1CXFA

Complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 227
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxfA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxfA01
3LIZL 2NZIA 4NOFA 1Q9LA 1R24A 3ZT7A 1L6XA 5I75C 4OF7A 4B15A 2AGJH 1N6UA 1N2RA 4DO6A 3DX2A 1SY6L 3LKNA 4H8VA 1A3QA 4YC2C 3AMLA 3G08B 3KYOB 1VERA 3H9HA 4LSVH 2VZ1A 3G5VA 5GHWL 3FN9A 4OQTH 5EG6C 4TRPH 2YKKA 1YZZA 2F54E 3BUYA 2VT0A 1BGXL 1AE6L 2EDYA 3QDGD 5DJZB 2A6IA 3CVHB 4WU7A 2O61B 3IU4H 3QCUH 4U6VL 4UU9B 3TT3L 5JLZB 1MUJA 3KAAA 3P77A 2A0LD 3OG2A 3EYOA 3UCQA 1GRWA 3MV8A 5E8NA 4K3GA 3RQ3A 3JZ7A 4ONHB 4LRNL 1IGML 4C56E 4MS8D 3T2QA 3UYPA 3RI5K 3KPPA 4RRPG 3DJ9A 3GH5A 3BT2L 1AGDB 3MBXL 1M01A 1U3YA 1XF5A 3EYFB 3TFKC 4DOHE 3CIQA 4O5LL 3EFDL 3ZSSA 4H41A 1IAII 1PSKH 4NKQB 3DROB 3VFGL 1LF1A 4JQIH 1CBGA 4L29B 4QTHA 3TESA 2DGAA 2OL3H 1RU9H 1H3UA 4JFYB 4JO4H 4XPGL 5B3JE 3FNDA 4ATLA 5JA9A 1LP9E 3O4LD 2IFFH 2DLIA 1S3KH 4IOFD 2FO1A 5ACMA 5ID1A 2BXZA 1M53A 3VILA 3GKWL 3LXCA 1MNUL 4ZFOB 7FABL 4PRHD 1B6UA 3B5GA 5IGXH 2VDOL 3U7WH 3AU1B 2NY3B 1WAWA 2NR6D 3FZUC 3CNKA 3CZJA 1LEIA 2DMCA 4AZ7A 4M80A 4Q74A 3ALGA 2WW5A 3B4NA 4ZXBC 4OFKA 5GZND 3VRIA 4JG1H 3AXLB 4HAGA 3BAKA 2CESA 1W3HA 1WITA 2VE6B 3GZAA 1FL3B 1GPOL 1V7NH 3O2VL 5HHQA 4UT9L 3F7YA 1PZUB 1TETL 3U57A 3QOMA 2OSWA 4L3ED 1XCXA 4ZPTA 1ONQA 4A6YL 5GJTL 4J6RH 4M9PA 2WMIA 5D1QC 5DD1H 2B4CC 3KPNA 5K9OB 4X6DF 3B9KB 5INCB 5C71A 5FECB 1HQRA 4I9WD 3NUKA 5D2LB 3LKOB 5A2IH 3QUMB 3EO0A 3WJJC 2E3VA 4NFCA 4F7MA 2DQHL 1OCQA 3N06B 5H35B 1ZVSB 4HD9A 3WFLA 2V9RA 4BQ3A 5K93A 3RGVB 5HHPA 4JJ5B 2WBGA 5C0CE 4X6FA 4GJTB 4R4BB 5IVXF 3PZNA 4HHAB 1VFBA 4LCWA 1AQ0A 2VXSH 1KACB 3QB7C 1H3WM 1T7XA 2R8SH 1WWCA 5I71B 4NQVA 1DCLA 4MJ5A 2ESVA 4WUUB 4FFZH 1EJOH 2Y2WA 1OP3H 4X0VA 1X9QA 2EPNA 3SO5A 5IB3A 3P4MB 4Y4FC 4X0NA 3ULVL 3DNKA 4PJBB 2OXHA 2W9EL 2WVSA 1XGTA 3D18A 3Q0HA 1JHTA 1ED3A 4JL2A 2H6PB 1W2PA 2O9RA 5HI3D 5F7WC 4KKAD 1US3A 4YHOH 1JZ2A 4NN7B 3BZDA 5K9QI 4R27A 1XIWC 2OR8A 3RWDB 1HJVA 3MCG1 4M61A 4M7ZB 1MY7A 4DWSB 1HSAA 2EQDA 4E4PA 5FOBB 3THCA 2JJSA 1ZVYA 1GGUA 4Y5VB 1ITBB 3T0EA 1JDCA 4YDKL 1SYVB 2DQUL 4UV7H 1J01A 4JZJC 1HILA 4S1DD 4MJ2A 4GO9A 1ZTXL 4KHTL 1A1OA 1J0ZA 1GQLA 5IESL 5INDB 3CZLA 3AIQA 5C09E 1FAIH 2NY4D 3GXDA 3L4UA 7A3HA 3QG6B 4TNWF 3E6HB 1U95A 3MROB 4P46C 3A67H 4P9MH 3VIJA 1S7QA 3S88L 1BREA 1JUFA 1TQUA 1UKQA 4NZCA 3IJ7A 4L8DB 1NOUA 1OSPL 2GUOA 1INQA 3MRQA 4APQD 3A6OA 1ESWA 4AZ5A 4X4ZA 1ZA3B 4DM2A 1FH7A 5C0FB 5IJKC 4W4NA 5GS0H 4GQQA 2A74B 1JRHI 4KTEL 4N8VB 2F53B 4NBYB 1UD3A 1CLCA 4KGJA 1TCRB 3KPSE 2AW2A 2UY6A 1HKJA 4C83B 4IEFB 5H37H 1PLGL 4OKDA 4W68A 1GPFA 2Y1VA 1UR2A 1WIUA 1P4LA 4QNPF 4XH2B 3NZ8B 1V8HA 5IF0A 4ZOEA 5F93C 1MRCH 1FO0H 4GOSA 1RZJH 3VJ6B 4MJIA 4Y2OA 2VL5A 3PDGA 4FP8L 4RFEA 2FYYA 4GUPA 1KFAL 3VWKC 3CPLB 1YJDH 5EU6A 1F3DJ 4M43H 3IDGB 3H54A 3QI9B 2XPGA 2F8VA 3RIKA 1FBIH 4WW2B 1CFQA 1PKQA 1MQPA 4YAQA 5A95A 1QLRB 3CIVA 5TGBB 1D7FA 3C60D 4P2OC 3W9EA 2BVEA 2VZOA 5KJRL 4W4OA 2AXFA 1JYVA 1I1AC 1UACL 4QRPA 1R0AL 1KTDB 3OZ9H 2NXZB 3AJ7A 4UZUA 2RGSA 1U2HA 5HDBE 1O5DT 2J8GA 1ZANL 1LHZA 5EUOE 1DANU 5CIPA 2V3DA 4NJAL 1FPTL 4LSRL 3VFWB 1T1ZA 2E8YA 1WP6A 1TDQA 3IVKA 2ZX9A 4ZO9A 2A3HA 3VXPB 3LMJH 3D39A 4JVPA 4LBEB 4RISH 5DHYA 3O6ML 2Y6SC 1GOIA 3KNBA 1GL4B 1J8KA 2IALB 1MCQA 4Y4KD 4H0IA 3UO1H 5KG9B 4KRTA 1D9KA 4S1SL 1GJWA 4RCAA 3CFKA 3B9AA 2V2XB 1GSMA 5DO2D 1GH7A 5DQDH 4PJ9C 1CCZA 1BQHG 3AZRA 1A3RL 4U1JA 5IMMA 3MXWL 1NFDA 3V52H 2BSRA 4JN2A 1HL9A 5ACZA 2EDEA 3KLSA 4P9HH 5AZEL 1RSFA 2IANA 1TMQA 2FIKB 4Z7OE 3HKFA 1G7QB 4X4YB 5GPRA 2NT1A 1NAKH 5LXGL 1G0CA 3RJDA 2OBGA 3ES6A 3RWIA 5ALBH 5F9DC 3UJTL 2J6EH 1HYSD 4G42B 1ZLWK 1W8OA 3IS0X 5AYUL 1RUAL 3VNZA 3KWWA 3BP7B 4W6YB 1T1XA 1YEDA 4XZUA 4HH9B 3LEVH 4UTBL 3W39A 2OL3B 3OR7B 5HGBA 4L9DA 3RKPA 4GRMA 3KYAA 4YEFA 1FVEA 3OXSA 1WO2A 1QI4A 3TA3B 1DWHM 3BPOB 4GINA 3CFDB 1L8NA 1QFHA 1CD1B 3BGMB 4JKMA 2YPKA 3PZTA 1MW0A 3GXPA 4E41E 3SPVB 3G5ZB 4WU5A 2R15A 3DX9A 2HVMA 2ORBH 2WCAA 3OR6B 1HJWA 4V2BA 3VXSB 5HI4D 5TFSL 4TQEH 3CUPB 4PJHE 4FZEL 1RPQA 2IAMD 4OI9A 4WHTB 5D2LF 1DL7H 2R69H 1KCVL 4J3UA 3SJVD 1QX1A 2GITA 2M26A 3FQTA 5IFHH 4X7CC 4NQCB 3DVIA 3P4OB 1A9BB 3V8OA 5E00A 2PWEA 3OKKB 3TVMB 5B39A 1WAAA 1V3IA 5J1SC 3I2CH 1OGAD 3W37A 4XPTL 2XICA 2OP4H 4M62H 4G3YL 4N1HB 1AXTL 3TJHD 3UP1A 2PF0A 3QUYA 4WFEE 5C0RL 2CGRH 5I79A 2NXYD 2R2BB 2ENYA 1C7SA 3MLZL 5F8RC 1CI5A 3SCUA 2FLRT 5D8WA 4ODUB 4LXFA 3L9RA 1V7MH 5DR5H 4N0UB 5I8OL 3I3DA 1NEZG 1FZOA 1MJ7H 1A4KA 1KYOJ 1JGEA 3TTQA 4M8QA 3VRJB 1U8LA 3QPXL 3STZB 2XZQH 3SKJL 1KIQB 4QYOA 3WD0A 2Y8KA 1C5CH 5IDIA 1WF5A 3NABL 3G6LA 3UETA 4PJBF 1YNKH 4HIIA 3LB6D 3OWEA 2CKBH 1NWTA 1W9DM 5E4EB 5HD8D 3I9GL 5LAXA 1J8HA 4DW2L 4AY0A 3G6JE 1DQDL 3BAXA 1LG2A 5CZXD 1GOGA 2VLKE 3UG5A 2IGFH 1XF4A 2WHKA 4KJWD 4HMDA 4P5MA 5TE7L 1A1NA 4FQ2L 3QDJB 1FRGH 1QSVA 4I18C 1E56A 3QPQD 3MNVB 5DTFA 1B3YA 3PN8A 3GO1H 2DIAA 1JHLL 5J9PB 3L3OA 1RHHA 3H6JA 1AR1C 4PJAB 3ZTJG 5CSBA 3QUXA 3V4UL 5ANMB 4YHYB 3CHFA 3UXFA 3DLQR 1G7PB 3VSTA 3GSNL 2JB5H 2WW8A 3O0RL 1OQOA 