4FAMA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with 3-((3,4-dihydroisoquinolin-2(1h)-yl)sulfonyl)benzoic acid (17)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 121
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4famA00
3VXGA 3R94A 4PUUA 3LD5A 4I5XA 1HW6A 4PRTA 5LIYX 4XZNX 3R8GA 1LQAA 1Z9AA 3D3FA 2IKHA 2PFHA 4PRRA 2HV5A 4GCAA 1ZGDA 2HEJA 4LBRA 3M64A 4EXBA 3GHSA 2R24A 2HE8A 1PZ1A 2IPWA 1VBJA 2ACUA 3UGRA 3M0IA 2PDKA 1RALA 3N2TA 4QBXA 4WRHA 1US0A 1EL3A 4EXAA 2FZ8A 3U2CA 2IQDA 4XZLX 4IJRA 4FAMA 1JEZA 1ZSXA 4JTDA 4XAPA 2BGSA 2PDQA 4JIHA 1Q5MA 4JQ4A 3UZZA 1XGDA 3Q67A 1R38A 4H8NA 3V0TA 3CAQA 3ONCA 5M2FX 2ISFA 1S2CA 1XJBA 1J96A 4LB3A 1T40A 3Q65A 2PDJA 3COTA 1ZQ5A 4PUWA 3V0UA 2VDGA 4IJCA 2IKIA 1PWLA 4FZIA 4WDUA 1MI3A 2AGTA 1FRBA 4ASTA 3UZWA 2DUZA 2INZA 1YE4A 3WBYA 1YNPA 4QR6A 3WBXA 4JQAA 4Q7BA 2I16A 1PYFA 4XZHA 4LB4A 3GHRA 2DUXA 2PEVA 2ACQA 3UFYA 5DANA 1AFSA 4GIEA 2NVDA 3LZ3A 4NKCA 2WZMA 4LAUA 3EB3A 4XO6A 2FVLA 5LIUX 3LQLA 3R58A 5LIKX 3H7RA 4DBUA 1S1RA 4GA8A 4JTRA 4FALA 1EKOA 1Z89A 3EAUA 4ZFCA 3DN5A 3H7UA 4XK2A 2PDGA 3F7JA 4WDWA 3RX2A 4L1XA 2C91A 3ONBA 2PD9A 2PDFA 1MZRA 3UWEA 3MC5A 2ALRA 3G1RA 1Z8AA 3T42A 4Q3MA 2NVCA 4R9OA 1Q13A 3V35A 4F40A 2PZNA 2IPGA 5AZ1A 3WG6A 5HNTA 4GABA 1X96A 1AH4A 4JQ1A 2HE5A 1AH3A 3FX4A 4YU1A 2PDMA 4JTAA 1UR3M 4JIIX 2QXWA 1S2AA 3RX4A 1IEIA 2BP1A 2PDPA 3LEPA 2DV0A 2PDCA 3LUTA 4XVDA 4XZIA 2IPFA 4YVPA 2A79A 1S1PA 2HVNA 1EXBA 1VP5A 4QXIA 3H4GA 2PD5A 2CLPA 1K8CA 1QRQA 1AZ2A 2FZBA 3CAVA 5JH1A 2FZ9A 4XZMX 3EB4A 3B3DA 1X98A 1ADSA 3V0SA 1MRQA 1SM9A 2BGQA 2WZTA 4GQGA 3O3RA 1AZ1A 2PDIA 4WDXA 4IGSA 4WDTA 1YE6A 4JQ3A 5C7HA 4XO7A 4H7CA 2IKJA 3UG8A 3LN3A 4L1WA 4DZ5A 4JIRA 1LWIA 1T41A 3RX3A 2INEA 3LQGA 5LIXX 1RY0A 3DOPA 5JH2A 4JTQA 4YVVA 2PDYA 2R9RA 3G5EA 2IQ0A 3LNMA 5AZ0A 3S3GA 2PDNA 2PF8A 4DBSA 3UYIA 1XF0A 4FA3A 4XVEA 3GHTA 2IPJA 3MB9A 1IHIA 1ZUAX 4AUBA 2PDBA 3P2VA 5HNUA 2PDXA 3CMFA 4JTCA 4ICCX 4GACA 3KRBA 4GQ0A 1YNQA 4YVXA 3O0KA 1HQTA 4QX4A 3UZXA 2HDJA 2FZDA 3V36A 2P5NA 2F2KA 1QWKA 2F38A 3CV7A 5LIWX 4LAZA 1A80A 3WCZA 3NTYA 3UP8A 3R7MA 4MHBA 3BURA 1Z3NA 1GVEA 3UZYA 4PMJA 3FJNA 1OG6A 2J8TA 1X97A 2I17A 3ERPA 2ACSA 3R8HA 1PZ0A 4HMNA 5HA7A 3R43A 2FGBA 3R6IA 1C9WA 2HVOA 3C3UA 1AH0A 3LZ5A 4YS1A 3LBOA 5KETA 3CV6A 2PDLA 4LBSA 4PR4A 1PWMA 2PDUA 3BCJA 3GUGA 4OTKA 4RPQA 4JQ2A 4WEVX 3CASA 4DBWA 4WGHA 2IS7A 2PDHA 3WBWA 4HBKA 2PDWA 3BV7A 3LENA 1EF3A 4G5DA 3N6QA 2IKGA 2ACRA 3GHUA 3BUVA 1M9HA 3M4HA 1RY8A 3QKZA
chains in the Genus database with same CATH superfamily
3C2RA 1XLCA 5ABEA 2YR1A 1AL8A 3U2OA 1WUFA 1YBQB 4XD4A 2CXEA 2DQWA 2QHAA 2YX0A 4PRRA 1Q6FA 1LM1A 3RM4A 2VFFA 1FXQA 4GY7A 3NQDA 4LBRA 3NSNA 3VUSA 4U3CA 5GQBA 4IOTA 2BY1A 2WK2A 3N9SA 5FKYA 3NQMA 2Z29A 3P6LA 1CB2A 2FDSA 2PDKA 2QDDA 3CHVA 4EPKA 3FXGA 2ZZ6A 1NFPA 4R88A 4YCOA 2VUYA 1O66A 4KIEA 2CWXA 1XHGA 1PS9A 1GQIA 4JX6A 2W92A 3W7CA 1HKWA 3CLWA 1S2VA 4N9EA 2I57A 1V6YA 1V3IA 4DZHA 2YCEA 4HCDA 1JZ5A 2JIWA 4CLMA 3WQVA 4Z1CA 1H62A 1V6UA 3N25A 2RJGA 3FEQA 3PB0A 4LB3A 3DC0A 4YWSA 2YL5A 1M41A 1VC4A 5I09A 3AIEA 3TK7A 4H9YA 4RE3A 3SCWA 3GWQA 4XKMA 4I7UA 1KFKA 3ARQA 1MW2A 1PWLA 4GFIA 4QFUA 1WAWA 4JTLA 4W86A 2R1MA 3WD4A 3CEUA 2YGYA 5C2GA 1BFNA 4W5UA 1N2VA 3AFBA 4G7FA 5HOSA 1DORA 2C79A 4ZCWA 1A5UA 2D1ZA 1B4KA 2WZEA 1KBIA 1Z69A 4IT1A 1C8QA 3B0UX 3KWXA 2FIQA 5CPSA 4JPGA 4P7QA 1QPOA 3MANA 5RUBA 4IMGA 5F2MA 2DZXA 5CPNA 4NX5A 2Z1VA 1YPFA 4GUHA 5LXEA 3CT2A 3EX2A 4E38A 3CHDA 3LZ3A 3PTQA 3CPUA 1A5SA 5A6SA 2E68A 4GQQA 3VNKA 1GOQA 4HZ8A 2V82A 3BLLA 1Z89A 5I07A 4YTQA 3FFSA 4YTRA 4HSOA 1XSIA 1ISYA 3T4CA 3OZOA 3CL8A 3F7JA 3DC8A 5I79A 3RX2A 3ABZA 1XV8A 4Q8OA 2QCFA 4LEQA 1K77A 4Q6JA 3AWNA 2ZXAA 3VOIA 2G3IA 5D2VA 4Z0SA 3M0YA 4BCEA 3ZJKA 3ICJA 4EWND 2EQDA 3I4KA 3SCPA 1P6WA 1GK8A 3MMWA 4KGJA 2FVKA 2H3BA 1R3RA 2QLYA 2QF7A 3CK5A 2GDQA 3O9NA 3C86A 4MGGA 1AK5A 5D33A 4I5RA 2PDCA 1U22A 2C1GA 1H49A 3ZFHA 5D9NA 3L2MA 3WJWA 5XIMA 4LVBA 1I60A 3O6DA 1WCGA 4TMBA 1QO5A 1DIDA 3BVJA 4M56A 1UP0A 3CL6A 4PMVA 4F4RA 3TEVA 1A4MA 3HZ3A 3WBEA 3SUVA 4ZMGA 3MCOA 5EMMA 4GCXA 2X8RA 1VYSX 4CD4A 4AZHA 1SM9A 2QDGA 5CZKA 1HJUA 4NAEA 4GQGA 1M7OA 4V1XA 2VELA 1A50A 3I6EA 3NJ3A 1TPWA 3CMGA 4MTVA 1HUVA 3L7RA 3NM1A 5B7ZA 1F07A 1EJRC 5L6UA 1D3GA 1Y65A 3M46A 3GS6A 1JCXA 3CEPA 4QM1A 1H09A 2FJUB 1XLKA 2QZRA 2NZLA 2Y8VA 2ZUWA 5AVNA 1EGZA 5H1WA 4AISA 5F2IA 3UJRA 4F2UA 1RY0A 4Z1BA 3DOPA 3W1TA 2FZMA 4AY8A 3VMPA 3TTYA 4AHQA 3REQB 1V3HA 4JYDA 3SUWA 1V77A 1B90A 4C1LA 4W84A 1JCLA 4HIBA 4J4KA 4O18A 4A2RA 3C4UA 3EA2A 1OT2A 2QUVA 4NRRA 1OFPA 1NSJA 4HNVA 1BQCA 3PWGA 1TPFA 3KLLA 1OZMA 3B8IA 2EF9A 4PRWA 4XG1A 5FF3A 5I78A 3WFAA 5FJRA 4RV3A 3NEHA 3VDHA 1AW5A 2W91A 2NXGA 2BVWA 3IUHA 3PUOA 4LAZA 4LUIA 3WEOA 5LYRA 4H8UA 2CW6A 3VIMA 1LORA 3EMCA 1IEWA 3O8AA 2WVVA 3ALFA 4K1GA 3OBAA 3HPXA 3P5ZA 1WKEA 2O92A 3FJNA 1EJ7L 1W1IE 2OO0A 1CGVA 2YA1A 3UY7A 4GI6A 4V27A 1KM4A 1WZAA 4JAWA 1UD6A 3KOZA 3WMCA 3WL1A 5F4SA 3TU9A 2H8ZA 3TMLA 5HPCA 3GXPA 3MYPA 3DENA 1TE1A 1EDGA 4GXWA 4HMDA 3GIPA 2CKSA 3AHTA 4KFPA 1JG9A 1ZFJA 2OOFA 