ6L 4LSPL 4ML4A 3E6HB 4RGNC 5JOPD 3MUGB 5BQ7B 1MRCH 3MNVB 1XR8B 4JDTL 4AYFA 5F1SA 2DT2A 3VXQA 7FABL 1H3XA 2F2HA 5ALCL 3RWDB 5CZXD 3T8XB 3RZWA 4GRLA 2BY0A 3SKUD 1YYLL 4KDWA 4BFIB 2DSZA 3TBSA 1CZ1A 1FN4B 1UA6L 2KQNA 3CZEA 4ELKB 1PW3A 1E0VA 4PY8J 5I18L 4UBDD 3CO4A 4PCSA 3BAWA 1CWYA 1MNUL 3KLDA 4JM2F 5D71L 5I19L 2BSTA 4JAMA 4LAQL 4I77H 4Z2LA 4J4PD 1A7RH 3NTCL 2OW7A 2PXYD 1XF4B 35C8H 3PL6D 5KSBE 4M1GH 1HHJA 2GJZA 3ARDD 1U3JA 1TPXB 2DD8H 2NY7L 4G8EB 5IMMA 5ICXA 2YA0A 2FX7H 1PYWB 3EOAA 3QB7C 3UTPE 5JQ6H 3HPJB 4Y19B 4HGMA 3D4YA 1NL0L 3U0TA 4GS7C 4JPVH 5AG8A 4KZDL 2YRLA 2JB6B 4UOW1 4ZAKC 3RL2A 2WVTA 1NWTA 3WN5C 3K4ZA 4KK8C 4HZLA 3S35L 1KPRB 5AD0A 1UYWL 4BQ3A 3VI3F 1FL6A 3HG3A 1GJIA 4BQCA 4JY6A 3O2DH 1WISA 1CCZA 1B6UA 4G7VH 4NYLB 5E9DE 3OXRB 4BSWA 1MHCA 1SY6A 2NLJA 3VD3A 5GS3A 4NBYB 3AYRA 1EQPA 4RDQF 5JPNB 3ME0A 1OAXH 4MJ6B 5D71H 1XSJA 3NTCH 3UCQA 3MRIA 1KJ2L 2B4CH 2VQUA 4HJGB 3TN0C 4KQ4L 3IDYC 4JHZA 1V0KA 3E8UH 1FYTE 3UPAA 4RAUA 4PG9A 2QR0A 4RFEA 3L9RB 1ZGLM 4GQRA 1DBBH 2IMNA 2EIZB 4W93A 2I9TA 5LAXB 2ZG2A 5LKNA 5IFAH 1YC8A 3DVGA 4W86A 3LD8B 2CKBB 4WU7B 5F9WC 4S1QH 3L5JA 1GGTA 1UKTA 3LXCA 5DVLA 5FA3B 5GPRA 3TP4A 1K5NA 3RUGF 2VT0A 3QIWA 3DURB 1G7JB 5ANMA 3PQYE 5KSAD 3LS4L 3GMNB 4ONFL 4XP4L 3MUZ1 1I3GH 2BC4B 4K3JL 4F80A 3WENA 4YHNB 3QDMD 1FNEB 1KNOA 1FO0A 1TNMA 3AMDA 1H0DA 2HFTA 5JXEA 1S9XA 1LE9B 1NGZA 4LLUB 1QR1B 2ZUSA 1I1AA 1HOCB 4R9HA 2WPGA 2PTUA 1MREH 1P1ZA 1U8JA 5EIIA 4LPCA 1GW1A 1JGUH 2BRRL 5I0ZA 4CVXA 5EN2B 3W28A 2B1HH 4I2XB 1AE6L 1ZBVA 3O2VL 4KJWD 5JZ7C 4IDLA 2YPLE 1RV6X 3QCUL 2DQFB 2UZIH 1YEKH 4HS8L 2J6EH 3LXBA 4WF7A 3UG5A 5A8QA 2WP3O 1QBLL 2VIRB 3CXHJ 5D1XB 3VXRA 3RZCC 2VXUH 1FFPA 2AXFA 2EDLA 4Y4HA 1MFCH 1VFUA 1FFRA 4FNLL 3REWB 2BSSA 1BEYH 1V3LA 4WEUD 2P5EE 4RIRA 4OGAD 5CBEB 3GJEA 2VZVA 4IOFC 1N2RB 4G6KH 4WKAA 3VFRB 1PY4A 5KN5A 3RO8A 2VRKA 4U6VH 4NQVB 3RFZC 4OF5A 4XUYA 4F37F 1CZ8L 3FN0L 