4DELA

Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. tuberculosis
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
publication title Active site loop dynamics of a class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 138
structure length 345
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4delA00
3M7WA 4IGHA 3BW4A 4Y9AA 1XM3A 3CIXA 2E1DA 3R2GA 4R33A 3M47A 2G97A 3DFNA 4X3ZA 2NWSA 3NZRA 2GQAA 3BG3A 3E12A 1FWSA 4BI7A 2NXIA 1F73A 4NQ1A 2Y7GA 3G1DA 1H7OA 1N8FA 1Q6LA 3UPWA 3CWNA 1ZJIA 3ZWTA 1Y0EA 1LOQA 4MUZA 3QRHA 3THQA 3CLMA 1VCVA 3W3OA 1A5AA 3GXTA 3KFTA 2CLHA 4NXSA 3S5NA 3UNDA 3L0NA 4OQVA 4O1AA 1LBLA 2ZRZA 1VLIA 1W3IA 1FXPA 2O7SA 4UTJA 1EUAA 3LBMA 2NV2A 3CTLA 1XBVA 3HF3A 4LVDA 3HPZA 2V82A 5DCBA 2XN2A 3WJXA 1GVOA 3STGA 3M0ZA 3OA3A 1TIMA 4M6PA 4E2DA 3DBPA 1H62A 3QF0A 4NJKA 3FJLA 3NZ1A 3HBLA 4LRTA 5F2MA 3C61A 1LRQA 3G0UA 2OZ0A 1WXJA 3HB9A 4UFLA 1W56A 2NLIA 4NVTA 2QDGA 4LNYA 3EX1A 1QO5A 1OFQA 1A5BA 3OHIA 1SU5A 3QW4B 3PBWA 1ME7A 4JS3A 4E38A 1P1XA 2Y89A 3GDMA 4WUIA 5F2GA 4N4PA 2FTPA 4CNPA 3KRUA 4BWLA 1DV7A 2A2IA 5E0KA 2QCGA 1KW1A 3OIXA 2D73A 2ZA2A 1GTEA 4TR9A 1K8YA 1RD5A 2ZZ7A 1KBJA 3I6RA 3SSJA 2E77A 3TE9A 4MFDA 3W7MA 3W88A 3ZWSA 1AL7A 3RLVA 2BXVA 2ZYFA 5G2HA 1QNVA 1W0MA 5DBTA 3Q37A 5FF3A 1GWJA 3BGJA 1O5KA 5BNKA 3QJAA 3FKRA 4AH7A 4AHPA 4FNSA 5AN7A 3TA6A 3GNDA 1ZFJA 4KWWA 4E0CA 3SI9A 4HPJA 5KINA 4DO5A 4IJBA 1LOLA 3G0SA 3G3MA 4R34A 4OU1A 4A2RA 1WAUA 3T7VA 2VFHA 3DU0A 4AAJA 5LKYA 3QW3A 4DF1A 2WNNA 2ZDRA 1JUEA 5TBOA 2C15A 1MZHA 2W0UA 3A24A 4LWWA 4B5NA 2J6XA 2RH9A 1PVNA 2VEIA 4MY1A 5F2LA 4I7VA 3MHUA 3KRSA 5CZSA 5KITA 2JKEA 2QCLA 5LNSA 2ZRVA 3O16A 4NT0A 4C1KA 2E09A 3NPWA 4Z1DA 4WQ6A 1FWWA 4X9SA 5T26A 3USBA 3FLUA 3GR8A 1IXPA 4XKYA 4LS2A 1H7WA 1TPB1 4O10A 2Q8LA 1L2UA 5EL1A 4XBKA 2I9EA 4IPIA 1M5WA 3QZEA 4I9AA 3IVSA 3MI6A 1GVFA 3SW6A 3B03A 3N2XA 4O57A 3ELFA 3GYEA 2NUWA 3DFPA 1BWKA 4O0KA 1MEWA 2EPHA 3TSDA 3FEMA 4KKXA 1HO1A 3EB2A 2QR6A 1GG0A 1SO6A 1FQ0A 1YPFA 5D05A 3R12A 4HNTA 1KM6A 2JKAA 5IM51 5HWJA 1OJXA 4MJZA 2PCQA 1UUOA 4LVAA 4DBEA 1KFBA 4HSNA 4NUWA 4O1CA 4GRSA 5HMSA 1EA0A 3KX6A 3DENA 1YXYA 1B4KA 2E6AA 3G8RA 3KVKA 2R94A 1VS1A 4DO4A 2HTMA 4K7YA 2YFOA 3GVGA 3MW7A 3C52A 1MEHA 1UASA 4JICA 4PC8A 1L6SA 3PSWA 3BLEA 4DO6A 1EP3A 3M43A 3W7EA 3BG5A 2ZQ0A 3O1NA 4XZ9A 4YMZA 3DH7A 2J24A 2V5LA 5DXXA 3N3MA 2PE4A 5C55A 3W1TA 1L9WA 4L4MA 3Q58A 4KFNA 3RK8A 2Y61A 5C5YA 1KV8A 4UUIA 3MI2A 5AHIA 4RK8A 1IIHA 1VHCA 2Z0IA 5BOOA 2BLEA 1ME9A 1OFRA 2H3DA 4DBDA 3W1MA 4RXGA 2H8XA 1GYLA 1ZCOA 2TPSA 1OX6A 3W6YA 4QAIA 3QPYA 3TC7A 3VNDA 1THFD 4Z0JA 1W5OA 2Y70A 4N9CA 1JCXA 2ZTJA 2WSYA 3SGZA 4DPQA 4GC4A 3E96A 3ATYA 3R5EA 4M7TA 3PSVA 1D9EA 5A8GA 3HOJA 2ABBA 1NEYA 3LCGA 3SECA 5C2XA 1GVRA 3NGJA 3I7RA 2CZ5A 3GAYA 5I3KA 3ANYA 4TIMA 1H5YA 4O18A 2CLKA 3NQMA 5FF7A 4HT3A 4IQLA 4O28A 4PL1A 5FEPA 3KHJA 3P7YA 2I14A 3UWWA 4IMEA 2GOUA 5CKSA 4Q4KA 3FKKA 1LM1A 1DL3A 1UBSA 1XDLA 3YPIA 2VFDA 1F05A 2YGYA 1K8ZA 1XDMA 1JCJA 3KOFA 3NQ7A 1LORA 1NF0A 1A53A 2VC6A 3NQCA 5D33A 4AVFA 4QJ1A 1ZY9A 1F6KA 1TQJA 3EWWA 2ZCGA 1SO4A 3MP3A 1SSDA 1X7FA 3QQ0A 2DZUA 3TQVA 3LCIA 4LUJA 3C2OA 4JX6A 1TREA 3DKJA 3NA8A 2JKPA 5D37A 1QPNA 1I2NA 2X2GA 4ZQNA 3O8AA 1ICQA 3PVFA 1NVMA 3A9IA 4LV4A 3LXAA 4ZQCA 4O1DA 4NXKA 1JULA 4RXFA 3WK2A 3N19B 3W2UA 2OT1A 3STCA 3W07A 4BFAA 1SW3A 1YLVA 2DU2A 4NJHA 3S42A 4CQ8A 2VXNA 4JY8A 5AYXA 4CCCA 5HR7A 5D03A 3TDFA 4U28A 4MIMA 3W7DA 4JTIA 3TW7A 4GFSA 1GG1A 3DXIA 3QYQA 1QMLA 1D3GA 1QFEA 2NX1A 1NAL1 5FESA 3DHDA 2YFNA 3L0KA 2A6LA 4GUFA 1WBHA 4NJJA 5KTLA 4WXZA 1J4EA 2WNQA 1YDNA 1QOPA 3DI1A 2C6QA 4AHQA 1R46A 3NNTA 5SWUA 5EKYA 1FWRA 4HN4A 3W2NA 3NQVA 4JNMA 2B7PA 3DGRA 1TPFA 5G1TA 1B9BA 3SIZA 4A29A 3HIJA 1JCLA 3W1PA 1TRDA 4Q33A 5K9CA 3W7CA 1GPWA 4DF2A 2QF7A 3W86A 3TMLA 2NX3A 2JBMA 1GVQA 2B7NA 3PY2A 4UTWC 3M5YA 2WJZA 1LDCA 1R2TA 3PG8A 3PR2A 4I7UA 1PHWA 4JX5A 3VI2A 5HWMA 1JCNA 2C18A 3W76A 5DCDA 4N02A 4JYDA 5AC6A 1T99A 3S1XA 5CZTA 5G1YA 1SZNA 2WSQA 3W7OA 4IX2A 3S1VA 1MSSA 3FJ6A 4E2BA 3DZ1A 5K9DA 4GXMA 2W79A 3P60A 3B04A 3TKFA 3E02A 2VELA 5DELA 5D04C 2HMCA 4JDYA 3LRKA 5D02A 3MUXA 4UMBA 1WQ5A 2PRLA 4MZ1A 4RZ4A 1YXCA 3FS2A 4RZ6A 2E6FA 3IIVA 4ZQOA 4JXCA 4UMAA 1QCWA 5DCEA 2IQTA 1TPC1 3W7HA 2C3ZA 4RKAA 1RQEA 3MYOA 3E49A 3L5LA 3NQ6A 2J9XA 1OF6A 3QPZA 2B7OA 4O53A 1YTEA 1FWTA 1ME8A 2V9DA 3IVTA 4IXXA 3UQNA 4LVGA 5F1UA 1Z41A 3QH2A 2ISWA 4I7WA 5AYYA 1YYAA 2CZFA 5D2YA 3L5MA 4PA8A 3CT7A 2YXGA 1BWLA 2J88A 3C4UA 1Z42A 3QM3A 5L6UA 3NPVA 3TX9A 3S8HA 5HULA 3PC0A 2KZHA 3IVUA 5FEXA 3CC1A 2VEKA 3MP4A 3HGSA 2ZFAA 4AWUA 4MPQA 4QSHA 4JTHA 3IV3A 1VZWA 1KTBA 1TSIA 2FJKA 5KMYA 3SFKA 1MEIA 1FY6A 2H90A 1PL9A 2B4GA 4Z1CA 1DQWA 2FPTA 4UFMA 2O7QA 3EEGA 1YTDA 3L68A 3GNNA 1GYNA 1OK6A 2ZZ5A 2E68A 3OVPA 2BZNA 3LHUA 3WK0A 1ZALA 3M44A 1OVDA 5MHBA 3WJWA 2OT0A 1SO3A 5LNVA 1TTQA 5KZEA 4OT7A 1NSJA 4JYEA 3M16A 2W6RA 3CEPA 1AW1A 3TQ0A 1KA9F 2Z6JA 5DLCA 4NZFA 3RMJA 1SSGA 1C8VA 3TSMA 4FO4A 4O52A 3HPSA 3N14A 1D3HA 1VRDA 3ZR4A 1SO5A 5LGXA 1OX4A 1A50A 4RZ5A 4AHOA 4EF8A 1J2WA 3TFXA 1WOAA 3TV8A 1PE1A 3EX4A 3OEXA 