4ZZ9A

Crystal structure of t75s mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
246
structure length
243
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYSGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 91
structure length 243
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zz9A00
2NWSA 1G7VA 3S5ZA 4O17A 4Z1CA 3NQGA 3PWAA 4JD4A 3PUDA 3ZS4A 3W1PA 3KVLA 5AFDA 3M6YA 4PEKA 2FTPA 3CEPA 1JCLA 1FX6A 1UUMA 2WSQA 3NL3A 4HN4A 3BPWA 3KVMA 4BR1A 3LRKA 2DORA 3G1DA 5KITA 5J5DA 1LYXA 1F73A 1NEYA 5LKYA 1DVJA 3TMLA 1FXQA 1GVOA 2C18A 2C16A 4ICNA 1B4EA 3L0NA 4K39A 3JRKA 4UFKA 1W5PA 2A85A 1OF8A 4IXHA 1H7XA 3VE9A 3ZWSA 2J24A 4N02A 4WQ6A 4ZVJA 1UUOA 3O06A 2PRLA 1ONRA 1L6SA 5EBUA 4IQLA 3P84A 3H54A 2AGKA 1T0OA 5DXXA 1CX9A 1W56A 3W7EA 1DL3A 5G2IA 3NL5A 3UWVA 4M19A 4QQ3A 4MOZA 1GQNA 1FY6A 1AW2A 4FO4A 5D37A 5EY5A 1N8FA 3TQ0A 2J9ZA 1ZAJA 4KWVA 4UC5A 1AMKA 3W7MA 4WOZA 4AHPA 2NUWA 3K30A 1YTEA 3GLCA 2GQAA 3I65A 3E49A 4O52A 1IIHA 4ZQNA 1YDNA 3TK7A 3IIXA 5D38A 1KLYA 3FEMA 2V2CA 3LV5A 2X16A 3HG4A 2E6DA 3NOEA 3GYEA 4LVFA 4O18A 2R91A 3NL6A 3GIYA 2ZTKA 1IXNA 2ZA3A 1FDJA 4Z1BA 3TAKA 1TRIA 3DI0A 1GEQA 2Y6ZA 1FXPA 2C14A 1G4SA 2ZRVA 2V5BA 4GJ1A 3R13A 1KFCA 4UTMA 2C0AA 3PG9A 1TIMA 1H1YA 5KSWA 5CGQA 1AK5A 1F2JA 3FJ6A 2FPVA 3LXAA 4IPIA 5K9CA 4U4MA 5DY2A 5I3FA 1BEUA 4JTIA 3QMTA 2E6YA 1OX4A 4NNAA 2H3BA 3GDLA 3GXPA 3I7SA 3TQKA 1QFEA 1TJPA 1SSGA 2GVLA 5D04C 1O94A 2F84A 1LM1A 5EMUA 5CKSA 4A3UA 4EF8A 3NNTA 3N3MA 3TIMA 3RLUA 3KRUA 3NQCA 3C56A 1A5SA 1YTKA 4CQ8A 2C1HA 3S8HA 2OJPA 3PM6A 1OABA 1G7UA 2YZRA 2P1FA 3KX6A 1O4UA 4JXCA 1X6UA 4X3ZA 1TV7A 4RV8A 2O7SA 3B05A 4PODA 3W7IA 3HO8A 3S1XA 2ISWA 2ATMA 4HSOA 2FFCA 3QQ0A 3SI9A 4B5NA 2YR1A 4N9DA 2DZUA 3IVUA 4MY9A 5G1TA 2RH9A 2QJGA 2X2GA 4JR5A 3VKJA 4O4VA 2VELA 1ICSA 4LRTA 2WQPA 3TXVA 2CZDA 3UZJA 2V30A 2YYUA 4UTIA 5LSMA 4IWWA 1LLZA 1ZFJA 3TR2A 4XKYB 1ICQA 3P8IA 1G6CA 3CPRA 2Z0IA 3ZWTA 3S9YA 3CLMA 1FWWA 1YXDA 1MEIA 5A5WA 2FB3A 1TPB1 4AAJA 4I7UA 4JNMA 1LLWA 1K7EA 1TJRA 4ORIA 3HG3A 2QJIA 2ZTJA 4O15A 3L5AA 1K7XA 4LW7A 2B7QA 5F2GA 4OGZA 2RDWA 1P1XA 1CW2A 2ZRWA 4K38A 4OBTA 4OQVA 4XQ6A 1H62A 3DZ1A 3W1NA 1H60A 3QMSA 2VKZG 4LU0A 2X1TA 5IBXC 2GUUA 1K8YA 4M6VA 1QAPA 3NM3A 1QNVA 1QCWA 4UFJA 3PY2A 1AW1A 4LC8A 4S1FA 2YCEA 3P5YA 4AWUA 1B9BA 2VFFA 3W1XA 5HNRA 1IF2A 3OG3A 1OK4A 4FXRA 4R34A 1OFDA 2QUVA 4AMAA 1TQXA 3MHFA 3EX1A 4GUIA 1I2PA 3UWUA 3IVSA 1L6YA 1WXJA 3DBPA 4JY8A 1EP1A 3S42A 2V5LA 2Z1BA 2H8XA 1AL7A 1KFLA 4KWWA 2C19A 2Y7EA 1IGSA 3QSTA 4PL2A 3C52A 4N9CA 1VLWA 1QO5A 3VCRA 5K9XA 4XZ9A 3EWXA 3EX2A 3NQVA 4TR9A 4Q33A 3LCGA 3OHIA 3BV4A 1EB3A 3NQ7A 3EEGA 5FF4A 4ZQPA 3W1LA 4WZHA 3C2VA 3LRMA 4OE7A 1W0MA 3W85A 2EHHA 3EWZA 4JIPA 5FF0A 3QJAA 4WOQA 3M7WA 5AHIA 2WV8A 5BMWA 3GNNA 4OT7A 3NPUA 5F1UA 1VJIA 4POCA 3M5XA 4E2DA 1Q6OA 1OFBA 4MPQA 4RXFA 2P0OA 3NAVA 3QW4B 4UTTA 1KM2A 2B7NA 2CLMA 2NXHA 3G18A 1TPVA 3OVPA 3RNDA 3W7GA 2H90A 2ATSA 4Z0JA 5IBXA 3PUOA 3M44A 1FCBA 3VFLA 2CWNA 2ZZ4A 3LHZA 1W3NA 1P0KA 3KRZA 3ABOA 6TIMA 1JCMP 1OFOA 3STEA 5FF3A 3GDMA 7TIMA 2EAWA 2FPTA 2QAFA 3TH6A 2ZFAA 4JTJA 3LHYA 1W31A 3ATYA 4WJEA 1NAL1 1VHCA 2GJLA 4JDYA 2C6QA 2DJXA 2BX7A 3C4UA 2G96A 4AVFA 3B8DA 1OHLA 4JTTA 4WXZA 1RV8A 4DO4A 3CC1A 1SZFA 3M16A 3PULA 1KM0A 5C55A 5BMXA 1E51A 3O6DA 3MYOA 5EL1A 3TQVA 1GG1A 4UR7A 4BWLC 3TXZA 2E1DA 1OYCA 3EB2A 3G1XA 5C6MA 4XTDA 3I7QA 2ZRXA 5AHFA 1DKWA 1OX5A 3M9YA 3ABQA 2QCDB 3QYQA 3SIZA 1EWDA 1K02A 2A21A 3RFAA 2QUTA 5C54A 2C13A 1ADOA 3LTPA 1W5NA 2OZ0A 3W1QA 5I3HA 3DFPA 4FX7A 3S1VA 2I9EA 1I2QA 1UBSA 5LNVA 4GXMA 2YW3A 1FWRA 1WDWA 2QCMA 1XXXA 1R30A 4LUJA 3L0KA 3DFTA 4WY0F 3C2RA 2X1UA 4AHQA 3L9CA 3CTLA 5AC7A 3BLIA 1PVNA 3KOFA 2Y7DA 2R14A 4EOUA 3E9AA 1TQJA 3UXAA 1X1OA 2NV1A 3W22A 3LCLA 3IIVA 1ME8A 3F03K 3L2IA 1O5XA 1GG0A 3WK0A 5K3VA 4GC4A 5AHEA 3QH2A 5AYZA 1OFEA 1WV2A 4UNLA 4O1CA 2RKXA 1VCFA 4LVGA 1IXPA 2ZA1A 3M43A 4MJMA 1SO3A 2BLEA 3HJZA 2A2IA 3PG8A 3W7DA 5K2ZA 4BWLA 3FYOA 1VS1A 3MUXA 1G69A 3W2NA 1TV8A 5F4XA 1HO1A 5ABTA 5KZEA 4PL1A 2PRMA 3NGJA 5D2XA 3WJWA 2PURA 2XN2A 4YLWA 3W1UA 4O0KA 4HSNA 3M5YA 3MW7A 1TTIA 5L9FA 2TMDA 3T4CA 3P81A 1Y0EA 1W8SA 5H2ZA 3G3MA 2CLIA 4RXGA 3B0VC 2GVGA 1KTBA 3GXNA 1YPIA 3HF3A 3UWQA 4DPQA 3TROA 1QPRA 4GUJA 4N4QA 4IGHA 4YWIA 4AXKA 1VHNA 2A7PA 2CLKA 5LHEA 3DFSA 3TW7A 2ZYFA 4QNWA 1I2NA 2ZZ3A 4JDBA 1H1ZA 1J5TA 3W3OA 4JTHA 4RX0A 1VYSX 5E0KA 4UXDA 3F4NA 3KVJA 1W5OA 2J9XA 1JCJA 3EWUA 3TW6A 3STFA 4MZ1A 1W54A 4H6KA 4FX8A 3W76A 1SFJA 3Q94A 5BNKA 1YDOA 2YSWA 3LHUA 3CHVA 1G4TA 1KBIA 3NQEA 4G1KA 1LDCA 2HS6A 1LBLA 3DFOA 3MI3A 3ABSA 2Y61A 5DBTA 5FEPA 5KINA 1LOLA 2W0UA 1SZNA 4N6FA 3HIJA 3TCEA 2VFIA 4EWND 2A6LA 5F2IA 5G4WA 4YXGA 3HQ1A 3BW2A 1GPWA 3PBUA 4NZFA 3GB6A 2NX9A 3GK0A 3O07A 2ZZ6A 4IMCA 3PSVA 4DEFA 3QFEA 3GX9A 2OT1A 1YDVA 3W7CA 1F6KA 5F4SA 3NQ2A 1LBMA 1EEPA 1DJQA 4N9BA 3W1TA 4LUIA 3IV3A 3UNDA 5G4EA 1BKSA 3MHUA 2D73A 2V0TA 2NWRA 4UTJA 3V1PA 4AF0B 3BGGA 4FNRA 2Y70A 5FF2A 3G1HA 3EWWA 4N4PA 2CFFA 3C2OA 3GAKA 3LTSA 3NZRA 3BW3A 2O7QA 2DZPA 1SZEA 1Q45A 5EKYA 1SSDA 1TPFA 3LX9A 3F4WA 4GUGA 3P80A 