1CXFA

Complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 227
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxfA01
1AR1D 4RGND 4U3AA 4H8WL 4H0IA 4JQXA 5C8BB 5F3BA 3ARBC 4KGLA 3WY1A 3BSZH 4YK4B 2ATKA 4UDTB 4P0DA 2NXZD 5DHVA 5F8RC 4TVPD 4FNUA 5ABFA 3T3MF 1J0ZA 4YX2H 1KXQE 4W7VA 2F53B 2FCBA 3PDDA 4ONGH 3PZTA 5CD5C 3UO1H 4Y5VB 3QXUA 5EU4A 3FQWA 4FABL 4HMCA 2VLJE 1BQUA 5EFIA 2XPKA 3S8WA 1JUFB 4MA8L 4KMTL 5FDWA 2XGBA 2VE6A 2B5IB 4PJBB 1OSPH 1UG9A 4FNTA 2PWDA 2VXUL 1XCQB 3BH9B 5LGKA 4WO4A 1R75A 5D70H 5KANG 1KF9B 1X4XA 3ECBA 5I1EL 4NZJA 3KNBA 4N8VG 3RX7A 1T0NB 3L9RB 1C93A 5DLMH 2E6JA 2VDPL 4P8UA 3HNSL 1ODZA 2OL3B 3ZTNH 1QSFD 3TNMB 4OJFL 5JXEC 3G08B 1T3FB 2CSPA 3ZT6A 4DW2H 5FIEA 3IDGB 1F90H 3KJ6L 5DMYA 4QRSA 1W9UA 1FOBA 2XACC 4Y19E 3SUSA 2GW5A 1IC7L 4HBCH 1G9HA 2YWYA 3CU1A 5ICZB 1V7NL 4QTHA 2BSRB 2D0GA 4LLWA 2E8YA 3W37A 5BJTB 2EE2A 4QRRA 1FSKC 1BVLB 4KDVA 1HJVA 3BQUB 3TA3B 5IHZA 4NQCE 1I9IH 3KPSD 3WEXB 4RE2A 3PTMA 4D9QE 4ODTL 3RVTC 3PGDA 2NY2C 1ED3B 1AVAA 4NC0B 1ZA6A 1INEH 4NZRL 5SX5H 1E4XL 1OB1B 2A9ML 4NRSA 2PYFB 3O4LB 4GG6F 4PB9L 2F19H 1DQTA 3RUGB 3U82B 3GBNL 4GKNA 4GW4A 1UYQA 4JZNA 4MLIA 3RMEA 2P43B 1DQJB 2RAMA 1XGQB 1BF8A 3L4YA 1RUML 3SKMA 4DKEL 3TVMB 2DWDB 5T5NF 4HLZH 1W1PA 4Q58C 2WK2A 2PTUA 2WHLA 1J1OL 4HXBL 3WQ8A 2XTJE 4ZFZA 2EIBA 5AUMB 3NN8B 4QOKE 2R0ZH 1KLGB 2WBJC 5MEQA 5I1KH 1IAOB 1WE5A 1W2VA 2CQVA 2HJKB 3BO8A 3KPRB 4ZOCA 2HKHH 3LHPL 3LPOA 4HS3A 1TCRA 2FO1A 1JPSH 2VLJD 4WI5A 1UKTA 4KK8D 3AHVA 3V6OE 1CZ1A 1RZFL 1JGVH 3BUTA 3MRIB 4H25A 3R1GL 3C87A 4OM1H 1MJJB 4WI8A 2FECI 3WN6A 2FL5A 3K4DA 1ADQA 1V3IA 5E4IA 3VFPB 4W8LA 2P42B 1DQMH 1GHFH 3I6GA 4NGHH 2EDRA 4XRCA 4EI5A 3OG6B 4UINH 4EN3D 1G01A 2CBIA 1OP5K 1WAAE 4PREA 1KXVA 5GGRA 4YDLB 2UUDH 3D9AL 4JDVA 4F7MB 4LHUA 2FO4A 3EUUA 4R2GD 3HCVB 3N15A 3CZNA 4TVDA 4RBPK 3AMGA 1NUGA 1E1EA 1EPFA 4F2MA 3H0TA 5FGBC 4PJHF 3V52H 3U36B 5DT7A 3VCLA 3P4NB 4P2RE 3R8QA 4Y19D 3VX1A 2CUMA 2FBOJ 1RQ5A 2YD8A 5DJ6A 1UACH 3Q48A 3TTSA 2XQBL 4U1KA 4JAWA 5I1CL 1HWGB 3UDWA 4HZAA 4Y4KB 3A21A 3ZYJA 4QO1A 4LGSB 4JJ5B 5F1IA 3VGAC 4GAJL 4D9QD 3DX7B 4D71A 2Z9TA 3MGTA 4N1EA 4YEEA 5IESH 2VUOA 3RVWC 3HR6A 1IAIM 3KLLA 3H3KA 3MJ8B 4GRWE 5A95A 1RUAH 4X7DC 4O51A 4NSKB 3FRPA 1Y0LB 4G9FA 4P4KD 1S3KL 2P8LB 2VQ1B 3UYOD 5CPSA 4KVNL 3FFCE 5FCUH 5E95B 2PTVA 4EUPB 2DH2A 7FABH 3O6FD 2CUIA 4N0UE 1IGTA 4HKZA 4Y5XC 1ZA3B 4RMVA 1QSVA 3RM9A 2UV3A 3MJ6A 4UT6H 4CMHC 1M7DA 1HOCB 3EHBC 2DT3A 1S7QA 1OWQA 2P46B 2PW1A 1I9RL 1MWAA 4YX2L 3SIMA 1FFNA 2XTJD 3MV9A 5IR1B 2YK1L 4ONGL 4HC1H 1TA3A 3I84A 4HBQA 3JV6B 3UO1L 5HGBA 3OG4B 3ES6B 3QEGH 5CJXC 3FZUC 1CLZH 4PJAF 1TQUA 2EKJA 1N7MH 3BAWA 4D1IA 5ALBH 3MLZL 4EQ3A 3BVNB 2IBBA 1SBSL 4KRPB 1JV5A 3VFTB 4YE4L 4F8XA 3EDEA 1OSPL 1XHGA 4IDLA 4RMTA 1ETZA 2O5XH 4IRJB 4IISA 2JCCF 1N82A 1NDGB 3H2WA 5D70L 4R5EA 5TQ2H 4NFDA 3CZEA 1MEXL 1UXWA 3IJSB 5DLML 3KWWB 4QXGH 3RWDA 4P5TC 4MNQE 3ZTNL 4ORGB 1JXKA 4I9WE 3BKJH 1OIFA 4MYWB 4DW2L 1E4KA 4HUXA 4Y4FA 2VT0A 3RTQA 1F90L 3UXFA 1NBQA 3A3HA 3SPVB 4OFYA 3VXPA 4HKBB 4QCIA 3QIBD 1D9KB 3P9LB 4J3XA 1IGCH 4P2RD 3IKCA 3CUGA 1OTUC 2WWMD 4XWGH 4RGOH 5BS0E 1WBZB 3H3PH 1PLGH 3TIDA 2GJRA 2D7OA 1HSAB 3N1GC 2D4FA 1P84J 5FO9B 3BMWA 2V9RA 4HP5A 4M80A 3PZQA 2BOBA 3QUKA 1OLZA 1I9IL 2YZ8A 3V0AC 2Y8KA 1KELL 1B88A 2FWOB 2XWJB 3DX2A 3MXWH 4L4OA 4HT1L 2G60H 3W11C 3ZJ6A 4XX6A 1U8KA 2AAVA 3KYKH 1EEZA 5AZEH 3LKNA 2LABA 3O11B 1G7JB 3WENA 1OGAB 1YECH 43C9A 5KBNC 3QEQB 4JDZA 5DUPL 4HJJH 4MB1A 5KG9A 4MDIB 2WLZA 1PIFA 1PS3A 1WWBX 2F19L 1LF1A 4U6VL 4R4BA 2E7CA 4H2CA 3V2AR 2WVUA 4IOFC 4KROB 1BVZA 1JTPA 2NLJB 1HF6A 5A8MA 4CD4A 1B9ZA 1BD2E 5LGJB 4L5FH 5D9NA 3GK8H 3VJ6A 3IGAB 4J2XA 3BZFB 1NGQL 5ESAA 4CGTA 2J79A 4WW2A 1ZHLA 4JY4B 2UYLA 4X5WB 1CI5A 2R0ZL 1B1YA 5HYSA 5MP6H 1OAZH 3PP4H 4ZUTB 4Q7NA 3LN4B 4PJ8A 1SZNA 3INUH 4Y4HD 2IG2L 3T0VA 4R27A 4LLDA 2ZPKL 3GBMH 1JPSL 2R2BA 2GYSA 3LRGA 1EAJA 3SE3A 1FAKT 4M7JL 4RDQF 4WNQA 1JGVL 3GSWB 4L4TA 1NAML 4OM1L 1PZ5A 5DQJB 3UTSA 3LOWA 5HPMA 5I73B 4X8XA 3PZGA 4M93B 3KLAB 1BGXH 1BIIB 1DQML 3IAQA 4X4MA 4UINL 1NUDA 5GISH 3UPRB 4LLMA 4MNQD 3CFDA 4AZ8A 4JM2C 1NEZB 4IPNB 4YHYB 4Z7UE 4C7GA 4LVHC 2PO6B 3C5ZC 1BSIA 3EFFB 2IAMD 3V52L 4YDJB 1DLFH 1UJ3A 1CLYH 4HX1B 2BX5A 2R2CA 4PJ7F 1G7PA 2UWEF 2XZCH 1K8IB 1J1PH 5BS0D 2WBWB 3ARGD 2HLAA 3BGMB 1XGTA 4UDTA 4H5SA 3TJEH 1NQBA 3OKYA 2APTA 4PD4K 2VQUA 4S0SD 2YZ1A 4AMKH 5IESL 4I4WA 5F7NC 2LVEA 2ICWB 4QEGA 1YPZA 1JRHH 1A4KA 2BVOB 1XIWC 1CD0A 2JJUA 1RUAL 4JHWL 5HSFA 2OS7A 1EBAA 32C2A 4LL9A 4Y5VA 4KQ4H 3C09B 2VB5A 5FCUL 4GZJA 1P6FA 1MI5E 4K94L 4L8SC 1J8HE 2YSSB 3B9KD 3U0WL 5IDIA 1BD2D 5J3HC 1JMXA 5KN5B 3I6LE 2ZJSH 3L2LA 1U2CA 1RHFA 3AUVA 1ORQA 1XCQA 3ARFB 3BH9A 3OR7B 5IW6B 3OLIA 3BT2H 1IEHA 4YHIB 4N0CC 3MLWH 1C3FA 3SDXF 1T0NA 3L9RA 3RWJB 1K4CA 4LPCA 2YRPA 2OL3A 3UETA 4UOW1 3TNMA 4LSDA 1MHCB 3O2WH 1T3FA 3QHOA 1UKPA 4YHEA 4ZE5A 1N7ML 2ZXBA 2FLRT 5ALBL 1N26A 4G42A 4Y16C 3WQVA 2GJ6B 3QUZD 1EHXA 5DURD 5E9AA 2O5XL 5FECB 4YO0A 5SWSB 3MROB 2BSRA 4BYHA 4M00A 4OI8A 1U95B 1IGJB 1JYNA 