4GJ1A 2OMAA 4EWND 4ORIA 1XUZA 5AC8A 1A5SA 1AW5A 3BW3A 3BARA 1VJIA 1DJNA 4TU1A 1EUNA 3C3NA 2QCFA 1W3NA 3N2MA 5BMWA 1OHLA 1BKSA 3EWZA 4GNJA 4ZQMA 1Q3NA 2NUXA 4CQAA 3FIGA 3LI1A 1ZAIA 3BLIA 3BG9A 1OFAA 4QNWA 4M7SA 3NAVA 2FPYA 3VE9A 3G22A 3PUOA 3MBDA 1VH7A 3A5VA 3IGUA 3CU2A 4UTIA 4P61A 4EF9A 5C54A 4DXVA 1S5WA 3UY7A 1AL8A 1KM0A 3EWBX 3G1FA 1R47A 4NNCA 5CSSA 4ALDA 4UFHA 4J9JA 3L2IA 3RNDA 4LT9A 5EYWA 2QCEA 3PS7A 1H7PA 2A4AA 3N73A 4JTFA 4L4LA 4Q32A 4Y90A 4LUIA 5CZ0A 2J27A 5DY2A 3MHFA 3QMRA 1F76A 5LHFA 4LV9A 3NQFA 4K6AA 3WK3A 1XXXA 5AYZA 4X22A 3BVJA 1GVSA 3EWXA 1YPIA 4IXHA 3W1NA 2V2HA 4JTGA 4PTNA 1JUBA 2P0OA 2CZEA 1QDSA 4WY0A 3T44A 1YADA 3VE7A 1V5XA 4XBSA 1XBZA 1G4PA 3LGEA 1W8SA 3MBFA 4UNKA 4UTHA 4GUJA 1DOSA 1JJKA 3LCLA 4LVFA 2E6DA 4M6QA 1ONRA 3PUDA 4BWLC 3TXVA 1WBJA 3O07A 3VKJA 3DKLA 1C9DA 1TV8A 3TIMA 4ZL1A 1GTHA 1SPQA 3R89A 1F74A 1XL9A 2V81A 2C16A 3C8FA 4O54A 1A5CA 5AHNA 3EX6A 2UV8G 1VR6A 3M1ZA 4JYFA 4N9BA 3U8GA 2Y63A 3G0XA 4LC8A 2BWGA 3TW6A 2WO5A 3W23A 1L6YA 3N34A 3RF9A 4RX0A 4UFJA 2DZVA 4N2YA 3MI3A 2CLMA 2RDWA 1LBMA 3DFQA 4O12A 1OFEA 2QDHA 5FF4A 3PBUA 4O1BA 2X1TA 3L67A 4ICNA 1KM3A 2Q3RA 1FCUA 2XN1A 3FYPA 1TPUA 4FX6M 3GXPA 4N9EA 3IIPA 3P84A 5G4EA 2LLEA 1OFOA 4WY0F 4LTSA 3O05A 1H51A 4Z1BA 1EWDA 4H4IA 3W7RA 2EKCA 4JD4A 5D2VA 4IPJA 3DAQA 4A2SA 3A22A 2HS6A 4ZQPA 1G4TA 1OFPA 2BSLA 1F6PA 4FNQA 1JR1A 3U6WA 1U5JA 3GKAA 4OV9A 1H1ZA 2GQ8A 2HS8A 3IIXA 3TH6A 5AB3A 3UXDA 3EWUA 3PM6A 3IIOA 1VYRA 3TAKA 5TIMA 1XCFA 1ICPA 1KLYA 3D0CA 3VFLA 2FQIA 3UD6A 1R2SA 1GZGA 3S5ZA 4FXRA 3V75A 1XBYA 3C2VA 4IMCA 4JEQA 3UZJA 1CI1A 2P1FA 2Y6ZA 4HKPA 1UB3A 1KTNA 3QEZA 4D2JA 4ZZ9A 1DHPA 1O4UA 5F2IA 4IMDA 3W7IA 4LU0A 2CLIA 4UMCA 3G24A 1P5BA 2Z6IA 4MYXA 2WOQA 2RDUA 1I45A 3B05A 2PRMA 3BGGA 1W5PA 4PEKA 1I2RA 4JR5A 4EIVA 2Z2UA 4FB7A 3CB8A 1W37A 3UZ5A 5AHLA 3FOKA 2GQ9A 1EP2A 3PG9A 5H91A 1SZGA 1I2OA 2WV8A 3C0JA 1KFKA 1LLZA 1TJPA 3QQ1A 1I4NA 3S1WA 5LGZA 3PULA 3NO5A 3W1RA 2WSRA 4UTLA 1IXQA 5K7JA 2QJGA 4R7JA 2XN0A 5AFDA 3MYPA 4GUGA 2VEMA 3DFOA 2J9YA 1H60A 3BPWA 1LOSA 3INPA 4OWGA 3UWQA 5KSWA 3B8DA 4YCPA 4O11A 4BK9A 7TIMA 5AHEA 1ML1A 3MWAA 3AO0A 3BV4A 3BW2A 3ZS4A 1UUMA 1GEQA 4MLRA 4MZYA 2A0NA 5G4WA 3NPUA 4N4QA 3NQEA 3R8RA 1OFBA 1ZNNA 4MY9A 1S5VA 1ZHAA 1LZOA 3TUUA 1RZMA 4O15A 2VENA 1RPXA 1K03A 3LX9A 4JTLA 3LHYA 3QSTA 4POCA 3R13A 4KWVA 4CNNA 3EXTA 3W2JA 1O94A 4UIOA 4HNUA 1G69A 2X1UA 3B4UA 1DORA 5D32A 1H7XA 3HPXA 3W1XA 3W7GA 1AMKA 2A6NA 1RQBA 4UFKA 2NV1A 4UTUA 1GJPA 1YXDA 3E9AA 4NZJA 3W2MA 2CWNA 4WX2A 3TNOA 2RKXA 4TX9A 3W7JA 2PRHA 5I3HA 1KV5A 2F84A 4H6KA 3W73A 4PFMA 1OX5A 4H3DA 3L66A 3EXRA 3TJLA 1OYAA 3NVTA 1FXQA 5U4NA 2NZLA 1M7OA 3TMQA 1TTIA 3F1QA 3N9RA 3DHFA 4ORMA 2Y7DA 1QAPA 4S2BA 3W1QA 4AEOA 5LHEA 1IXOA 3W72A 4HPXA 1FWNA 3Q94A 5IBXA 1TTPA 3NOEA 2QCNA 1FCQA 1TQXA 1RV8A 2NXGA 5L9FA 4XTIA 5ABTA 2A7RA 3TQKA 5K4ZA 2JGYA 3JRKA 1TPDA 4LVBA 3LCWA 2YYUA 3SJ3A 3HQ1A 1LRNA 1KTCA 5LNRA 3W85A 4K37A 4IMFA 4AWSA 3CEUA 5HJLA 3I65A 1R30A 2E5BA 1OFDA 4XQ6A 3RU6A 1NFBA 2I1OA 1QWGA 1FX6A 2EF9A 2R14A 3UYCA 1LBFA 1QR7A 4HHPA 3T55A 2DJLA 3HJZA 4JDBA 3TC6A 2QJHA 4O4WA 2ISSA 4NNBA 5CPNA 3G1VA 3KAOA 3T78A 1RR2A 3G18A 3S0CA 1S5TA 2WQPA 1WA3A 3TAOA 4EOUA 1MO0A 4Y6GA 1DVJA 1SW7A 3NL6A 5U7SA 1B57A 1AW2A 1OG0A 2EAWA 2Y85A 3SGUA 3EXSA 3C56A 1FBAA 3LLDA 3W7NA 4LS1A 2E6YA 1WOBA 1Q6OA 4FNRA 1HFBA 4XKYB 2BX7A 5DBUA 2A5HA 3I7SA 2A21A 1G7VA 3LV5A 3W7KA 4XTDA 1IGSA 3MHGA 5CPLA 3TROA 2E5CA 4PODA 1B3OA 4XWUA 3S1UA 1SZEA 2VFEA 1JUKA 5BMXA 3LHZA 3Q2DA 3C2EA 2RFGA 4YCOA 3P5ZA 4NJGA 1XC4A 2YYTA 2YW4A 3PAJA 1W31A 4LY8A 4MVAA 4O4VA 1PV8A 3HG2A 3W83A 1TPVA 4JTTA 3NQ8A 3PB2A 1SFLA 3IIZA 1Z48A 5F4SA 2TSYA 3GAKA 3AJXA 2R8WA 3NM1A 2VKZG 4O17A 4ZMGA 2DZWA 1YDOA 4GWEA 8TIMA 4UNLA 2QUUA 1V7YA 5LZLA 3WJZA 4GUIA 3P5YA 5F4WA 3NG3A 4BF9A 1LROA 1F7BA 3G1AA 3H53A 2F7FA 2EHHA 2Y88A 2DZTA 1XFBA 3GDTA 5LNWA 1UCWA 2AGKA 1QPRA 3LM7A 3KVMA 1TPEA 4DPPA 1H50A 3RFAA 5LSMA 3LBCA 1I2QA 1GQNA 1KBIA 4FXSA 1K7EA 3EWYA 1PIIA 3FFSA 1S3HA 5AHFA 1LYXA 2J9ZA 2OJPA 3TCEA 1KFEA 1OK4A 1KM2A 3BLFA 1JCMP 1TV7A 3GDRA 4FX8A 3UWYA 4UTTA 3TSBA 1G6CA 2FLIA 1W54A 4M5PA 4ONVA 3P80A 1GOXA 3EKLA 3G1HA 1W5NA 2NXHA 3S6DA 3P81A 3MO7A 1TJRA 1VPXA 2QCHA 2WKJA 2ZRYA 3FYOA 4ML9A 3WK1A 2Q3OA 2QCDA 3L65A 2Y7FA 4DQWA 6TIMA 2GVJA 1H7RA 4K8HA 1CW2A 5CSRA 2PURA 1TO3A 1ZENA 3GB6A 1EWEA 4O14A 3LCFA 3LHTA 1FCVA 3GX9A 4LC6A 3M5VA 3HG3A 3LLFA 3P61A 2Q8ZA 2QJIA 3S5YA 3LXCA 4OV4A 3MJYA 3P8JA 2V30A 3T40A 3W7QA 3THAA 2X1RA 2H3BA 4FEZA 2Y7EA 5AOUA 1IXNA 5FF0A 1VQTA 2YX0A 4FNTA 2Y62A 3WJSA 5CZJA 5HUOA 3W1LA 4UTMA 3W1AA 5J5RA 3CQ0A 4UTTC 3HG5A 3P67A 4OHQA 2ZA1A 3NPXA 4G1KA 2DZSA 1ZAJA 4YLWA 1QPOA 1F2JA 1G7UA 4W9TA 1Q6QA 4OBTA 2QCMA 5CGQA 3LV6A 3KXQA 1J5TA 3GXNA 3LRMA 1CX9A 4N6EA 1Q6RA 4CCEA 1IIGA 4MZ8A 1L6WA 1F5ZA 2C19A 2VEPA 3DI0A 3PBVA 3KVJA 4MKNA 1EP1A 3O06A 1T96A 2NWRA 4P2VA 1G4EA 5DY3A 1TCDA 3V1PA 3W71A 4FHAA 4GUHA 1Z44A 3O6CA 1SW0A 4HNNA 2QUTA 2VFFA 1ADOA 2QAPA 4YL2A 3JS3A 3SY5A 2JK2A 3RLUA 5EY5A 4AMAA 1KM1A 3QC3A 4HIBA 3B0PA 5G5IA 1KM4A 3TJXA 5I3FA 3A5FA 2V2DA 