3MRJA 2QSCH 5HYJA 2WBWB 4HGKC 5F3HA 4ZUVA 5DD6A 1JG9A 3C6LA 4NQSA 4OLYL 3WS3A 2CHNA 3O9NA 4BSVB 1AY1L 1S7UB 4K3EL 2DT2A 5KANG 1ZS8B 2NYYD 5A2CA 1JN6A 1DFBH 2A77L 3GSXA 4ETYA 3VGDA 2G3JA 1T1WB 4HFWB 4PGEA 1XCQA 2B31A 3KDMA 4KPHH 1A7OH 2XSAA 3DO7A 4EUPG 1XCTA 5HHOE 4JFUA 4UILL 2GSIA 4MQ7A 3C8KB 3GH4A 3DX7A 5B4MD 4HIEA 1B4JL 2YLLA 4LLWA 1YPZE 4Y4HB 1G9NL 3U36A 3WD1A 4HA4A 1D5IH 1E0OB 4FFWD 3F5WA 3QWOA 1HXYB 3N11A 1XT5A 2AJVL 2X2JA 1T4KA 1W0VA 2D31B 3QH3A 3CD4A 2W0KA 1UT9A 4FQHB 1CGYA 4ODVL 3IKKA 3C09B 1J0IA 3ILQC 4KJPC 3VW3H 1AGCB 3SGEH 3U0WL 4ATDA 2FJHA 3ROLA 1NP2A 1HKMA 4G6AD 2YOCA 1E73M 1TR1A 3OKNB 3TN0A 5ADOL 3BAEL 5D1ZC 3SDDA 3FTGA 5IMLB 2P8PA 2Q7NA 2GSJA 2VLME 3O6FB 4I0PC 4ZNCD 5SWZA 4QRUA 2DIEA 4DKFL 5MERB 5IW6B 3IS1X 3OGCB 4H88H 5IG7B 3AGVA 4PG9A 5K9KA 3P9MB 4Z7NE 3EJQA 3P4NB 4LPCA 4H5SB 2FJGA 4JQXC 4MB3A 4JFPA 4HU8A 1CU4H 2J75A 4JHOA 2FBJL 2VXVL 2I26N 4JHWH 1AQDB 5EU4B 4JO1H 1W72A 1GZPA 4PJ5B 4ZUUA 3FMGH 3RL2A 1XF3A 4CBPA 3REVA 3QEQE 4XHQA 1FO0B 2DM7A 3S4SG 3KPMA 1AGBB 1JZ5A 3QO0B 4JFEA 2R0LL 4ZO7A 2ZICA 1ZT7A 2XKNB 3H3KA 1I3GL 2XRAL 1K8DA 4HS6A 1JWMA 1NJ9B 3HJEA 2VRAA 1FIEA 1R75A 3VIMA 2AKRA 3IFOB 5T1LA 3S35X 5C0IA 5KZCB 3GMPB 5FA4B 1KIRB 2GI7A 3VXMD 4AZ8A 3MSGA 2ZWYA 5D70H 3A5VA 2AK4A 3SDCB 5KEZA 1BFTA 1S7VB 2FO4B 3UAJD 4H0HB 3MGOA 4EDWL 4AXNA 1RIVH 2CCRA 2LFGA 4U1IA 4HPHA 2H1PH 4LCCA 2VLLA 1MFAL 3SGJA 2VYRE 2XWTB 3W2DH 1UA6H 4POZC 3SGKC 4LEXH 3V6OC 1NC2B 3DMMB 4ODTL 3QISA 5B38G 3MRBB 2D22A 4GG6E 4ZYKA 4LARH 3WD5H 2HG5B 2NX5D 3F65A 4JRYB 2A6DA 4JY6B 1YQVH 3UROR 4YHZL 5E9DA 1KYOK 1L7TL 4PJFF 3TV8A 1DE4B 5F7FA 3ARRA 5GZOD 2M1KA 2R23B 2Y07H 4XMLL 1JNJA 1KCRL 4CJ1A 3W0WB 4DN4H 5J6HA 2DQFA 3MV9E 4IUGA 1S8DA 3PHOB 5EBWA 4M7LL 3NCMA 2IPTH 4H8UA 2PR4L 4IHOA 1E6OH 2P24B 3P9WB 1E4MM 1FNHA 3LSOA 5MEPA 4JQVA 4U1MA 2PO6C 3DSFL 3ZYOA 4C55A 3P0GB 3HRZB 25C8L 4AW7A 4FLQA 4KV5E 3AMDA 1VEPA 5DF0A 2X4UB 1XGUB 1OAUL 2BJML 5FM5O 3EUUA 3N9GH 2BS9A 5AY7A 2GCYA 3VI3E 1ZHBB 1SZNA 4OGXH 3IDNB 2A6JA 5M7QA 3MV7D 4MZ2A 3BH4A 3QFDA 5F7NC 1EX0A 1MRDL 3HUJE 1FFNA 4CVZB 3FQUB 3PZUA 4JAMA 5A2LH 1NGPH 2A9MH 4L1HA 4XP9L 1QNPA 2R56H 2OYLA 5E09A 1X5IA 5C0EB 2AJXH 3R8QA 1C8PA 4OCRL 2EECA 4OOZA 2R2CA 3MJGX 4HXAL 1XGYL 4JPWH 2R29L 2YRLA 4PGBB 3L3GB 4YZFF 1C90A 1JGLL 2E9JA 2IXUA 1B0GB 2ZUYA 4OCLC 1QW9A 1V3HA 3UESA 2Y25A 1UWGH 2UZIL 1C93A 4NRRA 1DDHA 3POCA 3ARBA 3BP5A 2I9LB 4HUUB 3GI8H 3SCNA 1RVFH 5BV7L 1SY6A 5M5DA 3TBVB 4LEOB 3BH9B 5T1KA 4OM0L 1FL6B 2XG4A 1F11B 3CK0H 4M3JA 4KVCH 2JEQA 5TPWH 3BD3A 1KTLB 3QIBC 4MX7A 3ARVA 4LIQE 5FL1A 4I0KA 2BOBB 2RFXA 4PBWD 1G7JA 4PJAF 5FYLD 1T7VA 3MJ6A 2EDLA 3NPSC 2QLVB 3LV3A 2GY7B 2CKBB 3V4PH 1A21A 4NX0A 1H3PH 4P57A 2HT3D 3BIKB 3LRSB 2XVPA 1MEXH 5FO8A 2JELL 3FAXA 3U9PH 5HVGB 4G9FB 4GAYB 2RCSH 5C07D 4J27A 2UY3A 4URIA 5E03A 3EDJA 4XXCA 3S5LG 1G6RL 1V02E 4OCXH 2A1WL 5A40E 1MFDH 4PR5B 3IGAA 2CO7B 5E1AB 1X5GA 2Q76B 3DV4A 2YDQA 2E27L 3X17A 2APVA 3CC5A 3WYRA 1T0MA 3IYLW 4IDJL 4WEBL 4M93B 5CHNA 4EANA 1EUUA 1T7YA 2AI0L 4O2FB 4HKZA 4D2NA 5DK0A 1Z9LA 1YNTB 3I6KA 2DH3A 5LGJA 5DFVD 1Y7VA 1AO7E 3U9UB 3I6LD 1N3NA 1RY7B 4MD5A 2CRMA 1FE8H 4LCIL 2CPCA 1NCDH 2WNWA 4APQA 4P59H 1UB6A 4CD8A 1DSFH 1IAOA 4I3SL 1P6FA 3ULUL 1HIMH 5JHDD 4ZNEA 4XPBL 2MKLC 1A6VH 3VFOB 3WLBB 2FECL 2Z91A 1NMAL 1I9IH 1T66D 5CIPH 4CJ0A 2G5BA 1Q9LB 1R24B 2XN9D 3ZDXE 2DM4A 3ZDYE 4FTVD 3U1SH 3LKNB 1P6AB 4NBXB 4QOKD 2BC4A 3CSYA 3UTQA 3H9HB 4BZ2L 4ODHH 4P99A 4UTAL 4LLMA 4A6YA 2FE0A 5F89A 5JPMA 4MAYD 3WBEA 5IROC 2R2EA 3BUYB 5F3BA 2UY7A 1CNVA 4TYUA 5IKCA 4E0RA 3VG0H 2GW5A 3SCMA 2A6IB 3QIUD 3UPAA 1UWXK 1UXSA 4WU7B 4MMXC 1X3DA 2V5TA 2Y7QA 4NNXA 1KLGA 1JGVL 1A6ZB 3HC4H 1CE6A 5T33H 4S11A 4OSUH 2DD8H 4H1LA 3AYRA 1FV1A 1GHSA 3NSMA 3FB8A 4Z9KB 1MUJB 3P77B 3BGFB 4XBEL 3BMVA 3EYOB 3DUSB 4YNYA 3D50A 4LQFL 1N6QH 1QFWH 5A94A 3PIQA 4YEEA 4MQXD 3KPPB 3IANA 3K1DA 2C1PA 3QQ9D 1IC4H 2W61A 4OTXL 4Q9RL 5BS0B 1XF5B 1KBBA 4ZTOL 2NY3C 2QSQA 4XPHL 4KMTL 3MUY1 4N5UA 1OPGL 4UQDA 4FLRA 1NUDA 2OI9B 1GGBL 1MJUL 5LKNA 4GRLB 2AP2A 1RFDH 5C6TH 1MJJB 3RI5F 3Q5OA 2GK1A 4W88A 3Q1SL 4XAWH 4QXGL 3WFDL 1CFVL 1OAZH 4K3JH 3WIIH 4Y4KA 2WVVB 4JGMA 1A1MA 4NM8L 1LEIB 2VDQH 5FKAA 3NA9L 3NFNA 3KPRB 3VRIB 1IAIL 4Y1AE 3CDYA 4WJ5A 3LRHA 3B9KC 5ISZE 1MFBH 1YEGL 3F7RA 5D8JL 2DTML 2DQCH 5HHQB 4MNHA 4CU7A 3WV0A 4GW5A 2D24A 4AZ6A 5I66B 5EFIB 2DH2A 1J1XH 5MENA 3SUSA 5CXPA 1ZLVH 3RGVC 1ONQB 2CMRL 3O6KL 4FN0A 2DQJH 3RM8A 5D71H 2WMIB 3KPNB 3AIWA 1FG2A 1HQRB 3H9SA 1MVUA 5B3NA 2H3NB 3M6DA 1WLHA 5I71C 1DUYA 1BZQK 3EO0B 3WH9A 3QXVA 5GRUH 3PV6A 4F7MB 4L8SA 2NMSA 2ZNWA 4NJ9L 1BEYL 5HHPB 2A83B 4U6HB 1WDRA 4X6FB 2XA8L 4CDHA 1JNLH 4PRNB 1Q4NX 1S7SA 2DLFH 1A7PL 2ADIB 1MLCA 1PVHA 1IKFH 1YY9D 4RDQG 1GOMA 3L95A 4MAUH 1UM6L 3FFCD 3OB8A 5C0AB 3SQOH 2HN7B 4D6DA 3WF0A 4XWGL 2C3XA 4NQVB 1WBYA 4MJ5B 3GNRA 2ESVB 4NYLB 3SJVA 4NN7C 2X4PA 5DURB 3S36H 1GHFL 3NA4A 2EDWA 5IB3B 4JFDB 1YYLH 1JXJA 1VEOA 4M7ZC 1JBJA 1OGAA 2ERJB 4YBQD 4WI6A 2J8UA 4UCFA 4DWSC 3A0OA 1BWWA 1KEML 5F7EL 4KZEH 4XP6L 3HHRB 4KQ3L 3D18B 5L9DL 