3RZCB 2Y23A 3QNZB 3BQUA 1D6EA 4QXGL 3WEXA 1WIOA 2HFTA 3V5DA 4Q9QL 1MFUA 5DS8B 3NSMA 4NX0A 1U2YA 3BKJL 3CSBA 1GH7A 4J3UA 3EBVA 1RZIB 1OY3B 3AHXA 4IDJH 1J18A 1OB1A 2PYFA 3TN0D 4F80A 1HVQA 3DARA 2W0FB 4K9EH 5FUOH 5C0BD 2XY1A 4RGOL 4G9DB 4H88H 3H3PL 4KK6C 3T2QA 1DSFH 5HYJA 1OL0A 1U3ZA 1XH3A 3N13A 1ZJBA 2XA8H 5ACZB 3D3VD 2WCAA 3L7FB 2AJSH 4ZYKA 5JDJA 1G6RH 3G6JB 4A2LA 5GZOC 5DYOA 3MXWL 2PXYD 2H3NB 2G60L 1VFAB 3KYKL 4M8QA 2PR4L 3GM8A 4KJPD 5AZEL 3ARXA 4W86A 3MUY1 3HZVA 1OWWA 2ADFL 4POZC 2LQRA 1YECL 4HPOH 4H0HB 3FJTA 3NN8A 4HJJL 3BP5B 1M71B 1IAOA 3KL0A 2DGAA 2HJKA 3KPRA 1OINA 3TP4A 5DJZA 4NZFA 1MI5D 4NQDD 2PC8A 2P49B 2X4TB 3FN0H 4URIA 4I3SL 1W3LA 1J8HD 4QRQB 2Y24A 4ACZB 2DD8L 5MERA 2EDBA 1HSBB 3BGFC 3RIAK 3GK8L 1MJJA 1H3XA 2GTZA 4MAYB 1IEAB 3NIDE 5SX4I 4NO3B 2BERA 5DC9B 3VFPA 1JF1B 5LA1A 1YY8B 3D39E 4ZXBB 1UR2A 1CFSB 5MP6L 1OAZL 3PP4L 4MQ7B 1MJUH 3INUL 2LFGA 5EOTB 3HCVA 4OLYH 4QRUB 2ALWA 5A6JA 3GBML 4X5LA 5CZXD 3TZVB 5DJ0B 2O9OA 1WBXB 3WXWH 2BY3A 3DHPA 4QRRE 1HHHB 4K3HA 2EH8H 4OCSL 3ZTJG 5DF0A 1T4KB 5C7XH 3IDYB 4P4KC 1M1SA 2XG4A 5A6SA 2RJMA 5A2IH 1GPOH 4N90E 2DAVA 3BH8A 2JB6B 1BBDH 5D7IB 3V6ZA 3O6FC 4LOUD 5GISL 4EIGB 3B3IA 1S78D 2NXYB 1FCCA 1X5XA 1IARB 1NFIB 3N1PC 3WFEH 2ZXQA 1W9BM 1MFAH 2AQ1A 3MV7D 1MRDH 4DCQA 4B9ZA 3ZDXE 2NT0A 1R34A 3MJ8A 3HG3A 3QFDB 2R23B 4YUEH 1KJMB 1Y0LA 4X6DF 2VQ1A 2XZCL 3GRWH 3LRMA 2VAAA 5GRUH 2AOSA 3LXBA 4F15B 3BPLB 3HPJA 1N3NA 3LRSB 1LP9A 3FN9A 3QJFB 2R2HA 1UC6A 4M61B 1UD5A 1DFBH 4BK4A 3AREA 4ZO8A 4APQA 4JIEA 3TJEL 3D0LA 3BKMH 4KRMB 2PKDA 4IMKC 1MCRA 4AMKL 2VR4A 3HRZB 5JHDA 4AZ5A 3MNVB 5F3HB 1T0PB 1OAQH 1P7HL 3HS0B 4PJEE 1R33A 3RWHB 3H8NA 5IR1A 2K7QA 5LGHH 1DBJH 3N9GL 4NOFA 1AH1A 1XCWA 3PUCA 1F2XK 4NFCA 3ES6A 3WO4C 4G8GE 4ZTOH 1V3KA 3AS3A 1RJYB 3LPWA 1A6PA 2DM2A 3TO2A 2H32H 1PG7W 5L2KA 1EUTA 3U2SA 1VBRA 4QCFA 4NQXB 3VFTA 1LO5B 2Z4QB 2ZJSL 1I8LA 1LL4A 4IRJA 2V9TA 4F9PA 4ODBD 4E4PA 5KSAC 1NDGA 1DQDH 5M7QA 3CIVA 4YXKH 3MREA 3MLWL 1C7SA 3BFOA 4UAOB 1NC4D 2WVSA 3D39D 5CLWA 3LPGA 1OB0A 4HV8B 3AS2A 4XXDB 4HUWB 1NC2D 2GUOB 1EOMA 3WUWB 3O2WL 2AERT 5TD4A 3N04A 4JVUA 1AMYA 4ONHB 2Y8VA 4BS0A 2Z91A 3NFPB 3T2OA 3N11A 4CNIB 2F54B 2CJUH 4DUWA 4M6OH 1D9KA 3P9LA 5JW4N 2DH3A 2XWEA 5C0ND 5FO9A 3IDUA 1FNEB 1R5WA 2W38A 1DVFC 4Z7OF 3VFGH 5ITBH 1SYSB 3HI6H 3UROR 3WNMA 3ULVF 2WMGA 3W29A 2NT1A 2EDKA 4UQ3B 5IP4A 4C56B 2XWJA 2R39A 2Y72A 3RU8H 4G9FE 4FNRA 1EOKA 1MRFL 4GO8A 5LVEA 3AU1B 4OZHF 1ODAA 3QXTA 5DQDH 3O11A 4QFUA 1G7JA 4CVZB 1OGAA 3LSOB 5MEOB 1D6VH 2V5CA 1RJCA 3WF3A 1CICC 1MAMH 4MDIA 3BUPA 4K9EL 4UUJB 1NFKA 5FUOL 1Y6KR 2BDNH 4XXCA 2X70B 4H88L 4DK3A 2VJXA 1F4XH 3LQZA 3VH8G 3BUDA 4HIJB 1C5CH 3B8SA 2E0PA 3EGSB 3VXRB 2XA8L 4BKLA 3O6MH 4DKFH 5LGJA 2AJSL 1DLHB 1G6RL 4EJ1C 3RL1B 3UAJD 3QDAA 2ARJB 5E4EC 5HHVH 4Q74A 2AGJH 5DK3A 2CO6B 3UR8A 3AYSA 1F6FB 3MLXH 4WV1C 1B3ZA 4HPOL 2QQLH 3KJ4B 1JPTL 4JY4A 5HHXH 3EO0B 1CDBA 3PL6C 4PJ9C 2GSGA 3G5ZB 4PRHB 1PKQB 1YEDA 5JO5B 5E9DB 1WVZA 2NTSP 4FFVC 4KKNA 2YS4A 4KK5C 5DDHB 1GVYA 4G8GD 4PRPE 4YH6A 5CSUA 4NJAH 3FN0L 2H8PB 3AIEA 4X9FA 1WNOA 2YN3A 3A6CH 3HLAA 1P5UA 2ZX5A 1CGWA 2MCG1 3V8CA 4JFXA 1X1NA 2CIIB 2JLLA 2XFFA 1QOKA 3PGCA 3QQ4A 5T5NG 1TQCB 5CP7A 5F93C 5HGGS 4BFIA 1BG9A 3RI5K 4DFHA 4IEFB 3VNYA 2EDEA 1LNUB 3NCMA 3RVUC 3TC9A 3L5HA 3UPRA 3GTNA 1MJUL 3KPPA 1DN2A 4R4FH 3MQIA 4D3CL 4OLYL 5M3WA 1MH5B 4IHOB 1A6ZA 4HUVB 1NEZA 1SJEB 2ZP0T 4G43A 5I0DA 1I1RA 2PO6A 2C1PB 3WXWL 3EFFA 1NLBH 4H0GA 4J3WA 2VDMH 3QWQB 4YDJA 4LCUB 5JW4Q 3A4WA 2AK4E 2EH8L 1GHSA 5C0GA 3QDMB 2D0HA 1HINH 1N2RA 5JOPE 1ZL1A 4BQ2A 3BC9A 1K8IA 5C7XL 5KAQF 2DDXA 2FX9H 3ULVH 4X6CE 4PIRF 5D4QA 1NBZB 1H3PH 3BKCH 1BBDL 3BEVB 3O9WB 1T1XB 2ENYA 2OI9C 1SMDA 1WO2A 2BZDA 5F7DB 1H0IA 4F7TB 1GNXA 4JL1A 1MFAL 5TE6H 1MRDL 1U6AH 5ICYA 4XNQB 2BVOA 5GZNC 2G41A 4MJ5B 3L4TA 5J89A 3O4OB 4GOSA 3GRWL 1HE7A 3T0BA 5AYIA 5GNYA 4PJGB 1EFXB 2P5EB 2Q3ZA 2GY7B 4GRMA 2NZ9C 5IFJB 4N0FB 1DFBL 4XCFH 5DHYB 1XF4B 2X4SA 1BOYA 2VLME 5BRZB 5KN5A 3BKML 2EE3A 4W81A 9CGTA 2ZKHH 3OR7A 3QQ3A 4NN6C 3VWKC 4NC1E 1OAQL 4PYHA 4PRDA 1MNUL 2CMRH 3OV6A 2AQ2A 3WLBB 3BPCB 5LGHL 1IVLA 3CZGA 2E7MA 4L4TE 3ARDA 3CHCA 1FP9A 1Q72H 4D9LH 3LKSB 3MPCA 4QLLA 4ZTOL 3THMH 2LTQB 1KWKA 4UBDC 4PRPD 3VD7A 2ZOKA 1QEWB 3OX8B 2GJ6A 4JPIB 5JW3H 1MW1A 1LEGA 1AHWB 3VKKA 1S7VA 1NMCB 2ATPB 2CUHA 2WZHA 3MROA 2ED7A 1G7IB 1DQDL 3OAZH 4XZUB 4YXKL 1KEGL 2PWHA 4PBXA 3EO9H 4LPTA 4PJ5B 3MCKB 4K94C 4L3AA 2EDDA 4O2EB 4ERSL 4W68A 2E9WA 2ZUXA 1R86A 3ALGA 2Z35B 1RZIA 4L9DA 1H3TA 4KJPC 1E3XA 2O9RA 3MUAA 5D7JB 4XX1E 5L7XH 4YR6B 2CJUL 5DFTA 3MLPA 3CHFA 3KR3H 2W60B 2ZZUT 3GEWB 3W0WA 2AK4D 3T0EB 1HP4A 5JOPD 5FUCE 4QGTA 4UOW0 5ITBL 3BDXA 3KXFB 3VFGL 5D4YA 3DX9B 4GI8A 4JVWA 2VISA 3ARZA 3S2CA 2F53E 4OZIB 5KZCD 4J23A 1FP5A 2B8OT 3HAEH 3RU8L 5FV1L 3WIHA 4N5UA 2DQDH 3LKQB 5IQ9B 2IGTA 5DQDL 4EUPH 3VFUB 3IXTB 1D6VL 1K8DB 5B3JF 1EO8H 1KXTB 3NZ8B 3AJ7A 1MAML 3MZTA 4UTFA 1OP3K 4PJBE 1OAYH 2V7HB 4P9HL 3KGRA 4GRLC 1F4XL 2F7OA 1MCLA 1OF2B 3PDOA 1A1NA 4OCYH 1C5CL 1FIEA 3RVVC 5DO2D 3HI5H 4F8QA 