4A22A

Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
342
structure length
329
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE
publication title Glycolytic and non-glycolytic functions of Mycobacterium tuberculosis fructose-1,6-bisphosphate aldolase, an essential enzyme produced by replicating and non-replicating bacilli.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 117
structure length 329
sequence length 342
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4a22A00
3W1AA 1ICSA 4IXHA 3NZRA 1YYAA 3OHIA 4UFHA 3MYOA 1M7PA 1Y0EA 5I3JA 4LC8A 1Q3NA 1GWJA 3SY5A 4HPXA 1YXCA 1W0MA 2V82A 4LW7A 5CGQA 3WJZA 3ABSA 3EEGA 1QPRA 2P0OA 1LROA 3PY2A 3W74A 3W1NA 2YFOA 5I3IA 2AQWA 1B9BA 1W1ZA 2FQIA 2CLOA 4CQ8A 4PL2A 2QCDB 2BWGA 4GFSA 3HB9A 3BGGA 4NZJA 1VLWA 1SFJA 2NUXA 1SFLA 3FIGA 2YX0A 1JCYA 3S5YA 1EA0A 1XBYA 3HBLA 2Y62A 3EXSA 3WJXA 1E51A 4I7VA 3NVTA 4X9SA 2R8WA 3DBPA 5G2WA 5IBXA 1RPXA 5KMYA 3SFKA 2YXGA 5HWJA 1OYAA 3EWBX 3W22A 3P61A 5FEZA 4Z1BA 1H7PA 4IGHA 2ZRUA 4XUGA 4MZ8A 2ZDRA 1WYIA 1XUZA 2XN2A 4JTFA 4N2YA 2O7QA 5CPLA 5C6MA 4ZZ9A 4JY9A 3LHZA 1KM1A 4OGZA 1TB3A 4QJ1A 3UWYA 1W8SA 4K7VA 3PWAA 1F74A 2QCMA 4PA8A 4UFKA 4CNPA 3L68A 3IV3A 1XCFA 4WXYA 3E96A 1QNVA 4TX9A 3UXAA 3PUEA 3W7LA 4M5PA 4RJEA 3DGRA 3L5MA 4RKAA 1TCDA 1G6CA 1AMKA 2I9EA 1OF6A 2QCEA 3OVQA 3B0UX 1H7XA 1TPFA 1FWTA 2TYSA 4WY0F 2QUUA 1MEWA 3G0UA 3LHUA 4WJEA 4BK9A 1JJKA 5H91A 2CZ5A 1G67A 4E2DA 1FWNA 1OG0A 1WOAA 3HG2A 4B5NA 3IIXA 2Z0IA 4UTTC 2DZSA 4HN4A 4ZQPA 5AHMA 2CLKA 3F03K 1TV8A 1KM3A 3BW2A 3PSVA 3PVFA 3OA3A 5D03A 3WK2A 4W9TA 1SSDA 4OU1A 4TU1A 3MHUA 2DZUA 1VS1A 1TO3A 3N2MA 4GE8A 3W1MA 4O28A 4LOCA 2ATMA 2PURA 2BLEA 3M9YA 3EWUA 4YCOA 1O5XA 1TTJA 1T0OA 5KZDA 3RK8A 4AVFA 4NX5A 3TSBA 1SW0A 2Q3OA 3ABOA 4O50A 1Q6RA 4RV8A 4NJKA 4RR4A 3LCIA 1G69A 4E38A 1NF7A 4U28A 1FQ0A 5D37A 5F4XA 2BX7A 4AB4A 1X1ZA 1PCKA 3IIZA 1P5BA 1QOQA 3HPXA 1QPNA 2GVJA 3QRHA 3G1VA 3M47A 4YLWA 3S5ZA 3W7EA 2WKJA 1AK5A 1EP1A 2FLIA 4BWLC 1H50A 3W9ZA 3QFEA 5D2XA 5A5WA 2X1TA 4ADUA 4Y96A 1KFJA 2EGZA 1OK4A 1C8VA 4UMAA 3I65A 5LGZA 4TR9A 2QUVA 3AJXA 2J6XA 5EKYA 4JDBA 3TAOA 1YTEA 2NXIA 4FB7A 3UYCA 3G1FA 3IEBA 1S5WA 1K7XA 4R53A 2QDHA 3NQDA 1Q6LA 5C2XA 3LCXA 4N9EA 1MEIA 3PG8A 3W7IA 1JUKA 4RXFA 5F4SA 1LBMA 1DKWA 3LRLA 1CW2A 5U7SA 1W5MA 5DY3A 3KOFA 3P74A 3W1RA 3M1ZA 3O63A 1GVRA 3L65A 4ZL1A 1TV5A 1ML1A 4N4PA 3O8AA 3M16A 2R91A 4A2SA 1JCXA 1F7BA 2GVGA 3WJYA 4WY0B 3EX2A 4O8RA 2CZDA 2JGYA 4JD4A 4O17A 4DELA 5DBTA 1DVJA 1ZAHA 4O12A 4LY8A 5DCEA 2DZPA 1D3HA 4ADSA 4LNYA 2RH9A 3WK3A 3A5FA 1X1OA 3MP4A 4LVFA 3R8RA 2ZZ3A 1XBVA 1SSGA 1B57A 4OV9A 1UUMA 1LP6A 3HGOA 1I2PA 4Z1AA 3CC1A 2GQAA 2HTMA 4K37A 4GJ1A 2Q8ZA 2PCQA 3HQ1A 2X1RA 4QNWA 1OFRA 2QAPA 2C16A 2C1HA 3P84A 1GZGA 1EIXA 4XKYB 4JYEA 3GAYA 2DZTA 3HPSA 3TQ0A 2VFDA 3LI1A 3M6YA 5I3GA 3A24A 4K36A 3KRSA 3GNNA 4RCXA 2QR6A 4I7UA 3DH7A 1ALDA 5F2LA 1SO3A 3GDRA 1WQ5A 1OFEA 5D2YA 2C0AA 3Q2DA 3IGUA 1U83A 3EX4A 2KZHA 1GVOA 5FF7A 5J5RA 2QCCA 3G1XA 4R7JA 3SR7A 2Y7DA 3L0KA 3QW4B 4P61A 3PAJA 1ICQA 4UXDA 1W56A 1WAUA 2O7SA 4JN6A 3EWWA 3PF3A 3C2RA 3EXRA 2NLIA 2VFFA 4Z1DA 3NQCA 3W75A 3DFOA 4IMGA 1RR2A 1YPFA 2E5CA 2C19A 4FNRA 3IIOA 3NPWA 1YXYA 5G5IA 1THFD 3FS2A 4QNEA 3CT7A 3O6YX 2WOQA 3BARA 1EWDA 4GUHA 4EIVA 5IM51 3TFCA 3GAKA 4HNVA 3LRKA 3FJLA 4RZ5A 4TO8A 3LV5A 3PS7A 4AWTA 1QCWA 3LM7A 3TROA 5IBXC 1WA3A 3C2FA 4K6AA 4JXCA 1FWRA 3K30A 1IXOA 5F1VA 5FF2A 4RZ6A 1Z42A 3T44A 3DXIA 1QFEA 1SR9A 4XBKA 3KVMA 3O07A 3UZJA 1QMLA 3UWZA 3DKJA 3W84A 4DPQA 4BR1A 2V81A 3LTPA 1JULA 5DELA 2H3BA 1HO1A 2I1OA 3DKLA 4LRSA 4AWSA 2F7FA 2I14A 2X1SA 4GWEA 1EP3A 4UIOA 2G96A 3STCA 1DV7A 1YTKA 1W3TA 2FIQA 3S1UA 4JR5A 4Q4KA 1H1YA 3QH2A 3P8IA 5CPMA 4DEFA 2EKCA 4FNQA 1ADOA 4K39A 4JX5A 1M6JA 4CQ9A 1LBLA 4IXXA 2E1DA 4WQ6A 2TMDA 3MMTA 5HMSA 2JGQA 5H2ZA 3W7KA 1GG0A 2C13A 4CNOA 3ZWTA 4D2JA 2YR1A 4GUIA 1VR6A 4MLRA 1R46A 1JCJA 5C55A 2EF9A 5K9XA 3NL2A 1N8FA 1L6SA 2ZZ7A 4WUIA 4HNTA 2RDTA 4NUWA 3UY7A 1DBTA 2A7PA 2GVLA 3DZ1A 2A0NA 2JKEA 3NGJA 2YGYA 4NU7A 3L2IA 3S9YA 5KZEA 2WV8A 3TMQA 3TNOA 4KWVA 4UTMA 4XTIA 2G97A 2F84A 1KLZA 2A5HA 2ZBTA 2Z6JA 1GG1A 1YTDA 1KTNA 4LV4A 5D33A 3N34A 2G5WA 3PBVA 4DBDA 4BI5A 3O05A 2EHHA 3M5ZA 1GYLA 3DFQA 1S5TA 3IGSA 1BWLA 1O5KA 3KVKA 4EF9A 1GTHA 3GNDA 1MZHA 3CPRA 2NUWA 4IMEA 5F1UA 3TSMA 3TCEA 3EX6A 2D73A 1O60A 1LRTA 3EKZA 2GOUA 4EOUA 4HNUA 1OFBA 2WNQA 3BLIA 3ZFHA 3N19B 4MYXA 2VEMA 5T26A 2GJLA 3ABRA 2B7OA 1SO5A 2OZ0A 3CM4A 3FYOA 3W7OA 4H3DA 2FTPA 3LRMA 3QSRA 5HULA 3TXZA 1AL7A 5I3FA 4GXMA 3QMSA 4HT3A 3CQ0A 1KM0A 3C0JA 2RDUA 1KBJA 3TUUA 3FA5A 4Q32A 1TPUA 2J9ZA 3LCGA 4FF7A 4GUJA 3TFXA 2FPVA 3VNDA 1D9EA 1G4PA 1GTEA 3TSDA 4M6QA 2QJHA 3VE7A 3G1DA 4FXRA 5BMWA 3W2JA 4UUIA 3RF9A 1A5CA 4E0CA 3USBA 6ALDA 1YLVA 3E12A 1TJPA 2RHGA 3RMJA 4PC8A 4O1DA 5D09A 4RZ4A 3C56A 1O94A 4QIUA 1DHPA 2E5BA 4K7YA 1H60A 4S2CA 3WJSA 3DENA 1G4SA 1LCOA 2H90A 4LVBA 4PEKA 1PHWA 1VCFA 2PRLA 1KFCA 1I45A 1OHLA 2V9DA 3W70A 2C3ZA 3W73A 5K4ZA 3M44A 5K2ZA 3GKFA 3M5YA 3I7QA 4UFIA 3C2VA 4UNKA 3YPIA 1N7KA 3DI1A 3PR2A 1BWKA 2ISVA 2YW3A 1NEYA 2E77A 4AWUA 3EWXA 