4HKPA 3FOKA 1KM3A 5HJLA 1WOBA 2FLIA 3THAA 3ZFHA 1KM5A 4JTUA 5HR7A 3LCWA 3NR0A 3W2JA 4JICA 4MVAA 4LT9A 4ADSA 4UR8A 5CPLA 4MYAA 3UZ5A 1DJNA 3HMJG 3INPA 4S2CA 1LROA 2X1RA 4Y90A 4QSHA 1KV8A 1MXSA 3LCFA 2Y88A 4AWTA 5AOUA 3WJYA 2VEIA 2QCCA 3L68A 3QSRA 2Y63A 3RLVA 4O13A 3W07A 1W37A 3DXIA 1TO3A 2WKJA 3C2FA 4A22A 2XN0A 4MUZA 3L67A 1F6PA 3P62A 3SSJA 4MKNA 1S5VA 3GZ3A 4TIMA 3G0SA 1UASA 1NF7A 2YDAA 1EUNA 2E5BA 4FNTA 1P0NA 3STCA 3QPZA 4XTIA 2VEPA 3W74A 1AG1O 3GVGA 3H55A 4JTFA 1O5KA 3GDRA 4MY1A 3DGRA 3LCIA 4N9EA 5DXYA 4XBKA 1XC4A 4JX6A 4MZYA 1KBJA 3R89A 1I45A 2KZHA 1PHWA 2OX1A 5D09A 1QMLA 1DQWA 3EWBX 4O0ZA 3DHFA 2DZSA 2Z6IA 3U6WA 4FXSA 2Y89A 4O19A 3RF9A 1FCQA 1ZY9A 3OA3A 3MP3A 3G1FA 4RCXA 2EGZA 2ZRZA 2ABAA 3HGRA 3LLDA 3GDTA 3HGSA 3B4UA 2QDGA 4UTLA 1HG3A 2C3ZA 3P8JA 4LOCA 4I7VA 2DZTA 2H8ZA 2QR6A 4O50A 1VZWA 3G8EA 2RHGA 2YPIA 3YPIA 5D2VA 4GBUA 1I8JA 5LNRA 3HBLA 2CZ5A 1EP2A 5CPMA 1LOQA 1YXYA 1XBZA 1KA9F 2RFGA 3NDOA 4O16A 5AYYA 2A0NA 1QR7A 1OVDA 2CLFA 2ZRYA 4UNKA 5LGZA 4GE8A 3EX3A 4P2VA 3G22A 5TBOA 3NQ6A 1T99A 3FJLA 3L5LA 4JTKA 3TC7A 1OF6A 1TV5A 2VC6A 4FHAA 3O16A 1XM3A 3BLEA 3M0ZA 4LV9A 3NA8A 4IXXA 3MO7A 3U8GA 5LZLA 3TE9A 4RKAA 2EKCA 3U2OA 4NNBA 1ICPA 4CNPA 3NYZA 1XI3A 4UFIA 5D30A 3QPYA 4R53A 1OYAA 3P74A 2V2HA 3B03A 2B7PA 4MYXA 4FNPA 1TPC1 3LLFA 3USBA 3Q2DA 1PCKA 2JKEA 4O11A 4O1DA 1WAUA 4E0CA 3A5VA 3LHTA 4LS2A 3W7LA 4UTTC 4CCCA 3O8AA 4N2YA 2JKPA 4HPXA 4UUIA 2WSRA 2DZWA 4NX5A 3P67A 3W70A 3L21A 3CIXA 4Y8FA 1P4CA 2ZZ7A 5K4ZA 1RR2A 4RZ5A 4BK9A 3R12A 5CPNA 3TNOA 3W1AA 3UY8A 4DBDA 4NXKA 1QPNA 1F76A 4JX4A 1GVFA 1TPUA 4WXYA 5KZMA 5G2WA 1XL9A 4XWUA 1NVMA 2Y7FA 3OBKA 3E96A 3IGSA 5FEWA 1WBJA 4W9TA 4UTKA 3IRDA 3N19B 3PAJA 3KRSA 2EPHA 4YL2A 5K9DA 1KV5A 1SPQA 1TYGA 2J6XA 4LC6A 4Z1DA 1H7OA 4UIOA 4O4WA 4NJKA 3W7HA 1TPDA 4RJEA 3W88A 3NZ1A 3PSWA 5F2MA 3I68A 1IXQA 3GR7A 4M7SA 5AC6A 5U7SA 1RD5A 4GRSA 3EXSA 1ME9A 5HMSA 1JVNA 1M6JA 2E68A 4MJZA 4N6EA 1JUKA 4TMCA 4FIQA 5T26A 1YTDA 4JIQA 4AEOA 3MMTA 5E1QA 3HGJA 1U83A 2FIQA 3NXFA 4IPJA 1PHQA 3OIXA 1SUXA 3G0UA 3WJXA 2ZZ1A 3W7QA 3C61A 4O53A 3UWZA 3A5FA 3M41A 5HUOA 4U28A 1R46A 5AN7A 3S1WA 5D2WA 1XBYA 2GOUA 4Q4KA 1U5JA 1JUBA 1S3HA 3MWAA 2G5WA 5CSRA 3NQMA 4HNNA 2CU0A 2V2DA 1BTMA 3M5ZA 4IX2A 1TTQA 3LI0A 1I2RA 3CQ0A 5AHMA 5L6UA 1SFLA 1JR1A 2ZZ5A 4JTGA 4UTHA 3G3DA 1PCWA 3P5ZA 1R47A 3DAQA 3G24A 5TQLA 3NG3A 4AHOA 3GKAA 2LLEA 3S5OA 4JY9A 1VYRA 1N55A 5HQEA 4CLMA 1HTIA 1AW5A 2R94A 3HPSA 1Q3NA 4QISA 1T8XA 1GVQA 4HNVA 1GVSA 4K7VA 3E0IA 1KFBA 2VFGA 3A9IA 1WOAA 5LNUA 4C1LA 1H50A 1LCOA 2PCQA 3SFKA 3TUUA 1M7OA 3LOTA 4GUHA 3BK0A 1I2OA 1W3TA 3IIPA 3D0CA 4P61A 1DOSA 3TJLA 3SZ8A 2OCZA 4O57A 4MLRA 2B0MA 3S6DA 1EX5A 3UWYA 3IGXA 2FJKA 4NJGA 4IUOA 3DU0A 1ML1A 3AO0A 4RLIA 4WY0A 3R2GA 3JS3A 3W71A 1KTNA 5AYXA 1M7PA 1QO2A 3LXBA 3LHVA 3P7YA 4MFDA 4O8RA 2YW4A 1GT8A 1V5XA 4X9SA 1R2RA 1H7WA 3NM1A 2ZA2A 2BTMA 3I6RA 1H61A 1R2TA 3MHGA 4CQAA 2FB2A 3H53A 3P60A 2WO5A 5LNWA 1TREA 1NF0A 2PE4A 1J2WA 4AWSA 3STGA 1UCWA 4K6AA 3UQNA 4DF0A 3ABRA 3NVTA 3QM3A 4XKYA 2QDHA 3W7KA 3TSDA 1H63A 1FUYA 4O28A 4A2SA 4KFNA 5F1VA 1HL2A 1SZGA 4NUWA 3CM4A 3G1VA 2ZRUA 3E12A 3O15A 5BRBA 3MJYA 1J4EA 4YMZA 3SY5A 3W86A 3EX6A 5SWUA 2V8ZA 3PR2A 5C5YA 1EPXA 2F7FA 4Y9AA 2Y7GA 2RDTA 3EXRA 4NQ1A 3CU2A 3F1QA 3P82A 1VCVA 3LGEA 1HFBA 1XBXA 3T55A 5DCEA 3LCXA 2IQTA 4NX0A 1LZOA 4UTWA 5I3JA 3E02A 2GQ9A 1TPWA 4TMBA 4C1KA 4HNTA 4I7WA 3WK1A 4QJ1A 4PA8A 3TDFA 3BARA 4FNUA 4HHPA 1GWJA 4O1BA 4TO8A 3W7JA 4NNCA 2WSYA 3N2MA 1C9DA 2XFWA 1WBHA 5I3KA 1OX4B 1JQVA 2TRSA 2DZXA 4BI6A 1LRTA 3GNDA 3TC6A 4CNOA 3V75A 2A7NA 1QWGA 5D05A 2QEZA 1RQHA 2J88A 3BVJA 2XN1A 1TPH1 4E38A 2GQ8A 3QMRA 5H91A 5G5IA 1YPFA 4WUIA 1SR9A 3PF3A 1TRDA 2WPBA 4UMBA 3UPWA 3VE7A 3S0CA 5D32A 2Q8ZA 3BW4A 3GXTA 3UYCA 2YYTA 3LM7A 3T44A 4DPPA 4JX5A 1EUAA 1QDSA 4M6QA 3LTYA 1EA0A 5EA9A 1JJKA 1IIGA 3C0JA 5AHNA 1ZENA 5LHFA 1H7PA 4FNSA 2NX3A 4RZ6A 4NJJA 4S2BA 3QC3A 5DBUA 3PBWA 5DN1A 1KFJA 5LNSA 1KFEA 3HGOA 1LP6A 1DORA 3N34A 3NQFA 3W1RA 1H51A 3Q37A 4ALDA 1FQ0A 3DENA 1OFQA 2QCHA 4EVZA 5FF7A 1JCNA 1GJPA 3BG3A 1L9WA 4MY8A 1SO5A 1EIXA 4UFLA 3TSBA 3O05A 4Z0SA 4CCDA 4DBEA 2GPTA 1CI1A 2VOMA 4LVDA 4JN6A 4K36A 1LTDA 3LRLA 1D3HA 3GR8A 4IOTA 3OEXA 1I4NA 3N14A 2R8WA 3MP4A 4JYDA 4DF1A 2YXGA 4DO6A 1ALDA 2DU2A 3BG9A 1JRBA 4JYEA 5EYWA 2VXNA 4X22A 1Q6LA 4DELA 3MP5A 2Y85A 3NL2A 4ZL1A 2ABBA 2JKAA 3FKRA 3UY7A 3C2EA 3PC0A 1H7NA 3C8FA 5D33A 1QOPA 3TFCA 1T96A 1SQ7A 1Z44A 2Q3OA 3HPZA 4YCOA 4UTUA 4LRSA 4CNNA 4LS1A 2DP3A 3L0GA 2YFOA 3EWYA 3W1MA 1YADA 2G95A 4LVBA 2JBMA 4ZQCA 3W2LA 1MZHA 2NLIA 5FI8A 3SGUA 4I9AA 3CWOX 1O95A 2QCLA 3OVQA 1TTPA 1FWSA 4EIVA 5HWMA 1WA3A 2Z2UA 1VRDA 4L4MA 1K8ZA 1NFBA 1OX6A 1S5TA 2CLEA 4K7YA 3L66A 3W84A 2QCDA 2FQIA 2C15A 4Z1AA 4XUGA 3PS7A 2I1OA 3CB8A 1M5WA 3DHDA 3O1NA 1FCVA 3TMQA 2QCEA 5D2TA 1O60A 1QPQA 1XBVA 2HS8A 3A22A 3Q58A 3PB2A 4JS3A 2CW6A 1RVGA 3IIZA 4LY8A 3MI2A 8TIMA 4OWGA 4TU1A 2NXGA 3T40A 4CQ9A 4O10A 2OT0A 4PFMA 3LXCA 1S5WA 1ZHAA 5FESA 1TPEA 4OV9A 2WNZA 1X8FA 2ALDA 4ZQMA 3IGUA 3B0PA 1SW7A 3C3NA 5D2YA 4JGDA 1GOXA 4ZMGA 4K8EA 