4NO5A 3IS0X 3L5WB 3O6ML 2R0KH 4DKFL 4ELKB 2DSWA 1MQRA 4XVTH 5I9QC 4HW6A 4OBRA 1IEAA 5HHVL 4KUZH 1E6SM 2AGJL 4PFEA 3F5LA 1JF1A 3MLXL 1HILA 1ULVA 2QQLL 4ZXBA 3UC0L 1OGSA 1V0MA 1E0XA 2XKUA 1A6UH 4MQ7A 1VGEH 1VFFA 3WS3B 4XVUC 4Y7EA 4LHJB 4E5XA 1AI1L 4NJAL 2IPUG 1I4FA 3GSNB 1CGUA 1XGRA 1WBXA 4HK0B 2EEBA 2B20A 4L3CB 1TZIB 4M5ZH 1KB5B 1S9XA 2W9EH 2CGRH 5H37H 1T4KA 1T7XA 4RAVB 5HXMA 4P2QB 4YDVB 3SUUA 4L8BA 5DTFA 3NMEA 1JNDA 1Z9LA 4N8VA 2W07A 2UY5A 3FHQA 2J1KA 3O4LE 4XHJD 4QGYA 4OZFG 1MCNA 2Y07H 4R4FL 4XNZC 5GGSA 1J0JA 2HMID 3RUGE 4MXVF 5K9OB 1IE5A 2FBJH 3SN6N 1NLBL 2VDML 1IGML 5J6HB 1BPLB 1KJMA 1M05A 1HINL 1MQKH 3V6BR 1T1ZA 1KCRH 5FOOA 5TJWK 2FX9L 3ULVL 4WY7H 3LRSA 4XTRC 1H3PL 3BKCL 4HOZA 4YBLB 1S7XB 3QJFA 4M61A 3MR9B 1T7VA 4P8XA 1V08A 1DANU 2F53D 1QFWH 3MX0A 3GMNA 4GXUM 1UUQA 3HRZA 1UVQA 1U8MA 1KIQA 1WBYA 4ODUB 5HDOA 2VCBA 1U6AL 4RRPG 3ALXA 3HS0A 1H3GA 5DWUH 5B38G 3RWHA 4K07A 1OOAA 3A4AA 3NGBB 1MVUB 4A3YA 3QYCA 5MENB 3TBYB 5JIKA 3PWPA 1DEEB 2C7FA 4DM2A 1KENL 1IZJA 2Z31C 4NQXA 4PJXF 4XCFL 1FL3A 5EUKB 3VXUD 4M62L 4JLRB 2ID5A 4QHNB 4E8DA 4FFWC 2Z4QA 1V8HA 4AZCA 2ZKHL 1DP0A 4LLAA 2EDQA 2Q8BH 2HKFH 5TGBA 2DMBA 1KIRA 2IPKB 4QRPA 5JIHA 5E2JA 3MNWA 2ZCKH 1E6QM 2VZUA 3BHBB 4HV8A 4UQAA 3V5HB 1TZGH 1H5VA 1ZMYA 4QXTB 2GUOA 4P46A 2D24A 1FHLA 1Q72L 3WUWA 2FHBA 3OHXB 1CU4H 3THML 3LQAH 4W84A 3NFPA 3GI8H 5GGTA 2F54A 2QKIB 1R8LA 3JV5A 4FNLH 5JW3L 5E1QA 3MRDB 5ETUB 1RZ8A 2ZSVB 3TA3D 1JNJA 5BZWA 2GEEA 1GJUA 3SURA 2CXGA 1PY4A 3D1MC 1T83C 1FVEB 2NY3C 3EO9L 3IDJB 1JNLH 1JL8A 2VZSA 3PTQA 1JE6A 4UQ3A 1AJ7H 4OF0A 4JL2A 4C56A 1ZLUH 5ENWB 1QI0A 3O4LD 3LDBC 1QBBA 3OLEA 1X4YA 1HYSD 3SQBA 4S1SH 4CVZA 1WCQA 2N7AA 3KR3L 4NO0B 1WEJH 2CLVB 4DK6A 3DYMA 4J4PA 3TVMD 5C08D 3DC0A 3LEXA 3DIFB 4PTXA 3PV7A 4MD0B 4U6XA 4OUUB 1MCEA 1UQZA 1W9VA 4JO4H 1BM3H 1UWXH 1DLHA 2IGFH 2IJ0C 3MFFB 4MDPA 3IFNH 2ARJA 4UIKH 2DQDL 1VGKB 2WVVA 3QOMA 2QQNH 2EXYC 3F62A 3O3AB 4XI5C 1OAKH 1EO8L 3EO0A 4PRHA 3G5ZA 1PKQA 3FB6B 4JB9H 1L0XA 5FV2A 3RWGB 1OGGA 5T1KA 1P4IH 2UY6A 3MBEB 5BZDB 3WHXA 4JFFB 3GGWA 5C07B 1B0RB 5I74B 3RHWF 4GPNA 5F1NA 4YHLH 2BVQB 3PF2A 2Q86B 1JF6A 2R0KL 5JPMB 3QPQC 4WTZA 2ICCA 4K71C 4MQXC 3C2SA 1T1WA 3GMMB 4GT7A 4KUZL 2YKKA 1JPST 4L8DB 3ZHLA 4LKXB 3S4SB 3A0OA 2APBA 4RQQB 1MFDH 4KJQD 1KPVA 2XTLA 5F1KC 4AQ1B 1A6UL 3RDTB 3OA5A 5IROA 2V3DA 1VGEL 4KRNA 2DDQL 2IALB 2I07A 1A2YB 2BY2A 4EVNA 4HUVA 3CMGA 1RP9A 2C3XA 2C1PA 1UD4A 3VRIB 5FO8A 1UZ4A 2WAGA 3QCUH 5D5MB 3QZWG 4M5ZL 4LCUA 4OZ4A 2VLKD 2W9EL 4Z6AT 2CGRL 2HVMA 1UB6A 1AKJB 4Y4KD 4ZD3H 2C1OB 3UCQA 3AY4A 2F7QA 2H2PD 1L4IA 3WHE1 1CTNA 3KYMA 1NBZA 2BVPA 2J12B 4GKSA 3ZLQC 3BZDA 1NANI 1BZQK 1AGEA 1OGAE 3A5VA 1T1XA 2NY0C 3QEQE 4LRNH 1XGYH 4FN0A 1F97A 3ARPA 1I1FB 3BN9D 2EZ0D 2Y07L 4F7TA 3Q6GH 1QWUA 1XD1A 1JFXA 5IBUG 5HVHC 3PP3H 2OXGA 3JBG7 4XNQA 1QKZL 2FBJL 35C8H 1C16A 5D96C 3NPSB 3CC5B 4U6TA 4L8CB 4MJ5A 1EDTA 4HHAA 3MBXL 4JN2B 1E56A 1LLOA 2DMKA 1T0OA 1MQKL 1RU9H 1Z9MA 3FFDA 1KCRL 3OWEA 3WD2A 4WY7L 3VFSB 4M48H 4XBPA 1IAII 1MIMH 2D3LA 1XF4A 2FD6H 2PUQT 2C4FT 1QFWL 3GNMH 4BUGA 1BLIA 3FL7A 4PGDB 2CRYA 4QYOB 1UH3A 4IMLB 5EOQH 4QDMA 4LBEB 5DWUL 3SGKC 3PZ9A 3W6LA 2UY2A 3K7UA 2WZIA 3WLBA 3K4ZA 1B2YA 1DWAM 2YL6A 1J8KA 3AHTA 1X6LA 5D1ZC 5E09A 4LCCB 3LKSA 3QIUB 1W2PA 1HH9A 4K7FA 4CD8A 1N6QH 4ONFH 4R8WH 4H1LG 5C70A 1RULH 1I7ZB 3OX8A 1IMHC 4DFIA 4M1DH 1TCMA 4M7ZB 2J77A 1KACB 2Q6WB 2Q8BL 3N06B 4RGMC 2HKFL 1HHGB 3TPUB 4J3TA 2CPUA 3RGVB 2ZSWB 1BFNA 4PJ5A 4MNJA 4O2EA 2XTKA 3OMZA 3OJMB 5GS3A 4TTDD 4NQSA 3FB8A 1FGVH 5DRZB 2ICES 5AG8A 1CU4L 1WZLA 2Z35A 1BJ1H 2QR0B 3GI8L 4MJIA 5D7JA 2D9CA 3IGUA 4L9LA 2G3JA 3LQMA 4YFEA 3F5JA 3T0EA 1I3GH 4OOZA 2OTUB 1CCZA 4M6ML 3SDDB 2EICA 3T2NH 4D8PB 1JNLL 1I1YA 3MV8B 2NX5E 3PHOA 2X4QB 1C5BL 4OZIA 2ZUVA 1AJ7L 4RWYL 3QEQD 5I2UA 4JAMB 1RPQA 3Q3GB 4ETYA 5IQ9A 2H26A 1E4LA 4YGVB 2AV7B 2XFXA 1Z2KA 4S1SL 3VFUA 2PF0A 3IXTA 1A3LH 4P2OB 5F6HJ 1FDLH 4KROD 5E24E 1US3A 3ABZA 3L4ZA 3LB6D 1BBJA 3ZKQD 4E42B 1WEJL 2ICWJ 2X4PB 1OBAA 1QTYT 3FO1B 5D1XD 4WWKA 1IBGL 1OF2A 2A83B 4FXLA 3OR6A 4OCRL 4YJZL 4K8RC 4Y2DA 1VF8A 1G9NC 4WCYL 3L5WA 4ELKA 1KULA 3O3UN 3E6FB 1BM3L 4JO4L 4HKXA 4UMGA 3D69A 5FAAA 2IGFL 3IJ7A 3NUKA 5FIPA 3IFNL 2PBGA 4MGXA 4UIKL 1BPVA 1JHKL 2I5YH 1XV8A 5BQ7B 5I6XC 2FJGB 5IMLB 1S9VA 2VOTA 2GJ6E 3CH1A 4JFWA 2JEQA 3BEWA 4OGXH 4JB9L 4R3SB 3WD5L 3D18B 3EYSH 2IH1B 1P4IL 2R4RH 3DVIA 4OKVA 5CIPA 5SWSE 4EDWL 4YHLL 1YEKH 3GSNA 4WFFD 4U0RC 1V3MA 4JY5H 4L3CA 1TZIA 1KB5A 4FRWA 3OKEA 3PWJB 3JTTA 1EJOH 4XNUH 3X14A 1ERNA 4PV9A 2GT9A 3PV6B 4RAVA 4YDVA 1Q6EA 1R5IB 2ZG2A 1W0VA 1MFDL 4P9HC 3H7BB 2G3MA 4TSCH 3N1AA 1A9EA 2V6HA 2GCYA 5F7MC 3STLA 1J11A 4M4RA 4UTBH 4A6YB 3CVIH 3WF4A 3POCA 3IJYB 3F5WB 1DBBL 5IQ7H 4MVBD 4JO1H 5K9OA 1E27B 4YPJA 3N0PB 3QCUL 1H8SA 4KKAD 4IRSB 4XC1H 1M7XA 2DB8A 2BVYA 4Z0XB 2XXMB 1S7WB 4LIQL 5A2AA 2D3VA 4QXUH 1WZ1H 5J9PA 4ZD3L 3G6JE 3CK0H 4XCCH 5K59E 3U83A 5GGRY 1UWUA 4CW1A 3KHOA 4ZSOB 2V38A 1YZZA 3VFVA 3N50A 1TZHA 4LRNL 2NX5D 1XGYL 3KVQA 1HIMH 1Z9OA 5GS0H 3Q6GL 4GMSH 1TJHH 