4P99A 3FCTB 4OM1L 1CGYA 3S37L 4AEIH 3CFDA 2D9CA 1QSEE 5E4EB 4XC3L 1AJ7H 3O2VH 1XIWD 4JFOB 3V5KB 2X41A 4LPUA 1HJVA 1W1PA 5ABGA 3CMOL 5C0CD 2NR6D 1IBGL 3H54A 5HPMA 1MCFA 4HS8H 4JRYD 3KJ4B 4QYOB 5FV2A 1T21B 1Z3GL 3T3ME 1CLOL 4MXVE 5GGQL 4JG0H 1H3VA 3HMWH 3P30L 2DMCA 4JHWH 1JWMA 3NSXA 3WMCA 3S88L 1YEEL 1QYGH 1C5BH 4MAUH 1JHTB 3S97C 5I76A 4TSBL 3ARFD 2LTQC 4FNLH 4QT5A 5T1LD 3RVUC 4NOBA 4PUEA 4NZFA 3POCA 1HYSD 5K93A 5EUOA 4N1HB 3H9SA 5TDPA 3NBNA 5JBFA 1YUHA 3FOMA 1VB9A 3V4PL 4MMXC 3IFNL 5FUOH 1F90L 1MFBH 2PCPA 3NCJL 3QDGE 3VXQB 2WQRA 3TH4T 3O3AA 5JW3H 4FTVD 2XNAA 4HC1A 1LG1A 5T1MB 1MWAL 1RUQL 4RFOL 1W8NA 4P2OA 1UASA 1A7OL 3PP3K 1OAQL 1U3HA 2G2RB 2EZ0C 3OB0H 1AXTH 4OBSA 1B0GA 1CLOH 5DT5A 1WV7T 3VWKA 1O7SA 4YK4B 2OJZL 1Y6MR 4UUJB 5EOCJ 1EJOH 1QRND 4X4XA 1HHJB 1YEEH 3EGSA 3H9YA 3S88H 4YN5A 4BQ6A 3BKML 5EUOF 3VIKA 1TJHL 3SQOH 3VRLF 2VMFA 1AR2A 3X11A 5LWYL 4NKOB 4LLMB 5ICXB 2JK5A 2PC8A 5EPMB 1ZT4B 1Y18A 3U0TB 2EYTA 5BJTB 2XUCA 5KTEL 3WUGA 4NPYB 1UKSA 3DX9B 5IHUH 5AD0B 4M5ZL 3NCJH 1FL6B 3WIJA 2XV6B 1KBGL 3GMLA 3O2WL 1E6OL 3WFZA 1RUQH 5DVOA 1FYHB 2WZIA 3LKPB 4BSWB 2J7HA 1MHCB 2GIYA 4YFEA 4XNMA 3RUGB 3VFOA 4KVNH 2VZ3A 1C5DB 5CQ1A 3QIBB 2XTJE 4FFWD 1GQIA 3MRIB 3VXSE 4F2MB 2WCAA 1FFNB 5KAQF 3BKMH 3G6JF 1UR0A 4NKIH 3OHXB 4G9FA 3N11A 1QG3A 4XV0A 5FYLL 4F58H 3CVIL 5C09A 3CVHA 3MV11 1FRGL 1OW0C 4PG9B 3SE3C 4TVUA 4KHXL 4RFEB 2DLFL 1FVDB 3ZR6A 1B0IA 1YMHA 1QD0A 1A7NH 1MRDL 3BGFC 4X0VA 1UKPA 2E4TA 4UMGA 1LP9E 3TCLB 2GJ6A 3TO4A 2EDHA 1E5NA 2R1WB 1RUMH 2R4RL 2GT9B 1YEFH 4XVJL 5IM7B 1WAWA 2VWEE 2GK1A 5EMYA 4WKHA 2C3VA 3MA7A 4H5SA 3S4SB 3JTSB 4G43B 4Q6IC 4Y4KC 3BVUA 4A4AA 1EHNA 1S7VB 1U2HA 2DWDB 4S1DD 1J5OL 1FO0B 4NN6C 5I2IA 4UU9A 3ULVE 1N82A 3AM8C 1KYOJ 1REIA 1H0DB 4HKXB 1S9XB 3UBXI 1MHHA 4KK6C 3WLBA 3ZJ6A 4LSUH 4ZODA 2D4FA 3VINA 1M05A 4YBQC 3CVIH 2J25A 1H49A 4JQVA 4AZBA 2Z93A 4KHXH 2DLFH 3QXUA 4M6NH 1I9RL 