4A21A

Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to sulfate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
342
structure length
314
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGYTSPEDFEKTIEALGAGEHGKYLLAATFGNLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE
publication title Glycolytic and Non-Glycolytic Functions of the Fructose-1,6-Bisphosphate Aldolase of Mycobacterium Tuberculosis, an Essential Enzyme Produced by Replicating and Non-Replicating Bacilli
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 115
structure length 314
sequence length 342
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4a21A00
1L6WA 2CZFA 3F03K 2CLHA 1LROA 1QDSA 3LHUA 4DF0A 3QSRA 3LTPA 1HO4A 3NR0A 3FA5A 5AHFA 1W5QA 1WAUA 3S5OA 4CNNA 1ME8A 3PSVA 4PH6A 4W9TA 3NXFA 3MHFA 3EWXA 3T4CA 2FB2A 1CW2A 4O12A 5FEXA 1MO0A 3QJAA 4RZ6A 1T96A 2CFFA 3O05A 3CQ0A 2VENA 1B4KA 3ELFA 4E2DA 4Z1BA 1BTMA 3G18A 3NPXA 4GUHA 1W3IA 1LCOA 2HSAA 3PWAA 2VEMA 3W2LA 3W7IA 4FX7A 5G1TA 2C1HA 1FDZA 1JRBA 1MEWA 3LXAA 5EMUA 4MUZA 4TR9A 3CEUA 1DJNA 3TNOA 1OX6A 4LUIA 1H51A 3CIXA 3S5YA 2C18A 2D73A 3NEVA 3C2VA 4QNWA 5HQEA 3WK2A 4JN6A 4NU7A 1OF6A 4PTNA 4X3ZA 4P2VA 5KZEA 1Y0EA 3B0VC 4HNNA 1FWWA 4HSOA 5FEPA 5TIMA 3C6CA 3N73A 1W5PA 2ZZ6A 3OHIA 3TSDA 1VH7A 2P0OA 5DCDA 5AC8A 4FEZA 4UC5A 4JDYA 4DEFA 5F4SA 2Y62A 4MY9A 4QAIA 4TMCA 1S5VA 4LS2A 1H7XA 2C13A 3EKLA 4IMDA 3E02A 1HG3A 1W1ZA 4RK8A 2PRMA 1O95A 7TIMA 3NL5A 5AYXA 2E6DA 4CNOA 4O8RA 5D37A 4DO4A 1IXOA 3SJ3A 1RQBA 4AHOA 2R94A 2G5WA 1YXDA 2A6NA 1IIGA 1W54A 4ZQPA 4K8EA 4EF8A 6ALDA 4X9SA 1JUBA 1RR2A 3DFQA 1YPIA 2ZRVA 2X30A 3KAOA 4JTHA 4MKNA 2CLLA 2YCEA 3LV5A 3W70A 1SFJA 1HTIA 1IGSA 5KMYA 3LOTA 4XTIA 1YLVA 1F05A 1W8SA 3NQ8A 3QRHA 4N2YA 5I3FA 1LORA 4E0CA 3UWVA 5CGQA 3EWBX 4UFMA 4OV4A 3KFTA 3DGRA 3LCLA 2Y63A 3UQNA 4MIMA 4ORIA 1TPUA 4LOCA 3S42A 2W6RA 2NXIA 2QAPA 1F76A 1YYAA 4O14A 4M6VA 5U4NA 1VLWA 5H2ZA 3LI0A 2C19A 1MEIA 1L6YA 1E51A 4BF9A 1SUXA 3FJ6A 2CLOA 1OYAA 3DFSA 4A29A 1GVRA 2FLIA 4RZ5A 1WX0A 2R14A 4TMBA 1OFDA 5E93A 3TIMA 2CZ5A 1G7UA 3IVTA 2QCMA 2RDTA 5KTLA 3RFAA 1G67A 2EF9A 2CLMA 1O94A 1Z44A 3DHFA 3W83A 5G2HA 3BLEA 3GNDA 2I9EA 2PCQA 3NL2A 2NXHA 5K9DA 4N9CA 1LBFA 1K8ZA 4LVBA 4J9JA 4O53A 2YPIA 1K7EA 2VFHA 1N8FA 5LSMA 1D9EA 4FNSA 2X2GA 1NEYA 1R2TA 1FXPA 3A9IA 4O15A 3P8JA 3P5ZA 2E5CA 1SW7A 5AHNA 3TMQA 3SGUA 2FFCA 4MJMA 3W23A 3OEXA 3SFKA 2GJLA 3IEBA 3H54A 4G1KA 5EKYA 2QF7A 2QEZA 3UWYA 4BI6A 1L2UA 3LERA 4M7TA 2IQTA 4MY8A 3GX9A 1BEUA 3A22A 4ADTA 3PVFA 3LHZA 3UZ5A 3G24A 5I3KA 5T26A 1ZJIA 4K6AA 4DPPA 2W79A 1H61A 4UTTA 3WJWA 3NGJA 3W72A 3CWNA 3PUDA 2V5BA 3TFCA 2R8WA 5E0KA 3DKJA 3IIVA 6TIMA 3T40A 4UTLA 1M7OA 5FI8A 4A3UA 3NQCA 1GWJA 3TXVA 4XTDA 3ATZA 1WA3A 1ZFJA 2B0MA 2JGYA 3NPVA 4HIBA 1R2SA 2CZDA 5AFDA 3LCGA 2XFWA 3LI1A 4UTHA 1S5WA 1B9BA 4JTKA 4ML9A 3KVJA 3GR8A 1XDMA 4AMAA 4IMEA 2XN1A 1NF0A 1RD5A 2E68A 3CHVA 1JJKA 3TC6A 2WNNA 2DZXA 3LHYA 3FLUA 4N9EA 1QOQA 3G1SA 2H8ZA 3M5XA 1FWRA 4KFOA 1XUZA 3GDLA 4CQ8A 1CX9A 3UWQA 1QPOA 3NQEA 3WFAA 4HPXA 3C0JA 4EWND 3C2OA 1I8JA 1DBTA 4Y90A 3PUOA 1OK6A 3CU2A 3PB2A 1SO6A 1TV8A 4JTEA 1K7FA 1XC4A 2QCDB 3GNNA 1O5XA 3LDVA 3IGXA 2DZSA 1G4EA 1ONRA 5HUOA 3UY7A 3M16A 5F2IA 1KLZA 4DF2A 4LC8A 4OHQA 4R34A 3P60A 1M6JA 4LU0A 3ANYA 3LLDA 3E49A 4LRTA 3FIGA 4O19A 3EXTA 5BMWA 4NJHA 3QW4B 3W7EA 1LLWA 4FX6M 3G1DA 1SO5A 3USBA 1ADOA 4MZ1A 3WJZA 4CNPA 4IMCA 5KITA 2CLFA 2J9XA 1PL9A 3BLFA 4NJJA 5K9CA 1GYNA 2C0AA 3LCIA 3TR2A 2A4AA 4ZL1A 3UPBA 4Z1AA 4BK9A 3IGUA 3LBCA 5ABTA 1X1ZA 1DQWA 3PBYA 1EEPA 2J6XA 3W07A 1TQJA 2VKZG 4UR8A 1U83A 3EWZA 3M43A 1VLIA 3UWZA 4H6KA 3GDMA 3QEZA 4ZQRA 1KTCA 1TQXA 3CLMA 3L9CA 4FNTA 2ZZ7A 3NO5A 3W7HA 5C5YA 1AK5A 5AHIA 2E6YA 3NQ7A 1EWDA 5DELA 4DO6A 4O13A 3DFNA 4UTTC 3MBDA 3TQKA 2E5DA 1LRQA 1FDJA 4FIRA 1LOLA 4HPJA 4YXGA 2XN2A 3IIZA 3HQ1A 3UD6A 3CTLA 3M9YA 4IPIA 2VFDA 2J27A 2RH9A 1LDCA 2FPVA 4OGZA 5CSRA 1SZNA 1X6UA 1GYLA 2FQIA 3DU0A 3Q2DA 3TMLA 2Z2UA 1H63A 5HWJA 2ZA3A 4FXRA 1OX5A 3WK0A 3W6YA 3W84A 1QO2A 3A21A 2G97A 4ZVJA 3P5YA 2Y6ZA 3HGOA 2YFOA 3TROA 3TE9A 2GVJA 4JDBA 3K30A 1MZHA 2Q3OA 1QFEA 3HGJA 2OX1A 4LY8A 4UFIA 4XZ9A 1F73A 2F7FA 3N34A 1O4UA 4XWUA 5G2IA 1QWGA 3STCA 4GRSA 4JTGA 5DLCA 2H90A 4LT9A 1G4TA 1KV8A 4X22A 4JY9A 1AMKA 2B7PA 5L6UA 1FDYA 3W2JA 4A2RA 3G22A 3B4UA 5G1YA 3CC1A 3KOFA 4WY0B 3HBLA 3LM7A 3U2OA 3MI3A 1TPH1 3Q58A 3GLCA 2X1UA 3UWWA 1F74A 1KBJA 3HO8A 4Z0JA 3NM3A 5D2TA 3STEA 3NQ2A 3LRMA 1F7BA 1LZOA 5KZDA 1G4PA 4WOQA 3TAOA 1GG1A 2Y7FA 2NZLA 1OABA 3GXPA 5LZLA 1UB3A 3KRSA 5TQLA 2A7NA 4JTFA 3W3OA 3L65A 3EX2A 3MO7A 3OVPA 1TPVA 3HGRA 3NG3A 4QITA 3S1WA 1VCGA 4PEKA 3HPXA 3G3DA 1G6CA 2ISVA 4O57A 1AW5A 4MPQA 4AWTA 2WSYA 3NZ1A 1W3NA 5G2WA 3Q94A 3W1RA 3M47A 3TDFA 2CW6A 1G69A 5GVJA 1GEQA 1G7VA 4GUIA 2OMAA 2Z1BA 2B7QA 5CZTA 2NX3A 5BW6A 2E1DA 3S8HA 2I1OA 3IRDA 2AQWA 2QCHA 2RDUA 1X8FA 2QDHA 1Q6LA 4Z1CA 1ZAHA 1PIIA 3PF3A 2EPHA 3RF9A 4O52A 3QSTA 3OIXA 2CU0A 4C1KA 3HG2A 4HNTA 3TC7A 1OFPA 3N2XA 1ME7A 1LBMA 2VFGA 1QPRA 4X2RA 2NV1A 1MEHA 4Y96A 1W5MA 2A5HA 3NL3A 3UPWA 4D2JA 2FIQA 4MZYA 1XL9A 2BLEA 1VPXA 2EGZA 5HINA 