5JXAL 1ZGLA 5D71H 3E1F1 5CD3B 35C8L 5DA4A 5KS9A 1MVUA 3BD5A 5C0EB 2JJSC 4NQEE 1RU9L 1DEEA 3ARSA 1SY6H 5F9WB 1VSCA 2ZUWA 2BHUA 3HE7B 3ARFD 1NCDL 4M03A 5KAQG 4HWEH 1R87A 1MIML 5EUKA 4NIKB 3O6KH 2FD6L 4QHNA 3GNML 1PG7H 1NCUA 3SCMD 1YMHB 2R1WA 1MXGA 2IPUK 5ERWB 1AP2A 4LEOA 5EOQL 5CSZA 1I1AD 2CKSA 1FFPB 3ULVC 2VKXA 3EIFA 5DRXB 3NA9L 4JEGB 5DRNB 5CXPA 2NQCA 4NRYB 1IM9A 1GGBH 3P30H 4OFIA 5EIIB 5EBWA 1K3IA 5SWSD 4ONFL 3CZLA 3KZSA 3DETC 1RULL 3ZDXF 2QKIA 1MW2A 2EO9A 4ZFMA 4HTYA 1U3HB 4M1DL 5D7IE 3MRDA 4N5EC 1CG9A 12E8H 3DRTB 1DE4A 1EUUA 5ETUA 3RQ3A 3RZCD 4JFUA 1U8JB 5D9SB 4LCWE 5EU6B 1G9MH 4HFUH 4Y5YB 3KDMB 4ZOAA 2XWDA 2A3EA 1JN6A 4OLUH 2E7HA 3G6LA 2YLLA 5ENWA 1MFBH 1U8HA 5BVJB 3SOBL 1NGXA 1QOXA 4HH9B 4KXZI 4YEFA 1RIUL 4W4NA 1WIUA 3MXVH 1NFDA 5E0QA 3IF1B 3W27A 4NO0A 1I3GL 2EPMX 3QOKA 2DMCA 2XVGA 3HG1B 4XNYH 4OCMC 4OUUA 2YD2A 1NGYB 5CGYC 1V6VA 3MFFA 1U92B 4HWZB 1KCKA 4K3DH 4TUOA 3IETB 4WUKH 4XMKH 2DSZA 2XWTA 3L95B 2DSUA 1IKNA 4ZAKA 3BW9B 4AYFA 1I85C 5I66B 3X11B 1A3LL 3F7VA 1FDLL 3MUHL 5D8JL 2PWEA 3REVB 3FB6A 4X9IA 4PGCB 2QQKH 4NQED 4XH2B 1G7QB 2BVDA 4JFFA 2X4OB 1B0RA 5C07A 4MAYD 4JFDA 3MRQA 2J62A 4M43L 2Q86A 1QG3A 3TESA 4XBGB 1I1CA 3SCQA 5HYQA 2IF7A 2XG5A 1FZOB 5KVDH 2J5LB 3GMMA 2I5YL 4YDKL 4Z95L 4FLSA 4L8DA 2J3SA 3ZE2E 4LKXA 1QD0A 3GJEA 4RQQA 3TZVD 4P57A 1WT5C 2X2HA 2F54E 2V9QA 5A2FA 4IIQC 4OGXL 3GJFH 3SDCC 3EYSL 2R4RL 2HLFD 3WS6A 3BN9C 5F6HI 4I2XA 1A2YA 3WH7A 3O2VH 1XF2B 2ICWI 3T0WA 5E6IB 3QAZB 4JY5L 3VRIA 3ARBB 4ENED 3GKZA 1AGDA 1MCCA 1J1XH 2MANA 2WQRA 1EJOL 1NEUA 3WUFA 4MNHB 1K4DB 2AJYH 4C56E 5C2UB 4LCWD 1WZAA 2JFEX 1E1FA 5E94A 3HI1A 3U1SH 4QWWC 4TSCL 1ZANH 5D1QA 4TXEA 1I1FA 3SBWA 4XVSH 3CVIL 3CMOL 2V17H 3BN3B 3MOAH 3WSUA 5AC4A 5IQ7L 3JWDC 5D6DA 4JO1L 1KUMA 1NJ9A 3EZ8A 1K3ZA 4GS7C 5HGDA 4XC1L 4K68A 5IJVB 3CC5A 3VXRE 1X5YA 4PJDA 1BZ7B 4QXUL 1WZ1L 1D5IH 3CK0L 5FA3A 1QW8A 1L6XA 1ADQH 4EI6B 1YDPB 4ELMB 2Q7YA 3VFWB 2NY7H 3DYPA 3TJHC 3RY6C 3ULUH 1I8MB 2MFNA 2I25N 4FLRA 1HIML 4PRHE 3AZTA 1PKQE 3KPNA 2VH5L 5E9DE 1B3WA 5GS0L 4GMSL 4QYOA 1QYGH 4IMLA 3PXHA 1TJHL 4FXGA 4HIEA 4LBEA 4PUBH 2E9MA 4D6EA 3DXAB 5E8PA 3GYCA 4KQ3L 5E0CA 4LCCA 1LEKB 4PJCA 4HZ6A 1SY6L 3QIUA 2ICEB 1B0GA 1KPUB 3DLQR 1HXKA 1BJ8A 3SUVA 3QHTC 5EWIH 3QP3A 4PRID 1I7ZA 4U49A 3VWJC 4AG4H 1FSKB 1JD7A 5D2LB 2JF1A 3UTQA 3MRMA 2AEPH 2Q6WA 3SCRA 3LV3B 5C0JB 1OSEA 3GSXB 4WKAA 1HHGA 2X44D 5JZ7C 2F18A 4DWSA 4JKMA 3RGVA 1ZSDA 2ZSWA 2MTPA 3MGOB 1R3JA 1NWUA 1EO7A 1KTLB 3ZKNC 2A9NH 3FO2A 3FT3A 3QDME 3WJLC 5KSBA 1FBIH 1NGWB 1GGBL 3P30L 5AWNH 1WPCA 4XAKE 4UIMB 1W0WA 1PY9A 12E8L 4C7DA 3EDFA 1YEIH 2OTUA 5BRQA 1FNGB 1G9ML 3GMLA 1PAMA 4HFUL 3SDDA 3VDHA 5D1XC 2YBUA 4D8PA 4LMQE 3MV8A 4WW2F 4DGVH 1V5JA 2WBJB 5E2TH 3T8XA 4OLUL 4E9LA 4EXPX 2X0YA 1MFBL 4JAMA 3Q3GA 5I17A 4Z2KA 1E6OH 4OT1H 4U1GC 5MEPB 5GS0D 2V5MA 4XNMB 4PJGE 1U3YA 2AV7A 2P5EE 2PWFA 3RX5A 1UZ6E 2E7LC 4PG2A 4HS6B 2OTPA 2WUCL 3MXVL 1II4E 3MMWA 1NGZB 5FK9A 3VXRD 2NYYD 2EC8A 5IVXB 4E42A 1MCKA 5BRZE 5SWZD 4LLUB 2NR6C 4F9LC 3BUYB 5DMJB 2HVKB 1GONA 5C0IB 3OJDB 5LKNA 4Z7WB 1I8IB 3NFSH 1L8NA 5HHOD 3DO3A 4NQTA 3E6FA 4RFOL 3WDQA 4K3DL 4QHUA 4HU0A 2Q20A 1Z0NA 2YFNA 3DHMA 4WWID 4XMKL 3OB8A 5E9DD 4NWUL 2GDUA 2WZEA 3U0TB 3KG5A 4OV6F 1FHDA 4OF8A 4GBXA 3C6LC 4BUHA 3BUQA 5FOBB 1U8IA 2VUYA 4MA7L 4S1QH 5KZ6A 5JHLH 3IANA 1QRKA 3D18A 4JFPA 2QQKL 5T3XE 3HJEA 1I9JL 2VLRB 3BAXA 2XKNA 2NY6C 4YZFE 2VZ3A 1US2A 3VDCA 1WSST 4KUCF 1S7SB 4AWEA 5ISZB 4JDTH 1MLCB 5JUVA 5IOPB 1N0XH 3WUBA 3IXAB 1FP8A 3CX5K 5KVDL 3O8XC 1PYWB 3VGAB 5AEAA 2E3ZA 3C5JB 4RMWA 1KNOA 4YFDB 2DKUA 5D6CB 3GBEA 4M3KB 4Q9BA 2DBJA 1YPZF 1E6PA 3T1WA 2YKLL 3BMVA 3T0EE 4D6HA 3BZ4A 4NDMB 1NP0A 3IJYA 3QDMD 2XZZA 3ARVA 4QLJA 3A4XA 3W6MA 3O2VL 3JV4B 3KPMB 3VMOA 4LU5H 3BAJA 4F57H 1MUJA 3KXFE 3DMMB 4Y5XB 1UXSA 2OCFD 1S7WA 1J1XL 5IFTA 3MC0A 4OZIE 3QJHA 2AJYL 2X9YA 2XWBB 5IHSA 2Z1KA 5HHMB 1QWNA 5DVLA 3VXTB 1EXUA 1I75A 3V5KB 3U1SL 2NW0A 5F7UA 4Z2GA 1ZANL 4ZUUA 3W28A 1J0HA 2ADJB 1CF8H 2V17L 6TAAA 3MOAL 4NOBA 5B4MC 5L0QC 1YJDL 2X1PA 5I76A 1MXDA 2IQAB 1LO0L 1EFXD 2P45B 2P5ED 2W66A 5I79A 2EEDA 1VDGA 2QLVB 5EMYA 1I1AC 4R9HA 1YYMH 4LNRA 4N1CA 1TETH 3WDRA 1D5IL 4W70A 4BH7B 3KWXA 4WI2A 1ADQL 4ZFFB 2A0LC 3ULUL 2NY7L 3GMRB 1GORA 4I0PB 3M8OH 4JM4H 1Q0YH 5DUBA 3RKPA 4CL7A 3PNWB 3RWCA 3UBXB 3VIPA 4M7KH 4P5TB 2DKMA 1YMMD 4WTWA 3SDYH 3EDDA 2ADGB 1QYGL 4OGAC 5ERWA 2FYYA 3EOAB 4QY8A 1XGUB 4PUBL 5TPWH 1EH9A 1BYCA 4M8VA 2AMGA 1FC2D 3QUYD 5GRZA 1BVKB 2AV1B 1P4LA 4Y1AB 2IXVA 1J5OH 4NRYA 2G2RA 2MKWA 4DUXA 3HC0A 5EIIA 3FCTB 4ZS6C 4GG8A 4P2QE 5ID1B 1C8QA 4XCNA 5FA4B 4AG4L 4X7CC 4GQRA 1Q9OA 1U3HA 5BW7A 2P8MB 4ZG1A 1KCSH 3TEUA 4AYGA 5D9SA 2FATH 5EU6A 1ISXA 5A8OA 4Y5YA 3SQOH 3WN5C 1CPUA 3MRRA 4XPFH 2BCKB 4MNGA 1UQSB 3SUTA 3FQTA 3HG5A 2ESVA 4X0VA 1IQDB 3E6HB 4P5MA 5HHNB 1J9CT 1B6UA 3TBTB 5J1AB 4FQXA 4HH9A 4BFEA 3U4BH 3W9DA 5IJKC 2H6PB 4J1UA 1FH9A 3KXFD 3IF1A 1TVBA 2OR8A 3PQYD 4XZBA 3LMJL 5C0DA 3C6SB 3NFNA 3UEZA 3QFJD 1MWAL 3HG1A 2D1ZA 1RK0A 4KMQA 3ULUD 1ZHNB 4DGVL 1NGYA 1CZ8L 3GHBH 5E2TL 