3H53A 1KV8A 3KRUA 1VJIA 4WOQA 3JRKA 3NDOA 5MHBA 4O15A 3A23A 2XN0A 2YPIA 1R2SA 4Z0JA 5EPDA 1OFPA 4N9BA 4NT0A 1DORA 2WNNA 4QAIA 1TPEA 3GKAA 1X6UA 4WD0A 5D05A 2P10A 1W37A 4IMFA 5D04C 4FX7A 1Z48A 3QMTA 3R5EA 3IVSA 1KM6A 3W7RA 2QJGA 4NZFA 4HHPA 2ZRVA 5FF3A 2EAWA 4ZVJA 3LXAA 3CTLA 5D32A 5AYXA 4NVTA 4ALDA 2LLEA 1I2OA 1SZGA 3MHGA 1P4CA 5BMXA 4AXKA 2NV1A 4PFMA 3NQ7A 5LNWA 3IIPA 1SZFA 3C4UA 4FO4A 4GBUA 3TJXA 1RQBA 4IMCA 3FKRA 1KTCA 3LCLA 3P60A 4ML9A 3FLUA 2JKPA 2NWSA 3SJ3A 3GDKA 3T7VA 4C1KA 4G1KA 3C61A 4QITA 2QCDA 2J24A 1ZFJA 1OX5A 7TIMA 1TPDA 1RZMA 4GRSA 1GPWA 3NA8A 1JCLA 2X2GA 1ONRA 3LBCA 2B7QA 1KA9F 3CB8A 3TV8A 3R12A 1B4EA 1TMHA 4ORIA 5DCDA 3NQ8A 3GZ3A 3KHJA 2C18A 3V1PA 4XWUA 4R34A 3W7CA 5AC6A 4FIQA 1PVNA 3GR7A 3W1XA 2OCZA 3UWVA 3DHDA 4K38A 3QZEA 4O13A 3M5VA 3L66A 3VCRA 4R33A 3BV4A 4JTJA 4JX6A 4LVDA 2R94A 3NPVA 1TREA 1EPXA 1RQEA 4HSNA 4YXGA 5D2TA 2PE4A 3M0ZA 1GVQA 2ZZ1A 1OX6A 4Y90A 3L9CA 1VHCA 3NL3A 4OWGA 1UJPA 3SI9A 1F6KA 4UTJA 2HSAA 4MFEA 4N02A 2E5DA 1A5SA 3TIMA 4MPQA 5CZTA 3R89A 4O0KA 4A2RA 3SZ8A 1WOBA 5EMUA 2XN1A 4FX6M 4JTEA 2ZRYA 3U8GA 1SW7A 4AMAA 1WBHA 3STEA 3M43A 3L67A 5TBOA 2Y63A 4JTGA 1VC4A 3B0PA 1GYNA 2AGKA 1ZY9A 4NXKA 1PL9A 4MJMA 4M7TA 3EWZA 3NM1A 3MBDA 1FBAA 1FWSA 4OE7A 2J88A 1TRIA 3NPUA 1VYSX 2H8ZA 1XBZA 2GQ8A 3LCWA 5DY2A 2FB3A 2A6NA 3G1YA 4CLMA 5G1YA 3UPWA 1TYGA 1SZEA 3W2UA 3DI0A 2QCLA 1R2TA 1FXQA 2V5LA 3I7RA 3PC0A 5FEWA 1K8XA 2AAMA 4ZMGA 3HF3A 4PH6A 3U6WA 4JTUA 2VENA 4KFNA 2YYUA 2YYTA 1JCNA 3NQ2A 4UNLA 5F2MA 5SWUA 1RD5A 3NG3A 3NQEA 2Y85A 2C14A 4O4VA 1DJQA 3I6RA 1J2WA 1F5ZA 1CI1A 3L5LA 4UMCA 2Y7GA 2CZEA 3GDMA 5LNUA 1G4TA 4O57A 3O06A 4RX0A 1M7OA 3IVUA 3HIJA 1P0NA 4ORMA 1LOQA 5I3HA 3PUOA 2WPBA 2TSYA 3MHFA 2ISWA 5BW6A 1XFBA 4JNMA 1EEPA 5HUPA 2ZZ5A 1R30A 3P7YA 3N73A 1SUXA 5FF4A 3A9IA 5LNVA 2C15A 3W83A 2A4AA 3S6DA 2FFCA 2CWNA 2W6RA 1KTBA 2BTMA 5EA9A 5K9CA 4WXZA 1Z44A 1OYCA 1ME9A 1IF2A 3SIZA 3QQ1A 1DL3A 5KINA 4CCCA 5G4EA 4JTLA 3ATZA 4GUFA 1NAL1 3NL5A 3B03A 1TTPA 5AHFA 3HGJA 3TH6A 4DQWA 3OG3A 4K8HA 3GVGA 4XZ9A 3PBUA 1VZWA 1H7NA 2WNZA 3G24A 4O4WA 1A5BA 1BEUA 1KM2A 4O1AA 2VFEA 1XDLA 3BVJA 3NYZA 3GR8A 1KFKA 4AEOA 2NV2A 3W7GA 4MFDA 3P67A 5KSWA 1FCUA 5HUOA 3LCFA 3U2OA 4OBTA 1C9DA 4NX0A 2QEZA 4UFMA 4WY0A 1LYXA 1WDWA 1KM4A 1K7FA 3UPBA 1HTIA 2V2HA 4LC6A 3TA6A 2H3DA 2TRSA 4P2VA 5J5DA 3LXCA 4PL1A 3R2GA 2V5BA 3STFA 5FF0A 2EPHA 2A6LA 4TIMA 3HG5A 1PV8A 3OVRA 1FXPA 3UWWA 1Q45A 5HR6A 4AHOA 3QJAA 5BOOA 4LTSA 3S0CA 1YPIA 4JTKA 3W1UA 5CPOA 3S1VA 2V2DA 4MY8A 3O6CA 1ME8A 1XI3A 4MZ1A 4XKYA 1ZNNA 1CX9A 3FYPA 4UTLA 3LHVA 4M6PA 2E68A 4UTTA 1OFDA 2VKZG 4PTNA 2ATSA 2PRHA 3WK0A 2E6DA 1LZOA 3S42A 3SECA 2V8ZA 1KLYA 3E9AA 3BG3A 3M7WA 3P8JA 1QR7A 3NL6A 1LDCA 1GVSA 2ZQ0A 3R13A 1OFQA 3C52A 3O6DA 3RLUA 3W1PA 3S1XA 3TXVA 3S5OA 3BPWA 3W7QA 1KFLA 4FXSA 1F2JA 2ALDA 1JCMP 1XBXA 8TIMA 3SSJA 1PS9A 1OVDA 1TTIA 2E6FA 1IXQA 1XM3A 1DQWA 1GT8A 3QF0A 1UCWA 3QM3A 4HNNA 3I7SA 4A3UA 1TV7A 1LOLA 2QKFA 2E6YA 1T8XA 4CNNA 2DP3A 3W86A 4FNUA 4JGDA 3B0VC 4TMCA 1QO5A 2PC4A 3LXBA 3HG4A 3OVPA 4XTDA 1T99A 1Q6QA 1SW3A 5HINA 4PCFA 1VLIA 1F6PA 4E2BA 2ZRWA 4L4LA 2PRMA 1OF8A 5D2VA 3MI6A 4CCDA 5CZSA 1XL9A 4AF0B 1JUBA 1T96A 3W2LA 4H6KA 1VPXA 3SW6A 3UWUA 2IQTA 4BWLA 1AG1O 2QCGA 3LERA 3TE9A 3FJ6A 1UASA 2JBMA 1SPQA 2BSLA 4GUGA 3PSWA 4IQLA 1HO4A 5A8GA 1S5VA 1FCVA 2WO5A 4KFOA 2QCFA 4ICNA 4HKPA 3V75A 1PE1A 3C2EA 4YMZA 5KTLA 1FX6A 2ABBA 3HPZA 3NO5A 5CG7A 3F4WA 1O4UA 3NNTA 3SGUA 2Z1BA 1NVMA 1TIMA 3THQA 3P81A 4FHAA 4HSOA 3T40A 4ZQMA 4DF1A 4CCEA 2VEPA 5DCBA 3C8FA 5CKSA 1VCGA 5FESA 3TK7A 1TPB1 4ZQCA 3PB2A 3THAA 3STGA 4U4MA 1P1XA 5LSMA 1UB3A 2HS6A 1ZALA 3MJYA 1NF0A 3A21A 3QQ0A 3B04A 3A5VA 2HS8A 3L0NA 5AB3A 1I4NA 4JIPA 3QC3A 3S1WA 2NWRA 2CLFA 3F4NA 5F4WA 3GB6A 1TPWA 3PBYA 4MY9A 1H62A 4O52A 4EVZA 2YFNA 2ZA3A 3N9SA 1X7FA 3GK0A 1C29A 4IPIA 1K02A 3L5AA 4NJHA 4BI7A 2VC6A 1OK6A 1KBIA 2JKAA 3G8EA 4Z1CA 3PULA 2VELA 1L2UA 5HWNA 2W0UA 1VGAA 2GUUA 3LHWA 1PCWA 3W2KA 1OABA 2A85A 3PB0A 3JR2A 4JY8A 3B06A 3T55A 2CLIA 3E0IA 2Q8LA 2WSQA 5EYWA 5EBUA 3CU2A 2OT0A 2ZZ4A 3W7PA 3QPYA 4Z0SA 3MP3A 2V30A 2HMCA 4RXGA 4AHQA 4LS1A 3EX3A 3G3DA 2Y89A 1R2RA 1TQJA 2YDAA 3CHVA 2CLLA 1J4EA 5E0KA 1B4KA 2FPTA 5F2GA 1F73A 4LVGA 5CZ0A 3IVTA 3QEZA 4I9AA 4CQAA 1FWWA 4KFPA 3VE9A 2B4GA 1OJXA 1L6YA 3LHYA 3A22A 4IJBA 2VEKA 5AC7A 5D02A 2DORA 1FY6A 2ZTKA 4JYDA 5EY5A 1K8YA 1JVNA 3UNDA 3AO0A 3KVJA 3QPZA 2Y6ZA 2FDSA 2YW4A 1LOSA 4ZQNA 2DJXA 2DZXA 3W7JA 1VYPX 2A7NA 3CLMA 3LGEA 4AHPA 4LRTA 4OQVA 3DFTA 3NOEA 5E1QA 4ZQOA 2QF7A 4PODA 3MUXA 1KFBA 4JX4A 1EWEA 4J9JA 2WQPA 5HR7A 4Z08A 4LS2A 1LRNA 4DPPA 3G1SA 4WOZA 1W5OA 1OX4A 3GX9A 5AHEA 1DOSA 4RLIA 1K8ZA 1VQTA 5D38A 2UV8G 4DXVA 1AW5A 3UD6A 1HG3A 4NJIA 3LDVA 1QDSA 4L4MA 2A2IA 1Q6OA 4UC5A 4UTIA 2BXVA 2BZNA 5LKYA 3SGZA 3D0CA 3N9RA 4JTTA 1VHNA 4JTIA 4MZYA 5CSSA 2DU2A 3P82A 3NXFA 4JIQA 3T4CA 5FEXA 3BK0A 4JEQA 3EXTA 3BG9A 2ZZ2A 3IGXA 1QPOA 2CFFA 5FI8A 2WSRA 4GNJA 4UFLA 5DLCA 3W07A 4OHQA 1H1ZA 3EWYA 1A50A 3EX1A 2ISSA 4JDYA 2A21A 2ZA1A 4N6FA 3PM6A 3RLVA 5DXYA 1FDZA 1HUVA 3DHFA 1EUNA 1V7YA 4LVAA 1RV8A 5K7JA 1D3GA 