2J9YA 1LLZA 2WOQA 1OYBA 2NUXA 5F1VA 4YCPA 3MP3A 5DXXA 3G8RA 1VYPX 5I3HA 4DBDA 1DHPA 3O07A 1ICPA 2YYUA 2ZRZA 1JRCA 3EXRA 5HULA 3C2FA 3W86A 3GAYA 2NLIA 1XBYA 3FYPA 3L21A 5CZJA 2JKEA 3DXIA 3SR7A 1H62A 1LTDA 1QOPA 2RHGA 5HWMA 1LRNA 4XQ6A 5BOOA 4UMBA 4WQ6A 3DZ1A 4LC6A 2ZCGA 2C3ZA 3MJYA 1H7RA 4JEQA 1XM3A 4WX2A 1P0NA 5G5IA 1W0MA 3W9ZA 4NNAA 4MZ8A 5AYZA 4WXZA 4O0KA 3C52A 5F2LA 4QJ1A 1FWSA 3T7VA 1P4CA 3PG8A 1H1ZA 4TO8A 5D05A 3L0GA 5CZSA 1MXSA 3RLVA 3W7JA 4AHPA 1H1YA 5D32A 4HKPA 4I7WA 1T0OA 2PC4A 2ZZ4A 2GVLA 3QH2A 1UASA 3S9YA 3R89A 3LCWA 5K7JA 4MLRA 1OYCA 1H50A 3EX3A 5CPNA 3W7CA 4IX2A 1DOSA 4UFJA 4FF7A 3VI2A 3VE9A 4RCXA 4A21A 1L9WA 4DO5A 3ABRA 3ABOA 3NQ6A 3RLUA 2E5BA 1C29A 4O16A 4N6FA 1VYSX 2QCCA 1FWTA 5D38A 3EX6A 5FF7A 1B4EA 1KFEA 4DELA 2OT0A 2ZZ3A 1A5AA 1FCBA 1TJRA 2NUWA 4S2CA 3L68A 1I2PA 2DZWA 4FNRA 3NQMA 5HJLA 1Q6RA 4JX4A 3TV8A 1OFEA 1SFLA 4CCCA 1KFJA 2WSQA 2QCDA 3OA3A 4AAJA 3BW4A 1VR6A 4IWWA 1FX6A 1FQ0A 2V2CA 3P80A 1DKWA 4R53A 1ML1A 1FBAA 3NM1A 3TX9A 4EF9A 2NWSA 4UTMA 1H7NA 2YFNA 5LNSA 4ADSA 4JTUA 4UCGA 1KM0A 4JIQA 5D2VA 4CLMA 2BWGA 3T44A 1GPWA 1TTQA 1H7WA 3G1FA 4JS3A 1XDLA 1TPFA 1TTIA 4E2BA 5J5DA 3S6DA 3IVUA 2Q8LA 4UXDA 4WOZA 1AW2A 5C2XA 1DORA 3GYEA 3W1UA 3TXZA 3R5EA 1JCXA 3TFXA 3TW7A 3G1VA 2YYTA 4YLWA 4OT7A 3PG9A 2CZEA 2ZZ5A 3G0SA 1SSGA 4FXSA 4FHAA 1GVOA 4IJBA 3QMSA 4MFEA 2JK2A 3E0IA 3NZRA 3P82A 2A7PA 4N02A 4UTJA 5EL1A 4UTKA 4NNBA 3QZEA 1RPXA 4XKYA 4AF0A 5CSSA 3BLIA 3E12A 2ABBA 3M6YA 1KTBA 1VYRA 1J4EA 2TMDA 3SZ8A 4O54A 1I2RA 1UUMA 2P10A 5AOUA 3O63A 3D0CA 1KM2A 1L6SA 4AEOA 1WDWA 1OHLA 5K4XA 1SZGA 1FCUA 3NQDA 3TCEA 2QR6A 4MY1A 4ZQNA 4ZZ9A 2AAMA 3M7WA 3HG5A 3TK7A 4UIOA 5U7SA 3W76A 2VELA 2YDAA 5I3JA 3EWYA 2C15A 5D04C 1F6PA 1ZHAA 4IQLA 4LV9A 4P61A 3LCFA 3HOJA 1PV8A 5EBUA 1XKYA 4O18A 3W85A 3TSMA 3W7OA 1PHWA 4KFPA 3IIOA 1Z42A 3UY8A 1ZAIA 2OJPA 2GUUA 1ME9A 3I6RA 4PA8A 3W7KA 1P1XA 2YXGA 2WNQA 5D02A 1OX4B 3L0KA 4NZJA 4Y8FA 2DZVA 4TU1A 3O6CA 1VQTA 1AG1O 3OVQA 3ZR4A 1YADA 2VEIA 1W3TA 3I7RA 4M7SA 1SSDA 1V5XA 4Q4KA 2ZRXA 1ZAJA 4C1LA 1KTNA 5G4WA 3U6WA 5FEWA 1C8VA 3W1MA 1I4NA 4GFSA 3M5YA 1FUYA 4FB7A 4NVTA 4WY0A 3MP4A 4JY8A 1I2OA 1SO3A 2QDGA 1PHQA 3BV4A 3GXNA 3RNDA 1GVQA 1J2WA 2A2IA 2ISWA 3ZFHA 3BO9A 1VGAA 2ZYFA 2Y89A 1EUAA 1Q3NA 3DFTA 3P84A 4O28A 1CI1A 4BR1A 3GR7A 4UUIA 3TU9A 1OFOA 2J88A 3GK0A 1F2JA 1ALDA 2HS8A 4RXFA 1NF7A 1YTKA 4LVAA 5HMSA 4NJGA 4JX5A 3EX4A 1KM1A 1TB3A 2JKAA 3BW3A 2DZUA 1WYIA 3KHJA 3L2IA 3MYOA 1JQVA 3IV3A 3UXAA 4K39A 3NQVA 2H3DA 1LM1A 2A1YA 4GWEA 4MFDA 1YDNA 5I3GA 5EPDA 3B0PA 3FJLA 1DV7A 3WJYA 1KM3A 1W5NA 4WD0A 3STGA 3O06A 1Z41A 3P7YA 4A22A 2GQ9A 4JD4A 4I7UA 1VJIA 1JR1A 2RDWA 2A85A 5AYYA 3W1NA 3LHTA 2ATMA 5I3IA 5BMXA 5L9FA 3R12A 4YWIA 3V75A 2KZHA 2JKPA 1X7FA 3FOKA 4TX9A 3C2EA 2H3BA 3O6YX 2YW4A 5K3VA 3WJSA 5C6MA 3CB8A 4UTUA 3NYZA 3KRUA 4K8HA 1UJPA 4CQ9A 2HS6A 3RK8A 3W74A 4DBEA 3CEPA 4N9DA 1YXCA 2A21A 5LKYA 1D3GA 3DFPA 2ATSA 4DQWA 1PCKA 1HUVA 2C6QA 1R47A 3ABSA 4O4WA 1S3HA 1A5SA 1IXNA 4HNUA 5K2ZA 3NQFA 5A8GA 3HB9A 3WJXA 4WJEA 4QM1A 3OBKA 4IX0A 3DHDA 3B04A 3LXCA 5FEZA 3PSWA 1GG0A 3EKZA 1EX5A 4S2BA 2G95A 3MUXA 3CIWA 4OE7A 3RMJA 1EB3A 2TPSA 2VEKA 3W2UA 4N6EA 3BGGA 3L66A 4FNPA 4LRSA 1JULA 3W7DA 2QCNA 4IGHA 3U8GA 4N9BA 2WQPA 4LW7A 4CCDA 3MHUA 2J9ZA 4AB4A 3R2GA 4DXVA 4NJKA 4RJEA 2AGKA 1K02A 1LP6A 1B57A 2NWRA 4JX6A 4NX5A 2DZTA 3NOEA 1QNVA 2HMCA 4AXKA 4IPJA 2BXVA 2DU2A 3B8DA 1GZGA 3T55A 1SQ7A 1V7YA 4M6QA 4FNQA 3L5AA 5AC7A 4I7VA 2E77A 3W1XA 4BFAA 3MW7A 3THAA 5LHFA 3NL6A 1R46A 5DBUA 4YCOA 3G8EA 3M44A 5IBXA 1K03A 1C9DA 1N7KA 3N2MA 2VFIA 4O0ZA 1WOAA 1P0KA 1W31A 2FPYA 1FCQA 4EVZA 2DJXA 4GUFA 3W7GA 5F4WA 1GOXA 1QMLA 4RR4A 5LGXA 1NVMA 3W7NA 2LLEA 3ATYA 2QUTA 2NXGA 3W7PA 1LYXA 3G1HA 2WNZA 3P67A 3BK0A 2CLEA 3PBUA 2DZPA 1TTJA 4NX0A 3P61A 1I2NA 5CPOA 1F6KA 4ORMA 1HO1A 3LB0A 4Z1DA 1TPEA 3SIZA 3TKFA 2NUYA 5AN7A 1TPDA 3DH7A 4UNLA 1S5TA 1BKSA 1R2RA 4M5PA 3LTYA 3W22A 3GDKA 1RQHA 5CKSA 3B0UX 4Y6GA 2VFEA 4HSNA 1WOBA 4GC4A 4UTIA 1I2QA 4LS1A 5D09A 2YX0A 1YTDA 3IGSA 1RV8A 2EHHA 3AO0A 4UTWA 4S1FA 3W7QA 3LTSA 4PL1A 5HNRA 1RVGA 3G3MA 4OBTA 4HNVA 2Y7DA 1J5TA 4EIVA 1GT8A 3GAKA 4QNEA 1NSJA 1F5ZA 2OCZA 4MVAA 1GTHA 4GNJA 3EX1A 2DORA 1EIXA 3FFSA 2BTMA 1DVJA 4I9AA 1D3HA 3NQAA 4O11A 2WSRA 2ISSA 3VE7A 2QCGA 3KVLA 4U4MA 1ZENA 1VC4A 1YDVA 5D03A 4NJIA 2E6AA 3E9AA 4A2SA 2JBMA 1KA9F 5DY3A 4LVFA 3I68A 3B05A 1VCFA 1YDOA 3PBVA 3W2KA 2J24A 3B03A 3LCXA 3P62A 4UFHA 5AHMA 1XUUA 1IXQA 2X1SA 3C3NA 4B5NA 4FX8A 1KV5A 4K7YA 4JICA 1EA0A 3BG3A 3WK3A 1FXQA 1KFBA 1O60A 4H3DA 2YR1A 2VXNA 3NA8A 2TRSA 2Y7EA 4IOTA 2Y88A 1OX4A 2G96A 3MHGA 3C61A 2ZA2A 3F4NA 1JCMP 3KX6A 3FYOA 4FIQA 2RKXA 2Q8ZA 4OV9A 3HF3A 2ZZ2A 3QW3A 1DQXA 4BWLA 3MI6A 3DI1A 1Q6OA 2A6LA 3DBPA 5G4EA 5EY5A 3W73A 4BI5A 2ALDA 2ZA1A 1KW1A 2VEPA 4MOZA 1SO4A 3LV6A 5HUPA 3LXBA 1WXJA 5E1QA 1GTEA 1K7XA 1XBXA 4O10A 1VHCA 3QC3A 4XUGA 1AW1A 4E38A 3SY5A 5IBXC 3RU6A 1OFBA 4ALDA 4IXHA 4Y9AA 5H91A 3WK1A 4JTIA 2E6FA 3P8IA 3L5LA 5MHBA 3MWAA 2O7QA 4KKXA 5F2GA 1TV7A 3PAJA 3L5MA 4NXSA 3C56A 1TREA 3STFA 2Y61A 2X1RA 5F4XA 1T99A 1Q45A 1TPB1 4O1CA 1N55A 4MJZA 3GVGA 3QPYA 