3Q6FB 5BV7C 3NABH 1J05A 3IDIA 4HWZA 3PHSA 5MENE 1NCNA 3QULB 4NZUH 2EDFA 3CXHK 2J4GA 1E6OL 3D85B 2P5WA 4DKAA 3OSKA 5IHBA 4MJ4A 1U8LB 1NL0H 3X11A 2DQJH 1IL1A 4WFED 1P5VA 3MRHA 2G5RA 1F11B 3HE6A 2CCRA 3REVA 1CVSC 1KC5H 4WU7B 5L8LB 1JYVA 4PGCA 1HXYB 2YUWA 4WHDA 4XH2A 2VR5A 1CL7H 4XBGA 3CO4A 2J8UB 2WSKA 2P8PA 1ES0B 2WLYA 3U46B 2VO5A 4RRPA 5B38A 4LVHB 2ZWYA 3I2CH 3V6FB 1RJLB 4FNSA 3MUIA 3UCRA 4S1QL 5JHLL 1XMWA 4F9DA 5F88A 1S8DA 5TDNB 3SEPA 4B50A 4XP5H 1XF2A 3QDJA 4LMQI 5E6IA 4JDTL 4POUB 4O2CA 1N0XL 3I3DA 1LP9F 3BSHA 2Y9RT 4OFPA 3WNPA 4I18C 1JGUH 1AD0A 5C0CA 1XF5A 2HJLA 3VXMA 1BYBA 5T1LB 4UQEA 1XIWB 1SJHB 3MV9D 1AQHA 1HEZB 1IGFL 1V3JA 4FA8A 2FEEI 1Q0XH 4UFJA 5C9KA 4L8SB 1QSFB 4NKIH 3VXOA 3OJ2C 5I1HH 1MCWW 4Q22A 5IFHH 1FE8H 3SO3B 4LK4A 1NWTA 1CGYA 1BZ7A 4WKFA 4BQ5A 4WI3A 5GGVH 5A2JH 4ELMA 2BXZA 1C92A 2F74A 2F5BH 2EPLX 3SE9H 2H1PH 3CZFA 1MAJA 4NKMA 3F7YB 3WL0A 1CF8L 3KPSB 4X4XB 4Z2HA 5MEND 4Q6YA 1UKSA 5CSYA 3DVGB 4JFFE 5C07E 3QXAA 4LSTL 3SDAA 5IFAH 4HZLA 4Y16B 3DXAA 3AIVA 4QHMB 3W0KA 4JY6B 1YYML 3V8OA 4EIZC 1TETL 5JDSB 2Y2WA 1KV3A 1LEKA 4W4OA 1JWMB 5E7FA 4U6YA 2X89D 1RUKH 1KPUA 3GNPA 1T5XB 1VADB 3QI9A 1EFQA 3EJZD 3FRUA 3M8OL 1Q0YL 1AD9B 4XVJH 1EZVX 1JHLH 5CZKA 3SJVB 4M7KL 2BSSA 2XA3A 3LV3A 3BP4B 3SDYL 2ZICA 5DD5H 4IUGA 4I0CC 1CFQA 4S1DC 2A1WH 1QSZA 3WDHA 3DVNA 3KPQA 3X13A 1E55A 1FN4B 5D5ME 3CX2A 3O6LL 1J5OL 1AO7A 3ILQD 5LG1A 1AGFB 2EPKX 4RBPH 3QCVH 4PLOB 4KI5D 5GS0C 3TF7C 4Q6IC 3DO7A 5CG0A 1FNSL 1JIBA 1CFVH 4UIMA 2W4XA 4JKLA 2E27H 4IPLA 5DJDB 2VL4A 5HHPA 5KVFL 3QHZH 1KCSL 2FATL 3IS1X 4UV7H 1FNGA 2IMMA 2AJZA 3PIQA 1DDHB 2H9GB 4YHNA 2J6EA 3BCFA 1CE6B 5M95B 4UV4H 2X10A 4XPFL 4G7YH 5JBEA 1X5KA 1PFCA 1V3HA 5GRJH 1JFQH 4UB0H 1OWRM 2X40A 3C60C 3U79A 4QHLA 2AJXL 2M26A 1G0YR 2D4DA 4OSUH 5LBSH 5ID0B 4XNMA 3AB0B 3DPBA 5MEPA 4BQCA 4M1GH 1EXPA 3MLTB 2YA0A 3FO9B 4AMCA 1HQ4B 1UA6H 2VXTH 1NGZA 2C5DC 3BGFB 3TGXA 1ONQB 1ECEA 3ZDZF 4UILL 4LLUA 4XAWH 4PBGA 2HVKA 2CIKB 3AYRA 3OJDA 4DN4H 3DNKA 1MIEH 1T66C 1UWTA 1I8IA 1E6RA 3U30C 4JQXC 1NCAH 5EG6C 4NSBA 3GHBL 3G5XA 1A8JH 3NABL 4NZUL 3DX4A 3QPXH 1QLRA 3WIJA 1MY5A 3MBED 4P23A 5CILH 1NL0L 4NJ9L 2DQJL 5FOBA 1V02A 2A6JB 1S9KC 4MA3A 1KC5L 1R3KB 4N68A 2CD0A 1U0QA 3MRGA 5E1AB 2DLFH 4JQIL 1XC6A 2GY5A 4I0KA 5KW9H 1OAXH 3HNVH 5I1IH 4P4KB 2OSLA 4S10A 3SGDH 3AISA 1CGTA 3L3OA 2QBWA 2OWXA 1CL7L 5IOPA 1HJWA 3DOSA 2FDMA 3O6FB 4PP2B 3IDXL 5EPMB 5IUSA 1RI8A 5E5UB 1R5VA 1PYWA 3RDTD 4P3CH 3C5JA 3V4PH 2DM3A 3VD5A 1VEPA 2GJZB 2ED9A 3QRGH 3VX0A 4WO4C 1A22B 1RZJH 5FYKH 4LHUG 4Z9KB 4RMUA 3N85L 3KPOA 4WIWA 3RL2B 2SEBB 3LS4L 1CLOL 4KI1A 5AD0B 1HCFX 2R0WH 1AKJD 4P2CG 4H1LA 4XP5L 1X7QB 3JV4A 3KPMA 3WNOA 3S9DB 3EDJA 2DQIH 2NY4C 4YQXL 4X6BA 3DMMA 3MV8E 4GQ9H 4I48B 1ZT4A 2V3EA 4OV5B 3FHAA 2XWBA 3B5HA 3PWNA 5E2WH 5HJ3B 3O41A 1JGUL 4ODVH 4Z78B 4HGKC 4LF3A 2WB5A 4PMYA 1DUYB 5I23A 1UM5H 2ZNXA 3VTRA 2ADJA 1IAKB 1KG0B 4AIXA 2TAAA 5DA0B 3WO4B 5DRWA 1Q0XL 1IC5H 4NKIL 4OFDA 5HDLA 1QVOB 4B9YA 5EUOA 3O3BA 4RL3A 3FRPG 2O9TA 2ZOLB 3QDGD 5CJBA 5E8OB 4OZGA 3WKZA 2VTFA 2XNAA 3TYFB 4ZUWB 5KVMC 3N1MC 1R3LB 1HT6A 3IJ8A 5GGVL 4CD6A 3MA7B 4BH7A 3QIBB 1RZGB 1BLNB 1ZVSA 3TLRA 4ZFFA 2YL9A 5T1MB 1EZVY 4DZBB 5KSAB 3WKML 4GQPH 1R85A 1UWQA 3GMRA 4OGZA 4D9RE 3M1BB 4I0PA 2W1NA 2F5BL 5GGSY 3SE9L 1KPRA 1MCWM 2H1PL 3DBXA 2CESA 1BGAA 2Y7QB 3J8F7 5DI8B 5F70A 1BFOB 1TENA 3PJSB 4U1SA 3ZO0A 2ADGA 4DEPB 3AHZA 4U1JB 2ED8A 3EOAA 1XGUA 2XN9B 4D0BB 1VFBA 3LRLA 3UJJH 2AV1A 1NGPH 4Y1AA 3EZJB 4DUVA 2BHYA 3ZE0E 1HJSA 1RUKL 3OIHA 1VB9A 1QP1A 3FCTA 4WJXA 1LO3H 2FZ3B 1DVFB 1XR9B 1YJDC 4Z7VE 5FA4A 1T20B 5F9DC 3U5UA 4XVJL 1JHLL 1S5IL 2P8MA 4RMQA 1RIHH 3ESVF 3IU3B 4MTVA 3PBGA 4U1LA 2XT1B 2V2WA 5IB2A 4NP4H 5I16A 3QWOB 2D22A 2A1WL 4XPTH 4ZS7H 3HTLX 1WFNA 4KTDH 4MCYA 3OKNB 3UTTE 4ODXB 5SX5K 4EI5C 5D2NA 1KXVC 1HTYA 4AT6B 2YHGA 1U8QB 5IMKB 5HHNA 3TBTA 3NAAL 1KSRA 5J1AA 4Y4HB 2H2SD 1KCVH 4AZBA 1R47A 1PKOA 2H6PA 1CFVL 4ZSOE 2COQA 2E27L 5F71A 3G9VA 3QHZL 2Z8WC 5E4EB 1A21A 4UV7L 4LAQL 3O3DB 4XP9H 5JR1H 4PLJC 1YHTA 4K3JH 5F7KC 1KN4L 4X6FB 3D25B 4WV1B 3WV0A 1O7AA 4CU7A 1ZHNA 1CD1B 4G7YL 5JUEH 4GSDH 3NCYS 3QXVA 2IANB 4PJ9B 1JFQL 4UB0L 4P2OD 4X4YB 4G3YH 3UDWC 1CTOA 4MLSA 3QULA 1DQQB 1BQCA 1DBMH 4LSRH 5JW4R 4OSUL 5LBSL 4MXQC 1ACZA 4M1GL 3SCUA 3EFDH 1JMZA 3C9NB 5DMKB 2VXTL 4ZFOA 4B3KA 1LE9B 1X6NA 2NW3A 3IFPA 4PSRA 1HXYA 3L3IB 3DTXB 4XAWL 3FKUS 4JKWA 2XN0A 4DN4L 3CZ8A 1EAPB 3CLEH 2GFBA 1NCAL 5FUZH 3MZGB 4KZDH 2V7NB 4U2ZA 1RMFL 4UOJA 3BDYL 4R4ND 1HNGA 3ZE1E 2PCPB 3RIAF 1ES0A 1HH6B 1WC7A 3STZB 1IC1A 3T1FA 2UUDK 1F58H 1WGOA 4MADA 5CILL 1JGDB 4AM0B 4HF5H 4MMZC 1RJLA 2Z8VC 1ZT1B 1HYRC 4G8IB 2DLFL 3BLBA 4IM4A 1OAXL 1BEYL 3ZDYE 5AYQA 2DRUA 4RFNC 2HT3C 2OYPA 3DRQA 4JRXD 4XGZB 1ZLWK 1IC4H 1KJVB 2O9PA 2CKBA 1VJZA 3BXWA 3U57A 4UQ9A 2VURA 2OI9B 4OQTA 1D5XB 2UY4A 2OM5A 1I3VA 4UFKA 4LNVA 1NAMB 5JHDD 1UM6H 3QRGL 1RZJL 5FYKL 4OOUA 5FDYA 1I7RB 1C7TA 3UYRL 4CU8A 4IRSD 4OCLC 4YBQD 5HVFB 3UTTD 3OKMB 1UWGH 1VACB 5LAXB 1R3IL 5CEYB 1QSFA 5FGCB 2ZCLH 2J7DA 3ZQ9A 2IH3B 3WUZA 