1CXFA

Complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 227
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxfA01
4JJHA 1A7OL 1P1ZA 1SJHA 4NQCA 1BFNA 4QEGA 4WDIB 1DN0B 2DL2A 2P1YA 5C7XL 1M1SA 3EYSL 3CSPA 3LEXB 3VXSA 5EFFA 3UTTA 3LDBB 5IJVB 2HJKB 3C8KB 4JFOA 1Q9OA 3EOBB 5DJYA 4AIOA 2AI0H 5LQBH 3DGCR 3GSWB 3QWOA 5ADPL 3WJJA 4NP4L 1T0PB 3CZ8A 4Y1AD 4W8BA 4MCZB 4F9PC 1KB3A 2WBJC 3JV4B 3JV6A 3ZKMD 5A2FA 4NRXA 4FNQA 1U8MB 1E4LA 5I15H 2UYLA 4RWYL 4O02L 1Q6GA 4O2FB 2B0SH 2FD6L 5KSVB 2D03L 1CDUA 1U41A 3S9DB 3CFJA 3EOYG 4DK3A 2J7BA 2WHLA 4GSDH 2A74B 5DVOA 3F5WB 3BAXA 3MLYL 4FMKA 4HQQL 3MXWL 3WSQH 1BF8A 3V6OA 4UV7H 1NGPL 1BOYA 1MIMH 3BUIA 4PSPA 2VDPL 4XHJC 3GMMA 4QTIH 1P2CB 2OYKA 3UJTL 5CEYB 3MJ9H 1ESWA 2FJFA 4YHLH 3LMJL 1G84A 4X0KB 3ZO0A 4C4KT 1XGRA 4NBYB 4HWBL 3AI0A 2DQDH 2BHZA 2UYLB 1R5IB 2YKLL 1CGWA 4A6YB 1MSPA 2EDDA 4F7MA 2EDQA 1GOQA 3DSFH 3NCFB 4ZTOL 4MNQB 1D9KB 2CHNA 2CIKA 5FYLH 5AD0B 4JAWA 5GS1C 2HFEA 1RHHA 4HPYL 4I0PC 1V3JA 5KZ6A 5GISL 3MMWA 1WFTA 2XNAB 2E8YA 5DJ0A 3ARQA 3PGDB 3UTTD 2OYMA 4ORZC 4KXZI 5C0BA 4R4BA 1DWFM 2DM7A 4YQXL 5FGBC 2Y8VA 2XWTA 1ZHLA 3VFTA 4G9DA 4PJXE 4KK5C 1S7XA 4ZFOL 2BC4A 3WO3B 1IBGH 4P0DA 4U0QB 3IDGB 5DK0A 5HYEA 1S7QB 1OARH 3MNZB 3FB7A 1BZQK 3SGKC 4OLZL 2V5CA 2W59A 2YMXH 1NH6A 4L1HA 3CUPB 1KCVH 4X7EC 1QRNB 3IS0X 3NZHL 4KAQL 3HR5A 5EU5A 3W5NA 4HBCH 4KUZL 5JBEA 4LSSH 4UV4H 3FT3A 4NO5A 3LQAL 5J1TC 3WCYA 1O6IA 4JQXA 2BXZA 1AXTH 4M7LH 2H6PB 3CCHB 2DJSA 2AJ3A 4YK4B 3CFCL 3BE1H 4Z2JA 4QHUA 3PQYB 5DZNA 3ARBC 4UZSA 1EFXA 4G6JL 3OZOA 4WFGD 4XH2A 4BQ6A 5GRZA 4Y2DB 4ZO7A 3SE3A 4AEHL 5ABEA 1LO2L 4UB0L 2OL3B 5D71H 4N90E 5D6CB 5DJCA 1N5YL 1H8SA 2HT4D 4LRNH 2V17H 5IWLC 4F37K 3V52H 5SWQB 2NY3C 4P46D 3EMCA 4B3KA 2XV6B 1C8PA 3QDGA 5LKNA 1IC4L 1K9FA 5C9JA 4O9HL 1DVFB 3QCTL 3R0MA 4PMQA 1LL6A 1A3RH 1ZBCA 1LO0H 3CCHA 5D2LE 3T4YB 3QG6A 5FO9B 1EGJL 1QI5A 3VIOA 1S9WB 5B3NA 2FHFA 4X99B 1KT2A 4TXEA 1NMAL 1TR1A 1UM5H 1UZ1A 2I25N 2VWEE 1JHLL 3CU1A 4IRJB 4MHHI 4ZSOB 5FYLD 4D8PB 4DVRL 1NFDA 4PJEA 2OTUB 2ZOKA 2EYTB 3HE7C 6TAAA 3WYRA 3GGWB 2R0ZH 4M7JL 5A6JA 5KSUA 1U3HD 3OJDA 5T3XL 4WW2F 2PR4H 4P5TB 1TE1A 3BRGC 5EZLA 2ATKB 4LVOB 4ZFGL 1X9QA 2JJSA 1M7DA 3S3PA 2RR3A 1IGJA 4AYGA 1KNOB 3ARFD 3QUZC 2QEJA 2RCSL 4WW1A 3ARFA 4PPTA 3H2WA 3HMWL 1JD9A 3EJJX 2DM2A 1CT8B 1J1PL 1FN4B 5C0ND 3E8UH 1MHPH 3MOAL 3HMWH 5D8JL 5F3BA 1FLRH 5EORH 3LIZL 1HE7A 4V1DA 3OAUL 4JZ5A 3F5JA 4FTVA 1HXKA 4H04A 2AXFB 1QVOA 5D7LE 2IAMA 4HKZB 4ZXOA 1REIA 3PP3H 4FZEH 4HHAB 1WBXA 3MRFB 1J12A 5INCB 1JPTL 2DMKA 5EUOE 5E70A 3UTTB 3N0PB 4TSBH 1AKJD 2GHWB 3DX4A 1A6AA 5A2JH 4XCEA 1EMTL 5AWNL 5CJXA 4PRBB 1E4XI 4WEBH 1BP3B 3RAJL 4AT6A 4TVDA 2DSZA 3RVTC 1VFAA 5FYKH 2JIXD 4L4JA 5ALCH 5FF6B 3WY3A 1JWUB 4DKAA 1NMAH 4M43L 2E7CA 3MA9L 4QXWA 1GPOH 1FNHA 2OZ4L 1U6AL 4XCCL 3BEWB 2HJKA 1J0ZA 4JFOB 5L8KB 1ZVHA 3FTGA 3ZE1E 2ADIB 3HE7A 4P9HC 5M03A 1NJ9B 1V0MA 4S11A 5JPMA 1RH9A 3JVGA 4DN4L 1AGDA 3ARGB 3S5LG 3L3OA 1X4ZA 4AMCA 3ZTNH 3G6JB 1ND0A 1F11B 4Y7MA 3V52L 5FK9B 3VI3F 3WS3A 4KJQD 4RGOH 3WL1A 3E3QE 3N04A 5D93C 4I13B 4N9GB 5TE4L 2DLGA 1X44A 4WCYH 3AYRA 1V3KA 3L4VA 4RBPK 1IGCL 1XF4A 5EFIA 5JOEA 2YRPA 1QYGH 5E4EB 3VXNB 3SKNA 2AK4E 5B8CC 3GDBA 4NRSA 2HFFA 1B2WL 1Q94A 5LXGL 1WK0A 5DZLA 1JWMB 4OFDA 1RULL 3L3IA 1DFBH 4G80B 1JHTA 5DSCA 3SE3C 1JNLH 4TSCH 4B41A 1LHZA 1EHLL 1BEYH 3JV0A 5E2TL 1WDQA 3WN5C 4OKDA 1KCVL 4I18A 1M05A 1V7NL 1X7QB 3GMPA 4RMQA 4X9FA 2WSPA 3ZJ8A 1KBGH 2Z8VC 3ARED 3QQ3B 2W63A 4FS0A 3I02B 3KHQA 4HGMA 3RWFA 3ZLQC 2ALWA 3AHYA 2VDQL 3QXTA 5IKCA 4X80L 2DF3A 1BJ1J 1NGXB 4XP1L 3BISA 4U1MA 5IB4B 3MJ8A 4Z95L 2AV7B 4OM1L 1I3GL 1N2RA 3K8LA 1TJIL 4NYLB 1GGCL 1S9VA 3G9VA 4FP8L 3RNKA 5FCUL 5B21A 4NRYA 2QSTA 4QYOB 1ZLUK 1FP8A 4FQ1H 4RMVA 2DN7A 1TMQA 2DYPB 2ICWB 3QO1A 5TE6L 3TFKD 2XVNA 4MQSB 4ZYKA 1KPVA 1W9VA 3KYMB 2W9EL 4QKXB 1H5BB 1K9EA 4ZUTA 3LRMA 1UWGL 4WFFE 6FABL 1AIFB 4UV7L 1ZS8B 1FAKT 3MSDA 1G7MA 3EJYD 4JFEB 3UBXB 1JGEB 4M1RA 3U0TB 3TLRA 1A2YA 1D5BB 5J1SC 2NSXA 1DE4A 1OAUH 5CGMA 5AC5A 3CVHH 3HAEG 3FT2B 5E94A 4O02H 3SKMA 4ALAL 5GS0D 2W61A 8A3HA 5DRXA 4OV6F 1JDDA 1EEYB 3O8XA 3N1FC 2GSIA 2DIEA 3GSRA 4S10A 1T2XA 3BZDA 4K3HA 3W0KA 1BFVH 3DLQR 1NMBL 1KG0B 1XCQB 4IPLA 5JNYA 3EYUL 3C2SA 3V0VB 2JJTA 4JG1H 4JQVC 3KPSE 3EYSH 2NXYC 2Y6SD 2KZ1B 4U49A 4X7FC 1AGEA 3PP4L 2HT2D 4LEOA 2WBJA 2WCAA 1HHIB 1KXQE 3V5DA 4EI5B 2MWCA 1GOKA 4Y5YB 2P5WE 3O2LA 1TENA 5EULV 3UAJD 3OJVC 3JUGA 3ZL4H 2C3VB 4R2GC 1JHTB 1BJMA 1RIHH 4KVNL 1IC7L 5C6TL 3G5VB 1K6AA 3O3DB 4J3XA 4EVNA 3MRGB 1W72H 1F3JA 1UD2A 3HZMB 3BAIA 4D2NA 2NR6D 2L0DA 3CPLB 4KQ3H 1LL4A 1AMYA 2WVVB 4AISA 5I17B 3D48R 4XX1E 3WHXA 5MEND 2ZUMA 5HOSA 4S0TD 5JORB 4M4RA 3QFJA 3QUYC 3SDXA 3VFWA 4G80A 4ZFMA 3WKML 1K4CA 4HS3A 3RGVD 1OW0A 2HRPL 4ODTH 5FDWB 1DCLA 1NCWL 2BRRH 3GHBH 4XMLH 1CGSL 5CJXC 3O2DL 5FO8A 5A6MA 5DUMH 3UZQA 2X1PA 1BYBA 3BWAB 2DLTA 1EUUA 1LO4L 3EJYC 5CWSB 1MJUH 1I1AC 3SY0A 1G6RB 2VLRA 2DIJA 3CNKA 5CINL 2Z91A 4YFDB 1KN2H 5D5MA 1A6TA 4YIQA 1NMCB 2GTZB 2R0WL 4YBLC 1U36A 4EUPB 3A0OA 4QOKB 