3SW6A 3PY2A 4AWUA 1LOSA 2DP3A 3CT7A 1GVFA 3QFEA 5HR7A 1NFBA 2H6RA 5DXYA 2WO5A 4PC8A 3B06A 4NZFA 3TQVA 3SGZA 2DJLA 2ZQ0A 1SR9A 3I7SA 2R91A 3W1AA 1KBIA 3DKLA 2QJHA 3JRKA 4L4LA 3HPZA 2YGYA 3PBWA 4UTWC 1KFKA 1EPXA 4WY0F 5DCBA 1BWLA 2E09A 1WBJA 3DI0A 5A5WA 2C14A 3QM3A 4AH7A 4IUOA 1VHNA 4O1DA 4PCFA 3S5NA 2VFFA 1TRDA 1XI3A 3MI2A 3N3MA 1VS1A 3BW2A 1BWKA 3EB2A 3KXQA 3PULA 4GJ1A 2YSWA 4PFMA 1B3OA 4K37A 3F1QA 3FKKA 2WPBA 1A50A 4HN4A 4RZ4A 1HFBA 1FCVA 4AHQA 4QISA 4ZQMA 1SW0A 1UUOA 2O7SA 1SW3A 4UR7A 5F2MA 4CCEA 3EXSA 4XBSA 3AJXA 2ZDRA 1QCWA 2Z0IA 1VZWA 5D2WA 3HG3A 1T8XA 1TYGA 5LHEA 1VCVA 1JCLA 4N4QA 2NV2A 5K4ZA 1K8XA 2ZRWA 1GQNA 3R13A 3C4UA 3S1XA 1EP1A 1JCYA 1GJPA 3LLFA 3SSJA 5FF2A 1H5YA 1SU5A 3PB0A 1A5BA 5CZ0A 4UNKA 1EUNA 2V8ZA 4BWLC 2GVGA 3LBMA 5LNRA 4TIMA 5TBOA 3LX9A 4ICNA 1FWNA 1H60A 3BGJA 3QYQA 3GIYA 4OQVA 1K8YA 4M6PA 5HWNA 4POCA 1XBZA 4NXKA 3W7MA 3Q37A 1KM4A 1WV2A 2NX9A 3BPWA 3UYCA 5AB3A 2QCEA 3CM4A 4O4VA 4LS0A 1JCJA 2ZZ1A 4JTLA 1ICQA 3PUEA 3JR2A 4YL2A 1IXPA 2VOMA 1TCDA 4RKAA 1WBHA 1K3UA 3PS7A 1PE1A 2ZTJA 3LCHA 4JR5A 3H55A 1OFQA 2FB3A 3L67A 1OJXA 1M5WA 3W75A 2PRHA 3W1QA 4RV8A 2QUVA 2X1TA 2Y70A 5DBTA 3FEMA 4FNUA 4GE8A 3EEGA 2CLKA 3NDOA 5LNVA 2YZRA 1YXYA 5SWUA 3O15A 1TMHA 1XCFA 3BARA 4FO4A 1IIHA 3VNDA 2ZTKA 3IIPA 4GUGA 4K7VA 4L4MA 1TV5A 3W2MA 1XXXA 1O5KA 3A5FA 1FY6A 3QF0A 3O8AA 4JYDA 2F84A 1NAL1 5C55A 4JTSA 3GDRA 1ICSA 3N9SA 1G4SA 5AHEA 3QMRA 4H4IA 2QUUA 3M5VA 4NNCA 1EP3A 3PM6A 1DL3A 4OWGA 4O50A 4PODA 1JCNA 1TRIA 2ZBTA 3M0ZA 2HTMA 3G1XA 3LHVA 5CPMA 3VKJA 1KLYA 3LGEA 1QPQA 2UV8G 3TSBA 5BRBA 2QAFA 4IMFA 3I7QA 4KWWA 1A53A 3F4WA 1M7PA 4Q33A 1JUEA 3JS3A 5AHLA 3EWWA 1TPC1 3G0UA 2X16A 1X1OA 2GJNA 3G1AA 3W7LA 3NAVA 2B4GA 3CWOX 1QAPA 2V9DA 2TSYA 8TIMA 3NNTA 3VFLA 4UMAA 3KRZA 2V30A 2JGQA 5K9XA 2Y85A 3A23A 1QO5A 5DY2A 2B7NA 3DFOA 4NUWA 3HIJA 3L0NA 3INPA 3W1PA 1RQEA 3MP5A 4JYFA 3NVTA 2BSLA 1TSIA 5FF3A 3W7RA 4JTJA 4LNYA 5LGZA 2V2DA 5LNUA 1ZALA 2A7RA 5CPLA 1OK4A 3HMJG 3T78A 2P1FA 4QQ3A 4RLIA 4Z08A 3NPUA 1U5JA 4UMCA 4M19A 3DAQA 3GB6A 3W1TA 1QPNA 1AL7A 3GKFA 3PR2A 3OG3A 3S0CA 4ONVA 4ZQCA 2GQ8A 3ABQA 2QCLA 3M41A 4HHPA 4O17A 3BVJA 1IF2A 3UXDA 3GZ3A 3LRKA 5CG7A 1R30A 3IVSA 3QQ0A 1JUKA 3O16A 4WZHA 4NT0A 5HR6A 1P5BA 4OU1A 5KINA 4Z0SA 3A5VA 3CPRA 4RX0A 1Q6QA 1KFCA 2FTPA 1EP2A 1TTPA 1JVNA 3GKAA 4HT3A 3LHWA 3G0XA 3W71A 3GXTA 2WKJA 4NQ1A 3ZWTA 3HPSA 3G1YA 4IXXA 2CWNA 2FJKA 4N4PA 2ZRUA 3W1LA 2PE4A 1A5CA 5D2XA 4XKYB 4AF0B 2V0TA 3NQGA 1XBVA 4LWWA 3THQA 3TJXA 1TIMA 2FPTA 1ZNNA 3EWUA 3FS2A 3IIXA 4LVGA 1YPFA 2BZNA 5KZMA 1GVSA 3BG9A 4JGDA 3FKRA 1SZEA 2QJGA 3KVMA 2A0NA 4ZQOA 4JXCA 1W56A 3C8FA 4ADUA 4ZMGA 2VC6A 4GUJA 4PL2A 2WJZA 1AL8A 3HG4A 3SECA 2QJIA 1LOQA 4JTTA 4KWVA 1Z48A 2WV8A 4QSHA 3TW6A 3H53A 1OG0A 2I14A 4AWSA 3TQ0A 4MLJA 2OT1A 2NX1A 3UNDA 1H7OA 4K36A 3E96A 2V2HA 2Z6JA 3O1NA 4QIUA 3UZJA 2ZFAA 4KFNA 2CLIA 1YTEA 3HGSA 4BI7A 3OVRA 3W2NA 4GBUA 1XFBA 3N9RA 5DN1A 2GPTA 1PCWA 2GOUA 2PURA 3TA6A 3GDTA 3SI9A 5FF4A 1OF8A 2C16A 2V82A 1LBLA 1W37A 5D2YA 3MMTA 5DCEA 5IM51 1SPQA 1TJPA 3VCRA 1I45A 5J5RA 3N19B 1KFLA 1MSSA 4DF1A 2ABAA 4YMZA 5AC6A 3KVKA 5C54A 2TYSA 4K38A 3BG5A 3M1ZA 3YPIA 2YW3A 4WXYA 3TH6A 1WQ5A 4O1AA 1THFD 4UFLA 2PRLA 4EOUA 3TJLA 3TUUA 2B7OA 3HJZA 3UWUA 4R33A 3M5ZA 5BNKA 3P74A 2W0UA 4LTSA 1UCWA 4U28A 3S1VA 4O1BA 2QKFA 1VRDA 2Q3RA 3V1PA 5EYWA 3MYPA 1ZY9A 1PVNA 2Z6IA 2QCFA 3A24A 4JYEA 1HL2A 2EAWA 3MBFA 1PS9A 1RZMA 1TPWA 3NPWA 5LNWA 4Q32A 1W5OA 1JQXA 4WUIA 4MYXA 4R7JA 3W87A 3LRLA 3R8RA 5FF0A 3P81A 4LVDA 1OFRA 1EWEA 1OVDA 2GQAA 1TO3A 3O6DA 4IMGA 4JNMA 1ZCOA 3QQ1A 5EA9A 4CQAA 3QMTA 4AVFA 1QR7A 1OFAA 4MYAA 2OZ0A 1DJQA 3DENA 5D33A 2XN0A 1UBSA 3C2RA 1KM5A 2BX7A 2V81A 5KSWA 4JIPA 2V5LA 1H7PA 2H8XA 5D30A 5FESA 1KM6A 4RXGA 4LV4A 2FDSA 3N14A 2ZRYA 3PC0A 2EKCA 3ZS4A 4XBKA 3I65A 3W88A 5F1UA 4GXMA 4UFKA 3TAKA 2RFGA 3ZWSA 3S1UA 3QPZA 3S5ZA 2Y7GA 1LRTA 4LUJA 4DPQA 1SZFA
chains in the Genus database with same CATH superfamily
4JHMA 1VIZA 4GQ0A 1L6WA 2CZFA 4UBPC 2PGWA 1QDSA 3LHUA 1CB2A 1V3IA 4HJWA 1W5QA 2FH8A 1VEPA 4CNNA 1ME8A 3WLLA 3QVQA 2HE5A 1X96A 4W86A 4W9TA 1E9LA 2J25A 3EWXA 4CVWA 4J7RA 2R82A 4O12A 1MO0A 4YYFA 4B15A 4WDXA 1R87A 1B4KA 3ELFA 4E2DA 4WEVX 2IPJA 1BTMA 2J78A 1XRVA 1J18A 4TX8A 4KRUA 2OX4A 3PWAA 2VEMA 2O4QA 5FSEC 3P6LA 2D0GA 1JRBA 4J3ZA 4TR9A 4LUIA 4IPPA 3CIXA 3LK6A 2D73A 2OZ8A 2PDNA 3C2VA 4MAVA 4QNWA 5HQEA 2OOGA 4ZB2A 4E4FA 5KEZA 3GVQA 1OF6A 3PZUA 1AODA 1HW6A 2Y2WA 2J47A 3ZLFA 4HNNA 5FEPA 3N73A 3G2GA 4MNLA 2P0OA 5AC8A 3R79A 1XCWA 4C7FA 4Q4OA 4FEZA 3WBYA 3GTXA 4QAIA 4TMCA 1I1WA 3GO2A 3LBOA 4PUDA 3NQBA 1RY0A 1H7XA 4IMDA 4PMDA 2YXOA 2DW7A 1O95A 3VGBA 5AYXA 1AVAA 3B8IA 1UR8A 2XIIA 1O1ZA 1CCWB 5D37A 1IXOA 2O0TA 3XIMA 2Q01A 4AHOA 1RQBA 4D8LA 2ZXBA 4I5XA 4XISA 4EF8A 1JUBA 3BICA 3IPWA 4PTVA 4JN8A 3S3GA 1UH4A 3KAOA 3QLDA 4MKNA 4ZEPA 4XZLX 4H6QA 1IGSA 5FSDC 3LOTA 4XTIA 4IG2A 4ICMA 1C92A 3KLLA 3NQ8A 3QRHA 1D8WA 1WXYA 1TWWA 3EOUA 3BUVA 2PWFA 3PTDA 4DJFC 4OV4A 3LCLA 2Y63A 4MIMA 3CHDA 4GABA 1E4NA 1TPUA 2FZBA 2D0HA 3S42A 3SCWA 5ABGA 1F9CA 4LJ3A 4QEEA 1F76A 3TLLA 2WKGA 1KGWA 1MW3A 3AYVA 3AISA 