2GVLA 2ZZ6A 1NF7A 4DELA 2QKFA 4UCGA 1EPXA 2X1SA 2C14A 2A7PA 3S9YA 4LW7A 3LCXA 5FEZA 3QMSA 4K39A 3KRZA 4MFEA 2X16A 2ZRXA 2ATSA 2B7QA 3LHVA 1KFJA 3OVRA 3W22A 4DEFA 2YCEA 2G5WA 3WJYA 4YXGA 3W2KA 4BI6A 5F4XA 1BTMA 4MLJA 1T0OA 5H2ZA 3NQAA 3HO8A 3ABQA 2YDAA 3LDVA 3BO9A 4WXYA 3ABOA 5KZDA 4CNOA 4JGDA 1KLZA 2NUYA 3NYZA 4TO8A 2GPTA 4BI5A 2ZZ2A 2YW3A 4UR8A 3LTSA 1SFJA 1H7NA 1MXSA 1HTIA 2BTMA 3UY8A 2YR1A 2QUVA 4JTEA 2YSWA 1K8XA 1XUUA 1K02A 1KM5A 1FDJA 1P4CA 3M5ZA 3LI0A 1VYSX 3LOTA 4EVZA 4JX4A 4GBUA 4RV8A 3OG3A 1WX0A 4MY8A 1SQ7A 3UPBA 3NQ2A 4NU7A 2FPVA 1RQHA 1JVNA 2GVGA 1BEUA 3A21A 1DJQA 1FDZA 1EIXA 4K7VA 1O60A 4RLIA 4PH6A 1DBTA 3P8IA 3IEBA 2CU0A 5DXYA 3W7LA 2QCCA 5EA9A 3NL5A 1TRIA 1WDWA 3PBYA 3PF3A 4X2RA 3SR7A 3O15A 2V2CA 4LOCA 1EX5A 4ADSA 1JCYA 3QSRA 4AXKA 3NDOA 5I3GA 4IWWA 1XI3A 1LTDA 2ZRUA 1UJPA 4O8RA 4DF0A 3CM4A 4N9DA 1GT8A 1T8XA 1ALDA 5D38A 4IUOA 4CLMA 3IRDA 1P0NA 3A23A 1RVGA 2DORA 1TPWA 4TMCA 1JRCA 2Z1BA 1SR9A 3SZ8A 2ZZ3A 3HGJA 2P10A 5J5DA 2RHGA 3STFA 4Z0SA 5G2WA 1SZFA 2V0TA 3NM3A 3CPRA 3FA5A 5HWNA 1I8JA 4N6FA 4O13A 1PHQA 1W5MA 3ZFHA 1H61A 3VCRA 1OYBA 4S2CA 1W3TA 2QCDB 1LRTA 4AWTA 3G1SA 2H8ZA 5HR6A 3QFEA 2HSAA 3F4NA 5HUPA 3W1UA 5TQLA 1IF2A 3E0IA 2TYSA 5I3JA 4AF0A 3JR2A 2VFIA 2B0MA 2WNZA 2ZZ1A 5HNRA 1I2PA 3B06A 3LXBA 3GDLA 5BRBA 1QO2A 1W5QA 4M19A 3G3DA 1VHNA 1OX4B 1N55A 4Y8FA 1OABA 4K8EA 4QITA 3IGSA 4K38A 4MOZA 1U83A 2CLEA 3B0VC 4HNVA 4MYAA 4O16A 2C0AA 3IGXA 3L0GA 1VYPX 1Q45A 5I3IA 1KFCA 4RJEA 3HMJG 4WOZA 2FIQA 4JN6A 1HUVA 3F03K 3C2FA 4JTKA 1JRBA 4CCDA 4O0ZA 4XUGA 4QNEA 1X8FA 5D2TA 2AQWA 3EKZA 4U4MA 5D2XA 4A21A 1JQXA 1X1OA 2TRSA 4Z08A 3UWUA 3MP5A 2ABAA 4FNUA 4NJIA 3GLCA 4K36A 3OVQA 4IX0A 2DZXA 2R91A 2FB2A 5HQEA 1OYCA 1DQXA 5E93A 2FDSA 4A22A 3WFAA 4BR1A 4A3UA 1HG3A 4HSOA 3TFCA 2XFWA 3EX2A 4WD0A 4Y96A 4LRSA 3ATZA 3GIYA 2GJNA 2OX1A 1M6JA 4IMGA 3LHWA 3UXAA 1FDYA 5EMUA 4FIQA 1LP6A 1XBXA 3NR0A 4MJMA 3W87A 1K7XA 1LLWA 3TXZA 3LB0A 5LNUA 1O95A 5AHMA 1VGAA 3NEVA 4ZQRA 4ADUA 2RDTA 2OCZA 2DZPA 5A5WA 4AB4A 3HGOA 5AC7A 1TTJA 1TV5A 2VOMA 2QEZA 4RR4A 2C1HA 1SUXA 3I68A 1PS9A 3H55A 3L9CA 5K9XA 3EX3A 3P62A 4S1FA 1WV2A 3C6CA 4UC5A 3LCHA 4CQ9A 3ABRA 3LTPA 2ALDA 1X1ZA 1X6UA 5EPDA 4O50A 5DN1A 3N9SA 4WY0B 3W84A 1O5XA 1P0KA 2G96A 4Z1AA 4QIUA 3G8EA 2QAFA 3TK7A 1YDVA 1VCFA 2DJXA 3K30A 3PUEA 1XKYA 3CWOX 3U2OA 3W2LA 1HL2A 3NQGA 3GKFA 1EB3A 6ALDA 5CPOA 4FX7A 2DP3A 4M6VA 4UTWA 3G1XA 1C29A 1EEPA 3DFTA 5IBXC 5K2ZA 1YTKA 3T4CA 1DKWA 1HO4A 5D2WA 1W1ZA 3TR2A 3LRLA 4QQ3A 5FEWA 1TB3A 4UXDA 3HGRA 4QM1A 1H63A 3GR7A 5CG7A 3O63A 3W74A 4KFPA 2V8ZA 1R2RA 3CIWA 1G67A 1H1YA 2CLFA 3S5OA 2YPIA 1TYGA 2C13A 4IOTA 3PWAA 3CHVA 3NL3A 3LERA 2NX9A 1TPH1 2FB3A 3I7QA 2V5BA 3GZ3A 2AAMA 4ZVJA 5FF2A 3B0UX 2CFFA 5D09A 1AK5A 4PL2A 4JTJA 5G2IA 1K3UA 3HG4A 2GUUA 2A1YA 1JQVA 5HINA 4JTSA 1QOQA 5C6MA 3UWVA 1M7PA 4OE7A 5EBUA 3M6YA 3W70A 4C1LA 1VLWA 3O6DA 2A85A 2VFGA 3L21A 2YZRA 1TMHA 3F4WA 3C2RA 4FIRA 2X30A 2WPBA 1VC4A 4TMBA 2ZTKA 1N7KA 3P82A 3W75A 4UR7A 4WOQA 3M41A 4JIPA 3NQDA 4RCXA 5KZMA 2PC4A 3G1YA 2GJLA 2TMDA 3DFSA 3NL2A 3TU9A 3LTYA 5CPMA 2CLLA 3BK0A 5GVJA 3W7PA 4JIQA 2ZRWA 2E5DA 4KFOA 4AF0B 4O19A 4NX0A 2CZDA 2G95A 1PCWA 4UTKA 3GDKA 2ZZ4A 1K7FA 3P74A 5BW6A 3L5AA 5K3VA 3ABSA 4JTUA 4FF7A 4ADTA 4QISA 3QMTA 4OGZA 3M5XA 5D30A 1OF8A 2H6RA 4LS0A 5FI8A 4YWIA 1AG1O 3UWZA 1ZAHA 2CLOA 4JY9A 2ZBTA 4R53A 1FUYA 3KVLA 4PCFA 2ISVA 1LCOA 1QPQA 1ICSA 4WZHA 3STEA 5F1VA 1G4SA 4GE8A 3NXFA 1WYIA 3H54A 2A7NA 1PCKA 1E51A 1VCGA 2FFCA 2ATMA 3MMTA 2JGQA 3OBKA 2ZA3A 5E1QA 3W9ZA 2EGZA 1B4EA 1FCBA 3M9YA 1KFLA 3GK0A 4UFIA 3O6YX 2CW6A 4WJEA 4NNAA 4NX5A 5K4XA 4FNPA 3PB0A
chains in the Genus database with same CATH superfamily
1AUSL 2HE5A 1UR4A 1ZLPA 3M7WA 3WQ4A 3NXLA 1MWOA 3M47A 5HANA 3U48A 2UWFA 2NWSA 3NZRA 1DIOA 3QVQA 2GQAA 3E12A 1FWSA 1O1ZA 2E3ZA 4PZVA 3SN4A 2Y7GA 3UPWA 3B40A 3CWNA 1Y0EA 4R27A 1LOQA 4MUZA 4E8DA 8XIAA 1R5YA 3W3OA 3VCCA 1IZCA 4IGMA 2CLHA 3UNDA 2QDDA 4OQVA 2GFTA 3A13A 3GTNA 1QI5A 4CD7A 4MUPA 2GVEA 2WVTA 5KETA 4B3KA 5C0QA 2QIIA 2GJRA 3HPZA 5DCBA 1JG9A 1MXDA 3M0ZA 1VBHA 4KS0A 2PSNA 5E0FA 1Z9AA 3H26A 3SJNA 3AROA 5ABHA 3NZ1A 1QNSA 1QW7A 2JIEA 1BRLA 2PBOA 3NTYA 2WC4A 3G0UA 1BXBA 4B92A 4ECLA 1UWRA 2PGFA 2OZ0A 3PZMA 3BJSA 3HB9A 1QVBA 4PCPA 3OW1A 1R38A 3VD5A 2QDGA 4X2PA 2JALA 5HOSA 1QO5A 2ZVIA 4EK7A 4NZ4A 2O4QA 3QW4B 3PBWA 4RPPA 3AYTA 1WDSA 3R7MA 1SFTA 2Y0FA 3OLDA 4N4PA 2ZIDA 2ZX5A 4UCFA 4OTKA 4CNPA 2CLPA 1W1TA 4BWLA 3TVAA 4JTRA 4GG9A 4MAVA 1US2A 3PZIA 1KW1A 2ZE3A 2ZZ7A 3GIQA 3SUWA 2C8NA 2D1ZA 5CBBA 3I6RA 3ITYA 1RCQA 2ESCA 1QHZA 3W28A 2G4FA 3TE9A 2BXVA 2IKGA 5G2HA 5DBTA 3RN6A 2D0GA 3DDMA 4CD5A 1E0XA 1WZKA 3L2LA 1ZTVA 3FKRA 2OZTA 4HBKA 3GNDA 1PWLA 4KWWA 1S5MA 3SADA 5KINA 1IYXA 2DSVA 4PUNA 3VKBA 4R34A 4OU1A 2GVYA 3ZT7A 1E9YB 4QDPA 3QW3A 4DF1A 1JI2A 2ZDRA 3T0AA 1JUEA 4QBXA 3AUOA 4C5ZA 2W0UA 4LWWA 1NH6A 2G37A 3ALFA 2J6XA 3U0HA 1HJSA 1X98A 1EEXA 1E9IA 3KRSA 5EGRA 5CZSA 5KITA 2QCLA 5LNSA 3EAUA 1O66A 1UZ1A 2DPEA 3ZJ7A 3NPWA 5CBIA 1FWWA 3FLUA 6TAAA 2ZOXA 4LS2A 5CC6A 3N4AA 2Q8LA 1L2UA 5EL1A 4H8HA 5CJNA 