1B3YA 1E73M 5GS0D 5C9JB 5L0QC 2A3AA 3VXUD 2VLJA 4R0LA 5LG1A 3W4RA 5A8NA 5ESAB 3HAEA 4MQTB 3EO9H 4B16A 5JMRA 4Z77A 2R4RH 3QI9B 4XVJH 1S3KL 2Z31D 3T4AB 1BIIA 3C8KB 2R2BA 4D8PB 2ADGB 3V6ZA 1HN1A 3MRDB 4APQD 2KDGA 3ZT7A 4AQOA 5KS9B 1YEDA 5ISZB 4WHCA 1IC1A 4Y4HB 4JFVA 5A2IH 3DX8A 4OZOA 1J5OH 1QBAA 2BSSB 2OWWA 5F9DC 1CIUA 4E5XB 1GVYA 3GJEB 4O51B 1XZ0A 2DBLL 1TLKA 1R6VA 3EHBC 4XNQA 1HHGA 4LF3A 4JE4B 5D1QC 5DHYB 1G7MA 4KI1A 4TSCL 1PG7W 1UJ3B 3LXAA 4GSDL 3QNYA 2IFFH 4ONHB 4P57B 2E27H 1NM9A 4IUGA 4OLVL 4A6YL 4P46C 3HU7A 1JZ7A 5D2NC 3BXNB 4EKJA 1S9KC 4JHAL 3ISWA 3MC0A 1XSKA 1CDUA 3HC3H 2FD6L 2RGLA 4FQ1L 4LCWD 3TONA 4NRRA 5E9AA 3MR9A 1JZ3A 2WMJA 5CSBA 1BP3B 3D25A 1B3WA 1U8KB 2YEZA 5CEYB 4GKZB 3ROLA 4BUGA 5HY9B 1S8DB 4M6OL 4BJLA 5I76B 3PZMA 3L4TA 3G6DH 2P5WD 3BN3B 1INDL 2D2OA 1U8MA 2GKIA 2E3VA 3OJ2C 2PO6C 1YUHB 5FDYA 3FOMB 1RIHL 3K81A 1IC5L 2W0FA 4Y5XC 5FF6B 2BZDA 1T80A 3VJ6A 3DRQB 2WP3T 3FTGB 3UJJL 4GSDH 5HVHB 3B6SA 5E6IC 2KKQA 2FBJH 4OLVH 3LZFL 4N8PA 3X3GH 3HUJF 1A6ZB 5A2AA 1J8HB 5SWZA 1IT9H 1FPTL 2NY6D 3RDTB 3QGVA 4ZPVB 5DURD 3V4VL 3VWKB 1FNSL 3QOMA 4XP5L 3GM8A 1LNUA 2UUDH 2UYLB 3I02A 4TVPD 2D24A 4BFEA 2GITA 4D6FA 4L4TD 2QV4A 4M6OH 3OJMB 1QFWI 3X11B 2W9DL 2JELH 3GKWH 2A9NL 4BA8A 5M95B 3G6JB 3VKKA 1I7ZB 2FGZA 1KJVA 4X6EB 1UOKA 1R0AH 3HB3D 3KPQA 1UKOA 1CK0L 5SV3A 3NJ3A 1CFQA 4G7YL 2DN7A 2YUZA 4G6MH 1OAUL 4TVSa 3GXNA 2EKSA 4D72A 5A2BA 3EDJA 43CAB 4NCC1 4X9FA 3QXDA 4N8VG 5HVWA 3GMLB 4H1LG 1CBVH 4EIGB 4PJEA 5F6IC 3TPUA 5MENE 3ABZA 1L7TL 3ARGD 5C8JB 2DWEA 4TOYL 4DOHE 1EEQA 2IQ9L 3MTRA 4JFFA 5AYIA 3ULVH 4XX1E 3QEQA 4XVTL 1FE8H 1W9XA 3CXDL 3R06A 1ZGLP 5J9PA 2FYVA 2ADJB 3V4VH 5CILH 2H32B 4U1IA 4JFEA 3ZDYE 1TETH 3I84A 5ID1B 3WFDH 2J8GA 2XPGA 1MCRA 5FUCC 1QACA 1DBMH 1SEQH 2HJFA 3CFJB 4XZWA 2W9DH 3C2AH 1II4E 1KFAL 1L9NA 2N7AA 3CVHB 3IXTA 2CK0L 4JFXA 2MSPA 3ZYJA 4G7YH 1MXDA 2DYPA 3O0RH 2GJ6B 4PRPD 2OL3L 