3G77A 3A3XA 4HYWA 2J74A 1SUXA 1E1EA 3FJ6A 4A29A 1UUQA 3AYTA 2HZGA 1OFDA 3GXFA 5E93A 4IMAA 1G7UA 1P7TB 2RDTA 4LY4A 5KTLA 1G67A 3MT1A 2EF9A 2CLMA 3EKGA 3DHFA 3V0UA 4NY2A 1E6RA 2NXHA 4PTWA 4N9CA 2VDHA 1FKXA 2GSEA 2YPIA 1K7EA 5I24A 3ZJ7A 1D9EA 3QPEA 4JN7A 4L80A 1FXPA 2PWHA 4EAMA 1O5QA 1UR4A 3H7VA 4C6KA 3SGUA 2O9OA 2FFCA 3MVIA 2WMKA 3OQ8A 3IEBA 1UZ1A 2PODA 5EKYA 3VGFA 3UWYA 1CWYA 2IQTA 4MY8A 4HZ7A 4FOJA 4U3CA 4UCFA 3SQLA 1YNPA 3UZ5A 4DPPA 3QHMA 1DWGM 2OFJA 1Y5XA 3A13A 2R8WA 1FWBC 1A0CA 3IIVA 4IFRA 4ACYA 4XTDA 1EEXA 1ZFJA 2JGYA 2WHLA 5AFDA 1B3WA 2E9LA 3LCGA 3BAWA 5GJNA 4Y7EA 2DGAA 1RY8A 4J28A 4L9ZA 1P6BA 2BMBA 2VNCA 4Y2WA 3KVJA 3GR8A 1JGMA 2XN1A 1NF0A 1B3VA 1RD5A 3P14A 2QLYA 3AWNA 1EZWA 3P3BA 1JJKA 2PTZA 3M7SA 1GYMA 3FLUA 2GGHA 3QZ6A 3A6OA 1FWRA 1XUZA 1CX9A 4F2BA 4PFHA 1GKPA 1QPOA 1P0EA 3WFAA 4HU4A 3C2OA 3EDEA 1DBTA 1OC7A 4Y90A 3PUOA 1OK6A 3PB2A 2W66A 1Q2RA 3GDBA 2DIJA 3MSDA 4D72A 2V5DA 2QCDB 2ZUTA 3QY6A 3C5QA 3GUWA 2DZSA 1ONRA 2IKIA 4QROA 1RD6A 3AXXA 3RIKA 4I9TA 4IFKB 5F2IA 1KLZA 3STPA 1UIPA 4OHQA 5CC5A 4F66A 4LAKA 4HOZA 3P60A 1ZJAA 2YL5A 1M6JA 3K4AA 4LU0A 3ANYA 1IR2A 3HM7A 5BMWA 1GPFA 4NJHA 3QHOA 4FX6M 3MDUA 2WMHA 1BHGA 3W82A 2F2KA 4WDTA 1EBHA 1SO5A 1ADOA 1KRAC 4MZ1A 1UOKA 3K8LA 2A3EA 2XIMA 4IMCA 2CLFA 1LQ2A 1MVYA 4RE2A 1HJXA 2J9XA 4PMQA 1RJPA 4UTFA 1TMLA 1GYNA 3LCIA 4RW5A 3GNPA 4ZL1A 4DI8A 4ERIA 2E4TA 3LBCA 2GYIA 1X1ZA 4FP1A 3D46A 3IJIA 1H4PA 2PU1A 2G4JA 5DFAA 3CUGA 4UR8A 1PWMA 1VLIA 2RAGA 1BSLA 4AVNA 3MVTA 4H6KA 4GX8A 4ZQRA 4KRZA 1EQCA 1KTCA 3L9CA 4P8UA 5A6TC 2R1NA 1AK5A 5AHIA 4H04A 2BHUA 2E6YA 4JTQA 2FZDA 3T05A 4JTAA 4GJJA 1V4YA 1WDDA 3TQKA 4Y9PA 1FDJA 1XINA 4HPJA 4EWJA 4B4FA 1BWVA 1CGXA 5T9CE 4OGZA 1PJ9A 4R7OA 4HNLA 1SZNA 2UY3A 3KLKA 2X41A 2FQIA 2PDJA 4Q22A 5HWJA 1FHDA 2ZA3A 1X7IA 1OX5A 4FXRA 5BU9A 3WK0A 3W6YA 1QO2A 4HGXA 1X6LA 1GOIA 4HQVA 4FXJA 1JPMA 2GVJA 2V67A 5A2CA 3UR8A 4E5TA 4M29A 2OX1A 2DUAA 5EB8A 4XWUA 3MB9A 4RE4A 4LAOA 4GRSA 3MA8A 3TYBA 5DLCA 4LT9A 1GONA 4H8VA 2I17A 5L6UA 1FDYA 1HKMA 5CBBA 5G1YA 3CL8A 1JNEA 3CAWA 2FKPA 3HBLA 1HJQA 2VX7A 3UWWA 1F74A 2BNJA 2RDXA 1F7BA 1H0GA 4X61A 1LZOA 3TAOA 3B9OA 1T7LA 1XPYA 4ZFMA 3PWIA 3KRSA 4JTFA 4QSFA 2ZVRA 5A69A 3L65A 3EX2A 4ZXOA 3UZZA 1VCGA 3WQFA 4LYQA 4NZ1A 3WD0A 3I10A 4LALA 4MAZA 3PZIA 4JFSA 3RXZA 2OQLA 3PK7A 5GVJA 4GUIA 2OMAA 3EPOA 5CZTA 4EAYA 2I1OA 1WKEA 5E70A 2QDHA 4Z1CA 1ZAHA 2A79A 2VZVA 1NWRA 3A3WA 5DQPA 4WVXA 2VZSA 3UG5A 3LN3A 4F2UA 3H26A 3TC7A 1ME7A 3WBAA 4PCSA 4X2RA 2NV1A 3U3HA 2A5HA 4DUWA 4CEXC 3UPWA 1QHOA 1NOFA 2J9YA 1LLZA 2WOQA 3LA4A 5F1VA 5I78A 3EYPA 3G8RA 4HTYA 2V63A 3O07A 3EXRA 3W86A 3GAYA 2Z2AA 3DXIA 3SR7A 5HWMA 1LRNA 1P0DA 4H9XA 4QJ4B 4WQ6A 4GGBA 4B91A 4NAEB 4JIHA 3ITOA 3KZPA 4WX2A 5G5IA 1JYNA 1FP8A 4R9OA 3T7VA 1P4CA 3FHQA 3VIGA 1YRRA 1SMDA 3L0GA 3NJ3A 1MXSA 5CC3A 4ROPA 3WDPP 1J93A 4I7WA 1R9XA 1UP2A 2PC4A 4B3ZA 1UASA 1OYCA 3EX3A 5CPNA 4IX2A 1DOSA 4UFJA 1J8VA 1L9WA 3ABRA 3PHAA 1NDVA 3ABOA 1UKPA 1ZB5A 4DJEC 1QBBA 1VYSX 3BLLA 2XFRA 3SCUA 1KFEA 5F7UA 4YTQA 2PBOA 2DZBA 3B9NA 3GXMA 2IW0A 1TJRA 1PAMA 3L68A 2CBJA 3TZFA 3LMZA 3NFUA 5HJLA 4U2YA 1Q6RA 3TV8A 1OFEA 3G5EA 2PDYA 1FRBA 2CIPA 2WSQA 4FZIA 3CUXA 4L64A 3ZZ1A 3P0XA 4B4HA 1GZ1A 4AAJA 2YB4A 3BW4A 1GKQA 1FX6A 3CYJA 4M24A 3P80A 5LIWX 3WNPA 1DKWA 1FH8A 1ML1A 4MB3A 2J7CA 3ZMRA 2NWSA 1H7NA 5E09A 3VNKA 3OO2A 2NVAA 3SRFA 4C1NB 4UCGA 5D2VA 4IJCA 4CLMA 3N12A 3AXIA 1TMQA 3G1FA 4JS3A 1XDLA 1TTIA 2VZTA 4KCUA 1DQUA 5DRCA 2Q8LA 1E6NA 3RMEA 3VK5A 3HURA 1Q8AA 3EB3A 5EFFA 1ZSXA 2FTYA 3TW7A 1DWHM 4YLWA 3WO8A 2FVMA 3WEZA 4K2SA 4P7NA 3ZSSA 1GVOA 4MFEA 4IJBA 5CG0A 2JK2A 4N02A 5EL1A 2A7PA 4NNBA 5EMYA 1WKYA 4GPNA 4IH3A 2ABBA 4D6FA 5D8ZA 1RHCA 4D6DA 1PIGA 1VYRA 3L4ZA 3GWQA 3HMCA 1I2RA 2P10A 1GJWA 1R85A 3ZQ9A 3D0CA 4NZ5A 1QASA 1WDWA 1OHLA 3WLQA 5K4XA 4G2DA 1SZGA 3LSCA 4KGLA 1FCUA 3TCEA 4MY1A 3GIQA 2AAMA 3K5XA 4IM4A 5RUBA 2J77A 3AHTA 3AMGA 3OLGA 1CT5A 5D04C 2E1WA 4LQ1A 3MTWA 2VD8A 2BVDA 3EDJA 1XKYA 3AUJA 2YZ5A 3IIOA 5A2AA 2GSHA 2GUUA 3AZSA 3SCTA 3R8HA 1P1XA 5J8LA 1K9EA 4NSBA 5C9XA 4HU8A 1VQTA 4LEFA 4JCLA 1CXLA 2QPSA 4JCMA 1AD4A 4TVCA 4LBRA 3C8NA 1ZAJA 1KTNA 3W1MA 4PTXA 4GFSA 3BMWA 1R7AA 1FUYA 4O1FA 5CPSA 3ZXWA 4FB7A 3MP4A 4JY8A 1SO3A 1Z8AA 2QDGA 1ODUA 2NW0A 3GXNA 3RNDA 1IR1A 2E9BA 4J27A 3HFYA 3ZFHA 3CZLA 2OQHA 4M8UA 3MUAA 2ZYFA 3TONA 2Y89A 2CEQA 3GSMA 1CI1A 3LMYA 1EA9C 3GTIA 4QAWA 4UUIA 3SM0A 2J88A 1ALDA 3AXKA 3KWSA 4V2XA 1NF7A 1YTKA 2PDQA 3HTWA 1LL6A 3KHJA 1Q6EA 3AXMA 3AHYA 3U0HA 2CPUA 4K39A 3CMJA 4ZR8A 4L6HA 5I3GA 1MDRA 4XX6A 3WJYA 1PDZA 3STGA 3P7YA 4JD4A 1VJIA 1JR1A 2ZUNA 3LHTA 4AW7A 2X09A 3R12A 1YBQA 2PP3A 4YWIA 1W3KA 1K6AA 1US2A 1ZRQA 4BF7A 4EXBA 3MKCA 4TVUA 4EACA 2YCKX 3UF9A 3M07A 4TTGA 1PWLA 2H3BA 3O6YX 5K3VA 2ISFA 1Z7AA 5C2GA 3V1HA 1CB7B 2NLYA 2ESCA 4GIEA 1C3FA 3W74A 2YIHA 2XSBA 2A21A 2XISA 1JD9A 4IUGA 2VVSA 4WKFA 4DQWA 3V5FA 1PCKA 1E4LA 3ABSA 1IXNA 1UG6A 1OWQA 3NGFA 3ARQA 5K2ZA 3NQFA 3DUGA 2R1KA 2OR2A 1DIOA 3B04A 4D71A 1GG0A 1EX5A 2G95A 2HNEA 1EB3A 3SSZA 3VVGA 3WD4A 4N6EA 3IANA 2BOFX 3ABZA 3MKKA 1SR0A 3L66A 4FLOA 1MXDA 3VKAA 4LRSA 5AYBA 4AZBA 1JULA 