5BMXA

Crystal structure of t75n mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYNGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 98
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bmxA00
1GTEA 2VFDA 3KVKA 5EY5A 4JX4A 3BW2A 3L5LA 1FXPA 1I45A 4HIBA 2OX1A 1K8XA 4LRTA 5FF3A 3SSJA 2PRLA 4MYXA 3LOTA 4GUIA 5HQEA 1SW3A 3N2MA 2PRHA 2WSRA 3W23A 2CLIA 4MY9A 3GX9A 2CLLA 3DHDA 5DCBA 2KZHA 4ZL1A 2V5LA 3OEXA 4AMAA 1PS9A 3SGZA 1FCVA 1OK4A 1TPDA 5EBUA 5AYXA 3HO8A 3O6YX 3QC3A 2P1FA 4C1KA 3TSBA 1KFCA 1QO2A 1YYAA 2C0AA 2Y7FA 4R33A 3RFAA 3W7RA 3LCGA 1X1OA 2X1TA 3N73A 3W2MA 2VEPA 3UNDA 4RKAA 3W83A 3MMTA 5CPMA 3SECA 4PH6A 4LRSA 2GQ8A 1L6YA 3QMTA 1VHCA 2I14A 5LNSA 1HG3A 2PRMA 1JQVA 1T96A 5K4XA 5AYYA 1T8XA 3P84A 4CNPA 3NM3A 5F1UA 2IQTA 1KFJA 1Q3NA 1W3NA 2JGYA 3ZS4A 4LVFA 1AW1A 3S5ZA 1TPB1 2BSLA 2QAPA 1MSSA 1JRCA 3OVPA 3UZ5A 1WA3A 1M6JA 3DHFA 1H7RA 4WOZA 4MVAA 1N7KA 1TRDA 4O4WA 3QW3A 5AC6A 5KZMA 4RJEA 4LS1A 5HR7A 4UIOA 3SGUA 4H4IA 2V9DA 1LCOA 1G4EA 4M6QA 5K4ZA 4N4QA 3TK7A 4UTTC 4FXRA 2YPIA 1VLIA 1KM3A 1F5ZA 2ATMA 4XUGA 4DQWA 2CZ5A 1ZJIA 3MUXA 2J24A 2E77A 5G1TA 4BK9A 2DJLA 3TXZA 1W5QA 4OBTA 4ML9A 1X6UA 3P61A 5F2MA 4TMBA 3NQ2A 2V2CA 3W85A 3TSDA 3MBDA 4LY8A 4NNBA 3B0PA 1F6PA 1L2UA 2QUUA 1XUZA 3HJZA 1AL8A 3S5YA 4QAIA 2DZUA 2E5DA 1HUVA 1NAL1 4LTSA 2YX0A 1SZFA 3M44A 1AW5A 1VYSX 2NXHA 3DH7A 4EF9A 1IF2A 1EWEA 1H1YA 1SU5A 5F1VA 3DGRA 3C52A 4AEOA 2QCLA 3LCLA 3MO7A 3SI9A 3MYPA 5CGQA 1P0NA 4BI7A 2H3BA 3CIWA 3TU9A 4UTMA 3M41A 1E51A 3CEUA 2A1YA 3LERA 2HMCA 4AHOA 1W3IA 3C6CA 3KVJA 3LV6A 4HSOA 2Z2UA 3V1PA 1B57A 2X16A 4HNUA 3MP3A 3C2VA 1TPEA 5SWUA 2DZVA 3P80A 4N6FA 4Y96A 1FDZA 2JK2A 3TAKA 2VFIA 1H7OA 5KINA 3BGGA 4K36A 3CQ0A 1L6SA 1O4UA 3C2OA 1OABA 1PHWA 4NT0A 3P7YA 4PA8A 2P10A 5EMUA 2PCQA 1G7VA 1XBVA 3ABSA 2E5BA 3I68A 3M5VA 4U4MA 2Z6JA 3PB0A 3TC7A 1TTQA 1ZHAA 2Y88A 3NQGA 3ANYA 1UB3A 3RLUA 3VE7A 4GXMA 1Z42A 3O06A 4N9EA 4X22A 2LLEA 2X1RA 5FEZA 3W75A 2OMAA 1H63A 3C61A 4OV4A 4QITA 2O7QA 1VJIA 4DF2A 1TO3A 1PHQA 2FB3A 2NUXA 5D2WA 2CZFA 4TO8A 5HWJA 3BG5A 3PB2A 1X1ZA 1WAUA 3LHZA 5L6UA 3L65A 3LCXA 1AMKA 2CFFA 6TIMA 1W31A 2RHGA 3GB6A 1GJPA 1WX0A 4JX5A 1CW2A 4MY8A 1I8JA 1O5XA 4NUWA 5E1QA 1I4NA 2ZZ2A 2QCEA 3LXBA 1PVNA 2FTPA 2H6RA 1A5AA 3T40A 1ML1A 1W54A 1XC4A 4MLJA 3PVFA 5AC7A 4XBSA 4LVGA 3NQ7A 5LSMA 2ZQ0A 3EEGA 1EP1A 2I1OA 4WUIA 3WJZA 3OVQA 3O07A 4O1DA 4LC6A 4TR9A 3LLFA 4XKYB 4UTHA 2R91A 1GTHA 2C3ZA 4O13A 5LHFA 4J9JA 4A2SA 5G5IA 1FDYA 3E9AA 3S8HA 3PULA 2DORA 5D2XA 2Y7GA 1JVNA 3TQKA 