5DJZA 5I8CB 5MERB 4RGMB 3B83A 1PQZA 3RGVD 1L7TH 3G08A 4WUUD 6FABL 3OG2A 4MQ7A 1AQDB 1E4JA 2GK1B 3RVVC 3AISA 4QRUB 5T3ZE 1N0LA 4WVRA 1MJ7L 1WBYA 3UJIL 2HISA 3RX7A 3UTTE 1WKYA 2H6PA 4P4KC 2NW0A 2PYEA 1HIMH 5C0BA 5I2IB 4UU9B 1TQWA 4WO4B 2A77L 5D9SA 1XT5A 1YEHH 2ZKHL 1UJTA 1R46A 1CGXA 3T0EC 4UINH 5EZOH 1DQLL 4LRIC 5C08A 3RVWC 5IK3A 3CU1A 4OI9A 4P5MB 3KWWB 1KFAH 3NIYA 3IS0X 4KRPC 4JPKL 5FGBA 1Y6KR 3I3DA 3TZVD 1VFBB 1V3KA 4MA1B 3JBG7 4R0LB 4D0CA 3ARDB 1NGWB 2OM5A 1ZLVK 3BCFA 2DLEA 4PYHA 1KPVA 2OL3H 3IDGA 3H9HB 5B39B 1H1NA 1DN2A 3DYMA 3QUYD 2WINB 2DSWA 1XAUA 1GCYA 4A2MA 1NGXB 4EN3C 4BK5A 1E6NA 2R2BB 4NN7C 1S7SB 2F74A 2YK1H 2G41A 1NAMA 2DLTA 4K23H 3C6LD 1X9QA 3UJIH 4DK3A 1E70M 5AYUL 5IT2L 4OT1L 2ATKA 3BWAA 2BDNL 5HYFA 5JW4Q 3THCA 3D39A 3OXSB 3QQ9D 3MRPB 1G84A 4YZFE 4R2GB 4LX4A 1CDGA 2ZSVB 4BFGA 4MPKA 5BMFH 4O9HH 4M8UA 5JHLL 4XNQB 5D7LE 5IR1A 1KLUB 3KPPA 4KK5D 3TYGL 5EC2A 3NCYS 4JJ5A 3SPVB 1PKQB 2F5AL 1TCRB 3QNYB 1V6XA 2OBGA 2B20A 1U8QB 3K8MA 1A1MA 2W91A 3P4LA 1DANU 4WFED 5A3ID 1GHRA 3VFGH 2CUIA 5A40E 1GGUA 1NWRA 3HUJB 1D9KA 2PW1A 3A5VA 4YH6A 1JTTA 4ZUUA 3SDYH 5C0AD 2UWFA 4PMZA 1WIPA 3D25B 1G01A 1P7QA 4FQXA 4OT1H 1GGCL 2X1XR 2A38A 2XQBL 1NGPL 2HT3C 4GJTB 4QWWC 1FOBA 3M8OL 1ZE3C 1KCRL 1XMWA 1U91A 5F89B 1XGUB 3STLB 3WD2A 3BZDA 3RTQC 5KSAB 4IM4A 2W0FB 2NXZB 1CICD 2E5EA 4I0PD 1MEXL 3GSQA 3NCBB 5JHDE 2Z1KA 2BNRB 4O2FA 2ITDA 1HQ4A 2AQ2A 4G42A 5DO2D 3B6SB 4ACZB 4ODVH 1UWQA 3AI0A 2PTTB 5SWZB 1MCIA 4X6DA 2PNDA 3Q1SL 4UB0L 2L7JA 2VITB 3HMCA 5GZNC 5KANI 4JREC 3KLKA 4ONGL 2Y7QA 3R0NA 2GITB 4GRWE 3BPNC 1CDIA 1AGEA 3JWDL 4C59B 4IMLB 3AGVA 2YZ8A 2X0HA 2EO7A 1FZOA 1A3RL 3M8OH 5I5RA 3PTMA 5EOTB 1IAOA 5KVEH 2XY1A 5EU6E 3U4BH 4U6YB 3BDYL 2WV3A 5TDOB 1CFQB 3UTSA 3CC5B 5FM5M 4YE4H 2EKSB 2VDQH 1DQDH 3UAJD 4LSTL 2G8ZA 1G0YR 2C8NA 1DLHB 3WUFA 2A0LD 5T3ZH 1PZ5A 3TPUB 4OKDA 4WWKC 5HHPB 3ZM8A 3QBTB 2PR4L 4K55A 1XF2B 