3LY0A 2QCNA 3ARUA 4W84A 4IGHA 3VOJA 2OGYA 3RCNA 2IPFA 2AGKA 4G7FA 1TZ7A 1UR9A 2DT1A 1PKNA 4JX6A 2NWRA 5MF5A 1BTCA 4V27A 4WKHA 2HMCA 3Q65A 3SADA 2DU2A 2VRJA 4M6QA 4NG3A 4FNQA 4TTUA 1A3WA 4MWAB 3QV9A 4BFAA 5LHFA 5BROA 2HQAA 4GIAA 2YBUA 1K03A 2OKOA 3N2MA 3CHEA 4O0ZA 1IZKA 3MY9A 2DJXA 4EVZA 5JBEA 3W7GA 2W27A 3R7MA 2Y5JA 1GZJA 3JU2A 3W7NA 2Z7KA 1C7SA 4Z2LA 3WF2A 1OQFA 3S4TA 1BVNP 2G3JA 2WNZA 3GNOA 3P67A 4Y9NA 4ASTA 3NO3A 1QATA 4NX0A 2PDHA 3DGBA 3KOXA 1HO1A 1XW8A 1R3WA 3BOLA 4GXPA 2IPWA 2NSXA 1AH0A 2I7GA 1VD6A 1S5TA 2YOCA 1BKSA 1EJXC 2WANA 3W22A 4U3AA 2O55A 3ZIZA 1YDYA 3B0UX 2VFEA 4HSNA 1FWDC 4AZ7A 1E73M 4L6DA 3HQOA 4QR6A 3NIYA 5D09A 3TN3A 1YTDA 2EHHA 4DZ5A 1T8QA 4S1FA 2GDQA 1RVGA 2GK1B 3BAKA 1E4IA 4S3DA 3W24A 1GT8A 1QK2A 1NSJA 4A4AA 4OKDA 1WZLA 4DWSC 1E9ZB 1ONXA 2VWTA 2BTMA 1DVJA 4I9AA 5CJNA 3NQAA 3WLHA 2ISSA 5JQ9A 7A3HA 2X8RA 4K68A 4GQGA 1ZENA 1LLOA 2E6AA 4IPNB 4A2SA 4MNMA 1KA9F 4S39A 3AHXA 1VCFA 4C5ZA 3EAUA 4KF1A 4UFHA 1BKHA 3MO4A 2ZC8A 4MJ2A 4B5NA 1WZKA 1M03A 4PMNA 4JICA 1KFBA 1O60A 3PZOA 2ON3A 2BY1A 2VXNA 2PWVA 4DLFA 4A8LA 1PDYA 1PO9A 2G96A 3ARRA 4OFCA 3FYOA 1XYAA 2Q8ZA 4LGXA 2ZZ2A 2PS2A 2QPXA 2ZX6A 3MI6A 1PKYA 4S3AA 3DBPA 1DJWA 2V3DA 5EY5A 3MV01 1KW1A 2VEPA 1HKKA 3JW7A 5T91A 3KBWA 3LV6A 5HUPA 3GYCA 1WXJA 1XJBA 3CJPA 2C0HA 3QC3A 1C93A 4QHRA 1H2JA 1XLKA 1MUMA 1VFFA 3D3FA 4E38A 4F0HA 1BG4A 4Y9AA 3WK1A 2PLCA 3P2VA 5C0QA 2E6FA 1DIEA 1TX0A 5LA2A 5CPTA 3T2OA 5MHBA 4KKXA 4DBUA 3C56A 2BVWA 2GJXB 1M7XA 1XIJA 3B97A 4UQ9A 4D6HA 2J8FA 1Q45A 1XRSA 3GVGA 3I3EA 5H8PA 3ARYA 1XH0A 1GVFA 3IJLA 3QFEA 4FAMA 1QNPA 2WKLA 1HP4A 2H6RA 2PLJA 4QLJA 3VGDA 6REQB 3RX3A 1Z32X 1AQMA 3TQVA 1CXIA 4P7RA 3I7SA 3W1AA 3IJQA 3ABXA 3UGVA 3ARTA 3DKLA 4I8DA 4GC3A 3JRKA 1KFKA 4MJ4A 1BWLA 1NM9A 2E09A 1WBJA 3T0CA 3DI0A 5A5WA 4GI8A 4E4UA 4EK7A 1KCXA 1MMFA 4IUOA 1VHNA 2WM1A 4O1DA 4FK9A 3GM8A 2VFFA 5CEWA 3DYPA 3EB2A 1TV4A 2YSWA 2FMNA 2VGFA 1PTGA 2WPBA 4A05A 2XVGA 3QR1A 4RZ4A 4WF7A 4AHQA 3U2CA 5I6SA 4ZQMA 3CQJA 1SW3A 3KTCA 4WLCA 4A8RA 1NP0A 3N29A 3WUEA 2CXEA 1QOXA 1VZWA 1JZ5A 4RDWA 2PD9A 1IV8A 4HSHA 4B9YA 3MDWA 1UH3A 4F4RA 4E8GA 3VIHA 1GVEA 2UY5A 3C4UA 1AJ2A 1UQZA 1JCYA 3KTXA 3SSJA 1MUWA 1A5BA 5CZ0A 2OODA 2PDMA 3LBMA 3VM7A 4M80A 4BWLC 4D6EA 3LX9A 3S46A 3NURA 3WNKA 2UWFA 4QE5A 1K8YA 4F8XA 1YW1A 5HWNA 2WAGA 2ZE0A 2YBVA 3BPWA 3UYCA 3SN1A 1V3KA 5H6HA 1IXPA 3NEHA 1QUMA 3QV8A 4X0VA 3BANA 4QTGA 1HGWA 3W1QA 4L4OA 2Y70A 3QBUA 5DBTA 4FOUA 3TJ4A 1W1A1 3FEMA 3T81A 4DN1A 5CLTA 3UU0A 3NDOA 5LNVA 2ALRA 3GC2A 2EO7A 1D2KA 5CPQA 1KR1A 2YCLA 5SWUA 4MSSA 2YL6A 4FO4A 1UWSA 1IIHA 4XD4A 4K7VA 1IZCA 1GK8A 3F4VA 4I3GA 3W2MA 3A5FA 3O8AA 3WQDA 2QQ6A 2BODX 4JYDA 3WL0A 1J0ZA 4V1YA 4JTSA 5A6LA 5LXEA 3GDRA 3BCFA 3PANA 4GLEA 3ANUA 4GQQA 3T09A 3PM6A 1E40A 4OWGA 1TE1A 2ZBTA 4PRRA 3M0ZA 3VKCA 4IQJA 1V8EA 4CUCA 3U9IA 5DT5A 1KQZA 4B5UA 1E0XA 1GHSA 4CQBA 1B9ZA 3W27A 3F4WA 3PTQA 1M7PA 4BS0A 2Z4GA 3JS3A 1R6WA 1DIDA 3TYEA 2X16A 3G1AA 3N6QA 3W7LA 2VL4A 1J0IA 4ZCWA 2V9DA 3VFLA 3ONBA 3WUGA 2GSJA 1IWPA 3EPNA 2V30A 2JGQA 5K9XA 3CTTA 3AJ7A 4MB4A 3H23A 4LYRA 3VC6A 4HZ8A 4NUWA 1PKMA 3CH9A 3HIJA 2XPKA 3INPA 4TVDA 3DESA 4YHGA 4JYFA 4S3CA 1TSIA 1ISWA 2JE8A 3CUZA 1OCJA 3SQMA 5LNUA 1ZALA 2A7RA 1ZJHA 3PZGA 2P1FA 4PGLA 4QQ3A 3AIEA 2BHYA 1K8CA 1OCQA 2EJ1A 3NPUA 1ZP4A 3DAQA 3MV11 2RJGA 3PR2A 3S0CA 4NAEA 4ONVA 2GQ8A 3N4AA 2QCLA 3WUFA 4O17A 1QNSA 3BVJA 3N4FA 3ZT7A 3NSMA 3UXDA 3LRKA 4WIWA 3IVSA 3C0QA 4WZHA 1X6NA 1PX8A 3A5VA 4RX0A 1VEMA 1EP2A 1TTPA 4LUYA 4HT3A 1S2WA 1NOUA 2OYMA 3G0XA 1BFNA 3SB0A 3G1YA 3UXKA 3AROA 1QVBA 1W9XA 1ZBCA 2FJKA 1X39A 3EBVA 1A5CA 5D2XA 1A5MC 4AF0B 4LWWA 4X60A 1GNXA 2FPTA 1E43A 3EWUA 1LQ0A 4H01A 1YPFA 2BZNA 3BH4A 2X42A 5I09A 2WMFA 1R9ZA 4ATWA 1M9HA 2PMQA 3FKRA 1SZEA 2QJGA 5JMUA 3KVMA 1W56A 4XUYA 3OBAA 4C6PA 3C8FA 2WJZA 1EL3A 2VUYA 3HG4A 3RUBL 3R0KA 5TD4A 1TCMA 2VUNA 1Z48A 3ZR5A 2MNRA 5LIKX 1OG0A 2I14A 3F2BA 1XIBA 1EO7A 2OT1A 3CQKA 3GW0A 2NX1A 3UNDA 1SFSA 1REQA 3SUVA 1ZZMA 5DRIA 3DYOA 1HNYA 2Z6JA 3EWDA 4YTTA 2ZFAA 2CLIA 3ERPA 3KDNA 1K1DA 3II1A 1PCWA 4H7VA 3BOFA 4C91A 3TA6A 3SI9A 2HPIA 4IP7A 2C16A 4JFUA 2HDJA 3OLDA 3M0KA 2YJQA 5DCEA 5HNTA 3VCRA 1KFLA 1U1UA 1BD0A 4DF1A 2C91A 4ZA0A 3KVKA 2OYKA 4A3RA 3M1ZA 3WG6A 2G4FA 2YB1A 3TH6A 1OADA 3IK4A 4O1AA 4CKQA 3QGKC 2GLKA 3TJLA 5XIMA 3SQSA 3HJZA 3UWUA 4E2OA 3M5ZA 5BNKA 3S1VA 2O9TA 2QKFA 3QFWA 4EX4A 3GQYA 4GIRA 1ZY9A 1XYMA 1B54A 2EAWA 4Q6JA 3MBFA 2WJFA 5D9MA 1TPWA 4BF5A 3VOFA 2ODOA 4IIDA 1FWCC 3WQEA 3P81A 4LVDA 2O56A 1OVDA 1XYLA 2DEPA 3O6DA 4IMGA 4ZB5A 3A4JA 1JXKA 5JUVA 3QMTA 2D2OA 1QR7A 1K4GA 1B2YA 3WH8A 3R6IA 4E8CA 4P8XA 1DJQA 2GZXA 2HJPA 3DENA 5D33A 1O68A 3CV7A 3C2RA 1KM5A 1JI1A 5I2UA 1U1JA 1PXGA 4JOMA 1KM6A 4RXGA 1YNQA 3ZS4A 4XBKA 3I65A 5IXEA 1UWRA 4DJFA 4IF2A 4UFKA 3TAKA 3ZWSA 4RPPA 2Y7GA 3URNA 1SZFA 3FHAA 4PUNA 3H21A 3T07A 4GACA 4XKMA 3IUHA 4DF0A 3DG7A 3QSRA 4RNIA 3ID7A 1M53A 1CBGA 3VCCA 1WAUA 2WZHA 3S5OA 2Z00A 3QR3A 4PH6A 4DWSB 2JIWA 2HXTA 4QEHA 2FB2A 1CW2A 3QJAA 4BJHA 2QMJA 3O05A 4ZTXA 2VENA 4FR1A 2NQZA 4MHBA 1BF2A 1V3HA 4GH1A 1HN1A 4G9PA 3B3DA 2QV4A 3RX4A 1H1NA 4ZFCA 4ZGYA 5JIPA 