2APBA 1WBZA 4U1IA 3DVNB 5AAWA 2QF8A 3CDYA 1RZJC 3B9KC 1U8JA 1WAAA 4DUVA 3HG1D 4RDQF 2F53A 5GGSY 3DMMC 4P5KA 1FDLL 3PGCA 3PHOA 4FXGB 4XBPB 3OGOE 5C86A 5FYJD 1GUVA 3FN9A 5DLMH 2W9DL 2XN9D 3F58L 4Q6YA 5GS1A 3FRPA 4CW1A 1EVUA 2CQVA 3C60D 2OBGA 5J06A 4EZMA 3KYNB 3LPFA 4IDJH 5IMLA 4W85A 4BS0A 1CENA 2IQAA 4OIIL 3NUKA 4K7PY 3LN4A 4NFCA 4ZPTB 4V1DE 1T83A 5EIIA 3QJHB 5C07E 1BLNB 3NTCH 1WVZA 3ZOAA 2BVQA 4XPTL 4F33A 3E3QC 1CK0L 1WTGT 2D4FA 4J8RB 3DXAE 3AFBA 2Z31B 4HDIB 4NGHL 5INCA 3O6FC 1MF2L 3CXHK 1JPST 2NR6C 4Y1AB 4CD8A 4AH2A 2AXFA 3Q5YA 4FHBD 4LCCB 1NGZB 4HPGA 3GM8A 5JBDA 2R2EA 1UCBL 1B30A 1GQKA 3VXRA 3KYOA 4H1LH 2V5YA 3O41A 5DJAA 2FZ3B 4KK8C 5IESH 2P24A 3O0RH 2JKXA 1U3HC 4WHTA 5C0CB 2OS7A 5LCVL 3GK8L 5CPQA 1KGUA 1YMHB 3G9AB 4W4NA 1KCUH 4ZTPL 3MBEB 4P8VA 3O9WA 4O2EB 3F7PC 1VB9A 3JWOH 3FFCA 4Q97A 1KR1A 1C12A 1C7TA 4PRDA 4KHTL 4IRJA 1RIHL 2WVUA 3MCLH 3PZNA 4R2GD 4QCEA 2EYSB 1KWGA 3MNWA 3VIJA 1S9WA 4RA0C 5I75C 3NVQA 4UIMB 4AEIH 1HJQA 5C0NC 1N6QL 3ARDC 1PBGA 1LDSA 4EN3A 2VH5H 4HF5H 1FZMA 5JTWA 4YDJA 4S2SB 5E08H 4JZOB 4NWUL 4Q6IB 5CD3A 5KS9E 2A83B 1FO0L 4I48B 4ELMB 4MB4A 3WDJA 4HUMB 1NC2B 1U8LB 3EYUH 1LK2A 3QHFL 4WO4B 4GRLC 4BQ8A 3A6CL 4PJGF 4QF1B 1G9MH 4NOBA 3ZJ7A 3BPNC 2CDFB 1ZU8A 3BAEH 3O45A 2B5IC 3VMPA 2P46B 1QKZH 1ZSDA 1CBGA 4AZ8A 4M6ML 5M3WA 2R0KL 1JWSB 4NZCA 5FL1A 2WBWB 4LHUD 5E2WL 2RGSA 3O4LA 1KWKA 5ISZE 2F58L 5I23A 3S36H 3ZKXB 3QWRA 3G6AB 2I07A 5BW7A 1X5IA 3D52A 5SWQA 1LILA 5IM7A 2GJ6B 1CF8L 4FG6D 2Y6SC 3C2AH 2FIKA 3KNBA 4OGYL 1WLHA 3VH8B 1C5DB 1HHJA 1EZVX 2V38A 1K85A 4GRWF 1CDHA 4WHDA 5E8DL 1M7IB 2QADD 5DC4B 2HKHH 3BD5A 1CBVL 4CMMB 4UT9H 1I1AA 1LK3L 3GRWH 3BD4A 1JNJA 2PW2B 3D69A 4AYFA 2QQQA 1D7FA 1S8DB 3O4LE 3AMCA 1X5HA 3OJMB 4W8LA 1B31A 2J8GA 4NQEB 4QHLB 1IEAA 1YEEL 2ZCHH 1H0GA 3AZRA 3FQWA 3SCVA 4IRZL 5EO1B 2R2HB 3EFDH 4YHMH 4I77H 3OPZH 1JGVL 5C0BB 3QIWC 2VDRL 4KUCD 1QD0A 1N7MH 3QEUA 3PNWA 1VFOA 4U2YA 3N85L 4R4NC 3SCSA 5CSGA 2Q7NA 1HI6B 4RGNE 3BPLB 5HYIA 4BSJA 2X7LA 5IBLD 4Q9QH 4RMTA 1E1EA 1AHWA 4L3AA 4AQOA 2DQHH 1MHCB 1FH5L 2JJVA 4KMTL 3OLIA 2PBGA 1P7QA 1XGYH 4K55A 5EZJB 1VAHA 4LP4A 1NSNH 1IT9H 5SWZA 3VMOA 4QRTA 3MRRB 3P4NB 4AQ1B 4G3YH 4M6OL 3DRTB 2C8NA 1TETH 2W91A 4GO9A 3TTYA 3TTQA 4OZFG 4F9PA 3M17A 1QO3A 4PJ9B 1EHLH 2VDLL 2DJ4A 1R47A 1G0CA 2C3XA 4HK0B 4O2EA 1XF2B 4JPVH 3ZJ6A 3O9WD 1MQKL 3QZWB 1OD7A 5IEHB 3QI9C 3MBXL 2HN7B 4R26H 3IDMA 2XYCA 1JGDB 2ESVE 3SE4C 2BZDA 2YK1L 3PL6B 4QXGH 1KIQA 1MLBA 2DOCA 3B9AA 2IF7A 3RL2A 2E40A 2JCCF 4FFVD 1U8IB 4UBDC 1B0WA 4HXAH 1MFBH 2Z93B 1SMAA 4QRPA 3ZT6A 3WFBH 1TVPA 5DXWA 4G6KH 1GXEA 3UYRH 3WEMA 1CWYA 5TH2A 3T77B 4FNTA 3D3AA 1KN4H 3TWCH 5FXCH 2Q6WB 1J8HD 1UASA 1OQOA 5E8NA 3CMJA 2E9BA 1MRCL 2XYLA 1KCRL 2CRIA 1T0MA 2XIBA 1GVYA 4WVRA 5E99L 1KEGL 2QHAA 4C56B 1GZQB 4PY8I 4RZCB 3DUSA 3E6FA 1UZ8B 5HDOA 2BVDA 1CFSB 4ATLA 1ZHNB 1V3HA 4NNXB 4WI9A 3GNOA 1LVEA 4PY7B 4JANB 2J8UE 5KBNC 1C90A 2RBLA 2FLBT 2B1HH 1MXGA 1I8IA 1TZGH 3I6GB 1XC6A 1OWWA 1CIDA 4H25B 4NJAH 1WAAE 4E41B 5CHNA 4TSBL 2ADJB 1R85A 3P4MA 4XNUH 3T0EB 3F7VB 2HISA 5D1ZC 3QRFM 1GPFA 4B50A 4PTVA 3OKKA 5IFHH 4MA3B 2A6IB 5HGDB 3HNTH 3ARFC 3QUZD 2BSTB 2GJ6D 2Z91B 3RZCB 3ZHKA 1I1WA 4RRPA 5HYJB 4HZLB 1T04A 4N5EC 3RVXD 1A3QA 2VDNH 2Y06H 2Q7YA 4PGEA 3AJ7A 3CZSA 2MQCA 3RKDC 5IQ9A 1J1PH 2XQYK 1IGYA 4U7SA 2RCSH 3G5YA 1WUNT 1MCIA 4HH8A 4HXAL 3RKPA 1D9KC 3F7RA 2W60A 3WIFB 1A5FH 1PIGA 3ZJKA 4PRIA 2DH3A 1AQKL 2OLDA 3IFPB 1WCBA 2FX7L 5KSBA 5T1DH 3X12A 1WWWX 1KTKE 1LEGB 1GIGH 2UZXB 3WFEH 2D24A 3ZQ9A 1L6ZA 4AZCA 1IGMH 4OB5H 4G8GD 3KPMB 1R3LB 5KVFH 3K8KA 1NGWA 2VN7A 1LO3H 4ZDHB 1EQCA 3AROA 4AM0B 4FF5A 1FNEB 4S2SA 3UO1H 1ORSB 3WEXB 1FNAA 1KTDB 3CXHJ 5D1ZD 3MRIA 3AXIA 1EBAA 3C9NB 4LXFA 1M03A 5D9SB 1G7JB 5F7EH 3N13A 4F7EA 2NYYD 1E72M 5GSRB 4LCCC 3EBVA 4GMSH 1PAMA 3VXPB 1A64A 3DHMA 5DFAA 3G5ZB 3KPSA 2WBGA 3O9WB 4LVHC 1MCPL 3DX8A 3RWIB 4HCRH 5M5DA 5K93A 5DRWA 1FSKB 2VDKL 4WW2B 1N4XH 4HIXH 2CBVA 3T0WA 3IU3B 5SWSB 3OPZL 1KBKA 4YHNA 3X3FL 5C2UB 2GY5A 3H3KA 5TDOB 1WCGA 3QQ9D 1UQSA 5FYLE 1I8MA 3MR9A 1S7SA 1LE9B 4L9DA 3WD1A 4XNMB 4PJ8B 4YO0B 1X5JA 1FIGH 5BXSA 1GIGL 2DYPD 1LK3H 3GRWL 1VSCA 3CFCH 3I3DA 2VURA 5EB8A 2BNRA 4MQ7A 5A16A 5ABHA 2EKSA 3KLLA 5TDNA 1TFVA 3MPCA 3LSOA 5F8RC 2VAJA 4UR9A 2DDQH 3IKKA 5I1GL 1KPVB 4LSSL 4KUZH 1IZJA 4MNMA 3E1F1 4LKXA 1X5FA 1DQJB 4HBCL 2UY4A 4LGSB 4JO3H 4MJIE 1V3MA 3Q1SH 1FFRA 4XPBH 3QOKA 2XHYA 4RGNC 4HS8H 4HU0A 4E8CA 4C58B 1F6AA 2DMBA 4CN1A 2WC7A 1A1MB 2IH3B 2X4PA 1TQBC 2V2WA 3BT2H 1V05A 1BSIA 5FAAA 2F74A 1XIWC 5C0EB 1CL7L 2YRZA 3GNRA 5E4IA 5HHPB 2OX5A 4XXCA 5CEXA 3S37X 1ORQA 3CVIL 4G6AD 1BVLB 3CTTA 2HKFL 4YPGA 2YD3A 1A6TB 1ZHKA 3SKJH 3C60A 4ETQB 4HF5L 5CLWA 4S1DD 3WS6C 3L5WB 1M05B 3GBLA 1KJVB 3AREC 4R7NA 4Z0XB 4JHBA 2ZG2A 2WM0A 3MRKB 2ENYA 3NA9H 3CZFB 2PO6A 1NFKA 5J13B 4ODVH 1TJHL 3V0WH 5BXFA 3RJXA 2NY1B 4U1KA 3UMTA 3NYDA 5L88H 3VX1A 2AK4A 1VBRA 1T66D 2VDPH 2CRYA 4AJ0A 4YHPB 1IL1A 2APVA 3WSQL 4HK3J 1T5XB 5K9QI 4H8WL 2CCRA 4I0PD 4C55A 1FZJA 3VSVA 4AD1A 1FO0B 4FLQA 2Y4SA 5IBLC 2VVNA 3MROA 