1NUGA 2DWEB 1TQVA 1IT0A 2DS4A 2FLRT 5DFTA 1HKJA 2EE6A 1C91A 2VDOH 1OTTC 3EDKA 3W11C 3CSYB 4UB0H 5J9PB 4XMKL 2DMKA 3SDAA 2ENSA 4YHPB 5EC1B 2X4SB 2NPLX 3D0LB 4PUDA 1UWXH 2Y07H 5DMJB 4PRWA 2V5YA 5E8PB 2HJFB 1DUZA 1AIFA 1K3ZA 4JRYB 3HJEA 3TV8A 2ICWI 2J7BA 4W81A 3RKDC 3FO1B 1A3RH 2DLIA 3MV8B 5ADPL 4KHTL 5D2LA 2WUBL 4AYSA 4NQEE 1R24A 4P48A 3NOIA 5FL0A 1ISWA 4HK3J 1E28A 4Z0XA 3RWFA 2BNQD 3MGTB 1P84J 5JTWA 2QSCL 5IROC 1TIUA 2J5LB 3D9AL 2ZX7A 5F7YC 4HSQA 3O4OC 4ENEC 1BIHA 2PWHA 1WBYB 4L8CB 3UBXB 3PHAA 2H6PB 1A14L 3HG1E 3S5LA 2EAEA 5C0BB 4UTBL 1MH5B 3ZL4L 3EOTH 4YXKL 3NH7H 1GGBL 5C07D 3U46A 4CN6A 3L3HA 3G6MA 3D6GA 1K9FA 5C08B 2VVSA 5A43C 5HYEA 5D2LF 1W72H 3DLQR 4ODWA 4P9MH 4U6HA 4EQ3A 5BRZE 2F18A 4KROD 5B38B 1HJWA 4OGXL 1QRNB 2JB5L 2O5YH 5EU7E 1E4LA 4YXLL 3V6FA 4K68A 1KPVB 1LO5B 1GVIA 4C58B 2Q8BL 5IMLA 4TTDC 4W5ZA 4ZPTB 3PABB 5IVZB 3N17A 2FCBA 4F66A 2DQCH 1TPXC 4OZIE 5EU4A 1NAMB 2VYRE 1VFAB 1JI1A 5DC0A 1XGYL 1E4NA 5HYJB 2VVNA 2ATKB 3TWCL 2AV1A 1LO4H 5FYLD 4K3EL 5EORH 3ZL4H 4DN4H 2E9IA 5B3JF 5ID0A 1I7RB 1HJUA 1VHPA 5F7EH 4I0CC 4U05A 3TA3D 4UQCA 3WELA 4AY1A 2CO6B 2IAMD 5IR1B 5IHSA 3KPPB 4AZ6A 1P6WA 4UIKL 2VNCA 2Y1VA 5IB5B 1KXVC 4P23D 3FQWA 4I13B 4OGXH 2JB5H 1RZ8A 4PJHE 2QJDA 2B39A 1A3HA 2APBA 4YXLH 4JZNA 5KVDL 4M62L 2OJEB 4XMPH 1MCWM 2R56H 4L4VE 2Q8BH 5K9OB 4MHHG 3MRHA 2OSWA 4XX6A 4BQ5A 3W9DA 3O2DA 4TUJA 2R1XA 1PEWA 2PW1B 4GRWH 1NFDE 4L3CA 4CCCA 3TTSA 1YYML 5DA0B 1JL8A 3SE9L 2XFXA 3BMWA 5F8RC 3ZE2E 1DQJA 3TWCH 3AXHA 4X6BB 1NMCB 3BO8A 1WDSA 3H3PH 1VEOA 5FO7B 5HI4C 1ZT1A 3MLSH 2QSQA 2G3JA 2DQUL 1CWVA 3JUYA 5C0DB 2AJSH 3LD8C 3VG0H 4FMFA 4KUZH 2P42B 5TQ0L 1HQ4B 4V28A 2C1OA 3KPOB 1CLZL 2XVNA 2E7HA 2V6HA 4MNGE 2YDRA 5F6HJ 4UQDA 2AJ3A 4ODUB 4EQ2A 5CP3H 5GGUB 4E41D 1M04A 3CAFA 5IFJA 2WHLA 2DJ4A 1DWHM 1I8IA 3L5IA 2Y7QB 3SE9H 1G9MH 4BH7A 1GXEA 2HN7B 4M48H 4ELMF 4TOQA 4L3EE 1AGEB 5GIRB 4QF1A 3PXJA 3JSSA 