1JHTB 1ED3B 4Y5VC 3LVEA 3WMSA 5F7UA 3SDXE 4WIWA 2V5YA 1UD4A 5HOSA 2DI7A 1UZ6F 4OD3L 2ICES 1H3GA 4JZ5A 2AV1A 4L4JA 3ALXA 4WTZA 3RTQA 2VB5A 4D3CL 1WCBA 3L2LA 1DWJM 5IJVA 5DQ9B 4M61B 1BD2B 4AMCA 4JHBA 4PV9A 4ERSL 4D0BA 4JDZB 3CH8A 1HSAB 3NFSL 2H32B 1IQWL 1DQLH 1R33A 3AZSA 2F58H 3K4AA 3T0EB 1JGDB 1AR2A 5DD0L 1JMZA 5MI0B 2EH7H 4FLSA 3EYSL 3RWHA 1N0LA 1Q1JL 3AXXA 3X14A 4LOUC 3T0BA 2FWOA 1D5ZA 2NY5C 2DYPD 2WUBL 3GSQA 3I3EA 3FY1A 4AD5A 3DGGA 4XX6A 3L3IA 2XOTA 1IEAA 1A6TB 3WO4B 1BFVL 1U95B 2QV2A 4YH6A 1X6NA 1NSNL 1S7QB 1JUFB 5FL0A 3CUFA 4L5FL 5CD3A 1INQB 4RZCA 2LE9A 3NIDE 1HJXA 1QSFE 1P7KA 2VKXA 2B1HL 4WSKA 2IF7A 1E4KC 2Z0BA 3ZKMC 5EORL 3LPPA 5FFLA 2IQ9L 3WUWB 2WPGA 1DQJA 2EXWD 4HT1H 4HK3J 2B2XL 5GRJL 1E4NA 2X1WL 3QI9C 4PRPD 4NI3A 2P8MA 5F44A 4PN2A 4OLEA 3CC1A 4WW2C 1JWSA 1JTOA 2BNRE 3E8UH 3NACL 4BA8A 5IF0B 5D2NA 1W72H 3D69A 5FYKD 3QEGL 1FG9C 2W59A 3BCFA 2ADJA 3FT4B 1ZT1B 1J0HA 1N64H 4GW1B 4POUB 4Z95H 4W93A 4PRBA 4XC3L 2DL2A 2GFBA 7TAAA 3GBNL 4A3YA 2NXZC 4RFEB 1EEQA 2CBUA 1JRHL 3OHXA 4OCSL 1UH2A 4NO0A 1OAKH 2NY0B 4YAQB 5F96H 2ADFL 2DEPA 1U3HD 3PDDA 5FYJD 3W9EB 3WS6C 1MCBA 2V17H 3BKML 4L4VE 4ZFMA 1HH6A 5FK9A 5I0ZA 4NHUA 4QRPB 4YQXL 1XD0A 3RVUC 3QR3A 2F61A 4HLZH 4WHYH 1RURL 3ZJ6A 1KJMA 4K68A 3NIFF 3A6BL 3PXHA 4G43A 5CINH 2HWZH 4OZHE 3VM7A 3G6DL 1OP5H 1CZ1A 5JW4M 3ZL4L 2AEPL 1T1ZB 4YXLL 3IVKB 1OAQL 2DM2A 3C5JA 5KSAA 3BVTA 5BXTA 2MANA 3D39B 4HUWA 3SKMA 5DHYB 4OB5H 4PY8I 1FGVL 1BLNA 4GAGL 2VQ1A 3KNBB 3TZVA 1XF2A 2YD8A 1KXQA 4PJGF 1WFTA 4O2CA 1SEQL 3D25A 1E55A 3AOFA 1D9KB 4NZUL 3F6LA 4NQED 3CFKB 4RNRA 1VGKA 3F6IA 2ZUSA 2ZOKA 4TOYL 5IQ7L 4O9HH 5DHXB 5IMMB 4Q9QL 1NFDB 2JKXA 5TF0A 2YUZA 4JN2B 3RZCD 4RX4D 5CSZB 5ACZB 2IANB 1MCHA 4U1SA 4BS0A 4B5EA 3TA3C 3MC0A 2FEEI 4IRSB 3BPOC 1KEGH 3VIKA 3ES6B 4YPGA 3MO4A 4UUJA 3L7EA 4DQOH 4WY7L 3T8XB 5IHBA 1WDPA 2AQ3A 4J4PA 5FM8A 1YEDB 4LSUH 1H11A 4XZUB 5JIPA 5I19H 5E8PA 5IUSA 3JWOL 3W39B 5HGBB 4BYHA 1TJGH 1I3RB 2Q6WA 1FVEB 1MCWM 2E9MA 3R1GL 3G6AB 3GSNA 1KQZA 1IAIM 4NKDB 5DEZA 3TVMC 2NX5A 5JHLH 2DT3A 4WU5B 3GXNA 3UEQA 3DX9B 1DEEA 4HF5H 4OD1L 4X99A 1NFIA 2BVPA 3NAAL 4PJIE 2QQNL 4PJDE 1YEFH 1UCBH 5DC4B 1UR8A 5D6DA 2GITB 3FQTB 2R0KH 4CMMA 5HYSA 5E00B 3PWPE 5B39B 3P0YH 2VDRL 2ZUQB 1JGUL 1ISXA 5HYIA 4E8CA 3LIZH 5EBAA 3QUYB 4V1DE 5CBEA 3S5YA 4Q6IB 2KQNA 1BG9A 4PTMA 1M71A 4I4WA 3C5ZD 5KANI 2C3VA 1SY6H 5E4EC 3L9RB 3B9EA 5EZLB 5GHWH 5FHBL 4MWFB 4Q2ZA 4QHUA 1FZOB 1BGXH 2DOCA 3CCHA 4KKBD 3X12A 2XKUA 3MV7A 3QXUA 5EUKA 1AE6H 4M8QB 1I1XA 2F19L 1R3HA 4QYOB 4X5WA 2DQIL 4U6TA 3UC0L 2R4SL 3P3YA 1XR9A 3SO3B 1NLBL 4HIIB 4U6VH 3TT3H 5LCVL 1QHOA 3U83A 2TAAA 4UIKL 1INDL 2AXGA 4YHYC 2WHMA 5LAXB 5CPSA 4HZ8A 5FF6A 4P5KA 5A3ID 3D9AL 5GSVA 1HXJA 4YJZL 2CEQA 5KSVA 1G0DA 1NWSA 4WNQA 4LHUG 3O45A 1EHLL 3HG4A 1XF4B 3FL7A 3BPNB 4P5MB 4LRNH 1IGMH 1SQ2N 2G3MA 3CFBA 1OD9A 4LCWE 4XNXL 3BGAA 4R0LA 4X7EC 2EKSA 1YA5A 3BT2H 3CFIC 3L3OB 3MBXH 2CBVA 3QUXB 5D7LB 4O5LH 3EBVA 3EFDH 2YD4A 4LNRA 3VFGH 3U7AA 1Y0LA 3MRJB 1QD0A 1X4YA 5HYJB 3ESVF 4P8UA 2AJ3A 4MGXA 4XPGH 4ZUVB 1T21A 4DZ8A 5IB4B 5DD6B 5DZNA 4Y19E 4NQSB 3WS3B 4Y4HC 4GBXD 1M05A 2CIPA 3IDYB 4UDTA 2IQAA 3GKWH 5EA0L 1MNUH 3NBNA 2VDOH 4QRRD 2HFEA 5F71A 1MIML 3GSXB 4PGEB 1XCQB 3O2LA 3SY0A 3KDMB 3C09C 3VXUD 1LL4A 3OKLA 2YRPA 3DO7B 4DGYL 4P48A 4L8CA 4GXUM 2VC2L 35C8L 1XCTB 2GY5A 1LWJA 2GSIB 2RQ8A 3DX7B 1HH9A 4LLWB 4X8XA 2XVLA 5JIKA 3O2VH 1GPOH 1PG7L 3O6FC 3U36B 1BPVA 2GJXA 4UT9H 2HLFC 2XVGA 2P5WE 5C07A 1TETH 5GS0C 2HT2C 3F5WB 3QWOB 3T3ME 1N5YL 3IRZA 1T4KB 1W0VB 2BSSA 4L4TD 4OKVA 4YWGL 1QVOA 4A6YH 4I2XA 2X70A 5GJTH 4HG4J 5EMYA 2FJHB 2JCCA 5GRYA 3ROLB 1PX3A 1WZ1L 2DL9A 3WFHA 4N8CL 2MQ3A 3WDIA 3O6LL 2VDKL 3BD4A 3SDDB 3FTGB 4Z8FL 2P8PB 4B3KA 2GDUA 2K3TA 3KS0H 3L5WA 2F5AL 1A6UL 1RZJC 4YDJA 2DQHH 4H1LH 4ACPA 4PG9B 2V2TA 3HFML 3D1MC 5DRNA 1YJDC 4JFPB 3N12A 1FFRA 3ET9F 4FOMA 2ZOXA 4NQTA 1XZ0A 4NXSA 1F00I 3W11C 2EICA 2KZ1B 2XFRA 4B0MM 1W72B 2NW0A 1GZPB 2HTKC 4ZUUB 4PMVA 1JPSL 1XF3B 3RL2B 5ICZA 3REVB 3VWJD 4NRYA 4Z7VE 5JHDA 3KPMB 4P7RA 4KC3B 3PDOA 1MI5E 4JFEB 3SDCC 3VX0A 1C92A 1ZT7B 4ZS6C 5AAWA 3U46A 2WMHA 4FTVA 1RJYA 1IGJA 1K8DB 2BRRL 3W26A 4HS6B 4PY7B 2WWKT 1JWMB 3RUGA 3ULVH 4QXWA 1T83C 3KEHA 1CFNA 3ZTNL 5AYQA 4KJQC 3EYPA 2AKRB 2W9EH 1U36A 5T1LB 1QUNA 1HIZA 1DBAL 4MAYA 4MJIE 4R7DA 5C0IB 1QA9A 3VGAB 4P2QE 1IBGL 2YL8A 2PF6A 1A7RL 1W1PA 4MD4A 1ZT4B 2VERN 1LDSA 3ZQ9A 4LPTA 2AK4B 2NSXA 3NCYP 3QIUA 3DMMC 4YR6B 1PKQE 2NY6D 3MGOB 2PB1A 3HNVL 5C2UB 1U8MA 1IQDA 5F9OL 3R0NA 4N9OB 5ESVA 4U1IB 2VLLB 2VLRA 4O02L 1ND0A 3FT3A 3LAFA 4PG2A 4BQ2A 1NFDF 4YDKH 5F9JA 5JW4Q 5MHSE 2DQUH 4GQPH 5K9JL 4MD0A 1GOHA 4QLRA 5DC9B 3AIUA 1ZTXH 2FYVA 4X7FC 1OY3B 4KHTH 4P9HC 1CEOA 4BQ8A 4ZYKB 5IESH 3UERA 4LSTL 4ZEPA 5CWSA 2I27N 2MQ0A 4WO4D 3T2PA 4ISVA 1R3IL 5E9DB 3S88H 3BH8B 1OSPH 1UENA 1T2XA 5J6HB 1S8DB 5EBWB 3KL5A 4LNVA 4IHOB 4POYA 4K9EL 4NCC2 5EB8A 3O3EB 2I9TA 3LDBB 2K7PA 5MEPB 4KTEH 1WEJL 4AZCA 4U1MB 3CX5K 4ORZC 3VXNA 3GYCA 1V0KA 3GJFA 4LLQB 1PLGH 2CERA 3ALFA 1G6RA 3TCLA 4M5ZL 4FF5A 5I6SA 3VFMA 