3AAZB 4MYWB 1F6LL 4G6KL 1H5VA 2G5RA 2J3SA 3VRIA 5FK9A 3BXNB 4XB7A 3BDXA 1CD8A 3ISWA 4ZS6D 5KZCB 4FQQB 5C0FA 4NP4H 1FPTL 4PGEB 4QXGL 1S9XB 3GI8H 5A2AA 5DD6A 1DQDH 4AZHA 5F6IC 5HYJA 2OZ4A 4JFQB 1NC4A 2EH8H 2VZUA 3U30C 2VXUH 4D0DA 3HI1A 1Q0XH 1YY8A 2P8LA 5CJOH 3UAJC 2AK4D 3QUML 4Y4HD 4KQ4H 4XWGL 4OIIH 5DJ2B 5C09E 5EO0A 1S5HA 2QSCH 1YQVH 1IFHL 5CZXC 2YL9A 1RK1A 1FIEA 2VERN 5ALBH 3TO2A 2E6QA 4NT6A 4OFVA 4ZAKD 3QO0B 4ODSL 3VM7A 2AJUH 4CGTA 1NEUA 5ETUA 5F1SA 4WU5A 3A6BL 4DOHB 2D73A 1S3KH 3HI6H 2ZUSA 1V0KA 1B4RA 5ABFB 2FJHB 4KMTH 5DUPH 4P5MB 4OCRH 4BELD 1E56A 4NQDE 4K94H 1OL0A 4HAFA 3BUDA 4NQXA 1ZWIB 2DKMA 1JN6B 4C56A 3L6FB 4HOZA 5DA4A 2DS4A 3C6SB 1CLXA 3HG5A 3O6MH 1YMMB 1ZOXA 5KSAC 2EEXA 3N85H 3I6KB 1XRVA 1BBDH 1CZ8H 2QR0B 2XZAL 5D96B 3EYQC 2I27N 3ZR5A 1C16B 3LHPL 5J11B 2J7HA 1RV6X 4TUOB 2YBUA 1E6XM 3KYMA 1FYTD 1KEML 4ZYKB 2HT3C 1XHGA 2Z8SA 2X4TA 3LKQA 1P9MC 3NCYS 1FZOB 3QXAA 3CFBA 1R24A 2MMXA 2YD2A 4JKKA 1SJXA 2P42B 2YWZA 3ET9F 4IIQC 4JPIA 5JW5A 4GRWB 4PJCE 2HKHL 1LJYA 1JK8B 2I9LB 1D5IH 2FLRT 4HD9A 2N7AA 3HZVB 1L8NA 3H53A 4X6CA 4EI6A 3FQNB 2X44D 3NZ8A 2W38A 4Y8AA 5IV2A 2APWA 2MPAH 3T0EC 3WY1A 4KI5F 4HP5A 5D9PA 2WPGA 5JLZA 5IB4A 1EX0A 3BGAA 1OD8A 3QBTB 2X9YA 4KUCF 4XT1C 1U8HB 3VJ6B 3ZKSD 4WFEE 5J6HB 2F58H 1Y6MR 1XF1A 5I8OH 2WCGA 1CPUA 1ZTXL 4PJ7B 4N0CD 4WV1C 1TQWA 2DBLL 5I8KL 3TIDA 4PR5B 3M17B 4F15C 4L4TA 4U6XB 5IB5B 5E00B 4U31A 1WPCA 1HIML 1T1YA 1ZT1A 2HJFA 3BJ91 2BRQA 4HWNA 1XCWA 1RZGA 1QNPA 1G7QB 3L3IB 3PWPD 4KJWD 1P7QD 3PP4H 2C1PB 5DHYA 4Y2DC 2D1ZA 3ARDA 2R1XB 4NWUH 3T0VA 3K0WA 5GXBB 2A9ML 3QDGD 1GQIA 5EOQH 1LEGA 3PGFH 3C87A 4QRPD 4FABL 4P46A 1Z5LA 1I9RH 1J5OH 3PABA 4Z6AT 2FL5A 4X9HA 4JGUA 4CNIA 2YPLE 3WIIH 1CFTB 3AS1A 3R4DA 4KHTH 4WJ5A 2OTWB 1MY7A 3VRLE 4ONFH 1VENA 5T1LB 1AY1L 3HE6D 4XH2B 4LHUB 2XVGA 2IXUA 4FNLL 5F89A 1Y0LB 3FOMA 1ULVA 3TNNB 3A4WA 4XC1H 3IGUA 4K3JH 5FHAL 1TQTA 4Z7UA 5B8CB 3EDJA 3ARXA 1ACYH 4JDVA 2XN9E 3GSUA 4I5BB 1IGTA 4WWKD 1ZANL 2A6KB 3EOAB 5JIPA 3BEWA 4ACZB 2VRAA 3ZE0E 1L7TL 2RFXA 1MQRA 4Y4HB 5F89B 1QVBA 4W8AA 3P0GB 1WF5A 3GEWB 4ELKA 4MPKA 2NXZB 1QPKA 2FEDD 1CICD 1BFOA 3GMOB 3OGCA 2NZ9D 2V5MA 3F7YA 2BNUB 1I8LC 1GGCH 4ESKA 4G6FD 3IF1B 4WTWA 1C92A 5M94B 4ZNEA 4FNRA 1P5UA 4OFYA 3EDEA 5L6YH 1R5VB 2HVKA 1XGTA 3RY5A 5TPWL 43C9B 2ICWJ 4LHUG 1ZBWA 3O3EB 4TN9A 3AXXA 4JR9H 5F7DA 3ZDZF 1FNLA 1KPRA 4G43B 3D3VB 2ADGA 2IMMA 2O9RA 4GZJA 3IDYB 3OX8A 3A23A 1K8IB 1KBBA 1MCWW 1G7LB 2A73B 2E27L 5L2KE 3B9KA 4KV5F 4W88A 1OGTA 4MD5B 1RZJL 1OTSC 3V7MA 5HYSA 3GYCA 4YGVA 1OSPH 1IFHH 4BJLA 4DVBB 3TIDB 1E3XA 1E6OH 5ESVB 2DSVA 4JM4L 4MA1C 2ZCLL 1R3HA 4WW1B 1T1ZB 1MRFH 3OAYH 1UACL 3OF6A 1YYML 2NX5A 4LMQE 5ILTL 2CKBH 3WLWC 3POCA 4UZUA 4DZ8A 1GGIH 4MD4B 3AZTA 2FZ3A 5EZLB 1HJSA 5CZXD 4TX6A 3EYVA 3IDNA 2NW3A 3VXRD 5MI0B 5IEHA 1OM3L 1OW0C 1FE8L 4JE4B 4XCFL 1T2QL 4H1LB 2CD0A 4AH2B 4QRRB 4JFFD 4P3CL 5BMFH 1R3HB 4OZGF 4R4ND 4BZ2L 1WZKA 2UWEE 1PBYA 4PEEA 1HKIA 4F7TB 3FQRA 3S96A 2X0YA 1C08B 5GRJH 2CDEA 4K07A 3W0WB 1PY9A 4NQCE 3WQ8A 5SWZB 3QJHA 1JYNA 2YPVH 4KY1L 3MSGA 3QG6B 1T66C 1P7QB 1F4YH 4AXNA 3FHQA 1GZJA 1W72L 1CIUA 2OQJB 3ILQD 5T3ZE 1ZWIA 1TJHH 1IC7H 1LEIB 1CDCA 1S7VB 3T3PF 5IW6B 2QMKA 3ZT7A 1FG2B 4EQ2A 3ROLB 3MLTA 5EU6B 1QW8A 3NIGE 3W53A 3BYTA 3EJPA 3ME0A 4TULL 4M1GL 2CLZA 4YUEL 3RTQA 2XFYA 3L2LA 4JFUA 1UKSA 5ID0B 5FYJU 3QDME 4PMRA 5HHVH 4AD0A 2D3LA 4V2CB 3PQYE 15C8H 4CKQA 1QFOA 4QP0A 4Y4HA 2VXVL 3BO8A 4TNVK 5DJXA 3GBEA 4HMEA 1JDAA 1NC4B 3VXQA 2J7LA 2ZUUA 2PNDA 3TEUA 3MS8A 5DD6B 1U2YA 3O6KL 3ZM8A 4BF7A 4HS8L 3DX1A 5GIRB 4EXKA 4UFIA 2VZVA 3UEZA 3CZKA 2FEDC 3G6DL 3OAZK 2XG4A 3Q6GL 2XVPA 3GSNL 3RWCA 1QLEL 2NXZD 3FB7B 5I1CL 5E8PA 4Y2DD 1U95B 1VKXA 2OTWA 5D1QD 1JUFA 2EQDA 5GGRB 4OV5A 4Y4KB 3ZT5A 4QY8A 1I7UA 4UTAH 1JTPA 3QEQD 3O3UN 5HDRA 1KLUB 5HI4C 2LU7A 1FFQA 1I9JL 2F54A 4LVNC 4LLQB 1NBVL 1G7PB 5GGTL 4OI7A 1QFHA 2W07A 4I48A 4N0FA 2EXWC 2PWEA 5CSBA 2EYRA 3P4LA 4JJ5B 3HG1A 4U1KB 2E4TA 5TQ2H 5FGCB 4D3CH 1IAII 3FKUS 4L3CA 4JB9H 1BECA 4P9MH 5DT7A 4F7MB 2EICA 2J4WH 4X98A 4WSJA 1RZGB 5JZ7D 2YXMA 4KTEH 2ZXAA 1N4XL 4XXDA 3WENA 5H37G 3DJ9A 4BFGA 5GRWA 1AXSA 2ZX9A 2WBJB 5DRZB 5ABDE 1MW3A 4MXVE 5JR1H 5E7FA 1J05A 1IEBA 1EDTA 1AE6L 1BQHB 1UKTA 1KPUB 2J74A 4NN7C 3NABH 5C0RL 3RKDD 1KBGL 4YHOL 5K59E 3FONA 3O6FB 3PZTA 4KDTA 3CMOL 5JLZB 2CLRA 1OPGH 3D25B 3MJ7A 5D9MA 1CGUA 1BEYL 5F9WC 4EI6B 2YUZA 3VXRB 1UYWH 4GIAA 3LD8B 5D70H 1B9ZA 2QBWA 4XPGL 3W27A 1B2WH 2OSLA 4RQQB 1FCGA 4MJIB 1W0WA 5BV7H 3FT4A 1AC6A 1XD0A 3D0LA 3FB6A 4HDIA 2Z31A 5I71B 5EUOB 4CAGA 5JPNA 2YA1A 3LPPA 1I8KA 4BK5A 3LCYA 1XR9B 3G5XA 3RWGA 1F42A 4JFXB 7A3HA 1UB5B 1YEHL 2BS9A 3QJFB 4HGWA 4YDVB 2A3HA 3B9VA 2ESVD 3O4OC 2FO4B 3LS4L 5IEKA 2R23B 4X9BA 5FECA 4H20L 3DROB 1UYWL 4KKCD 1UOKA 1LGVA 3WNPA 4PGJA 2ZJSL 2E9MA 3ULVD 2YPVL 2R2BA 1R86A 4RBPH 4DTGL 3RUGE 5CSZA 1S9KC 2CYGA 1MNUH 3U7WH 1A6UL 5EU4B 1U6AH 3TZVD 1ECEA 1HINL 1UM6L 4FXLA 5C2BL 1N64L 3WUWB 1U8OB 2KZWA 1WBZB 1TMCB 4U1IB 1I1YA 1W9XA 1R6VA 5ENWB 3DSFL 4W4OC 2A2QT 4NOFA 4Z7QE 5B38G 1YNTA 