4NJHA 4PC8A 3W23A 4GWEA 1XFBA 4QIUA 4QAIA 4AB4A 3UWWA 5DY3A 4E2BA 1QOQA 3C6CA 4BI5A 3A21A 4M6PA 1C29A 1H5YA 3SR7A 4MIMA 2CLLA 3FIGA 1FWTA 2VFHA 4NZJA 3CIWA 1TCDA 1THFD 2AAMA 4UMCA 2E09A 1KM1A 3O63A 2HTMA 2FPYA 2X30A 3NEVA 1OFPA 3FFSA 4BF9A 3W2MA 3ATZA 2NV2A 1VQTA 1HUVA 4FNQA 3W9ZA 4K8HA 4ORMA 3L65A 1XKYA 3LDVA 2E77A 1GVRA 3P61A 3UD6A 1GYLA 1ME7A 3T78A 4NT0A 2OMAA 1OFRA 4K37A 2ZDRA 3LCHA 4PCFA 4MZ8A 3NPWA 1WX0A 1BWLA 1VH7A 3RMJA 3M5VA 1L2UA 1B57A 1F05A 1VYPX 2BSLA 3JR2A 4HPJA 2QCNA 3HG2A 3DH7A 5D02A 3VNDA 1PIIA 2WNNA 1FBAA 4DO5A 3M1ZA 1DHPA 1LBFA 2FDSA 3TA6A 3PBVA 3W73A 1PS9A 1D3GA 2P10A 2W79A 3I7RA 1IXOA 4WY0B 5K4XA 5CZ0A 1UJPA 1XDLA 4A2RA 1OJXA 4ZQOA 4OU1A 2YGYA 5F4WA 5BW6A 4FF7A 4Y6GA 4IMGA 3AJXA 1GTHA 5U4NA 4Z08A 4Y96A 3L5MA 1MEWA 4X2RA 1JCYA 2QCGA 1FWNA 2AQWA 1HO4A 2J27A 1F5ZA 2TPSA 3LBCA 3N9SA 4IJBA 5IM51 1G4PA 2BWGA 1YYAA 4WX2A 1XDMA 3W87A 2ZCGA 3HG5A 3B06A 5FEXA 5E93A 1JQXA 3PUEA 3NO5A 2TSYA 3QF0A 4EF9A 4FB7A 1K8XA 2NUXA 2YX0A 1PV8A 4DF2A 3MI6A 1PL9A 2V81A 5HUPA 2A6NA 1GTEA 1G4EA 2Y62A 3CT7A 3S1UA 1VPXA 2W6RA 5I3GA 2HMCA 2B7OA 4MFEA 3GAYA 3FKKA 3RK8A 3S5YA 2NZLA 4PTNA 5KZDA 4KFPA 2QF7A 4OV4A 4NXSA 3TKFA 3MYPA 5DCDA 1X1ZA 5HR6A 3WJZA 3W7OA 3GDKA 4NU7A 4IX0A 5F2LA 4O1AA 4H3DA 1YXCA 3FYPA 3G1YA 2DJLA 4LWWA 2A5HA 2CZFA 3OVRA 2B4GA 4ZZ9A 4GUFA 4AF0A 5HWJA 4J9JA 4O12A 4ADTA 3QQ1A 3KVKA 4L4LA 3R5EA 1KM6A 4LNYA 4MLJA 1OFAA 4ADUA 2V82A 4H4IA 1K03A 4YCPA 1KW1A 1QPOA 1RQEA 2TYSA 3W2KA 1TTJA 2JGYA 4FX6M 1GZGA 2ISSA 5KTLA 3CWNA 1XUZA 3PVFA 1KTCA 3FS2A 3WK2A 3A24A 6ALDA 5CZTA 5CZJA 2ZZ2A 1RQBA 5BOOA 5HULA 5FEZA 3S5NA 3LBMA 4JTLA 2VEKA 4GFSA 3W7NA 2JK2A 4AH7A 3TU9A 5K7JA 4IMFA 3TX9A 1EP3A 2CLOA 4FIRA 3EX4A 1W5MA 1VGAA 1LOSA 1GYNA 1SW0A 1WQ5A 1SU5A 3TSMA 2UV8G 2RDUA 4NVTA 2ISVA 2ZQ0A 3DKLA 1TSIA 4KKXA 4RZ4A 1W5QA 3NPXA 1LRQA 3QEZA 3TJXA 3LERA 3HOJA 3W75A 1XCFA 3KAOA 3HPXA 1X7FA 3G1SA 1W1ZA 3W6YA 3W7PA 4OHQA 3NPVA 3NQDA 5A8GA 1PE1A 3SW6A 1FDYA 1EWEA 5DELA 1SO6A 3N2XA 1A5CA 1KFKA 1D9EA 2Q3RA 2VFDA 4R7JA 3ANYA 3W83A 5DCBA 3ELFA 3PBYA 5AHLA 3LI1A 2E6AA 2WJZA 2CLHA 2CZEA 2X1SA 4LVAA 2VFEA 4ML9A 3G0XA 4LTSA 4BFAA 1K3UA 3ZR4A 4DQWA 2QKFA 1TMHA 1OK6A 3B04A 4RK8A 5DLCA 4UTWC 3WJSA 3EKLA 1BWKA 4M5PA 4O14A 5GVJA 4LS0A 3IEBA 2HSAA 3MBFA 4ONVA 1DV7A 3CEUA 2PRHA 5CSSA 1W3IA 1VC4A 3NQAA 3BO9A 4JTEA 1P5BA 5G1YA 1JCXA 4NJIA 1Z41A 4BI7A 1H7RA 4HT3A 1A5AA 1LORA 3IIOA 3W7RA 3G8RA 2I14A 3T7VA 3IVTA 3KHJA 1JUEA 2QJHA 4UFMA 2NUYA 1Q6QA 5J5RA 2G97A 1B4KA 4GNJA 3UXDA 3THQA 1MEHA 1MO0A 4QM1A 1KLZA 4QNEA 3WFAA 3SGZA 2QAPA 1VLIA 2NX1A 5MHBA 3BGJA 1VCGA 3SECA 3EXTA 4UMAA 2Z6JA 3MBDA 4O54A 1L6WA 2QUUA 1Z48A 2ZBTA 5G2HA 1DBTA 3PB0A 4IMDA 5EPDA 5D03A 2BZNA 1JULA 5HWNA 3R8RA 1K7FA 1Z42A 2DZVA 2A1YA 5LGXA 3KXQA 3B0UX 4HIBA 3W2UA 2VEMA 4UCGA 4RR4A 3QW3A 1V7YA 5I3IA 3EKZA 2JGQA 4QITA 4R33A 2GVJA 2A7RA 3SJ3A 1ZAIA 3DFNA 3BG5A 3FLUA 1RZMA 4TX9A 4KFOA 3VI2A 1G67A 3LB0A 2J9YA 5HINA 4PH6A 3W72A 2WNQA 5C2XA 1TB3A 1AL8A 3TFXA 4JYFA 2H6RA 1SO4A 3HB9A 3DKJA 4M7TA 1UB3A 2E6FA 1SW3A 2E5DA 4FEZA 3G1AA 4DXVA 4HNUA 3TV8A 1ZNNA 1LRNA 4JEQA 2Q8LA 1FDZA 1ZCOA 3O6YX 2V9DA 3NQ8A 1YLVA 3RU6A 1MSSA 3QZEA 2BXVA 1OG0A 3DI1A 1RPXA 2YFNA 3QRHA 4D2JA 4Q32A 3N9RA 2EF9A 3TAOA 1FCUA 1XUUA 4JTSA 5CZSA 1F74A 4CCEA 5KMYA 1A5BA 3FA5A 4XBSA 1ZALA 4IMEA 1ZJIA 1N7KA 3LHWA 3UPBA 3GKFA 4A29A 1ZAHA 4UFHA 5AB3A 1KM4A 5CPOA 1VR6A 1R2SA 1JRCA 1WYIA 1OYBA 4LV4A 3KFTA 1B3OA 4ZQRA 3LV6A 3WK3A 2PC4A 3N73A 5AC8A 2VENA 4WD0A 1A53A 4A21A 3M47A 3O6CA 3DFQA 1Q6RA 2E5CA 2NXIA 1A50A 3A23A 2H3DA 2WOQA 5TIMA 1NSJA 1C8VA 2QCFA 5CG7A 2A4AA 3BLFA 2GJNA 1DQXA 1F7BA
chains in the Genus database with same CATH superfamily
2WW5A 4LFYA 4Q6XA 1IQ8A 4Z1CA 1CYGA 3VO0A 2XFFA 3WQ4A 4B9ZA 3FAWA 4KS0A 2OODA 3PWAA 5I06A 2WYSA 1V6XA 1V3MA 3KVLA 3M6YA 3R0KA 5AVNA 3QYSA 1PSCA 1FX6A 2VUNA 3NL3A 3PPCA 2DUZA 3BPWA 1UZ1A 4GA8A 2TODA 2DORA 4H83A 4GFIA 5J5DA 2VZUA 5DRIA 4ECLA 2D0GA 2HVNA 4IIFA 2E3ZA 3TMLA 5A6MA 1B4EA 1CB7B 3L0NA 4HPHA 2H9AA 1DJYA 1W5PA 3GZAA 5EBAA 3BLOA 4EACA 1H7XA 3VE9A 1TV2A 1GORA 2FGZA 2ZUWA 2XVPA 5EBUA 4LBSA 4L5ZA 1OBAA 4LUTA 3UWVA 3ARSA 2QGYA 1NH6A 3FCPA 4MOZA 1F4AA 3WQDA 2WM1A 1BFNA 5D37A 5ENLA 1N8FA 1YW1A 2J9ZA 3U0HA 1CNVA 2NVAA 4PMYA 3U4FA 2NUWA 4AVOA 4H9UA 4W5ZA 4YVPA 1XLBA 2GQAA 4US6A 2E28A 3E49A 1LF1A 2F8QA 4O52A 2QQ6A 3IIXA 4MADA 3LV5A 2V2CA 3OBEA 2E6DA 2ON3A 4LVFA 4XISA 2R91A 1RJPA 3GIYA 2VRQA 1IXNA 3VGEA 1FDJA 3TAKA 2UY4A 3HN3A 1TRIA 4GIEA 2AKZA 3R13A 3T8LA 3EOLA 3QC0A 4S23A 3PG9A 1ITQA 1H1YA 5KSWA 3CAWA 1V02A 4IPIA 4U4MA 1S46A 1VKFA 5H8UA 3UXIA 4NAEB 1OX4A 1XH0A 5CCZA 1XKJA 4HA1A 1QFEA 1TJPA 3U7BA 4HPGA 2F84A 4HCDA 5EMUA 5CKSA 2XFYA 3UG5A 1ZP3A 3OYXA 4EF8A 2CHRA 1BQCA 1YTKA 4OBRA 1B3YA 5I07A 1FFQA 1ZTVA 1OABA 1W1YA 3IJ7A 3KX6A 2OB3A 4AEFA 3LS9A 1BXNA 4RV8A 3B05A 4PODA 3W7IA 5AC4A 3LSCA 3NTYA 1UD8A 4JFWA 1LQ2A 5G1TA 4JNZA 2RH9A 2X2GA 5LIXX 1LWJA 2DVTA 3KOWA 3WCZA 5T91A 1MDLA 4LRTA 3MCNA 1U1JA 3V7PA 2V30A 5LSMA 2NQZA 4IFKA 1ZFJA 1LT8A 3TR2A 3N11A 4INFA 4O8AA 2D3NA 4FS9A 4X0NA 3S9YA 3CHEA 