3BG5A 1XC4A 5C5YA 1MO0A 2B0MA 2Y7EA 3LCHA 3MI2A 4POCA 4MJZA 1G7VA 4C1LA 4O1BA 2WSYA 5E93A 1MSSA 3GXPA 3W7NA 4UTWA 3TW7A 4NNAA 1IIGA 4A22A 2YSWA 5CSRA 3MW7A 3NQ6A 3HOJA 5HJLA 3NZ1A 4UTHA 1GVFA 1H51A 1S3HA 2CLEA 1I2QA 1QO2A 2QCHA 4NQ1A 3Q37A 1TQXA 2VXNA 1YDOA 3QW3A 1M5WA 1SO4A 3Q94A 4EF8A 3OIXA 4TMBA 1TPC1 4DO4A 3NEVA 3H54A 3S5NA 5BNKA 1BTMA 1H7WA 4JYFA 2ZZ6A 3W3OA 4QISA 1RVGA 5AHIA 1OFAA 1MXSA 4A21A 4QQ3A 4UCGA 5K9DA 4MY1A 5AFDA 3G1AA 4WZHA 3NAVA 1X8FA 4S1FA 3G3MA 1GOXA 1TTQA 4MVAA 1HL2A 1G4EA 3LLDA 2DZVA 3O15A 2RFGA 3WFAA 1F76A 3PG9A 4Y8FA 3HG3A 3GXTA 4IMDA 4LWWA 5KZMA 3T78A 3W1TA 1LORA 3W87A 4HIBA 5DXXA 2V0TA 2Z2UA 4UR8A 1LM1A 4IOTA 3UQNA 1JR1A 3GIYA 1YADA 3O1NA 3ATYA 3JS3A 3NQVA 1LLZA 4N9CA 2OJPA 1FCQA 3MI3A 1F05A 4X3ZA 1YDNA 3BLEA 2GJNA 3VKJA 3Q58A 1ME7A 3I68A 3KFTA 1IXPA 1DJNA 2V2CA 3B8DA 2B7NA 4X2RA 3H55A 5F2IA 4X22A 2DJLA 2VEIA 3EKLA 1A5AA 2NUYA 3W71A 3HMJG 3ZS4A 5BRBA 4Y6GA 3W72A 1NFBA 4FX8A 4YL2A 3LHTA 3FFSA 3W23A 1VYRA 3ZR4A 1VH7A 3W1QA 3P5YA 1GEQA 2B7PA 1K7EA 2C6QA 5AYZA 3CWOX 1L6WA 2JK2A 3MP5A 3LOTA 4K8EA 5L6UA 1SU5A 3OEXA 2TPSA 3E02A 3UY8A 3F1QA 1GQNA 4FNTA 5G2HA 4M6VA 2CZFA 2VFGA 2A1YA 4OV4A 3NQAA 2Y88A 5LNRA 1VRDA 3MWAA 3NPXA 2YZRA 3C2OA 2J9XA 1ZAIA 4ZQRA 1J5TA 2R14A 3NM3A 2X30A 1I8JA 3C6CA 2J27A 4UFJA 1SZNA 2CLHA 3QMRA 1QWGA 2VFIA 3ZWSA 2ZA2A 4Y9AA 3TDFA 3WK1A 1EP2A 2QUTA 4N9DA 4ADTA 4O11A 4Q33A 2H6RA 3LB0A 4O14A 3LI0A 3LTYA 2ZYFA 5CPNA 3TC7A 4M7SA 2CLMA 3GLCA 4H4IA 3NQMA 5AHNA 2DZWA 3W7MA 3G22A 5LHFA 1QOPA 4UTUA 2OX1A 2RDWA 4LV9A 1EX5A 2WJZA 4S2BA 2QCNA 5AC8A 4XQ6A 5LZLA 3GYEA 3OBKA 3PBWA 3B4UA 1FCBA 1W54A 5U4NA 1KW1A 3CWNA 4MUZA 1LTDA 1TPVA 3NR0A 2VFHA 3S8HA 3LLFA 1XKYA 1W3IA 1N55A 2ZRZA 3QYQA 3QSTA 4O0ZA 4UR7A 4WX2A 1GJPA 5L9FA 3E49A 4NNBA 4MIMA 3TJLA 3LV6A 1FDYA 3NQFA 3KRZA 4LU0A 1EB3A 5GVJA 1HFBA 3TU9A 3TX9A 1NSJA 3P62A 1IXNA 4DO5A 1G7UA 4IUOA 1K3UA 3BW4A 5C54A 2NZLA 1U5JA 5D2WA 5K4XA 5LHEA 3DU0A 4UTKA 3TR2A 1H7RA 2W79A 3TAKA 3HGSA 5I3KA 4NJJA 2FJKA 1XUUA 3G8RA 4YWIA 5KITA 5AHLA 1Z41A 4A29A 3KVLA 1ZCOA 2H8XA 3LX9A 5G1TA 4BI6A 4O53A 4O54A 5ABTA 5HQEA 2OT1A 3GDTA 1UUOA 2X1UA 2ZTJA 3FOKA 3BW3A 1LBFA 1K03A 2XFWA 1A53A 4N4QA 4BFAA 3G0XA 2YCEA 3W2NA 3HGRA 3N3MA 4MYAA 1ICPA 3W1LA 4OT7A 2ZRXA 1JQXA 3RU6A 3EB2A 3UWQA 1W3NA 4FEZA 3W76A 4DF2A 1JUEA 1XXXA 2QDGA 5DBUA 1YDVA 1WX0A 3DFSA 1KM5A 4JTSA 3TKFA 1LLWA 1TSIA 2ABAA 4FIRA 1JQVA 2NX9A 4JICA 5HNRA 4HPJA 1R47A 1W5QA 3P80A 2RKXA 4ONVA 5HWMA 4FNSA 3KAOA 2Z6IA 3KX6A 3TMLA 3P5ZA 4EWND 1SQ7A 4FNPA 4MLJA 1EUAA 5AN7A 6TIMA 4UMBA 1L9WA 4IPJA 2Q3RA 3KXQA 4LS0A 3CIXA 3TQVA 4RK8A 3MYPA 2G95A 4DF0A 1KV5A 3RNDA 4AH7A 1QAPA 1OFOA 1OYBA 1RQHA 4JTHA 3W7DA 2E6AA 4O10A 3DFNA 2CU0A 1H63A 5LNSA 3NQGA 5D30A 1W5NA 2NX3A 1TRDA 4KWWA 2J9YA 4LUJA 5FEPA 1PIIA 3MBFA 3CEPA 1O95A 4NJGA 3UXDA 4UTWC 4MOZA 2NXGA 4IX0A 2FPYA 1TJRA 1BKSA 4JS3A 5G2IA 4BF9A 4QM1A 5EL1A 3L21A 4DO6A 2GQ9A 1AW2A 4NNCA 1SO6A 2CW6A 1ZAJA 2NXHA 2NX1A 2Y7FA 2ZCGA 1VCVA 3TQKA 1H7OA 1AL8A 3GXNA 1I2RA 4IX2A 5TQLA 3M5XA 4AAJA 4O19A 1H5YA 2E09A 1XDMA 1YXDA 3BO9A 3HO8A 4MKNA 4O1CA 2ZFAA 3RFAA 4KKXA 3G18A 5DN1A 1P0KA 4LUIA 5K3VA 1W5PA 5CZJA 3TC6A 1WXJA 3W88A 4YCPA 3CIWA 3ABQA 2A7RA 4M19A 3MO7A 3G0SA 3FEMA 3WJWA 1JRCA 3L0GA 1B3OA 4AF0A 4GC4A 3TW6A 3N2XA 3G1HA 3UZ5A 3DAQA 4LT9A 1FDJA 4O18A 1H61A 3VFLA 2Y61A 2FB2A 3BLFA 1TPH1 2OMAA 3GDLA 4NXSA 3N14A 2P1FA 1KFEA 3O16A 1W31A 3VI2A 1PHQA 4N6EA 4IWWA 3LTSA 1AW1A 1QPQA 2X16A 1ZHAA 5AOUA 3W6YA 1WBJA 3LBMA 1FUYA 1LRQA 1WV2A 3B05A 3HJZA 2QAFA 3BGJA 4DBEA 4O16A 3C3NA 5G4WA 5LGXA 2GPTA 2QJIA 2Y70A 5TIMA 1IGSA 3ELFA 1I2NA 3INPA 3IRDA 3PUDA 3CEUA 1ZENA 1ZJIA 3ANYA 1UBSA 3W7HA 3M41A 4QSHA 4XBSA 5AYYA 1JRBA 3DFPA 3FKKA 3IIVA 4I7WA 1IIHA 1V5XA 3W2MA 1MEHA 1DQXA 1OX4B 2VOMA 3W85A
chains in the Genus database with same CATH superfamily
3W1AA 4JTDA 2Y8UA 4BZYA 3NZRA 3MYOA 1M7PA 2CITA 1Z6KA 5CSYA 2ZIDA 2WHJA 3SY5A 4ZB2A 4IJCA 3WLPA 5CGQA 5JVLA 3RIKA 3GW3A 2P0OA 4C6KA 4B9ZA 4H41A 3BAJA 1D7FA 2QCDB 2BWGA 3BAYA 2E1WA 4NZJA 3S2JA 4DI9A 2AL2B 1SFLA 2UZ9A 2YX0A 4XZIA 1POKA 1EA0A 1XBYA 4HHHA 1W17A 3WJXA 5XINA 1E51A 4ML4A 1LUCB 1JYVA 3EGJA 4YHGA 1NIUA 4B5VA 4D8ZA 5G2WA 5CH9A 1VFSA 3SFKA 1BF2A 2YXGA 3V18A 5HWJA 1OYAA 3W22A 5HMEA 3P61A 1PIGA 4Z1BA 3AIRA 2ZDRA 1LWIA 1WZKA 2YBUA 4JTFA 4N2YA 1HT6A 4J3UA 4L9XA 3G2GA 4ZZ9A 4JY9A 1KM1A 5A8PA 3OYXA 4Q4QA 5KZ6A 4AZIA 3UWYA 1E40A 2OZTA 4UFKA 3L68A 3GIPA 4WXYA 3E96A 4TX9A 1W1IE 4HOZA 4KESA 2QPXA 4QGCA 5CCZA 2J8TA 1M9HA 3B9DA 3QOMA 3W6LA 1TCDA 6A3HA 3SQMA 1AMKA 5FJTA 1WZLA 3GG0A 1GOIA 3W38A 3TTEA 4TX8A 1H7XA 1TPFA 3BMWA 4WY0F 4FK9A 2QUUA 4WJEA 3AIWA 2CZ5A 1G67A 2B81A 4X61A 1FWNA 1OG0A 4W5UA 1J0ZA 3H4XA 4HN4A 4ZQPA 5AHMA 3H7UA 3T09A 3F03K 2OOGA 5LIYX 1ADDA 4QTGA 2DZUA 1VS1A 1EHNA 5BXTA 3BJTA 2WC7A 3N2MA 4GE8A 4OUIA 2PURA 4E2VA 1B2YA 4YCOA 1ISYA 1G0CA 1VAHA 3EWDA 3GSMA 3WDPP 1XLDA 3ZJKA 3TSBA 2Q3OA 3WNKA 4I6VA 4NF7A 4RV8A 3R1ZA 4L56A 4NJKA 4WJ8A 2IS7A 1ITQA 3TYCA 1G69A 3URBA 4JN7A 1FQ0A 3UFYA 3GW0A 4M6UA 1P5BA 1TCMA 1GVYA 3HPXA 4A35A 1T40A 2F2KA 3M47A 2VWTA 3IJDA 4YLWA 