2PDCA 4IPIA 5J8LA 4AQLA 5M2FX 1TV2A 4IFKA 3WF0A 1XLLA 1GVFA 3ELFA 2J79A 2E7FA 1MEWA 1FP8A 3FEMA 1HO1A 3EB2A 3B8VA 4G2DA 1KXQA 1FQ0A 4W8AA 4L1WA 4TV5A 5HWJA 1AQHA 3EA1A 4KWSA 4NAFB 1OJXA 3ABXA 2QJJA 2PCQA 2A3LA 3GQYA 1KFBA 4O1CA 1JAEA 1HW6A 4CVWA 3VDGA 5HMSA 4HPHA 1ZBWA 4URIA 4DO4A 4HZ8A 3BLEA 2DZAA 1CIUA 3M43A 2ZQ0A 3O1NA 3DH7A 1GHRA 4CQCA 4E6MA 3M0XA 3PBMA 3RK8A 3GNPA 1C93A 4IICA 4UUIA 4RK8A 3AIVA 1XGDA 1JYXA 2Z0IA 3GXDA 1OFRA 4G8TA 1GOWA 2F6UA 3R94A 1GYLA 1OX6A 4PRRA 1ZSXA 1XRFA 1VP5A 2D23A 3EPOA 3I6EA 3ZSTA 4ROQA 2WSYA 3I10A 5CBJA 2AKMA 3FXYA 4M7TA 3KS5A 1R85A 3PSVA 1D9EA 1R3TA 3R6IA 3SECA 4PTWA 2VDGA 4GVIA 3I7RA 3D46A 3ANYA 2INFA 1JZ3A 4O18A 1BGGA 3IARA 2Y1HA 4HT3A 4IQLA 4YS1A 4PL1A 1AJ0A 5FEPA 2XFRA 1VEMA 3MSGA 5A6SA 3UWWA 3F2DA 1EJSC 4IMEA 2XVLA 5CKSA 4P8UA 4Z2IA 3TYZA 1LWIA 3YPIA 3E0LA 2VFDA 1K8ZA 1JCJA 3KOFA 1LORA 4LAUA 1A53A 4V33A 3NQCA 1I9CB 3G6LA 3T6CA 3V3WA 1F6KA 4FR1A 2CERA 1RCXB 1SMAA 2ZCGA 3L4UA 4GCXA 3TLLA 2DZUA 4LBUA 1TREA 2JKPA 1QPNA 1NVMA 3EMQA 3SBFA 1FWIC 1JULA 3QV8A 4HZMA 1LG2A 3IUHA 4PMNA 2QULA 5JIPA 4KW2A 3STCA 5BRPA 2VVNA 3VINA 2VXNA 5AYXA 1SFSA 4D6DA 3FNDA 3OZYA 4U28A 3VKAA 4GQRA 3WO8A 1V0MA 4GFSA 3DXIA 4F2TA 1D3GA 3JZUA 1NAL1 5FESA 1GQLA 1UPMB 2YFNA 4EANA 1WBHA 4WXZA 1RBAA 4QQUA 3TQPA 2ZX7A 3LZ5A 1RP9A 4OVXA 2C6QA 5SWUA 4I6KA 4PMJA 4HN4A 3IRSA 3FV9A 4OIFA 4MKVA 1DWJM 2PWHA 4FAMA 3B8UA 4JQ3A 1JCLA 3W1PA 1TRDA 4Q33A 3DEQA 1M03A 4DF2A 3TMLA 1OIMA 5FJRA 3CAVA 3ENLA 3K1DA 3PR2A 3PG8A 1R2TA 4WR3A 1JCNA 2C18A 1LL7A 1EZ2A 1T99A 2WQDA 1D8WA 1NQ6A 1QTWA 5G1YA 3NO3A 4MKSA 3NDYA 3ITXA 3ZVHB 3DZ1A 1GOMA 4GXMA 2W79A 1E0TA 3VIFA 3VDAA 3GY1A 3EMZA 2VELA 5D04C 1QPKA 2HMCA 3AXMA 3LRKA 4JDYA 5D02A 1ZRQA 3FS2A 4FOUA 2E6FA 1ELSA 4UMAA 1QCWA 4NRRA 4ZB0A 1TPC1 3W7HA 2C3ZA 1HKJA 4LGXA 4RKAA 1ZP3A 4IHCA 3RCNA 3FSUA 1DEDA 2J9XA 2B7OA 3CHFA 4O53A 1FWTA 1W3HA 3UQNA 3N2CA 3DG6A 2VUNA 3QH2A 4HA3A 2ISWA 3IGHX 1YYAA 1M01A 3ZM8A 2E9BA 2OEKA 1PTDA 5L6UA 1XYLA 3PC0A 2QDEA 5I78A 1V77A 2KZHA 3Q65A 1UWTA 2ZFAA 1TSIA 4XSMA 2FJKA 4GIRA 5KMYA 3SFKA 1NWRA 3VNKA 1PL9A 1DQWA 2O7QA 1UD6A 1EZWA 4AG0A 3L68A 4PBGA 2BDQA 1E3XA 3WK0A 4PB5A 4C6DA 2OT0A 5DT7A 1J10A 5I3DA 5LNVA 5KZEA 1ZP4A 1TFVA 2QZRA 3TQ0A 4PYSA 3FN9A 4ATWA 1J0IA 4DNHA 4NZFA 1G01A 1V02A 1U1HA 1C8VA 3LA4A 3VD3A 2GJXB 1MW2A 5G1MA 5LGXA 1OX4A 1XYMA 3SSZA 3XINA 5FJUA 1W9DM 3SN1A 1PE1A 3T0DA 3OEXA 2EXOA 4ORIA 5AC8A 7PTDA 1AW5A 3BW3A 4RNJA 3U2ZA 3B3DA 3BARA 5LIYX 4LY4A 4TU1A 3QY7A 3SCRA 2QCFA 1W3NA 4CKQA 3N2MA 5CSUA 1DYSA 3KWXA 3HQNA 1PKLA 3I4EA 1ZAIA 3BLIA 2YCLB 3AXIA 4M7SA 1U33A 4ZCWA 4XV0A 4Y9PA 3G22A 2VCAA 3H2EA 1YNPA 2PTWA 4EF9A 3EWBX 1R47A 1V3IA 1ISXA 1AQFA 1W9UA 4UFHA 4J9JA 2O55A 3E2RA 1JZ2A 2V68A 2AGTA 3L2IA 3CV6A 4WLCA 4C90A 2XDFA 2HBXA 4RW5A 2J27A 2E4TA 3UZZA 2TAAA 4QP0A 1M7XA 4GPNA 4B16A 4LV9A 1UW9A 5C9ZA 3AYRA 1SVDA 2Z2AA 5A8PA 4X22A 4IXHA 1BVWA 2V2HA 1S2CA 1MVYA 4FK9A 2CZEA 4IIDA 4J3VA 4AX6A 1XHGA 1YADA 3GE7A 4TTUA 3ARZA 5PTDA 3W01A 1R3RA 4GUJA 1EDTA 4D6GA 1JJKA 2E6DA 1KKRA 2IKIA 3TXVA 3ARXA 3O07A 2VEGA 1GTHA 1SPQA 3LSBA 2OEJA 2V81A 1XP3A 2C16A 2PS2A 3ZT5A 3GBDA 3GVQA 3KHDA 2EQDA 1VR6A 4N9BA 3G0XA 4ENLA 3DFYA 3W23A 1CGTA 3N34A 1V3JA 2R82A 3RF9A 2D2GA 3KEHA 2WMKA 2I7GA 2CHRA 3DFQA 4O12A 2GL5A 4UOJA 4KETA 3A4AA 2PA6A 3GHUA 3L67A 2Y8KA 3AHZA 3WCZA 3C3UA 3PJWA 2DIEA 3IIPA 5GNYA 3TYCA 3P84A 2Z1KA 1BFNA 5BZAA 4WSKA 1K6WA 1UMLA 3ZYZA 2F2HA 1IWPA 4Q8UA 1KC7A 3W7RA 2WMJA 2EKCA 5JH2A 1SJAA 2JF7A 3A22A 4IFRA 1OFPA 3U6WA 4OV9A 1XIEA 4PMUA 1H1ZA 2HS8A 3TH6A 5AB3A 4Q8OA 4L6HA 3V0UA 3CT2A 3D0CA 4NILA 1NDYA 3UD6A 3V75A 4IMCA 1CI1A 2P1FA 2QPXA 1JZ8A 1T8QA 1XLKA 3ORWA 4IPPA 4IMDA 5C2GA 4IH3A 4ZO6A 4LU0A 2CLIA 3UWEA 4AD3A 1X1NA 2XISA 5CJMA 3B9OA 2Z6IA 4J3WA 1V6YA 4HHHA 4L5ZA 2ZUVA 2RDUA 1I45A 2PRMA 3ISIX 4NKCA 3ZQ9A 3BGGA 2Z2UA 2WSPA 2OXNA 3VD9A 3FOKA 2GQ9A 3SUTA 3WH8A 1SZGA 1POKA 4Z17A 3C0JA 1RA0A 3OLEA 4US5A 1LLZA 1TJPA 1I4NA 3IK2A 1D7KA 4O8AA 2V3EA 3BLOA 1VPYA 4EAMA 2WM0A 3PULA 3CV2A 4Z2HA 5AFDA 4XBJA 3KBJA 1H60A 3BPWA 3TN4A 3ARWA 3B8DA 4FS9A 4O11A 7TIMA 2RAGA 3KDNA 3HN3A 2VYOA 1E3ZA 2G3JA 4JHOA 3XISA 3WYZA 3NPUA 3VA8A 3NQEA 4MY9A 1ZHAA 4GYPA 5TNVA 4O15A 1JAKA 2V6AA 2CNCA 1EJWC 1K03A 4DXXA 3QSTA 4NZ5A 4W8LA 4KWVA 4CNNA 1XYAA 5CEWA 3WLKX 2QV4A 3W2JA 4UIOA 4HNUA 1G69A 1DORA 1H7XA 2WNWA 3FAXA 4AC7C 1AMKA 1GGOA 5DT5A 2GDVA 1YXDA 4HK7A 4M51A 4WX2A 2RKXA 2PLKA 1GK8A 2F84A 1ZCCA 4PFMA 1W1A1 4HMCA 3U3HA 3VKKA 1XGEA 3N9RA 3DHFA 3WELA 2Y7DA 3WEMA 3EDFA 3UZYA 3VMNA 5LHEA 3OOQA 3KWSA 5CAKA 2G50A 3WDQA 1KR1A 3W37A 1WDPA 1DXEA 3NOEA 1NM9A 1FCQA 3WZ0E 1RV8A 3ABZA 3GIPA 5L9FA 4MB3A 4XTIA 5ABTA 2JGYA 5MKGB 1S1RA 4DJDC 3MKVA 4ZO7A 3ZLHA 3T09A 3UETA 4I8DA 4S23A 4AFYA 1OD0A 4W89A 3CEUA 1MFVA 3GFXA 3I65A 4QS6A 2PWVA 1OFDA 5C7HA 1P7TB 5AVNA 2VCCA 4PUUA 3FSTA 3UYCA 1LBFA 1QR7A 4HHPA 4HMEA 3T55A 3HJZA 3PZUA 2QJHA 2ISSA 3MKKA 3HZ3A 1MNZA 1KCXA 3G1VA 3F4DA 1XQLA 5BXTA 2WQPA 4EOUA 3WDIA 4Y6GA 3VGHA 2CKSA 4RZBA 3EXSA 4I5XA 4XD3A 1P43A 3VIPA 3W7NA 1A4MA 2D0FA 4W5UA 3QTGA 1G7VA 3LV5A 2OSYA 5CPLA 