2HA1A 1OSEA 1OGAD 5DMGD 2ZG1A 2JIEA 1RJLA 5JHLL 5IB1B 5HNNA 2YR3A 5HDQL 2VABA 4WI4A 5C0FB 4CD4A 2YL6A 4LCUA 4G8GE 5FO8B 2JCCE 5D7JA 4NO0A 3PN8A 1JV5A 4LP5A 3VFVA 4HS3B 2LU4A 3MFFA 2N4IA 2ZSVB 4UOJA 3MGTB 3VWKB 3X14B 4AIXA 3VO0A 2A0LD 3PIQB 5IVNA 3L3JB 1FZJB 4PRIB 5E6IC 1MCQA 4DUXA 3AGVA 4JRWA 4ZEPA 2BHUA 5KSAB 4Z7OF 5CLTA 4P23B 4GBXD 3FAXA 3H54A 3TONA 1U0QA 3DHJA 4L3EB 3OR6B 3TIEB 1SYVB 2AABH 2G75B 3DV4A 5DK2A 4X4MA 2W5FA 4N0UB 4DM1A 3BZFA 4NXKA 3CZFA 2AI0L 5L6YL 3ECBA 1TTGA 4R26L 1YQ2A 2Q8AH 4KH2A 3UC0H 3VE0A 5LVEA 4LEOB 1J1XL 2VL5A 1OLLA 1A7OH 4YUEH 3NGBC 4O58L 2V7NB 1PX8A 1R5WA 4PB9L 4KKLC 1UEYA 4PJ9C 4LHQB 5JNYB 5CHNB 3GH4A 1KV3A 1E0VA 1WAAF 4DGYH 1DL7L 5BS0D 5EBWB 1A6AB 3TESA 1JPFB 3RPIA 3REVB 3EJSA 2XWJB 1FOBA 1SJEB 4P8UA 4RAHA 3KLHD 3EBAA 3L7EB 3KEHA 2EPMX 3CPUA 2A77L 1I7ZA 3P4OB 1WIPA 3WBEA 4MJ2A 4FNSA 1E40A 3WHE0 3FN0L 4JY5H 4PJCB 5I6XC 4ATWA 2V9RA 7CGTA 3W28A 4GQQA 1CGYA 5IEKB 2EPOA 4U1HA 5MP6L 4XZUA 3KXFD 4PJFE 3LSOB 4IRZH 3QRGL 5D71L 3VGDA 4MVBC 5TFSL 3PGFL 4WFHE 5LAXB 4AEHH 2IAND 5F7YC 1HP5A 1FYTB 3VFUA 1BQUA 4J12A 1AI1L 2H2SC 3VD9A 2OMBA 2RGLA 3N1AA 4X9YA 4WF7A 4GS7B 4RSVA 1CBVH 3DX0A 1FORL 1I1YB 3V0AC 3GB7A 1N2RB 3WHE1 1US2A 3LQAH 1MRFL 2HVJA 4LSUH 2NY6D 4U7MA 5DS8A 4LLUB 5HHNA 1N0LA 4CMHC 4OGXL 5FYJE 2CIIB 4MNQE 3QZWA 4PD4K 1FC1A 4B16A 4P49A 1ZEAH 4FQHA 5HYQA 2VC9A 2VZOA 2WWDA 4OQTH 4IOSD 3RVXC 3OZPA 3TBVB 4PJHA 1RFDL 3I75B 3OKNB 5GGTA 2VIRA 2PCPA 5JUEL 3PZQA 1XEDA 4JFHD 5FL0A 3L3DB 4MJ5B 2CUMA 2BCKB 3U9PL 4PV8B 1QSZA 3KG5A 3NIDE 4J3OC 4F57H 1ZGLB 4P3DA 3CDFA 1MFCL 2X7LB 3D39B 5HPCA 4JFYA 1F45A 4MA8H 1WEJH 1NANI 3BH9B 35C8H 1T2JA 2ADFH 5E09A 3OZ9L 5C0JA 3RCNA 4FLRA 1KFWA 5BOZG 7FABH 3FQTB 3KLHC 1R0AH 1OM0A 3RO8A 4QY8B 1KCLA 4XRCB 2Y2WA 4PN2A 5KSAD 1O5DT 2JB5H 5ACZA 1KXTB 4R8WL 1ED3A 4V28A 2XWBB 3HE6B 1ROWA 1ACYL 2BNRE 5E9DB 1FFNB 5DEFB 1QNSA 5EU3A 3VVGA 1E4IA 5FOBA 1U3YA 4WKAA 3UX9B 2CBJA 2X89A 4LGPB 2FYYA 4E0RA 3WDHA 4UQ2B 5J1AB 5FYJH 2FGLA 1C5DA 4Y16B 4JRXD 1AXSB 3GMRA 3M8OL 3MCKA 3EHBD 1WICA 4LDOB 3OXRB 2JK5B 1JF1B 5GRUH 1VFFA 4TX8A 4EDWL 4O58H 2W0FA 3DYMA 1R0AL 3WDIA 1DWJM 4GRWH 4JRYD 4M93C 1DSFL 2QQNH 2VXUL 2XPGB 1QBAA 1FJ1B 3HG1B 2YC1B 4LGXA 1UT9A 1LEKB 3S4SG 1NL0L 2WZHA 5D7IB 1MFCH 4MAUL 1CG9A 4OZIE 1FPTH 4XP4H 4U2ZA 4NNXA 1U8LA 3G6MA 4HWZB 4W70A 1U8KA 1RP8A 3BKYH 1MCWM 2CEQA 3P9WB 4X6FB 4Q6IA 2NCMA 1KJ3H 5DVMA 4KTDL 2VCAA 1INDH 4K3DH 3QOMA 2CHOA 1I7RB 3F5KA 1C5CL 2VNCA 3WFLA 1ZLWH 1ZEAL 3IDIA 2R29L 3THMH 1DDHA 1IC5H 4GLRI 4XP6L 3HRZB 3TO4D 3S4SA 1DEEA 4OCNC 5MERB 4UNIA 4YXHH 4WI8A 2DLIA 1RK0A 3IDUA 4Q9RH 5TD4A 1H5BC 1LP9B 2YD6A 5DMKA 5CD5C 4LSUL 1AD9A 4OAWA 4H1LA 4HMCA 2D31A 3N06B 4ONHB 1UR9A 3N18A 3B6SA 1DN2A 5CINH 1SFSA 1NAML 3O4LD 4KKLD 1NWRA 5E7BA 1JZ7A 2ATKA 4TVPH 1NOFA 3U7VA 4KRTA 3SKJL 2ZSWA 1Z32X 3CVIH 5C0CD 3HPJB 2R2EB 2VJXA 1QP1A 3BUYA 2A1WH 2NY4D 4NRXB 1UYQA 3SCWA 5D7LB 4M81A 1XF2A 2Y7QB 5B3JF 2FHCA 3ULVE 3AHVA 4L8SC 5BWFA 1NFDB 4PJEB 3RA7L 1OVZA 1GSMA 4BH8A 3GBML 3O2WH 5GS2D 5EIQA 1Q6DA 3TFKC 4HKXA 5JW4M 3HC4L 5I6XB 4DTGH 2A73A 1JNEA 1HHHA 3HZ3A 2XTKA 4PLNC 4A4AA 5IHSA 5J57B 2J8UA 4U1SB 1CGVA 2YBTA 1AFVH 1C08A 5B39G 3R06A 1IKFL 1F3DJ 5ISZB 2Y07L 3SN6N 4Y4KC 3SCMA 1OWQA 5KVDH 1YNLH 5I1GH 3TV8A 5GS2H 2X2JA 3MJGX 3UESA 5CD5D 3GFUA 2J2ZA 1DQTA 1DUZB 3SHSA 1B0IA 1JGUL 5DFVC 2XN9A 3QEQA 3TV3L 4Q22A 5CS7A 4QHKI 1QUNA 5HGHB 4LEXL 1YEGL 3PWPE 3SQOL 1DLHB 3GXDA 1EA9C 4UNVA 2VRQA 4LQFL 2J5LB 3NBNA 1A14L 2YD1A 4K7PL 3T1FA 3VI4F 4WFGE 2YPKB 2J8HA 4JZJA 2JF7A 1M7IA 4CD6A 2C3WA 4QRPE 5GS0H 1IGTB 4DO4A 1G6RA 4JDVB 2GT9B 4DVBA 2YPLD 3EO1A 4Z7UB 2PUQT 4MXQC 1SEBB 3VMNA 4WEUD 3IDIB 4FQXA 4Z7NF 4R0LC 2NX5E 4LSTH 1QFPA 3IDGA 2CESA 4Z7OE 1K4CB 3M46A 1YZZA 1AXIB 1QEWA 1YNKL 2C26A 2XXMB 2P5EB 5JORA 4Y4KD 5I19L 4UQBA 1NDMA 1QBMH 4PJHE 1S7UB 1F8TL 3Q5TA 4HJJH 4OCWH 1LO3L 3DDFA 5CILL 5FA4A 1RZKC 1EK3A 2XSBA 2EC8A 3GBNL 2A83A 3SCMD 4P2QD 1IGML 1QRKA 1M4KA 1S5IL 2GK1B 4PRAB 2C1PA 4KK6D 1NBVH 2DT1A 3AM8C 1G7QA 1TJIH 2PO6C 1Z3GL 2GK0A 1AQKH 2CJUH 1B3VA 1AO7B 2BVTA 2RJMA 2MANA 3D6GA 3H9YA 1O7VA 1NCUA 4X80H 2WBJD 1UB6B 3UEQA 4MQTB 4PRHE 4S0SD 2Z92A 4E0RB 3HI5H 1N26A 4PJFF 5AUMB 1T89A 3KJ6H 5LA0A 1YDPB 4R0LB 4NSKA 3HI5L 5AG8A 3PHAA 4ENED 1KXTA 4FA8A 4Z7WB 4JO3L 5HD8D 4LBEA 1UWSA 1U33A 2PWDA 3RTQD 2VITB 1V7ML 2CSPA 4XHJD 3SKUD 2W66A 2BVYA 4N0CC 1HNYA 5A40E 4U5IA 2MTPA 3PABB 3U57A 3HG4A 1A7PL 5AZ2H 4RAVA 4NJAL 5D2LF 4L4VE 3BH9A 1BIIA 1TZGL 2F5AL 4I8DA 1N5AA 3MLZL 1ZS8A 4NNYB 3DRQB 4N8CH 1T21A 3FO9A 2GDUA 2BVQB 5CILH 1BLNA 2XPKA 2OWCA 4X7SL 2IGFH 3EYQD 3VFGH 4N1HB 1SYSB 1EAPA 4LNRB 3L3HA 4PTUA 1GOFA 1ZT1B 2VXQL 5E2UL 5ECJE 5FGRA 2DYPA 3OKOB 1D9KD 2PTVA 5I5RA 1HQRB 3C6LB 3MLWL 2PYEB 3ULVF 4TVSa 3OHXB 3LKRA 3LQZA 3OKMB 2DT2A 1MCPH 1R3JB 2C0HA 5HYJE 2P5WB 5E1QA 2X6MA 2BERA 4O5LL 1J10A 3QI9D 2P7TA 3NCYP 4WHCA 3RP1A 1CI5A 4NPYA 1JZ4A 4M7KL 5DGQA 4OZHF 4LPWA 4NFDA 5F7EL 5DHVA 4HIEA 3NCMA 3V79C 1OF2A 1H1NA 1AH1A 5J11C 1I1AD 4H5SB 2O9PA 1E9LA 3GMPB 5TQ2L 4D3CL 1UXWA 3FJTA 4LQFH 