3HG1E 5ILTH 1W9PA 2AI0L 2ZUTA 1E4KC 4X83A 4Y4FC 4IJ3C 3MRNB 3RTQC 3C5SB 3MLRL 2X9XA 2Z8SA 4OF3A 4X99B 1CGSL 1A02N 3QUZB 4PMXA 3BJ91 3NVQA 4XX1G 5E2WL 4NN6B 4ODVL 1UWRA 5E99H 2EDLA 1SM3H 1HN1A 4NF7A 1XH2A 3PWUA 4HJGB 1UM5L 2GJXA 3DHJA 3F7YA 3Q5OA 3NBNA 5B8CA 3L3DA 3WY2A 4X4XA 5B39B 1QPPA 2FEDC 5EU3B 2KPNA 4QP0A 4R7NB 3M07A 4P3DA 4BELD 3GKWH 3HE7D 2BNQB 4QHMA 5KOMC 4ZO9A 2DQFB 4Y89A 1G7HB 1W1YA 5I1LB 5IWLA 1U30A 3VINA 4GG6B 2BVUA 3WFDH 3K4AA 4N8CH 4BQ8A 3ILQC 1FH8A 2UWFA 5C0BB 1T5XA 3D51A 1MCSA 3C8HA 4J6RH 4P2YA 4D6IA 5FKAA 3ILPB 4F37K 3O3EB 4ETQA 3QBTB 2D9QB 5IVNA 3U7BA 1TPXC 3HG2A 2EYRB 3D3VB 2BNUA 2Q7NA 5EZIL 1HHKB 2PXYB 4G8FA 3GMQB 5HD8D 1H3UA 3BWAA 4WW2C 1FN4A 3B5TA 2UZXB 3UJJL 1N59A 4BQ9A 2XICA 3FQUA 3FQRB 4NRZB 4S2SA 3BH4A 4F3FB 2BOCB 1AGFA 5DJCB 3VXNB 1J86A 1GGYA 4PJ8C 5HI4C 1LO3L 5IIEB 4HJ0C 5EO9A 1CEOA 3WMSA 4ZO7A 5IF0A 1RJZA 4NBYB 4NQDB 2VLJA 3HC4H 3SE3C 3AOFA 3ME0A 1RIHL 4X7EC 1FZKA 5EBLA 1DTUA 2CLZA 2H9GA 1HKFA 4HDIA 4CDHA 5A3IC 1CE6A 4XPTL 4ZS7L 3EYPA 4OLWH 4KTDL 3QO1A 3W24A 4EN3A 4MSWA 1REIA 4Z7NE 2BK8A 4M7LH 4PGEA 5D7LB 3TCLA 5E00B 4ELME 3MMEB 3ZKMD 3FO9A 5CEZH 2G3NA 3FT4B 2PTTB 4PJHB 3SCTA 4Q9RL 2V2TA 3H9HA 3ALPA 3FQNB 5I9QB 5HYEA 1UJ3C 4MCZA 1QQDB 4XP9L 1XGZA 4Y19A 4CADB 4NZTH 1GOOA 4PN2A 2R9HD 5INCA 5JUEL 3TCXA 1G84A 1F02I 4GSDL 4HOWA 5EBAA 1W3JA 3DXAE 5FYLE 4NHUB 5H35B 3D5OF 3NSXA 3QHFH 4NBZB 4L29B 4TSAH 5IB1B 4LSRL 4HK3J 4HS8H 4HCRH 4E8CA 1N8ZB 2CRZA 1GGCH 3EFDL 3MV7B 2W67A 2DLIA 3EOTH 1KLUB 1FFOB 5JTWA 2A6JA 5D2LE 1LO2H 1R3KA 43CAB 1S9YB 4R96B 1UM4H 5EA0H 3HB3C 3QXDB 4P4KA 4Y5VC 2B31A 3WMCA 2EYTB 2F58H 2QV4A 3CLEL 5FUZL 4OD3H 1VIWA 1X5LA 4KZDL 3P11L 3S35H 2JJWA 2ZUMA 5BWFA 2F2HA 1WP6A 3QEHB 4XNZB 3W39B 3VFOB 2O61A 4ZFGH 4GLRI 2AK1L 1F58L 3KL5A 3UEQA 4HWUA 3FO0H 6FABH 4TPRH 1ZBKA 2R56L 1UT9A 5E2UL 4YPGB 3RL2A 5AD0A 3H9SB 3GSOB 5I3DA 3CPUA 4PJAB 4M4PA 2ZUQC 3QA3A 1GOWA 2YDQA 5KJRH 1IC4L 1FZMB 1UZ6F 1X5GA 2VXVH 3EJJX 2FSEA 2VMFA 4I48A 4GXUN 2H45A 3V6OA 3WIHL 4OV5A 4GXPA 3T0DA 3RY5A 3GNRA 1A9BB 3D2UB 5CD5D 5HJ3A 2JCCB 4CCDA 1UM6L 5L9DH 4E0RB 1JBJA 4BCEA 2XGIA 1A7BA 1G7MA 2FIRT 4Z76B 1JWSA 3BQUC 5IK3B 5IVXE 1WAAA 1N4XH 1NC2B 4IOIB 2J78A 1ZK9A 3KLSA 5I15L 2ZCLL 3Q1SH 1EMTH 1I8KB 1OARH 2B7DT 2X4RB 4BM7A 5E2VL 5ILTL 2CIPA 1PSKH 4Z7WE 5E8OA 5J0BA 2PW2B 3TYFA 5DJXA 4ZUWA 3PE9A 1D5MB 1U8PA 4EUPG 1JZ2A 3K8LA 3QIBA 1XFPA 3B8YA 4P2RA 4DZBA 5E99L 3QEUA 5JXED 1FLRL 4YZFF 1SM3L 1TQSA 4PB0L 4HGWB 2HYMA 3DSNA 3HMXH 3Q0HA 4P7NA 4LSSL 4FNPA 5FYLD 3MOQA 4NQVB 5DI8A 4JZOB 3NACH 3MUGB 3SGJA 4U1JA 2VLRE 4O2FB 2GI7A 3GKWL 4FMKA 4W8BA 3ZSTA 5ISZE 3U6RB 4IM8A 3SKJH 2XZAH 2M2DA 3MRCA 1YY9C 4X98A 1F3DH 4JGMA 4N8CL 4DWHA 1G0CA 1XCTA 3AS0A 5DC0A 4J6RL 3NA4A 1QFHA 5GIRB 2FZ3A 2NY2D 1XR9A 3FFCA 1OM0A 1W2KT 2DPEA 5ICXB 3GIZL 3IU3A 4ZXLA 4OZIF 1MCOH 3CFEB 5CINH 1B31A 3GI9H 4PTVA 4U6HA 3S34H 4FMVA 1RPKA 3F12A 4JFYA 1CXKA 3QWOA 3VGGA 1C91A 1JFHA 1FL5B 3OKNA 4ODXA 1QO3B 3VGHA 4FP8H 1EERB 4AT6A 1U8QA 4TQEH 5IMKA 5HHME 4Y4HA 3REWB 1CN4A 2A6IA 3HC4L 1YEJH 1K5NB 3W5MA 3G5VA 3IRPX 1CS6A 5EZLB 3KAAA 2NTFB 1M04A 4WIQA 4WU5B 5I19H 4PRAB 2KUTA 3LS5L 4HUUB 4FQLH 1FAIH 4L4VB 5I8EB 5IV2B 2WINA 4AZIA 4WV1A 4V1DD 5F8QC 3MRBB 1GVIA 4OD1H 4X6EB 1ND0B 4F7EB 4YDIL 4JFTA 4WHYG 1KCLA 4KGJA 5JPNB 2XM1A 5M03A 4KJYA 4GUPB 4X4YA 3T2PA 4F58L 2KH2B 2D7MA 1IGYB 4M7LL 4MNQA 2FGWL 2J4WL 5CEZL 3BI9X 3C9NA 4PTUB 2RCSH 4UNUA 4WW1B 1WFOA 2PI6A 1PD6A 4WFGE 2IAMA 4PJ7B 4BSWB 3LKPA 1FLTX 1RIVH 4MD4B 3DTXA 4G6AC 4Z2LA 3OZPA 5IW1B 1IT0A 3GUTA 1EAPA 3CVHA 1IM3B 1KCUL 5BS0A 4JRYB 3ARGA 1RHHB 2V7NA 4TVUA 5IEKB 3MJ7B 1VENA 3QNYB 4AJ0A 1TZ7A 2JB5H 3QHFL 4TSAL 4WHTA 4Y1AE 3ZJKA 3AREC 4APQC 3PZVA 4HS8L 4HCRL 1G6RB 1GQKA 2VLRD 5ESQB 1U58B 3OGOE 3DSFH 4AM0A 1ISZA 2D03H 3DROB 1PEWA 1LO2L 5ISZD 2W5FA 3S88L 4D94A 4P7RA 4G8IA 4OBSA 2DBLH 4MA8H 5M5DA 7TAAA 1SJVA 1HHIB 2F58L 5DSCA 4LPUA 2G4FA 4OD3L 3RVWD 5I8CB 1W72H 2NY0B 3B9KA 4JPKH 1BD2A 3EDKA 4KRPC 5I1EH 3U7VA 1H5BA 4ZFGL 3CDYA 3HZMB 1I8LC 4IRJC 4OKDA 4NYLB 4F9PC 4OLVH 4PS4H 5HVHB 1W1VA 6FABL 4FQCL 3D4ZA 5D96B 4PY7A 5BXFB 5SV4A 4G7VH 1NEZG 4XCYB 5KS9F 3OKMA 2EDHA 1VACA 3RWEB 5F7YC 3VI4E 5E08L 3EHBD 1FV1A 2FJHB 3EYQC 2IH3A 5HHMD 1IC7H 2I9LA 5KJRL 5C71A 4JGJA 1E3ZA 2D23A 3HMCA 2VXVL 5CEZD 3VXSB 3IDMB 4X4ZA 1VKXA 3WL9B 5FM8A 3QUZA 1QUNA 1D9KC 1FGNH 4NC2B 4PJFB 5L9DL 1P7KB 4K3EH 3FZUD 2UY3A 1QLEL 1IGIH 3PXJA 4HJGA 4ODTH 2C26A 3WSQH 3KE0A 1D2KA 4RX4D 4WUUD 5I71B 2I9TB 2EDNA 4NZRH 5B39A 4DZ8B 4D2NA 2B0SL 3VIMA 2HAZA 1EMTL 1OARL 5EC1A 3QWRD 1PSKL 5HD8C 4FG6D 1NCBH 1L0QA 1G7HA 4Z7UA 1OP3H 2J8UE 5C9JB 4WFGD 1HVXA 3TN0A 1PZ3A 3MJ9A 1MWOA 1RUMH 4WK9A 4RGMB 1A7RH 2AS5M 3VSTA 1T1YB 1MCIA 4XXCC 3G04B 4IS6B 2YD5A 2EKSB 2GITB 3HMXL 3PZUA 3O3EA 4TVPE 1UD6A 1J1OH 4HXBH 3ZYIA 2GK1A 3D3VA 1TE1A 1YEFH 5KZCB 3GH7A 3NACL 5ESVB 2PXYA 3A24A 4OLZL 4PSPA 4NNYB 3UYPA 1QR1A 1OTUD 4PY8J 4PBWD 1F3DJ 4UFHA 1MCQA 3LHPH 4DAGH 2BV9A 1F4HA 2JEPA 3SKJL 1NFDF 4NRZA 2XZAL 5HI3D 1CFTA 4PRNA 3ZKXC 4HC1A 4FQ2H 5A8NA 2D31B 