3P81A 3QV7A 1SJDA 5FSEC 4QDMA 1OT1A 3RR1A 2J88A 1PWMA 3S2CA 1F8MA 1IZCA 4WEVX 4JFWA 1UZHA 4J9JA 2C1HA 1OCQA 3VNZA 2GSHA 1M9HA 3LXCA 3OHMB 2CHNA 7ODCA 4O10A 1GOMA 4LXFA 7REQA 1DWFM 4F0LA 3CIVA 1NDWA 4W93A 1WPCA 5KZEA 4FNUA 4MJMA 4O28A 2FYMA 5LIYX 4E3TA 3OZYA 2A85A 3LI0A 3TAOA 2XGIA 3VCRA 3R0UA 4ZQPA 1OFOA 3TE9A 4QCEA 5M5DA 2ZUSA 1GT8A 3PK7A 2WVSA 5SWUA 3R10A 4NNBA 2GQ8A 1VB9A 5BWFA 1ZB5A 1FCQA 4FLQA 1XKYA 2UZ9A 1SJAA 2IXUA 4ZXOA 4JOMA 4URIA 1JJKA 1ODZA 4WRHA 1SZGA 1EC9A 1T99A 5GJMA 4EXAA 2GUUA 2IQDA 3VKCA 4B90A 1SMAA 2HNHA 3VD5A 1LROA 4MAZA 1MZHA 2BFGA 1IEVA 4HNNA 1HT6A 1R5YA 1B31A 2YFOA 4U2YA 4O1CA 4QS6A 4DAFA 4UOZA 3B9OA 1E6SM 1ZAIA 3W1LA 4CCZA 2VX4A 5C71A 4ZODA 2WSQA 1EJVC 3PY2A 4JTEA 2E3ZA 4IFRA 1SR9A 3Q65A 3SR7A 1WDWA 1JCJA 4LV9A 5A2AA 3AU6A 1XI3A 2DZSA 4BY3A 2QNEA 1FWNA 3THDA 1W9PA 2OLHA 5K9XA 4LJ3A 5AHLA 2V2DA 1HL2A 2GDVA 5IBXC 2C0HA 3S4TA 1UPMB 6TAAA 5C2CA 2POZA 3EZ4A 3IS4A 3VFCA 2V5JA 3D46A 3U8GA 1REQA 1TPB1 4FHAA 4OBTA 2XIQA 4XZHA 3GXDA 4ZE4A 4QG8A 1QNQA 2J66A 5HQMA 4J27A 3OA3A 4HYWA 1R6WA 2BASA 1AFSA 1YRRA 1XLBA 4GQBA 4YCPA 1IWBA 4P8XA 2WZMA 3PJTA 4US6A 5LIUX 3CWHA 3E74A 3EOSA 4LF1A 4ILSA 4MZ8A 1S1RA 4FALA 3AJXA 5KTLA 5HQLA 3ABXA 2I5QA 2YOCA 2WCSA 3THQA 3B03A 1GKQA 4A2SA 3LLXA 4CNTA 1MUCA 1WDQA 3RRAA 1E6PA 2YXGA 4HJFA 2ODOA 2DH3A 4HPHA 4YL2A 5IBXA 4A35A 3NQEA 1NDYA 1VRDA 3HF3A 2ZWZA 4GIAA 3L2LA 4RCXA 1B9ZA 3V35A 1W3KA 1IT0A 2F84A 1XBZA 2OT1A 1NWTA 2DSKA 4NILA 3H55A 1Q6RA 1E43A 2POTA 1WDRA 4FOUA 2PDPA 3S5SA 3WJZA 4BQ4A 3LUTA 1TPVA 3FDGA 3BC9A 2ZC1A 1TTJA 4GJJA 2PWVA 4LC8A 2C13A 1UASA 1VCFA 4M1BA 6ALDA 2ZXBA 3W2UA 1YPIA 1POKA 1DJHA 4YPJA 3MUXA 8XIAA 1G94A 3Q58A 1HGYA 1SZEA 3E2SA 2PWUA 2NW0A 1FH8A 5ECVA 1F3WA 1DXEA 4UQEA 1NWSA 1GCYA 5HPOA 3NWRA 1ZP4A 3MMDA 4B9YA 4E4UA 1YE6A 2Z7GA 1LQ0A 2IKJA 3M0MA 3GXIA 3UG8A 3MS8A 5AHEA 4DZ5A 1X1ZA 2XGBA 4B16A 2VHLA 2BDQA 2HNEA 4V1YA 5H8UA 4JTQA 4IX0A 1UKPA 1FWGC 3H2CA 3G5EA 4XZ9A 2KAUC 5KMYA 3WQCA 1UC4A 4IJBA 2EPLX 3BJTA 4ICNA 3TQ0A 4X22A 1ZBKA 2VGIA 4O0ZA 2JFEX 1DWHM 1MUMA 2QCDA 3VX1A 2WKGA 4JKMA 3TW9A 2IPJA 4H04A 3WH6A 3TN5A 4PBFA 2CFFA 3C2EA 1W5NA 3L4UA 4CU7A 1VCVA 3ABSA 1RAKA 4JTCA 1VBRA 4ICCX 1A53A 5TF0A 1N55A 4KRZA 1RK6A 3ME3A 3WH8A 1KWKA 1W0MA 3STEA 4A3RA 5CSUA 1WDDA 3W7LA 4W89A 3TIMA 2QJGA 5BXPA 3WLHA 2P5NA 4LS1A 1ME9A 3ARUA 1UMLA 1XYCA 1XQKA 1TYGA 2O7SA 2PP3A 1O12A 1F76A 4M81A 3H23A 3S83A 4C1NB 2A5HA 3BURA 3FW6A 2X09A 4O4VA 3RYSA 4LCSA 2NQJA 2MNRA 1LG2A 5BROA 5I3IA 1FHUA 4GOAA 1MW0A 2Z6IA 1C9DA 3FIGA 1X1NA 1XLIA 3DU0A 5ENLA 2P53A 5HQEA 1G4EA 4QJ1A 4A8NA 2ADAA 3GXFA 5A8NA 1XYFA 3E2QA 3NZQA 1UA3A 4WOZA 3FKRA 3ZLHA 5DCDA 4F8XA 5EKYA 1ICSA 1EJUC 2Y7GA 3NQAA 3QPZA 4HA4A 3R0KA 4Z0JA 4UFIA 4PR4A 3HGJA 2ZXQA 2BV9A 2PGFA 1H11A 4XV0A 3WBWA 1CEOA 4W5ZA 4U5IA 4F0MA 3GK0A 5DXXA 2YB1A 3GZAA 1TG7A 8XIMA 3NSMA 1NAL1 3M4HA 4MWAB 2FHFA 4DEFA 5CQ1A 3EWYA 4M82A 3TN3A 4C6IA 2OELA 2HCVA 4GXMA 3EB2A 4C5YA 4M19A 2HXUA 4KFOA 3IIOA 1NP0A 3TN4A 3G1VA 1K6WA 1M03A 1OF8A 4Q4PA 3ANYA 4UCFA 1M7JA 1A5MC 4OWGA 4L61A 4FXFA 3EPNA 1H1YA 4DZIA 3TQKA 3RF9A 1OF6A 1J4EA 4XD3A 2REQA 3QGVA 5E09A 2WHJA 3B4UA 1IGWA 5D2XA 3FYPA 3QGKC 3GDMA 2C8NA 2GVLA 3NR0A 3CZLA 4W7VA 2L5HA 4DLFA 1NH6A 3HM7A 3IARA 4O52A 1E0TA 3PHAA 1XBYA 4GI4A 1A0DA 1XR2A 4E3VA 4BQ3A 4H2CA 4H9TA 5FJUA 1UZ1A 2VEIA 1QU4A 4MNMA 4H7ZA 1YTDA 1GOKA 3C0SA 1RLCL 1MFUA 2PDJA 4D6EA 2JQXA 3VVGA 1YQ2A 4NASA 2VDGA 3UPBA 3K8KA 3QOKA 3SCNA 3EOUA 3VNYA 3CUZA 3BK0A 1FQ0A 1DWAM 3G1AA 1HP4A 5HWNA 2XINA 3AALA 4UZSA 3ZR5A 1F3EA 2VRQA 3UWZA 3P5YA 1J18A 5HAOA 1R30A 4G9PA 1EGVA 2PRHA 3LBMA 3KS6A 4UOJA 2DZVA 1P6BA 5H91A 2X41A 4IMAA 4EAMA 4G1NA 3R8RA 1JL8A 3FK4A 3GXMA 5C9XA 1EHNA 3F2BA 3WUBA 4DF2A 2XVNA 4HOZA 4BA0A 3QY6A 5EMLA 3BAJA 3B06A 1PX3A 1KLYA 2CNCA 3I10A 1V0KA 3DN5A 3I6TA 1LL7A 3PN8A 4RW5A 1AMYA 1JUEA 4ADUA 3KCJA 4C60A 4LYPA 2ABBA 3EDDA 2HPMA 4ALDA 1J0YA 1XYLA 1ME8A 4MB4A 4MM1A 2PS2A 3W1NA 5K9DA 2HTMA 1R3QA 1J5SA 1P48A 1W3JA 3VIPA 1BKSA 1E9LA 3WUFA 2I1OA 2XWEA 4Y9MA 2D24A 3IAQA 2B7NA 3A4XA 2V3DA 2Y5JA 3TW7A 3VE9A 1B3OA 4Q22A 3SJNA 2YJQA 3UPMA 1DWIM 3R1ZA 1BSIA 2PLKA 3GO2A 4JQ1A 1X96A 4R5EA 2JEQA 2DVUA 2VWTA 3F4WA 1KXHA 1FCVA 3OPSA 3PBYA 2UWFA 2QCNA 4KIRA 3BGGA 1G5AA 1A3WA 1XD1A 4D2JA 4B5NA 1XIEA 1A0CA 5H8MA 1VBHA 4GVHA 4IH3A 1W9UA 1DOSA 4NZ4A 2Z00A 2WHMA 2FZBA 3CAVA 3OODA 4HU3A 3TUUA 4Y6GA 4OKDA 1GHSA 4ZQOA 4MY8A 2ZUMA 5G5IA 3W24A 3WQ8A 5A3HA 2E7FA 3OQEA 1GQNA 4QHRA 4WCJA 3RUBL 4I6VA 4LUSA 4WVXA 4WDTA 1U30A 1HF6A 3BICA 2J62A 1H3GA 3BARA 3GQYA 1ITQA 2ON3A 2OLAA 4K39A 3VOFA 3DYMA 1T7LA 2HISA 2WQDA 4WXYA 3BSHA 1AL7A 4UTTC 2OODA 5BCAA 4QG6A 4CQAA 2FQIA 2VUNA 3A9BA 3A23A 4YVVA 5JH2A 1UMYA 2E5DA 1L6GA 4UTIA 3R12A 1DE6A 3LNMA 4AAJA 2PB1A 4PC8A 3TFCA 3SM0A 4W9TA 3MJYA 4AZCB 3C6CA 4DUXA 1EYWA 2DGAA 4XAGA 3GR7A 1E70M 4AF0B 3QMTA 2OQYA 3TYZA 1EO7A 4FA3A 4Q8NA 3VGFA 4XISA 1TV8A 1AQHA 2YW3A 1IWAA 1J2BA 3C0LA 3L4YA 2VCCA 3AXXA 1EC8A 1GZ1A 1KO0A 4QRNA 3CMFA 2GYIA 1H0GA 4CN4A 2V0TA 1YEYA 1E1EA 2CBIA 3CO8A 3A4WA 4I9JA 4PTDA 3ZYZA 1Z42A 2XDFA 2VC5A 