4LLDA 1J9CT 2GCYB 3HS0A 3GB7B 3WDPP 1DWFM 1E3XA 2A6JB 4MDJB 1FFNB 3IDXL 3UYRL 4EN3B 2AABL 5IV2A 4FP8H 2QBWA 1KFAH 2N7BA 1TQCB 4P8XA 4ZFGL 2Z31A 1AKJD 1YEIL 1W0WB 3WBDA 2HAZA 3QHZL 1QR1A 1OAXL 1SJHA 1OTSC 3DYOA 4AIXA 1HT6A 5ADPL 3MUIA 2RBLA 3UYOD 5KJRH 5A16A 3CLFL 3OLGA 5E6IA 3WIHL 1UACH 1R0AH 2FEDC 4M5YL 3IDJA 3QIWD 2L0DA 1IJ9A 1G7IB 1ZANH 1N0XL 3OAZK 1E6JL 4RGND 2UZYB 4HXBL 4NJAH 1DDHB 1H0GA 3ARBB 1FPTH 3FFCA 4LSRH 2P45B 5I16A 3ISWA 5CJBA 5D7KE 3VMPA 5T1KB 3M45A 2EABA 3FFDA 3O6MH 5I76A 2I25N 4QLKA 3EW3B 2RB8A 4OCYL 1CBVL 3OSKA 5E5MB 2X40A 2FHBA 3CUIA 4ZFZB 1KENL 4Z76A 2R1YA 4XX1G 2UWFA 2DTSA 4S1SH 3H3PL 3SBWA 2RFXB 1MF2L 2PI6A 3WFEL 3LV3B 1U8HA 3CMGA 3KLAA 4M93C 3QA3A 3GFUA 4PBVC 1A3RH 3QNXA 3MXWH 4P57B 1FYTD 4NUJA 4WUKL 5E8EA 4PY8J 5FO8B 3GBEA 1F8TL 2AEWA 2XV6B 5AZEH 3FHQA 2R0WL 5C08A 1SJVA 2G9HA 4KVNL 4C59B 3IGAB 1KR1A 3DV4B 5LXGH 3ZE2F 3UJTH 1FFOA 3CC5B 1PZ2A 5CHNB 2ZSWA 1QSEB 1RUAH 5AYUH 1Z3GL 5H37G 1DVFD 4UTBH 1VB9A 1F4YL 4HKZB 5DVMA 2NY4B 3S36X 5DK0B 4UQEA 4YBHA 3I6KB 3NFPA 1FNEA 5I8EB 2ZXBA 2HTLC 1N3NB 4PBXA 3LN5A 3BO8A 4MD5B 2WKLA 5JW5B 4APQB 3BAWA 1H0DB 4LVOB 3KXFB 4PJCF 2QHLA 3QDHA 1YECL 4ENEC 5TFSH 5BRZB 4X9YA 2FJFA 4FZEH 4FK9A 2UV3A 4D9QD 4GI9A 1UYQA 2Z91B 1KCVH 2WINB 2G5BB 3TBTA 1TJIL 5C7XL 1EDQA 2JIXA 2XTJD 1DWGM 4MNQE 3HR6A 1FLRL 4XPTH 1X4XA 1XRVA 2XI9A 4PP1D 4G3YH 2BC4B 1AXTH 3UTQB 3BGFC 4ONGL 4XMPL 5C0RH 4LLMB 4HUVB 5F89B 5JPMB 3ELAT 1A2YA 5DDHA 3SDAD 2J7DA 1R5IB 1UWRA 3MLZH 5B21A 5F3BB 1HHGB 5ESQB 4PCSA 2FBOJ 5IKCB 4E0RB 4HBQA 2FHFA 3SCMB 4PREA 1UWSA 1JPTL 2Y7QB 5I8OH 1KLGB 2P49B 2YD3A 1CE6B 4H1LB 1FV1B 3FB8B 4YHKL 1G94A 4A4AA 1NBYB 3DURB 1U3HA 3QPXH 3SKJH 2XXMB 3H53A 2OI9C 3NABH 3KYMA 3ETBF 4NC1C 5SWZE 3VNYA 4GRLC 4AYFA 3I9GH 4DW2H 4LDEB 3PIQB 1DQDH 5BVPL 2W0FA 2IPKA 3BLPX 1A0QL 1BPLB 3Q6GL 2ZXQA 2NTFB 1C12A 4UT6L 5TE7H 1XMWA 4HSQA 4FQ2H 1HN1A 1SJXA 2EBNA 1JHLH 3ZR6A 1JHKL 5FIEA 3V4UH 1ZAGA 1V03A 5H94A 5D9PA 4KGLA 5JQHC 5JTWA 3SIMA 3GSNH 5HBBA 3HCVA 3O0RH 2GK1B 4PP2A 2XYLA 3FRUA 4YFLF 3D3VD 3N9KA 3A21A 5DJXA 1KT2A 4OLYH 4NQEA 5FKAB 1XV8A 1HEZB 4G7YL 1AY1H 2D2OA 4KROB 4K3EH 3NFNB 1KJ2L 5IFAL 1RP8A 1JFXA 2A77H 4WJ5B 4R5EA 1K3IA 1WCQA 3D85D 1FFQA 3RZCA 2CDEB 5AYBA 4C7FA 4MNHB 4PJEF 3QDGE 1R3LA 3OJVC 4XB3A 4GW5B 1Q6EA 2X4TA 1URLA 1MCFA 5MENB 2YJQA 4UILH 4MAVA 2F53E 2G2RA 1B4JH 4DTGL 4UMGA 3RAJL 3UBXB 5CSGA 1G9NH 3B6SA 3UTTE 3K74B 1JGIA 5GQBA 2AJVH 3ZHLA 3RDTA 2EE9A 1RMFL 1FG2B 3HE6D 5SV3A 3CZFB 3H9SB 4ODVH 3VGGA 2A2QT 1MVUB 4HC1L 3U0WH 5DHVA 2Z35A 2J79A 1DUYB 1NWRA 2XQBL 5I8KL 1LEGA 1DP0A 3PV6B 4L8SB 3MGAA 2EC9T 5ADOH 2BVUA 3BAEH 4JFOA 4R90L 3MQIA 4LCYA 4EBQL 5FGBA 4DKFH 4XCFL 4BFGA 2ERJC 1MLCB 3ARQA 3U4EB 3CDFA 3L95B 3QNYA 1P7QD 4NRSA 5IFJA 5D1XA 1W0YT 3MFGB 3VGHA 5IBUB 3O4LE 1NCAL 4ZUSB 2FBJH 2VXVH 4RQQB 3WN6A 2X4PB 2MWCA 3ARDA 4X7SL 4PRHE 3OAZH 4UZGA 4K94L 1KOAA 4UQ9A 1BVKA 2I24N 1WBXA 3ZHKA 4KK5C 2E7LA 1TUXA 3IXAB 1W9XA 2R0LH 1FC1A 2B5IB 5D9SB 4JFZL 2NW3B 3GNML 1I3GH 2XRAH 4Z77A 3T0EC 2JALA 3C2SA 2C1OA 4GQ9L 4LPUA 1HDMA 5MI0C 4E42A 3T4AB 4M1CD 2AV1B 4QHNA 3RTQB 1WCBB 3N1QC 4L3EE 4PJ7A 5IJVB 2CK2A 5F7HA 3T0WA 3L5XL 4D0BB 3WO4C 1RP9A 2BVOB 1M6OA 1CLYL 1NP0A 3WD4A 4EDWH 4P0DA 4LYRA 3NCCB 4HZAA 4NRXA 3GHEL 4I9WE 5D7IB 5B8CA 1IM9D 2ED8A 3RWHB 3EJRA 3X14B 4LAQL 5HHME 2FWOB 3EJUA 1D5ZB 2J5LB 3PJSA 2VAJA 1QLEL 1MFAH 3L3IB 1VFFA 2CKRA 3PQYD 2FATL 2FNBA 3D2UD 3V4VL 4JY5L 4ODTH 2QEJA 3RJQB 5CD3B 4RZCB 3MZTA 4PJFE 1YEEL 2E40A 3DX6A 4YHZH 3TPUA 3AQUA 3MRGA 3CFJA 1U33A 4LSPL 1ZK9A 1L7TH 4Y16A 2F54A 3N18A 4LIQL 3PWUA 4OF6A 4XMLH 3SKOA 2A3EA 3BVUA 1KCRH 5AUMA 2AAAA 1DQJB 1UD6A 4OF0A 1MVFA 3BLKA 5IHUL 4M7LH 3EOAA 2PR4H 4W89A 2P8MB 5DLML 4FG6D 5GRXG 3AFLA 1JWSB 2NY0C 4QDMA 1KR0A 1I7UA 3DSFH 5D2NB 3D69B 4G8FA 2H41A 25C8H 4KH2A 2ADJB 2A3CA 1MLBB 4HZLA 5A43C 4W4OC 4AH2A 3MLYL 1KG0A 1OAUH 1OM0A 2BJMH 2GFBB 1EQCA 3TBYA 2EDDA 1EIBA 1T0NA 4P23D 4GKZA 3UMTA 4KRLB 3P73A 3RX7A 3OHXB 1EGZA 4NO0B 2IADA 4R2GB 4WHDA 5E4IA 4HH8A 1NDMA 1MRDH 4KKCC 1BG4A 3LPGA 2IFGA 3DHMA 4G6JL 4EKJA 4XP9H 4XBGA 2V3EA 1HH6B 5FK9B 2R2HA 2XZCL 3MV9D 4NHUB 3JV6A 4OCRH 5DVNA 3VIHA 4KK9C 1KJMB 1HCFX 2W4XA 1C8QA 2APWA 4YZFE 4HXAH 1Q9KB 4IIQA 1BF8A 1XGYH 3WQ8A 2R29H 1A47A 3HI1A 2VH5L 2YMXL 15C8L 1JGLH 2UY5A 1D9KC 3CXHJ 3JVGA 5JXED 4OF8A 5DJ6A 2AJYL 5I2UA 3RNKA 3C5JB 1Z5LA 5KSAB 4J23A 4HUWB 2UZIH 1QACA 3RNQA 3MRLA 1UG9A 1N26A 2O5XL 4LGXA 1X4ZA 1EAPA 3TZVB 5BV7H 1PKOA 2EEDA 1XF2B 4GRWH 5FM5M 1XGQA 4CNIA 4GG8A 4O2CB 1IAKA 3TJEL 4OM0H 3D25B 3BD5A 4DN3L 4IRSC 3RPIB 4QEGA 1UQZA 4RNRB 3PWLB 1A7QL 4FQXD 1VGKB 5ICXA 2C3GA 5HYQA 1S78D 4JANA 4PJAE 2ZCKL 4Y0GA 5GIRA 1H41A 4O51A 4X4XA 3ULVF 1FHDA 3G9AB 1TLKA 5EBLA 2WAGA 3EDDA 4PMYA 3TT1L 2BERA 3BJLA 3I02B 1A7NL 1BQLL 5C0CA 4EVNA 2G4FA 2JELH 5EFDA 1P4IL 1QBLL 4UQ2B 4YPGB 4UUJB 3GEWB 1HQ4B 3L7EB 3GJFH 5C8BB 1EQPA 1G6RH 2OZ4L 3MNZA 2Q7YA 1DQTA 2A1WH 4TN9A 4Z7QF 4KZDL 2B8OT 5E8PB 5HPMA 2E27H 2YPLB 4WEBH 4IDJH 4HIJA 3VIGA 1IKNA 2Q6WB 5TE4L 4PLJD 2AI0H 1K3ZA 3MLXL 32C2A 4XX1E 1OD0A 