2WHJA 3CLMA 1PDYA 3UA4A 4AAJA 4JNMA 4FZIA 1J0YA 5F2GA 1NWSA 3KBWA 1UP0A 1UROA 4XQ6A 1G94A 8XIAA 5CH9A 3KBJA 3TLLA 1H0GA 1QAPA 3N15A 4W4QA 5FKYA 4C6OA 1UIPA 4S1FA 2P3ZA 4AWUA 1C9WA 2YXOA 4P7NA 1Q6CA 1XW8A 5HNRA 2ZX6A 3EX1A 1I2PA 1VBUA 1KB3A 5HATA 5B7YA 1IE7C 2Z1BA 1US2A 4YIWA 2XUCA 1FH8A 2NQ5A 4DX3A 1B3XA 2PODA 2D0FA 2VEFA 3PZMA 1SJDA 1VLWA 1QO5A 3VCRA 3GD6A 1V03A 3EX2A 2VHLA 3UERA 4Q33A 1MWOA 3MV01 3BV4A 1EB3A 4GQBA 4ROQA 1QW8A 1ZBVA 4XKMA 1I60A 4ZQPA 4OE7A 2BVTA 3VGDA 1WKEA 5M5DA 1UC5A 3QJAA 4Q8QA 4WOQA 2G3NA 4NAFA 5BMWA 3BAKA 4OT7A 2ANUA 3D5HA 1Q6OA 1EQCA 3IJ8A 2P0OA 1A80A 3PJUA 2NXHA 1AD1A 3QBUA 3K4WA 3OVPA 2HRWA 4YTTA 3D46A 2H90A 2O4QA 4PB3A 2ZZ4A 4RDYA 3LHZA 4ZTYA 1W3NA 1P0KA 1JCMP 3VKAA 3AAMA 4JTAA 1MFVA 1QI4A 3QY8A 1GHSA 2VD8A 1TWSA 4UQEA 3OLEA 1XG4A 4JTJA 3FSTA 2BVDA 3H6OA 4IF2A 1P43A 3DC0A 1OGSA 2GJLA 4JDYA 3GFXA 2BX7A 5EFFA 1DJWA 3VZZA 4AVFA 3B8DA 2A3HA 1OHLA 3H21A 3MSRA 1E4LA 1MQRA 1MDRA 3CC1A 3M16A 2FFIA 3MYOA 3WUEA 5I77A 2DT1A 4UR7A 5A8MA 2E1DA 3G1XA 3GTHA 3N4FA 4W89A 1IHIA 1HT6A 2ZRXA 3B9OA 5AHFA 1DKWA 2DVUA 3KLLA 3HZ3A 3ZM8A 4QEEA 3QPEA 3SURA 4WGHA 1R8LA 3SEPA 1R87A 2OZ0A 1UKSA 4MDOA 3C0LA 3WDPP 3VC5A 5JMUA 2I9EA 1YIXA 2VOTA 2WCSA 3WF0A 1I2QA 1YHTA 3KLKA 2DUAA 3GE7A 4DAFA 2EPLX 4LUJA 3L0KA 4H9TA 4NP7A 3CTLA 5AC7A 3BLIA 4P7OA 4L6OA 3IJLA 1F3XA 2POZA 3ALGA 3E9AA 3W22A 1FVPA 1SMAA 3NSMA 2QMJA 3IIVA 3F03K 2OYLA 4AEEA 5A94A 5AHEA 1WV2A 2CPUA 1V08A 3BL3A 4JQ3A 4O1CA 1DE6A 2RKXA 4OTKA 2L5HA 4LVGA 1HKVA 1IXPA 3I6EA 1Z7AA 1SO3A 2AMGA 2Q6ZA 3F2CA 3CZKA 3MUXA 3FN9A 1CENA 3QLLA 3KM8A 2OEMA 3ARXA 1TV8A 5CBJA 5ABTA 5KZEA 2PRMA 1W9VA 3CBWA 4NYYA 2XN2A 1C8QA 4O0KA 5L9FA 2CBVA 2FHCA 4KCTA 5H2ZA 4RXGA 1CXEA 2GVGA 4KESA 3GXNA 4LF2A 2CBIA 3UWQA 1QPRA 4UR9A 4IGHA 5GJMA 4YWIA 4EKJA 5ABEA 3WD2A 4IIGA 4QNWA 1W9XA 5IDZA 4JDBA 3V4BA 1KKOA 1IT7A 4XD6A 1UR2A 4UXDA 3QKEA 3T0BA 1W5OA 3HPFA 2D2HA 2GWNA 3WZ0E 4GIYA 4MZ1A 1SFJA 5T9BG 2F2KA 3CUZA 2FZNA 4XZBA 3LHUA 3CHVA 5J04A 4DLFA 1KBIA 3NQEA 4G1KA 3DGBA 2QV4A 2HS6A 3DFOA 3URQA 1XPYA 2Y61A 5DBTA 3QVQA 1LOLA 3ITXA 3T05A 1HIZA 1X39A 4WSHA 3BW2A 3SRHA 3RO6A 2KX9A 3F2BA 2HBVA 2NX9A 1QI5A 1R0MA 3CIVA 3QFEA 1CDGA 2XIBA 1SZRA 5M2FX 1EEXA 1WZKA 3SSZA 1F6KA 1RLCL 1RJRA 1XYFA 4N9BA 4H7CA 1DEDA 2FTYA 1TG7A 4E8DA 1BKSA 3MHUA 2V0TA 1SJAA 2FJUB 4AF0B 3BGGA 5DQPA 2G37A 4GIRA 4A8RA 3G1HA 3IANA 4N4PA 3C2OA 3GAKA 3NSNA 3NZRA 1KD0A 3VGBA 1Q45A 3O0KA 3GH5A 3GVVA 5EKYA 3CASA 3AHZA 3CT2A 3WMCA 3LPPA 3ZFHA 1TZ9A 3AZSA 4JICA 4MVAA 4DWSC 3UZ5A 4GBDA 3INPA 1FHDA 4OFCA 1VPYA 1PYMA 2E8YA 3H4WA 4IISA 3QSRA 1D8WA 3EMQA 3P3BA 1W37A 4EP8C 1TO3A 2WKJA 3C2FA 3L67A 4F0KA 3R0DA 4OJYA 3SSJA 2GL5A 1S5VA 4MNKA 2W27A 3GZ3A 3SUWA 1W3JA 5FD0A 2AAAA 3PFRA 3CH0A 5T8GA 1EUNA 1TA3B 4Y9OA 2QNEA 4F0SA 5EFDA 1OZQA 3KEHA 3V0SA 1T5AA 1U30A 3DGRA 2J74A 4N9EA 1EKOA 1XIEA 4XBKA 5A1AA 4J3SA 1QMLA 4AG0A 4S3JA 1KXTA 2HWGA 3EWBX 1W17A 3DHFA 4YNGA 5E0FA 1POJA 4IT1A 3W28A 3SQSA 3RF9A 2ZUSA 3CUIA 1KRBC 4RCXA 1R38A 2EGZA 2ZRZA 4FLRA 1V6TA 1JD7A 2QDGA 3P8JA 4I7VA 6A3HA 4HK7A 2PDHA 3F5LA 4IH3A 1VZWA 1L8NA 3AS3A 5IOBA 2HPIA 2QPSA 2YPIA 2I5QA 3QY6A 5CPMA 1LUCA 3CHCA 1TJ0A 1XBZA 2DIJA 5AYYA 1OVDA 5I03A 2ZRYA 1TUFA 3ARTA 2ACSA 3WIJA 3ES7A 3G22A 3NQ6A 1T99A 4JOMA 4NI3A 3TC7A 1PX4A 1V3IA 3WH7A 4LV9A 1CXLA 3VOCA 2ZUNA 1JZ2A 1OCQA 3WEZA 4E2OA 5LZLA 1Y8BA 2DSWA 4QTGA 3CHDA 2DQWA 1Q4WA 1KXVA 2PF0A 1ICPA 1LL4A 1S5NA 3QPYA 1KNWA 3I10A 2PDFA 4QJ4B 3UVIA 2IQDA 1XWYA 5HANA 3LGDA 3Q2DA 5I02A 1AH0A 2HDJA 1E72M 1WAUA 2DFAA 4E0CA 2E9LA 2BGSA 4D6DA 2QV5A 4UTTC 2HNEA 4AY1A 3IJ9A 3OLGA 4HPXA 1RLDA 4MWAD 2WSRA 3OZMA 7A3HA 3GO2A 5CJ5A 3OLDA 2QDEA 1EBHA 4DXXA 4U3AA 4WCJA 3XIMA 2QLYA 2VL4A 3B0XA 5C7VA 3W1AA 3UY8A 1F76A 5CBIA 4C6QA 1GVFA 4PUMA 1TPUA 1H1NA 3RUBL 1XL9A 1E0WA 1NVMA 1EDQA 3R4IA 1ESWA 3GC5A 4ZFMA 4DLMA 2WJDA 3PAJA 3KRSA 3MCMA 4Z1DA 3VIGA 1JEZA 4NJKA 4E3TA 1IWBA 2QGHA 3PSWA 3I68A 4FLQA 1R3YA 3AMKA 1CZ1A 1M6JA 2E68A 4MJZA 1JUKA 4QEHA 3RX2A 1ISXA 5T26A 3U4AA 1H09A 1YTDA 2RJHA 1AD4A 4AEOA 1HQTA 3EPNA 3HTWA 1EF3A 2INZA 4BKNA 5JVLA 2D23A 1PHQA 3N13A 4ZO7A 3ZVHA 3CK5A 3N6JA 1SMDA 2W62A 2YCJA 2OYMA 1A47A 1F9CA 3WJXA 2ZZ1A 3NIYA 2WCAA 4O53A 3UWZA 4UBPC 3TP4A 5HUOA 1R46A 3C86A 5AN7A 3S1WA 1HNYA 5LXEA 2OKTA 2GOUA 5AKQA 1U5JA 3M4HA 3E0LA 1H3GA 5A6BD 2CU0A 4EPKA 1UR0A 2PD9A 1TTQA 1H49A 1C7SA 4PMOA 1I2RA 3CQ0A 1JR1A 2ZZ5A 4PCPA 2QW5A 3G3DA 3GY1A 1CTNA 3AROA 1PCWA 2VGFA 3P5ZA 3WQWA 4TVDA 3QGAC 3AC0A 1GUVA 2VJXA 1NFGA 1Z6KA 1VYRA 1N55A 3OHMB 1Q3NA 5CBBA 4RUBA 3MTWA 3FSUA 2VFGA 3A9IA 5DMMA 5LNUA 4C1LA 4HD5A 1NQKA 3SFKA 3TOYA 1M7OA 3LOTA 3CXOA 1W3TA 4ZSTA 2XH0A 4P61A 1OC5A 3U2EA 4PRRA 4IUOA 4RLIA 3AO0A 4JIHA 1RCXB 2R1PA 1MUWA 4U10A 3W71A 1M7PA 3P7YA 3LXBA 3LHVA 4GYKA 3WLIA 3AXXA 4O8RA 2NT1A 3RCNA 3W6MA 3NM1A 4I9TA 1R3TA 2PDWA 3BH4A 4G7EB 1R2TA 4CQAA 2RGLA 3P60A 2PE4A 5EMYA 3E2QA 3VNMA 4PTDA 3RJXA 3STGA 3QOMA 1NP2A 3MDWA 3UQNA 3ABRA 4M3PA 1OSEA 5F1VA 1HL2A 1SZGA 4Y7EA 1LLOA 1YRRA 1J4EA 2HCVA 2FVMA 4CQBA 3ANUA 1NWRA 4B5WA 2HQAA 2OEJA 3KE0A 4L4PA 4LPCA 2XDFA 4H19A 