3ZT6A 3WQWA 2E5CA 4PODA 4H6EA 4AZBA 2VFEA 1JUKA 5BMXA 1DWIM 2FZMA 3N6JA 3UXLA 1XC4A 4WKFA 3WBWA 4RE4A 3BSMA 3TTEA 3KTSA 4MVAA 3BURA 1YKWA 3K2GA 3HG2A 3EGJA 2CESA 1UD4A 3PB2A 4BZYA 3IIZA 2CKRA 4BA0A 2TSYA 3GAKA 3FHAA 4JCLA 4ZEPA 5HNNA 4O17A 3L4VA 2EO7A 4GWEA 3HJEA 1VENA 2UZ9A 5LZLA 4FXFA 1QNQA 3BAYA 2HE8A 1U1JA 1NOWA 1MQPA 3WF1A 4CN1A 3OO2A 1V6VA 2WHJA 4GVFA 3R8GA 1TPEA 3RU8X 3T2OA 1H50A 1DJXA 4C5YA 4XD4A 3QR0A 3LBCA 1X38A 2QW5A 4FXSA 2G3MA 3EWYA 5A8QA 1PIIA 3FFSA 2J7HA 1KBKA 3ITGA 1OK4A 2I5QA 1K9FA 4UTTA 3TSBA 3M0JA 2YBUA 1W54A 4KWOA 2A3BA 4HSHA 3G1HA 3EKLA 3S6DA 4QS5A 4XZMX 3MO7A 2Q8XA 3KTCA 3FYOA 1E43A 2QCHA 2WKJA 2ZRYA 1UWSA 2PDBA 4R7OA 4N42A 4GISA 4DQWA 3U5YA 4PB3A 2EKGA 3V5FA 2PURA 4Y2WA 2VZOA 5M3WA 4GCAA 3LCFA 5EBAA 4B3ZA 2Q8ZA 6CGTA 4OV4A 3GTHA 3CZEA 3P8JA 4AX7A 3W7QA 2J8GA 4NL1A 2H3BA 4ZA0A 3NFUA 2RGMA 4QDMA 2HCVA 3VGFA 1IXNA 2YL8A 4IZGA 3RG6A 4DNMA 4AY1A 1NFPA 5HUOA 3W1LA 3CQ0A 2REQB 3HG5A 2DEPA 1OADA 2FZDA 4S3GA 2VGFA 2DZSA 4NYUA 4YLWA 1QPOA 4F0KA 1F2JA 3AIQA 2PDXA 4W9TA 3BH4A 3CHEA 1J5TA 3LRMA 2G4JA 2HBVA 1F5ZA 1NY1A 2C19A 2YB1A 3DI0A 5B7ZA 3JUGA 4US5D 3PBVA 2VR2A 2XU2A 3CTTA 1YW1A 3O6CA 2R1KA 4U5KA 2QUTA 2QAPA 3T0CA 3W25A 3SY5A 2JK2A 2IXVA 2FVMA 4EXQA 3GD6A 3QC3A 4HIBA 1UKTA 5XINA 1C8XA 4KERA 2YA0A 1Q6CA 1GUVA 5I3FA 1VBJA 1F3WA 2XFYA 3R11A 1EJ7L 4EPDC 4DELA 1X96A 4UCGA 4BY3A 2C14A 1OSEA 2QIWA 4LW7A 2D2JA 1BPLB 3KRZA 2X16A 3VMOA 1I0BA 2W9MA 5C9XA 3ITVA 3W29A 1OC7A 3BOXA 2E28A 2G5WA 4YXGA 2ZUWA 3IAPA 3PWGA 1FHLA 3KBMA 1BTMA 5F4XA 1AH3A 2WLYA 3BV7A 3BO9A 4TV6A 2QPUA 3ABOA 4ERGA 1Z32X 4WDWA 3NYZA 1T7LA 2BTMA 3UY8A 2FKPA 2YR1A 2QUVA 3POCA 1K8XA 1M41A 3TTQA 3WLMA 4HTBA 1DWHM 2GGIA 3QV6A 1KM5A 3UBPC 4F3HA 2OZ8A 3OG2A 1ZBKA 3LOTA 4DVOA 4EVZA 3AMLA 4ZR8A 5C2CA 1SQ7A 3UPBA 4GQGA 3TWAA 3CMFA 5A6KA 1J2BA 1VF8A 4J3TA 5AC5A 3ARYA 1EIXA 2VZTA 1DBTA 3P8IA 2CU0A 5DXYA 3W7LA 5BXSA 3L4XA 1TRIA 2E9MA 7CGTA 2DUXA 3PBYA 3WLQA 1Q13A 1TWSA 3PF3A 4DJFC 4EPKA 1E6NA 4G7FA 3WQ6A 3O15A 4LOCA 4J3ZA 2XM2A 5JH1A 4ADSA 3THUA 1JCYA 5I3GA 2V63A 1XI3A 3MT1A 4S3KA 4B4HA 1EJXC 2A3AA 3CM4A 4N9DA 1W1VA 1OGBA 2VD8A 1PPIA 3IRDA 1P0NA 1RVGA 1TPWA 1K6AA 2FJUB 1JRCA 4RL3A 4PMRA 1OGGA 1EGVA 4LUTA 3ZVHA 4GZ7A 2RHGA 4Z0SA 2V0TA 3NM3A 3N25A 4PULA 4N6FA 1NJJA 3DYMA 4F8XA 1W3TA 2QCDB 2Q09A 1LRTA 4AWTA 3DESA 3H24A 1Q6GA 5CGMA 3QFEA 2KAUC 2OOGA 3VPLA 3BUVA 3E0IA 5I3JA 2VFIA 2PLJA 1N82A 2WNZA 3VC6A 3FGCA 2ZZ1A 4RDZA 4H7VA 2Z28A 2GYIA 2JEPA 5BRBA 3G3DA 1DHKA 4X63A 5LIUX 3UG8A 4F40A 3UCQA 4ICMA 1Q85A 3SO7A 3SQMA 3BAIA 2X2YA 2OWWA 1UA3A 4JTDA 2QT3A 1A5OC 1H41A 1LL6A 4ERAA 4HNVA 5IFTA 4LUSB 4MYAA 4O16A 2C0AA 1FWAC 1VYPX 5I3IA 1XLMA 2ZXDA 1C7TA 4RJEA 4JN6A 4JNZA 1HUVA 3C2FA 4H9YA 3AZTA 2XVGA 4O0ZA 2RJHA 4A21A 5C9WA 4U4MA 5D2XA 1XYCA 3S9ZA 1H11A 1X1OA 1ZQ5A 4AW7A 4K36A 5CPSA 3WH6A 3GNOA 2G8ZA 2DIKA 1DQXA 3CMGA 5FL1A 5JIWA 4A22A 5CPQA 4A3UA 4ACYA 2XFWA 3MB9A 1FHDA 7TAAA 3Q67A 4GVGA 4Y96A 4ROPA 4HN8A 2GJNA 3WMLA 4DM1A 1M6JA 2R1PA 4DWSC 4QJ4B 4IMGA 1UA7A 3CQHA 1LP6A 5E9AA 4OUEA 1LLWA 3TXZA 1PDYA 1VGAA 3MQTA 1JL8A 3GC2A 4ADUA 2RDTA 5A5WA 5AC7A 2WSKA 1TV5A 2VOMA 1AD4A 2DQXA 4J3UA 4RR4A 2C1HA 4M3PA 1PS9A 3H55A 1W3LA 3EX3A 1V3LA 4XKMA 1MRAA 4GI6A 3LCHA 3F5LA 3LYEA 2ALDA 4WY0B 5T91A 3W84A 1PKMA 4C6OA 4QIUA 3CQKA 3K30A 3PUEA 1H0IA 2DY3A 1L8NA 3B9EA 2YXXA 2A3EA 2CXEA 3G1XA 1UR2A 1J0JA 2EG6A 5K2ZA 1XG3A 1JYWA 1EJRC 3II1A 1DKWA 4M29A 1FP9A 4L80A 4AIUA 3LRLA 3GUGA 2ZWYA 1TZZA 3RDKA 5FEWA 1TB3A 1EKOA 4PUJA 4UXDA 1H63A 2WKGA 5CG7A 3W74A 4ZB5A 1XPYA 1H1YA 4FP1A 4C6BA 2PDHA 1REQB 1TYGA 3T8QA 4IOTA 3AIUA 1EC8A 2NX9A 1TPH1 2FB3A 3DG7A 2X1IA 5D9NA 2WC7A 3GW3A 5LIWX 1PSCA 2PZ0A 4IGSA 5E5CA 3I7QA 1DJHA 3VDCA 3GZ3A 3CUZA 3EOUA 3PFRA 1AK5A 4QSFA 1DPMA 4PL2A 5G2IA 1NTHA 1QI0A 2A1YA 3VOHA 5A6AA 3WBYA 2PI6A 4Q4MA 3D3FA 1A5MC 1V6TA 2AL2A 1M7PA 4KQNA 3R58A 4LYQA 1TMHA 3F4WA 3KCOA 4FIRA 4RNHA 1VC4A 2OELA 3S2LA 2ZTKA 3P82A 1Q4NX 5KZMA 3PNZA 2PC4A 3NL2A 4H9XA 1DWGM 2ISFA 3QN3A 4JTAA 1SJBA 4HTYA 4KFOA 3S4TA 4YWSA 4NX0A 4GJIA 1LG1A 1TR1A 1XS2A 1PCWA 3VUSA 4UTKA 3GDKA 3KS6A 4H6QA 1Q4WA 3QQWA 5K3VA 3L5AA 1UWAA 4JTUA 3D47A 7ENLA 1F4HA 4P8VA 3QMTA 5D30A 1OF8A 5HNUA 5CC7A 1MUCA 1C8QA 1AG1O 1W2VA 2EPKX 3KVLA 2H9AB 1LCOA 4WZHA 3WQCA 3H54A 1PCKA 4XB3A 3MMTA 2FFCA 2JGQA 5E1QA 4JTCA 3M9YA 4UFIA 2CW6A 2HVNA 4H2HA 5BYWA 3PB0A 5JBDA 4KCTA 4E2VA 4PRTA 4GQBA 2VHLA 2V3DA 4C6FA 4EPBC 3BW4A 1VKFA 3B0YA 5XIMA 3VXGA 2E1DA 3WBEA 3GVRA 2E40A 3DFNA 1PWMA 4LYPA 3M0MA 4TQTA 4OKDA 3BG3A 2QJNA 1F73A 4FLQA 1Q6LA 2ZX8A 1ZJIA 4QCFA 3QRHA 3THQA 2XWEA 1VCVA 1LWJA 1QI3A 5HMEA 3L0NA 2A79A 3VNLA 4M81A 4HA4A 4UOQA 2PTXA 4O1AA 3RCYA 1VLIA 1CLKA 1W3IA 1FXPA 1EUAA 3LBMA 2NV2A 4F79A 1UH4A 3QY8A 4I5RA 4LVDA 1AJZA 3STGA 1E70M 3OA3A 1TIMA 4GABA 3DBPA 2VX4A 1LJYA 4PUKA 4H1ZA 1J6OA 3MWCA 2FHFA 3FJLA 5AZ1A 1E4LA 4C6KA 4DBUA 4DLFA 1VFOA 1LRQA 1YE4A 1DE5A 5E09A 3G6MA 2YL6A 3TYUA 4H7CA 1W56A 4NVTA 1EO7A 3N6HA 3QGVA 3RPDA 1VFSA 4ACZB 1A5BA 4ILSA 1Q8JA 1ME7A 4E38A 3VD7A 1RJPA 3IANA 1UH2A 1V8EA 4EE9A 4HVXA 2E1WA 3TA9A 1DV7A 2Z2BA 4XSLA 