3DECA 1FZOB 3DGGA 3B43A 5FM8A 3RY4A 4DGIH 4H0HB 4EBQH 3F7VB 1CFTA 4XHQA 5C0ND 3WJLA 4M7ZC 4UOQA 2IH1A 4WI4A 5EBMB 4X5WB 4GZJA 1V7MH 4H25A 2RAMA 1F58L 4HS3A 1DWAM 4N0CC 5BW7A 2BOCA 3VXSD 1DBJL 4IOIB 3RKPA 2R2HA 4MXQD 1OINA 1S7TA 3IDMA 3PTQA 4GI9A 2HFEA 3PGFL 4HFUL 3U7WL 3VXNB 4LSVH 3QEGL 5CEXB 1MRFH 2FLBT 1N0XH 1FP8A 1J88A 4PMDA 3WDQA 1ZLUH 1M03A 4KPHH 5DEFA 1WTGT 2R9HD 3ILPB 4B50A 3BIKA 3K3QA 3KPRA 1GQJA 2BS9A 1KTLA 1WZKA 4KDTC 2E40A 1ED3A 1PAMA 2X5PA 2PB1A 3VFNA 1SHMA 5E4EC 1SYSB 4LCWB 3WIIL 2A3CA 3L95A 2GSGA 3O3BA 5GSRA 3V0WL 4LLYA 5D2LB 1M6OA 5BO1L 1T0MB 3KJ4C 4Q0XL 4CADA 3C09B 3D48R 4AZ5A 1V02E 3CUPA 4E9LA 1E28B 4K94C 2P5WB 3CZGA 3UESA 2Q86B 5FFLA 1JGVL 5J06A 4PGDB 4TULH 4UNTA 4JM2C 3E2HB 3IJYA 2FGWH 1QI4A 4DTGH 3RAJH 1UGNA 4AMCA 3DSFH 1QQDA 1ZWIA 3P9MA 5A6AA 5MHSE 2IPKA 3VSTA 2O9PA 4GBXD 5ITBL 1HZHH 3AU1B 4FABH 4QRSB 3HZ3A 2R69H 5KSBA 2VSDA 1UM5L 5KOMC 2F8XC 3D2UA 1YN6A 3PWJA 2P8PA 4GRLC 5DURB 4JVPA 4RE2A 2I25N 1QX1A 5TQ2H 2DM7A 4HUUA 3STBA 2FZ3A 2V7HA 1JAEA 5I79A 3FT2B 4WEBH 3TNNB 5BO1H 3IDXL 3FB6B 4HZ8A 3GIZL 4L8BA 2CERA 3RIFK 3KL3A 3MO4A 4YK4C 1LK3L 3C60A 5FK9A 1MAML 3HR6A 5E9DA 4JFZH 2F5BL 3HRZB 3PWPA 3BZEB 1WC7B 3PP4L 4MNQB 3MBEA 4HV8B 1C3FA 4GXUN 5KSBF 4JY5L 2V5DA 2V17L 4X4ME 1R7AA 2QL1A 5ITBH 3AS0A 1M4KA 2WM0A 1UM5H 2R0WH 4P5TA 3SDDB 1K6QH 4Q97A 2ADFL 4IRJA 4NQXA 2VDPL 4NC0B 3SJVE 3ZYZA 4C56A 1M71B 1FYTA 1NJ9A 3SEPA 3K0WA 5JW4M 2HLFD 5C0GA 1SVCP 1CS6A 5J57B 1XGPA 1RZ8B 3KGRA 5E03A 4DEPB 1B6DA 2HRLA 1I3RB 5ESVA 1MFVA 3MMWA 2ARJA 2DKUA 3WUWB 3QIBC 1MQ8A 2COQA 1US2A 1A6WH 4TUJB 3PQYA 2WWMD 4PJ9D 4G6FB 1FH5L 1W1YA 5GHWL 1OAKH 2V17H 2H2PC 1DQJB 5F7UA 2EE2A 1Q1JH 5HHVL 1LEGA 1CFSA 5C70A 2VXVL 5E00B 4M81A 4JQIH 4ELMB 3AS1A 4RMUA 2VDPH 4OF3A 4HZAA 3V0VB 2VTFA 1RZIB 4W6XB 3MZTA 1I75A 2FECL 3IFOA 1X5IA 2BVEA 1DFBH 2X7LA 3GRWL 3RM4A 1HI6A 5HJ3B 1ESWA 1T4KB 1BZQK 4PJCA 2C1OB 4KJQC 