1WDPA 3CU2A 3ZYZA 4PMUA 5DCEA 2IQTA 3THDA 4NX0A 5A6SA 2GK1A 4UTWA 3FXYA 4IG2B 2GQ9A 3N6QA 4S3GA 3LSBA 1V0NA 2ZX5A 4J2MA 4C1KA 1J2BA 4HNTA 4I7WA 4JFTA 3WK1A 4PA8A 4TO8A 4NNCA 2PDBA 4OVXA 4HMNA 1QU4A 2DZXA 3RGTA 3TC6A 3OLIA 2A7NA 2QEZA 4IGNA 3MS8A 2G3IA 2J88A 1XYBA 4E38A 5H91A 1DXFA 2O55A 4WUIA 3RM8A 1YBQB 3PF3A 1SYTA 1PKNA 4ACZB 4C6KA 4WDXA 2YZ5A 2FZBA 2YBTA 3GXTA 2WHKA 3RLHA 1YEYA 1EUAA 1ONXA 4LYRA 3LTYA 3MPGA 3THUA 1JJKA 3QFWA 3P93A 3AXKA 1DE5A 1H7PA 4FR6A 4FNSA 2NX3A 1R6WA 3AYTA 4Z1YA 2ACRA 1GQLA 5LNSA 3NQFA 3GS6A 4ALDA 3DERA 2UY5A 1OFQA 3WLRA 1GJPA 3BG3A 4HTYA 1E40A 2C1GA 4AZIA 3CQJA 3UCDA 2YCKX 3LQLA 4EPEC 3MUAA 1W1VA 3F4CA 3OB8A 3TSBA 4LYQA 4C6PA 1EC7A 3GNXA 1L2QA 3LRLA 3N14A 2BDQA 3F4VA 2CYGA 4JZ5A 2J7EA 5EYWA 4LJ3A 1Q6LA 2AL1A 2CESA 3MP5A 1S38A 2NQLA 2ABBA 4IPLA 3C8FA 2QJJA 3S2NA 4WVXA 1T96A 2O9TA 4YCOA 2DZBA 3L0GA 1BAGA 1R7OA 2WB5A 1M7JA 5E09A 2NLIA 5FI8A 2HXTA 1TTPA 2HROA 4GZIA 5CPQA 2EJ1A 3PJTA 4TTUA 1VRDA 1NFBA 1OX6A 2J77A 3N6HA 3T9PA 5E9XA 5GNYA 2PGWA 1SR0A 5HDRA 2QCDA 1U22A 2C15A 3BC9A 1ZJAA 4QCEA 1QHOA 1M5WA 3DHDA 4A8IA 1A5MC 3PP7A 2PEVA 1ODUA 5HOSA 3IIZA 1OZMA 4AIOA 3SCWA 3M0KA 4TU1A 2J66A 4O10A 3LXCA 1XQLA 4GGBA 1WKDA 3I4KA 1X8FA 4P8UA 1GVEA 2PDYA 2BMBA 2GQ3A 1SW7A 3C3NA 5D2YA 1JDFA 1MQQA 1GOXA 4I8YA 2WMIA 2P8BA 4QIUA 3E0VA 4QAIA 3GUWA 1RK5A 4JKMA 4IZGA 5CC3A 2X7VA 2VR5A 3A21A 4R27A 3KW3A 3FIGA 5CAHA 2Z1VA 1PTAA 3PWIA 1V6UA 4QJ3B 3RMEA 3HFYA 3CIWA 2XM2A 1E55A 3RJYA 4DJEA 4YTUA 2GYIA 1KM1A 3QXBA 4JQ2A 2HTMA 1PYFA 1F4HA 2GUBA 1OFPA 2F9RA 1VQTA 4K8HA 1OQFA 3L65A 1UD5A 3LDVA 3T2QA 3WNPA 1GVRA 1GYLA 1ME7A 3VZXA 3T78A 2OMAA 3O9NA 2QIIA 2ZDRA 2VDIA 1V6WA 3CL7A 4C91A 4K1GA 1PZ2A 1TWIA 1Q6GA 1VYPX 2UWFA 3JR2A 1DTUA 3QGVA 2QCNA 4KEMA 3QR0A 4EK7A 2CXEA 4TV5A 1CECA 3KTSA 3CZEA 2OTDA 4RL3A 5HXMA 1PS9A 2WMHA 4WY0B 1C3FA 4CEXC 4AD3A 1UJPA 4XAPA 7REQB 4ZQOA 3P14A 4IMGA 4DRSA 3AJXA 5U4NA 1PO9A 1MEWA 2A3BA 4X2RA 1JCYA 3N9SA 1G4PA 3DDMA 2BWGA 1YYAA 3KOZA 4WX2A 3PTKA 3HG5A 4ZO6A 4JEJA 3WL1A 4L4OA 5BU9A 3NO5A 3XINA 2P76A 4D6CA 1PV8A 3MI6A 4E5TA 3TTSA 3MUZ1 1GTEA 1LWHA 3CT7A 3S1UA 1VPXA 5I3GA 2HMCA 3UBPC 2B7OA 3NDZA 4HYWA 3RK8A 3VAVA 1JZ8A 2NZLA 9XIMA 4B3ZA 4PTXA 4NXSA 3PTMA 3MYPA 3WJZA 1EJSC 3GDKA 4IP7A 4I5RA 4JNYA 2Y4SA 4PR4A 1UWAA 2WSPA 4PTWA 1BVWA 3G1YA 1UPMB 2DJLA 2A5HA 3WLTA 4M81A 3VYLA 2XFRA 3UR2A 1OD0A 4ZB2A 4LEQA 4L4LA 2YBVA 3R5EA 2WVSA 2YCLB 4MLJA 4GQQA 2ZX7A 4YS1A 1UR8A 1MXDA 1JF6A 1KW1A 5E6YA 3VDCA 2OLAA 1QPOA 4F4RA 1K6WA 2JGYA 4E4FA 2YLAA 3F2DA 4LCRA 4AZHA 3AWNA 2GDUA 2PFHA 4GX8A 1KTCA 3FS2A 4C6EA 6ALDA 3DN5A 5CZTA 1SM9A 1RQBA 4US5A 5BOOA 3TR9A 2C91A 5FEZA 2FYMA 3S5NA 2DEPA 4XB3A 4C60A 3LBMA 4JTLA 1KC7A 4NL1A 1E6SM 4GFSA 1GHRA 3GU2A 5K7JA 3A4JA 1KBLA 5DFAA 2FGBA 4Z2KA 4IMFA 3TX9A 1EP3A 3OP2A 4L65A 4G56A 4A6GA 1QT1A 1SW0A 2Y5EA 3N9KA 3TSMA 4E4UA 2G8ZA 1KR1A 3H2MA 1TSIA 4RZ4A 3NPXA 3QEZA 1XRTA 3CYJA 3TJXA 1GPFA 3LERA 2GGJA 5FJUA 3POCA 3B8VA 3HPXA 3G1SA 1W1ZA 5IFTA 3NZGA 4J4KA 3BDKA 5C0QA 3GW0A 2NSXA 1TVLA 1PJ9A 4F0RA 1SO6A 1RBAA 1KFKA 3EA2A 3ANYA 4DB7A 4WRHA 4ACYA 1O6IA 1J01A 3LI1A 2CZEA 4FLOA 2EG8A 3ZVIA 3NUKA 1AH3A 3G0XA 4BFAA 5I24A 4NF7A 2X7WA 2BNJA 3TN3A 4RK8A 3B04A 3ZZ1A 1FA2A 3B9DA 4XZHA 4GABA 4PZVA 2VT0A 3UCQA 3PTDA 3RIKA 1W3IA 3BO9A 1IWAA 4JTEA 5G1YA 3ITGA 4NJIA 4V1YA 2YA2A 3JW7A 4BI7A 1H7RA 1QW7A 3B4YA 4HT3A 3W7RA 1UKOA 2JEPA 2OOGA 3EKGA 3TYZA 1HKJA 1JUEA 3RM9A 3OZPA 2G97A 2YJQA 5I5RA 1OGGA 4IQEA 2Z1KA 3NO1A 4QNEA 2QAPA 2NX1A 3BGJA 2OQLA 4U2ZA 4JFVA 2JE8A 1QNQA 2IXVA 3W00A 3KBVA 4QCFA 1JYXA 2HK1A 1DBTA 5A6TC 3GH7A 4HJFA 3KRBA 4Z2GA 1V3JA 5D03A 4JL2A 1FWBC 4IPNB 4S3KA 1Z42A 2J8FA 4HIBA 4DYEA 1V7YA 8A3HA 3EKZA 3T81A 2GGIA 1JFXA 2GVJA 2A7RA 3SJ3A 2DT0A 3TYAA 5C2GA 4XUYA 1M65A 1Y7VA 5EB8A 1RZMA 4HSHA 4TX9A 3MY9A 4KFOA 3VI2A 4YPJA 3OVGA 2J9YA 4LCSA 4B90A 4J3VA 2P0IA 3IAPA 1TB3A 1AL8A 3TFXA 2H6RA 4DUXA 1XLKA 1EJWC 1UB3A 3GIQA 1VEOA 4FEZA 2HV5A 2YL6A 1OCBA 4H9MA 4J3UA 2PS2A 4JEQA 1FDZA 3WQCA 3O6YX 3QZEA 1OG0A 3WQOA 3JUGA 3EB4A 3SAZA 2Z1SA 4RDZA 4D2JA 1U1UA 2EF9A 1XUUA 4JTSA 5KMYA 4NI8A 1ZJIA 3D47A 3LZ5A 3UJSA 2KAUC 3GKFA 2XIIA 4C6DA 1ZAHA 4PUDA 4H41A 4HK6A 1R2SA 1PIGA 1WYIA 3HU7A 4F9JA 4ZQRA 3H26A 1EOMA 5REQA 1QATA 2PC4A 2RJGA 5IXEA 3RITA 3FK4A 3O6CA 2REQB 4GNKB 3A23A 3SO7A 3BMVA 2H3DA 2WOQA 5TIMA 4J28A 3HQOA 3U57A 4ZXLA 1F7BA 4HZ8A 5JQ9A 3S5ZA 1HKWA 4S3DA 5HQLA 4H2CA 4JD4A 4H9YA 3ZS4A 5HNTA 3GXMA 1OCJA 2FTPA 1U33A 3WH5A 3CEPA 3VNKA 3VC6A 4AD5A 4YTQA 4WJXA 5KITA 2XWEA 3E74A 1LYXA 2AQVA 1WP6A 1UC4A 4UWMA 1F73A 2V3EA 3ZXWA 3LY0A 3U5YA 1FXQA 1GVOA 3JRKA 2DVXA 4UFKA 3ZT5A 4R7OA 4F79A 2Z00A 3ZWSA 1SVDA 4WQ6A 4ZVJA 3O06A 3UXKA 2PP0A 2PA6A 1E1CA 2J13A 4MKVA 1WB0A 3H54A 1FH9A 1T0OA 5DXXA 1CX9A 1W56A 3W7EA 1DL3A 5G2IA 1R3VA 4M19A 1GQNA 2VURA 1FP9A 6XIMA 1UKQA 1FY6A 4IQDA 3VKKA 4QE4A 4PTVA 4Z42C 4FO4A 4GH1A 1BSLA 4DO7A 1YMYA 4RNIA 1H4PA 3GC2A 1R85A 3PUGA 4WOZA 2V3DA 3DG3A 2BP1A 4LCQA 3R0UA 1XRVA 4ZQNA 1BQGA 1LT7A 3TK7A 2Y8VA 5D38A 2XH4A 3PNZA 3GYEA 4O18A 2AL2A 3SN1A 4HGXA 3HFTA 2ZA3A 4Z1BA 1YKWA 2Y5JA 