3WLSA 6XIAA 4L64A 1U22A 5A8NA 3CK5A 4U3AA 2XG9A 4HA0A 4OOZA 1SR0A 3ARVA 3SSJA 1XSIA 4MFDA 1VIZA 1AL7A 3WLTA 1Q2RA 1AJ2A 5E70A 2VTFA 1QNRA 3Q37A 1XH2A 4INFA 3BGJA 1O5KA 1S2WA 3WBAA 3GYCA 5BNKA 3QJAA 2GJPA 4LXFA 3TCSA 3SUUA 3OZPA 4A35A 3TA6A 4E0CA 1JDCA 3EB4A 3SI9A 2QGYA 4QLKA 1UD5A 3K4WA 1LOLA 3C0QA 3E0FA 3G3MA 1U30A 1US0A 3T7VA 3DU0A 4ZFMA 1E72M 2VURA 5LXEA 2PPGA 4RDWA 3UZWA 4NI3A 1MZHA 3A24A 3QXBA 1PVNA 4I7VA 2JKEA 3T0BA 3SCUA 5B7YA 4PGLA 2ZRVA 4PMZA 1PXGA 2OODA 3R25A 4NT0A 5EMLA 4C1KA 5E6YA 2HWGA 4IPLA 2D22A 5A1AA 4V27A 4Z1DA 4FALA 3AWOA 3AIWA 4X9SA 1PDZA 4Q4QA 3DUGA 2XGIA 1TV4A 2Z24A 2YIHA 3M0LA 1TPB1 1RUSA 6PTDA 1J01A 4P7OA 3VNIA 3QZEA 3LU2A 3MI6A 1T5AA 1XIIA 1JFHA 1GW9A 4K8GA 3WLOA 3DFPA 1BWKA 2EPHA 4LYRA 4B9YA 2QR6A 1HL8A 4DHGA 3A12A 2Y8VA 5I24A 5D05A 3KOXA 3AMGA 5FA5A 1KM6A 2JKAA 4HQVA 2VC7A 4PSPA 2IW0A 4Q8PA 4LVAA 1NOFA 4W5ZA 2GDQA 4HSNA 4NUWA 4RE3A 1ZPTA 3QV9A 3W6MA 3CYVA 2VO5A 3KX6A 4HU3A 1YXYA 1B4KA 3KBSA 2E6AA 4Q4SA 1VFFA 5HPOA 4QG6A 1SYTA 4K7YA 3C52A 5CSYA 9XIAA 3PSWA 4KCVA 4IIGA 4DO6A 5CCZA 1L6GA 1XPGA 3WD4A 4XZ9A 2J24A 2V5LA 5D9OA 3WUGA 4BQ3A 3N3MA 4AWEA 1KBLA 3SAZA 2PE4A 5C55A 3W82A 1AZ1A 3A9BA 2FZ9A 4PEEA 4S3AA 4L4MA 4L9ZA 4KFNA 2WMFA 5C5YA 1KV8A 1NDWA 1XIDA 1Z69A 1VHCA 1GVYA 3GU2A 3V36A 2ONEA 5BOOA 2BLEA 3I4KA 4DBDA 3B9AA 1JI1A 1ZCOA 2TPSA 4XAFA 4REQA 3QPYA 3VNDA 2DSZA 4KIRA 1Y7VA 1DXFA 4Z0JA 3WSUA 2Y70A 2PWGA 2BY3A 4W84A 1YNQA 4YVVA 3E96A 2XH2A 4JIHA 2IUZA 1Z3NA 3N11A 1W1B1 4WHBA 5H8PA 5A8GA 3HOJA 4WCJA 1R3SA 2P3ZA 3NGJA 4Q4OA 2IQDA 3M0IA 5I3KA 4DZHA 4TIMA 1H5YA 1KD0A 4MG4A 5FF7A 4O28A 4DJDA 3HM7A 4A3HA 4IT1A 3BGAA 3K8MA 2REQA 2GOKA 3SY1A 1PTAA 4GY0A 1E73M 3R0UA 1HN1A 2ISDA 2P88A 3MTWA 1F05A 1XDMA 5C70A 2OQHA 2BHYA 4MWAE 2VC6A 3CPGA 4C7FA 2P50A 5D33A 4AVFA 4HMDA 1ZY9A 2RUSA 2XIQA 1BSIA 1TQJA 3VDBA 4EP8C 5HJXA 1SSDA 1X7FA 2X41A 3LCIA 3NURA 5D37A 8XIMA 3KOYA 1E6QM 3TTOA 3PVFA 4ZQCA 2DT1A 3BOFA 2GQ3A 1S46A 4RXFA 1GNXA 3W2UA 4ERIA 3QBUA 3E2VA 2OT1A 4BFAA 4XO7A 5HNTA 2WHMA 3O9NA 1MUMA 4NJHA 4CCCA 1JEZA 5CLTA 3PPHA 2J13A 4QLJA 1QMLA 1KGUA 4U33A 2UY4A 2NX1A 1OD8A 4HCHA 2A6LA 3VYLA 4A05A 2WNQA 1YDNA 1Q7ZA 2NSOA 3DI1A 5IHRA 5EKYA 1LF1A 3NQVA 4JNMA 1IZKA 2CITA 4A29A 3L4TA 1VBGA 3LMYA 3TYAA 1UWQA 3CZKA 2QLYA 3W86A 5TF0A 3FEQA 3UG3A 2W91A 2JBMA 5I2UA 1GVQA 2B7NA 1FOBA 4UTWC 4FLSA 2WJZA 3UP8A 4JX5A 3VI2A 4WRHA 4KF1A 5DCDA 4JYDA 4WDUA 1OT1A 5AC6A 5BXPA 3S1XA 4IFKB 3CAQA 5CZTA 3DERA 2WSQA 3ECQA 4CQDA 4MF4A 4IX2A 4MADA 2Q01A 3QKEA 4LBSA 1EC7A 3P60A 3WNNA 1XF0A 2VOTA 1R7OA 3EKGA 1HGWA 4DM2A 4UMBA 1WQ5A 3QZAA 2PRLA 1V4YA 4RZ4A 1K4HA 1YXCA 4RZ6A 1E0VA 4H9VA 1KQYA 4DUVA 2EEXA 3WQVA 1RQEA 2IKJA 3MYOA 3AIEA 3NQ6A 4NHVA 1YTEA 2V9DA 4IXXA 1TX0A 1Z41A 4I7WA 5D2YA 3APGA 3F4VA 4E3TA 3BANA 4PA8A 1Z8AA 3CT7A 4S3FA 3LNMA 1BWLA 2J88A 3S8HA 5HULA 4GYJA 4WGXA 5FL0A 4PRWA 3BAXA 3ITCA 3OODA 3HGSA 1L2QA 3VIOA 3EA2A 4F2BA 1MEIA 3TW9A 3BMXA 2PDWA 4Z2GA 1HKIA 2H90A 3GU9A 2B4GA 4Z1CA 2O9RA 4GYFA 3WUFA 4CD6A 4H7ZA 1YTDA 3PZQA 1JCTA 3GNNA 1JGIA 2FHBA 2F61A 4H9ZA 1GONA 2BZNA 3LHUA 1ZALA 1OVDA 5MHBA 3PHAA 3WJWA 3MC5A 3LBOA 1KRAC 4PTVA 1SO3A 3QZ6A 1TTQA 1XIBA 4OT7A 3VZXA 5HK4A 1ZJBA 2Q6ZA 4MNMA 2W6RA 3CEPA 4C1NA 1AW1A 1KA9F 2AAAA 3SCWA 3T2PA 2IS7A 5DLCA 4FO4A 1VRDA 4RE0A 3ZLFA 1SO5A 4RZ5A 2BOFX 3QHNA 4AHOA 3GTXA 1CB2A 1HJQA 1J2WA 5BWAA 4FR6A 4ZB2A 3TV8A 3EX4A 4AY7A 3O6AA 4GJ1A 2ZICA 4ATDA 2FMNA 1BGAA 1A5SA 5CC5A 3ANUA 5BMWA 5AVHA 1BKSA 3PZOA 4GI4A 3H4XA 5FJTA 1WZAA 3L4ZA 3BAJA 2MNRA 4I3GA 1Q63A 1AH4A 4QNWA 5HBFA 2EPLX 3NAVA 3SRFA 3S2NA 1I1WA 3KBNA 3CWHA 1TUFA 1W1YA 1JF5A 1ZB5A 2CHOA 3A4WA 3P14A 1TMQA 3VK5A 4J2MA 2YOCA 1CDGA 3VX1A 3FHQA 4P61A 3WIJA 4PB4A 5C54A 1AH0A 1RBOB 1Y65A 4ALDA 2RJGA 5AKQA 2BHZA 2Z26A 1CXEA 2QCEA 3PS7A 1BWVA 2A4AA 3OPSA 1PEZA 1I0DA 3QHOA 3CL8A 4ZTYA 2W4XA 1QRQA 5CZ0A 5DY2A 1UR0A 1K77A 1OCBA 5LHFA 4K1GA 3NQFA 3WK3A 2AL1A 2J66A 4DJDD 3EWXA 3E5PA 5DMNA 2P76A 3H2MA 4GGHA 4D6CA 2P0OA 3B0XA 4YPJA 4WY0A 3T44A 1VFUA 3EZ4A 1G4PA 3LGEA 5IDZA 1DOSA 2WMIB 3LCLA 5IFPA 1YBQA 4LVFA 3B97A 2GLKA 4M6QA 3RX3A 1ONRA 3VKJA 3TIMA 3R43A 4UZUA 6REQA 1BXCA 4XD5A 4R9OA 2E9LA 3C8FA 4O54A 5FJJA 1A5CA 3H7VA 3M0KA 4ASTA 1BYDA 2B81A 5AHNA 3MSRA 4D6JA 2UV8G 4JYFA 1V0NA 1XLGA 2BWGA 4NIRA 5AZ0A 4RX0A 3O0KA 4XIAA 3RMEA 3MI3A 1M9HA 3RYSA 1HL9A 3SCSA 1POJA 1OFEA 3GS6A 1KM3A 2ZWZA 2PF8A 4FX6M 2C71A 3GXPA 1KFWA 2DZBA 1NWSA 5G4EA 1QT1A 4P7LA 4LTSA 3O05A 4IP7A 4JD4A 5D2VA 3D5HA 4IPJA 3GHSA 3IJQA 4A2SA 1IR1A 2HS6A 4ZQPA 3RITA 4FNQA 1JR1A 2VRQA 4GO8A 3CZLA 1TV3A 1XKJA 1B5TA 5BOEA 3ALGA 3AUJA 1VYRA 3IIOA 4LAKA 4CNTA 5TIMA 1KLYA 4L4PA 1KKOA 1F3TA 2X09A 4NY2A 1R2SA 1GZGA 3S5ZA 1RHCA 1F8MA 3UZJA 1UB3A 1CB7B 4B15A 4J3SA 2R1NA 1O4UA 3BSGA 3W6LA 2ZDSA 4PSRA 4NZCA 4XZLX 3AHTA 1W5PA 1WDDA 4JR5A 4DBSA 4FB7A 1XISA 3CB8A 1GJUA 3UZ5A 4C60A 3C2YA 3PJTA 1I2OA 2EG7A 3B8IA 2OTDA 2O9PA 3GVVA 4PMDA 3MA8A 4E2OA 3N6QA 4RUBA 5LGZA 5EMMA 3NO5A 4JKMA 2QJGA 2BXZA 2XN0A 4LFYA 4H83A 1X6NA 4R5EA 2VEMA 4GH3A 2P53A 3INPA 4OWGA 3TWBA 5KSWA 3N2OA 3K8KA 1R3WA 4OZOA 3MWAA 4DWSA 