1AK5A 1EJWC 4BWLC 3MUCA 4J3XA 3W9ZA 4PB5A 5I07A 3QFEA 4JAWA 3ORWA 4ADUA 4Y96A 5FOOA 1O6IA 1C8VA 1DPMA 3SCPA 2BXZA 1E43A 4QG6A 4EX4A 1NP0A 2J6XA 3ARYA 1RBLA 4FB7A 2VOTA 3UYCA 3G1FA 3OP2A 1F3TA 1B9ZA 3IEBA 3GVQA 3AXMA 1UKQA 2A3LA 1K7XA 3VOHA 1Q65A 1HJUA 3NQDA 1MRAA 3PG8A 5DRCA 4S3DA 1JUKA 3RAOA 2EG8A 4PMUA 1DKWA 5U7SA 1CW2A 1XLHA 3KOFA 3N04A 3M1ZA 3ZLFA 2V69A 2ACUA 1GVRA 2R1PA 3IACA 3L65A 3RR4A 1N82A 1Q6CA 4DUXA 4N4PA 2PDMA 2I5IA 3M16A 2KAUC 3VM5A 1JCXA 1F7BA 3CV7A 4QJ4B 4HHMA 4PMXA 4GY7A 4UQCA 4J35A 2H9AB 3VDBA 3BLKA 4DELA 1EOKA 5LA0A 4UBPC 3MA8A 2XFYA 2BP1A 4DJDA 2DZPA 2XHYA 1QNPA 4ADSA 4LNYA 1GZ1A 3HM7A 1WE5A 1X1OA 1XBVA 1SSGA 3KOYA 3IAPA 4QLJA 1LP6A 3BSMA 3OBEA 3JW7A 2BGQA 3HQNA 3GXDA 3HQ1A 2X1RA 3C86A 3GH4A 1SGJA 2C16A 2C1HA 2D0GA 4OZOA 4XKYB 5I3GA 2VFDA 1DXIA 3A24A 4AZBA 3KRSA 4P7QA 3DH7A 4LEQA 5F2LA 1A5KC 1SO3A 2WMKA 2XSAA 3GDRA 1WQ5A 1E4IA 4BEQA 9XIMA 2QW5A 2KZHA 1MW1A 1WKDA 5FF7A 3M0HA 3OODA 1EH9A 2QCCA 4R7JA 3WF4A 1FA2A 2Y7DA 1WO2A 1UROA 3ONBA 1CENA 2ONEA 5KEZA 1JFHA 4GIRA 4GI6A 1VFUA 3EXRA 2Y8KA 2VFFA 1O12A 3L4WA 4GVGA 3XIMA 3DFOA 4IMGA 1YPFA 3B0XA 4FNRA 4H8VA 3NPWA 1YXYA 2QXWA 3RR1A 2WVVA 2HZGA 3M0VA 3ICJA 4J2MA 3RITA 4D9PA 3T0CA 5E70A 2P8BA 1AH3A 1J11A 4GUHA 1WDRA 4PYSA 4RZ5A 4AWTA 3RG6A 1IT7A 5MF5A 1DJZA 4JXCA 3PHAA 1D2KA 3K30A 2ZXDA 2QPSA 4CN1A 4LYQA 3T44A 1QFEA 2V38A 4XBKA 1ZLPA 4IH3A 3WBWA 2W5FA 3C0SA 4JQAA 4BR1A 3GRIA 3LTPA 1W3KA 2H3BA 3M0XA 4ROPA 3TLLA 5E6ZA 3UZYA 1Q85A 2D0FA 4BF7A 1EP3A 1EJUC 2X41A 1N8IA 4UIOA 3SN1A 1W3TA 4V1XA 5CPMA 1H1YA 3QH2A 1ZQ5A 4AY7A 3VIPA 3GBEA 4KRTA 1XLFA 3W7KA 4WEVX 1RBAA 1KCXA 1QNSA 2F6XA 2ZUNA 3ARPA 1R46A 5HJXA 4OBSA 4DN1A 1Y8BA 1N8FA 4BQ4A 2ADAA 3GXIA 3GY1A 1XYBA 1XV8A 4WKHA 1OQFA 3PTKA 3AIUA 5XIMA 2YGYA 4XVDA 2A3BA 3PZQA 3QV8A 5KZEA 1Q6EA 4E4PA 2F84A 1XYAA 2VRJA 1YTDA 3E0LA 5ENLA 2GJRA 4LV4A 3DN5A 5D33A 5IDIA 3N34A 4WSHA 5E9AA 3SCVA 4FXJA 3GQYA 2EHHA 2J6VA 3CZ8A 2E25A 1GYLA 4KEZA 4KBXA 3DFQA 3EOUA 1GTHA 3KCOA 4K68A 5F1UA 3TSMA 3NXLA 1EOMA 3EKZA 1OFBA 4GCXA 4TVCA 3RX4A 3S2LA 2DT1A 4MYXA 4WLCA 4F4RA 2JIEA 2GJLA 3RXZA 2X05A 3SN4A 4MMWA 1SO5A 1TUFA 1M03A 2BVWA 2OZ0A 1S5MA 1UUQA 4BF5A 4H3DA 2FTPA 4D6JA 3GFYA 5KETA 3TXZA 3B8WA 1RAKA 3GVVA 4HT3A 1E1FA 4LAUA 3PJXA 2J9ZA 4K1WA 3UZZA 1ZRQA 1GTEA 3SURA 4M6QA 2CBUA 5T91A 1HQTA 1OC5A 4UUIA 3RF9A 5DMNA 4GY0A 3E12A 1TJPA 2DSVA 3OU8A 3TTSA 5DMYA 1CB2A 2KX9A 5ABFB 1O94A 3UERA 1GOMA 4S2CA 8A3HA 2DSUA 3CZKA 2Z2BA 3DENA 1RCOB 1LCOA 1J0YA 1PHWA 1TWWA 1VCFA 2PRLA 1OD0A 2FJUB 4FR6A 2V9DA 5K4ZA 2JEPA 1DJWA 2UY5A 1QNOA 3DI1A 2FVLA 1MRQA 1NFPA 2ISVA 3PZIA 1XC6A 4UNIA 4BQ2A 3JRKA 1IEXA 5DEZA 3LU2A 3NDOA 2O0TA 4A8IA 4O15A 4LNCA 2XN0A 2YPIA 3U9IA 5EPDA 4XIAA 5A6BD 4NT0A 1DORA 3CV2A 1RLCL 4HMEA 2ZUSA 3CUXA 3KBMA 3OPSA 3VCNA 1ECQA 2G3JA 4AZHA 4RV3A 5ABHA 3VOJA 1KM6A 2G3NA 2WPGA 2ZRVA 2GK1B 2BGNE 5FF3A 3LXAA 2I9UA 2Z00A 4NVTA 1I2OA 1HN1A 4CNTA 3M7SA 3NQ7A 1SZFA 1S1PA 4FO4A 4GBUA 1KTCA 3QV6A 4ML9A 4ZE5A 4OJYA 3GDKA 4G1KA 1DWFM 4QITA 2IKJA 4B91A 1TPDA 4GRSA 1J79A 1GPWA 3ZLGA 1RLDA 4HCLA 3LBCA 2O4MA 3GWQA 3TV8A 1C8YA 4AG0A 1L0PA 2DT2A 4ORIA 4DM1A 1RY8A 3V16A 3EDEA 4JQ4A 3V1PA 3GVRA 4R5EA 1SFSA 2AKZA 3UESA 4R34A 3W7CA 3H24A 1PVNA 3W1XA 2VI0A 2Z28A 1TFVA 3NEHA 1UMYA 3ARQA 4EK7A 4U2ZA 1PZ2A 4LUSA 4JTJA 1AVAA 3WL1A 1BYBA 3NPVA 3VGFA 1EPXA 4YXGA 3I3EA 1KGWA 3QOKA 7ODCA 2PE4A 4AD3A 3M0ZA 3PFRA 1V6XA 5I78A 3WDRA 3VDAA 1VHCA 3GFZA 3EPMA 4C6JA 4MFEA 1MW3A 1A5SA 3BC9A 4MPQA 3R89A 3WH5A 4Q8TA 3I6TA 1WOBA 1UKOA 3EKGA 4FX6M 3U8GA 3QY6A 1WBHA 1IQ8A 3M43A 4BHYA 2Y63A 4PTXA 1V77A 1ZY9A 1VEOA 1CBGA 2BV9A 4MJMA 5IOBA 4V15A 5HDRA 3RYSA 3MBDA 5G4HC 2ANUA 2AOSA 2QIWA 4QG9A 4HU8A 3CHDA 2CZVA 2YDSA 2H8ZA 1WUEA 3B9NA 4H2HA 5CLTA 3WF2A 2FB3A 2E9LA 1TYGA 2NQJA 4X0NA 3DI0A 5REQA 3PC0A 3POCA 5FEWA 1K8XA 1S39A 2OSYA 3S9ZA 4JTUA 4KFNA 1BQGA 2REQA 1HJSA 1GORA 2Z25A 3NQ2A 1MDRA 1RD5A 1F8MA 2C14A 3QFWA 1DJQA 3EOOA 1VFTA 4AY1A 1CI1A 1FWAC 3KL3A 2Y7GA 4UMCA 5LNUA 3S4TA 4GQQA 1G4TA 2YCKX 3O06A 3CV1A 4F8XA 3VNYA 2BOGX 3HIJA 3S47A 3MHFA 3MB9A 1R85A 4V27A 5BW6A 1EZWA 2WHKA 4D71A 3UNTA 2J25A 4JNMA 3SCOA 1JYXA 4LX4A 2GGHA 2ZZ5A 3GNXA 3PTDA 1R30A 2VX5A 3P7YA 4HNCA 1SUXA 3UGRA 1S5NA 3W83A 2A4AA 2CWNA 1V02E 1NQKA 2BTMA 4LEFA 1Z44A 3R79A 4LPCA 1OYCA 3ZJ6A 1IF2A 3SIZA 3H21A 4EE9A 4RE0A 3SRHA 4QHRA 4GUFA 2J7DA 1TTPA 1BGAA 4DQWA 1HNYA 4K8HA 3GVGA 3BURA 3G24A 4CUCA 2HEJA 3URQA 1BHGA 3K8KA 1R7OA 3GR8A 1KFKA 3AMGA 1JPDX 2NV2A 4CN4A 1J0HA 4AD0A 1X98A 1M7XA 3K4DA 1V79A 2OZ3A 3WCZA 1XH1A 3LCFA 1NOFA 2P0IA 2QS8A 1C9DA 5A1AA 4UFMA 5I06A 1Y7VA 5I3DA 1K7FA 3QGAC 4PMZA 2YXOA 2PUZA 1XQKA 4IUGA 4EPDC 4LAZA 4P2VA 4IGSA 2Y5EA 2HXTA 1V0LA 1N2VA 1EGVA 3GHRA 4ZENA 3STFA 1R9YA 4TUFA 2NQZA 5HR6A 3PWIA 1TV2A 3S0CA 5GNZA 3W1UA 1XYZA 4XK2A 4MY8A 1R86A 2Z26A 2P5NA 4DNMA 3UT0A 1RP9A 3THCA 3FYPA 4UTLA 3LHVA 1E0VA 1V3KA 2VURA 1NDVA 4C1NB 4M6PA 2E68A 4GQ0A 4UTTA 3OVGA 4JKLA 4URIA 4IL0A 2QVHA 1QR7A 2WHMA 4L64A 4GO9A 3BLPX 1OFQA 3TXVA 3HQOA 3W7QA 4FXSA 2ALDA 1R3TA 4PUUA 1H5VA 3TCSA 1DQWA 3ANVA 1EXPA 1UCWA 4LH8A 4ZSUA 2EQDA 3I7SA 2QMKA 