1CPUA 3NUKA 1F6KA 4L6DA 2W9MA 1X8CA 4RXFA 2NVAA 1AG1O 2Q3RA 3HQNA 1OHLA 3M7WA 3Q94A 1V0NA 1ZU8A 3BOLA 3AIQA 3O1NA 4H6QA 1X97A 1DL3A 3R0DA 1RZMA 1VPQA 2E5CA 3WNPA 3ZVIA 1XRVA 1XIFA 1DJWA 2VTFA 3W84A 2HVOA 3TSDA 3PZQA 4IP5A 4YS1A 4WXZA 5PTDA 9CGTA 4ACYA 2XYLA 2GZXA 4Z08A 1XYZA 1UH2A 3GC4A 2VEPA 3B4YA 2GVGA 3LENA 3TOPA 1B3XA 2BY3A 2Y5EA 2XUCA 4G5DA 2FGZA 3RLVA 3S5YA 1JCYA 1H7OA 3L5LA 3TONA 4MAVA 3VDBA 2CLEA 3LHUA 4FK9A 1XLEA 1J93A 1OFEA 2V63A 1CYGA 3SGGA 3GU2A 4R53A 4GUIA 1EP1A 3WEZA 4CVWA 1HW6A 4PUNA 1RBOB 3NDYA 1Z9AA 1XLHA 1UD8A 1X7IA 3TYAA 4CD8A 4N6FA 2ZKMX 2DW7A 2WV8A 1VHCA 2PLCA 3MA8A 4JYEA 4PTVA 1V6XA 1J01A 1B3YA 3ZVHB 4PODA 3EDKA 2JK2A 3F5KA 3NM3A 1CWYA 1QUMA 3H2EA 3UGRA 1DKWA 4LEFA 2IXVA 4ZB2A 2E5BA 2WBGA 3M7SA 3THAA 5A2CA 3W71A 2V5DA 2YDQA 3V5FA 3NDZA 1XG3A 4HZMA 4ZVJA 3RO8A 4IXXA 1JDEA 3QTPA 4ZL1A 2EJAA 1DXIA 2FH8A 1HP5A 1Z44A 3AXHA 1Z6KA 4BWLC 1WKFA 3GG1A 4F2TA 2PLJA 1HTIA 2C19A 1QHOA 3NZRA 3ECQA 3EPOA 2ZBTA 1GYMA 1FP9A 1S5VA 2WM0A 1IXNA 1HG3A 2OQHA 3MWAA 1W9BM 1CB7B 1KGUA 3OO2A 3QBUA 2QYGA 1HKJA 2C6QA 2XHYA 1XCXA 4FMVA 3I7RA 2DW6A 3GIQA 4MLRA 3A12A 1R9ZA 1SJBA 4K7YA 3C2VA 1ZENA 4FZIA 5G4EA 4WDUA 3M5YA 2AGTA 4DM1A 3W38A 1E4MM 1EA9C 2Y7EA 1RSCA 2INZA 1WDPA 4ZOBA 3B8VA 4Q7BA 4NXSA 4LOCA 3AZRA 3XISA 1IQ8A 1QJWA 2E67A 1NU5A 1KA9F 3GLCA 4MYAA 3W2MA 4UTJA 1OSEA 1TPC1 2ZC8A 3NZPA 4O19A 3V5CA 3TLLA 2Y8KA 1GOWA 3RJYA 4DWSC 4PMZA 3M5XA 3SRHA 1RCQA 3AAMA 1BXNA 5EBUA 3H7RA 2R1PA 4B5WA 3PTDA 4AY7A 3T0CA 2ZWYA 3T9PA 4EPEC 4XAFA 1FDYA 3WJXA 3OIHA 4I9AA 3AHZA 2H6RA 4LT9A 1AW2A 3L5AA 2G50A 4ORIA 4WQ6A 4XUGA 4L1XA 5AC7A 1RK5A 1K1DA 1LBFA 4PN2A 4ZB5A 2PF0A 3MC5A 2V5KA 1PIFA 3IV3A 1UIPA 2AQOA 3AC0A 2NVCA 3GTXA 1Q13A 3GRIA 4AW7A 8CGTA 2FVMA 3O07A 4F40A 3W1QA 4LFYA 4NZ5A 3WG6A 4D6DA 1XSJA 5C7VA 2D0FA 3POHA 1LJYA 1E6QM 4JIIX 1UH3A 2EO7A 3DFYA 4DXKA 3STCA 1XDLA 2DVTA 3W76A 1C7SA 3TXVA 3G18A 5MF5A 4DWSA 1WAUA 5CG7A 1PZ2A 4KH2A 4IQEA 2G4JA 1QPRA 3IJIA 4RUBA 4LW7A 3W2NA 4ZGYA 2BHYA 2PU0A 4NSBA 2HK0A 5JH1A 1KRBC 4MUPA 3VKBA 3W2KA 3O16A 1H50A 2JKPA 4JFTA 2R91A 3R25A 1U5VA 2X7WA 2HS8A 2VEKA 4UR7A 5C2XA 4BEUA 4DYEA 2DP3A 4DUOA 5KEZA 3NOYA 4IGSA 2C16A 2PA6A 4Z1AA 2DU2A 1V3JA 3CQIA 3UJSA 4R7WA 1EP2A 2AQVA 4U10A 3PFMA 4HK5A 4QGCA 1EO5A 2D2JA 3UD6A 3CXOA 4WKHA 3FJ4A 3TXZA 1MWOA 4K6AA 4AC1X 1Q6OA 3LYEA 4KPLA 2TPSA 3U5UA 1OX4A 2Q8LA 1TFVA 1GQKA 1CCWB 3NL5A 4BF5A 3P67A 5LIXX 1XINA 3AHVA 1OY0A 1EJTC 2Q6ZA 1TRIA 1CECA 1R47A 1JPMA 3LA4A 3UWYA 3KWSA 5CC7A 1KKOA 3KRSA 3TH6A 1H2JA 1SW3A 3LGDA 1AJ0A 2PDNA 2YFNA 4JHOA 4NU7A 2A7NA 4LALA 3L4XA 3A47A 1HKKA 4UTHA 2QUTA 4LYKA 3T2OA 3SQLA 1NOUA 2E4TA 2VD9A 2EPMX 1XRSA 2ZX7A 1HKIA 2G8ZA 2P50A 1NY1A 1A3HA 2WPGA 5H8PA 1XPGA 3UZXA 4FIQA 3STPA 4C6QA 1MYRA 2GFTA 3KAOA 2CZVA 1WOBA 3QHNA 1YXCA 2W6RA 2VDIA 2PPGA 5FF0A 3FJLA 3UP8A 1W6TA 1MXSA 5FL0A 1Y5WA 5F1UA 2BY0A 5CC5A 3L0KA 4O15A 3S0CA 1CI1A 3LHVA 2J6XA 1DEDA 2Y8UA 1DXFA 3OVQA 2ACSA 3ARYA 4ROQA 5DLCA 3WJSA 2X42A 1VJIA 2NQHA 2PZ0A 2Q8ZA 3GDTA 4PH6A 1TZ7A 2IQTA 3SCTA 2VEGA 1XD0A 1WKDA 2WPBA 3GW3A 1ZJAA 1F7BA 3C5QA 5K7JA 1E72M 4QG9A 3FDKA 4X2PA 3EXRA 3UPWA 3THCA 2PDHA 4HBKA 3BV7A 5T91A 1E6RA 1J0ZA 2WLZA 4WLCA 1P7TA 4KETA 3DH7A 1RD6A 1AODA 2PMQA 5FF7A 3L9CA 3AXIA 2I7GA 1MW1A 1DIEA 3BW2A 4LS2A 1DP0A 3W07A 3BOFA 4AIBA 1EDTA 3ARSA 4P2VA 4PUUA 4C6EA 3CWOX 3VZYA 3PZNA 4XZNX 1JCNA 3AUOA 5TD4A 1PKNA 1IT8A 1J5TA 2PRMA 3UXKA 4A3UA 1H7NA 3C2YA 4RJEA 5CAKA 1E73M 2DEPA 3EKLA 1TVPA 3GVQA 2HEJA 1PPIA 2INFA 4EXBA 2A3BA 2G96A 1MXDA 1V93A 2Z27A 2HBVA 5C9ZA 3ZZ1A 4IPNB 3RIKA 3M0IA 4Q8PA 1LRNA 1JZ3A 1RALA 3MVTA 1I8JA 1ONRA 4IP4A 2OEKA 1TJPA 3GNDA 4D8AA 2BLEA 4X2RA 1I0BA 4IJRA 5DMYA 2J7DA 3WLOA 1KTNA 3HTWA 1LUCB 3CO4A 3MP4A 5DBTA 3ITLA 5HJXA 5KZ6A 1OYAA 4NNAA 4JIHA 4UIOA 4IX2A 1QXLA 1O68A 2MUCA 3SUUA 5I02A 4AWEA 1LG1A 5M2FX 5LNVA 3CH9A 1S2CA 4PL1A 1BD0A 3TLQA 3EOEA 2RHGA 1IIHA 1BF2A 1H51A 3HB9A 2O7QA 4PUWA 1TKKA 3SSZA 5HUPA 2IKIA 3ITVA 3LU2A 1BQGA 2BS9A 1M01A 1SZNA 2GQAA 2ZUNA 3AMKA 1UWAA 1WO2A 1FRBA 4ASTA 3HG3A 3CTTA 3W7HA 4GUJA 3LHYA 1JDFA 4QAIA 3W27A 3WK0A 4AZ5A 1YNPA 3MT1A 1GVIA 2WKJA 3H21A 3HGOA 4ZSUA 2ICSA 2I16A 2O9TA 4J3WA 4IICA 3NURA 4CNUA 2VYOA 3E2RA 1XGEA 4FXRA 3DUGA 1EWEA 1C92A 1JPHA 1LOSA 4P7NA 1EPVA 1N7KA 4GYJA 2QCHA 2WNWA 4MIMA 4OGZA 4Y9PA 4LUTA 2A3CA 4RXGA 2X1SA 3QQ1A 3W7MA 1VFUA 3ELFA 5A6JA 2DZUA 1Y5XA 4MF4A 2ISSA 1GORA 3KDOA 3OOQA 1BWKA 3CQHA 1XSKA 3NPUA 1TTIA 2CITA 2PD9A 2VCAA 4BI6A 3MI2A 3G1XA 3E3HA 4C6OA 1V3MA 4DO6A 1FWDC 3T42A 2JKEA 4QQUA 4HHLA 2OQLA 3MUZ1 3Q45A 3WUEA 2J74A 3QN3A 3W82A 3UCQA 1HNYA 3ANUA 2VZSA 1AH4A 2HE5A 4Z1DA 1AH3A 3GNXA 2G3JA 3TOYA 4Q32A 5E1QA 2VZUA 2BP1A 2XM2A 3QEZA 4H3DA 4PCPA 3N17A 1FDJA 2WHKA 1Z41A 3P74A 2OMAA 3P62A 1O7AA 2Z2BA 4DI9A 3WF0A 3URQA 2Q71A 2OB3A 5MKGB 5DF0A 1QPNA 2YCLA 1HO4A 4GISA 5K2ZA 2VC9A 3EX4A 5JBDA 3B3DA 2G3FA 1CLKA 3JW7A 4NY2A 1KRMA 1SZRA 4AXNA 3INPA 2P10A 2GUYA 2ZOXA 2PC8A 5LGXA 4L5ZA 2BODX 3U2ZA 1JRBA 5K3VA 3HPFA 1GTHA 4J3TA 3T2QA 5A6BD 3QF0A 1XIIA 3I7SA 4DIAA 3BSMA 1E51A 2VQUA 2XSXA 3WDHA 2DQXA 2QUUA 