4KT2A 3ZS4A 1ITXA 1UUMA 1GEQA 4MLRA 1X7IA 4HK6A 4N4QA 2YCIX 5CH9A 4XZNX 2HNHA 2ZUUA 3P2VA 3TUUA 1RPXA 3MUAA 2XTKA 1EBHA 3LHYA 1V3HA 4A3QA 4ZBCA 3QYSA 3E2QA 5D32A 3HPXA 3W7GA 1C8YA 4UB9A 1JD7A 4AZCA 2A6NA 3IWPA 2Z7KA 4DAFA 1GJPA 3E9AA 1QHPA 2PDGA 3W7JA 2PRHA 5I3HA 5HDRA 3UZXA 3OP2A 3EXRA 3TJLA 1GKQA 2BODX 1FXQA 5U4NA 2PWFA 1M7OA 5AY7A 4AD1A 2IPWA 1QAPA 1K70A 4FXJA 1IXOA 2OQLA 4HPXA 3BWWA 1V7AA 1UJQA 3GZAA 3GXFA 3WLIA 2PC8A 1TQXA 3ARSA 2NXGA 4PBEA 2DW6A 3T8LA 2A7RA 3TQKA 5K4ZA 1PTGA 4NRSA 5BCAA 5J04A 3LPPA 2YYUA 3SJ3A 1S38A 1FH8A 1V51A 3HQ1A 5HPCA 1LRNA 1KTCA 3AXXA 1ZL1A 4K37A 3T81A 1J79A 4L61A 4IMFA 2ANUA 4DYKA 3GC5A 4XAGA 5REQA 3RU6A 4XQ6A 3KE0A 4JZ5A 1O6IA 2I1OA 4MPKA 2VDIA 4US6A 4AEFA 3TC6A 5JQ9A 5I6SA 1TWZA 1IT8A 1BLIA 3RR1A 3CUJA 1CBGA 2BNJA 3G18A 2XSBA 4GZEA 3OIHA 1MO0A 3PPFA 1DVJA 2NQHA 3NL6A 5KEZA 1OG0A 1AW2A 1FBAA 4UNIA 3B9DA 5T9BG 3VIMA 2XIBA 4LS1A 1J5SA 4FNRA 1K9EA 3UR5A 1HFBA 4XKYB 3IAQA 1O1HA 5DBUA 3I7SA 4TXEA 1W2PA 3UCCA 2YXOA 3MHGA 1J9YA 3RRXA 4UQ9A 3QR1A 4CCZA 4LH8A 1B3OA 5BXRA 2INEA 1A49A 1E0UA 1JZ5A 1TJ2A 2RFGA 4NJGA 3QLDA 3PAJA 3VX0A 1W31A 1VFHA 1F3EA 4PR4A 1TPVA 2NLYA 1E4MM 3FDGA 4DLMA 3NQ8A 4ZFCA 2WHLA 1Z48A 3PWIA 5F4SA 5JU6A 3AJXA 4WSJA 4ZMGA 2DZWA 1X39A 1DJIA 1YDOA 1TZ9A 1RH9A 3GXMA 3GFYA 8TIMA 1PX4A 2VQTA 1TJ0A 5F4WA 4DJFD 3BLPX 1LROA 3M07A 1J0KA 2WXDM 2F7FA 4CN4A 4P7NA 2EHHA 3B4YA 2DW7A 5LNWA 2HV5A 1UCWA 3OVGA 3WG6A 3KVMA 3W4RA 1PKNA 4H41A 3D6NA 3RFAA 3CO8A 5LSMA 1Q65A 3TN3A 3ANVA 1KBIA 4LEFA 1WUFA 3LG3A 4DJEA 5AHFA 5CAHA 1LYXA 1KFEA 1PB0A 2PP1A 4AYGA 1KM2A 3BLFA 1JCMP 1TV7A 2FDMA 3P6LA 1KCZA 1SZRA 4M5PA 4ONVA 5DRIA 1GOXA 1XLIA 3EPNA 4I8YA 3B8TA 3AS0A 1W5NA 3H22A 4P7QA 2WJEA 3WK1A 1TMLA 2Q3OA 4M6UA 3A3HA 5D8WA 2Z7GA 2GVJA 4GKLA 3RAOA 1TO3A 4HOWA 3GB6A 1VFLA 1EHAA 3ZR6A 3ARPA 3LHTA 2R1LA 3M5VA 3HG3A 3LLFA 4I9JA 2QJIA 3S5YA 2J7GA 3LXCA 3BXWA 2DGAA 3EYPA 1CTNA 3IJ7A 4G7EA 1ZZMA 1XYBA 4DRSA 1WKDA 1P0BA 4UTTC 3NPXA 1FKWA 3KL5A 5HAOA 3PZGA 3UW6A 1NWTA 1CLVA 3V16A 3E0VA 3HV8A 5CGQA 2DH2A 1RCOB 2PBGA 5EMJA 2HDJA 3GVWA 4RPQA 4J4KA 4K68A 4N6EA 1L6WA 4AZ7A 4KEMA 2WYSA 3ZSSA 1IEQA 3AU2A 3BZJA 3KVJA 1XIGA 3O06A 4KIEA 1TCDA 4WF7A 3O3RA 1GKPA 4HNNA 2VX7A 1ZBCA 1ADOA 1EL3A 2D2HA 5IRPA 3L7RA 3RLUA 3BQ5A 2OEMA 1KM1A 3LS9A 4L6DA 5G5IA 1KM4A 1XCWA 4GY1A 4WEVX 4DWSD 1G1YA 3DBNA 5EFDA 2WBGA 3AS3A 4ZE5A 2GVLA 4CEXC 2ZZ6A 3RUBL 2X1SA 2A7PA 3OU8A 2PWDA 2G41A 4Q4PA 2X0YA 4B9ZA 3QMSA 2DIJA 5A6TC 3RX2A 4MFEA 3LQGA 1JPMA 2I16A 2YCEA 1UZDA 9RUBA 3WJYA 2PAJA 3TYBA 1IWBA 2FH8A 2VEFA 3LEPA 1T0OA 4MNLA 3LDVA 4A3RA 4X61A 3K1GA 5HMDA 1BYAA 4GKTA 4UR8A 1ONWA 1SFJA 1XYZA 1HTIA 4F0LA 1TE1A 3NDZA 3RPTA 2YSWA 1XUUA 1K02A 1UYQA 1P4CA 3M5ZA 2WWCA 1VYSX 2WPGA 3OG3A 2WJDA 3CUXA 2FPVA 2GVGA 4W87A 2BASA 3T0TA 4LQ1A 1DJQA 1FDZA 3AQUA 1O60A 4RLIA 1J6PA 4PH6A 3OYZA 2QCCA 1BYBA 4MB4A 4HHLA 4S39A 1WDWA 4JN7A 4X2RA 4V1XA 4F0MA 1JFXA 2V2CA 2EG8A 3CO4A 3VCNA 1EX5A 2G3NA 4GIAA 4GACA 4R85A 1OBAA 3AALA 3KUMA 3QSRA 4TOQA 3UJEA 4KRUA 2ZRUA 4C7GA 1AODA 3S6OA 1UKOA 1T8XA 5D38A 4IUOA 3F4CA 2WAGA 3WH9A 1BAGA 1ZU8A 3HGJA 2P10A 3FXGA 1EGMA 1W32A 1SZFA 2OR2A 3CPRA 1WZLA 4O13A 1PHQA 3ZFHA 3VNJA 3W81A 3RM8A 3S5SA 2WKLA 3G1SA 2DVTA 2H8ZA 1AZ2A 3FW6A 3F4NA 3SB0A 4QJ3B 3A4JA 1Q5MA 3KRBA 4MDPA 2QMJA 1AA1B 1AFSA 3PZVA 1E6ZA 5HNRA 4LYKA 3B06A 3UR7A 1GVIA 1V3MA 2QYGA 1QO2A 4M19A 1VHNA 1N55A 1F4AA 1S2TA 3PTDA 2I57A 2HISA 2XUCA 3UCDA 2DT2A 2HPMA 3T05A 4GD0A 3MKCA 3B0VC 4DB7A 1NELA 3TP4A 4QROA 2Y2WA 3IGXA 3L0GA 2VGIA 3V5CA 1XWYA 1NOUA 2FIQA 5CGTA 4EACA 4JTKA 4CCDA 4D1IA 1CGUA 5DF0A 3AIRA 1JQXA 2TRSA 4Z08A 4F48A 3CAKA 4XX6A 3UWUA 1HIZA 4FNUA 1WAWA 3K46A 1CLXA 5DO8A 5HQEA 1OYCA 4BR1A 1HG3A 2DSWA 4LPCA 1B1YA 3GNRA 3TFCA 2QJMA 4IFOA 1FHVA 2F6XA 4IG2A 2VI0A 5EMUA 1XBXA 1VAHA 3W87A 1K7XA 4WSHA 5AHMA 1JYVA 2BG5A 2J8FA 4ZQRA 3EBVA 4AB4A 3HGOA 3SCOA 4P5UA 1L8PA 5ABFB 3POHA 1SUXA 1S39A 3VGGA 5K9XA 4S1FA 3C6CA 1A4LA 4P7RA 4CQ9A 3EEZA 3LTPA 2PDYA 4D6IA 1X6UA 1LLOA 5EPDA 2E67A 3V5OA 9XIMA 3W38A 1SM9A 2IXUA 1P0KA 4NZ3A 1I6NA 2ASHA 2D3LA 3AC0A 2VP8A 2YKKA 2DJXA 3VKCA 3CWOX 4L9XA 2AQVA 3U2OA 4YVXA 4AD4A 3NQGA 6ALDA 2A3CA 4FX7A 5CPOA 2DP3A 5B80A 5A6BA 4UTWA 3QC0A 1DTUA 1XIJA 5CJ5A 1R8LA 1CEOA 3C5QA 4MWAC 3HPFA 3WLLA 1HO4A 1A0EA 2CBUA 1UUQA 1NDZA 3L23A 1Z89A 2WLZA 1E55A 3HGRA 3H7UA 3WD0A 3GR7A 3GXIA 3O63A 4KFPA 1R2RA 3CIWA 4W4QA 4M8UA 4XIMA 3ZO9A 4G9PA 5A95A 3L2MA 2MANA 1LT7A 2C13A 3PWAA 4C6JA 1WDRA 3NL3A 4XG1A 3GRIA 4H8VA 2QS8A 2BVDA 1KGWA 2V5BA 1EPVA 3VOFA 1WE5A 5FF2A 3VOCA 4MM1A 2WMIA 2VC5A 2EPNA 4JTJA 1K3UA 3HG4A 2FVKA 4FOKA 4V1YA 5HINA 1JDAA 5C6MA 4LUTB 3M6YA 3U7BA 3W70A 4C1LA 1VLWA 2A85A 4AD5A 3MY9A 1HGYA 1GQJA 4TMBA 1N7KA 1HJUA 1XLEA 2DQWA 3DFSA 1FWDC 2HK0A 1DJZA 2CLLA 2IMRA 3BK0A 4JIQA 2ZRWA 4O19A 1KCLA 3FGCB 3WDPP 4LAMA 1T41A 1KO0A 4A4AA 5BW6A 3VC5A 3ABSA 4XAZA 1XX1A 5FACA 4ADTA 2H6RA 4V28A 1ZAHA 4GO9A 4JY9A 5M17A 1FUYA 1RY0A 5F1VA 1G4SA 1XV8A 1WYIA 1E51A 1VCGA 2W61A 2ATMA 1B4EA 1FCBA 2OSXA 3KM8A 3O6YX 4WJEA 2PP3A 4NNAA 2CHNA 2PLMA 1PZ3A 4FNPA 5K4XA 4ES4A 2GGJA 