3FHAA 1LOLA 4WVXA 5C7VA 1P6BA 1T8XA 2UWFA 2DP3A 3W86A 3H7VA 2PC4A 4XTDA 1T99A 1Q6QA 1TVLA 5HINA 1VLIA 1OF8A 5CZSA 3PPCA 4AF0B 3CUGA 1W1VA 1VFLA 5A6BA 1VPXA 3UWUA 2IQTA 3E5PA 1AG1O 3R7MA 4D6DA 3WUGA 4F3HA 1EQPA 1K8CA 3FJ6A 1XGZA 4WGXA 2BSLA 4GUGA 3ARRA 1HO4A 1S5VA 1FKWA 1C8QA 2CLPA 4ZTYA 4KFOA 2HBXA 3WUFA 3FA3A 4UZSA 4D72A 3REQB 3TWBA 1W1A1 3EDJA 4HU3A 4IQEA 1FX6A 1XIMA 1FWCC 2CHNA 3C2YA 4PULA 4HMDA 3UCCA 1MZRA 1O4UA 4JFUA 2Z1BA 1NVMA 1PBGA 3P81A 4V28A 3S83A 3VK5A 2VEPA 3C8FA 5GPRA 5FESA 3A4WA 1RJQA 2VGBA 3IS4A 4HTBA 1LG2A 1VJSA 2HS6A 2QDEA 2VM8A 3G77A 2XSXA 4JHMA 3W27A 1U5VA 1YBQA 1IEVA 3WLHA 1SJAA 1FWHC 4N42A 3ES7A 4RNFA 2GDVA 3JVAA 3S1WA 2CLFA 4PSPA 1T7LA 2ZA3A 1W9UA 3CPGA 4H9YA 2FYMA 2IQDA 4IPIA 1U2YA 3L5AA 4BI7A 1KBIA 3PULA 4AIUA 3VIKA 1LT7A 3WL0A 2EKGA 1HJWA 1VGAA 4ZO6A 4JIIX 2RUSA 4WKFA 2Q8LA 2G8ZA 4FOKA 3CU2A 3WNNA 3ITCA 4YVPA 5ABEA 3HJEA 3MP3A 2V30A 3QQWA 2HMCA 4RXGA 1I9CB 1R2RA 3VGEA 1POJA 2YDAA 3SRKA 1YE4A 1XRFA 3MJMA 3MMWA 4FS9A 4A3QA 4R88A 5H8UA 1IWPA 1A3XA 9CGTA 2E28A 4NHVA 4X9YA 1L6YA 5I24A 4S23A 5D02A 2ZTKA 4QDMA 1JVNA 1XIDA 2POZA 4KS0A 1AJ2A 2DZXA 3W7JA 3OGVA 3I4EA 1VYPX 2A7NA 1BTCA 2G4JA 1B3VA 5FD0A 2GWNA 3ARSA 4AHPA 3DFTA 5JH1A 5CJNA 4L4PA 4PODA 2D23A 3MUXA 3ARZA 3H2CA 5I5RA 5A8MA 1Q7ZA 4GO8A 2J66A 2PODA 4J9JA 2Z24A 2WQPA 3WNPA 5HR7A 4JCLA 2BY0A 1W5OA 3VYLA 4FXFA 5AHEA 2CBJA 5EGRA 1K8ZA 1VQTA 3BLLA 5CC3A 1PX3A 2BBFA 3BV7A 4HSHA 1AW5A 4MWAC 3SFWA 4EAMA 5H8PA 3LGDA 1W1TA 4L4MA 1Q6OA 1F6YA 5BWFA 1QBAA 4QR6A 2V5JA 3TQPA 4MZYA 3P14A 3NCOA 5CBBA 5CGMA 1BG9A 1QNQA 3TJIA 3IGXA 1QPOA 2CFFA 3AMDA 3QZAA 1PAMA 5FI8A 1MUMA 5BXRA 2DH3A 4GNJA 3WBXA 4IICA 3FSTA 2ISSA 4N6FA 1A0DA 5DXYA 3DHFA 2HWGA 1V7YA 4LVAA 4LCSA 5K7JA 1D3GA 2I57A 1MYRA 2QUMA 4POCA 1G7VA 4C1LA 1OT1A 4O1BA 2FDMA 2CXGA 4L7ZA 1GW9A 3TZFA 3TW7A 3VC5A 5HMDA 5CSRA 1UR8A 3MW7A 1DJHA 4BS0A 1GOWA 4WK9A 4R9OA 4X0VA 3NZ1A 4UTHA 3WX7A 1IR1A 3L4XA 3WLKX 3EPOA 1I2QA 4GCAA 2VEFA 2VXNA 3Q94A 3OIXA 3W53A 1PX4A 4GHRA 3PZOA 3VD7A 3PK7A 3ABZA 1TVPA 1BTMA 1R3VA 2PTZA 1RVGA 1MXSA 3F2CA 4QQ3A 1EA9C 5CC7A 5M3WA 1JI1A 2PDKA 2G0WA 4DAFA 1E1CA 1CGVA 2GL5A 2A3CA 3G1AA 5IFTA 1HKKA 4H9VA 4WZHA 5E6YA 4QX4A 1ODUA 4B2DD 4DJEA 4PGLA 3E74A 1TWSA 5BZAA 3VDGA 2DZVA 1C3FA 2RFGA 4C7DA 2VRQA 3PPHA 3GXTA 3T78A 3W1TA 3KHDA 4HIBA 4H8UA 2OWWA 2V0TA 4UR8A 1H0GA 3UQNA 3UF9A 3O1NA 3ATYA 4N9CA 2OJPA 1FCQA 3MI3A 1E3ZA 4HQVA 2PU0A 3VKJA 3HU7A 1U5HA 4GH3A 3CAWA 3IJ7A 1WB0A 4LUYA 2NUYA 3U57A 3HMJG 2ZKMX 2O9PA 1NFBA 4WSJA 4YL2A 1FTXA 3OZPA 1VYRA 1V3JA 3ZR4A 1XDJA 3P5YA 1JGMA 2EPNA 4IFKA 2AAAA 1KWGA 4OIFA 5HNTA 2W92A 2HROA 4HHLA 1SU5A 3OEXA 2TPSA 3T0BA 3F4DA 4WIWA 1DHKA 2Y88A 3E5BA 1KRBC 2ZUVA 2J9XA 3G6LA 3PZMA 3QMRA 2ZA2A 4N9DA 3WMCA 4Q8VA 4LBRA 2GFTA 4O11A 2VDHA 3AYSA 4Q33A 4ZFCA 4E8DA 2HISA 5FJOA 2DT0A 4QE5A 4ZFMA 1XCWA 3TC7A 5DT5A 2DQXA 4FMVA 2G50A 1C93A 3HA1A 3K4WA 3CZGA 3TA9A 1T41A 2DZWA 3GUGA 1O68A 1BWVA 3EMCA 1ZTVA 1JZ3A 2OX1A 4FLQA 2WVVB 3BJFA 1UD6A 4HGXA 5AC8A 1UOKA 5LZLA 1FCBA 4NZ5A 1KW1A 3CWNA 3GTFA 3LZ5A 4LALA 3VC6A 4Q4RA 2VFHA 3S8HA 1AQFA 1N55A 3QSTA 1V02A 2VC5A 3TYUA 1FDYA 1PX8A 4IHCA 1HFBA 4B16A 1GW1A 1NSJA 1IXNA 4N7QA 3DFHA 3S5SA 4H6RA 2YDRA 1JF6A 5D2WA 3TWAA 5K4XA 2BNJA 2DUZA 5DT7A 1OIFA 1W3HA 1M65A 3FJ4A 3OZMA 5I3KA 1XUUA 3G8RA 1HW6A 1NU5A 5KITA 5DX7A 3U48A 2H8XA 4PMDA 5ABTA 1VBUA 4AY8A 3DEQA 1VBHA 2OT1A 4Z17A 1UUOA 5E0FA 1NQ6A 2PLCA 1F3WA 3O7UA 5CJ5A 2YCEA 2GZXA 3W2NA 3N3MA 1ICPA 2XISA 1JQXA 3L12A 1FP9A 3CO4A 3RU6A 4NZ4A 4H7VA 3UWQA 4FEZA 1UWSA 5EU9A 5DBUA 4AX6A 3KP0A 1WX0A 2FHFA 3FCPA 5MKGA 3QGVA 3MS8A 4HA0A 4CGTA 3A12A 2ABAA 5FAGA 4DZIA 1JQVA 2NX9A 5FACA 3RUBL 4ASTA 3N3TA 1R47A 2RKXA 5B7YA 5HWMA 5M03A 3N2BA 1Z69A 2QPUA 3ITYA 5AC5A 2G3IA 1SZRA 1PPIA 4JL1A 4FNPA 1EUAA 1L9WA 4IPJA 2Q3RA 3FK4A 2X09A 1V8EA 2G95A 4DF0A 4AH7A 1QAPA 4WHBA 3DC8A 3KM8A 3GIQA 3T4WA 4J3SA 4KWWA 1W2VA 5I03A 4LUJA 1O95A 3AALA 3UYIA 4DX3A 4UTWC 4MOZA 3EDFA 2ZX9A 3SQSA 1TJRA 3ZT7A 1H0IA 4BF9A 1Q63A 4CN6A 3GNRA 3L21A 2X40A 1E4NA 1SO6A 2CW6A 1ZAJA 2NX1A 2Y7FA 4IIEA 1H7OA 2ZOXA 4MTVA 3DERA 3NTYA 1I2RA 5TQLA 4GQRA 4JTQA 4MKNA 4QS5A 4O1CA 2CCRA 3RFAA 3G18A 5DN1A 1EYEA 3LENA 1TJ2A 1E4LA 4LCRA 4PBGA 1QI4A 4LF2A 2WHLA 1PWMA 4BQ5A 3VOGA 3AYVA 1FHUA 4JIEA 1HGYA 3MANA 2FZNA 2OWXA 5DF0A 3SCUA 1JRCA 3L0GA 3N4FA 1FWIC 3N2XA 1XYLA 5I0DA 4O18A 2IPGA 1KFWA 5CC6A 4S39A 4HZ7A 1KFEA 1PHQA 4N6EA 2NQLA 4QCEA 4AZGA 1P0DA 4C6FA 1QPQA 1ZHAA 1JI2A 2PFHA 1X97A 1FWEC 1FUYA 2QULA 1XLAA 3R43A 2C1IA 4B15A 1MQPA 4GX9A 3C3NA 5G4WA 3S9IA 1YE6A 1FHDA 2PWGA 3SY1A 2UY2A 4NG3A 3PUDA 3DG6A 1ZENA 3CEUA 1ZJIA 5CPSA 3DESA 3M41A 4GNKB 3H12A 1VIWA 4GYKA 4DLFA 3IIVA 1UZDA 1BSLA 1DQXA 3WMLA 3PBGA 4QQUA 1ICSA 4IXHA 1B3YA 1YYAA 4B2DA 2PWFA 4PMYA 5AYIA 1X39A 2HJPA 2VNCA 3FNDA 1GWJA 5LYRA 1W0MA 1ZSXA 2PLJA 3H4WA 3EEGA 1LROA 3PY2A 3WF0A 3W1NA 4NYUA 5I3IA 2R24A 4GVHA 1CYGA 3ARUA 5AKQA 2IKGA 1UD3A 1K4HA 5G1MA 2CLOA 3VXGA 4CQ8A 4PL2A 4GFSA 3HB9A 3V35A 3CHCA 1L6FA 2RDXA 4D1JA 3HBLA 2W3ZA 5T8GA 1FH9A 3KE0A 1HKJA 2J47A 5HNUA 1REQA 4I7VA 4X9SA 2PU1A 5FJRA 1BD0A 1JCTA 