5CCKL 5IIEA 1P2CA 3W11D 5IHRA 4HIIA 4DOHB 2BSTA 1V0KA 3UR7A 2V5RA 1MI5A 5TDOB 4NQDA 1QI2A 2W92A 4HUNB 1J8HA 2H32B 3V0WH 1ITCA 4NT6B 4DKDC 3JTSB 5C09B 2DL9A 1MCOL 5JIWA 1UWEH 5CINL 3GI9L 4JKKA 5IBLC 1QSFE 2OJEA 5I73C 1XZ0A 3G6DH 4MWFB 2IADA 5DT1H 3NH7L 1FO0A 2Z93A 4LAJH 5JNYB 4IOFD 1V0LA 3AAZB 1RZKC 1FL6B 1HXMB 2BNRD 4TQEL 1EK3A 3MMEA 2PTTA 4YHYC 4M82A 3FT2A 4J28A 2FEEL 1CDUA 2J8HA 3FQNA 2J8FA 1YC7A 2XQBH 5AYUH 3KPSE 5I19L 4Z77B 1FAIL 2OLDA 5I6XB 3D85D 2ZOXA 3EO1B 1AGCB 5DO8A 4Q9CA 5BO1L 2DJUA 4OD1L 4U1NB 2WMIA 3UPCA 3NIFF 1JAKA 4L29A 1H11A 2XSAA 1W32A 2DSKA 4ZUVA 3VFNA 5F21B 1N8ZA 4G80B 4QCEA 5EIQA 1IRAY 3HR5B 2XPGA 3MV7A 1S3KH 5L88H 2RCSL 1FFOA 3ETBF 4LEXL 1G0XA 2E9JA 3D5HA 3DECA 4CVUA 1OQXA 2OW6A 4R96A 3SJVE 4GINA 1TUXA 4X6DB 1RIVL 5HTSA 4BSVB 5GGUB 5TE4L 2MCPH 3AIWA 4JFEB 1B90A 1R3HA 2EYTA 4JM2D 2P47B 3IKKA 4M6AA 5CPQA 1UJTA 3C5ZD 1I9RH 2JB5L 3UP1A 3QEHA 5MHSD 1V05A 3KYOA 3W39A 5J7CC 2YK1H 2HT4C 1ZE3C 1HKMA 1Y18A 1YEHL 5FF6B 3DSFL 2D03L 3RJYA 5F9OH 1HL8A 1E5NA 4NN7C 4YPGA 3KYNB 3ZTJH 4PJDF 2DBLL 2MOVA 3MLZH 3A23A 3ARDC 1SBSH 1YEEH 3DX8B 4OIAA 3U9PH 4YFLI 4ZQKB 4YE4H 1ZT7A 3H53A 1SR0A 1FZMA 1W72L 2VVSA 2EPNA 1MFNA 5T1LD 3TV8A 2L4OA 5IB4B 3RILA 4JPKL 3ZR6A 1XIWD 3S5LB 3LXCA 4MNLA 3VXUB 2ZX8A 1MEXH 1A9BA 2G5BA 3VE0B 1Q6GA 4E0RA 4OLVL 2MWCA 4PS4L 4CD7A 3JWOL 4PV8B 1INQB 2VITB 3NTCH 5J4MA 1NC4A 4G7VL 4MDJA 3D39A 5FM4A 5DK2B 3UBXI 5IK3A 15C8H 5J3HD 1NC2A 4QKXB 2VIRB 4PJCF 4OAWB 2QMJA 2X4RA 5C0AD 3B6SB 4UU9A 3BAEH 5AC5A 5F9AC 4M8UA 3RWFA 4N0CD 1XT5A 3VFMA 2F8XC 5ITFB 1D5MA 4X8JA 3JVGA 5IT2H 3Q5TA 1RUPH 3CFKA 1FGNL 1EHAA 1GHRA 2XG9A 1U36A 2YUVA 5GPRA 2D0FA 1KELH 4K3EL 3HHRB 1IGIL 3P4MB 3WSQL 4HT1H 3DX6B 1XF1A 4OF6A 5A2LH 5EU7E 4Y16D 3T3PE 1Q9KB 4JZOA 3MUGA 5DUPH 3HZYB 3DV4A 5KSBF 4OZHB 3AMCA 3MRLB 2VXQH 3T65A 4P7LA 1KIPB 1FNAA 1NCBL 4U6VH 3HC3L 1I7TB 1QR4A 3U6RA 5CJOH 3WJJA 4C83B 2HFFB 3BX7C 3SJVD 1A0QH 2X1IA 1A7RL 1TJGH 4X0KA 5C08B 1FVDB 1NGQH 4ZPTB 1X5AA 1Q94B 4Q2ZA 1I3RB 5ICXA 3JV0A 4FQJL 1AXSB 1YEFL 2DQGH 2EDYA 3PABA 4GKZB 4ZO6A 5BXRA 1E0WA 1BAFH 3I02A 4PR5B 3QR3A 3OB0K 1W91A 2P24B 1YNKH 4KK6D 3WUWG 1A6VH 2FR4A 2IG2H 4DAGL 5JIPA 2ZPKH 4ZXBC 4UNVA 4PJEA 5B3NA 1A7QL 1F3JA 3S3SA 2L7UA 4M7JH 4JPVH 3RKDC 4FQ2L 5GZOD 1NAMH 4WEBH 2DLEA 4G8GA 2ZE0A 2WCSA 4POZD 4RA3A 3V0WL 4P5KB 1K5NA 2MHAB 4RE3A 2K3TA 5EZLA 1FH5H 1UWEL 4MD5B 2QHAA 5EU5B 2E9BA 3ZJ7A 3V0VA 2O93L 4PRAA 1GW1A 4XCEA 4UDUB 5IV2A 1MJ7H 3G6DL 5DT1L 4POYA 1LE5B 4X6EA 4ZOEA 1ND0A 3HZKB 5CP3A 1Z5LB 1BREA 1R24B 4BSJA 4F7CB 2B1AH 5D72H 4PY8I 1QNZH 2NXYC 2E5EA 2LU3A 4HFWA 1OCQA 3PWVA 3EJSA 2VYRE 1E28B 4PLKD 5HGHB 3IJHB 3UJIL 1XYZA 2A3AA 4MS8C 1ZHKB 5AYUL 2VSDA 1TIUA 2VLKB 4WJ5B 2VWEC 4G5ZL 5IW1A 1HP5A 5I6SA 2EH7L 2V5YA 1HQRB 3K0WA 3EYVB 2VERN 1RHHA 2XN9E 3BPLC 3AXHA 4IIQB 4QNPE 3MJ7A 3QNYA 3QSKB 3QNXA 1CR9L 2LAGB 5SWQB 4LLQB 3WEMA 1B3JA 4JHWH 3HAEB 5ESQA 2HN7B 5HY9B 5L88L 4L3EE 1AIFA 1KJ2H 3DROA 4K94H 5ELIA 3NCEB 5EBMB 4LXFA 5GJTL 3U0WH 4W93A 2MCPL 1TVHB 4OCNC 5AAWA 1WIPA 4WTZG 1YA5A 1EGJA 1P1ZA 5I8CA 3ULSB 3MRKB 4FS0A 1S9WA 4NRXB 2DJ4A 3HG4A 3DDGA 2BS9A 3UESA 3R0NA 4GW5B 1E4NA 1KQYA 2FH8A 2JK5B 3VNZA 4NUJB 1M53A 1JZ6A 2AEQL 5F9OL 2A74B 2FJFB 4U33A 4XCYA 2X05A 1Q4NX 2YPLD 4U3XA 4P46C 4NUGH 1YEEL 3U9PL 2XVLA 3LKOB 1T7WA 3QIWA 4PRPA 1Q6CA 2DJSA 3IDMA 3W81A 3VPLA 3WL9A 3BP7A 2IANE 4FG6C 3G9AB 5C8JA 4YHOH 3FOMA 4PJFA 1NBYB 4Q9QH 2YD4A 3IRZA 2DQUH 4TX6A 1JPFA 3NTCL 4IRZL 3P9WB 2GSIA 2ITCB 15C8L 4R7DB 5E5MB 1WDPA 4Y0GA 4WDIB 2VC2H 3MLVL 3ZZ1A 4LGXA 3BAEL 5KSAD 1Q1JH 3VWJB 4JQVA 5C9JA 5IT2L 4PMZA 3CCHA 1RUPL 3BPOB 1U8NB 1O7DC 5A16B 2AK4A 5HI3C 1NCWL 4J4PC 3K81A 3GRWA 4IS6A 1HDMA 1NUNB 2YIHA 1J88A 5FXCH 3T3ME 1BYAA 3AIQA 1KTBA 2QV2A 4X6CA 1XF3B 4EBQH 2PR4H 5D9MA 2XN9D 4XWOC 5F97E 3TIEB 2ADFH 1V6XA 4MAVA 3IFOB 3RVXD 4X7TB 5ESVA 2L7JA 3RJDA 1SQ2N 1T89A 1UH2A 2VXQL 4GW1B 1ZJAA 4L3ED 1DVFD 5CJOL 3UJTH 5CBAB 2GSJA 1I3UA 3QG6A 4I3SH 4MJ6B 1A0QL 4RFEB 2X1XR 2DD8H 2CLRA 2D31A 1TJGL 5D1XB 3AXXA 1CT8A 1QPKA 2A6KB 1JNHB 2H32A 2GUYA 3GSVB 1K9TA 2DQGL 1PQZA 3P4OB 3THCA 1CICD 1E4XI 2HFEB 1BAFL 4UFMA 1F6AA 3CPLB 1F8TH 5FO7B 4GKLA 1RP8A 6CGTA 5FGCE 2JIXB 5DK0B 4NN5C 1YNKL 3CSYB 1A6VL 4JFHD 4MNMA 1UR9A 1XEDA 1KBKA 5A2BA 1FL6A 5IROC 4JPVL 3MMUA 4WEBL 3QUXD 4OCSH 4MHHG 2DQTL 3KPTA 1ZLVK 1GJIA 3BDBA 3MCG1 3ARWA 1M7IB 2C4FU 2BRQA 5DMGC 1QNPA 1MAKA 1JWUB 1FH5L 3PL6D 2IAND 4PJ9D 1OM3L 2FGLA 2ZNWA 2OR7A 5T3ZH 2VX4A 4EKJA 4FFVD 1MJ7L 3AY4C 3EO1A 5L6YL 4KK5D 5CGTA 3T77B 3P40A 2BNQE 3TTYA 4ONOA 1JGLL 3T4YB 3MRJB 2B1AL 1IT9H 1C08B 2BMKA 3TV3H 5D72L 4AH2B 5I1DB 4KDTA 4GG6E 1HL9A 2ORBH 4TVCA 1QNZL 1T21B 1A7OH 1EHLH 2NY6B 4JZJA 4JO3H 5CJQH 5C0BE 5DJ2B 3RP1A 4CVXA 5F6IB 5CLTA 3RJXA 2OQJA 1IEBB 2R69H 2AXGB 3RVUD 3O8XB 1U91B 5EBGA 4A2MA 1VHPA 3D3VE 3AMKA 4BSVA 4PGZA 1EDGA 3O4OC 2HVJB 8FABB 3VUPA 4S1RH 3WLWC 2N1KA 4JFQB 1HJUA 1FYTB 1KEMH 3MV11 1SEBB 1OT1A 2NX5B 4JFOB 2F53A 3GXFA 4KY1H 3P9MB 3N9GH 1F42A 1OD8A 5IB3B 1G1YA 4HA3A 1KJ2L 4FZEL 3A6BH 4NQDE 3F7QA 2ZXAA 4K23H 