4JIRA 1LBMA 3G6LA 3WF3A 2ASHA 3CIXA 1XFCA 4DQWA 4KCUA 3JS3A 1Y7VA 4IFKA 2HSAA 3KOWA 2XIOA 4ECLA 2V69A 3ANVA 2TODA 1V5XA 4MVAA 4HTYA 4CNNA 1DTUA 2PF8A 4NZ3A 4RDVA 4DBSA 3TV8A 1XF0A 3FGCB 4H4IA 5H2ZA 2XZ9A 2ZXDA 3THUA 5EFFA 3WO8A 4OV9A 3IIPA 2EXOA 2PDXA 3QR3A 2CBJA 3TNOA 4YVXA 5BZAA 1VKFA 3UJEA 3S1GA 2DPEA 1P0BA 4A4AA 5C0QA 1IYXA 2F38A 3TX9A 1ECQA 3LV5A 3AU2A 3JR2A 4B5VA 2WMFA 3EOOA 2WMIB 1PTGA 1UB3A 2FFIA 3KEHA 3POCA 2NQZA 1E0XA 2CCRA 3NO3A 3UZYA 2F7FA 3M43A 3C0QA 3AZSA 4F9JA 4CU6A 3DFTA 4Q4OA 3N3TA 1UR0A 4HHPA 3GAYA 3UCCA 1W1PA 2YSWA 4FI4A 4GO8A 1R0MA 1L0PA 4WD0A 4WIWA 4E6MA 2E1DA 2W79A 1NTHA 3GB6A 3E1F1 5TIMA 3BLKA 3I4EA 3W7JA 5I00A 1FCUA 1OYCA 4TTUA 4LS0A 1KQYA 5BWAA 4RPQA 2VI0A 3HFYA 4WKAA 1JGIA 4FX6M 3N6QA 2IKGA 3LV6A 5LA2A 2CKRA 3A9IA 3S42A 4O1FA 2XJ7A 1F74A 3FYYA 5KINA 3LLDA 1Q6EA 3UXIA 3VIOA 3IK2A 2QVNA 1U5HA 3R8GA 1NM9A 2E28A 1GPFA 3D3FA 3IAPA 4MB5A 5KZDA 2GOUA 2VL4A 3RMJA 4GGBA 2EPOA 3NNTA 1FKWA 1TWZA 3GIYA 3ZT7A 5J04A 1NF0A 3MJMA 1I2QA 4HOXA 4YYFA 2X16A 2Y4SA 3N13A 4HZ6A 4DPPA 1RLDA 3TYCA 1K8YA 4B4FA 4QBXA 5I3GA 3WQ5A 1UR1A 3VNLA 4GYPC 1D8CA 3IGUA 5JMUA 4AHPA 4UTMA 1L2QA 4XAPA 4S3AA 3FAWA 3ARZA 4AD4A 4MOZA 3WYZA 3CS2A 4Y90A 3UZZA 4BK9A 5HANA 4Z1YA 4XD6A 4NZ1A 3VU2A 3ONCA 3CZEA 4GD0A 3V1PA 2VRKA 1ELSA 4I9MA 1V7YA 2PP1A 4DWDA 1XLMA 3OA5A 4LY4A 1FWFC 3NOEA 2RJHA 3NG3A 3KUMA 3MBFA 3BLOA 4N4PA 1ZJBA 3WQFA 4L65A 5CPOA 2P8BA 1TVNA 4YWIA 4S3GA 1E3XA 3CU2A 1QAPA 2J13A 5U7SA 1W37A 4US5A 2V68A 5HULA 2V5BA 3GHRA 4W8LA 4UTWC 1PTDA 1FWJC 5C8BB 2QF8A 4AZ7A 3H26A 2R1KA 4P8WA 4GO9A 5LKYA 3A3WA 3IGHX 4HTBA 1RA0A 3P0WA 2NV1A 3LQLA 2ZZ2A 3WJYA 3BG3A 4DBUA 4GA8A 3A64A 3U9IA 4RDZA 3VOCA 4MFEA 4QSHA 2ZUUA 2CESA 2Y89A 2Y6ZA 1OK6A 2HZGA 5F4XA 1VCGA 2G41A 3LSCA 3AS0A 1QW9A 1MEIA 5CPTA 3MP3A 2PDFA 1ISWA 1MZRA 1TPUA 3BLIA 5BW6A 3KL5A 2HPIA 2BY2A 5GPRA 1U1UA 3G1RA 4BEQA 2XG9A 1OGSA 1FFQA 3T08A 3WD1A 4OVXA 3DHUA 1RP9A 3H2AA 2J47A 3MKCA 3OB8A 3NCOA 2IPGA 3DKLA 3OHIA 1UZDA 5HNTA 4GABA 3RNDA 3EMQA 4YU1A 4L80A 5JBEA 2G95A 3MV01 1XWYA 5I3JA 4XD5A 1LWHA 4FNRA 2YKKA 3TJ4A 3W28A 4YVPA 4C6JA 2A79A 1JDAA 3PBUA 4PFHA 2E1WA 1R46A 2X7VA 3EWCA 1BRLB 1GOXA 1CXHA 3AZTA 3PSVA 5BYWA 4J3XA 2NX3A 1UUMA 2ZVIA 2CBVA 5FL1A 5EGRA 3KP1A 5A6LA 2XH4A 3VD7A 3WEMA 1FWWA 4LGXA 3DBPA 5CPQA 1RD5A 2BXYA 2A3LA 4YJ5A 4Q8MA 1E55A 3LRKA 3AISA 1XLJA 2PGWA 2WHLA 2X2GA 2Y61A 1AMKA 1DHPA 2A3EA 4GNVA 3EWUA 5CH9A 5BOEA 3GVWA 4XKYB 2J7BA 3GAKA 3B8SA 4K1WA 4PSRA 5D03A 2PURA 3WK2A 1K8ZA 1HVXA 4OFCA 1K70A 3PUDA 3SJ3A 2OT0A 2E6DA 1ZNNA 3LQGA 1EX5A 2Z1KA 3PZ9A 2G3MA 2FLIA 4AZBA 3M47A 1QWGA 3RLHA 4HK6A 4JEJA 2YDSA 4HKPA 3N4FA 3M0LA 3F2CA 3MB9A 2F6KA 1OFQA 1QNOA 2GL5A 5CLTA 3L21A 4U31A 1TUXA 1IEQA 4PBGA 5A6KA 1GQJA 3ZWTA 4GACA 3V1HA 1Q3NA 3NQGA 3IJDA 4JDYA 3TMQA 4ES4A 5A1AA 4GLEA 1TTQA 4KEZA 4WSKA 3LRMA 5M17A 4N6EA 4WF7A 2XSAA 1OM0A 4A8IA 4DXVA 1FP8A 2VFGA 1CXFA 3I68A 3IK4A 3D5HA 4BJHA 2W5FA 4P7OA 2OTDA 4F66A 2VJXA 1C3FA 4GMEA 4PMJA 1L6FA 2YBUA 5XINA 4CNPA 3FLUA 3KCLA 5DO8A 1Q2SA 3ABQA 2NUXA 5EY5A 5J5DA 1KM3A 3S5ZA 5FJIA 4C65A 4Y96A 5ABFA 3BL3A 4LNYA 1PZ0A 3VTRA 4H2HA 5HA7A 4ERIA 1W9DM 4Q8QA 3EWZA 1B2YA 4WY0F 5GNYA 2PDLA 4FNSA 1OIFA 1UBPC 4OTKA 1I2OA 2BX7A 4DBWA 3SUSA 2Z7KA 2ZRUA 1QHPA 1J0KA 1WUEA 1YBQA 5CPLA 3GHUA 1GHRA 3CQKA 5LNWA 3K1GA 1BWVA 4DJFC 1RY8A 2PTYA 1J11A 2ISFA 3N1AA 4I8DA 4V15A 1OVDA 3LXAA 4KERA 2D3LA 3ZO9A 1TV5A 4AB4A 4REQB 4NI3A 2QAPA 1JGMA 2FKPA 3TFXA 4K38A 2HV5A 1I75A 1TJ2A 4UNIA 2YL8A 4PMUA 1FHDA 1TV3A 4BKNA 3H2OA 1ITXA 3CMJA 1FA2A 5IXEA 5AY7A 1VRXA 2IPWA 1VBJA 3W1XA 1V02E 3W9ZA 4HOWA 3RG6A 4EK7A 4N4QA 2ZUVA 2WC4A 1I2RA 1ZS2A 1VYPX 1R3YA 4AIUA 1KNWA 3N2BA 3U2CA 1JEZA 3E0IA 4HA0A 4KWVA 5JBFA 3WQWA 4HPGA 3P93A 1DJZA 1FXPA 5CLWA 2BGSA 2ZYFA 2NV2A 3PP7A 2FTYA 3CZGA 1JFHA 3DHDA 3N9KA 4DF1A 4DJFA 1SSDA 1D7KA 4H8NA 1B57A 2NT0A 1KC7A 1ZBWA 4DVOA 3E6EA 3W87A 2ZA3A 3WQPA 2D22A 1RV8A 2FPVA 2NLIA 4C6PA 1XW8A 3PC0A 3UZ5A 4GX8A 1EHAA 2VP8A 3CUIA 4C7FA 1CLXA 3N2OA 3H4XA 3QPEA 1LCOA 4TV5A 3WBYA 3IJ7A 4E5TA 3EGJA 5DELA 1R7AA 1V03A 3CZKA 1UJPA 3DXIA 1PZ3A 1S5NA 3SQMA 2PTZA 4QLKA 4JN6A 4Q4MA 3VGDA 2CLLA 4PCTA 1YNYA 3GE7A 3ABRA 4IMFA 1CTNA 4HB7A 3ITXA 1UWIA 2PEVA 3T81A 3A6OA 3MSRA 3V18A 4GNKB 2NVDA 1Q66A 3WH9A 1V02A 4W8BA 2WO5A 4PUJA 4IPJA 4O13A 1H0IA 3TR2A 4CCDA 5AHIA 1GW9A 3WNNA 3ZLGA 4JTRA 4QEEA 3HFTA 2DZWA 3H7UA 1DWGM 3GR4A 2ALDA 1QPQA 4JEQA 3R2GA 3MTWA 1K4GA 3MZNA 3VI2A 1WXJA 1R3TA 3TCEA 2GJNA 1UD3A 3UCDA 3TJLA 2ALRA 1CENA 2NQ9A 2X0HA 3LY0A 2PI6A 4XTDA 3SRKA 4UCGA 5C6MA 3TYUA 4AZ6A 1DE5A 4UFHA 3L23A 1L6WA 2BOEX 4H9MA 2PCQA 4IPIA 1P0EA 3VNJA 3GG7A 2YW4A 2QXWA 2RAGA 5HINA 3ARRA 3UERA 5E0KA 1R7OA 2IPFA 3RPDA 1GPWA 3K46A 1DJNA 4GXPA 2QJJA 3VOGA 2FTPA 4J3UA 1K8CA 4QSFA 3TSMA 4J3ZA 4QP0A 2PC4A 4KWOA 3VDCA 4US5D 2FZ9A 3WQDA 1T6MA 3IACA 2F6UA 1SVDA 3SB0A 4M6UA 1VBGA 1LOLA 2Q02A 1QOXA 1V0MA 4M0XA 3N34A 2PTDA 2HVMA 1K9DA 4KMQA 1YDYA 3VZXA 5CC6A 3F03K 3T78A 3URBA 5FOOA 4F0RA 4WOQA 2NX1A 3HJEA 3WNOA 4K8GA 3A3XA 4KBXA 5LZLA 4O4WA 1JZ8A 5C7HA 4DUWA 3F2DA 2PWHA 3T4WA 