5HVWA 3QDMD 2ZUQC 1EDTA 2FEEL 4MQTB 4WO4A 3KYNA 3K8MA 1DEEB 3QUYC 4X99B 3V5KA 4BKLA 4CN1A 4AC1X 4D1IA 1NFIB 4Q6IC 2BVPB 2XXCB 5F1OB 1DQQB 4LCIH 3UPCA 1MPAL 4HCRL 2APBA 4MXWL 4I3SH 4CMMB 4E8DA 3ULUH 2FH6A 3DUHA 1UD5A 4YN5A 4M4PA 3U30B 5I1DA 1JV5A 4OZFG 4XPBH 3TFKD 4PSPA 1NMAH 5DMKA 4OCWL 5SWSD 4R7NA 3AM8A 3WO3B 1M71B 1KJVA 4I4WB 1MRFL 2EDRA 1VFOA 3SO3C 3VXRE 2C3VB 4QLLA 4OZIB 5C0BD 3HMWL 4BZ2H 4PJXE 4UTAH 2P43B 4Q2ZB 5L7XL 5JMRA 3X12B 2UUDH 3CCHB 1T22A 3MV7B 3B8SA 3IDUA 3EO1A 5EUKB 3FZUD 5HSFA 3BPNC 4GKNA 1UKOA 3D52A 4TTGA 3RU8L 2VLJD 5BW7A 4JM2A 5H8DA 4ZXBD 1JGVH 1XR9B 3BHBB 1UGNA 5FO9B 5KVMC 1AKJA 1EPFA 2WVUA 2QADD 2LAAA 1SMOA 1IGYB 3QUXC 4XBEH 3KHQA 2BMKA 5FF6B 4AZHA 4P5KB 3EYVA 4NKOB 5GSVB 4G8EA 5KSVB 4WSJA 4WNQB 4FNQA 3O45B 3PZIA 1MCKA 4LQFH 3GSRA 4OZGE 4TUJA 5M3WA 4WFHD 1KLFA 1RZ8A 2YZ8A 3SGDH 1JFQL 2YPVL 3CFBB 3WUWG 3QIWA 1NCWL 5FYKU 3HR5A 5D1QD 3IDYC 2EKSB 4OTXH 1IFHL 5KAQF 4Q9RH 5DA4A 2OWWA 4ZTOH 4QRTA 4XPHH 5FO7A 4KMTH 5D7IF 1OPGH 2DQEL 4GW4A 3G6MA 1LQSR 3ZR5A 1FNSL 1UEYA 5I8CB 5BRPA 3H55A 1GGBH 1MJUH 2GK0A 3BN9D 5IW3A 4Q0XL 1T21B 4N90D 5D7JA 3DVNA 4YGAB 5SV4A 2J8UE 4HPGA 5A2KH 1VBUA 5FYJU 1M05B 2BHUA 3Q1SH 1FZJA 2IQAB 4UDTB 4QXGH 1REIA 3WFDH 3D5OF 1CFVH 1NCUA 1TXKA 3I85A 4X9GA 5IW1A 3IT8D 1ADQL 4NM8H 3BUIA 3SY0B 1MHCB 1GVYA 3SCPA 1EFXD 3NA9H 1CD8A 3ARFA 5C0DA 4L8CB 4PGDA 1EEZA 3CXHK 1CE1L 2Z8RA 1IAIH 2W92A 2HMID 3JV5A 1UXWA 2X4QA 4UFKA 3SDDC 3WNNA 1HH9B 1YEGH 4OIAA 5D5MB 5HGGS 1K8IA 5D8JH 5F7DA 2DTMH 4XVJL 4Y4FD 2V7HA 2BFVL 3JXAA 1NBQA 5EUOA 2D3LA 4OKVB 2AXJA 5A2AA 1XYZA 1T5XA 2CMRH 2VZSA 2X70B 3O6KH 3S2CA 2JCCB 4KQ4L 5A6BD 1HE7A 3WFHB 3IFLL 2Z8WC 1HHHA 1XIWD 5CGMA 2O26U 3TWCL 1JVKA 3FO9A 1DVFA 3U6RB 5IVZA 2VSCA 3L5WB 3JUYA 4UQAA 3WMBA 3AS0A 4YDJB 1BWMA 5GGVL 1KGCE 3VXOA 4TNVK 1ZHKA 4NJ9H 1BEYH 3OV6A 5DRNB 5FB8A 3QEHA 4XI5C 3MLRL 4X98A 5F9AC 4U0QB 3T3PF 2XA8H 2WWCA 2YZ1A 2ATKA 3OKOA 1A7PH 4F7PB 3HAEA 5ISZD 1G7HA 4OIFA 2KDGA 3EYUL 1UM6H 3BKYL 43C9A 3OKMA 5DJAA 5ICZB 3EGSA 3VGAC 4XWGH 4NRYB 1M7DA 3S3PA 5JHDB 4PD4J 1OAYL 4KRMB 4P46D 3UDWA 5GRVK 1ULVA 3PDOB 1QQDB 4Y5XB 5GRWA 1GHFH 3U46B 2BY1A 4IMKC 1RJYB 1IGJB 2IH3A 3KPTA 1UYWL 5DZLA 3WNOA 4FFYL 2EAEA 3RUGB 5TE6L 2HJFA 1TVHA 2OMBA 1CFNB 1KEMH 3JTTA 3Q3GA 4K8RC 4XP6H 1U8IA 4KQ3H 5F7EH 2I07A 4ELME 1J10A 5L9DH 3SDAA 4R7DB 1QA9B 4KUCF 3BUQA 1ZJAA 4C57C 3VFTA 1WCGA 4MD4B 3GK8L 2D03L 4OD3H 1BMGA 5EU5B 3BSGA 1MCWW 1OTTC 3DRTA 4P4KA 1AI1L 4X8JB 4D3CH 3AROA 4ODWA 4E41A 3WIHA 3ZE1E 1U8MB 2X44D 1IQDB 4ERSH 3LRKA 4D1JA 3NFSH 5ESVB 1RHFA 1IQWH 3ARSA 4L3CA 2VLRB 1ND0B 3FT3B 1GZQA 5DD0H 1WB0A 2COQA 1DBBL 3GHBL 5D7SL 3EYSH 4OT1L 5BZWA 5SX5H 5F9JB 1Q1JH 4OJYA 4MD0B 4MNJA 43CAA 4X6BA 1J1OL 1I4FA 1W1YA 2WUBH 2GYSA 5BV7B 1CN4A 4GRWB 3WFBL 3HZYA 2Y5EA 3SEPA 5CWSB 3FQWA 4IM8A 3LDBC 4JPKL 4XVUC 1BFVH 1TTUA 1WZKA 3A4XA 2AV7B 4ISVB 1NSNH 3L5IA 1IZKA 4BH8A 5JO5B 5D9OA 4AD2A 3U7YL 1V3LA 4L5FH 5DHVH 1I1AD 1QNSA 2HT4D 4OGYL 3ESUF 3IAGC 2J3SA 2B1HH 4EI5D 3KG5A 4HOXA 1BIHA 2PN5A 3GRWL 1RIUL 1OLLA 2VCCA 5EORH 2UVEA 3N13A 2YD2A 2IQ9H 2I9TB 1ZU8A 2OTPA 5CEYA 1RZIA 1KXHA 4BUHA 1N59B 2VI0A 4PRID 4EN3C 2IBZY 4OZOA 5DUBA 1TQCC 5IM7B 1RK0A 2B2XH 5GRJH 3GJFB 3PP4L 5ETUB 2EYSA 1G6RB 3TCLB 3KLKA 2Y6SD 3K2MC 3N50A 3G6JA 3VFMB 4LLDB 3NACH 3VXME 5I9QB 1QEWA 3P9LA 3QEGH 4JFTA 2UZXB 4PLKC 5I0DA 5EU7E 5TF1L 4XC3H 4KAQL 5CCKL 3GBNH 4KDTA 3RA7L 2BNQD 2Z31B 4PJ9D 4NO5B 1JRHH 1QSFD 3O9WA 4OCSH 2PWDA 4BQCA 1NGZA 3NOIA 1QR1B 5HYEA 4X4ME 2W65A 2ADFH 1I1WA 3NCYS 3ARBC 4OZIF 4FNLL 3D0VA 5A16B 1Q8MA 1JF6A 3BKMH 5E6IB 2ZJSL 1HF6A 4HEME 3UTOA 4YQXH 3RWCA 3FCTA 2NX5E 1C08B 1RURH 5E94A 2DICA 3IDJB 5HGDA 3A6BH 3MRFA 2FR4A 3GTNA 3CMJA 3G6DH 4TSBL 3AI0A 3FFCB 1P7QA 4YHEA 3ZL4H 2AEPH 3DHPA 4YXLH 2NY2B 1IM3A 5I16B 5KVEL 2MKWA 2R0ZL 4N1EA 1OAQH 1WDQA 4RRPA 4XHJC 3CMOL 4B3LA 1W2VA 2MJWA 1X5HA 5E2VL 5L2KD 3FFDB 1BTCA 4PJGE 1CVRA 1JPGB 1FGVH 4AM0A 3U5YA 8FABA 4GAGH 4UB0L 5GGTL 1JPFA 3WJLC 1R5WA 3DVGA 4Z76B 2R1YB 4XXCC 5BS0E 2L7JA 1SEQH 3MO1A 1EHXA 1WT5A 1YC8A 1KTCA 4NZUH 1NL0L 1PGRB 4BH7B 3CHDA 3O6AA 3AMGA 4L4VD 1XEDA 1JMXA 1GUVA 1A9EA 4NC1E 3KLAB 2QHAA 4TOYH 3HG1D 4JFFB 3QA3B 5IQ7H 5J89A 3ZDZF 4Q9QH 1RUPL 4NUJB 3L6FA 3ZMRA 2CHOA 2R1WB 2NY4C 1LO4L 2E7BA 1A6AA 4QO1A 5C08B 5IEHA 2DMKA 5EPMA 2DBLL 2VCBA 4U1NB 2VO5A 1MCJA 2IBZX 4KI5F 4MADA 3DECA 4WY7H 4MXVE 3KPRE 1IM9A 4APQC 3S5ZA 2ZSWB 1W3JA 3X13A 3WDHA 4R96A 1M1SA 2JIWA 4LVOC 4KKLD 4K3HA 5F7LB 3JWOH 5EC1A 5GS1A 4ZSOE 5D5MF 3T77B 3DDGA 4Z2KA 2H2SC 3D2UA 4YE4L 3NFPB 5I17A 4CD7A 5TD4A 4M24A 4OCNC 2NLJA 2CJUL 3R1GH 3H9YA 1KULA 2GJJA 4HUNB 5E2UL 3BO8B 1UASA 4WKHA 4NZTL 4Q6YA 2JCCF 2PYEE 4OD1H 4WGWB 3BDBA 3OF6D 4LDOB 2AJZB 5LQBL 4PTWA 1J0JA 2FJFB 3NAAH 1E15A 1H4PA 4CD4A 5DQJA 1KJ2A 3SKUD 2QQNH 3V7MA 1NBZA 3SUUA 1NPUA 5IWLA 3SCMC 3SE3A 2GDVA 2JIXB 3CDGA 4FQQA 1ZLUK 1AR1D 2VDRH 2QQLL 4FNTA 1JGUH 1MFCL 5FYLE 3LD8B 1W9PA 4G6ML 3FO1B 2F7RA 1E6SM 2NW2B 5DDHB 1A2YB 5EIIB 1I1CA 4MA7L 1MW2A 3CUHA 3ARGA 3BDYL 5DYOB 1TZHA 5GGUB 1T20B 5C07E 3A47A 5I1JL 4AYSA 