3SY0B 2VZ1A 4LLMA 1E71M 1TA3B 3V4UH 3VGGA 4KGJA 4M62H 2G2RA 1JJUA 2X89D 3CK0L 3MMEB 4POUB 3QDMD 1J87A 1MWAL 3BP4A 4X7CC 2GITB 3VI3E 2ZCLH 1Q8MA 1MWOA 2BNRD 3DNKA 4MDIB 2D23A 1T83C 1WIOA 4ODWB 4G8GA 5JO5B 5C0AB 1UJ3A 4KVCL 1GOMA 4GKSB 4PV9A 1IKFH 3V5KA 4G3YL 1IRAY 3VILA 1OP3H 2PYFA 4XCNA 3DXAA 2WVTA 1HKLL 2ZXBA 3SUUA 2DQHL 1IL1B 2Y06L 3O6KH 4W89A 3HZYA 1F00I 1ITBB 4L9LA 3OKDA 4B9ZA 3VG9B 5BXFB 1N7ML 5D1XB 3F65A 5ABGA 2DQIL 5IBUB 2CO7B 1JGVH 1HWGB 3GUTA 5D1ZB 1AO7D 5DMJB 1B3YA 4NQDA 1CFNB 4AZGA 5E8OB 1W32A 2EDLA 4XNUL 3MRJA 2H2SD 3P0VH 3RY4A 3L2MA 4JFQA 2R0ZL 4M7JH 4IRJD 4PREB 2A3BA 4HZ8A 1F4WL 3K7UA 2JE8A 3MV8E 1RPQA 4M1GH 4PGBA 2Q86A 4HFUL 3BXWA 4X9GA 3U2SB 3GHEH 3DGGA 5D1XA 2F7OA 4BSWB 3QHMA 4FQQA 1CFBA 3KWWB 2CKNA 4TVPD 5DEFA 4LL9A 3MJ9A 3L3KB 4Z5RA 3PWNB 3MRDA 1U3HB 4OZHE 5E5UB 4HLJA 3VNZA 2NY2D 4P5TD 5KSAA 1GORA 5BS0B 5E99H 1KEGH 1EEZB 5D5ME 1EO5A 5ICXA 1LO0L 3MMUA 2VLRE 4LLWB 2YD8A 4OI9A 4XP5H 4GJTB 3S36L 3BZEB 1Q9KB 2XKNB 3THML 5F9OL 4B53A 4A3YA 3NH7H 2ZSVA 5D8ZA 1JNHB 1B0GB 2R0KH 3TA3A 4LCWE 5KS9F 5J3HD 3I9GL 2DLFH 4HKBA 3ARDD 3MLUL 4LQ1A 3EYPA 4KJWC 4P3CH 5BMFL 1GQLA 3KXFB 2W62A 3QFJE 1NBZA 1V6VA 4X8JA 4X4XB 2AQ1A 2DT0A 4CJ1A 3DX9A 1VBUA 5GQBA 1YEKH 4PP2A 4JY6B 2O5YL 4AMKL 3TBVA 2EIEA 3OB0K 4QRSA 5IWLA 1CLYH 3QIUC 1J11A 3SUVA 2EDTA 5ILTH 4PRPB 3IFNH 1T6WA 3IVKB 4ERSH 1U2CA 4NQVB 4MJ4A 1OP5H 2IQ9L 2EDFA 5E2VH 2AEQL 3TCLA 1Z9OA 1KXQA 1JZ3A 4IHOA 5DTFB 1BF2A 1IKNA 4XX1G 1A9BB 1GVIA 4P4KC 3V7AG 3BIAX 5EOCH 4NZDA 1H11A 2ZX5A 2F7QA 2EDNA 2LQRA 3VD3A 3WD2A 3LN5B 1D5IL 1AP2A 2W9LA 2OTPA 4JO1H 4MD0A 4QDMA 4YDVA 5GISH 1MJ7H 3WUZA 4L8BB 4DGVL 1UB5A 3OLDA 1FNEA 4PJDB 1AHWC 1MJJB 4U1HB 4R4FL 4NFBA 2EC9T 4YHML 4ZTOH 3BIKB 1A7NH 3QIBA 2GSGA 4LVOC 3SKNB 5A95A 1H3UA 3R1GH 2DQDL 4MJIA 1QI3A 1WCBB 3MO1A 2WZIA 1G7IB 1OGAE 2A6JB 2DD8H 4NZTL 4DGVH 1SJEA 3BMVA 3EJRA 4I0PA 1TJGL 4P57A 2X1XR 4YHLL 4YHNB 5JUEH 4U6YB 5I76B 4H41A 5L7XL 3KPRB 3T3ME 1HVQA 2BHYA 4C57C 2DQFB 1UHVA 1IQWH 4XAKE 5AAMA 3HMCA 1RFDH 3OWEA 3PQYA 6CGTA 4JDZA 1C93A 3MLYH 2O5ZL 2UWEF 3TN0B 3AIWA 4G42A 1KIUA 3DGGB 1XIWB 2EIZB 3U82B 2A38A 2HMID 4LASH 2X4OB 3MYJB 5DA0B 1R87A 5TGBA 3X13B 5ALBL 5KANI 1Q6FA 2YUXA 5I15L 2XWDA 3ALWA 4MNLA 4OF5A 3B9KD 3VE0B 4WIWA 4G8FA 3AREB 1T1WA 2GUOB 5JXEA 1J5OL 5ADPH 3ARTA 1KN2L 1JG9A 2BV9A 3W38A 2EH8L 3ZE2F 1A3LH 4AM0A 2QQLL 2CUIA 3RTQC 1ZVYA 1MXDA 4XAWH 2D9CA 1FO0H 3GSQB 4X5XA 3RI5K 2X70A 3HZYB 5MI0C 4AMXA 2GJXA 4N0YL 3RL1B 3IJHB 4PJXF 3OB0H 3WKZA 5LGKA 3NDZA 2IANE 4D6IA 3EO9L 1HOCA 3C5SB 2BOBA 4WTZA 4PMOA 1MQ8A 5I9QC 4J1UA 4JN1L 4XMLL 2DWEB 2UWEA 3A22A 2BRRL 4AEIL 3O11B 4YLQT 3LKPB 4LIQL 2J6EH 2VSDA 4GKSA 3U0WH 4F7CA 2D22A 3B4NA 4GRWE 4RNRB 1G9MC 1DQML 5TF0A 4EJ1C 2E3ZA 1JF6A 3FN0H 4MDIA 3ARGC 4NO0B 4OLUH 3I50L 3JWOL 2D7QA 5CIPA 2ZP0T 2ESVA 5IHUH 1KB5B 2Q6WA 3WH8A 4H8WH 3GRWA 2ZX6A 1KCUL 3IXAB 5HHOB 1IE5A 1MHHB 1L0YA 5KSBE 4JKMA 4JFED 5IESL 1XF3A 3SCUA 3DO7A 1M01A 1S7RB 3EGSA 5IF0B 5C8JB 4L4VD 1MLCB 1Q6EA 4J23A 4JFZH 1JGIA 3LXCA 4ZNCD 4UOW1 3ULUD 1N6VA 2HN7A 1E4JA 1FL3A 1NEZG 2IPKA 2ZNXA 5HJ3B 2NXYB 3IU4H 5CEZH 1YA5A 2PTTB 3GXIA 1NOWA 2LV4A 3H55A 2FX8L 4P4KD 2Q8AL 2P8PB 4OQTA 5DJZA 2NT0A 1KGWA 1FVDA 5EBLA 1RIVH 2PBOA 3P9LA 4X7TA 5MEOB 1NMBH 1W9UA 5IVZB 3RVWC 1MCLA 4K9EC 1NAKH 1AR2A 4M56A 4ZPVB 3NJ3A 3VRLF 2I5YL 1VFBB 1QSFB 5FKPA 5L2KD 1TVDA 3ALFA 3Q6FA 2X2YA 3IRPX 2W9DH 3F58H 3A6BH 1JXJA 2QSVA 1OB1B 2O5ZH 4G8IA 4FQJL 5EUOA 5ANMA 3KLAA 1C1EH 1MH5A 1W72B 2ZUNA 2AJYH 3QNXB 4W4OA 4BUGA 4QRPB 2X4QA 2F15A 3RVUD 4AG4H 1I1XA 3BUYB 1MVUA 4FTVE 1GHRA 1MW0A 5EO1A 1U9KA 4Z7UE 3S5LA 2L7UA 3MOBL 4UOQA 2VITA 4DKEL 3UPRA 3W9DB 4JFDE 3QDJE 3MJ7B 5T1LD 1LD9A 4CL7A 1MJUL 4WJXA 1U8QA 5HDBE 3SUWA 4NWTL 4QHUB 2NX5B 3F62A 5TE7L 1FL6A 2IFFL 1ADQL 4O4YL 4PJDF 1XIWD 4Z76A 3AXHA 5DUML 1CGSH 3JUZA 2H45A 2YPLA 1RPKA 4HT1L 2CK0H 5CKAA 4XP1H 1QO3B 4WTXA 3N1GC 2OMNA 3P30H 1NQBA 2F9BT 3DRTA 5EOCL 3GIVA 4QCIB 3VCLA 1E6QM 4ZFZA 2BC4B 5T3ZD 3CFEB 1Q4NX 3LKPA 3MLWH 4DWSD 5CG0A 2CDFA 4XNXL 3T09A 2ZPKL 1S7UA 4ODVL 4L4TE 3RVUC 1DWIM 4ETYA 3C08L 5JXAH 4MAZA 2AV1A 4HV8B 2C3GA 4JO2L 4OB5L 3F7YB 5F70A 3MGOB 2YFNA 3VCLB 1HJXA 3CBWA 1T0OA 5CJ8A 5CAYB 5EU7E 2V2XA 5E5RB 4IMLB 4KKCC 4PGDB 1UKPA 1SEBA 4X6CE 1KIRA 3BT2L 1LNUA 5IMKB 4JPWH 3GJFK 3VH8A 4XCYB 2VO5A 2BMKB 3SGJC 5E6IA 3TNNA 5IJKC 3GXFA 2YOCA 3BO8B 1MVYA 5DRNB 1NEZA 4LF3B 4W7VA 1L0QA 2VR4A 1WB0A 5GGVL 4XP5L 1BOGA 4GOSA 1NCBL 1RJYA 2D7OA 4JFDA 5HGHA 3W0WE 1NGYA 3ZKND 1XZ0A 4EDXA 1CFTA 1ERNA 4KROD 5CMAB 4P4KB 4YDIL 1OIFA 1E27A 3AU1B 2P47B 2W9EH 1QPXA 2WW8A 1BQSA 3BP6A 1FVEA 2Z1KA 2BOCB 4HFUH 4WEBL 1QLRB 5FUOL 2B1HL 3RAJH 2YXFA 4CADB 1QFWM 2PETA 1WFOA 3RBGA 5CD3B 1MJJA 4FQ1L 2G5BA 1XGPB 3BUTA 4K23L 4L8BA 2PO6D 1F02I 4PMVA 1UWEL 4FP8H 4KC3B 4NKQB 2DGAA 3IFLL 3GO1L 2EXYC 4DZBB 2PXYC 2A3EA 5I19H 2VQTA 1HH6A 1MWAB 3CZJA 3UR8A 4GRLB 5EDXA 1HILA 3BAKA 5DYOB 3VGAC 5F9AC 3BP7A 2SEBB 1TZHA 2VB5A 3EFFA 4APQC 4QLRA 2EH7H 3FQXA 3L9RB 3CFKB 5GRVL 5DJZB 5IFJB 4D72A 2GCYA 1O0VA 4Z0BL 1HKLH 1GONA 