3SE8L 1T83A 4DM2A 2F54D 2AJ3B 1QP1A 3QO0B 4P5KB 4PRID 5IBTL 1WJ3A 3N1GC 2WC4A 3BLBA 3TVMA 1BFSA 4QXUH 3TZVB 1I8IB 3VFTB 3EBVA 1KG0A 2WSPA 3DXAD 2X4TA 3SQBA 1TITA 3U48A 4W85A 3V95A 1ODZA 2XN9E 1E3ZA 5F7LB 5HHVH 4QF1B 3SCWA 1DHKA 2WZPD 3FT4A 1H11A 2P5EA 5FOJA 2AEQH 5J3HC 1BZ7B 3WEOA 2W61A 4BQBA 1F11A 3MOBL 4HF5H 4Y4FA 1OTSD 1BGXL 4W6YB 4WTXA 4DKAA 4JQXA 3RY6A 3GRWH 1N26A 1HL9A 4XP9L 2HJLA 2X10A 1H5BA 4U3XA 2HVKA 3IKKA 4GXVH 1S7TB 3C87A 4Y4HC 1KJ3H 3P0GB 2B0SL 3T0XA 2IPUK 1ZBCA 4AD5A 1OTUD 5SWSA 5CZVL 3WFEL 4BF7A 3FY1A 3N9GL 1K9TA 4OTXH 5JDSA 2CCRA 5I77A 3T4YA 1B30A 5DFVC 1AQHA 2ICWB 3HNTL 5DEFB 4LL9A 4HU0A 4P2RA 4OLYH 1OY3B 2MHAB 1UJ3C 4YUEL 2FEDC 1KTLB 4TRPL 5DJXA 4AMKH 5IEKA 1ED3B 1DN0A 3MLRL 1WIUA 1YC7A 4D3CL 3MOBH 1MFUA 1FDLH 4LLYB 2EXYD 3KDMA 4DGVH 1EAJA 2H8PA 1IQWH 2PUQT 3G9VA 3QDGA 5DD1L 5IW1A 3N50A 4A3HA 4HWZA 3NFPA 2R8SL 2DJSA 4OCNC 4M3JA 1JWUB 5EIQA 3T3MF 3A67L 3IJYB 1AQKH 4MXVF 5MP6L 3TGXA 1SYVA 3WDHA 1CICB 3LN4A 1I9EA 1AC6A 3BW9A 5CZVH 1ZWIB 2QQNL 1HXYA 3N9GH 4W6WB 1HHHB 2I07B 2XN1A 2CETA 1CVRA 1X4YA 3BX7C 4AH2A 3D1MC 1CVSC 5KSBB 1FLRH 5ILTH 2Y5EA 1QOXA 3D2UB 3EFFA 2EPLX 3HNVL 3MCLH 4YUEH 3PWJB 1B3ZA 1BGAA 4F37K 5I73B 5IB1B 1H3UA 2P8PB 4W5UA 3BAEL 1CR9L 3LKQB 1NBYA 1CL7L 1XF3B 4BSVB 5HVHC 4KH2A 4LEXL 4P2OC 3W9EB 1A9BA 1TENA 3BXWA 2FZ3B 2V7HB 2NXYD 2WBJA 3RDTC 1B3VA 1D5ZA 2UWEE 4YDLB 2XYCA 4GKLA 1YPZE 1VBUA 3PN8A 2DDQL 3VWKC 5IF0A 5I1AA 5FK9B 1EUUA 1A4JA 1IEBB 3BP7B 1NLDH 5H8DA 1EZVX 4M1CD 2FL5A 2EDJA 2EEBA 2KL6A 1T7XA 3MBEB 3C5ZD 3I2CH 3L3OB 3MNWA 3ARBD 5T5NF 3P40A 3OPZL 4GXPA 3SN6N 4KUCD 3VRJB 2XTLA 1M53A 1VRXA 5FOBB 5H37G 1JF6A 5EDXA 4F57L 3QR2A 4UIMA 3CHCA 4JANA 4Y5YA 1WDQA 4NQXB 4EI5D 5A6SA 1FYTB 5DD6A 1L7IH 3BAEH 1CR9H 5C0GB 1KJMA 3ULSA 4LEXH 5CPQA 3Q5TA 4AG4H 1KQYA 4UT9H 1OAYL 2RGMA 4YHIB 3PZOA 3AFLA 1LP9A 1A4KA 5EZJB 2ZJSL 2MFNA 3PGCA 5ESVB 2IGFL 2YD9A 3M46A 2IBBA 