1M1BA 1RPXA 1QI2A 4J28A 4KEUA 4PTVA 3SIMA 5FEZA 4IGHA 2Y2WA 2ZRUA 4XUGA 4HMCA 1WYIA 5CPLA 2O7QA 2X7VA 4OGZA 3CB3A 3L4TA 2VZTA 4P5UA 1V3IA 1W3LA 1DEDA 4K7VA 2R1LA 3WD1A 3PWAA 4PA8A 4LUSB 4IFOA 1XCFA 1QNVA 3LUTA 3K4AA 1OIMA 1TWIA 2FHCA 3KS5A 3DGRA 4H19A 3QHNA 3SGGA 2HVOA 3H26A 2I9EA 3VX1A 3QBUA 1Y5VA 1K9EA 4Y2WA 3MWCA 1OF6A 3WO8A 1JPKA 3VO0A 3OVQA 3B0UX 3A3HA 3LHUA 1JJKA 2PWEA 4E2DA 1GPFA 1WOAA 4B5NA 3MUIA 3MKKA 3IIXA 3T42A 2NVAA 4ZR8A 4IMAA 2CYGA 3VFCA 2Z7KA 3BW2A 3OA3A 2E9MA 4FP1A 1XQLA 4OU1A 2DUXA 1PKMA 3NQBA 2PP3A 4H04A 1P6WA 2WJDA 2E0PA 3W1MA 5J8LA 5I02A 1JFXA 3EYPA 3DG7A 3K8LA 1EL3A 5REQB 1YDYA 4BJHA 1P48A 4AYGA 2J4GA 3M0IA 2REQB 2I5QA 1DXEA 2VRKA 1Q6RA 3ZO9A 5A8QA 4UOJA 2JE8A 3NDYA 3LCIA 3EAUA 1CEOA 4I3GA 2VDGA 3TONA 1NF7A 5FJPA 5D37A 5F4XA 2BX7A 1X1ZA 3IIZA 2A79A 2DVUA 1QOQA 2ALRA 3T2PA 2RGMA 3GH7A 1QPNA 2GVJA 4JHZA 3G1VA 4MG4A 3B8VA 1EEXA 4MB1A 1EP1A 4C5YA 2XH7A 2VDIA 2YL6A 5D2XA 2X1TA 3AC0A 1KFJA 5HAOA 1OK4A 1D8WA 4FF5A 1RP8A 4AX7A 5F7UA 2QUVA 1JF5A 3AJXA 5EKYA 1XRTA 2XU2A 3VKKA 3JZEA 4JTAA 3VKDA 3QLLA 2WK2A 2NSOA 1S5WA 1E9ZB 4IPPA 1ZCCA 2QDHA 3IUIA 4DUOA 3LCXA 1W1B1 1MEIA 3IPWA 2YOCA 4RXFA 5F4SA 3L4ZA 2WLYA 1LBMA 3VDHA 1JDEA 1W5MA 5FA5A 2W9MA 2O55A 2JALA 2O9RA 1TV5A 4K1GA 1OINA 3CXOA 2WMIA 5HK4A 4A2SA 4MWAE 4RPQA 2NQ5A 6XIMA 1FFQA 2JGYA 4JD4A 4I9JA 3OLEA 1DVJA 1Q8JA 3CS2A 4J1OA 1IZJA 4I8YA 4LY8A 1XGEA 4FALA 4C6MA 1DQUA 1JPMA 1D3HA 2X1IA 2RH9A 3WK3A 3MP4A 1XPGA 5LXXA 3SEPA 2J13A 1DYSA 5HXMA 3HGOA 4DWSA 3CC1A 3B0YA 1IZKA 2HTMA 1NFGA 1R87A 2WANA 2Q8ZA 4KF1A 1BYCA 4QNWA 5JIPA 2QAPA 1GK8A 4TXEA 1GZGA 1CGUA 3AHZA 4JYEA 5AECA 3QN3A 3LI1A 3M6YA 4K36A 3KBVA 1AJ0A 2QR6A 3CLWA 1VJZA 2J7HA 1HGWA 5D2YA 5JH2A 3Q2DA 3C8NA 2YBVA 1RK6A 1FKXA 4XX6A 4ZOCA 3BZGA 3L0KA 4D6GA 4P61A 3PAJA 1ICQA 4UXDA 5CC5A 3UWEA 4HA4A 4L61A 2O7SA 4DXKA 3C2RA 3NQCA 3KOXA 3LD5A 3QV9A 3FS2A 3MDWA 3KBJA 4XISA 1V6WA 2WOQA 1EWDA 4EIVA 5IM51 4CD5A 3P6LA 3LRKA 4HNVA 3E0VA 3OG2A 1PYFA 3SCRA 3BWWA 1K6WA 3CL7A 4DAIA 4AW7A 2ZXAA 5IBXC 4UB9A 3C2FA 4K6AA 1FWRA 4RPPA 3OW1A 5FF2A 4RZ6A 3DXIA 4C65A 1XICA 3O07A 3UZJA 3I3DA 3UWZA 2C79A 4DPQA 2VC7A 4DWDA 2V81A 4F0HA 3SAZA 2PP1A 2XDFA 1EDGA 1WNOA 2WZMA 3LBOA 5I2UA 2QMJA 3AUOA 3U2ZA 1L2QA 2BVYA 1DV7A 4W4QA 3P8IA 4DEFA 2EKCA 4FNQA 1ADOA 4K39A 4GG9A 2E1DA 2MNRA 2ZWZA 1Q8AA 3DYMA 2TMDA 3PJTA 2FTYA 3MMTA 5H2ZA 4D6IA 3VMNA 1GG0A 2C13A 3THUA 2IKIA 3J7HA 5FJUA 4MLRA 5C55A 5K9XA 1YBQB 1BYDA 5BWAA 1TJ0A 1L6SA 2ZZ7A 3ITLA 4HNTA 2RDTA 4H9TA 1DBTA 2JKEA 2GJXA 3GXMA 4I9MA 5AVHA 3WNLA 3NGJA 4BKNA 4NU7A 1UP2A 2ZX8A 5JQ9A 2E8ZA 1OGSA 2WV8A 2VEGA 3N13A 3N18A 1KLZA 4I5UA 2GGGA 1KWKA 2Z6JA 5AZ0A 4YS1A 1A49A 2PTDA 4ACYA 1XSIA 4MWAD 3BAIA 2G5WA 3PBVA 2R9RA 4K8GA 3O05A 1UZ1A 3SCTA 4HJWA 3OLIA 3KVKA 4IMEA 2AMGA 3IGHX 1O60A 2IUZA 3AWOA 2XVLA 3WLRA 3LNMA 8CGTA 3R8HA 5T26A 9XIAA 4DJFC 4EPEC 2ZVRA 3CM4A 3FYOA 3DCPA 1KKOA 4RNIA 3GC4A 3LPPA 5I3FA 4GXMA 3QMSA 3CQ0A 4PRRA 4KW2A 2RDUA 4GJJA 2OQHA 3KWXA 1XG3A 4Q32A 4FF7A 1VKFA 1VEMA 4HYRA 3CYJA 2X0SA 2FPVA 3VNDA 1JZ8A 2ACSA 3G1DA 4L4OA 4FXRA 4JCMA 1A0EA 5BOFA 1J96A 3VIFA 3H2AA 1A5CA 3VUSA 4QDWA 3HPAA 2RHGA 1V4YA 1MFVA 5D09A 4RZ4A 3W02A 4U10A 2WMJA 4QS6A 1DHPA 1JDDA 7TAAA 2WAGA 4KRZA 2VGIA 1QXLA 3N4EA 1VF8A 4F2TA 4A3RA 4HYVA 3U4FA 2H90A 4YVVA 3CAVA 3HFYA 1BXBA 1I45A 4WKAA 2GDQA 4LGXA 3AXHA 3UG8A 4CU7A 3AS2A 4RZBA 1US0A 3GKFA 3M5YA 4UNKA 3YPIA 1BWKA 1BFNA 1EJTC 1NEYA 2E77A 3EWXA 3KRUA 3GU1A 3PUGA 3RJYA 3M0KA 4G7FA 3WD3A 2PDLA 4KCWA 3A23A 3BSGA 2GGEA 1YPXA 4REQA 3MDUA 1OFPA 2O56A 4N9BA 2WNNA 4QAIA 2G41A 1XLBA 3GKAA 5D05A 4OKDA 3KZSA 5D04C 4FX7A 1E4MM 1WKFA 2BODX 3N2OA 4HN8A 2R1NA 4HHPA 4B3LA 3SRDA 4Q4MA 2EAWA 2IKHA 5AYXA 1E55A 5BMXA 4AXKA 4CD4A 2NV1A 3T2QA 3PNUA 3TJXA 1RQBA 2RAGA 5A2BA 3LCLA 3IJQA 2PA6A 3P60A 3NVDA 2JKPA 2C71A 3SJ3A 1UBPC 3T7VA 4C1KA 2D24A 3C61A 3W4RA 1ZFJA 5C9WA 5DMMA 1RZMA 1UOZA 1M53A 1KA9F 1YEYA 4H7CA 4IP4A 2WWCA 1E1CB 4F0RA 3R12A 1GZJA 1GJWA 1VFMA 2QF8A 3KHJA 4OFCA 2C18A 4LJ3A 2YCJA 3RMEA 4XWUA 4R3UA 5EMLA 5BXPA 1OCJA 3EBVA 2TAAA 4Y7EA 4PCNA 3UWVA 2W67A 5GNYA 4DVOA 3WDQA 3M5VA 2BY1A 3NO1A 3N15A 1OGGA 3L66A 4E6MA 4R33A 1JDAA 3BV4A 1ZBWA 5T9BG 1PSCA 4KRUA 3VAVA 5D2TA 1GVQA 1V03A 2D3NA 3AS3A 3RJXA 3L9CA 3NL3A 1UJPA 3SUWA 1F6KA 4UTJA 2HSAA 2J75A 2DIKA 2ZVIA 1JYWA 1S2CA 1NDYA 3WELA 1V6VA 3ARWA 4IFKB 4F79A 5CZTA 4XAYA 3SZ8A 3WQVA 5EMUA 2XN1A 2XIIA 2ZRYA 1SW7A 3STEA 4D8AA 4A4AA 1UPPA 2WCAA 2OO0A 3MPGA 2DSZA 5AZ1A 1VC4A 3EWZA 4IGNA 4CU8A 1TG7A 6REQA 1TRIA 3NPUA 1VYSX 2FKPA 3S46A 5DY2A 5AY7A 1L8NA 1VFOA 4PFHA 3W2UA 4MJ4A 2BXYA 4KQNA 4JFWA 1NWSA 3C5QA 3D5HA 3EA1A 1XD1A 1VFFA 2VENA 1E6NA 2PC8A 2V3FA 4UNLA 1Q6DA 2Y85A 1AJZA 3CHEA 4C6NA 1J2WA 1XX1A 1OCBA 2IQ0A 3U5YA 3B8TA 2OFJA 4O57A 4I90A 5A2AA 2HE8A 3IVUA 2E8YA 4ORMA 3MQTA 1HZYA 4F2BA 2WPBA 2ISWA 2DT3A 4C91A 4BCEA 4ZTXA 3R0UA 5HUPA 5BOEA 2GJPA 4AIEA 3VZXA 5LNVA 2WMGA 1TR9A 3ZR5A 3AS0A 3VD3A 1EO5A 4D6HA 2GWGA 1ME9A 2PGWA 1RUSA 5KINA 4CCCA 4XZMX 3R0DA 1NAL1 2EG7A 1XINA 3TH6A 3UJSA 4Q8UA 1UHVA 3OG3A 4DUWA 3PBUA 1EC8A 4O4WA 3RU8X 2PTWA 1A5BA 4IM4A 3HN3A 