1JUKA 3B05A 3MY9A 2V81A 3REQA 5IHRA 4TV6A 1W5OA 1XIJA 4ML4A 3RX3A 5I2UA 2WSKA 2EKCA 3N6HA 3W53A 3FYOA 3MPGA 1NVMA 1KCKA 1WE5A 2PU1A 3MQTA 2ZZ3A 1GJUA 1N8FA 1NOWA 5CPMA 4NRSA 1EZ2A 3PZGA 1ME7A 6TIMA 5AZ0A 1F6PA 4HU4A 3SDOA 1JI1A 1SZFA 3VNIA 1WX0A 3CUXA 2WC7A 3CZ8A 3W25A 3HURA 3B0XA 3E49A 1IHIA 4NYYA 5LSMA 2CETA 1K02A 1UA7A 3B9NA 1PX4A 4NZFA 3QMSA 1IGSA 2ZZ5A 3QJAA 4TU1A 1RCOB 1OBAA 2HBXA 4QX4A 2WWDA 4O50A 5HNRA 2BVYA 3PBVA 2FZDA 1D2KA 3GU9A 4JTTA 4FNPA 4FF5A 6REQB 1U83A 1GKPA 3WCZA 2VVSA 5FEXA 2DZAA 1UR8A 4ERAA 2Z25A 5CSYA 5BXRA 4HGXA 3G24A 1BXCA 3DCPA 2XPKA 1UR9A 4RV8A 4ORMA 3QV9A 4FIRA 1NWUA 4AXKA 4RNHA 3S2NA 1O5XA 4CD5A 4LAKA 3FS2A 3N73A 4JDBA 4HMNA 1HXJA 1V79A 4O53A 3CYVA 4ZXLA 4NX0A 3T0BA 1B5TA 1YKWA 2WAGA 1P1MA 3LCXA 5EMKA 2VFIA 2UBPC 3UG4A 1QR7A 3CV6A 4G7EB 1GG1A 2OU4A 3GUGA 4JQ2A 5K9CA 1PL9A 2IS7A 3OLGA 3QC3A 4C7DA 4AG0A 1KCXA 1W1TA 3KX6A 4I9TA 1S39A 1R2TA 4WUIA 3N2MA 3ZM8A 4AD1A 2GWNA 2Q09A 4DI8A 5IDIA 1JR1A 1KB3A 2E25A 4GBUA 1PKMA 2WZHA 4H41A 5CJNA 5LHEA 4MADA 1OX4B 5A8OA 1JDDA 4EX4A 4DJED 3N19B 4X0VA 5REQB 3UA3A 1R8LA 2RDWA 5FJPA 3T40A 3UVIA 1E0UA 3GVRA 1TQJA 3ENLA 3MMTA 3WDIA 4M24A 4LNCA 3ID7A 4I7VA 1UYQA 5LHFA 4E8DA 1VPYA 2AL2B 4PMNA 1OEPA 3AYVA 4CKQA 2VURA 3CJPA 1FOBA 3C3NA 4DRSA 4D71A 5AYZA 3UXDA 3SCUA 1KBBA 1XUZA 1XIBA 2O55A 4JTDA 4QTGA 1JZ2A 4O11A 1C8XA 2PDQA 5A8PA 2UY5A 3W1RA 4JQ4A 3WY1A 4N9BA 2OGJA 2YA2A 3LX9A 2VR2A 5LA0A 3NSXA 1VD6A 2BB0A 3M0ZA 1RVGA 4UXDA 2WM1A 4HNOA 3AWOA 2WSYA 3OVGA 3COTA 3NL3A 4F0KA 4Z2LA 4FR6A 2BMBA 5IDZA 4M5PA 3C61A 3PWIA 3RLUA 4GVGA 2EGZA 2VM8A 3N9RA 4IP7A 4ZO9A 5JQ9A 4W85A 3W7IA 1F05A 4O1DA 3CUGA 3O63A 3NQVA 1EF2A 3PVFA 4WGXA 1TR9A 2QMKA 4DO5A 2QW5A 1F61A 4BHYA 1OGGA 3CYJA 3GU1A 3KVLA 4BI7A 1PX8A 1PKYA 1H1NA 3ZJ8A 4IIGA 1JYNA 2EPKX 3GTHA 1CXLA 2QQ6A 4O14A 1PYFA 3MU7A 3WLQA 1NEYA 3EYPA 4PB3A 3ITCA 2WXDM 1Z7AA 3EWXA 5E0CA 1QK0A 4JR5A 3S9YA 3PZUA 7CGTA 3UFYA 5I7GA 1V0LA 1D3CA 2OPJA 1GOIA 8TIMA 1C8VA 1W1B1 3GH7A 3EAUA 1TCDA 4W88A 3KTSA 5AKQA 1Z32X 5BRBA 3IPWA 3L5MA 1L2UA 2I5IA 5JIPA 3CUJA 1JCTA 5EPDA 4GI8A 1T96A 3ONBA 3E2VA 3S6TA 2QPSA 4O8RA 3MO7A 4RE0A 3DDMA 3G77A 3A5FA 3BPWA 2FHCA 2CZEA 2E6YA 1W17A 1HJSA 1R2RA 1PBGA 3RU6A 1SQ7A 2AAMA 2BHZA 3MI3A 2ZRYA 4NAFB 3FX4A 4JZ5A 3U7VA 1UR3M 3SW6A 3DECA 5FAJA 5A6MA 1QPKA 3LEPA 1UD5A 4XZIA 7A3HA 2NSXA 3MUCA 5CZ0A 1S5WA 4LVFA 2ATMA 4QE4A 1AJZA 1S46A 5DCBA 2PE4A 4D1IA 2AKZA 1RH9A 3DFNA 1OFAA 4AMAA 3LXBA 4Z2KA 1GJWA 2I9UA 1W5PA 2H8XA 3CWNA 3AIWA 3TZFA 2ZZ7A 4AHOA 1UZ4A 1VIZA 3FKKA 4X61A 4UQCA 3URAA 3AMLA 7ENLA 2W62A 3LS9A 3VGEA 4ZQRA 4DBDA 3L68A 4U33A 2J7HA 4IMDA 4LAOA 2PDIA 3NQ2A 1S5TA 1YHTA 3LM3A 1P0KA 2PSNA 4L9XA 4K3ZA 5AN7A 3N18A 4UR8A 1A5NC 2GOKA 3CV1A 1WYIA 4X9SA 3H2FA 4H7CA 3UR5A 2EEXA 5FF2A 4B5SA 1Q8JA 4ICMA 4LQ1A 2Z2UA 3OG3A 3B0VC 1LL6A 1XP3A 3QRHA 5GJNA 4BR1A 2Y7DA 5TBOA 3FV9A 4ERGA 1WP6A 1SFJA 4GZIA 3HPAA 4RNJA 3TP4A 3T0AA 4HPNA 2OSXA 4G56A 2E8ZA 4JFSA 3LTYA 3VUPA 3L66A 3EWBX 3VKJA 2HRWA 4LC6A 4ZQNA 5HBFA 1A3XA 4Q4RA 2VENA 2YBVA 3V75A 1MUWA 4ML9A 4NUWA 4DJDC 3LNPA 4UFKA 2PWFA 3WENA 4BF7A 1AD1A 1XBXA 3RO6A 2GGJA 4KEMA 4E4FA 1JPKA 1E9YB 4UQDA 4MWAC 3VIHA 3EA3A 2OLSA 1W3NA 5T9CE 5CBIA 4C7GA 5E5CA 1KFBA 1E1CB 4DNHA 4NZCA 2HDJA 4C1NA 4XBSA 4B5XA 5AC6A 3TTSA 1PJ9A 3PZIA 2PWEA 5AC5A 3CAKA 4OJYA 1GEQA 3WH5A 3UEQA 4E4PA 3RRXA 5KITA 2QJHA 1O5RA 1TELA 2P88A 1QTWA 3BO9A 1XIHA 3I3DA 3JU2A 1LT7A 4P7RA 4M29A 3MSYA 1VHNA 6CGTA 4ZO8A 1LLWA 3K4WA 2V3EA 1IZKA 4UTLA 3JVAA 1XKJA 3CQ0A 2QEZA 1M6JA 3E0LA 4N0RA 1RXOB 3R11A 1WXZA 4C6CA 1ZLPA 4Y9OA 4DJDA 4P7LA 4JS3A 4IGHA 4KQNA 2DT2A 3AJ7A 4LBSA 1J8VA 2OSWA 2FTWA 3S1UA 3AHXA 1VR6A 3FCPA 1W1VA 4ZQMA 4MY1A 3VO0A 4XBKA 1B1YA 1EF3A 4L64A 2EG7A 3HQOA 3B9EA 1O5KA 2QV4A 4Q8VA 1E0VA 2SFPA 4Y8FA 1FBAA 3K4DA 1JVNA 2Z28A 3QKZA 3PBMA 3VXGA 1CT5A 4JNYA 1K03A 5E9XA 4PRTA 1G1YA 2QIIA 1I4NA 3AYSA 1O5QA 3H2NA 5LNRA 2ZRVA 4B3ZA 4GCAA 3BQ5A 2VO5A 4JBRA 3T55A 1HFBA 4GC4A 2JKAA 1TUFA 4CQ9A 2XIMA 5JUVA 4WY0A 1R3VA 3OGRA 1DJGA 3VM7A 1TPEA 3SECA 4S23A 2YYTA 2H9AB 1PXGA 4FX8A 3KBJA 1IR1A 1GTEA 1QNRA 3MCMA 4LRTA 4GJ1A 1ZSXA 2JBMA 2ISDA 1H41A 5A94A 4KWSA 3VC5A 3ES7A 4GKLA 1KFWA 4JTHA 5J8LA 3QHOA 3O06A 3M0VA 3K8LA 5AHNA 1AQFA 2W27A 1XBVA 3DAQA 4H01A 6XIMA 4B92A 4B9ZA 3BDKA 1TZ9A 3NEVA 3EA1A 3MHGA 3WLSA 3G6MA 1J96A 1IV8A 2ONEA 1T40A 2DIJA 3GG8A 2DUAA 3RPTA 3T6CA 1FKXA 4D72A 1QNSA 2WB5A 2X2YA 1E15A 3RN6A 4D6FA 4RNFA 4GE8A 3E0WA 2VZTA 1QI3A 1G4SA 1IZJA 1AA1B 1WV2A 5BXTA 5IFTA 2GGHA 2QUMA 4I90A 3W7KA 2XH2A 3KOXA 3NPVA 1SPQA 3WNLA 4WR3A 4YTUA 1TIMA 4E2BA 2FPTA 4JQAA 1BVWA 1D7FA 1XLDA 4Y7EA 4LSBA 2ZE3A 3WQGA 5DQPA 1C29A 2FB2A 3L67A 1YTKA 2CHOA 5CZJA 1F6YA 1WZKA 2Q01A 5F4WA 1MQRA 2WW5A 4QJ4B 1KKRA 1X39A 3QZAA 1L8NA 1EQPA 4V28A 4NL1A 1U1HA 3MP5A 3A21A 4R9XA 4ACZB 2FMOA 3EB3A 4BZYA 3E5BA 4EF8A 3KL0A 3G8RA 4CQ8A 4ZENA 1LBLA 4IM4A 2X05A 1F3XA 1WB0A 1XPYA 2YXXA 3HQPA 3ZXWA 3SCSA 3NVTA 4AEFA 4MMWA 3TR9A 2XZ7A 3GVVA 4KS0A 3FN9A 2J27A 1XDMA 2NXHA 5GNXA 2GGGA 2XN2A 4PB4A 2XSBA 4AWTA 3CPRA 2J7EA 3FA5A 3FAXA 2FGLA 5EL1A 