3CHDA 3N17A 1A6AB 3KYNA 2GVYA 3OKKB 3RM8A 3PZMA 1JUFA 1S7RB 3SKUD 4NXSA 3MSPA 5LWYL 1NM9A 4PJBA 4O4YH 3DURB 2JIWA 4EEEA 4PJXB 1CGVA 2WC3A 4OZFH 1UH4A 5IB4A 4OTXH 5GZND 1T0MB 1A4JB 3DV6B 1HKIA 3RCNA 1ZKAA 5L0QB 1QFWM 2R2EB 3B43A 3SCMB 3NDZA 4NFBA 5D7LE 3RPIB 4PV8A 3G08A 1INQA 1I1AB 5KSUB 5KSVB 4PJHE 2NZ9D 5K9KB 3BISA 4YHKH 4P8VA 5BRPA 2D20A 3RNQB 3IDGA 1UFUA 5DGQA 5F7FA 2VIRA 2ITDB 4NUGL 5C0FB 3VGFA 5K33A 4KH2A 3VWKD 2J7EA 2J88H 4AMWA 5ICZA 3GDBA 4IBLT 5FGSA 2XI9A 5D7JC 1L9MA 4L9LC 5BJTA 4YWGH 1BVLA 4YHOL 3TA3A 3T0EC 1U2HA 3BP6B 4XC3H 4LDEB 1UA3A 1A1MB 4KHTH 3NDYA 4PG9B 3F6LA 4N0RA 2DQUL 3IDNB 3P4MA 1MRFH 3MV7E 4UBDD 4EZMA 3ARTA 1ED3A 1Q8MA 2BNQD 1ROWA 2JALA 2VC2L 3NZHH 3O4LA 4U7MA 2CDFB 1G9EA 5DZOA 1Q1JL 1KIPA 3RUGA 4H8UA 3GO1H 2IBZX 3JWOC 3SCNA 1DQJA 1XGQA 4HD9A 1MCFA 1E4IA 3U7AA 2EADA 1A5FH 2BHZA 1GRWA 3TVMA 3THDA 5C08A 3WN5B 2DWDA 4CN6A 2BNJA 1KFAH 1YUHB 2ADIB 3LN9A 4WWKC 2CRIA 4EBQL 1D5BB 2YDSA 4KKLC 4Y2DC 2DQXA 1P7QD 4NNXB 1AXSA 1QPXA 3U7YH 5AUMA 1JPTH 1J9YA 2VZOA 1KLGA 3L1OH 3H9SE 2C9AA 4PJAE 3CSPA 1OT2A 5CWSB 4GO9A 5FCZA 2HT2D 2WCGA 3UJTL 3GBLA 4I5BB 3GSUB 1SMOA 3OF6D 5E8DH 3MRIA 4NQEB 3AFBA 2JCCE 3UG3A 5CMAB 3L4XA 5KOVC 5HYFA 4P5KA 2MHAA 2DN7A 4PLKC 1RV6X 1TQBC 1BVNP 5EU5A 1E6ZA 1F8TL 1FORH 4UDUA 2VRQA 3POHA 4F7MA 4GRLD 4WGWB 4H04A 4D3CH 5D7LD 3ZM8A 3W4RA 3RVVD 1Z5LA 1R24A 1LWRA 1QA9B 5BMFH 1LK2B 5HOSA 2EIZB 1UA7A 3AQUA 1EDQA 1CIUA 3QB7C 3R06B 3U36A 1FJ1B 1W8OA 2LU7A 3P4NA 1B0IA 5EZJB 2IWGA 1P9MA 2YXFA 1U8OB 5HGHA 1V6YA 1OQOA 2RFXB 2QF8A 4W7UA 1ZHKA 1QNRA 1C5DB 2VLKA 4M7LT 5T3ZL 1BF2A 3DUSB 4Y4KA 3SKOB 5IHUH 4XVUD 1BZ9B 4LCWB 2QMKA 4JJ5A 3TPKA 2WANA 3EYVA 3KHQA 3DX7A 3VD3A 3GZAA 3F7RA 2K1MA 4BQ6A 2MSPA 1IT9L 3TV3L 3M6DA 5E8EB 1EEUA 2ORBL 5SWQA 1A7OL 1EHLL 1WV7T 1QRNB 4JO3L 4LLQA 4LVNC 4NKOB 3HAEA 4NSKA 5CJQL 3RIKA 2HN7A 4ESKA 2P8LA 3IYLW 2FYVA 4NWTL 4EUPA 2R69L 5EBMA 2JELH 1CENA 3NGBC 4CMMB 1BFVL 2J7BA 4ORZC 1ZA3A 4TOQA 4I18B 2J6EH 2WMFA 5I24A 1VCAA 4CKVX 1HOCA 3DGGB 4S1RL 4QRTB 4MB3A 3ULSA 4Y7MA 1KEML 5D7KD 4M5YL 2GJPA 1MNUH 3S4SG 1E70M 3BYYA 4KY1L 3S3PA 1Q6DA 4GW5A 5EB8A 3KLDA 3JV6A 3H9SD 3TBWB 1MFCH 5EUOF 1GOHA 3A6BL 4XTRD 4K23L 1N5AB 4WI7A 2A74A 2FJFA 4OZGF 2Y5EA 5KEZA 3BAYA 4XBEH 4Z2JA 3WQWA 3U9UB 1HXJA 3BVNA 3MTRA 1WTGT 3D2UD 4L4VE 4O4YL 4L1DA 3RY6A 4K7PX 3ARQA 1JVKA 4PRIB 4OTXL 5KVGL 5CSGA 1NMBH 4LSQH 4R6UA 2PYED 1KEGH 3O9NA 2E3VA 4ERSH 1GPFA 2R1XB 3IJSA 3D4YA 1FG2B 3KWWA 4LCIH 5T3ZD 1OSZB 5F89B 3WDIA 4ORGA 2CERA 2DQEH 4K8RH 1K9EA 1G9NH 2Z31D 1F5WA 4YHKL 5DJAB 4D0DB 2ITCA 5EULV 2WYSA 1GGTA 3I3BA 4PJ7E 3SPVA 1GOIA 4FFWD 4NPYB 3I75B 2DLTA 4WDIA 4HKBA 4LVOC 5HVWA 1VRXA 3RVXC 2IBZY 2J88L 3LKRB 2OWCA 3FONB 1WBZA 1YN7B 4JRYE 1A1OB 5IKCB 1HSAA 3F4VA 4YWGL 1U8NA 1A7PL 3NJ3A 2HFGH 4M9PA 4XC3L 1RY7B 1O0VA 2R29H 4KHTL 4LKCB 2FWOA 1RFDH 3T4AB 1UZ8B 5JW5B 2EQDA 1DUZB 1D5ZB 3X3GH 3JXAA 2WWDA 2M1KA 3UZVB 5EIVA 1YC8A 1PZUB 3TIEA 2EYSB 3EYUL 4KKCC 3IFOA 3QEQA 4X7TA 4PGBB 3NZHL 4JE4B 2J47A 1LVEA 1QSED 4DQOH 2VDNH 2J74A 4Q6IB 1IKNC 4EANA 4P9HH 4ZAKC 3GO1L 2NY3D 4AZHA 1CQKA 2NLJA 2GTWB 1A5FL 5SWZB 2CRMA 2F9BT 3VMNA 4KKBC 1KFAL 3IGAA 3BZFA 3QUXC 5HHOB 3CBWA 1B3YA 2YR3A 2EE6A 3U7YL 4X5WA 3UC0H 2HFEA 3CPLA 1M4KA 2QADC 3L1OL 4P49A 1TFVA 3LIZL 4ZUTA 3ARYA 3W2DH 3F6IA 3LN4A 3CSYA 1I1WA 4NO2B 2DTMH 3RA7H 1SBBA 4NM8L 1AI1H 1EEQA 3VXSE 1KIUA 2F8VA 5EO0B 4C55A 3P73B 5E8DL 3GSWA 1I7UB 5DQJA 3BRGC 2YEZB 3WS6C 4PJFE 5INDB 1U41A 1QX1A 4L4VD 2EXYD 3U30B 4DGYH 3L5JA 4XI5D 3KLAA 1EV2E 1BIIA 1QI3A 2ATKB 2VDKH 4HMDA 1DCLA 4X9GA 2J7LA 1FORL 1QBAA 3C08H 3SE4A 5DHVB 5J13C 4UZGA 1XSIA 1CDIA 3WBDA 5EDXA 5ABFB 5F96H 5BMFL 5TDPB 1SHMA 3QPQD 5D1QC 1T21A 1OW0A 3SBWC 1IGMH 3RIFK 4MQXD 4HX1A 2J25A 3PHQB 5EU4B 3FQWB 1RURL 5DJ2A 5EFIB 5D6DC 1TQTA 5GJSH 1IEBA 4JRYD 2YFOA 5FDWB 5C6TL 3NPSC 1F45A 1EQPA 5I8KL 2VE6B 3RNKB 5IHUL 3BGMA 4WO4B 3WNKA 3KNBB 2ICWA 5FYJL 2WBGA 1P53A 1SEBA 2NX5A 2W0PA 2X7LB 2DIEA 4JFOA 1MRCH 1H0DB 3AZRA 2QSQA 2R1YB 4JHZA 4DOHE 3QGVA 1E0OB 5K9QI 2XJ7A 2BC4B 3HNTL 4NNPH 4F9JA 2JELL 1A6AA 1Z6JT 2YSSA 4QRSB 1KENH 2NY0D 4B7LA 5LA0A 5C09E 4K7PY 1X9QA 4LCCC 4U5KA 2J6EL 4FMFA 4M62H 3QIUC 4QTHB 2OP4H 4KJWC 2DT0A 4LLWB 3ARFA 5IW6A 5FCSH 4HKJB 2L0DA 4YHIA 1QNQA 1T0MA 4KMLB 2XUCA 1A4JA 4M7ZC 4YXLL 3RWJA 1YMMB 2R2EA 2PN5A 3SCMA 2CK2A 3RPIA 1MFCL 4XPAL 1CXIA 1MHCA 2NMSA 4DWSC 5IM7B 1ZGLP 1ZA6B 2X5PA 3RGVC 3CDCA 5DHXB 4FTVD 3QUYB 3VXSD 4XBEL 2EO7A 1B0WA 1QFPA 2ITDA 3GJFB 3C8KB 1UWSA 1QNSA 5ACLA 4GKNB 5FECA 2AVGA 5SWSA 4JZNB 1JDAA 1E6NA 1ZOXA 1Y6NR 3LN5B 1U95A 5GSRB 4JGUA 2WSPA 1NMBL 4LSQL 3SKMB 1IGJA 1JRHI 3UMTA 3D50A 3RZCA 4OB5H 3QNZA 5D1ZD 4EAMA 2Y4SA 4JO2H 4LCIL 4PG9A 3SDDC 5DS8A 2DQEL 1L0PA 4K8RL 4ZFZB 1G9NL 2M8XA 3ESUF 4LPWA 5GS1B 4X0NA 3PDGA 4X6DE 2HISA 3BO8B 1E4MM 2CDFA 5DFWH 2WMJA 2W0FA 4JFEE 2CKBH 4HS3B 4G9DA 5CUSH 5I0ZA 4OQTH 4BK5A 5BXPA 4PP1C 2HT2C 4PG2C 3H7LA 1O7VA 2YC1B 1MJ8L 4H25B 4P48A 5ACZA 4HGMA 3PQYB 2HFGL 3NYDA 3MFGB 3L7FA 2R29L 1RFDL 3G6JA 4GAFB 2HTLC 5FOJA 4FQQB 3X3GL 2H3NA 3JWNC