4FOJA 1XDLA 2BB0A 3R8GA 1J2BA 1UQZA 2PGEA 1TE6A 4Q8QA 1W91A 1ZS2A 2VC9A 1QPKA 3ITVA 4MFDA 3P67A 5KSWA 4CQCA 3U2OA 2BHYA 4OBTA 4LFYA 3TR9A 4NX0A 3CUZA 4WY0A 3MT1A 3V4BA 1C9WA 5MKGB 3WMSA 1M7JA 1DP0A 4FAMA 4LC6A 2ZC1A 2TRSA 3AJ7A 5AVNA 2PAJA 4JIRA 3DBNA 3KTSA 7ENLA 3AIQA 1S2AA 2A6LA 2D20A 4TIMA 3GNPA 3ALGA 2QIIA 3OVRA 4B92A 1FXPA 1EGZA 4LTSA 1NOWA 1E0UA 2WCSA 4DYKA 3MY9A 5FCZA 4FR1A 1JNDA 3M07A 4MZ1A 1AD4A 3BMXA 4NILA 1KD0A 1UQYA 5TD4A 1Z3NA 3LMYA 1OFDA 3GDBA 3WK0A 1JNEA 1W6TA 3SECA 2V8ZA 1N8WA 3NGFA 3P8JA 3N1AA 4AIBA 2PDHA 1O1HA 3OO2A 1D3CA 1QRQA 3QTGA 5HOSA 3KBWA 3RLUA 3S1XA 4TTGA 3S5OA 1KFLA 1F2JA 1XBXA 4D6EA 4F0KA 3QF0A 2VCBA 3UG5A 3QM3A 2GSJA 1Z32X 1TV7A 5DQPA 4BEUA 3LA4A 1ZP3A 2E6YA 4ICMA 1OY0A 4FNUA 2QNEA 5CBJA 3CV6A 3CL8A 2V5CA 1QO5A 3HG4A 1XH2A 5D8ZA 2ZRWA 4L4LA 3M46A 3MCNA 5D2VA 2XVKA 1BSIA 1UR0A 3OOQA 1JUBA 1T96A 2P53A 4XD6A 3CIVA 3BL3A 3W2LA 4H6KA 4CD6A 3LNPA 2QCGA 4IG2A 2SFPA 1WAWA 3TE9A 1F61A 2X0YA 2JBMA 1J6OA 2A3EA 1JIBA 5A8GA 3PPFA 2WO5A 1S46A 4ICNA 3AIVA 3V75A 4B5SA 4MB3A 2ZUMA 1XH0A 3SM0A 3HPZA 3NO5A 1UWRA 1OT2A 4MJ2A 3SGUA 4A05A 3THQA 4OOZA 4HSOA 2WCGA 4HB7A 4YPJA 1XRSA 3PB2A 3THAA 1TELA 2EO7A 2VR2A 1P1XA 1UB3A 3AZTA 5DO8A 2PWDA 1NF0A 3A21A 4GYFA 3A5VA 3MCOA 1XCXA 1EJRC 1SMAA 1V93A 3N2CA 3QC3A 4INFA 1NWTA 5A6TC 3CL6A 2GVYA 3F4NA 2J7EA 1TPWA 4M29A 2IPFA 4EVZA 2YFNA 3CTTA 1X7FA 4QEHA 2Z2AA 3GK0A 1C29A 1LF1A 3P93A 3WUEA 3G8EA 1YQ2A 2W0UA 3ERPA 2XM1A 3W2KA 4JIHA 1M68A 2A85A 4JY8A 1BQCA 4AEFA 2DVXA 3E0IA 2WSQA 4C6EA 3ID7A 1REQB 3FV9A 1HVXA 4W86A 3MC5A 2ZZ4A 3W7PA 1OCQA 4TX6A 2WZEA 3GNOA 3UVIA 2O9OA 4C7FA 3O0KA 1TQJA 3RM4A 1L8PA 1K77A 5FSEC 4TOQA 5CZ0A 3VABA 3IVTA 3QEZA 2Q71A 4I9AA 1FWWA 2FFIA 3U7BA 2B4GA 4CCZA 1P0BA 3KCLA 3QY8A 3UCDA 1HL8A 2VEKA 1IT8A 1FY6A 5EY5A 4DJDC 1K8YA 3UGVA 2YLLA 3QPZA 2Y6ZA 1LOSA 5GQBA 1US3A 2OEKA 4X2PA 2ASHA 1M3UA 4KEVA 3CLMA 2OZ8A 4LYKA 3LGEA 1V6TA 5E1QA 1J12A 1WDPA 3MZ2A 4PB3A 3F7JA 5GJPA 4LS2A 4G5DA 4DPPA 4HCDA 3RO6A 2Y0FA 4H6QA 4RLIA 2UV8G 3ZJ8A 5C9XA 3B4YA 1QDSA 5LKYA 3SGZA 1W3JA 3N9RA 3II1A 2F61A 2BHZA 5CSSA 1JL8A 3P82A 3OZYA 3AS1A 1AQHA 4JIQA 1JEZA 1P0EA 3UPMA 2PWHA 4AEEA 4XV0A 3FW6A 4M80A 2Q6ZA 4UFLA 1MI3A 5DLCA 4QSFA 3ZMRA 1Z89A 3DC0A 1IR2A 2ZA1A 1WCGA 4H9ZA 1EUNA 1RV8A 4J5NA 3BG5A 1XC4A 1MO0A 3EA2A 1KCZA 5E0CA 4IIBA 4JNZA 2WSYA 3WMBA 5E93A 1NWRA 3GXPA 3IWPA 4OECA 2NW0A 4UTWA 5BU6A 4A22A 2YSWA 1I1XA 5D9MA 1QNRA 5LIKX 3T1GA 3HOJA 3TVAA 4M3PA 2JQXA 5HJLA 1H51A 2D2JA 3IK2A 4QE4A 2QCHA 3RPTA 3VIJA 1SO4A 3W37A 4DO4A 4QFUA 4HP5A 2OEMA 3RILA 2VYOA 4W87A 5BNKA 4JYFA 4EPBC 3W3OA 1H11A 4X63A 3S1GA 1XF0A 1DTNA 3PANA 4MY1A 3UP8A 1XLJA 3NAVA 3IANA 4AVOA 4MVAA 2PS2A 1HL2A 1GQKA 1BRLA 4GPNA 3WDHA 2WMIB 3BANA 1PZ3A 5HBFA 4PUWA 4LWWA 3W87A 2BFGA 2OQLA 4IOTA 3ZQ9A 3ZR6A 1YADA 5EMMA 3B97A 3H2NA 2ZUTA 2OKTA 5I7GA 3I68A 2EPLX 4IPNB 3GS6A 4KWSA 2DEPA 3FGCA 4B3KA 3PJWA 2VD9A 1A5AA 3ZS4A 3GHTA 4DWSB 5FAJA 2INZA 3THDA 6TAAA 3FFSA 3CZLA 1VH7A 3R4IA 1GEQA 4JKMA 5IRPA 3C3UA 3CWOX 1L6WA 2JK2A 3MP5A 3LOTA 2XINA 4HMNA 1GQNA 4FNTA 5G2HA 1ZB5A 1A0CA 2HNHA 4L1XA 4JFTA 5LNRA 3NPXA 3C2OA 2DW7A 3NM3A 2X30A 1I8JA 3C6CA 2VR5A 3UZXA 2CLHA 2VFIA 3MMUA 1G94A 1HF6A 1UWAA 3TDFA 4ADTA 2WKLA 3LB0A 2WSPA 3LI0A 3LTYA 2ZYFA 1A80A 2W63A 3HPFA 3QHOA 4H4IA 5C9UA 1R3YA 3E3HA 3W7MA 3G22A 1QW8A 5A6LA 1QOPA 3G5EA 1OC7A 3N17A 1VPQA 4UTUA 1EHAA 2WJZA 3WY1A 2JEQA 3GYEA 5FL1A 1E9YB 3QPEA 3PBWA 1NM9A 4UQDA 3IV8A 1IHIA 3W82A 2ZRZA 4CEXC 1LT8A 4KWUA 1KRAC 2CPUA 3E49A 3UG4A 4DZ5A 3TJLA 4YN5A 3WEOA 1EB3A 2VHLA 4YIWA 3SUVA 3WLLA 3TN4A 3TU9A 2J7GA 3SB0A 1K3UA 5C54A 4W93A 3DU0A 1ENUA 3KOWA 4DUVA 3HGSA 3N6QA 3PZ9A 2FJKA 1G01A 5AHLA 2ISDA 1Z41A 4A29A 3LX9A 4Q4PA 4AMCA 4H9MA 3SCSA 3CQJA 5HQEA 3GHUA 3N9KA 3GDTA 2X1UA 4DJFD 1XFCA 3FOKA 1GQIA 1A53A 2V3DA 3USZA 3IARA 4N4QA 4BFAA 3I4KA 1PWLA 1ELSA 1A5OC 3FYYA 4JZ5A 4OT7A 3ANUA 1GJUA 1QW7A 4C6BA 1JUEA 2QDGA 3CUFA 2VGGA 2GJXB 3TKFA 1LLWA 2D1ZA 4W8LA 3N6HA 4HPJA 3DECA 4AUBA 1SJBA 2AMXA 3P80A 4ONVA 4XAZA 4EANA 4EWND 1XHGA 3WF3A 3AHTA 4EXBA 3W81A 3K2GA 4JFVA 2DSKA 4W8AA 4OBRA 4LS0A 1V0MA 1YNYA 3TQVA 3MYPA 1I6NA 1OFOA 5EB8A 2ACQA 5LNSA 1H63A 3TNBA 1WZAA 3VMPA 1W5NA 1EQCA 1TRDA 4P8WA 2J9YA 5FEPA 1PIIA 3CO8A 1IZCA 4FZIA 3UXDA 1E72M 4WGHA 2J7FA 3EDKA 2VQUA 4M81A 5C9ZA 1BKSA 2GQ3A 4JS3A 2ZICA 4QM1A 2FVMA 1ONXA 4MNLA 1VD6A 1AW2A 4NNCA 4DNHA 5LA2A 1A5LC 3TQKA 3AIEA 1AL8A 3PN8A 1X1NA 1EBHA 4AAJA 4R9XA 2WC4A 2V3GA 2WXDM 4GVIA 2PDUA 5CZJA 3LPGA 3GTIA 3CIWA 3WQCA 3SUSA 1AQMA 2A7RA 4M19A 3MO7A 2HVMA 2YB4A 1H09A 1ZBVA 1RVKA 3IUHA 3WH6A 3WJWA 1B3OA 1FVPA 2HRWA 1VBJA 3HFTA 1PKYA 3RX3A 2CKRA 3G1HA 1UA7A 2G3MA 5CJMA 4CQBA 1H61A 2XGZA 3B8SA 3VFLA 2Y61A 3BLFA 2OMAA 1V51A 4K3ZA 1KXQA 3O16A 1W31A 4GI9A 3NZGA 3N6JA 4XO6A 4PN2A 2XFFA 1GHSA 3S6TA 2F38A 4G56A 3GTXA 4GH1A 1WBJA 4XO7A 3W6YA 2PTXA 5D9NA 4YTQA 1KRMA 1FOBA 3HJZA 1R8LA 3QGKC 2L5HA 4B4HA 4GY1A 4DBEA 3L7RA 2EG6A 3CMJA 2GPTA 3DOPA 4IP5A 4RDVA 1R7AA 2Y70A 3CH0A 4REQB 4PMQA 3ANYA 2IXVA 3N29A 1B3XA 4JOMA 4GGHA 5AYYA 4F0LA 1JRBA 1GHRA 1LQ2A 3FKKA 2NVDA 1IIHA 4FLRA 1OX4B 