3RMEA 4XIAA 3MHUA 1V3KA 1O60A 4HPXA 1ZBCA 3HV8A 4IGMA 4R27A 4RZ4A 3FA3A 4R9OA 1B54A 1RR2A 4NIRA 3H54A 4PMXA 1LLOA 3TA6A 1PCWA 4ATDA 3KBMA 3TVAA 1GYNA 4JICA 2G37A 1W3IA 4A6GA 2CERA 3H8AA 1G7VA 3C52A 3C2OA 3VKKA 4XVDA 2HVNA 1VP5A 2PBGA 4MUZA 3KW3A 1E4LA 4D8LA 1W3LA 1AZ2A 4K8EA 1GWJA 1ZBVA 3BLPX 2I14A 2WKLA 1JNDA 4OU1A 2PRLA 6XIAA 4DY1A 2JGQA 3GNNA 3LCIA 1Q4WA 4JTIA 4XTIA 4CN1A 2C71A 1M1BA 1W32A 3VK5A 4TVUA 2DY3A 4YHGA 1QI5A 1E9ZB 5BOFA 4GX9A 3AXKA 1ICQA 1TIWA 4AWUA 4I3GA 2CU0A 1LWJA 4IIBA 3W23A 1Y0EA 2WLYA 5D37A 1KM5A 5HWJA 4GKTA 5HJLA 1I0DA 1UP3A 2BOGX 2OCZA 3SCOA 3U7BA 2MANA 4DAIA 1ZJHA 1EDQA 3IGSA 1B3ZA 1GW1A 3WLMA 1XH0A 2OEJA 2A7RA 1ZCOA 3F5LA 5DRIA 1Q8AA 1X6NA 4AZCA 2QCLA 2QDEA 4NG3A 4NHVA 4XIMA 4AF0A 3B0PA 2PDYA 5BNKA 3WLJA 1A5CA 5EA9A 5FEZA 1KQZA 2V5LA 2VEMA 1VQTA 1MQQA 2CYGA 2DH2A 4UB9A 3P3BA 3N15A 3S3GA 3ZQ9A 4UNKA 3HIJA 1GZJA 1G6CA 1DV7A 4CQBA 4IUGA 1Q6DA 1M3UA 4JCMA 3PS7A 1EC7A 2RGMA 2TAAA 3P2VA 3NQ6A 4IF2A 3ZWSA 5HR7A 2G97A 4ZR8A 1GGOA 3E0FA 3OGVA 3L0NA 3VINA 4JD4A 4FLOA 2X1IA 3BAXA 1V6VA 4TVCA 2X30A 3BANA 3TDFA 5I06A 1EA0A 3PANA 2PTXA 2QGYA 3STFA 4A8RA 4O1BA 1F2JA 2A21A 1ITCA 3C8FA 4B91A 3NQ8A 4DX3A 2YCIX 4S3CA 3IIXA 1MFVA 1IT7A 3QLLA 7TAAA 2V30A 4FP1A 4Q4QA 3W26A 1KR1A 4HVXA 2JEPA 4PYSA 2XU2A 4QE1A 4EIVA 1XIMA 2H90A 1JAKA 2CLHA 1GONA 1ITUA 2Z1XA 4AC7C 5I03A 4X60A 1L6SA 3LPFA 2J8FA 3LHTA 4P8UA 3C3UA 2J6VA 4QCFA 1A4LA 4OE7A 2AOSA 3DHPA 3CIWA 2Y2WA 3D3AA 1PEZA 2W63A 4PMQA 5KETA 1OC5A 2R14A 3VNMA 2AMXA 4Q7NA 3LGGA 1E5NA 3GC5A 5BOOA 2ZX8A 5I5RA 4WK9A 1HJWA 2NSOA 2VGFA 5D32A 3IIZA 3R94A 2VNCA 1PO9A 2Y7FA 3B97A 3ZVHA 3VDAA 2PGEA 1L8PA 1VFHA 2V9DA 1VEMA 2GK1B 4IPLA 2VGGA 3G0UA 1ZALA 4JX5A 2ZIDA 2EKGA 1PKLA 3AOFA 3PPGA 1EX1A 1OWQA 4QIUA 1QHZA 5G2WA 3SRDA 1RQEA 3CHEA 3PTMA 4KT2A 3LRLA 2RDXA 4L1GA 2WNNA 4CCEA 2XN1A 2DZTA 5TNVA 4HHHA 2CLFA 1US0A 2NWRA 4GC3A 3W70A 1CGTA 3B8DA 1LP6A 3PG9A 4Q8TA 2EAWA 1VEOA 3NGJA 2F6XA 1EGMA 4DLMA 4IG2B 3VD4A 4ZTYA 3DFQA 1SGJA 1FVPA 1JD7A 1M65A 2OGYA 4HCHA 5FI8A 1QW8A 4TX8A 3QKEA 1DHKA 1PVNA 1EIBA 4KCWA 3TZNA 3B9AA 2DT1A 2ZUTA 4MNLA 4DJDD 3BLFA 1R38A 4J2MA 2PTWA 4V33A 3G3MA 3P8JA 1UUQA 4FOJA 4FPSA 2YB4A 4MDOA 2KX9A 1R9YA 4NJHA 2Y1HA 4GQRA 3Q4DA 3WKZA 2P3ZA 3BSGA 3W7DA 4PUKA 2DSVA 4JL1A 1KM6A 2OWCA 2XFWA 1UWTA 2PWGA 3WNMA 3V4BA 2Z24A 4J40A 3CTLA 3RCYA 5D4YA 3T09A 1QK2A 2GLKA 1W1A1 2YLAA 1BVZA 1EXPA 4RW3A 5DANA 3IIVA 1RVKA 4PEEA 1R85A 2VC6A 1NQ6A 1A5BA 3EX1A 4KRTA 4MG4A 3IANA 2FVLA 2QPXA 5M03A 5BU6A 1NQKA 1FHLA 5D9OA 6A3HA 1YADA 3S9IA 1XX1A 2ISVA 2QV5A 1FWBC 3NO1A 3D6NA 2Z6JA 4ZOAA 4L4LA 2XN0A 2WOQA 1QDSA 1BEUA 3CAWA 1RA5A 4FO4A 3AROA 2WCAA 3QFEA 2XIBA 4L6OA 2ZRXA 3R5EA 4Q6XA 2RGLA 1PDZA 4JIPA 4MNKA 4I7WA 1UW9A 1EBHA 1BWLA 3FVDA 4PBEA 1XCWA 5E0FA 1MEWA 2VFHA 4H9VA 4IIDA 1VH7A 1O94A 4BQ2A 1KBJA 4N9DA 3B40A 3G22A 3JUGA 4S3JA 4UFMA 3QW4B 4U5KA 3H4WA 3QV8A 2YXOA 1BYDA 4RZ5A 3FHAA 5CSSA 1BAGA 1QO2A 2OX4A 4UTTA 1Q7MA 1QRQA 4UMAA 4W4QA 5F1VA 1UKQA 5G4WA 3WQEA 4AWSA 4HPJA 3HGSA 1BTMA 1H5VA 4MJ2A 1X98A 1OG0A 1ADSA 1TZZA 1WDSA 4KEVA 2X0SA 3RGTA 2WSRA 1MQPA 1JQVA 1EUNA 1YDVA 4OQVA 3GTNA 4LX4A 1JYXA 2VOMA 3WMLA 1F73A 3GC2A 3T8LA 3AS2A 3J7HA 4TOQA 3KTCA 1IIGA 4HD5A 1FY6A 1EQCA 3CB3A 3BAIA 2OXNA 3W2LA 1LWIA 1NIUA 3MUAA 5EYWA 3GXNA 3KHJA 4JFVA 2GQ9A 1TA3B 3WLKX 2ZRZA 2FHBA 4DO4A 1JULA 1FWSA 3KBVA 2J9ZA 4HP5A 3KBNA 1E5JA 4TQTA 1XCFA 3SN4A 4O17A 3VIFA 4E2VA 4JHMA 3KTXA 1H63A 3U48A 3S5NA 1G7UA 1MRAA 1VFLA 1TMHA 3NQBA 4E8GA 3W1PA 5GNZA 1QBAA 1W54A 3EXTA 3DHFA 1KLZA 1VPXA 5LA1A 5A6TC 1DWJM 4LF2A 1YNQA 2GVEA 3UR2A 3O0KA 3PAOA 3CLMA 1GVQA 4OBRA 4YLWA 1SO3A 3S1XA 2OZ3A 5KZMA 4C6FA 4AD3A 1ENUA 4CD7A 4FNQA 2W3ZA 1DJXA 1A80A 2HS6A 4GH1A 3R7MA 3AIBA 1NOFA 3GW0A 1ICPA 2O9PA 3GD6A 4AX6A 2CWNA 3VFLA 3T1GA 3U2EA 2XVGA 1R3SA 3MO4A 4TO8A 1P1XA 4PL2A 1QI4A 5CJ5A 1AQMA 2D69A 2AMGA 4XZBA 3HPZA 2WC3A 1AW1A 2ISWA 1SUXA 4OHQA 2ZA2A 3G2GA 4AX7A 4C90A 4QJ5B 1H4PA 1VIWA 3IRSA 3A13A 4X9YA 1PCKA 4F0SA 4JN8A 3UJ2A 1OD0A 3ATZA 3R4IA 1R86A 3LBOA 4H00A 4P5UA 4U3AA 2O4QA 2V67A 1Q45A 3KVJA 4PEKA 1KV8A 5D8ZA 3P60A 1HX0A 5ABHA 1BSLA 1ISZA 1V51A 4ROPA 5MHBA 3GNRA 1OINA 1W56A 1PHWA 4NVTA 2CC0A 4IL0A 2RKXA 1MMFA 3Q37A 3W02A 2DIEA 2ZZ1A 3APGA 3M16A 4BWLA 2A0NA 4C6MA 1LQAA 1XXXA 2IKHA 5DRCA 2P76A 3D47A 2BHUA 4GJIA 4YXGA 1TPDA 1JQXA 4IISA 1A5KC 1JCMP 8A3HA 3HA1A 3W7OA 2R24A 1PZ1A 3TYEA 2QPUA 5G1MA 2PCEA 4JIEA 2NUWA 3W7EA 2CPUA 4PA8A 1CXIA 1LUCA 4O12A 2A3HA 3URNA 1CDGA 3LG3A 5FSDC 2A7PA 5CZSA 3BJSA 4L4PA 1OYBA 5K4XA 3H53A 2WVTA 4R7JA 5TAOA 1U5JA 3KLKA 4XZLX 1NDZA 2QCEA 3BMWA 4IXHA 4H1ZA 3LERA 3TC3A 3GFZA 5EU9A 1PAMA 3TA9A 1ZJIA 4NJIA 3LBCA 1E6XM 5HWMA 1P5BA 2V6AA 3HG2A 3R79A 3NPWA 3H12A 3ZJ7A 2VC7A 2X0YA 4KF1A 5AB3A 1CW2A 1JZ6A 4WJEA 2E6AA 2ANUA 1YLVA 3XINA 1Q63A 1ZQ5A 4DHGA 3V0UA 1BYBA 2QCCA 3VOHA 4ZB0A 1DQWA 3VGHA 1V4YA 4X63A 4F9DA 2WCGA 3OZPA 4YTSA 3P8IA 3OGSA 5C5YA 1SR0A 1VF8A 5FESA 3SIZA 2Y88A 1UIOA 3WBXA 1KXTA 3W1MA 3NL2A 2XIJA 1UP2A 2GDUA 5G2IA 4PE8A 3SSJA 2ABAA 1LQ2A 1Q4NX 3S2LA 2XIIA 4QDWA 3NXFA 4HN8A 5ECUA 