4CNUA 1GEQA 2Y6ZA 4C5YA 1FXPA 2C14A 1G4SA 1K9FA 4Q8VA 1EYEA 3R43A 3PTQA 1TIMA 4WSKA 3FJ6A 3U9IA 3P0XA 4JTIA 4MGGA 3QZ6A 3QMTA 3CZLA 1FKXA 3FJ4A 4NNAA 3GXPA 3I7SA 2P5NA 5FAJA 3TQKA 2OU4A 4MDPA 5D04C 4CVUA 1O94A 3ZJKA 1LM1A 4C7GA 3AMLA 4JQ1A 3VD3A 3LBOA 3NQCA 4CQ8A 2C1HA 3S8HA 2NVCA 3K13A 2GVEA 3PM6A 1RVKA 1XQKA 1ITCA 2XVLA 4JXCA 3CZJA 5A69A 4X3ZA 3AIEA 2E67A 2O7SA 3S1XA 1VEPA 3ALFA 3PNUA 1XIGA 5KETA 3SI9A 3TEVA 2A3CA 4HJWA 3IVUA 2D2JA 4WDWA 1G5AA 3GDBA 3IJIA 3WQGA 2QJGA 3JU2A 4JR5A 1XLCA 4GY0A 2EG7A 1XGZA 4UOZA 4LAOA 2Z26A 2QPXA 4KPLA 2CETA 3B8TA 1R9ZA 3UZJA 2CBJA 1LLZA 4OECA 3P8IA 1WZMA 2ESCA 1G6CA 3CPRA 2Z0IA 2WAGA 3GU1A 3ZWTA 3M0LA 7TAAA 1VJSA 5GNZA 3TYEA 1YXDA 5A5WA 5G4HC 1XIHA 4I7UA 4ZO8A 1LLWA 2RDXA 3URAA 2QJIA 2ZTJA 4O15A 4EAMA 1K7XA 1RHCA 4NY2A 4MJ2A 1P1XA 3KCOA 4K38A 1PB0A 1DXIA 2QIWA 4ERGA 1O66A 5FJIA 3W1NA 1H60A 4DBWA 3AMDA 5EU9A 3PZTA 3ITVA 2GUUA 1K8YA 3E1F1 4HMDA 2XVKA 2PMQA 1QNVA 3WMBA 1CLKA 3POHA 4UFJA 5CSYA 3S6TA 2BFGA 5EGRA 3T2OA 2PLMA 5ABFB 2VFFA 3BCJA 1ZLPA 3QR3A 1C8XA 1IF2A 1OK4A 3MUY1 4FXRA 2QUVA 4AMAA 3N4EA 4TVCA 5I0DA 3WLSA 2VD9A 4GUIA 2ZXQA 1WXJA 4D6FA 1AL7A 1KFLA 1IGSA 1Q63A 2BS9A 3AIRA 3LYEA 4N9CA 3MQTA 3ZLGA 3DESA 4XZ9A 4F0LA 1W3KA 4TR9A 2WJFA 3LCGA 4KWOA 3H24A 3AIQA 3EEGA 2Z25A 5FF4A 5CSUA 1KCZA 3LRMA 3W85A 2EHHA 4JIPA 3GWQA 4M56A 1REQB 1A5KC 5BOFA 2NQ9A 3KS6A 3BQ6A 4A3RA 3CQKA 1V51A 5HMDA 4GYPC 5FA5A 3T09A 1UD2A 4E2DA 3M5XA 1OFBA 1VFSA 4D6IA 4RXFA 3NAVA 1KM2A 2B7NA 3G18A 1TPVA 3RNDA 4NASA 5I09A 3UZWA 4KWUA 3PUOA 3M44A 4LALA 1FCBA 3VCCA 2NQJA 3ABOA 3PN8A 6TIMA 1OFOA 4G2DA 3DEQA 3STEA 3W27A 4S38A 3GDMA 7TIMA 3TH6A 2QAFA 3OOQA 4ZB5A 5RUBA 1B2YA 3VA8A 1XH2A 5FL1A 2PWEA 1WUEA 4HPNA 4LBUA 4IFOA 1FHVA 2IXUA 4WXZA 2PDNA 4R5EA 1RV8A 2C8NA 2PLCA 3BLDA 3M07A 3GTXA 4LAKA 3TQVA 4IP5A 3R7MA 3UJEA 1RCQA 3LPFA 1NARA 1GQJA 2IKHA 5CEWA 2GGGA 4PUEA 1OX5A 3M9YA 2Y1HA 2D24A 5HPCA 4IIEA 3T0AA 3SIZA 4B3KA 3GUGA 2A21A 3UWEA 2WWCA 4IQJA 3LTPA 1Z9AA 1W5NA 3W1QA 5KZ6A 1VP5A 3KTXA 4DM2A 3S1VA 1M01A 2FMNA 2OLHA 4GQGA 3DOPA 4GXMA 4NYUA 1UZDA 1XXXA 2QCMA 1JNDA 1XYAA 2HEJA 1Q8JA 4WY0F 3WMSA 3C2RA 3WQFA 4AHQA 1PVNA 3UG3A 2Y7DA 2R14A 1HP5A 1VBJA 2NV1A 3TN5A 3PZGA 2W66A 3WK0A 3GG8A 5K3VA 1MFUA 2F6UA 3A13A 4JTDA 1DWJM 1VCFA 1Q2SA 2JEQA 2VC7A 2IS7A 3HJZA 4NKCA 3PG8A 3MCOA 3W7DA 2IKJA 6ENLA 1VS1A 3G5EA 3BCDA 1EF2A 4S3BA 1BLIA 3ENLA 5F4XA 4PL1A 2WHLA 3WJWA 5IHRA 2XSBA 2XYLA 3DYMA 3W1UA 4HSNA 4PRTA 3P81A 1BGGA 3KHDA 4L61A 1R3SA 2CLIA 4YJ5A 1OEPA 1XLAA 1PZ0A 4JHMA 4ERAA 1OD8A 4GUJA 4N4QA 3BWWA 1Q65A 3CPUA 3DFSA 2Z2BA 2ZYFA 5F7UA 1I2NA 4C6CA 4RNHA 3TTYA 3CUJA 3CHFA 2HE5A 4GVGA 4DJDA 5EMMA 2CERA 4H6KA 4FX8A 5BNKA 1U5HA 4KW2A 4N42A 4P8XA 2GFTA 3ABSA 5H8MA 4IMAA 4GC3A 2W0UA 2VQUA 3M0HA 3HIJA 1TUXA 1PUDA 4HZ7A 8XIMA 3LEPA 2HE8A 3WQ8A 3PBUA 4NZFA 3GB6A 2ZZ6A 4DEFA 5BXSA 2FTWA 3ZMRA 3FGCB 4O0QA 2OT1A 3W7CA 4BCEA 1JCTA 1JG9A 4GINA 3VNJA 1YNPA 1EEPA 2CCRA 3WX7A 1ZL1A 4AISA 1PX3A 2PDQA 3OYZA 1J6PA 3IV3A 5G4EA 3NDYA 3V1PA 4XO7A 4ROPA 4FNRA 2CFFA 2XISA 4Q4OA 1PEZA 2O7QA 2DZPA 1SZEA 1SSDA 4H00A 3F4WA 4GUGA 4HN8A 2XHYA 3P80A 1VPQA 1F3WA 1KM3A 2VEGA 1WOBA 3SQMA 1ZB5A 3VD4A 1W3HA 3ONBA 1KM5A 2YCIX 3EB3A 4UCFA 2VZOA 3NR0A 1D7FA 1FTXA 4Y9MA 4AMCA 5CPLA 3DC8A 4YVXA 2BOGX 4PN2A 3HMJG 4IM4A 3FHAA 4Y90A 1JZ4A 4QSHA 5B80A 3LCFA 3VGFA 3HA1A 1NJJA 2QCCA 3L68A 1OINA 1A3HA 3K8MA 2Y63A 4WIWA 3D3AA 3TC3A 3A4WA 4GZJA 4MUZA 3ITOA 4WK9A 3VOGA 3QTPA 3P62A 1C90A 4BQ5A 3BAXA 1ZCCA 2WMJA 4Q6JA 2QS8A 1W91A 3BAYA 3G0SA 1UASA 4PSRA 4F3HA 2E5BA 4XIMA 4X2PA 3QPZA 4XTIA 2PDKA 2XVNA 3NSXA 3WD4A 3A64A 4AD0A 5ECVA 3PPGA 3GDRA 3M0JA 3LCIA 5DXYA 1XC4A 4K68A 4DIAA 3HV9A 1ECQA 2E8ZA 2G3JA 1DQWA 3OPSA 4YTRA 3TYDA 2Z6IA 3U6WA 1CXIA 1MQPA 3UJ2A 4QXIA 4O19A 1T40A 1ZY9A 1V79A 2Q71A 3CO8A 1A5UA 3J7HA 4DWSA 1VIZA 3GDTA 4UTLA 2VZSA 2I5IA 2FMOA 4JQAA 2ZX9A 3G8EA 2RHGA 1F6YA 5D2VA 2G3MA 4M29A 3HBLA 2CZ5A 4KEVA 1GYMA 2PDGA 3WYZA 1LOQA 1UR9A 1J10A 1XC6A 4O16A 4YU1A 3TQPA 2CLFA 3B8IA 1XGDA 2VCAA 3WQEA 3EX3A 1V3LA 1XIJA 5TBOA 5ECUA 5A2AA 4G5DA 4JTKA 1G01A 2XIOA 1TV5A 5BYWA 2VC6A 3O16A 1XM3A 1XISA 4XV0A 3M0ZA 1JPDX 4TVUA 3CV6A 5I6SA 3EWCA 3WDQA 3TE9A 4TXEA 4JHOA 9XIAA 3I4EA 3A6OA 2XIMA 4J3TA 2V2HA 4LAUA 3AXIA 1A0DA 2GLKA 1E56A 2JKEA 1V0MA 3CL6A 4HA0A 3LHTA 3K4AA 3IJ6A 1S2UA 4CCCA 5CC6A 5AZ0A 2JKPA 4TV6A 4UTFA 3WF3A 4QSFA 1S1PA 1X96A 3P67A 4Y8FA 3USZA 1V7AA 1VBHA 1X98A 4BK9A 3WKZA 4DBDA 4S3FA 4NXKA 1QPNA 4JX4A 1KO0A 3H2NA 4XBJA 4XAZA 1GW9A 4XWUA 3Q67A 2WCGA 3ZLHA 4C7DA 5FEWA 4H9ZA 1WBJA 3IRDA 4MF4A 3N19B 2FH8A 3DG7A 1BG9A 5K9DA 1KV5A 2J6XA 3A4AA 1UZHA 3O3RA 3K4DA 5MKGB 1TPDA 4RJEA 4ZODA 5GJNA 3QHMA 4FF5A 1PZ1A 4YTSA 4LQ1A 4K8GA 3SCPA 2W3ZA 1GCYA 1JVNA 4FIQA 2V63A 3MMTA 1RBOB 1EGZA 1XSJA 3HGJA 5E1QA 3DIPA 3OIXA 3VZYA 1XLJA 3P6LA 4WSJA 1KRMA 1SUXA 5IDIA 3G0UA 4QDWA 3WBAA 3PZUA 4QROA 4UQDA 3UG4A 2D2OA 3QGKC 2OO6A 3KDOA 5JBEA 1YNQA 1UOKA 2G5WA 5FACA 2NSOA 1BTMA 4Q7BA 4CD6A 4MNLA 7PTDA 3A12A 2GZXA 3KWSA 3UGRA 1SFLA 4JBRA 4ENLA 4JTGA 1RBLA 1UWRA 4W85A 3RXZA 5HPOA 4PMRA 3VD5A 