1QRKA 1Z0MA 4PREB 1RV6X 1ACZA 4HC1A 4OLWL 5FHBH 4GG6A 2FX8L 1N4XL 1XYFA 5HI5C 1U6AL 3V5DA 3AREA 4XCEA 1EHNA 4RE4A 2EXOA 4QFUA 2F19H 3RUGF 2DQIH 5EWIL 3UC0H 2R4SH 2HP4A 3KYMB 3ILPB 1NLBH 2N56A 4ZFFA 2APFA 3ULVC 5LCVH 3MV9A 1QRND 1INDH 1KPUA 2GJ6D 4UIKH 3VFVA 4ZPVA 1J5OL 3D9AH 3RVTC 1GGTA 5F7KC 2W0FB 2IPKB 3K8LA 1PEZA 3I6LE 1EHLH 4IPLA 2Z1SA 2EO7A 3MX0A 5JDSA 5H2BB 2ZX7A 1NWUA 3OGVA 3ILQD 4KJPD 3DC0A 1UKSA 1TJHL 2VABA 5JXEA 3SUTA 1KXTA 4XNXH 2IG2L 3MRDA 4KROC 3TIEA 1TA3A 2VWEC 5D1ZD 1M7IA 4AJ0A 1E0VA 1F58L 3A23A 4NQDE 5BO1L 4I0PD 5H94B 1QP1A 2E6QA 2XN0A 3HCVB 3K81A 2XN9E 3FRUB 4P2RB 4FTVE 3WKML 1U2CA 3HUJA 5DJXB 1GXEA 1J1PL 3MOAL 4GRWF 4F8QA 4QOKE 3AXIA 5HTSA 1KT2B 5F7YC 4NQEB 1UH3A 4FQXA 5EA0H 3H8NA 1QBML 1WC7B 5DI8A 5GRZA 1VRXA 1JZ7A 2WHJA 4BSWA 1MIMH 4ZXLA 1QHPA 1U8JB 1P7HL 3KLDA 4AK1A 2X41A 2CBJA 4P3DA 1R3LB 4DGYH 1D6EA 2VC2H 35C8H 4HIXL 2J62A 4LSQL 3PGCA 1Q9OA 4L8SC 3QXWA 4Z7WA 2CR6A 2YS4A 3FB7A 2O93L 2OWXA 3N1FC 1PG7H 3B6SB 5E2JA 2O5ZL 2WBJD 2OR7A 3KHOA 1FNGB 3PL6A 1N5YH 1O7SA 4Q7DA 2EXYC 3RDTB 4YWGH 3MODL 2YFNA 1LILA 3T4YA 4Z2IA 2Z35B 3WEZA 1WZ1H 2EKJA 3L4TA 4XMKL 1LEGB 4N8CH 5GJSL 3OB0K 1EXUA 3O6LH 2VDKH 5CILL 4Z8FH 4LCYB 4R8WL 3Q2CA 2F5AH 1ODUA 1A6UH 1S7RA 1JNHB 3F4VA 3ZT6A 2NY7L 4PRDA 3HFMH 3QNYB 2B5IC 5IFJB 5D1XB 5JOPD 4POZD 2X1IA 3QAZB 4GQRA 1W91A 4JG0L 3ARDB 3V7AG 4HAFA 2HYMA 4OFVA 1JPSH 3RTQC 4BM7A 3I50L 1BVKB 1EO5A 3O41A 1WBXB 3ULUF 1V02A 3MSDA 3L4WA 3PE9A 4LLUA 1SVCP 4X9IA 3VIOA 4LU5L 4GPNA 4AD1A 2MNUA 1RD6A 2DQDL 3EDEA 3AS1A 5F9WB 2XIBA 2BRRH 2C1OB 1HDMB 3PTMA 1C7TA 1EMTL 4E42B 5IT2L 3MYZA 4QHNB 1U8QA 2J5LC 3ZTNH 1EHAA 2ARJA 2FGWL 1DBAH 4GZEA 1IBGH 2BK8A 3AUVA 3HE7A 1A7RH 3D87B 2XWDA 3M1BA 2WVTA 4JFQA 2HKHL 2PO6D 5LJYH 4IS6A 2HFGL 4NO2A 1M6OB 1BQHA 3QPQC 4NRXB 3HNVH 4ZTPL 1KXVC 2Y23A 1X44A 2BNUA 4OF5A 2VRKA 4HGWA 5F9OH 3UG4A 3ZHDA 3PJSB 1ZBWA 1B0IA 5A2JH 4GKLA 1HJQA 4IRJC 2P5EE 4O02H 3V79C 3AHZA 3VVGA 1K4DA 4IJ3B 3RKDC 3MS8A 5K9JH 4RIRB 5JDJA 5FUOL 5CBAB 2J7GA 3S34L 1QI3A 4EXPX 3SCSA 2PTTA 4ONOA 4WLCA 2WIIA 5D1QA 4NWUL 1NMCB 3QFJE 4LSTH 3AISA 1R3IH 3DX6B 1EUTA 3TPUB 3LMYA 3MRGB 2WANA 3OGRA 5D2NC 4P2QD 3EKCA 2J7HA 4Y16B 2F54B 1Q9WA 3WJJA 3PABA 4MDIB 2X9WA 5C3LD 3STBA 1HXKA 1FHGA 3SKOB 3ZYIA 5AUMB 1ZGLM 4LL9A 4DGIL 1WJ3A 2IWGA 1UD2A 3CV5A 2VZTA 1GOFA 5IMOA 3LY6A 2PWFA 5JOFA 4B41A 2H8PB 3EOAB 2A6KA 5JPNA 4K9EH 2CIIA 3U4AA 4R2GC 4D0DA 1I8MA 1LEKB 3HAEH 1WEJH 1I7UB 5DEGA 1IMHC 2P4AB 1A8JH 4G8FB 3W28A 2WSKA 2BHYA 4Q7NA 4LLYB 2WZIA 4HZLB 3WLWC 1E4XL 4AH2B 5DS8A 2OZ4A 4ZODA 1KG0B 3BYYA 4C56B 3FB5A 4M5ZH 3RVVD 5FUCE 5BOZG 3BIAX 3TBYB 3JWDL 3QIBD 4GKZB 4H26A 5CEZE 3OL2A 1T04A 1X5YA 3P73B 5KVGL 2IADB 2CD0A 2HH0L 4DOHB 4WCYL 1N8ZA 1BYBA 1NDMB 3IDXH 3UYRH 2AABH 5CJ8A 4E2OA 1UWEL 4DGVL 4ZFGH 2IH1B 5A6BA 5IXEA 4XBGB 1YEIH 5KSAC 1UVQA 3QHZH 1OAXH 2R2HB 1NEZA 1XIWA 1LP9B 3JV6B 5C0JA 4W5ZA 3NIGE 5ADPH 1RK1A 4PGCA 1H5BB 4R97B 1KGUA 4IIQB 2EYRA 3TZVC 5E8DL 4D9RD 2ZCHL 3CLFH 3WIHH 4LFHD 1TQVA 4HCRA 5MEQA 5F1IA 1GOKA 3S7GA 4PUBL 4M5YH 4LVEA 1T1YA 3QUML 4WWKA 3RNKB 4HKJA 2DRUA 1Z5LB 3DXAB 1N0XH 1WFNA 3BPCA 1E6JH 4PV8A 5ISZA 3CSGA 4HXBH 3BPLB 1TNNA 4X83A 2OCFD 3VFSB 4R3SA 2G75B 3SCWA 5DVLA 3IJYA 3NH7L 4QF1A 1MQRA 1CXEA 4GG8B 4CNIB 1LL6A 3UJJL 4XCYA 5GNXA 3P11L 1T80A 4PRPE 2D9CA 3D0LA 1EEUA 4OCYH 1CBVH 1T3FA 3GMLB 5ICXB 5D9MA 5FYKE 4JANB 3UBXG 1KENH 1WZLA 2VXQL 5GISL 4J4PC 3PBGA 4O51B 1F4AA 1CIUA 3DX4A 5ACLA 3H3PH 1P4BL 2FSEA 3D48R 4X4XB 3ZYZA 1MF2H 3MV01 1MWOA 4MB5A 5EBLB 3WFEH 1F2XK 4DKEL 4KJYB 4Q58C 4KFZC 4WUKH 1TVBA 5C0CB 4EVNB 1F8TH 1B3VA 1HKLL 3DPBA 5FYJE 2R0WH 4ZOCA 3MNZB 2Q7YB 4EUPA 4KVNH 5HPMB 3PHQA 5TDPA 1ZV5A 1RZ7L 3RWJB 2UWEA 4N0YL 4HIJB 5DK3A 4NXKA 1Z3GH 2CKNA 2B39A 3N1MC 5D6DC 5IBUG 3IDMA 2EE3A 5ABHA 2RGLA 4PB9L 3WEXA 32C2B 3U30C 1F4YH 1BJ1H 2A9NL 2VQTA 3KYNB 2D3NA 4DUXA 5DJ2A 2WC7A 5E0FA 4BKLB 1WNOA 1CENA 3S97C 1G9NC 1IC5L 1U8KA 3SDXA 3V0AC 5IOPA 4OM1L 2XWBA 4PJCE 3WH5A 2Z1KA 2C5DC 1TVPA 5ID0A 2ZNXA 3DRQA 4EI5A 3OAYH 2FDMA 1MFVA 1YECH 1JZ4A 5HY9B 5I1DB 1JV5B 1MCRA 2XIDA 4WTZG 3O3DA 2NY3D 3GSWA 1NMBL 5FDWA 3MLTA 4ZAKA 5DMKB 4G6FB 1TJIH 4HK0B 5C7XH 4R7NB 3LN4A 1CT8A 1KJVB 4JZOA 5SX4I 2CSPA 2DF3A 1FLRH 5KAQG 3L3HA 5C0NC 1BZ9A 4KRPB 3S4SA 2OW6A 4ONGH 4XMPH 3OX8A 4WI5A 2XN2A 5HYFA 3TIDA 1NGYA 5C09B 3WFZA 4S1RL 3VRLE 4U6YA 1I8KA 2QR0A 2X2HA 1T22B 2ZCLL 1J9YA 3EO1B 1OP3K 4GKNB 1U8OA 4JHAL 1JPTH 3QO1A 2HJLA 4JM2B 5LGKA 2BNQA 4PJ9A 4JFXA 1QSFA 1AKJB 2P46B 4RMQA 4RMUA 5ESAB 4YHKH 5IR1B 3CTTA 1B6DA 2BMKB 2EO1A 1B1YA 3EYVB 3BSHA 1L9NA 2DB8A 5I1AB 2VQUA 3EDKA 2UY4A 1IT9L 3BXWA 4GXPA 4FQCL 4ZD3L 1BOGA 1NCCL 3GSRB 3KPQA 3RGVD 2UVFA 1CFTA 1RZ8B 5HGHA 5J6GA 3MA7A 3KPSB 4MNQD 4TVPE 5BVPH 1ECEA 4DAGL 1A0QH 1FVDA 3EO9L 4LQ1A 3Q6GH 3S8WA 2BNRA 3QUKA 4KI5C 4OFPA 4UT6H 5FO7B 1LWRA 1XD1A 1ISYA 4GW4B 4OJFL 5A6JA 1CG9A 4WUUD 5B38A 5AWNL 4D72A 1I8IA 2GK0B 1JHKH 3BEWA 5DJCA 5D7JB 4MDOA 3NMEA 1J86A 3DVNB 1J11A 5IVNA 3H7BA 1XC6A 1FZJB 3QHTC 2X7LA 4OBRA 3II1A 5IW1B 4OV5A 1DUZB 4BA0A 2ICEA 3C8HA 