5M3WA 4XUYA 3ALGA 1DJIA 4M80A 4NKCA 2GSEA 1TJ0A 1EZWA 1J0IA 1MSSA 2ZVRA 1BG4A 5LIKX 2NLYA 3WMSA 2WNZA 1EKOA 2DZBA 1POJA 2HQAA 5EMJA 1S5MA 3GX9A 2R1LA 3IUIA 1CGUA 2EG8A 5HK4A 1DVJA 4PGLA 4CD6A 4WHBA 4JGDA 4TVDA 3LHZA 1FX6A 1LYXA 1R9XA 3IJLA 2YL9A 1F9CA 3ZJ6A 2OKOA 4M51A 1PUDA 1KCZA 3IVUA 1V08A 3VGGA 4A22A 3T2PA 1KFJA 2BVTA 2W66A 4BF9A 1B4EA 3SCQA 1TVLA 1IR2A 3A5VA 3EBVA 1SU5A 1CXKA 7PTDA 3WD0A 4JTAA 4OBSA 1VFOA 4L56A 1K8XA 2VFDA 3G1SA 5MKGA 3W4RA 1DQUA 2QJNA 4GK8A 2A4AA 2OVLA 5IRPA 4O57A 4WZHA 5JXQA 1SFLA 4OUEA 2DFAA 2J75A 3NL6A 3KM8A 1S2UA 1DQXA 1H7PA 3BG5A 4EF9A 2QDHA 4EANA 1UUOA 2Z26A 3PJWA 4PMDA 4H6RA 2YL6A 2PP0A 2VDHA 1UOKA 1QI0A 3L4TA 3O0FA 4LPCA 2J9XA 2IMRA 3SADA 4HHMA 3SURA 3PM6A 1J0HA 1OQFA 3PNUA 3WFLA 4S2CA 4OOZA 1HJQA 3OLIA 3EDEA 2EJ1A 4JQ3A 1FWAC 3GXTA 1M68A 4NAEB 4ZSTA 1UOZA 1V8EA 4L1WA 3RK8A 3VX0A 4FEZA 4MPKA 3A3HA 3IJ9A 1T8QA 3GM8A 3U3HA 1QMLA 3M0JA 4IQDA 5A8MA 3FGCA 3TCSA 4FNTA 1EUAA 1EP3A 1RQHA 4ZE5A 3A22A 1SYTA 4KCTA 2GWGA 4ZZ9A 4RLIA 1R3WA 1EB3A 3NXLA 1VAHA 3UYIA 1Q6LA 1TO3A 4W7UA 1VFMA 4BS0A 2BVDA 1S38A 5HNUA 4Q7IA 2WMGA 5I0DA 3N6JA 3VD9A 1XDJA 3T07A 5DY3A 3A4AA 1UWSA 1X1OA 4G8TA 4GYKA 1ECEA 1WXYA 3AMGA 3M0XA 3VA8A 1SW0A 1TV2A 2NX9A 2WMIA 4C91A 4KW2A 4LBUA 2E9MA 3LMYA 3UJFA 3QTGA 1G4TA 4IQLA 3QPYA 1QWKA 4PCFA 1D8WA 2AAAA 1W1ZA 3WZ0E 4GH3A 4KESA 5CZTA 3SRFA 2BOFX 3V3WA 3G3DA 5DY2A 3VILA 3U4FA 3ARXA 4LRSA 1G67A 1UQYA 4MB3A 1UD2A 3M41A 2YZRA 4MZYA 5D02A 2I17A 3BQ6A 1H7WA 1E0WA 3VC6A 3QY8A 5I6SA 2WVVB 3NQCA 4HSHA 3QC0A 3R6IA 1SO6A 3AQUA 4XAZA 3SZ8A 1TE6A 1XYBA 2HROA 3JRKA 3GG0A 1E6NA 3GZ3A 1P0DA 2XVPA 4AD0A 4O0QA 3TQPA 4HZ7A 5F2LA 1YIXA 1JRCA 3DFHA 3NYDA 5D2WA 2G3NA 1US3A 1XUUA 2XH0A 5A2BA 1ZPTA 4INFA 3MKKA 5FIPA 3OIXA 5G4HC 2WBKA 1TV7A 2CHRA 2VCBA 3NGFA 1I9CB 1JZ7A 1YXDA 4H6EA 4GBDA 4NQ1A 1LF1A 7REQB 1TPH1 4CVUA 4A3HA 2DVXA 4AU0A 3FSUA 3ORWA 3W72A 1J79A 3O6CA 1V7AA 1J2WA 3KDNA 5L9FA 2UV8G 1QBBA 3UR8A 3WFZA 4QNWA 3RHGA 4F3HA 2ACUA 1JPDX 3AMCA 3F4NA 2DSWA 2JF7A 5CJMA 4WSJA 1VBUA 4EP8C 2UY4A 4AYSA 1HIZA 3RITA 4DO7A 3DESA 2WANA 3PWAA 3FEMA 1KXQA 3W3OA 4EAYA 1XGZA 1BYAA 5FCZA 1EEXA 5IOBA 2HXTA 3GKAA 3HO8A 4Z2GA 3BJFA 2YCJA 2YIHA 3WIJA 4L4OA 2B7PA 1XJBA 3E38A 4CU8A 3NA8A 5FJOA 2WJFA 4A8LA 3OBEA 1OCBA 1UQZA 4BQ5A 3N12A 4FB7A 2I5GA 2ZDSA 2P0IA 1E6ZA 1LLZA 3ZLFA 2ZCGA 1PDYA 1TCMA 4UTKA 5I3DA 1ESWA 1KGWA 1MI3A 4UNLA 4IFOA 1VLIA 2CIPA 4MJZA 1M53A 4CEUC 3UW6A 1YE4A 4PMOA 3WD3A 1YDNA 4JXCA 3OYXA 5DT7A 4W8AA 1ZP3A 3W7PA 3WL0A 2GGEA 3W88A 2CZFA 3ZT5A 2F2HA 2GVJA 4NJKA 2D3NA 1ZHAA 3W83A 3QR1A 1REQB 2XFYA 3DGRA 1CZ1A 2QAFA 4IIEA 1DIOA 3VNDA 4EACA 2OOGA 4DYKA 3GSMA 4S3EA 3PPHA 1EFZA 5BXSA 1M7XA 3QLDA 1LL4A 4HA1A 2VWSA 2J9YA 1W3TA 3F4DA 2BG5A 2V3FA 5FJTA 5I77A 2C91A 1VFTA 3M07A 4HQVA 2B7OA 3EDJA 3Q2DA 1VFSA 1ZCCA 4OOUA 4LWWA 3OBKA 3ABOA 1E56A 4WY0B 1MW3A 1H61A 3ARVA 5D8WA 2I56A 1JD9A 1GQLA 4KCVA 2GUBA 1MDRA 4DWSD 1I2PA 4R85A 4LV4A 1BRLA 5HMFA 2B4GA 4M6QA 4ZEPA 5CEWA 2E9LA 4IUOA 4AVNA 1XISA 3LCFA 5DCEA 1E1FA 4G1KA 1KW1A 4OIFA 4POCA 5D9MA 1M04A 4MY9A 3KFTA 1S1PA 5I24A 3USBA 2OWXA 2XFRA 1OX6A 5E70A 2GJXA 1SFSA 2VX7A 2ZDRA 4DXXA 1E40A 5T8GA 2CLKA 4IPPA 3N14A 2YZ5A 4UQ9A 1FDZA 3UNTA 2PUZA 3TC7A 2OYMA 2Y5SA 4XKYA 3UWQA 4M8UA 1MRQA 1OZQA 3RR4A 3H22A 2NXIA 3BV4A 3O3RA 4C5ZA 3BLEA 4Q33A 4KFNA 3M5ZA 3HPSA 5LGZA 1JI2A 4WDXA 2PWDA 3SY5A 4JY8A 1GJPA 4H19A 3O15A 4DM2A 3SEPA 1T0OA 3BMVA 5DEZA 3DKJA 3SCRA 2DJLA 4PCNA 4C6BA 2ZQ0A 4FLRA 3GTIA 1P43A 1W5MA 2BWGA 1TX0A 1YYAA 1A49A 1JF6A 5FA5A 3A4JA 2OZ8A 5D9PA 2WJDA 3PBGA 1JFXA 1Q7ZA 1C7TA 1SFTA 2R9RA 2C7FA 2B81A 3K5XA 4RE4A 1EWDA 2OWWA 1HVQA 2PODA 4MSSA 2J77A 2O0TA 3HN3A 3OYZA 1P4CA 2RH9A 5BMWA 3OLDA 1QNPA 3SN0A 5ABTA 3CUHA 4Z42C 1VGAA 4AUBA 3HGRA 3PAJA 3PUEA 1EYEA 2Y63A 3TQVA 2CXGA 3SCVA 2QCDB 4H9XA 3KRBA 4GQ0A 4L9ZA 1F8IA 1GVFA 3EKGA 4K68A 4WJXA 3AICA 2AGKA 5CBBA 3F1QA 1SMDA 3KHDA 3W0KA 3O7UA 3CV7A 2WZIA 4L7ZA 1Q2RA 2WYSA 3R89A 4E0CA 2XISA 4GNJA 3KRZA 3N4AA 4GI9A 3FJ6A 1H1ZA 4JTUA 3STGA 1NF7A 3AIVA 3BAYA 3TN6A 3DYPA 4P8VA 3EOLA 2P0OA 4QROA 3ATYA 2VZVA 3MDUA 3WQOA 4J1OA 1J6PA 2VMFA 3P14A 4HA3A 2GJLA 4YNGA 3UYCA 1JZ4A 4RL3A 5HMEA 4GY1A 3ISIX 1WA3A 2ZTJA 4ZA0A 1RJQA 4K8HA 3DG6A 4GY0A 5HJYA 2DZPA 4QISA 1ZY9A 5AOUA 3JZUA 2O4MA 3SY8A 2PDUA 3M6YA 2X1TA 3KP0A 3VIGA 4WGHA 2OR2A 2OFJA 1OX5A 3L4VA 4EE9A 2C3ZA 4REQA 1X7FA 4GYPA 2E8YA 1XRTA 4UTUA 3L12A 1X6LA 4S3FA 1QNVA 3PR2A 3ZR6A 3QFWA 2QCMA 4UBPC 3LD5A 3OLEA 1UPPA 3AIUA 4I5XA 4F48A 5C54A 3TROA 1O6IA 5T26A 4XQ6A 3KVMA 2W0UA 3GHSA 2E40A 2HE8A 4AY1A 4B4HA 4GINA 4XZWA 3APTA 3CV2A 3DFPA 1GEHA 2XTKA 4MZ1A 3BE7A 5A69A 3EXSA 4RDYA 1K9TA 3C2FA 4FSAA 3DFSA 3GTFA 3QR0A 1VJSA 1ZZMA 2REQB 1XRFA 3UWVA 3SAZA 3AIRA 4MLJA 4W87A 3LGEA 3L0GA 4WX2A 1QASA 1ONEA 1XGDA 1EH9A 1KTCA 4UTWA 4LANA 3MVIA 6ENLA 1H5YA 3R13A 4AEEA 3W81A 2IW0A 2D23A 1NELA 4JTFA 1TQXA 3HJZA 1MNSA 4HNCA 3PNZA 2YCKX 4YIWA 3MCNA 4IIHA 1RUSA 2TYSA 5IFPA 3QV6A 4HYVA 1CNVA 1XH2A 3EWWA 3S2MA 2NV9A 1TREA 4B3KA 3QOMA 1P0NA 3DG7A 3ITOA 4IGNA 1J9YA 1GOOA 4G6CA 2VXNA 1QATA 3O2LA 1K9EA 