4P23C 3QI9B 4R27A 4NKOB 4FQXC 3QWQB 5AYQA 3WFBL 2IBZY 5A94A 1J86A 5C08E 3TVMD 4Y19B 1MLCA 4YE4L 1FNGA 3MRQA 2VLJE 1AD0A 4OZ4B 1S7RA 1BG4A 4M5ZH 4G8EA 1A14H 4K7PH 15C8L 1XF3B 3GNML 3UTOA 4JRXA 4KZDL 4AZBA 4HKJA 3OLEA 4NKIL 3RPKA 1V03A 3NMEA 3QZWG 1FGNL 2GY7B 1H49A 2DL9A 1CGTA 1D5MA 5MEQB 4DVRH 1ZA3A 2VDLH 5BXTA 3VG0H 3U79A 3FOLB 2GW5A 4QHMA 4NRRA 5J6GA 1KPRB 1K9TA 5KVDL 3RZWA 1WSST 2PKDA 2Y9RT 2NNAB 4M7KH 1F4YL 3FB8B 1BZ9A 3IJYB 5DDHB 4AMWA 2FJHA 1P84J 4ZUSB 3SCMC 4QLKA 3UTTE 3QPQD 2VLKA 2EE9A 3C09C 1EEZA 4WI3A 1CG9B 4DCQA 3HC4H 3PHOB 4GAGH 5C07A 4PMUA 1PX3A 4P4RB 3PWUB 2YC1A 5C09B 1TVBB 5CSYA 4NHUB 3EUUA 3U6RA 5JIIA 5C0DA 3WNLA 3ARYA 1QFWH 4EQ3A 1D3CA 4JRYA 2FWOB 2GUOA 2CBUA 4LRNL 4PJIB 4KI5E 5IXEA 2JELH 5FA3B 3VW3L 4P7OA 5F72S 3PV6A 3JV5A 3GO1H 1YEEH 2ZCHL 3MA7A 4UB0H 4PREA 1LO2H 5F88A 2OL3H 5CXPA 2LAGB 3K3QA 4HK3N 5C71A 3QUXC 3CX5K 5GS0C 3PHQA 3Q0HA 4UQ2A 1EMTH 4UT9L 2VKXA 5DO8A 2ZUYA 5HY9A 4L8DB 4H26B 2X4NB 3C5JA 5E8DH 2G75A 3DV4B 4KJYA 2PXYA 5DQDH 4PJAE 3VM5A 1A7PH 4LYQA 4L3EA 4ATDA 2YWYA 3PUCA 4MS8C 4YDIH 4UQDA 3QQ4B 1CF8H 1ZT4A 1IGFH 4BM7A 2XZQH 5CJBA 4LARL 4XCNB 1TVHA 3OAUH 1ZB5A 4JFEE 2H26A 3FT2A 4WI5A 5E94B 3PIQA 3SKMB 2FSEB 5MENE 2WKLA 2COQA 2IXVA 2AJVL 5E2WH 5C0JB 3KJ6L 4HX1A 5EUKB 1HXYA 4LAQL 5DT1H 2PWGA 3PZGA 4CVWA 4IISA 3H0TA 4BKLA 3QIBD 2WNWA 4K3DL 1INDL 1JHKH 5EPMB 3ARDB 3HUJF 5J0BA 5I1DA 4WRLA 3SEPA 3BH8A 4OUOA 3TZVA 4H0HB 1NCAL 4XP4L 1EGZA 5SV4A 5F3HB 3F5LA 5KSBF 1MHEB 1AQMA 5KAQG 1EVTC 5T3XH 4I3RH 1RZ8B 4PJBE 3VPLA 4JO2H 4WGVB 1BGXL 1BIHA 3O9WC 2QLVB 4CBPA 5DQ9A 3C08H 4JPVL 4EIZC 1KUMA 1QHOA 3GSNB 2KQNA 4MS8D 5DS8B 2JF1A 5HHNB 3N15A 3B9DA 2P5WA 5IV2B 3AS0A 3PZOA 1E73M 5HI3D 1NQ6A 5T33L 1JI2A 1ZK9A 3JVGC 1YJDL 3QQ3A 4XC3L 4XC1L 1HQ4B 3RU8H 1NUDA 4G9FB 1FG9C 3D18B 3W24A 4R8WH 2FSEA 4PRIE 1EZVY 1UCBH 4H0IA 3LKNA 1FYHB 1AIFA 4IRSB 5EWIL 3OG4B 3HCVA 3QDJD 2HFGH 1ZHBB 2VDRH 5GS0L 5HXMA 1UH2A 5EPMA 3W81A 3B2UC 5A8NA 1N5YH 3SDCD 1A1NA 4PS4L 1N5AB 4TNWK 3CUGA 3D0LB 1MCFA 3FB6B 3NIDF 2XA8L 4LCWA 3X3GL 5GNYA 4MA8L 1DQQA 3LEYL 3QPQC 4RMUA 3SQOH 4KMLB 3P77B 4HIIA 5C7XH 3HHRB 2IADA 3DOSA 4J3WA 4UFMA 5MENA 3RHWK 5GRXG 3U9PH 4LLWA 2Q20A 1S7WA 4UINH 1FA2A 1VEMA 2D7MA 4M7LL 4AG4L 2AXGA 1U3JA 4WW2A 2EDHA 1JGLH 3MV01 4OZHA 5DRWB 4Q2ZB 5FA3A 1ZLVK 4OKVB 3VWJC 3TZVC 1NM9A 2G3JA 2FBJL 1RD6A 4KJYB 5FGBA 3IYLW 4PB0H 3BKJL 1OAXH 2ERJC 5F1KC 2ITDB 2VAAB 3KPSB 1NAMB 1HYSD 5ICZB 3BLBA 4FLOA 2OWXA 2I9TA 4M3JA 1KLGA 2BSSA 1XF5A 3QEHB 1JF5A 3MCG1 5IHBA 2IBBA 2X8RA 4Q0XH 4OTXH 3GBMH 3IGAB 4RIRA 1D5XA 2NNAA 4UQ3A 1GH7A 1OCWH 5GZNC 4HU8A 5FF6A 5IQ7L 1FORH 2ZKHH 4JJ5A 1CLOL 3S2CA 1A7BA 1PEWA 1AQ0A 3BCFA 2DKSA 3LH2L 4NO3A 5FYLL 3IU4L 1E70M 1TNMA 3BN9D 5HYSG 5BXRA 1Z6JT 4DKDC 3NN8B 1IM9D 2FCBA 4UTBH 4X7DC 1KLUA 3WV0A 1NKOA 3QUXA 1ACZA 2W60B 3GMQB 4NIKB 5MP6H 2B31A 2OR8A 5ESQB 4Z18A 1FH9A 4MX7B 1A7QH 1EFXD 2V5TA 2AK1L 2B20A 3UJTH 5DUBA 2OP4H 5B39B 4PJ8C 2ZUVA 2PN5A 1JL8A 2Z35B 2ATPB 4ZTPH 2H32B 3OGRA 2ICEB 4GMTH 5CJ5A 5I16B 4Z0XA 4GSDL 4JRXE 2X40A 1IKNC 3I50H 4LLMB 1FHGA 1G7HA 2X1OA 2B0SL 2FD6H 2X1IA 3TJEH 4NO2A 4UFKA 1N0XH 2AAVA 1BWWA 2YD9A 1U93B 3KAAA 3F7VA 1UWQA 2PF0A 3MRPB 2NY3B 1F90L 2EEBA 3GJFH 2F2HA 3F8UB 4OF0A 1Q0XL 2NY6B 5CJOL 1H15A 3QI9A 3I6GA 2LAAA 4S1QL 2VX7A 4I4WB 5T5NG 3L95B 3UC0L 2JIXB 3OGSA 2HT2C 4XPTH 5GNXA 2QPUA 1NP0A 2P8MB 4UDUB 3NAAH 1CFSA 1JRHI 3QDGE 3A21A 1GJWA 1WBXB 2OR7A 5GRUL 1FVCB 1KT2B 32C2B 5J13C 1Q0YL 3FQUB 3MRCB 3DROA 5D6DA 3TJEL 4V1DB 5D96C 1NGYB 1QSFD 5FYJL 5BXPA 4ZOCA 1KJ2A 2BVEA 1RJYB 5DLML 4ODXA 5EU7C 5L9DL 2VZSA 4F7TA 2OJEA 3WDPP 4F7PB 3G08A 3BP6B 4L4VA 4OI8A 1JTTA 3VXMB 1BD2B 1QLFB 3F6IA 3M7SA 5H35B 5CBEB 3H9SB 1NDGB 3NFSH 1IGJB 5HDQH 2XICA 1C8YA 3MMDA 3A3HA 4ZS6C 4MAVA 3NA9L 4PP1D 3DWTA 3RNQB 3OZ9H 1UXSB 3CHCA 4Y2OA 1OAYH 4NSKB 3EYFB 1LO4H 4RFEB 4UTBL 5C0CE 4GW1A 2B7DT 4JQIL 3SOBL 3RMEA 3BPOB 43CAA 4OAWB 1PYWA 2YA2A 4OLVH 3KPSD 3TO4C 3O2DH 1MCRA 1KTCA 4PJXA 1FFPA 4OZGA 3QUXD 5BO1L 1HINH 1UM6H 5C0BE 4GKLA 4KRPB 4MDJA 5GSRA 1AKJB 5BROA 3QG7H 3UTSB 3IFOA 4X99A 1XD1A 4F2MB 4XXDB 4RGNB 1MCDA 3ULUC 1DBKH 2DSWA 5A2IH 4S3KA 5KS9A 2NQCA 4IRSC 1F2QA 4S3JA 1AHWB 5JOFA 3EYFA 1ZT7A 1EIBA 1QI4A 3LEVH 2PB1A 3CH8A 4BQ2A 1YUHA 2FBJH 2F8OA 2DDQL 4QRUB 1WE5A 5I2IB 5D6CA 5DJCB 5HVHC 1J1OL 1F3RB 5GGQL 1BD2A 1JUFB 4UINL 5CIPH 1YMMD 4HZAA 2EKJA 1HDMB 4AMKH 2O5YH 2B1AL 3Q3GB 5HHMD 3HA0A 3KS0H 3S6TA 3W9DA 2JB6B 3UTZB 1D6EA 1FAIH 2C5DC 3VXRE 4PJHF 4QXUL 3C6LC 2F18A 3QIUA 2HFGL 3BVWA 3ULSB 3RZCA 2GJ6A 3KJ4C 1MCKA 3A67L 1JNNH 5TJWK 1BAFL 1RZKH 4JZJB 4GI6A 1IAKA 3NABL 4F9JA 3GSVA 3CUPA 2AKRA 3DV6B 2BNQA 2WWMD 2X4RB 4JM2C 4TYUA 1DLHA 5DVKA 4DKFH 5ACZB 2WHKA 1AGBA 3QDJA 4YFLF 3GH7A 3UPRB 1EXUB 4R96B 2V3GA 1NCNA 4OF6A 3MKKA 3U46A 3MV7D 1W1YA 4AZ5A 4Y5XA 2A9NH 3TBWA 4GQ9L 5IVZA 1QNZH 1K2DA 1A9EB 1PY4A 5ANME 3K2UL 4QRQA 1EOKA 3FRUB 2VUYA 4UUJA 5IT2H 2G8ZA 5KVGL 1J1XH 3MFGB 4YDJB 4YBLB 4U1LA 3A24A 4V1DD 3CIQA 2Z4QB 5LBSH 4NBZB 4UIMA 2J12B 3C8HA 4NZJA 3PWPB 3EYOA 3MRPA 2ZOXA 3DMMB 