4AHOA 3GKAA 3LENA 4WDTA 3BSMA 2YKKA 3SCUA 1MXGA 4R9XA 1K70A 1F07A 4CLMA 4B15A 3L23A 1EX1A 2R94A 3EDKA 2GGHA 3DCPA 5EMJA 3DYPA 4QISA 1J12A 1GVQA 1YDYA 3N18A 4JAWA 3ZO9A 3VTRA 3BOLA 4LANA 1H50A 1LCOA 3BK0A 1PKMA 1I2OA 2GVYA 4CD7A 3IIPA 4QGCA 1D3CA 5DF0A 2D0HA 2C0HA 2B0MA 1EX5A 3UWYA 4NJGA 4WY0A 3W37A 3UZXA 3NWRA 4MM1A 4KEUA 1GJWA 1QO2A 5BXRA 1S1RA 3R79A 3N3TA 4LUTB 4RW5A 2YW4A 4X9SA 2ASHA 2BTMA 2PTDA 4L80A 4WDUA 2FB2A 1O7AA 4PB4A 2WO5A 1SFSA 1NF0A 2EPOA 4GX9A 4GY1A 3AIUA 4MMWA 1KGXA 4G7FA 4K6AA 4H04A 4XKYA 3MSYA 3W7KA 3TSDA 1FUYA 3W6LA 1GOQA 2WQDA 2D69A 4MAVA 4U31A 3RRXA 2ZRUA 2WZIA 3E12A 3H7RA 3MJYA 3SY5A 3W86A 2BASA 2VGBA 1G0CA 3KS5A 5C5YA 2QXWA 2F7FA 3EXRA 1UR4A 4Q4RA 3N2BA 3LGEA 1HFBA 5H6HA 2WBGA 3LCXA 1VENA 4KERA 4KRTA 2WC7A 1EO5A 3RU8X 1E1EA 2PGEA 3TDFA 1W9UA 3BARA 4FNUA 1GWJA 3W7JA 3MMUA 2WSYA 1TWDA 1WBHA 2A3EA 3VABA 2W4XA 1OX4B 1JQVA 2TRSA 1H0IA 2YA0A 1LRTA 3V75A 1US3A 3F5JA 4KRUA 3W24A 2V5JA 3LMZA 4DJED 3RN6A 3QMRA 3M0IA 3O7UA 3BZJA 4XAFA 5IFPA 3IK4A 4GO8A 3T08A 4UMBA 2PWFA 5GQBA 3UYCA 1UA3A 2YYTA 4QG9A 1X6NA 4BEQA 4DPPA 4JX5A 4LAZA 4S39A 4MPKA 2VX4A 2FGLA 3HMCA 1EA0A 3K8LA 2GJPA 4FPSA 4RZ6A 4EANA 1DHKA 3V3WA 4A4AA 1AVAA 2QVNA 1KFEA 3HGOA 1LP6A 3PJXA 2EXOA 2Y2WA 3AHVA 2EJAA 3DENA 1P0BA 1VD6A 2VWTA 4EVZA 1J96A 1L9WA 4IFKB 3KOXA 4AZGA 4M51A 3O05A 3GG7A 3EAUA 3SBFA 4CCDA 4DBEA 3ISIX 4JN6A 3AFBA 1LTDA 2Z7GA 4IOTA 4HQVA 3REQB 2R8WA 4HCHA 1PPIA 1U2YA 4DO6A 1PKLA 1JRBA 4JYEA 2VXNA 3VOIA 4DELA 2Y85A 3NL2A 4ZL1A 4Q7IA 1U1HA 2G0WA 2MUCA 3UY7A 3MVIA 4UQAA 5D33A 3TFCA 1SQ7A 1Z44A 4LRSA 4CNNA 4HNOA 5FJPA 2DP3A 3ZJ6A 3N1AA 2OEKA 5EMKA 5M17A 4XZMX 3EWYA 2J7FA 1Z89A 1MZHA 1O5QA 5A2CA 3CWOX 2PDJA 2QCLA 3OVQA 1V6VA 1T41A 4EIVA 5HWMA 4GG9A 1WA3A 2Z2UA 5C8BB 1EOKA 1K8ZA 4C1NA 1S5TA 1BF2A 3N29A 4GKTA 4K7YA 1MW3A 3OTRA 4Z1AA 2I1OA 3CB8A 3S83A 1NDYA 2HZGA 2OZ3A 2ZX8A 2YOCA 3O1NA 1XBVA 4P5UA 4S3EA 1RVGA 2UY3A 4LY8A 8TIMA 4PMVA 2NXGA 3R11A 2OT0A 4PFMA 1M68A 3S47A 3VINA 1S5WA 1ZHAA 4OV9A 1JPKA 1JGMA 3IGUA 4AX6A 4RDWA 4B5VA 4K8EA 2CNCA 2VCCA 2A3AA 1OWQA 2D2GA 4US5D 4AB4A 4J5NA 2SFPA 1ZU8A 5LA2A 2C79A 2WXDM 7ENLA 4M6PA 1C29A 3K5XA 3NXLA 1H5YA 1DIOA 3WNKA 2J62A 2X0HA 1K4GA 2VFHA 2V67A 1TVPA 1AZ1A 1UH3A 4RE4A 1KRAC 5EMLA 3VOHA 4J1OA 2EO7A 2Z1WA 2JFEX 1X6LA 5H1WA 4D1IA 1E0TA 3FFSA 3ZSSA 2NV2A 1VBGA 3W9ZA 5LA0A 2E77A 4NT0A 4R9OA 3U2CA 4AZ5A 2VRKA 1K9DA 1E6XM 3DFYA 4PCFA 4PFHA 4D8LA 4MZ8A 2NQHA 1EC9A 1WX0A 1VH7A 3FDKA 1CGVA 3RMJA 3M5VA 1LG1A 3UXLA 5CG0A 1L2UA 1B57A 2BSLA 2PCEA 1ZS2A 1PXGA 4Q8WA 3DH7A 3ARWA 1OADA 2BXZA 3VNDA 1ZSXA 1HW6A 4DO5A 1DIDA 3WBXA 1LBFA 4OBSA 1TWZA 1I75A 3W73A 1D3GA 2P10A 2W79A 1IXOA 5K4XA 5CZ0A 1XDLA 3CLWA 2YDSA 4A2RA 3SCSA 3GG1A 4OU1A 5F4WA 5BW6A 4FF7A 4UQ9A 4Y6GA 4Y96A 4ASTA 3L5MA 2NVDA 2AQWA 1HO4A 2J27A 3LBCA 5IM51 4IJBA 1M3UA 4DVOA 4AIEA 4CD5A 5FEXA 1BF6A 5E93A 2TSYA 3QF0A 4DZIA 1K8XA 3WD1A 5MF5A 1PL9A 3AYVA 2Y62A 2W6RA 4I6KA 1UBPC 4AZ7A 3FKKA 1K77A 4L1XA 4NIRA 5LIYX 4OV4A 1X1ZA 4IX0A 5A2BA 5C9UA 1EZWA 5FOOA 5F2LA 3WLJA 3CAVA 2HVMA 1E0UA 2CZFA 2B4GA 4QLJA 1Y5XA 1EJTC 3THCA 1K9EA 4DNMA 4ADTA 2QYGA 4L6HA 4GLEA 1KM6A 2WHMA 1UA7A 1V3HA 1K03A 3IAQA 3H4GA 2ZVRA 3PJWA 1M7XA 1EXBA 2DV0A 2RGMA 4YVVA 4W93A 2JALA 1NFPA 2EQDA 2ISSA 2CBUA 1XUZA 2YL9A 1HN1A 3PVFA 1FWGC 3UR5A 2ZWYA 1GK8A 3A24A 4EX4A 3ZJ7A 1VEMA 2PTWA 1JDCA 4A3QA 3SJNA 2JK2A 1B3WA 2X1IA 4CKQA 3QHOA 4HOZA 4FIRA 2CKRA 3ARPA 5XINA 4ZFCA 1WQ5A 3TYUA 4NVTA 3GH4A 2ZQ0A 3DKLA 3GHUA 1P1MA 1QRQA 4KKXA 4NG3A 1R5YA 2ZADA 4L7ZA 3W75A 1XCFA 1O1ZA 4HMCA 1VB9A 3NQDA 1VFTA 3TOPA 3N2XA 1SFTA 1J6OA 3CUHA 2R82A 2Q3RA 3W83A 4GXWA 3PBYA 5AHLA 2E6AA 1E0VA 1JZ3A 2X1SA 4ML9A 2GJXB 4LTSA 5LXXA 4DQWA 2QKFA 1OK6A 3KCLA 4UTWC 3WJSA 2FZDA 3EKLA 4ZB0A 1BWKA 3A3XA 2ZXDA 2RAGA 4O14A 3H8AA 1NELA 3CNYA 4WHBA 4QJ5B 3OJGA 3OA5A 4YYFA 3L4UA 3CEUA 2HXUA 2PRHA 1AUSL 1TIWA 4EPDC 2I5GA 3GFZA 2ZUUA 1JCXA 5C9WA 1QNPA 3CTTA 3IIOA 3LU2A 1XPGA 2I14A 1NDWA 1ZPTA 4L9YA 3ZT7A 2I16A 2YL8A 3WLLA 2NUYA 4JTQA 3S2MA 3TTOA 1B4KA 4GNJA 4QM1A 3BUVA 2J7DA 3SGZA 3WFAA 1VLIA 3O0FA 1J11A 1EZ2A 5LIWX 3SECA 3P0WA 3SCTA 1ISYA 4CNTA 3MBDA 3H2FA 2WVUA 3AMCA 1L6WA 2QUUA 2ZBTA 5G2HA 3PB0A 3E2SA 4IMDA 1JGIA 5EPDA 1PDZA 3PZQA 4DAIA 2FVKA 3WMLA 5TF0A 2XGIA 2OZTA 3KXQA 1BGAA 1BRLA 4AZCB 3GXIA 4DI9A 3AYRA 5I3IA 2VR2A 3NOYA 1FWFC 1Z32X 1MW1A 2BY2A 2YIHA 1ZAIA 3FLUA 2B31A 4U5IA 4V33A 2GSJA 4GZEA 1G67A 1NP0A 1RY8A 2WNQA 3IPWA 1V0KA 2VRJA 1NTHA 1SO4A 3NQBA 3BQ5A 4FAMA 3AHYA 1UD6A 5FJOA 4W8AA 1X38A 1EJXC 1E15A 3TV8A 1QHZA 1LRNA 2PLKA 4FR1A 2OSXA 1LUCB 2Q8LA 1Q8AA 4KETA 4F9DA 3NQ8A 4A35A 1MSSA 2BXVA 1RPXA 1Q13A 2CWXA 3MUIA 4Q32A 3N9RA 3WG6A 1WCGA 4CCEA 2V38A 1AJ2A 1ONWA 1TR1A 1I9CB 4XBSA 4XZIA 1HXJA 3I3DA 4YN5A 3D3FA 1L6GA 1JRCA 4LV4A 1B3OA 2G3FA 3LV6A 2F6XA 2PDCA 3N73A 1PBGA 2EPMX 1RH9A 4A21A 3M47A 2NXIA 3CUGA 3VNIA 4H8NA 4H7VA 2DQXA 4N7QA 2WK2A 4A8NA 2QCFA 4FOJA 5CG7A 2A4AA 2PWHA 2GJNA 1FWSA 4TTGA 5FSEC 5AYBA 4XD3A 2NWSA 3VKBA 4O17A 3TWBA 3FV9A 3IS4A 5KEZA 4I6VA 1B30A 3PUDA 3W1PA 3VOJA 1K8CA 5AFDA 4XSMA 1PKYA 1QHPA 2CITA 