1LCOA 1B3ZA 3RAOA 3W7IA 1H0IA 2YXXA 2FHFA 1W1IE 3SUWA 1HGYA 3RPTA 3CEUA 3TNOA 4Z2HA 5A1AA 1A3XA 1Q66A 2D22A 3K8MA 5CBJA 3FY1A 1KXVA 1XHGA 4PTNA 2E40A 3H8AA 2DUZA 4P2VA 5KZEA 2WW5A 1S39A 1FWWA 4ATLA 3C6CA 3TN6A 2GWGA 4G1NA 1VH7A 5DCDA 4UC5A 2Y62A 1UKOA 4MY9A 2X7WA 4IP4A 1PBGA 5HDRA 1QWKA 2FDMA 4LS2A 2C13A 4PTMA 4JFTA 1W1ZA 1FHLA 4RK8A 1TX2A 1LWIA 7TIMA 4Q7IA 3NL5A 3C3UA 4DBWA 4O8RA 4DO4A 2O9PA 1EXBA 3SGGA 1YXDA 1W54A 4REQB 1E6PA 1RR2A 1YPIA 2ZKMX 2X30A 2NQ5A 1I60A 1Q63A 4GVGA 3PZ9A 1EHNA 2FH6A 3LV5A 1SFJA 5CH9A 4BCEA 2OSYA 3MKVA 5C70A 1W8SA 4NAFB 2BG5A 4N2YA 2ZXDA 1UWAA 4HPHA 4HZMA 3EWBX 4UFMA 1XLDA 2G3IA 5J04A 1QNRA 4DM1A 3UCDA 1WKDA 3HZ3A 4H7CA 2VR2A 2VCAA 4O14A 2ZXAA 3EMCA 5U4NA 2O4MA 1MEIA 2PDFA 4KQNA 4YU1A 1DWJM 4TMBA 1WX0A 3LEPA 5FACA 2QCMA 1XX1A 1FHVA 3BLOA 5HMEA 3W02A 1E71M 7REQA 1EDQA 1O94A 1Z44A 2PP1A 1OD0A 2VEFA 1HKWA 2ZXQA 4GQBA 1K8ZA 4LVBA 1TJ2A 1XFCA 1XG4A 2VFHA 1WDQA 1EJWC 1UC4A 3LPPA 1N8FA 4FNSA 1NEYA 2Z7GA 3ZJKA 3V4BA 1EF3A 4TX6A 2PPGA 4S3EA 4O15A 2E67A 5BXSA 3TMQA 1XIHA 3CMGA 2J7BA 1UH2A 2PI6A 4BI6A 1HKVA 4M7TA 3GX9A 1RXOB 2BXZA 1CGTA 2W62A 3REQB 4AZ5A 3G24A 5I3KA 5T26A 1RALA 3V35A 2J7FA 1H61A 3S6TA 3LGGA 1RCQA 3W72A 1XGZA 2P8BA 1JFHA 6TIMA 3PN8A 5FI8A 3FXGA 3A4XA 4MADA 1KBLA 3WQGA 3RO8A 4H9YA 1UW9A 4H7ZA 1EPVA 3ATZA 2CESA 4HIBA 3NDYA 3Q4DA 3R11A 1I1XA 2XIBA 3Q45A 2GUYA 2XFWA 1S5WA 1IT8A 1B9BA 1GUVA 3EWCA 4ML9A 4HA1A 1XDMA 2E68A 3H4WA 4IICA 4J5NA 2WNNA 3U4FA 4N9EA 3M5XA 4J4KA 2R1PA 1DJXA 5BXTA 5DF0A 3QC0A 4EWND 1MQQA 2RGMA 4KBXA 3CT2A 1W1TA 1TV8A 3WDIA 1UMYA 1JYVA 1DWIM 1K7FA 3V3WA 3IGXA 1QNQA 3OGRA 3D3AA 4FOKA 1G4EA 2FGLA 5HUOA 1JIBA 4RDYA 1GJUA 4LC8A 1E6SM 4R34A 4DJFD 3LLDA 3E49A 4LRTA 3B4YA 2NSOA 4G6CA 3Q67A 4MNJA 1FWJC 2WVUA 3AYSA 2UY2A 2Y1HA 3NTYA 2F9RA 4PUKA 3ARSA 4HHMA 3RPDA 5M5DA 4IL2A 1FH9A 1K77A 3K1DA 4QLLA 3M46A 4PB4A 2A4AA 4AZCB 1TWIA 1ZU8A 3UPBA 3IGUA 5ABTA 2J6XA 4ZE5A 3EWZA 3M43A 5ECVA 3UWZA 1YEYA 1R38A 3DIPA 2J13A 1RUSA 3M0JA 4FNTA 3WLJA 1XQKA 3KDOA 5C5YA 5GJPA 6PTDA 3SRKA 3QHNA 3TP4A 3LU2A 4JNZA 3DFNA 4UTTC 3MBDA 3OODA 2E5DA 2Z1XA 1LOLA 5CJMA 1E3XA 3MCNA 1T41A 3M9YA 2W3ZA 1XIFA 3VNZA 2FPVA 3TMLA 2Z2UA 1H63A 1YMYA 3ES8A 1X8CA 3OG2A 2D3NA 3ITTA 3CXOA 3A47A 1MI3A 2G97A 3P5YA 2GJRA 5AVHA 2YFOA 3KBVA 3TE9A 4JDBA 4UFIA 1F73A 4Q8OA 1O4UA 1QWGA 1EJSC 3OZOA 2PDXA 5FJRA 2H90A 1M04A 5I02A 1UD4A 1IEIA 1AMKA 2DSKA 4DJEA 4I6KA 3T1GA 4YVVA 3U2OA 3MI3A 2X1UA 3SN0A 3PZTA 2Q09A 3CHFA 4C6QA 5KZDA 1G4PA 1C8XA 2VC9A 1UR3M 2G8ZA 2QS8A 5BYWA 2HISA 5PTDA 1OG6A 1UHVA 3TTEA 4C6MA 3W3OA 3HGRA 3NG3A 4UR9A 4QITA 2BVTA 4PEKA 3HPXA 3O7UA 1AW5A 2WSYA 2AL1A 1W3NA 1ADSA 3I3BA 3AFBA 4LCRA 3UXLA 2YCJA 3TDFA 1G69A 2AL2B 3GG0A 3CK5A 1GEQA 3R1ZA 2NX3A 5BW6A 1E70M 4PMYA 4HPNA 4RZBA 3T8LA 2QCHA 2J75A 1FFRA 1X8FA 1XLJA 3RR1A 1Q6LA 1VAHA 1PYMA 2P0IA 3AWOA 4HNTA 5FJIA 1R3VA 3LPFA 2REQB 3EOOA 4J3TA 1MEHA 4L1GA 4B3KA 4HU0A 2D23A 2FIQA 3ECQA 4AX7A 2EGZA 5I79A 1BYCA 6XIAA 1UROA 4TOQA 5IFPA 1EYWA 2ONEA 4YCPA 2QZRA 1VYPX 2L5HA 5I3HA 4C90A 1V03A 5FJPA 2EPLX 1JRCA 2OEKA 5HULA 4HYVA 3ZT5A 3FYPA 2JKEA 4M82A 1QOPA 1W8GA 4XQ6A 5HOSA 1PX4A 1CDGA 2DSUA 3HA1A 3KBNA 4DY1A 2ZCGA 4LNCA 4CD6A 4KEZA 1EIBA 1K9DA 2X0YA 4EP8C 4JEQA 4J40A 3W9ZA 5BWAA 4NNAA 2HE8A 3D6NA 3PJXA 3UESA 4BA0A 4YJ5A 3PG8A 1H1ZA 1AH4A 2WQDA 1GQLA 5BZAA 3AIQA 1D7KA 1A80A 5CZSA 4GO8A 3W7JA 3VGHA 1H1YA 4HKPA 3NSXA 2ZZ4A 3E2SA 1TZ9A 1H50A 4Q8NA 4A21A 4RCXA 4HNOA 4DO5A 3UG3A 3GHRA 3RLUA 2WMGA 2WYSA 4N6FA 5D38A 1GOWA 2OT0A 1GW9A 3MSGA 2VI0A 1JYXA 2NUWA 4NZCA 4F40A 3BAJA 4S2CA 3BTNA 1I2PA 3NQMA 5LIYX 1UPPA 5REQB 1SFLA 1E5NA 1KFJA 4Q4MA 4G8TA 4J3VA 3AQUA 1NU5A 1OBAA 4L65A 4MNKA 1V6XA 4PBEA 4EF9A 5LNSA 2DT0A 4JHZA 4DYKA 4JTUA 4QDPA 1AJ0A 3VD9A 4KEUA 1Q65A 3GNXA 3N6JA 4UXDA 4WOZA 1AW2A 5FAGA 3GBDA 2C1IA 3GYEA 3W1UA 3G6MA 3N2TA 4U31A 3E1F1 3G1VA 3K8KA 4OT7A 2OO0A 2VQTA 3G0SA 2ZZ5A 3CASA 4D1IA 3QYSA 2A3HA 3I3DA 3P82A 3UJRA 3EPMA 2NT1A 2KX9A 4UTKA 4JPGA 5KETA 3B9EA 2Q8XA 4AF0A 1BSIA 4LAMA 4W7WA 1KTBA 3BAIA 1TA3B 2TMDA 2JFEX 4PB3A 5A94A 3SZ8A 2BY3A 3GFXA 4QFUA 3M0VA 4H9ZA 3T2PA 1L6SA 5JH1A 1POKA 1NELA 4Q7BA 4AEOA 2QJMA 1Z89A 3AIRA 4FLSA 4AD3A 4LCSA 4ZQNA 1XLHA 3M7WA 1EGMA 4UIOA 5AZ1A 3W76A 3QGVA 5I3JA 2C15A 1F6PA 4C60A 1ZHAA 3LCFA 3V0TA 5M1TA 2YA0A 2EPMX 3TSMA 1N2VA 3W7OA 4KFPA 2AMGA 3APGA 3TTYA 1ZAIA 1ME9A 3I6RA 3OTRA 1HKJA 3W7KA 2OG9A 1DWAM 1XRTA 5D02A 1OX4B 4Y8FA 4TU1A 1UR0A 3O6CA 2J7DA 3OVQA 4LH8A 3ZR4A 4AXNA 4M81A 5M17A 1SSDA 1V5XA 1ZP3A 1ZBVA 4Q4KA 4JNYA 5G4WA 1C8VA 1PZ2A 4L1WA 3THCA 3M5YA 3P93A 3CWHA 4WY0A 1M68A 3CB3A 3SN4A 2XVNA 2AKMA 5H8MA 3TJIA 1PHQA 4JEJA 4S3BA 3SUTA 4I9MA 1JDCA 4F0RA 1J2WA 3ES7A 3R58A 4DJED 4HCHA 2J8GA 1G01A 1F4AA 4BR1A 3GR7A 1OFOA 1Z9AA 3RDKA 2HS8A 1BRLA 3WH5A 1RP8A 1MW1A 1DXEA 2FHBA 3EX4A 1TB3A 2WVVB 2P50A 1S2VA 4OTKA 2DZUA 1DXIA 2B81A 1V0LA 2MUCA 1JQVA 2CHNA 1NDWA 2F6UA 3NQVA 5LA0A 1DJZA 4ERGA 1TZZA 1VFLA 4QP0A 3VINA 1XYBA 1KM3A 4WD0A 3T8QA 4JL2A 1Z41A 4A22A 4I7UA 2QHAA 2BOEX 3W1NA 3CZ8A 4OBRA 5BMXA 1JYWA 4JFWA 2VX5A 3RX2A 3V75A 1B5TA 1KO0A 3WF4A 4DUOA 2KZHA 3FDKA 4JFVA 3THDA 