4WHYG 1IQDB 3ALGA 3PZVA 5D7IF 5E6ID 1K3ZA 3OR7A 5D8JH 5IROA 3SUSA 3I6LD 4XPHH 1JHKL 1GOWA 1W8NA 3LZFH 3HE6C 2UUDH 4PJ5B 3OAZH 1XR8B 3UR7A 3O8XD 1AQDA 3RGVB 5I30L 1T7XA 1WO2A 4MD4A 4JFVA 5DUBB 1H9VA 5E2TH 4LARH 2EDEA 3Q5OA 4Y19D 4YHZH 5DJ8B 1CR9H 3WY2A 2HFTA 1IGFL 1F4HA 1UZ6E 1BVKA 2WSKA 2ZG3A 1MWAH 3EHBC 4RIRB 1F6FB 1UR8A 3BGMB 3MUZ1 1GZPB 2IBGA 4PYHA 5IMMA 5HHVL 3C8KA 2EAEA 4L5FL 3UDWA 3QPXL 2UVEA 4ZS7H 4OM0H 3W39B 1WV7T 5SX4I 2E9LA 4ZQKA 3U36B 2DLHA 4NC2B 3B8SA 1OGBA 3PWVA 5E2JA 3REWB 3SDYH 3U9UA 1T80A 4N0UE 2WMJA 3QUYA 5C2BH 3ARBB 5IMLB 1A1OA 4KROC 2NPLX 2XTJE 4G8FB 1I1FB 3TP4A 1VCAA 2EXWD 5IVXF 3U7WL 5EBGA 5I66A 1PW3A 1Q9WA 3DVFA 3RL1A 3W2DL 1UWXH 4DN4H 4OZIA 5C6PB 2X70B 4O9HH 3RIAK 3VFSB 4NT6B 1D5ZA 2MSPA 2R1YB 4XP9L 2WC3A 5J4MA 1Q9LA 1S5HB 1FCCA 5HHMB 4WUKL 5E2UH 4LPTA 1UXSA 4IPNB 4X7SH 4U6YA 4WWKA 4CU7A 2J88L 3D1MC 4L4TD 5CP7A 2DI9A 4K7FB 5MENB 5AWNH 3MUGB 4KRNA 2X0HA 3K8MA 1HJVA 3MV9E 4BQBA 4AD5A 1QLFA 1RUPH 1P4LA 5DD0H 4BFIB 4J28A 4P2RE 4NN6C 2NY6C 4NM4H 1UACH 1UKQA 4XVJH 4NCC2 5T3XE 5F6HJ 3VRIB 5GSVA 5GZND 3AIVA 4YE4H 3HU7A 1G9HA 1V7MH 5ID1A 4OFKA 4O51B 5IMOA 1E5JA 3DURA 4LNVA 8FABB 5ACLA 3O45B 1OGAA 3CMOH 3MV7B 2E27H 4OLZH 1UEMA 4N8PA 5C3TA 1NSNL 4Z0BH 3QIBB 3EZJB 5GJSL 2WANA 5K59F 3EOTL 2R1XA 4P3DB 5HDBF 5I77A 2X42A 2Y5EA 4U5KA 1FFOA 3WH6A 5EMYA 3ILQC 1NMCC 3B2UD 1QX1A 5EC2A 4FXKA 4HPYH 4ZUVA 2VIRB 2X05A 4JO4L 2VZTA 1Z9LA 1W1VA 2J4WL 1IAOA 3TC9A 3BYYA 3C60B 3HLAB 3C6LD 3WMSA 1LMKA 3S37H 3D2UA 3VDAA 3ZE0F 1SR0A 3GBNH 1NC2D 1Y6KR 3MZTA 2XGIA 2IPTL 1TZ7A 3IXTA 4IHOB 3V8CA 1OT1A 4HJJL 3CLEH 3K2UH 4GAJH 5T5NF 3V6OC 3LMJH 3SBWA 1TZIB 2J5LC 5BZWB 1I9JH 4L8CB 4GI9A 4DK6A 4O51A 4LLUA 1G9NC 4RAUA 5IFPA 1JHLH 4LPXA 5DD3H 3AC0A 2IC2A 1FFOB 2H32A 4BSVB 1YNKH 4UMGA 1F97A 2Q76A 3MXWH 4FG6C 3O2VH 4MLSA 5I1CH 1HYSC 2Z31D 1EERB 1H3VA 2YZ8A 2WKGA 3WNKA 3H0TB 3HTLX 1A3RL 5GGVH 4BKLB 4TTDD 5BRZB 1HXYB 3G6DH 1G01A 1TQVA 4NI3A 2WMHA 5A6BA 3FCTB 1L4IA 3B3IA 3NPSB 1HWHB 3WIHH 1YC7A 3A67H 4IRSD 4PBWD 2WIIA 2VLME 2YN3A 3NACL 5E95B 1ITCA 4XNYL 1NLBL 4PJFA 1F58H 2OJZL 3LPOA 5A16B 3UG3A 3WE6A 4QXUH 4EKJA 5LQBL 3U83A 4TOYL 1MW1A 1DUYA 3TA3B 1X4XA 3MBED 2JLLA 3H7BA 2HRLA 1TCRB 1E4XH 3CJJA 1KYOJ 3L7EA 5I9QB 4CJ0A 1OAZH 3QCUL 4YBQC 2XWJA 4F8QA 4TULH 2P44B 1JPFA 4AIZB 5DDHA 2E7LC 3D25A 1HIMH 4OFIA 1VHPA 4MAYB 4N1CA 4L4OA 2ED7A 5JQ6L 4U1GC 4K3EL 3PTKA 2ZPKH 2DEPA 2Y07H 1MQPA 3RWDB 1TVBA 3QSKB 4OIBA 4UAOB 5D7IE 4PGBB 4CDHA 3MV8A 1YY8B 3VXPA 4YHGA 4DOHE 3CC5B 1YN7A 1E4WH 3BP5A 1V6UA 5GRJL 1DBKL 3IRZA 4I18B 3SO3B 1JP5A 2G9HB 1GJIA 1MJ8H 1M04A 1A1OB 5DWUH 3S34H 2ARJA 4KPHH 1J88A 4BZ2H 1JWMA 1DUYB 2CK0L 1HKMA 1E4KC 1HL8A 3D5HA 3RGVA 1OGGA 5D1QC 1DQLH 2XQBH 1KEMH 3PL6D 3RIFF 1FSKC 3WHXB 5IMMB 1NAMH 5I3DA 1FQ9C 3LHPH 3L9RA 4OZFH 3NTCL 3WN6A 2JIWA 1PX4A 1ZLSH 1U95A 3CPLA 1VKXB 2QADB 3WO4B 3G5YB 1ZAGA 5D7JD 4PGCB 3V6FA 1E6OL 1QSEB 4Y7EA 3EYOB 5I1HH 2GITA 1L7IH 1OQXA 4X6DB 2C3VA 2MQ0A 5ICYB 4L9LC 3WFZA 4XP6H 1HSAB 4FQJH 4GAFB 1V02A 3VSUA 1HNFA 4HZLA 3MRLB 3BUPA 4YXLL 2G5BB 4OF7A 4PIRF 2FDBP 3IXTB 1YPZA 4NKMA 2BVOA 4M48H 4X5WB 4AENA 4G5ZH 1P6WA 2AEPL 3L4TA 4KQ4L 1UJ3C 3MV7A 2VDML 3STZA 2ZNWA 1DWAM 3QUKB 4OOUA 2R56H 1TLKA 2YSSA 5CSZB 1MI5B 3HUJB 5JHDB 2FX8H 4Q6IC 3TA9A 1NWUA 5K9OB 5EC1A 5DRNA 1DSFH 1I4FA 25C8L 1G5AA 4RZCA 4OD1L 2FECL 3WIHA 3GHBL 5EUKA 4HKZA 5B38A 4MXQD 4AK1A 2Y23A 4HOWA 3H9SE 3HMXH 4XNQA 3SGDH 3WKMH 4MSWB 4LSPH 1D6EB 2P45B 3M1BA 2K7QA 4GXPA 1RZFL 2CDEB 4NHCH 1ZT4B 1XSKA 2AKRB 3DV6A 5B4MD 4GMTL 2ZX7A 5JPNB 3SUTA 3GSVB 1XH2A 4PTWA 1SBBA 1Q9LB 4FNLH 3KDMB 4RWHA 1DTUA 4TSAH 4YFEA 5D2LB 4D0BB 2YDSA 1AY1H 1BFSA 2JB5L 2JEQA 4I2XA 2EDYA 1OP5K 1HVXA 4PRID 1DQMH 3KPLA 5AYUH 4JIEA 4NYLA 1IVLA 3VWJD 1YUHB 2VXTL 4ZSOE 5A2KH 3IU3A 4XTRD 5SWSA 4P23D 1HJWA 4HUVA 1KCSL 4JDTL 3S3JA 3WN5B 5CBAB 1JPSL 1GQJA 1A4JA 1WZLA 3LH2H 3PWVB 4U05A 5EH1A 2Z92B 4W6XB 5FKAB 2ZOKB 2QQLH 1GHFH 4UQAA 4KRPD 2OYLA 1WBYA 3EO0B 5F7FA 1ZJBA 4OUUA 2DT3A 1I1FA 3L4ZA 4MNHA 3AS2A 1G7LA 3W37A 1FH8A 4PJ7F 1VPOL 2HJLA 1QEWB 4JM2D 4HXBL 3SKOA 5D8WA 3U4EA 4ALAH 4F37F 1ITXA 4LX4A 2VX5A 3SDCC 1YEJL 3DSNA 4XPBL 5JMRA 4XNZB 1P6AB 3RNQA 3BSGA 1A6ZB 4JKPH 4HLZG 1HKFA 1XR8A 5ADOL 2AEWA 2F54E 5E1AA 2EXOA 5CBEA 4NZUL 3OGCB 1TJGH 1ES0A 5A1AA 3V6OE 5CBAA 1CFQB 2DD8L 4NZTH 3PQYD 3LVEA 3WFDH 5IVXA 1QSED 3R1GL 2RFXB 1BWMA 5IQ9B 4W93A 3TYGL 5D2NB 3X3GH 2XA8H 4UQ9A 4B0MM 3QRGH 4PLJC 3X3FH 5F6HI 1I3GH 4D9LH 2XQYG 2YBRB 4MHHG 5F96L 2XZAH 3WEOA 1DBML 5EWIH 1DUZA 2BSTA 3BUQA 4FNPA 2L4OA 4L4VB 5DHVH 1U8PA 1NBQA 5EC1B 1QOXA 1V0LA 1ZBKA 4YHEA 1UWXK 4Y5XB 2FDMA 1S9YB 3VXSE 3HUJA 1W0VA 1FVDB 3MRMB 5EBLB 5C0IB 1JWUA 1S7QA 3MNZA 3U1SL 4H7VA 2ZXQA 3PWPA 5HHQB 1B3ZA 2C7UB 5FIEA 1NGQH 2NXYD 4MSWA 4JANA 4NKDA 3E0GA 3VG9C 2AJUL 3QEQE 2O61B 4U1LB 4G6AC 3LXBA 3RIKA 4QF1A 3L7FA 3MNVB 3IAQA 3GM0A 2MCG1 4U6TA 1E28A 1S7VA 4PB9H 1U8PB 3OL2A 3UO1L 1B4JL 3QUMH 2VVSA 5C8JA 2UY3A 5JIWA 3AB0C 2DPEA 5LG1A 2R4RH 2NY5C 1E27B 2AQ2A 4I3SL 1SJVA 5IGXH 1CLYL 5DHXB 4NKDB 3UTZA 1DQDL 5HJ3A 