4LF3B 4U1HA 3ARFB 4L4VA 1Q94A 4G7YH 5GGRA 3VD7A 4PGDB 1EEZB 5C0DB 1KGXA 3N1AA 1KJ2H 3E3QC 4NIKB 3M17B 4PJ7E 5IFAH 3E2HB 4PJEE 1HJUA 4EZMA 4JN1L 1UXWB 2X4QB 3RM9A 1WBZA 4XNQA 1K8IB 3QWQB 5F7DB 1YMME 1F02I 3QCUL 1HNGA 3FRPG 4P8VA 4OZHA 5CKGA 5EUOB 4YHNA 4DWSD 1JL8A 1FZMA 1J87A 1XH1A 3VXTA 2V3GA 4DEPB 3RAJH 4DTGH 3UTSB 4X80L 1AP2A 1F2QA 4U0RB 5IHZA 2YSSA 1HHHB 4K3DL 5KW9L 4J3VA 1RMFH 1GGIL 2YA2A 3FO9B 4NDMA 1DVFB 4HC1H 5IVZB 5EO0A 3GBLA 1TVNA 2XQBH 5I8KH 2ZUMA 1JNNL 2EDXA 3OKEA 1UFUA 3VXOB 1ZHKB 4NZFA 1T66C 2YA1A 1CZ8L 5HHNA 5FB8B 1MXDA 4Y5XC 4R90H 4X98B 3GRWA 1DWIM 4EBQH 4H8HA 4R4FL 4XCFH 4HK3N 3OKOB 2ATKB 1CGUA 4LOUD 1A5FL 1WFUA 3T2NL 4CCDA 3HAEB 4LHUD 4NKMA 2BZDA 3UTPE 3FN3A 43C9B 3OKMB 5DJAB 5B3JF 2JFEX 4HDIA 3O8XA 3BKCL 1M7DB 1I3UA 1LP9F 4JPVL 2ZUTA 1NCAH 3CSBA 1TFHA 2F53D 2XKSA 2XWJA 4TNVF 1JD9A 5J57B 4UOQA 4X7SH 5EOTA 2HJKA 4QRRE 3UTTD 1CDUA 4K94H 2IH3B 4JM4L 1UD8A 3E0GA 3IJSA 4YHIA 4Z0XA 3V9FA 3VXUE 2GK2A 1TVHB 4RBPH 1TE1A 4MA3A 3Q3GB 4Q9CA 3W27A 1U8IB 2I07B 4JFZH 5A6AA 2EEBA 3GNMH 3SDAB 1V0NA 5CJXA 1S9KC 4PG2C 4GQ9H 3O81A 4W6WB 2D73A 3LQAL 2QMJA 5E70A 3DRTB 4P4KB 1T2JA 1HKFA 4L4TE 5BV7C 1I1RA 3H0TA 4E41B 3SUWA 2W9LA 3L5XH 5ABFA 3BIBX 1CQKA 3IDIA 2H45A 1CLYH 1JCKA 4L3CB 3DIFA 4PJHB 4PJIA 4ETQA 2FGLA 2VOTA 3V7AE 1GZQB 3GHEH 4PJDA 2HVJA 5BZWB 3RIFK 4N42A 4RAVB 5C3TA 3IF1A 2JB6A 4LAQH 4X6BB 1QRNA 43CAB 5I78A 3S5LA 1I4FB 3PWVB 2GFTA 3GIZL 3PWPA 1QLEH 1V3KA 2BFGA 5EOCL 3D5HA 2FATH 2LVCA 1GORA 4LVNB 1VF8A 4V1DA 2WHLA 2LVEA 3CZEA 3V4VH 5ABEA 4JY5H 3RWEA 4BH8B 2XPKA 2ZKHL 4XCNA 1UM4L 5GGTA 5KOVC 4XZBA 3GSUA 4P5TA 3CZ8A 3EAKA 1R5VA 1YEEH 2Q3ZA 1RUKL 3SE8L 4I0PA 1J7VR 5A6LA 4XZWA 4LSPH 5DA0B 3MTRA 5I9QC 2VITB 4B7IA 4OLZL 3RJYA 4LIQH 1KB3A 4P8WA 5CEYB 1CK0L 3ZZ1A 4DKAA 2VDNL 2X2IA 1KCLA 5IHUH 5DUBB 2GEEA 1RK0B 2Z31C 1W32A 5DLMH 1ETZB 3B2UC 3BXNA 4HKBB 5HHMD 2F9BT 2W9DL 4PRAB 1F3JB 1SR0A 1HXMA 3G6JB 1ZGLA 2CBIA 1QEWB 2JTDA 1B3JA 2DI8A 2AJSL 3RGHA 5KVDL 2VLKB 3CU1A 5E6IC 3PZMA 3MLYH 1EVUA 5A8QA 5CJOL 3ULUC 1EERB 5AEAA 4YGVA 2PW1B 1SBSL 2WBJA 3O9WB 1DLHB 3QUZB 3TO4A 1HSBA 1NGZB 3DETD 2QQKL 3VD3A 3WNLA 2W65B 1T2QL 1YY9C 2EIBA 4WKAA 2D7NA 2NY2C 4JRXE 4G6JH 1RUML 1NM9A 1C8XA 1FVCB 3TA3D 3RWCB 2XZCH 3FCTB 1XF1A 4Y19A 4KDWA 3CFEA 3BUTA 5E94B 1G7LA 1HOCA 4BUGA 3FONA 3MRFB 5FKPB 1RZKC 1DQML 5J13B 4JM2F 4F7TA 2VH5H 2YMXH 15C8H 3VXSD 4IPNB 1O7AA 3SBWC 3SCVA 3L5HA 2ENSA 1IM3B 2AJYH 3TNNA 1JWUA 5E8OA 5M95B 5HHOB 3SGKA 1JP5A 3V6OA 4NQCD 1QG3A 4UOW0 1YPZB 3FJTA 2O5XH 8FABB 2P5WA 4OLVL 1JPFB 5GNZA 1R5WB 4Y5YA 4LHQB 2DJ4A 3M46A 1PG7X 2VXUL 1IEHA 4JDVA 3TJEH 3MO1B 5EO1A 4DN3H 2OSXA 4QP0A 1OVZA 3QDAA 4YBLB 1A7QH 4LP5A 5J1AA 4HP5A 5SWQA 4PPTA 2Q86A 2ZCKH 4CMHB 5EZJB 3TV3L 3L6FB 4CRPA 4GZIA 1OTUD 5FD0A 2MHAA 3TT1H 1A6AB 3SUVA 1OINA 3TYGL 5IEHB 5IVXA 1JFHA 5EPMB 1BQLH 4Y7EA 3U48A 2ITDA 1P4IH 1QBLH 4YFLI 2GUYA 4JY4A 2OQJA 2E5EA 3CZKA 3X13B 2OZ4H 4R96B 4KZDH 1GJIA 3WH6A 1D5XA 3V6BR 3UTZA 4D0CA 3QEQB 4Z7VA 4QGTA 3HZKB 4L8BA 1OB1A 3BRFA 2P47B 4M81A 1U3ZA 1LMKA 5HDBF 3D2UB 1MI5A 4MLIA 3QDJD 5TE4H 5I17B 1ZGLP 4ALAL 1YYML 2NLJB 2ZWLT 5EUOF 4RGNE 2B20A 3MLXH 3TOPA 3C08L 3Q5TA 5CPQA 1GGCL 3L2MA 5EBMA 3LD8C 1S7XA 5E24E 5F6HI 1QFUL 3R06A 4P2QA 3DX8A 1KIUA 5DQJB 1KJ2B 3LX9A 2CUMA 3MUHL 1KB5B 1XH0A 1S9WA 5GNYA 1MPAH 4HCRH 5I18L 5JNYA 3RMEA 4MXWH 1V6WA 1KCUL 6A3HA 2ID5A 4FQQB 1AD0B 3VCLA 4AWEA 2RGMA 4AIOA 3CPUA 2Y06L 4OGAC 5MP6L 4OCWH 3GBML 1AQKL 3VDHA 2DT0A 1FYTE 1MRFH 1QLFB 3LKQA 3ARGB 1GQKA 1TZHB 3HMWH 3CFCL 4Y4HD 5BJTB 2PBGA 3ZTJH 3WN5A 3QQNA 2R9HC 4GG6B 5A1AA 2J6EL 3E6FA 5GS3A 5L7XH 3SKNA 5BQ7A 2Q8BL 2DJUA 3W0KA 1BFOA 4HW6A 3AREB 5KS9B 4XCEB 5EOQL 2JJUA 1E0WA 5ECJE 2YR3A 3RU8H 3PZGA 3WUFA 3PWNB 3B9VA 2O5YL 3LHPL 4ZFFB 3WHE1 3MV9B 2HRPL 4HX1A 2Z8VC 3VFVB 1FC2D 3O6FD 4CD5A 1Z2KA 2WMJA 2HLFD 3OJDA 3CSPA 2HT2D 5FHAL 3HC3L 2X8RA 1O6IA 5IMKB 1E4WL 5JDSB 4EDXA 2YD6A 1UJ3A 1QHZA 5D4QA 4EUPH 2X1OA 1JFQH 2VABB 2YPVH 4D9LL 4BF7A 1KXTB 1NCWH 3VXRD 4F37K 1FA2A 3MRDB 2OR9L 1TA3B 1IFHH 1M7IB 3FN0L 5K59E 4PJHF 1R86A 4M6OL 4PJ5D 4D9QE 4KRNA 2DQEH 4NFBA 4U3HA 5CGYD 1FNSH 3GH7A 2XTJE 1KC5L 4Q0XH 1V6YA 2CXKA 5IHRA 2O9PA 3UJIL 5I23A 2I60L 2EIEA 5L88L 1DHKA 3W11D 4K23L 5DI8B 3RDTC 2HTKD 3QXAA 1ADQH 4M7KL 5KZCD 3NYDA 3EHBC 4P3DB 1VFUA 1D6EB 1CE1H 4QHMA 3PGCB 3SDCD 5A2FA 1LQ0A 4ZS6D 5BYWA 1LGVA 3FB7B 1LE5A 2O61A 3B43A 1V0LA 2YK1L 1K6QL 4XVJH 1B9ZA 1HVXA 2VZ3A 4RAHA 3F8UB 5FGBC 2EZ0C 4JJHA 2BFVH 2HISA 3MUAA 4QXUL 5IB5A 2Q8XA 3PL6B 1EH9A 1CGVA 1FHLA 3WY4A 4KJQD 2H26B 5L0QB 1MYRA 3ABZA 1X7QA 1WK0A 1F4XL 5JW3L 5D1XC 1AC0A 4XNUL 5DRZB 5DSCA 3DX3A 1FH8A 4KQ4H 1BAFL 3G6JF 3IFLH 4KWUA 1EGJL 3ECQA 5DUML 2VURA 3QAZC 1EXUB 1NC2D 3DMMD 5FIPA 1CLOL 3ARDC 3FQXA 1K2DA 1WWBX 3HB3C 4U6XB 3TWCH 3T1FA 4JRYD 1AGDA 1QOKA 1S7RB 2OS7A 3T3PE 5GGVH 1BQCA 4KTYA 4PRDB 4XCCL 3DROA 3MLRH 2FX9L 4O4YL 4PMDA 5F9WC 3K46A 4JFYA 1MQ8A 4OUEA 3W0WD 1BBJA 2VRJA 3MRRA 3EYUH 4P3CL 5DEFA 3D3VE 3BKYH 1GHRA 4D6CA 3O41B 1XR8A 1OAYH 3AU1A 4KKBC 4LLUB 1K9FA 3MGTB 2GSGA 5EDXA 1KN2L 