2HEJA 2OPJA 1FTXA 3VMPA 1X7FA 2QW5A 2PDLA 1BPLB 4TX9A 3URAA 3ITXA 3GXDA 3WJSA 5C6MA 4GFIA 4TV6A 3OJGA 4UTUA 1NQ6A 3NYZA 3KRUA 4K8HA 1UJPA 2HS6A 2BXYA 2Z2BA 2ATSA 3TTOA 2UY4A 3B8VA 4A6GA 1HUVA 1ZCCA 2C6QA 4PMXA 3UVIA 2FGBA 4U2ZA 3WF0A 4HNUA 2BB0A 3QXBA 2D2JA 1XWYA 3KW3A 3WJXA 3EDFA 1PPIA 4QM1A 2I16A 3BLDA 3OBKA 4Z2GA 4IX0A 3DHDA 2AAAA 1JL8A 4JTDA 5H1WA 1RBOB 3PSWA 2ZUSA 3EKZA 4K3ZA 2WNWA 3UPMA 2ZUMA 3CIWA 3UJEA 3RCMA 3BGGA 5HA7A 1JZ4A 1ITUA 3GUGA 3W00A 2VM8A 4XBJA 4FMVA 4LW7A 4ACZA 4Q8MA 4ZODA 1C90A 3QOMA 3R2GA 2OZ3A 1VJSA 3PFMA 4ICCX 1QU4A 1KNWA 2DZTA 5CAKA 2BXVA 4Q8WA 1GZGA 4F9JA 1V7YA 1FWAC 4TXEA 2PTWA 4XO6A 4Q8QA 1HXJA 5AC7A 3WMCA 2E77A 3MW7A 5DBUA 3LGDA 3M44A 4DIAA 2VFIA 1JZ3A 1P0KA 4XZBA 1FCQA 5GQBA 5MKGB 1QMLA 2W9MA 4REQA 3SRHA 4JTCA 5JH2A 2NXGA 3RITA 1NP2A 3W7PA 3FYYA 3WL1A 2CLEA 3WDHA 3PBUA 3S2LA 2XG9A 2DZPA 3F5JA 3P61A 4PMRA 5CLWA 4ORMA 3ZVHA 1FWHC 4Z1DA 3L4XA 3SIZA 5AN7A 1TPDA 3BJTA 3PPFA 4UNLA 3VMNA 1R2RA 4DI9A 3GDKA 5CKSA 1I2QA 2YX0A 2VGGA 3K1GA 2VDGA 3LTSA 2INZA 5HNRA 2Y4SA 1YKWA 3GY1A 4OBTA 4HNVA 2Y7DA 1J5TA 2PDCA 1CYGA 2POTA 1JZ6A 4QNEA 2PDBA 3AIUA 2E9MA 4MVAA 1T6MA 1EIXA 3PTMA 3AIVA 3URQA 3POCA 4K1WA 2WSRA 2J62A 1OC6A 1J11A 4QQUA 1UJQA 2OEJA 4NJIA 3UR5A 3I68A 3MPGA 2J24A 3ENLA 3B03A 4WJ8A 1E15A 2QDDA 4MDPA 3WUBA 4K7YA 1OD8A 1EA0A 2OVLA 3BG3A 4AG0A 4LANA 1NFGA 1XC6A 5LIUX 2Y7EA 4BZYA 3W38A 2Y88A 5JBFA 2ZA2A 3O3RA 4HOWA 4PUMA 2RKXA 4OV9A 3HF3A 2W63A 3QW3A 3REQA 1TJ1A 4HB7A 3SBFA 3VZXA 4BWLA 1DXFA 3UT0A 2J7EA 2A6LA 5G4EA 3USZA 3W73A 4QGCA 2ALDA 4AZGA 4KETA 3RRAA 3WBEA 5AVNA 1VHCA 1XKJA 4IQDA 5LA1A 4XUGA 1RAKA 2CWXA 1XS2A 5IBXC 2R9RA 2WXDM 1OFBA 4ALDA 4IXHA 4NYYA 3VU2A 4JTIA 4MF4A 3KBMA 2O7QA 4GH3A 2R1LA 2P3EA 4C6EA 2Y61A 2X1RA 4LF2A 2XH0A 3BCJA 4WGXA 4MJZA 1JF5A 4OIFA 3VX0A 1EH9A 3CT7A 5IHSA 4OUIA 2V5JA 2X2YA 2QULA 5HR7A 1EJVC 5FKYA 5JBDA 4RW3A 4PC8A 3B06A 3N1AA 4NZFA 2Z25A 4Z2JA 3SGZA 2DJLA 2R91A 3ORWA 1WKFA 3MZ2A 2X7VA 4GK8A 1FP9A 3UERA 3KOZA 2YGYA 1F8IA 4UTWC 2V5CA 2WK2A 2WVSA 3BSGA 4WY0F 2QGHA 1FH7A 2VDIA 3ZSTA 2QJJA 3GR4A 2QV5A 1J79A 2F8QA 3AIWA 3N13A 2PGRA 4NI3A 4WSKA 3O2LA 5EMJA 4KH2A 3S5NA 1TRDA 1XI3A 4XD5A 2F6XA 3MI2A 3N3MA 1VS1A 3KXQA 4ML4A 2XTKA 3NZGA 1ENUA 4HN4A 1HFBA 1SW0A 2O7SA 2ZICA 4RUBA 3CO4A 4UR7A 4CCEA 1Y5WA 4DWSD 2AOSA 1QCWA 2Z0IA 4JAWA 3VD4A 3OGSA 1TYGA 5LHEA 4PEEA 1EJTC 2NV2A 4OECA 5C9RA 1Q6DA 4DVOA 1EP1A 3LLFA 4HOXA 5FF2A 2I5IA 3O0KA 3PB0A 4GNKB 3GIPA 1NOWA 3G1RA 2DH3A 1JXJA 1EUNA 4YVXA 2GVGA 1BGAA 1JFXA 4TIMA 5TBOA 4ICNA 1H60A 3VILA 3WY1A 4M6PA 4POCA 2GL5A 3W7MA 2VRKA 2NX9A 3RILA 1VRXA 2PC8A 5C9WA 1XG3A 3FJ4A 4QCEA 3CHCA 5HQMA 4YL2A 3JR2A 3A9BA 2E0PA 2O92A 1TCDA 2C7FA 2X0SA 3MC5A 1VB9A 2QT3A 5BXPA 1PE1A 3LCHA 4JR5A 3H55A 4CGTA 2FB3A 3I6TA 1M5WA 2VR5A 3MS8A 1GQJA 2PZ0A 2QUVA 3IUIA 3VNYA 1CENA 3OZPA 4RNFA 1DHKA 2CLKA 1MQRA 2YZRA 3TYZA 1YXYA 3B0YA 3DFHA 1DJYA 2BGSA 4C6JA 3W81A 3VNDA 4GUGA 4HMCA 1UYQA 4L4MA 2DUXA 2XH2A 3PTKA 3QF0A 1KWGA 4UWMA 5CBIA 5C2CA 5JIWA 1A4LA 2IS7A 1NAL1 5C55A 4DJDC 4WSHA 3VDGA 3QMRA 4H6RA 1EP3A 3E5PA 4FLRA 2OSXA 2PWEA 4O50A 3RU8X 4LCQA 3LHVA 1E4MM 5CPMA 3VKJA 4DBSA 3LGEA 1QPQA 3LQLA 1O66A 1O1HA 3TYUA 4YTUA 2VEGA 1DJIA 1ZPTA 3WDRA 2AL2A 4F0MA 1TPC1 1JZ8A 4CN6A 2NT0A 3G0UA 1X1OA 3NAVA 3CWOX 3F2CA 5B80A 3NNTA 2J79A 4UMAA 5A8NA 3RM9A 2PF0A 2B7NA 3I6EA 3VMOA 3U48A 2REQA 2E8YA 1TE6A 4EPBC 3L0NA 5M03A 4Q3MA 2C71A 3W1PA 2D0FA 4DO7A 2E28A 1E0VA 1ODZA 3S2MA 2H9AB 4JTJA 4P7OA 2V2DA 4WGHA 3T78A 3V7PA 4LAUA 1MNSA 3ALGA 3UR7A 4WDWA 1MNZA 1LQAA 4Z08A 3GB6A 3E2RA 3W1TA 4QG6A 2W5FA 3GKFA 2OO6A 2PTYA 4FLQA 3VOIA 2XIQA 3OG3A 3B8TA 4ZQCA 3ABQA 3M41A 1IF2A 5DEZA 2Q6ZA 1R30A 3QQ0A 5JU6A 1J01A 3DHUA 4MWAC 1P5BA 3WCZA 4XG1A 3CPRA 1LUCA 1KFCA 1UP3A 2FTPA 2GGGA 3E5BA 4F2TA 2HVMA 2PUZA 3VDAA 3ARXA 1RLCL 3ZWTA 3HPSA 3GU9A 3WEOA 1ZLPA 3KHDA 1XLIA 3WF3A 4N4PA 2ZRUA 5HATA 2PE4A 3T0TA 1FHUA 2V0TA 2EXOA 1XBVA 4H6EA 2I5QA 1MZRA 2IKJA 1TIMA 3NWRA 1BVZA 4HMEA 1QI4A 1AFSA 1CPUA 1Q85A 1E56A 1GVSA 3BDKA 3BG9A 5CZKA 1MFVA 2IKGA 4JQ1A 1HKIA 5XINA 3CS2A 1TELA 1XD1A 1UIOA 2QUNA 2ASHA 1MW0A 4X2PA 4ZMGA 3GVWA 4PL2A 3U5UA 2FHCA 3SECA 1XLCA 1RBAA 1JPIA 4QSHA 5G4HC 1QI5A 3H53A 4YNGA 1OB0A 4EANA 1GW1A 1H7OA 4JIIX 4D6IA 2W61A 2VP8A 1A5UA 3TW9A 4AISA 3UZJA 1V6WA 4BI7A 5H8UA 4AIUA 4GBUA 3N9RA 3GFYA 2GPTA 3GDTA 4ZOCA 3R4IA 4JKKA 2DT3A 4HU3A 2NQJA 2V82A 4HN8A 1Q6FA 1JEZA 4R3UA 1VBGA 3MWCA 4V33A 1SPQA 4KWOA 3IJ9A 2ABAA 1D3CA 4F79A 4JQ4A 2YW3A 4UFLA 3TUUA 1CLXA 1W3HA 4QX4A 2DSZA 3AYRA 1M41A 4PUWA 4LTSA 4O8AA 1UCWA 1WDSA 3WIJA 1JDEA 1W3JA 1RCXB 5EYWA 4F0SA 3BJFA 1TVLA 2WBKA 2GGJA 1TKKA 1HL2A 4PYSA 4XIAA 1PS9A 3S9ZA 2P88A 1RZMA 3NPWA 5LNWA 3KUMA 1W5OA 1EJRC 1JQXA 2Z1WA 3R8RA 5FF0A 2OWCA 3AZTA 3EA3A 1KD0A 3SAZA 1ZCOA 1A49A 3MCOA 3QQ1A 4CQAA 4AY8A 4AVFA 4O0QA 1PB0A 4AY7A 1TWZA 2PA6A 4JHOA 2XN0A 1WO2A 2VMFA 1UBSA 1XRFA 4U5KA 5HNUA 2PLMA 2V81A 4G7EB 1S46A 3F5KA 1H7PA 2H8XA 3IGHX 2FDSA 1VFSA 3W88A 3AICA 3KS6A 1EBGA 3S5ZA 1LRTA 2GQ3A 2V38A 4UQCA 4DPQA 2WZMA 1QHZA 4DB7A 2QVNA 3F03K 5I5RA 2CLHA 1LROA 2B31A 4AYSA 1HO4A 1W1B1 2I5GA 5AHFA 1W1PA 4RDZA 