4U4BA 2Z35A 5HHQA 1SMOA 5TH2B 2EYSA 3T77A 3HZKA 4KI5C 4XV0A 2AXHA 4DWSC 2AABL 2H2PD 4WLCA 5IG7A 5EOCJ 1ES0B 4QLLA 4F66A 3ARFB 2KPNA 4HZ6A 4X6DF 1HH9B 3QYCA 1UA7A 2DLFL 2Z9TA 4PMDA 3HPJA 2DDXA 2E6JA 4FQIH 1U91B 1DJSA 4OQ1A 4LAQH 5DT1L 3VWJB 5C9KA 2XN1A 3IT8D 4HG4K 3RDTB 1J8KA 3IDMB 2VI0A 4X6DA 3DO3A 5A69A 1MPAL 2BFVH 3UJIH 1QSEA 5CIPB 1ZA6B 5DD5H 5H2BB 1HDMA 3ZDXE 2H32H 5T1KD 5L88L 3GGWA 1H09A 1GPOL 1T1ZA 3V0WL 4L29B 1JPGA 5DQJB 3LKQB 2OTUA 3MANA 4OJFL 3QHZH 4F2MA 4Z7VE 1YEIL 1T6VN 3KPQA 3BVNA 1YC8A 3LEXA 1K8DA 1KLGB 4BFBD 1CICC 2J79A 1FFPB 4OZGB 3MRRA 3P4NA 4GG8B 4UU9A 4ZAKA 3VFMA 4NQCB 2NLJA 4ZPTA 4PYSA 3BN3B 3P0VL 1PYWB 3GIZL 4S1RL 3N11A 1JPTH 2WIMA 4FN0A 3FN3A 5ITBH 1OWRM 4FQCH 1N64H 3SDDA 1JRHL 5FUZH 3I3BA 1OT2A 1YEIH 2DIBA 5IHZB 1P4BH 4FZEL 2WWCA 1D5XB 1UQZA 3WMCA 4OD2A 4Y0GA 4HS6A 3KPRA 1QACA 4YDLC 4F80A 4GG6A 1QQDB 3RJYA 3IFOB 2HVKB 5F7MC 3WO4C 1INEH 3S88H 2R2HA 4XGZA 4ZNEE 3P77A 3MYJA 3TCXA 4QHLA 3V4PL 4LK4A 4H0GA 3WN5A 4Y5YC 3Q1SL 3EIFA 5DJ2A 1GHSA 4CN4A 3FRPG 4FQIL 4RFEA 5E9DA 5I1EL 2VLLA 1KB9J 4M9OA 4XMPH 4R7DB 5FM8A 3HI1B 3BPOC 2WIIB 1V8HA 4CCDA 1KTLA 3BD3A 3LN5A 4MD0B 4M1DL 3D5OF 1XH0A 1NARA 1LQSR 5I8CB 3WF1A 3IDXH 4G9FA 2PR4L 4Y5VA 4D0BA 3SE4A 4ENEC 3RFZC 1PD6A 1HXJA 4P7RA 5FOBB 5BV7L 1MCJA 2GSGB 3G6JE 4KKAC 2UVFA 2MKWA 3KPOA 1HWWA 5SV3A 1MI5A 5JHDA 2ZUTA 5IGXL 3RX5A 4PTTA 2F8VA 5C3LD 3HCVB 5F93C 3PZUA 4HIXL 2VDOH 4YBHA 1UVQB 5GGRY 5BZWA 4L8CA 4UFLA 1P84K 5I17A 1H3TA 1JMZA 4M6OH 4HCRL 5DJ0B 3PL6C 2GYSA 3BGFC 5HHXL 2V3FA 1G0XA 1ZLWK 2MJWA 1HEZB 4PRPE 4RE3A 4P8XA 5JR1L 3MRGA 1B3WA 4MDPA 2DQCH 4JY6A 4P8WA 1RUAH 1BJ8A 3VDCA 3DX3A 3ULUF 3L95A 2PO6B 5EN2A 3FNDA 4IOFC 4XX6A 1LDPL 2AOSA 4R7NB 1AJ7H 4KTEL 3VIIA 4I77L 3U5YA 1C5BH 5I1DB 2DQTL 4FRWA 4WNQB 5DJDB 4Y19E 5A3ID 1H3WM 2IGFL 1T4KB 3L3GB 3D2UB 1IZKA 5M17A 4YBQD 3QHNA 3N9GL 2R8SL 1IAOB 2D0FA 1OSZB 4HWEL 4W5ZA 3OQ3B 1XCTB 2CXGA 1WGOA 1T89C 5HPOA 5AZ2L 5ICYA 4D6DA 4FMFA 1OCQA 1NUGA 1HF6A 4NO3B 5I78A 3UCQA 1LWHA 4R9HA 1F2XK 4F58L 3O6AA 2BSED 4PGCA 1QLEH 3V6FB 1HYRC 5T3ZH 3RJQB 2X1WL 1E1FA 3C5JB 1DE4B 5HVWA 2VC2L 2YMXL 1KC5L 2Y1VA 2H9GA 2EDXA 1TVHB 4D0CA 1FH7A 3FFDB 2NTFA 3CU7A 2O5XH 2GJJA 4I0CC 1R3KB 1P7KA 2BJML 1V3IA 1SMDA 1HCVA 4JPWL 3PWNA 4BZ1H 4HUWA 3QDHA 3QHFH 2JJSC 1FHLA 1W1PA 2XN2A 2VISB 5DMIL 3KPPA 4DO5A 4XNMA 4QYOA 5GNZA 4C56E 2H8PA 3PWLA 4HGKC 2OSWA 4CRPA 5TDOA 4P2CG 5A8MA 1RY7B 1KJMB 5T5FH 3VUPA 2YKLH 4EI5D 1N6QH 4QCFA 2WHMA 3MV8D 2AP2A 4OCWL 5JDSB 2NW2A 2X4OA 2W65B 3QULA 4Y1AE 2X09A 1E5NA 3KPPB 2DTSA 1QBML 4EUPH 2AW2A 3MJ9L 3T2OA 4QTIL 1I75A 1KR0A 4QOKA 4JVPA 3NIYA 1PQZB 4LSTL 2Y5TA 3BVNB 4R90H 3BDBA 3JTSB 4GO6B 2A6JA 5IW1A 4CDGC 1W2KT 2H8PB 3P30L 3C5ZD 4HWBA 4L29A 2Q87A 1TCRA 1KTDA 3VFPB 4CVZB 1PZ2A 5DEGA 5BRZA 5I1KH 4P5TC 3INUH 2V9QA 1Q94B 3NCEB 5C0AA 4WY7H 5H2BA 1TTFA 5BYWA 1TCMA 1R3KA 4LCUB 4PJFB 3V7AE 3MLXH 1ADQH 2XFXA 2IFFH 4O4YH 5K9JH 5HDLA 3QFJD 1EPFA 3K1DA 4D6FA 1KYOK 4D0CB 4HPHA 3UZVB 1INQB 25C8H 4OLXL 5FV1L 5ITFB 1W9PA 3BGMA 1YEGH 3OXSB 3IETB 3QA3A 4HIJB 1KJ2H 3D18A 3MV9D 4CCCA 4PJBF 4DKEH 3MOBH 3A5VA 4PMNA 3HZMA 4OBSA 2Y36L 5IG7B 1FLTX 3RWHB 1R3IH 3OA5A 1A9BA 3JSSA 4YC2C 1RURH 1HHGA 5D7JB 1WC7A 2PWHA 2RB8A 5DHVB 4WUUD 1MHEA 3BQUB 3G5VA 3DVGB 1KTRL 1MAMH 4HG4J 4MMZC 5L2JB 3BDYH 5JPMB 3BEVA 4YXKL 1OBAA 3SE9L 1KJVA 2D7NA 2I60H 2WQRA 5F1OB 1T21B 3FO9B 1AR1C 2EEDA 1CU4L 4E42A 4XBGA 3EFFB 3D2UD 2GJZB 3MLPA 1K2DB 4Q9QL 2WMPA 4NCDA 4M1CC 2XVLA 3L4WA 4QRSB 4DN3H 4LLVA 4WO4D 4DGIL 2K3TA 3RUGF 4DW2L 2ZE0A 2DI8A 2HWZL 4KZEL 5I1HL 5F3HA 4IMKC 2E8ZA 1JNDA 4PLKD 4EDXB 4I1NB 1QNQA 3PZIA 4TRPH 1A3HA 4Z7WA 3KXFA 2EEAA 2X4RA 3SDAA 1WZ1H 1XH1A 2BNQD 4Z2KA 1T20A 2WW5A 4OLXH 3N9KA 3CD4A 1FVEB 2CGRL 3D85A 2XQBL 1V3LA 2OCFD 2HRPH 4ODTL 4FTVB 2B5IB 5CP7B 3PP3K 5I1LB 3WEZA 1DZBA 3JWDH 2FR4A 5F1IB 2YL8A 1X5XA 5INDA 4YXHL 3SDCB 1P69B 1MJ8L 2PXYD 1IAKB 1T1XB 1ONQA 3N1MC 4K8RD 5KN5A 4BSWA 1H2JA 3SIMA 1W0WB 1KPUA 3C09B 4NQED 4Z2LA 4OLUL 4S1SL 5TF1H 4WEMB 3RNKB 3MUGA 5A3HA 2Y24A 3F4VA 1FNSH 4KVNH 4KTDH 3VXUB 1KTLB 4LU5L 4HFWB 1KB9K 4UDTA 1JZ2A 3K4AA 4PLKC 2VZ3A 2HMIC 2A9MH 3QUYB 4ACYA 4JFTA 4GXVL 2YDRA 5I79A 2FWOA 2VKWA 3KS0J 3REWA 2IMNA 1MY5A 3GMLB 3B2VL 2CPCA 5I1JL 4Z77B 3SGDI 3OV6A 2H1PH 3VFSA 5J12C 4ZFOA 4OUUB 4OZIB 5I2IA 1KQYA 1E4XL 3HE7D 1OD0A 2QQNL 3UTSA 4K71C 4ZUUA 1NDMB 1XH3B 2HP4A 3MCLL 4P7LA 1W0YT 2DBLH 4LKCA 5DI8B 5I8KH 4X98B 4OV5B 3NDYA 1F58L 4GUPA 2Y8KA 3FOLA 5I1AB 1ZA3B 2OXGA 3NGBB 3CV5A 1ZA6A 1YEDB 3WIHL 3ZR6A 1NCTA 4N42A 1QZ1A 2NY2B 2IH1B 4GAYA 4V2BA 3X12B 1AKJA 1CE1L 2OR9H 1IM9B 5D4QA 2C4FT 5MEPA 5L7XH 4BA0A 2QQKL 2R4SH 3I2CL 5DR5L 4NQEA 4P59L 3G08B 5EIVA 5HPMA 1PPIA 1J9CT 3KR3L 1S8DA 4U3HA 1BBJA 1HILB 3L5HA 4X6BA 4C59B 4P7QA 1W3HA 4WI6A 5F71A 1QSFA 2R8SH 4NJ9H 4HOXA 3EDFA 1J8HB 4X8XA 3P0YL 5HBFA 3T65B 5H35A 5C0BD 3FT3B 4Z95H 4DFIA 1MRDL 1EBPA 1SM3L 4XMKL 1G6RL 2A6IA 5CJQL 5HGDA 1A4KA 3KPNA 3OHXA 3WD0A 1FP9A 3UJJH 4IDJL 1H0DB 3B43A 2VDQH 3R06B 3WNMA 1TUXA 4P4KA 2D7TH 4XWOD 5FKPB 3S35L 3UTPD 5HI3C 1LF1A