1FWEC 2R6OA 4XSMA 4M6PA 4CGTA 3UG5A 3UY8A 4ATLA 3EWDA 2A3AA 4J3SA 3BOXA 3BG9A 2UY3A 5EMUA 1J6OA 3G0SA 4L6HA 3ES8A 3CL7A 3PTKA 3DG3A 2EG6A 4ZFCA 2VR5A 2WVUA 3ZOAA 1V3LA 4XK2A 4FLSA 1B0IA 1UKOA 3BXWA 4JTGA 4UQAA 3TC6A 4N42A 4AZIA 1EIXA 3H2MA 1UD4A 1W8SA 1XLGA 3OZMA 3T0DA 3HV9A 3W75A 3E5PA 1G4PA 4MB1A 3AHYA 3P0XA 4H7VA 3MV11 1C90A 3UNDA 4WSHA 2J8GA 3S1VA 4LVGA 1GYLA 4C6LA 4PZVA 5AZ1A 5BRPA 3PJUA 3KZPA 1A0EA 2VVNA 3KL3A 3ZIZA 2ZICA 4K7VA 2A1YA 2E9BA 5G1YA 2OJPA 1ZAJA 3DX5A 4ZFMA 2GPTA 2YPIA 3AO0A 3C56A 5C70A 4TX9A 4PMRA 3WK3A 1TTPA 3DIPA 4GHRA 4QLLA 1WOAA 3FVMA 4NJJA 2VOTA 3ITTA 4KWWA 3WDPP 1KWGA 1AD4A 3FSTA 1FH9A 4CNSA 1VYRA 4D1JA 4PTNA 5CCZA 4LTSA 4HSNA 3P7YA 3TW6A 1K7XA 4XB3A 3V0SA 2Y24A 1HJXA 4D6JA 1AZ1A 2CZDA 2D73A 2J7CA 4MNJA 1U33A 2ZE0A 4JTKA 3PPFA 2QJMA 4LUJA 2JGYA 3EMZA 3RILA 3VKDA 3TYBA 4JHZA 5EBAA 2AQWA 2QKFA 1UWUA 3S46A 3APYA 4LUSB 3LSBA 1GNXA 1T41A 3LCLA 4UR9A 4L4MA 4UFLA 4I5UA 1U1JA 4LH8A 5A6BA 3WK1A 4LUYA 2BZNA 1YPXA 5AYXA 4UWMA 4Q8WA 2IQ0A 3S6DA 3LLFA 3P80A 4TUFA 3F5JA 4PUMA 4AMCA 3BTNA 1VEPA 3FHQA 4TXEA 2QUNA 3HOJA 2QJIA 5F7UA 3ZT6A 1JIBA 3T05A 4XVEA 1WNOA 1ADDA 5IHSA 3VIJA 3C8NA 4PULA 4PSPA 4BI5A 4MYXA 5XIAA 4RZ6A 4A3YA 4M7SA 2A6LA 4RDWA 1OABA 3M6DA 6REQA 3ARTA 4NZJA 2OYLA 2D2GA 2Z4GA 1S3HA 3VMNA 1DTNA 3RM8A 3BZJA 1PSCA 2ZX9A 3QYSA 4HT3A 3V36A 1XIDA 2DDXA 2LLEA 5A8GA 4DNMA 3EKZA 1HJVA 3EPMA 1W8GA 5CKSA 4S39A 5K4ZA 3WD2A 3PPCA 3S5OA 1UC5A 1YX1A 3SY1A 2GQ3A 4FR1A 2YYUA 4YMZA 4AIOA 3VAVA 1UR4A 4FOKA 3G1HA 2ZFAA 1W3HA 3M0HA 1Q85A 2J4GA 4G7EA 3AYRA 1VLWA 1K6AA 4UTFA 5A95A 4I6KA 4B15A 2FGBA 1UKTA 3V5OA 2TRSA 1S2TA 5KSWA 4LVAA 1TWSA 3O05A 3WLLA 3RM9A 2GSJA 1UWQA 2HJPA 5GJPA 4DF0A 4F2BA 4AFYA 3BCJA 3KRUA 3N2XA 4ZQCA 2PDWA 1KR0A 1LZOA 2OZ0A 3TWBA 4RX0A 4LU0A 1GVOA 1EOMA 1WBHA 1I1WA 1KBKA 5REQA 3VE7A 1OD8A 4GZJA 2YDRA 1CX9A 4Q8UA 1UWRA 3W6MA 4QEHA 1PYMA 3PJXA 1EBGA 3VZZA 4J7RA 4F79A 1LT8A 4JX4A 4QJ3B 1DBTA 3P61A 2AL2A 3GNPA 5D2TA 4H83A 4L9YA 1GVYA 4H8VA 4LYQA 3QMRA 1JXJA 1FHVA 1LOQA 1K7FA 1FWHC 2X1RA 4JNMA 3TTOA 6PTDA 3PZTA 5J5RA 3UWUA 3GDLA 3MW7A 3S2JA 4NP7A 1HZYA 3LPOA 4RNIA 2C14A 3SO7A 4UQBA 3CPGA 2XFFA 1IE7C 2R8WA 4D9PA 2DSUA 3S6OA 3L4ZA 1YW1A 2VD8A 4S3KA 2Y62A 3D0CA 3V0TA 5IM51 3UR7A 2JIEA 3E96A 2OO6A 1MXGA 3GFXA 3NYZA 1B3WA 4P61A 1ADOA 2FH6A 3T8QA 3GFYA 1XYAA 3BMXA 1X6UA 1XC6A 3ZSSA 1K9FA 3HMJG 3GYEA 1P6CA 4GIYA 4K37A 1TJ1A 2AKMA 4B5TA 3RJXA 2GGIA 4LYRA 4N2YA 1JAEA 4C1KA 1FCBA 3W2JA 5C9WA 3U0HA 2YA0A 3PF3A 3LPGA 4Q4KA 3WUGA 3QSRA 3S9ZA 4QITA 3I6RA 3RAOA 4IMCA 1PIGA 1FWTA 3MYOA 4GIEA 3NIYA 4QE5A 4JIQA 1D3HA 1Z48A 3SQSA 4FS9A 1WZMA 1T8XA 4XO6A 3BGAA 1NFGA 5AC8A 1VS1A 4Y2WA 3I3EA 5BRQA 2D2HA 3KZSA 1B9BA 4K36A 4JN7A 3UETA 2VX5A 4XBJA 2O9RA 4AYGA 3BGJA 3T44A 1O4UA 4NT0A 3UESA 3V16A 2Q8XA 4NAFA 2UY2A 3WDQA 4HNTA 3IVTA 4PMYA 1BGAA 3ZS4A 3CUFA 3SIMA 4OZOA 4EPBC 1ML1A 1TJRA 4UMCA 4TIMA 3UZJA 2TSYA 1CXEA 1KCLA 1WBJA 1KM1A 4UZUA 3RX4A 1IEIA 9RUBA 2ATSA 1BG9A 2C15A 2VZOA 4OV4A 4EPDC 4Z2JA 3EX3A 4LY8A 3W29A 2HK1A 3IRDA 4QXIA 1HKMA 3QY7A 2PD5A 1XG4A 4EVZA 4OUIA 4ZO7A 4O0KA 1O1HA 3VMOA 5AVHA 2RDUA 4AD2A 5C9UA 1GVSA 4UMBA 3AI0A 3EB4A 3IV8A 4OECA 3AUJA 1OIMA 3UU0A 3E9AA 3UQNA 3G1YA 4DWSB 1BF6A 3UWWA 3VYLA 2P3EA 4S1FA 1I6NA 4HMEA 2OX1A 3CB8A 1NARA 2DSZA 1VFFA 3M0KA 4AZGA 2B7QA 4M6VA 2V2HA 4FX7A 4MJ4A 3W01A 3G1DA 1RCXB 4H9ZA 4M7TA 3SBFA 1KD0A 3KCOA 1E71M 5CXPA 3MZ2A 1I45A 1ALDA 1Q65A 1C93A 5G2HA 1SSGA 5ABGA 5E93A 3VM5A 5G1TA 1IXPA 1B30A 1KFEA 2YDAA 4O1AA 2DT3A 5AHMA 1YMYA 3LCWA 3QHMA 3FNDA 3AS3A 3RPMA 5AFDA 1MVYA 1PV8A 3TWAA 5CSRA 1IXQA 3IUDA 3BH4A 1ZUAX 1F4AA 1GVRA 1V6WA 1E1CA 1PTAA 4GG9A 4DBEA 4UOQA 2PDBA 3UT0A 1VZWA 4IIFA 4W7WA 1WQ5A 3BLDA 1K3UA 2RFGA 1BXBA 4GUGA 4AQLA 3W7RA 1JUBA 1JNEA 2TMDA 2Z1SA 3F4VA 3O6YX 4DELA 4B2DA 1HQTA 9XIAA 4CEXC 1ZRQA 4MDPA 5HATA 4PTWA 3HG5A 3TTEA 4GRSA 1F3TA 1ISXA 4RZBA 1XL9A 3A24A 5E6YA 3QZ6A 3NTYA 2OYKA 2ESCA 4MHBA 4PCSA 3TKFA 3CBWA 5A5WA 1UR2A 1Y5VA 3BAKA 4ADSA 1VENA 1E4IA 4ONVA 1RBLA 3MHFA 4AH7A 2J8TA 4WJ8A 1IEXA 1LRQA 3DEQA 1QFEA 3LTSA 1QI2A 3K30A 1RJPA 2WJEA 2EBNA 1AJ2A 1BGGA 4IL2A 4Z2HA 3DGBA 1W9XA 3WF1A 3QM3A 3OEXA 3R43A 2IUZA 4GYFA 4HMCA 1TX2A 2F9RA 5FEPA 4YHEA 1N8IA 4JTJA 3ZMRA 1TR1A 4LVDA 2G0WA 3IGXA 3SFKA 2RDTA 1XYMA 4MPQA 3VKAA 4D6IA 2EHHA 1X38A 3CNYA 2HWGA 1L6YA 3GBEA 4YYCA 2FMNA 1DIKA 1KM0A 1ODUA 3GH4A 3SFWA 4Y9AA 4S3BA 1OFDA 3NO5A 1OC7A 3P84A 4DZAA 3BUVA 1NDVA 2OSYA 3U57A 3VIKA 1JYVA 3N2CA 3NFUA 1W2PA 3PZMA 3GVGA 4MFDA 4H8HA 4D6CA 4EXQA 2KZHA 1P7TB 4NYUA 5JIWA 2ZX6A 5D2YA 2VQTA 3SN1A 2PFHA 1XS2A 5DN1A 2C0AA 2J79A 3W85A 1SO5A 1AQ0A 2G4FA 2H9AA 3DI0A 1EJXC 2J7GA 3SUTA 3M64A 4A3QA 5EFDA 3W86A 1H7RA 2DT0A 3LTPA 1N8WA 4WKFA 3OU8A 5DT5A 4J28A 4O8AA 4PB5A 5HDRA 1C8YA 3HMCA 4MKVA 3WMBA 1OC6A 2WMKA 1OFRA 5CGQA 3W7GA 4IMEA 2C1IA 1OADA 2CLOA 4DJFD 3IEBA 3K8MA 4DUVA 4FAMA 5CBJA 3H7VA 1JYWA 5CG0A 1XFBA 2WMHA 2XH7A 1Q5MA 2XM1A 5FF4A 4S2BA 3AXMA 3B8UA 1BLIA 1CGWA 3FXYA 3MUIA 5FACA 3MSGA 3AMDA 3OQ8A 1UH4A 4RE2A 4K2SA 3G1FA 2Z1WA 1Q6QA 1G0CA 2G5WA 1K7EA 4J2PA 3OVRA