1WCGA 2DQWA 3PSVA 3GHUA 2V68A 3MHFA 3T4CA 3WFLA 3WD1A 2YL9A 4RZ6A 4AD4A 3CQ0A 1Q2SA 4EPEC 1I6NA 1VPQA 3AU2A 2WMJA 1GQKA 3G18A 3NPXA 4GO9A 2GOKA 3W2LA 2ACQA 4FX7A 2C1HA 4NP7A 1FDZA 5B7YA 2XFYA 1DJNA 1POJA 1H51A 4ILSA 3NEVA 3B8UA 3WK2A 4GINA 5EU9A 3IJDA 3VKKA 4JN6A 2WLZA 2YCIX 2VR4A 2A3BA 4J3SA 2HBXA 3B0VC 3VNIA 3FGCB 4HSOA 2ACRA 4AWEA 3OHIA 4TQTA 4GKTA 2XZ9A 4X9YA 5FL1A 4WRHA 3XISA 4JDYA 4DEFA 4IISA 1UQYA 5F4SA 2WWDA 4DAIA 1S5VA 5I0DA 4B5XA 3EKLA 1D7FA 1IHIA 1IWBA 1A3HA 4ZOAA 1OIMA 5IOBA 4H9TA 4NHVA 1U33A 4DLMA 3PNZA 4Z17A 4DUXA 3GTNA 4XIMA 3AC0A 4GZEA 4ZQPA 4XSLA 2AQVA 6ALDA 1E3ZA 2XM1A 4Q7NA 3UYIA 4EXQA 2EEXA 5AC4A 5AKQA 3W70A 1HTIA 1NDYA 5KMYA 5A3HA 1Q5MA 2Y8VA 2DH2A 5CC7A 1I0BA 3ISIX 4TUFA 5I3FA 1LORA 4ROQA 8CGTA 3UWVA 4C6CA 2YLAA 5CGQA 4Y9MA 1DJHA 4CD8A 3PPCA 3KFTA 2IMRA 3DGRA 3AUOA 2EQDA 1AQHA 4ORIA 4GYKA 2QAPA 1YYAA 1E6ZA 3LI0A 3TQPA 4HTBA 1L6YA 1XLMA 2P53A 2W91A 1KCKA 3WDQA 4OUEA 5I3DA 2CLOA 5T9BG 2FLIA 3GBEA 2DV0A 4RZ5A 4PBGA 4AY1A 3IVTA 1S1RA 3RFAA 4DYEA 5BOEA 3GU1A 3CO8A 2BOGX 4CU6A 5G2HA 3BLEA 5K9DA 2QYGA 4J9JA 4O53A 4KCVA 1TUXA 2JEPA 9XIMA 3SDOA 4AC7C 5LSMA 1CXKA 2X2GA 3MUIA 1NARA 5MKGA 3UA4A 3BMXA 3A9IA 5HANA 3P8JA 1XYCA 3P5ZA 5D9NA 5AHNA 4ZSTA 4MJMA 3CGTA 4IP5A 3SIMA 1TR9A 2QEZA 1L2UA 1V77A 1FFQA 2CNCA 3VIMA 1BEUA 3P0WA 3A22A 4ADTA 5B7ZA 1PYFA 4C6DA 3W4RA 2ZWZA 4K6AA 2QIWA 4UTTA 1LG1A 3SCVA 3ANVA 3CWNA 3PUDA 2HXUA 2V5BA 4IIHA 3DKJA 4E3TA 2HNHA 2YL8A 4A3UA 1SJCA 2XH4A 2ZX8A 3NQCA 1GWJA 3S9IA 3HQNA 1VPYA 3SY1A 1WA3A 4ZXLA 2B0MA 3NPVA 1R2SA 4YN5A 2CZDA 1Y7VA 4C7GA 1J6PA 4H00A 1E6QM 3LI1A 1OINA 2QF8A 4E8DA 1LT8A 3WNOA 4UTHA 2GGEA 3GW3A 1ITXA 4AMAA 4IMEA 4J3UA 3CHVA 1EZ2A 3TC6A 4QRNA 2DZXA 3BGAA 3CAVA 4CN1A 5FIPA 4XV0A 1QOQA 2H8ZA 4L1XA 3TC3A 3CUFA 3CAQA 4L61A 1SO6A 4C7DA 1R3QA 3RPMA 1PX3A 3KP1A 4W88A 1XC4A 1O5XA 3LDVA 2D2HA 4PE8A 2FJUB 4ZO9A 4Q8VA 3HV9A 1TVPA 3UY7A 3WD2A 1EDGA 3EDDA 2D2GA 3VIIA 1CXEA 3KCJA 5CCZA 1X38A 1XR2A 4YTRA 4W7UA 3UW6A 3SURA 3E2QA 5EBAA 4O19A 3QW4B 3CUJA 7TAAA 1J0JA 3ZYZA 3LZ5A 5CSUA 1WB0A 3IJ7A 1U5HA 4XZNX 4LXFA 3BZGA 3LNPA 3W25A 3SO7A 1ZQ5A 4JKLA 4NJJA 3VIPA 4WSJA 5K9CA 2C0AA 3RLGA 2A3LA 1KXQA 4CNSA 4GZIA 4BK9A 1RA5A 3C2YA 3DCPA 1DQWA 3W07A 1TQJA 2F2HA 4K1GA 2VKZG 1U83A 2OZTA 1FWEC 1I0DA 2EKGA 5AYIA 5I00A 3AXHA 1UWQA 3GDMA 3UG8A 3CLMA 2BY0A 1FWFC 2ZZ7A 3W7HA 2XJ7A 3VKDA 5BRQA 3VFCA 1IZJA 1QK0A 5HQLA 3GNRA 1Q4WA 1M1BA 4C6LA 2G3MA 2HROA 1DE5A 1Q7MA 9XIAA 4IIFA 1WUEA 1S2CA 4YXGA 2VO5A 1Q8JA 3T4WA 2EPOA 3A12A 3CTLA 4HBKA 2J27A 1LDCA 5CSRA 1JDAA 1X6UA 3DU0A 3Q2DA 3I4KA 4GCAA 1Q4NX 3FAXA 3W84A 4HHHA 4HCDA 3OA5A 4GZJA 3TLQA 2Y6ZA 1TV2A 3LZ3A 3HGOA 4ERAA 2JALA 4XAPA 3HGJA 1RK6A 5FOOA 2OLHA 4LY8A 1UZDA 3D47A 3FCPA 3N34A 5G2IA 3OB8A 3STCA 5ABFB 1ESWA 2DY3A 4JQ3A 4GIYA 1KV8A 2EG7A 3AMLA 3PP7A 2B7PA 1MDLA 1EF2A 4A2RA 3G22A 3B4UA 4UZUA 3CC1A 4MDOA 3AMKA 3A4AA 4QS6A 3LM7A 4GY7A 1CEOA 3Q58A 3MU7A 3E0LA 3OGVA 4ZBCA 2WMIB 3SCOA 3LRMA 2Z29A 4WOQA 1GG1A 2Y7FA 3GXPA 4OOUA 1UB3A 1AZ2A 5TQLA 5DX7A 3MO7A 3M0YA 3OVPA 1TPVA 3W26A 1UD3A 1HT6A 2WWCA 3G3DA 1WP6A 2ISVA 1M3UA 3NZ1A 3OQEA 5G2WA 3PJUA 5I77A 3M47A 2CW6A 1AUSL 1GKRA 1G7VA 3W29A 3GC4A 3H70A 2DSVA 1P7TA 2AQWA 4N42A 2RDUA 4BHYA 1A0EA 2BHZA 2BGNE 2XGZA 1L8PA 2EPHA 3R25A 1RK5A 4O52A 3QSTA 3OIXA 1YBQB 4E2VA 1LBMA 3DERA 3QOKA 1L2QA 1R9YA 2VFGA 1CGUA 1QPRA 3KCLA 1NQKA 2VZOA 4AMCA 4D2JA 3UXIA 4MZYA 1XL9A 2BLEA 4KW2A 4L9XA 1JAKA 1CZ1A 1OYBA 3MP3A 1QJWA 5DXXA 3LPOA 3APTA 1US0A 2DT2A 4DBDA 4I6VA 4Q4PA 1ICPA 4W87A 1JPHA 1M65A 2ZRZA 5ENLA 3C2FA 4OVXA 5CZJA 3L21A 3S2JA 3V5CA 1H62A 2OLAA 5BOOA 4UMBA 1VFOA 4GMEA 3CV2A 3ITYA 4LC6A 3NYDA 2C3ZA 2CBIA 1H7RA 1HZYA 1XM3A 1P0NA 1W0MA 1L6FA 3CQIA 4MZ8A 3F5LA 5AYZA 4WXZA 3N15A 4O0KA 2A3CA 1FWSA 1KRCC 1CNVA 2VOTA 1L0PA 2TAAA 4EKJA 4KCWA 3XINA 3RLVA 3M0IA 3ONCA 5D32A 1VBHA 3MMUA 1T0OA 1UD2A 1AA1B 1JPDX 4GY1A 3QH2A 2GVLA 3L12A 4KIRA 4Q8PA 3LCWA 5K7JA 4MLRA 1EGVA 1UWIA 2QVHA 3VI2A 2PTDA 3VE9A 4GG9A 3PPGA 4J2PA 2CERA 2WVTA 1RJRA 3NQ6A 2G3FA 5GPRA 4LX4A 1C29A 4O16A 1FWTA 3CBWA 1B4EA 4MWAE 2ZZ3A 1VP5A 1FVPA 2J6VA 5BU6A 2DZWA 2NVDA 2H9AA 2P76A 2QCDA 5CGTA 3OP2A 5E0FA 4OBSA 4IWWA 5FCZA 3OZYA 8A3HA 1FBAA 1R5YA 4UOZA 4IFKA 4A3YA 2DVTA 3NM1A 1PZ1A 2ZUUA 1EQPA 1C8YA 3KE0A 4UTMA 2YFNA 1KBKA 3FVDA 4AEEA 2PLKA 3V5OA 4QJ3B 4JIQA 2HWGA 1OIFA 1H7WA 4XD3A 4E2BA 5J5DA 3S6DA 1QT1A 3RM8A 4B90A 3F2DA 3IVUA 1S1PA 5C2XA 4QS5A 3TXZA 1L6GA 3U4AA 5C8BB 1JCXA 4IHCA 1ISVA 3PG9A 3L7RA 2CZEA 1XPGA 1SSGA 2I57A 3QMSA 3NZRA 3WQOA 4CVUA 2GVYA 3KS5A 1CECA 1RPXA 5IFTA 4D6CA 3BLIA 1G94A 1XLFA 3PAOA 1A5LC 2J66A 1TJ0A 4OOZA 4O54A 2V3EA 1BQGA 1QXLA 1UUMA 5AOUA 1C8QA 3O63A 2WPGA 4XVDA 3B8WA 4ZO8A 1RSCA 5C7HA 3NQDA 2QR6A 2HVOA 1U30A 1J6OA 1QNOA 4AIEA 3HG5A 1KGUA 1AQFA 1F6YA 2VELA 3EWYA 4LV9A 1E72M 4P61A 5TAOA 3HOJA 5EBUA 2XGBA 4O18A 3MUCA 2YLLA 4Z2KA 3TEVA 1PHWA 3UY8A 1F3TA 3N4EA 1B31A 3QV6A 4PA8A 2XU2A 2YA1A 2FFIA 4I5UA 2YXGA 2WNQA 3L0KA 1V3LA 3AI0A 3TVAA 1AG1O 1YADA 1P1MA 4M7SA 2G37A 1TWSA 3JVAA 4HVXA 4C1LA 5FEWA 3U6WA 1I4NA 2TODA 1TR1A 4NVTA 1XCXA 1I2OA 3WNLA 4PSRA 3N04A 4Y9OA 1ITCA 1GVQA