1XM3A 3ARRA 2I5GA 3JU2A 4AZHA 4R33A 1UP0A 2G97A 2F2KA 4UTFA 4D8ZA 4MNKA 3ZIZA 2NXIA 3OBAA 2XWDA 3G1DA 1H7OA 1S3TC 1N8FA 4XAPA 1L6FA 1AVAA 3ZWTA 1Q6DA 5KZ6A 3CLMA 4JL2A 2GK1A 3IV8A 1A5AA 2WMHA 1E6RA 3GG0A 3KFTA 3S5NA 1E5NA 2F6KA 5FIPA 4U31A 4JAWA 4D6FA 1NDVA 3V0TA 2J8TA 1LBLA 2OOFA 2ZRZA 5E0CA 4DWDA 1CT5A 1XBVA 3HF3A 4MWAB 2GUYA 3WQPA 3WJXA 4MJ2A 4MB5A 7A3HA 2SFPA 4BKNA 1YRRA 4E2DA 1H62A 1MQRA 3FJNA 3WNPA 3HBLA 4LRTA 1W3JA 2VZVA 5ECVA 3N3TA 1D3CA 5F2MA 3IS4A 4C91A 4S3EA 1UD3A 4R88A 5BU9A 3AIBA 3KW3A 1WXJA 2PD5A 4UFLA 2NLIA 4HOZA 1UBPC 4HYWA 5HQMA 3EX1A 2C79A 1OFQA 3OHIA 5I23A 1XYFA 1E6XM 4JS3A 1P1XA 2OYKA 1DWAM 4CU6A 4HU8A 3EDKA 5F2GA 1TKKA 5FD0A 2FTPA 4GI8A 2X8RA 1XLDA 4MJ4A 5C8BB 3WBXA 1H1NA 3K4AA 4JQAA 4B5XA 2HXUA 4Y9OA 1S5NA 3OIXA 1GTEA 1K8YA 1XLJA 3WH7A 1KBJA 2OVLA 3W7MA 4GXWA 3ZWSA 3TOPA 2ZYFA 3UXIA 3SY8A 1W0MA 4B5WA 3ME3A 2OO0A 2EPMX 3VIKA 1GWJA 5H1WA 1TVPA 1WNOA 3B9NA 2PTZA 2NV9A 1IGWA 1TA3A 4W7UA 1JF6A 1QHOA 1TVNA 5AN7A 3LPGA 2F9RA 1ZFJA 1Q7MA 3V0SA 4IJBA 1TWIA 2D3NA 3G0SA 3LY0A 4QXIA 3UPMA 3TTYA 3TJ4A 4O1EA 1XH1A 1XRVA 2VFHA 4AYSA 4AAJA 5LKYA 3V35A 3L4WA 5TBOA 3MSDA 1JZ6A 4QAWA 4XZHA 2AL2B 3T4WA 2FZ8A 2RH9A 3M46A 2NVCA 2VEIA 5F2LA 2NQJA 3IUIA 3MHUA 3ZMRA 1R86A 4GJJA 3CPUA 3RILA 4Q8VA 1IXPA 4XKYA 1OC6A 4YN5A 3RO6A 4O10A 4HU4A 4XBKA 3PUGA 3VKDA 1IHIA 1M5WA 2QNEA 4I9AA 3SW6A 1PBGA 3N2XA 4O57A 3TNBA 1Q2SA 2QUMA 4Q4RA 3WLNA 4O0KA 1E0WA 4KKXA 4X9YA 1GG0A 1SO6A 1GQIA 3PBGA 3QHMA 3R12A 5LXXA 4HGXA 2VQUA 4MJZA 1JYNA 4N7QA 3N2TA 2OQYA 4DBEA 1E40A 4GRSA 4ZXLA 1V08A 2HRWA 1GZ1A 1OINA 4IP4A 1NP2A 3KVKA 1MEHA 4PC8A 1TG7A 4JICA 1L6SA 4HMNA 4PMXA 3ES7A 2GDUA 1EP3A 3W7EA 5JXQA 4BEUA 4I9MA 1EO5A 3W1TA 4Q7IA 4DBWA 4ZSUA 4UZSA 3MI2A 1IIHA 3F5JA 4MGGA 2F38A 2QGHA 1J0YA 2HVMA 4F9JA 3ES8A 2INZA 3RGTA 1ME9A 4HB7A 5H8UA 1UIPA 3W1MA 4PFHA 2X7VA 3W6YA 1CCWB 4X0NA 3TC7A 1THFD 3OGVA 5A2BA 4V2XA 4D9PA 4JHMA 3OLIA 1JCXA 2ZTJA 4GZIA 3SGZA 3LN3A 4MNJA 3IK4A 3ATYA 3UT0A 1XFCA 3WQ5A 2BOEX 3WQFA 4H9TA 3R5EA 2W62A 1GYMA 4KPLA 1BQGA 2ABBA 2OYMA 3LCGA 4HA1A 2BBFA 2QF8A 3E74A 3GG1A 1XIMA 4BJHA 4JFWA 1Q6EA 4YTSA 3WDHA 3KHJA 3P7YA 3REQB 3MANA 4FPSA 2FGLA 1VB9A 4Q4KA 3FKKA 1LM1A 1DL3A 4S38A 5H6HA 4LAOA 3PFMA 3VFCA 3ID7A 3CZJA 1QW8A 3R8HA 1A5UA 3U7VA 4WDXA 3STPA 4DX3A 2I56A 5ABGA 1W3KA 3EMCA 4IF2A 7REQB 3EWWA 4CEUC 4LCRA 3TQVA 1BSLA 4L7ZA 4LUJA 2V38A 3NA8A 1I2NA 2X2GA 3O8AA 3TC3A 3MO4A 3LXAA 4D72A 1G9HA 3PPGA 4NXKA 4O1DA 4ZO9A 3SM0A 2CPUA 1XLBA 1IT7A 3M64A 3QPEA 3QFWA 1S2AA 5I06A 4AZGA 4JBRA 1SW3A 2XGZA 2DU2A 1KB3A 3S42A 4CQ8A 4JY8A 4Z2LA 5HR7A 5D03A 5EB8A 3TDFA 1UG6A 1E4IA 4JTIA 3QYQA 1BTCA 2KX9A 2BVTA 3GFZA 4NJJA 3UJFA 1J4EA 3U2CA 1MW1A 5I03A 1QOPA 4UQEA 4Q8TA 4AHQA 1R46A 3NNTA 3BOLA 4IIEA 3HQOA 3IACA 1EJTC 1RAKA 1H5VA 1TPFA 4HYVA 5G1TA 3U2EA 4C6LA 4OUIA 3IJ6A 3FA3A 3HIJA 2OWXA 2XZ7A 5K9CA 1GPWA 2QF7A 3OHMB 5I0DA 3PY2A 3O7UA 1LDCA 1TCMA 4I7UA 5HWMA 1PHWA 4M24A 3LPFA 3W76A 4N02A 3WQGA 5GPRA 5IHSA 4C65A 4AY8A 4DZAA 3W7OA 1S1PA 4PMOA 5A2AA 1CXFA 3L12A 5ABEA 1OCNA 3FJ6A 4EXAA 1V03A 2HQAA 3MCMA 1LT8A 3B04A 4K1WA 1ITCA 5A2CA 3MUXA 4MZ1A 4ZQOA 3KZSA 5DCEA 2FVLA 2IQTA 1V3KA 1LUCA 3E49A 3WD1A 2X40A 3EOSA 2PB1A 3QPZA 1UKPA 5LA2A 1ME8A 3KP0A 3WUEA 4LVGA 5F1UA 3MCNA 5AYYA 4FLRA 2CZFA 1CGXA 3WLJA 3CUIA 2BVYA 2OKOA 3U4AA 4DAIA 2YXGA 5D9PA 3C4UA 1Z42A 3QM3A 1TUXA 5FJIA 3MCOA 2E8YA 2ACQA 3H2FA 3IVUA 3CC1A 4HNCA 2XVKA 4JTHA 2VDHA 3IV3A 3NSMA 3RIKA 2AMXA 1J12A 3PJUA 3BAWA 2FPTA 4UFMA 3SQLA 3EEGA 1JZ4A 4REQB 4LCQA 3N12A 1MUWA 5EU9A 3M44A 3DYOA 4NP7A 3M4HA 1ADDA 1NSJA 3M7SA 1MNSA 1RY8A 3M16A 1E1EA 3DX5A 1QBAA 1TELA 1ODZA 1QI2A 2J6VA 1KWKA 3TSMA 3ZVIA 4DO7A 4O52A 1J93A 1WKEA 3ZR4A 1FH7A 1A50A 1DXIA 1XDJA 3MVTA 3WUBA 4WVXA 5IDIA 1XW8A 4EF8A 1E1FA 3WY1A 1US3A 3TFXA 3PANA 1WOAA 2OMAA 5JMUA 4JN8A 3MZ2A 3BICA 4LF2A 1XD1A 2WVVA 1DJNA 1HVQA 3F7JA 2ODOA 3C3NA 3MSYA 1B9ZA 5JUVA 4FMVA 3LSCA 3TTSA 1OHLA 4YNGA 3SQSA 1Q3NA 3AU6A 2L5HA 4CQAA 1KQZA 1IR2A 3EDEA 3K13A 2QHAA 3LI1A 1EDGA 3BG9A 2HZGA 5JBFA 1OFAA 5JVLA 4AZ6A 4MSSA 3CBWA 2FPYA 3VE9A 4D8LA 1VH7A 3A5VA 2PLCA 3R0KA 4LNCA 1XSKA 2O56A 3CU2A 4UTIA 3M0VA 4EAYA 1H0GA 3GTFA 4DXVA 3UY7A 4YVPA 1XIFA 3G1FA 4OECA 5CSSA 3CGTA 1F61A 1ZS2A 2DT0A 3UJ2A 1XLCA 1XH0A 4HYRA 3GO2A 3RNDA 1BHGA 4LT9A 1UR3M 5EYWA 1H7PA 1FKXA 3B8SA 5DMYA 3TOYA 4L4LA 2PD9A 1YMYA 2X0HA 4Q32A 4Y90A 4LUIA 4G6CA 1R3VA 1F76A 1ZUAX 5ABFA 2WZHA 4LF1A 4RDYA 1X6LA 1XD0A 1XXXA 1GVSA 1JXKA 4JTGA 4PTNA 1JUBA 1B30A 1EH9A 4ZO8A 3VE7A 4XBSA 1XBZA 2OG9A 3MBFA 4UNKA 4YTQA 3AZRA 1IT0A 2ZVRA 4H00A 3THDA 1ITUA 1A5LC 1WBJA 3CZ8A 3DKLA 1C9DA 4CVUA 4ZL1A 1DE6A 2YCJA 3FVDA 1J96A 3E1F1 1FWBC 3UVIA 4L4OA 3UU0A 2AKZA 3EX6A 3M1ZA 4LC8A 3TW6A 1B3WA 4QE1A 2WO5A 2X0SA 3TYDA 3CJPA 1L6YA 3C0LA 2DZVA 3CB3A 4D6HA 1KNWA 4M1RA 2RDWA 2GSJA 2QDHA 2HNEA 5FF4A 3PBUA 2YZ5A 4ICNA 4IP5A 1FCUA 2XN1A 1PIFA 3FYPA 4LSBA 1TPUA 1DQUA 4E4PA 3OZOA 2ZC8A 3N1AA 2R9RA 1OFOA 1H51A 4Z1BA 2OPJA 1WUEA 4JFTA 1EWDA 3QR3A 4H4IA 3IJ9A 1XG4A 3TJIA 3DAQA 1J0HA 4TVCA 4KGJA 2PWUA 1G4TA 1GVEA 3GG7A 3IJ8A 1U5JA 3GKAA 4HPGA