4JN7A 3U7VA 5BRQA 4CVWA 2Y5SA 4HN4A 3KVMA 4BR1A 3LRKA 3SB0A 3G1DA 2WZEA 3Q45A 3VM7A 1NEYA 5LKYA 1BYCA 1PWMA 3GNPA 1Y5VA 1OG6A 2C18A 1EPVA 4K39A 1XYMA 1KXHA 5ABGA 5BOEA 4IXHA 3VNZA 2ZDSA 2J24A 3CV1A 5JUVA 2PRLA 2O4MA 1L6SA 2PPGA 3KL0A 4IQLA 3P84A 5M03A 3PWGA 4CGTA 3DECA 3NL5A 1CGTA 4HP5A 3GW3A 1AW2A 2YXXA 4NZ5A 4UC5A 1AMKA 2W61A 3W7MA 4AHPA 3ZVHB 1IIHA 1RCOB 4PUKA 1UKPA 2YBUA 1KLYA 2X16A 4CU6A 4HYRA 3NOEA 4PMZA 3NL6A 4AIBA 1KCXA 3KWXA 3GVQA 3VDGA 4AWEA 3H23A 3DI0A 3GYCA 4YYCA 3MO4A 1R3QA 2ZRVA 2V5BA 4GJ1A 3CWHA 1KFCA 2A3LA 2VVNA 3T0DA 4ZBCA 2C0AA 3C5QA 2ZC1A 4D72A 4MWAE 3PBGA 4W8LA 3UJRA 5CGQA 1F2JA 1ISWA 3BSGA 1ADSA 4P8VA 4B91A 1KFWA 3LXAA 3VM5A 3S46A 3WFZA 3HURA 1BEUA 1E1FA 3RYSA 4LBRA 5HNUA 3MZ2A 2ZWZA 1UD4A 3VOFA 2J79A 1XRSA 2DW7A 5AECA 1OY0A 3L4WA 4X61A 2OOFA 5CJNA 3GDLA 1CBGA 1SSGA 5C7HA 2GVLA 1QPKA 4MJ4A 1J8VA 4GH3A 5A8OA 9CGTA 3NNTA 3UVAA 3N3MA 2Q02A 3QTGA 3CV7A 3RLUA 4LAMA 1A5SA 1ZBKA 5I7GA 2OJPA 4E3VA 3WUGA 1G7UA 2YZRA 4LF1A 1X6UA 3FAXA 1BYBA 1TV7A 2YDRA 3HO8A 4HSOA 1J0HA 4H9XA 4FOKA 1E71M 1MVYA 3QQ0A 4W7VA 4B5NA 4N9DA 3RX3A 4AY7A 2DZUA 4MY9A 3H4XA 2W92A 3EMZA 1OIFA 2PP1A 3VKJA 5C9RA 1BPLB 4O4VA 4YHEA 3LUTA 2WQPA 1EYWA 2CZDA 2BHUA 2V3FA 2YYUA 1UR1A 4UTIA 4WKAA 2CHNA 3A3WA 3KBNA 1ICQA 1CB2A 5DANA 2NLYA 1WPCA 1WXYA 4LEFA 3ME3A 3VIIA 1MEIA 2F6KA 2E4TA 3T42A 2VI0A 1K7EA 4ORIA 3HG3A 4PMDA 1S2CA 3TW9A 4A05A 4LW7A 1DJZA 4OGZA 2RDWA 1CW2A 4LX4A 4OBTA 4OQVA 3UEQA 1DIKA 1FWEC 2PBOA 3DZ1A 3IUHA 3FJNA 4DBUA 2GK1B 3QMSA 2VKZG 4C65A 1CLVA 2X1TA 5IBXC 4IFRA 3GXDA 1IEWA 3NM3A 1HVQA 1QCWA 3PY2A 4RPQA 1ITUA 1B9BA 1AMYA 1I6NA 1ZGDA 5CGTA 3W1XA 4EPBC 4RZBA 1H11A 2VX5A 3F5KA 3MHFA 1IZKA 5D9MA 8RUCA 1O68A 1O5RA 3UWUA 2DPEA 4JY8A 3GBEA 3MUCA 3S42A 2V5LA 4GD0A 2H8XA 4JTRA 4DZAA 5JH2A 4KWWA 2WMGA 1W9DM 3JVAA 3C52A 1VBRA 4ZCWA 3RR4A 5K9XA 3EWXA 2WWDA 3OHIA 4J7RA 4AC7C 1Y65A 1HZYA 3NQ7A 5DMNA 4QS5A 1ZUAX 4UZUA 2VWSA 4M6UA 3W1LA 4GMEA 5M1TA 3C2VA 6CGTA 3EWZA 4PUWA 3LM3A 5FF0A 4IIHA 3M7WA 1A0CA 2WV8A 3BLKA 1E6QM 1I0DA 5D8WA 5BWFA 3GNNA 1VJIA 3R8HA 1JYWA 4HK5A 3QW4B 5FJRA 1XYZA 3MC5A 1BTCA 4DJDD 4HHHA 1RAKA 2HJPA 4TQTA 4LUYA 3VFLA 2BOEX 5JBFA 1A0EA 3B9NA 3KRZA 4AYSA 3UA3A 2Y8UA 2Y0FA 2EAWA 4F2TA 2FPTA 3UGVA 3LHYA 1W31A 3ATYA 4WJEA 3M7SA 1MYRA 3LK6A 5AYIA 3ICJA 3C4UA 1XRFA 4PTMA 3AUOA 1P7TA 4JTTA 3OGRA 4HTBA 1CXHA 1AQFA 4DO4A 1XS2A 6TAAA 1SZFA 1KM0A 4HOXA 5C55A 5BMXA 1E51A 4C6LA 3R58A 3IGHX 1QK2A 1UWSA 3O6DA 1C92A 4JN8A 1HKIA 4BWLC 1QOXA 3CH9A 5D8ZA 3OGVA 4KBXA 1OYCA 1T7LA 4G8TA 5C6MA 3AQUA 2PC8A 4XTDA 5BRPA 3I7QA 1EFZA 4W87A 5HJXA 3QOKA 3ABQA 2QCDB 2DT3A 3QYQA 4WEVX 3RFAA 5LYRA 4NZ3A 2IW0A 2QUTA 2ICSA 5C54A 1ADOA 3VMNA 5I3HA 3DFPA 1R9XA 1FWIC 1EJ7L 4DM1A 4FI4A 7ODCA 3S2JA 2YW3A 1NQ6A 4W86A 2J7BA 1FP8A 4OKDA 2X1UA 3L9CA 1S2VA 1ONEA 1VFUA 3KOFA 1A4MA 1ZBWA 4EOUA 1X1OA 1QI3A 2RUSA 3LCLA 1HL8A 2WMIB 3L2IA 1GG0A 5BU6A 1F3TA 5AYZA 4AU0A 1OFEA 2OSWA 1GOWA 4XVDA 1R3WA 3PPHA 4UNLA 4U5KA 2ZA1A 3FA4A 3M43A 1UHVA 2A2IA 3I3BA 4BEUA 3WLPA 1AH4A 3FYOA 1G69A 1W6TA 4W5UA 1HX0A 3EWDA 5GNXA 1HO1A 4ZGYA 1S39A 3VXGA 3VK5A 3G6LA 3NGJA 5D2XA 3TZFA 4ZXOA 2WNWA 1B1YA 3B0YA 4UZSA 4YLWA 4NZ1A 3M5YA 3MW7A 3UW6A 4IP4A 3DX5A 1UR3M 2X0SA 4HHLA 3B0VC 4A3YA 1JZ5A 1YPIA 5MKGA 2PLJA 4AXKA 2AOSA 4PUUA 1IZCA 4AD4A 3VIMA 1VHNA 2A7PA 2CLKA 3TW7A 4DWSD 1XIMA 4BQ4A 3VGGA 3W3OA 5E0KA 3R8GA 3F4NA 3WFLA 3HQPA 1AODA 3EWUA 5LA1A 4WKHA 3STFA 1W54A 4AYGA 3Q94A 1YDOA 3DHUA 4D71A 1G4TA 4Y8EA 1N8IA 4E4PA 3MI3A 1LBLA 3WNNA 3GQYA 3SADA 3MWCA 4KGLA 5KINA 1SZNA 4N6FA 4EWND 2A6LA 2CEQA 5F2IA 3HQ1A 1GPWA 2E9BA 1C93A 3GK0A 1WO2A 4XD4A 3PSVA 1E9YB 1WDQA 3SGGA 3GX9A 1YDVA 3E0FA 1IEQA 1I0BA 4C6JA 4RE3A 1DJQA 3AIVA 4JL1A 4LUIA 2ACQA 2JIWA 1UOZA 1KRCC 3UNDA 2YB1A 3VCNA 2NWRA 3GM8A 4UTJA 1W1TA 1NY1A 1QW9A 4PCSA 2Y70A 5FF2A 4PE8A 3DUGA 6REQB 3LTSA 3BW3A 3NYDA 4QG6A 4F40A 3B3DA 3LX9A 2BB0A 4HKPA 1MW2A 5FAGA 2F2HA 1JAEA 4J3WA 3LCWA 1X97A 3W2JA 4GVHA 4ADSA 1ISVA 1LROA 2X1RA 2UY2A 4UNIA 1KV8A 1NIUA 5CC7A 4AWTA 5AOUA 4M8UA 3WJYA 2VEIA 3L4ZA 3S4TA 2PWUA 4B5XA 3K2GA 4O13A 3W07A 3G1RA 2OGYA 2BHZA 3DXIA 1EJUC 1LG2A 4DN1A 4REQA 4KF1A 4GCXA 2PB1A 3KL3A 4GIAA 1F6PA 4L1WA 3UNTA 3S2LA 4MKNA 3WENA 4TIMA 4XZNX 3BOXA 2VZTA 2I57A 3STCA 1P0NA 3ITTA 4ZE4A 1JDEA 3Q4DA 2DDXA 1YPXA 3UG8A 2OSYA 4JTFA 2OQYA 3EBVA 3DHPA 1V0LA 4MY1A 1W32A 4V15A 3ARRA 1SGJA 4C5ZA 3BAIA 4MZYA 1KBJA 3R89A 2KZHA 3UT0A 4O0ZA 2QMKA 2DZSA 1W1A1 1GZ1A 4ATDA 1FCQA 3ITYA 4PUJA 1BXCA 4XD5A 3T6CA 4GI4A 3MP3A 1MZRA 1P0EA 1UWQA 4E6MA 3B4UA 2C3ZA 3OODA 4AXNA 4LOCA 4C6BA 4DZHA 3WD3A 1WKYA 1U5VA 1XLHA 4TUFA 1KQYA 3WN6A 4GBUA 1I8JA 3VKCA 4IJRA 1UQYA 1A3WA 1YXYA 1KA9F 2RFGA 2Q09A 2Z27A 3GIPA 1QR7A 3V36A 5LGZA 1L0PA 4GE8A 3M0YA 4P2VA 3RG6A 2HBXA 3GR4A 3L5LA 1OF6A 3IV8A 5E0CA 4FHAA 4DWDA 4LSBA 4CU8A 3U8GA 1QI2A 5CC5A 3WBEA 4EXAA 5JH1A 3VX1A 3U2OA 4HNCA 4NNBA 1FRBA 4R53A 4DI8A 1OYAA 3P74A 2P88A 4MYXA 4FNPA 3REQA 3USBA 1PCKA 1D2KA 4O11A 4J2PA 4O1DA 5BROA 3RM4A 1J0ZA 3BICA 5TNVA 4AD1A 3A5VA 4LS2A 3W7LA 1XYLA 2OR2A 5GJPA 3OQEA 4PB5A 2DZWA 4G6CA 3DBNA