3VXPA 4C83B 1HHKB 4O58L 3BUIA 3T2PA 3SBWA 2XN2A 3SOBH 5E5UB 1KB5L 4NZUL 3M45A 2CBJA 1UC6A 2BVPB 1NBVH 4HPYH 2BNQB 4RWHA 3U7YL 1CFSB 4X4YA 4QTHA 3CPUA 1ES0A 1BQLH 1YQVH 1RJZA 3SCNA 4K71B 5H94B 3V2AR 3TO4C 2IF7A 2EIDA 5GGSB 4OZGA 3DV4A 1NH6A 4AYGA 3AREA 4ATLA 3B2VH 2ZZUT 4RGMC 1LP9F 2X7LB 3HAEG 5D70L 3KE0A 1DP0A 4L29A 4GMTH 4OCYL 3FO9A 1CFNA 3BGMB 1ITXA 2YPLB 4P2QE 3WH6A 4JAWA 2G75A 4PP1D 3VWJA 4JPIA 2R0KH 4YDVA 4NHUA 4WO4C 3U6RA 3TVMB 3DMMA 5HI5D 3ULVF 1JFQL 1C5CL 4NC1C 4CMHC 1EV2E 4UBDC 5D5ME 3BC9A 4JZ5A 2X4TB 1L6XA 1KB5H 3P0VH 4HEPG 4NZUH 2QSVA 2OQJB 1UG9A 2AXGB 4JZJA 5C8BB 3MOQA 3U7YH 3FT4B 4MADA 2XM1A 5I15L 4OLZH 1B2WH 4HCRH 4MA1C 1NDMA 4R0LC 3V4UL 3ARDC 1KIRB 3VM5A 2UY5A 5BVJB 1CTOA 3I6LD 4KDVA 3BQUD 3GMQA 4ZFOL 4Z2JA 2OP4L 1KTCA 1IGFH 4JFDE 1MCLA 1QSEB 4EE9A 4D0BA 2Q1EA 4OLUH 2HVKB 3UMTA 3QUML 2NY4B 1KTBA 5JUEL 2ZUNA 3TA3B 4X9HA 1U8HA 5CWSA 1J0HA 2IAMB 2XZAL 1TTUA 4UFJA 3VTRA 4X7TB 4R2GC 2PWDA 1DQQA 2J4WH 5JNYB 4HHAA 4V2BA 3KYKH 5JDSB 4LSSH 4ZFFB 4U1JB 2EXWD 4QRRE 4YEEA 3C08L 3VDBA 1NCDL 4U2YA 4OD2A 2DIEA 3KYMA 5D96B 3CXHK 4YHOL 5DJXB 1AVAA 5IEKB 1DVFD 3PWVA 4EOWL 2NZ9C 1TZIA 3QUXA 5IBUG 1TZ7A 2H1PH 1XR9A 1RSFA 1VCAA 2DQHL 2HJKA 1HL8A 4FN0A 4HWZB 4MA7H 4PRHE 2CRYA 3GO1L 5E8DL 4C55A 3QUMH 5EA0H 3P3YA 3A4XA 3LKSA 4KK9D 2C4FT 2HKFL 4JKLA 1TFVA 1AGDB 1E6QM 4J23A 1SQ2N 4AH2B 2VRAA 3C08H 1LO2H 2NW2A 2NXZC 3QH3B 5I0DA 3QOKA 4PREA 1VEMA 3BWUC 1JUFA 4JPWH 4YHOH 5IESH 3D51A 1KPUA 1B9ZA 4WEMB 4PRAA 3U9UA 4BUHA 1NBYB 4EOWH 2APTA 3VILA 1ZTXL 1FHGA 4UQ3A 5DRWA 4WI9A 4QGTA 1MQQA 2J77A 3W29A 3MJ9A 4ZOBA 2X8RA 2DQHH 1DDHB 3BSZH 1A2YB 1K85A 3LKRA 4X6CA 1CT8A 3QXVA 5IF0B 4M43L 1V7NH 2Q3ZA 2WCSA 2DOCA 5E8DH 2WKGA 1RU9H 3MUJA 2JE8A 3LEYL 4EJ1C 1O5DT 3OZPA 5GZOC 4KQ3H 4DWSD 1HXKA 5F21B 2HTLD 2HKFH 4NGHH 4CU7A 2XTJB 2D3NA 3VXSB 4YO0A 2GAZA 1K4DA 5F7MC 3MLZL 4LCCB 2IXVA 2WMKA 1RK1A 1TJGL 4PTMA 5E56A <