3C8DA 3LKPA 1S9VA 5KVFL 2OYKA 2WB5A 1UYWH 1OW0A 1X6LA 4FFYH 4TSAL 2C7UA 1K9TA 5TE6H 1NQ6A 4NNYA 1MCNA 3R0MA 2ARJB 4Z2JA 5F70A 1YPZF 1KGCD 3HE7B 3GK8H 4IJ3C 4JFQB 2D03H 5E0CA 1AO7B 4IS6B 4XVSL 2KPNA 4OFYD 4NO2B 1AI1H 1BQHB 4XTRC 1YN6A 2JIEA 2YUXA 4UQCA 4Z0BL 3QYCA 1NMCC 1T0PB 3S98A 3T0AA 4FQLL 2QADB 2XFFA 5K9OA 2EC9U 5INCA 1YDPA 4HGWB 5FECA 2AK1L 1HINL 4Z2GA 3LKOA 1HJSA 1DJSA 3QUMA 4Y16C 3HG5A 4HA1A 3TTYA 1Z9MA 2HVKA 1K4DB 1DBBH 3GHBH 5D7SH 4OT1H 3SE4A 4O58L 4FNRA 4EOWL 4AIZB 1J1OH 3KR3L 2CRIA 4MNQA 4Z7NF 2VC9A 2WIIB 5HDQL 3WFBH 4MNMA 4J2XA 1OTSD 2Q1EA 1XAUA 4JPKH 2I5YL 3C5SA 1Q6FA 4QCFA 5BXSA 1V6VA 2EDKA 2CIKA 5MEOA 3U7YH 2YPLE 5BVJA 3PABB 3VH8G 3HI5L 3MRPA 4OGYH 2MMXA 2PXYA 5IMOB 1PEWA 5D4YA 5ENWA 1IAMA 5JOFB 3GRWH 5DD3L 4ZG1A 1RIUH 5JPNB 3OGSA 4FQPA 3PHAA 4D6GA 2ICCA 2CIIB 3KLHC 4PJBA 2PNDA 1G9ML 1I8MB 3WQVA 2J1KA 5DEGB 4XNYL 1FN4A 1HWGB 2E9IA 3UBXI 1PFCA 3PP4H 5E2TL 4UV4L 4JREB 1BBDL 4FRWA 4PEEA 3ZKXB 3LKRB 5TDNB 1TZGL 1EDGA 3RWDA 4G9FD 3A4WA 3RPKA 1UA3A 1JAKA 1H5BC 1T04B 4R97C 4IIQC 1KBKA 1VACA 2AAVA 5TF1H 4WW2F 3HC0A 5JW4N 2RHEA 1N8ZB 5T1DL 4KAQH 5FOBA 5CCKH 2IGTA 2E9BA 3RA7H 1G1CA 1FH5L 1NUGA 3L4XA 4TTUA 1SYVA 4JCLA 2H2PC 1E6PA 4OZIE 2FGZA 1UVQB 4Z18A 2BHZA 3PG2A 1NEZB 5C0JB 2UY2A 1RK1B 3BPLC 3PQYE 4PGCB 3LPOA 5A3HA 4RSVA 4FNLH 2VR4A 2EYRB 4U3CA 1NH6A 2ZJSH 3QG6A 2JF6A 3E6HA 3MROA 4GG6F 5MEQB 5F1IB 3LS4L 4GAJL 4G8GB 5KS9F 1T1YB 1XFPA 4WWKB 4HKJB 4MCZA 1CDCA 2EE6A 4ODXB 4Y1AB 2OK0L 4X0KB 5ISZB 4LHUA 4TSBH 2FL5A 1FP5A 1KFWA 1L6ZA 4R3SB 3QDGA 1J0YA 5KVEH 1PIFA 4DKDC 1VIWA 3ROOA 2R0ZH 5FYLL 1DLFL 1INEL 2F53A 4PYGA 3CMOH 4XCYB 1KWKA 1NARA 3TA9A 5E2VH 2KUTA 3D0LB 3UTTA 1T3FB 4UB0H 2YDRA 5GGTH 2F2HA 1FOBA 3LRLA 4ZUTB 2NNAB 4LMQE 4D6JA 3HU7A 4ENED 4OAWA 1NL0H 2FSEB 3ZDZE 4UQBA 3G9VA 4JFHD 5E1QA 3EJSA 1RUPH 2BX5A 2WV3A 4JCMA 1E5NA 3MLUL 5I1LA 4AD0A 3QRFM 1F13A 3I6GB 2OJZL 1LO4H 4DVBA 5TGBA 4HLJA 4AL8L 4EUPB 2DBLH 1JF5A 2EDFA 5TDPB 3O4LA 1HWHB 4M9OA 1DTUA 3AHTA 3MMUA 2MOVA 1VPOL 2NZ9D 1T89A 4PRHA 3IDMB 5D5ME 3F5LA 1PJ9A 3V5HA 1QWNA 5BS0D 2XTKA 5CQ1A 4AZGA 5E95B 1ZLVK 1MHHA 5DJ2B 4YE4H 5AG9A 1YHTA 3NCOA 1GC1L 3BSZL 3K0WA 3FO2A 3F62A 2CJUH 2C4XA 2IC2A 3AM8C 5JOEA 6CGTA 5E2UH 5IOPB 3VXPA 2XWBB 4GRLD 4NF7A 3H2WA 4NZTH 4KRPC 5ID0B 3DRQB 4EI5B 4L3EA 1ES0A 5LQBH 4J1UA 1U93A 4MVBC 3GSWB 4C4KT 5KG9A 3L3KA 5FDWB 4HTYA 3MLTB 4ZAKB 4WI9A 4PYSA 4ORGA 1PS3A 2YD9A 5HPOA 3LN4B 1CT8B 4JM2C 1QPXA 3KPRD 3HI6L 1U2YA 2QQLH 1MFCH 1QW8A 3L3HB 1BZ9B 1WICA 3EJYC 2WZPD 1HWWA 4G6MH 1NDGB 3OX8B 4Y2DB 5F6HJ 3VTRA 3TIDB 1NGYB 1E4JA 4Z7WE 2AVGA 4MA7H 4U6YB 1I8KB 2QR0B 4WI2A 3BDYH 4U1KB 5DGRA 4X4YA 4DO5A 5I1JH 1M04A 3FT2A 3Q6FA 1TITA 4MNGE 2X4NB 3CDCA 4OLWH 2QV4A 3QO1B 2HJLB 3LN9A 2FX8H 4OD2A 4ZXOA 3HLAA 1N4XH 4JFXB 1U6AH 4XP5L 4PJFA 1DBJL 2PYED 2JJWA 5DRXB 5CZVL 1IGCL 1DN2A 5JIHA 5EWIH 1A6PA 3BISA 1L0QA 4W84A 3HZ3A 1BOGB 1DEDA 1JTPA 4YDVB 3KPQB 3TF7C 4ZENA 2BVQB 5D7JC 1CFTB 1CDGA 5HGHB 5J6GB 2X1PA 3CFDA 1J5OH 3QDME 4NCDA 2ZWZA 5DJ8A 2NT0A 1FVDB 1ZHLA 3PWJA 1MAJA 2BNRB 1ZBVA 5C0AD 4GKSA 3QUKB 1SM3L 3BQUB 1TJHH 4GXUN 3K4DA 1HHIB 5E08L 1UA7A 1Z9OA 4QRQA 3ZOAA 2IG2H 1CG9B 1YEHL 2ESVD 3ARFC 5B38B 5FCSH 5D8ZA 2ICWA 4JVWA 1I8IB 5DJCB 1EOKA 3BEWB 3E2HC 4W7UA 1F58H 2YD5A 5BO1H 1OT1A 4QKXB 4FMFA 4JFDD 4R4NC 3H7BB 5SWSE 2X7LB 1TQBB 1E4LA 3WKMH 4OV5B 1J1PH 3MOAH 4F80A 3VMOA 2WP3T 1UR0A 4DEPC 2ICEB 5C0BE 3OG4B 4U1HB 4L4VB 5GGRB 2W91A 2ZOLA 1QBMH 1Y6NR 3GMRA 4LPWA 4U0RC 1WGOA 3MFFB 4PMNA 1BP3B 1ITCA 1WBZB 4XNQB 2PCPA 5ECUA 4HBCL 3K7UA 1BD2D 1D5MA 3QCVL 4KK5D 1UWQA 2VLJE 4OZHB 4YHNB 3PGFL 4HIXH 1FCCA 3OLIA 1I9JL 3F5KA 4QCEA 4LSQH 1FZMB 1V6XA 3VXTB 3R8BB 1PIGA 1VFAA 3T0ED 4AMWA 2O5ZH 4AENA 5A6KA 4K9EC 4WI7A 1PYWA 3ZO0A 1AP2B 5IHZB 2YSSB 4YHML 4NQDD 1RUQL 1CFSA 3MODH 4QTIL 3TPKA 4NDMB 1NBVL 4WFHE 5IFPA 5EO0B 2BSTA 3W9DA 2DBJA 1N2RB 4G9DA 3BESR 1P1ZA 4QWWC 3OKEB 4QXTA 4XMKH 5GJSH 4BFEA 1RJLA 4OLXL 3VI4E 3NCJL 4OUUA 5CILH 5HHNB 1QI5A 1BGAA 2D7OA 2EPLX 4R8WH 3G5VB 4NP4L 5J9PA 5HPCA 4PJAA 4NN6B 5I30L 1K4CA 3RRQA 4PP1C 2PBOA 4ZO8A 2NY7H 1G7PA 1KGWA 3ARPA 3BC9A 4KY1L 3FW6A 4W7VA 5CEXA 4H8WC 2JJTC 3O8XB 4JEGB 4HS8L 4N90E 3SDAC 5E56A 4M00A 1CIDA 4MDPA 1E0XA 4HKXA 4JG0H 1KSRA 5EOTB 3RP1A 1EO8L 2HJKB 4P4KC 3F58L 3I50H 1S7UA 4JDTL 3C60A 3GUTA 3CHEA 4MXQC 3IJSB 4YHIB 1SMAA 4Z0XB 4WRLA 1YQ2A 1OP5K 1T1WA 4HFWA 4TVUA 3MV8B 1XHGA 4MA3B 5E8NB 4LU5H 3DV6A 4ZOAA 5CEZL 4GH7B 4LPXA 2DQDH 1N82A 5D93B 5T5NF 4CD6A 3GXFA 1UQSA 3C8KA 1EMTH 5IT2H 1CTNA 2OJEA 5A8NA 3OGOE 2FGWH 3Q5YA 1E1FA 3H0TB 2NY0D 3W82A 4QTHB 5DMGC 5A8PA 4M1GL 2HKHH 4LVNC 4FQHA 4F7CA 5ABFB 1WUNT 3IDIB 3IFPA 2HFGH 1MFUA 1K85A 4PJIB 5IVOA 4PJDB 3KS0J 5ID1B 3PP3H 4QRPD 5IQ9A 2VZVA 4JFFE 3IF1B 4DO4A 5IMLA 2JB6B 3OJMB 5LVEA 4LMQI 2QF8A 3RY6A 2F8XC 1LO5A 3S5LB 1JYNA 5HDOA 3PWPB 3QRGL 4N5EC 5IW6A 1CS6A 4J12A 2XGIA 2Y24A 1OSZA 4KKCD 4V1DB 5FUOH 1UQYA 1GQJA 3S34H 5DFTA 3RWEB 5EIVA 4HUKB 4U5IA 4BZYA 4XCNB 3VXRA 4NWUH 4UNIA 3GSUB 4P5TB 3RIFF 2VTFA 3F7YB 1R5VB 5EU4A 3RBSA 1ZOXA 4KK9D 2EPKX 4PJXA <