1QT1A 1SMDA 3C0LA 4UFHA 3MSYA 1Y0EA 2DH2A 5CEWA 3P0XA 5I3JA 1Q3NA 4HPXA 1YXCA 4LW7A 4ERIA 3WJZA 3ABSA 1WDQA 3GM8A 2AQWA 1B9BA 4MADA 4NI8A 4C7GA 2FQIA 2WSKA 3BLOA 4UQ9A 1RA0A 1DWHM 2WLZA 3VIIA 1EBGA 3BGGA 5HNNA 1VLWA 1E15A 2NUXA 4WSKA 3FIGA 1DXFA 1JCYA 1I1WA 5TAOA 1QHPA 2Y62A 2F6KA 1EJSC 4NL1A 1J8VA 1XP3A 4FLSA 2O92A 2RGLA 2R8WA 3DBPA 5IBXA 2XGBA 2DV0A 3EWBX 1H7PA 1JPHA 2VT0A 4MZ8A 5IHSA 1C8XA 2XN2A 4B5UA 4Q7BA 3LHZA 1MDLA 3RM9A 1TB3A 3RRAA 3OJGA 1KBBA 3OZOA 1W8SA 3FXYA 1F74A 3HMCA 2QCMA 4CNPA 2RJHA 2PDXA 5PTDA 1QHZA 4AD5A 3UXKA 4ACZA 2C8NA 1UIPA 1OM0A 3N2TA 1QK2A 4RJEA 1FWBC 3BCFA 3L5MA 2PP0A 4RKAA 5BXSA 4RDWA 3VINA 1W8GA 2VZSA 2NT0A 5JBEA 1RD6A 4WDXA 4CNSA 1E6SM 3IK4A 2TYSA 4BK9A 1U1JA 3G0UA 1R38A 4O8AA 5H91A 3NDZA 3GH5A 4RDYA 4UTTC 3DHPA 1A5MC 3R11A 2D2GA 4DO7A 4U2YA 2CLKA 4F66A 2D2OA 1BVZA 1TV8A 6CGTA 3PSVA 3PVFA 5D03A 4C6DA 1KXTA 3IJ9A 2FHBA 3MHUA 1ZPTA 2I5GA 6REQB 2YXXA 3DYOA 2PDJA 2Z1SA 1TO3A 1US2A 3UJ2A 4O28A 5EMKA 1SJDA 2ATMA 2BLEA 4IP7A 1FRBA 1O5XA 1UH4A 5A3HA 3LQLA 1TTJA 1T0OA 4RUBA 5KZDA 2W66A 4AVFA 4NX5A 1PEZA 5TF0A 4KT2A 2ODOA 3ABOA 5EFDA 1NDZA 1XIBA 4Q8WA 3QHMA 3WQWA 1EYWA 4MNKA 4AB4A 2BHUA 4DJFA 1P43A 4CVWA 1FH7A 3W7EA 3KDNA 1S2UA 1H50A 3CQIA 4M1BA 4UMAA 5LGZA 4TR9A 3NYDA 4NYYA 4E8CA 4JDBA 3OB8A 1YTEA 1XIIA 2NXIA 4TV6A 1J10A 3ARXA 4E3VA 3F4VA 1E70M 2I7GA 1LL4A 3APYA 3FXGA 2V63A 4R53A 3L2MA 3AMKA 1TZZA 4PBEA 1QI0A 4O0QA 4N9EA 4GYPC 4XBJA 3WQ8A 3ZVHA 3OTRA 3ZXWA 5J04A 1DIEA 3W1RA 3H7RA 4C6IA 4OOUA 4ZL1A 1AODA 3VKCA 1ML1A 3UXIA 3LYEA 3COTA 3SN0A 2GVGA 4KEMA 2OX4A 3H22A 3AI0A 4WY0B 5D9OA 1C91A 5A6AA 3WLNA 1NOUA 3WFZA 4O17A 3V0SA 4GQGA 2XWEA 4B9YA 1ZAHA 4O12A 1VFHA 2GOKA 4LYRA 5DCEA 4NASA 2EXOA 4YVXA 1CDGA 1OZQA 1JDCA 3BICA 4OUEA 4XUYA 3FVDA 4OV9A 2Z1VA 4QP0A 1C90A 1UUMA 2OYKA 4Z1AA 3W6MA 1EDTA 4K37A 2XVGA 3WYZA 4LAMA 1UZ4A 2P50A 1J6PA 3KLLA 3P84A 1EIXA 1GYMA 1DE6A 3GAYA 4TVDA 2DZTA 3PP7A 2CBVA 1FHLA 1JD9A 4GK8A 2DIJA 4RCXA 3VGBA 3KBSA 2WMFA 4EKJA 1C7TA 2HNEA 1LQ0A 4R7OA 1NY1A 1OFEA 1UC4A 2J8FA 3K5XA 4S38A 1V0KA 1GVOA 4H9XA 3AMCA 3SR7A 4AU0A 4NAFB 2PDWA 1PB0A 1W56A 4JQ3A 3EWWA 3PF3A 4Z1DA 3VNIA 4A8NA 3W75A 1RR2A 2C19A 5C2CA 1VB9A 3IIOA 1TMLA 1EX1A 3FJNA 1ZBCA 1UW9A 1W9BM 1MUCA 2WZTA 1UWIA 3SJNA 3DIPA 3GAKA 2QYGA 3ES8A 3FJLA 1E6QM 3IJ8A 4TO8A 3LV5A 2R82A 3PS7A 1QCWA 4G1NA 2EBNA 2PSNA 1SR0A 3MUY1 5FKYA 4A3HA 1R9ZA 3U3HA 1IXOA 2E40A 3T0DA 1ZL1A 4IG2B 1CLXA 1J9YA 1SR9A 3ZOAA 3WLOA 1E73M 3KVMA 4M0XA 2YL5A 3DKJA 3W84A 5CAKA 1Z9AA 1JULA 1VENA 1HO1A 3WEZA 1OEPA 3KW3A 3BAWA 3LLXA 3DKLA 4LRSA 1FWDC 3OHMB 1LWJA 2G96A 5CBIA 4J4KA 1YTKA 4JR5A 5GNXA 4Q4KA 1BLIA 4D6CA 4C1NA 4JX5A 1M6JA 4GXPA 1LBLA 3GG8A 4WQ6A 5HMSA 2JGQA 4B3ZA 3VZZA 3ZVIA 3AISA 1CZ1A 4CNOA 4D2JA 2YR1A 3K1DA 4GUIA 1JCJA 4Q8OA 3D46A 3NL2A 1I0BA 4WUIA 3CNYA 1S38A 3UY7A 2XIQA 2PWUA 4MHBA 3IAQA 1A3WA 2VVNA 3OGSA 3B9OA 3S9YA 4IIGA 3TNOA 4XTIA 4AXNA 3QC0A 3VIMA 3URNA 2A5HA 3GU2A 1K9TA 1UR4A 1GG1A 3T9PA 1Q6GA 3BQ6A 4GI4A 1Y65A 4DBDA 4BI5A 1ISVA 5LIXX 1RK5A 3M5ZA 4IIHA 1S5TA 3WZ0E 1BWLA 1FHVA 4US5D 1O5KA 4EF9A 3VMOA 3GNDA 1MZHA 3VGHA 3JU2A 4DJEC 3LK6A 3EX6A 2D73A 1LRTA 4XG1A 2GOUA 4EOUA 3PPGA 3TOPA 3BLIA 3MZNA 3FDGA 3M6DA 3N19B 1EF3A 3ABRA 2B7OA 2J79A 3K46A 4FLOA 5HULA 1WXZA 1AL7A 3KTCA 3SRFA 3WQPA 1WKYA 1KM0A 3C0JA 5CPTA 4G7EA 4PMNA 3WLIA 1TPUA 1TVNA 3LCGA 4GUJA 3TFXA 1XGDA 7REQA 1D9EA 1IV8A 1G4PA 2QJHA 3VE7A 4XSLA 3STPA 3WBEA 3U0HA 3F2DA 3T8LA 6ALDA 1YLVA 1RCQA 4GQBA 4O1DA 3TTOA 3BAKA 3C56A 4Q8MA 1GVIA 1E6XM 1XLCA 2YJQA 3GXFA 4S3KA 3OQEA 4PMVA 4K7YA 4A3YA 1RPKA 3BDKA 4Q7NA 4LVBA 1P7TA 1KFCA 4L1WA 3P3BA 1RCXB 4AYSA 4I6KA 5JXQA 2C3ZA 3ME3A 3WQ5A 4YJ5A 1AQ0A 4V33A 3ARVA 4ZXLA 1VBGA 3AYTA 4FA3A 1YNQA 4AWUA 2Z29A 1KV8A 3LQGA 1VJIA 3ZT5A 4WOQA 1HKMA 2C7FA 4LSBA 5MHBA 2OPJA 1R2SA 4Z0JA 4MKVA 1NELA 4Q8NA 3BSHA 4MAVA 4XZNX 2P10A 1W37A 2PEVA 3VPLA 3ZJ7A 1E9LA 1UKTA 2PDNA 3TN6A 1PJ9A 1JYNA 1NARA 1Z48A 3OLGA 3QMTA 2F9RA 3KUMA 3IVSA 3W7RA 2BASA 3CTLA 4ECLA 1JD7A 3MHGA 2OWCA 1CLKA 1J0IA 2C1GA 3IIPA 4LB3A 4YTSA 3CQHA 3TEVA 4IMCA 3S2CA 1RSCA 1RALA 3FLUA 2NWSA 2ZE0A 4PUKA 2J24A 4QG8A 4U5IA 1OX5A 7TIMA 3WEMA 1QOXA 3NA8A 2PMQA 1JCLA 2BOFX 2X2GA 4IFRA 4ZGYA 1B4EA 4QJ3B 2INEA 1TMHA 2PDFA 1KB3A 3GZ3A 3BLDA 2VCAA 2FMNA 2PDYA 1BRLB 5AC6A 4FIQA 3GR7A 4DLMA 1GKRA 3ZZ1A 2VUYA 4K38A 4O13A 4QAWA 1KNWA 3WQOA 1GCYA 2VO5A 2XVNA 1OB0A 4JX6A 1WXYA 4LVDA 3WBYA 1KGUA 4NSBA 2AL1A 1TREA 4MUPA 2Q8XA 3FGCB 3WDJA 4Z2KA 2ZZ1A 3MUZ1 4Y90A 5DANA 1ZGDA 4H7ZA 1F07A 3O0FA 2CHRA 2E5DA 3MCMA 1F4HA 4GMEA 3TIMA 1ZBKA 4GGBA 4A2RA 2ESCA 3ISIX 3QYSA 4GINA 3K8MA 2QDDA 4QLLA 4JTEA 4WDTA 4JPGA 1I0DA 3F5KA 4AMAA 1BVWA 3K1GA 1QATA 3L67A 2F6UA 4HU0A 1EF2A 4JTGA 3B0PA 1JG9A 3TYAA 1PL9A 4YTTA 3NJ3A 3EZ4A 3AICA 1FWSA 3B8IA 3A9BA 2J88A 4XKMA 3ALFA 4BQ3A 1XBZA 1QWKA 1XLMA 1EC7A 2DZAA 3WUBA 3QKZA 3LCWA 4CLMA 5G1YA 3ZSSA 3UPWA 3AXKA 1KKRA 2QCLA 1R2TA 3IRSA 3I7RA 5E5CA 3MSGA 2AAMA 4ZMGA 4PH6A 5HATA 4ZOEA 3AU2A 4F9JA 4UOQA 3QTPA 2ZUUA 1VIZA 3DG3A 5F2MA 3NQEA 4O4VA 3I6RA 1F5ZA 3LZ3A 3NURA 2CZEA 3GDMA 3KLKA 1OC6A 3XINA 3NO3A 2VQTA 4ZB5A