4EOUA 4RK8A 2A6LA 2GVLA 1GYNA 3L5MA 3TQ0A 1HL2A 2NUWA 3NPUA 1F73A 3M16A 3S6DA 3A9IA 3V75A 2HS8A 1KM0A 1B3OA 1KBIA 1OVDA 5MHBA 3BLFA 1OFPA 3L67A 2AQWA 4Q4KA 2V30A 1JUEA 4HNNA 3ZWTA 1RVGA 5IBXA 4JICA 3U6WA 1TTJA 2QUTA 4ADUA 3NQ6A 3MI6A 4JEQA 1I2PA 3WJWA 4EWND 1AW2A 3KX6A 3NQVA 2GVJA 4AVFA 1TJRA 1VZWA 4TMCA 2JKEA 3W3OA 3KRUA 5AHEA 2ISWA 4EVZA 1JCMP 3BG9A 4GRSA 3MJYA 3L66A 4NJGA 3M1ZA 3HIJA 4UMBA 5G2HA 3G0SA 4OU1A 3WJXA 1W5OA 2X30A 1TB3A 3IIOA 4JTIA 4OGZA 4LV4A 3NO5A 4RLIA 4U28A 5TQLA 3UY8A 3LRMA 2ALDA 1YDVA 5FEPA 3VKJA 4GWEA 1TTIA 3NVTA 2A6NA 4AH7A 3IGUA 4S1FA 4NXSA 3NEVA 1OYCA 1SO5A 4O50A 4E2BA 3IV3A 4NX5A 4FNSA 5K3VA 2QCMA 3M9YA 5H2ZA 3HG5A 2Y7DA 1VYPX 4Y8FA 3EWXA 3NPVA 2FPYA 3FOKA 1G7UA 4MKNA 4AF0A 1TREA 5BOOA 3UWWA 3NG3A 3W7PA 1EUNA 1YTDA 3H54A 4FB7A 3WFAA 1YLVA 1LBFA 1FWRA 1W0MA 1ZAHA 3A23A 2HS6A 3DU0A 2E1DA 1XBZA 5KZEA 4DBEA 4YWIA 1DBTA 5E93A 4O1BA 5BRBA 1VCFA 4POCA 2D73A 3CHVA 3W2UA 3NL2A 1H7WA 1JULA 3EB2A 2PE4A 4WXYA 2WKJA 4RZ5A 3STEA 3UPWA 3ATYA 2VKZG 3USBA 4MIMA 2ABAA 5LKYA 5AHFA 1W5NA 2CZEA 2QCDB 3T7VA 2FFCA 4GUJA 5DBTA 3LBCA 2DJXA 3R12A 4BWLC 4JTUA 4XTDA 2TMDA 1ME9A 3W1QA 3STCA 4E0CA 4G1KA 1R2TA 4O1AA 3S42A 5EL1A 2ZRUA 4UTTA 2QUVA 4UTWC 3NL6A 2H90A 3W22A 3W7HA 4O53A 3GDRA 2GVGA 1SW0A 3M47A 3PBVA 3NDOA 3KXQA 6ALDA 4R34A 5LGZA 4ADSA 2RH9A 2RKXA 1SQ7A 2Y61A 3B4UA 3IIXA 4UFJA 3GNDA 4K38A 3PUEA 5KZDA 2V5BA 4NJJA 2OCZA 3P62A 4S2BA 2E6AA 4IQLA 2FIQA 2XN1A 3CIXA 4JNMA 4NZJA 4MPQA 1QPQA 4XTIA 5G4WA 5HUOA 1F7BA 3AJXA 4YXGA 1QWGA 1OX6A 3Q94A 2NUYA 5F4WA 2ZZ6A 4O54A 3INPA 1YTKA 3PAJA 3W76A 2JBMA 3N19B 1OHLA 4R53A 2BXVA 3CPRA 3TUUA 2YCEA 5KTLA 4EIVA 3W7DA 2VEMA 1P0KA 3GXTA 2EGZA 3KRSA 1D9EA 3N9SA 3BO9A 1IGSA 1WV2A 4FEZA 3A21A 3E0IA 3JS3A 3NQDA 1DQWA 3TFXA 3PY2A 3LI1A 3LXAA 3TXVA 1VCVA 3QYQA 3MHFA 1I2RA 2QJIA 3W86A 1SO6A 3QRHA 3LM7A 1ZY9A 3NQ8A 3UZJA 3S1VA 4M6PA 1LBMA 3L0KA 2NXIA 1THFD 1XBYA 1BEUA 4ZQOA 3U2OA 5T26A 5HMSA 1LOSA 1GG0A 1M5WA 1C9DA 3DFTA 3C0JA 1KW1A 3UXDA 1BTMA 3BVJA 3FFSA 3STGA 4KWVA 1J5TA 1OFDA 4NJKA 3GLCA 2E09A 1SR9A 4N6EA 4Z1DA 3CC1A 3KVLA 4A21A 4CNOA 1P5BA 3NZ1A 2DZPA 2Y7EA 4FX7A 2YFOA 5CPNA 4ORMA 1JJKA 4Z08A 5BMXA 3DZ1A 1KTBA 1VHNA 4UMAA 1W5MA 2ZYFA 4FNPA 2NX9A 3W70A 1KFEA 3OIXA 4DO5A 3TDFA 3HGSA 3PS7A 3UYCA 2WNQA 4O52A 3W2NA 3THQA 1GVSA 1GOXA 2VOMA 5K9DA 3LHUA 4GE8A 2ZRWA 3GXNA 2DP3A 3B03A 4IMGA 1G4PA 1A5CA 4PL2A 3BW3A 3MW7A 4Q32A 2X1UA 3HG4A 1I2OA 1K7FA 1LRTA 2W0UA 5EKYA 3ZWSA 1B4KA 2ABBA 1RR2A 2CLMA 1OFEA 3G3DA 3THAA 3O16A 1LRQA 2BTMA 2OZ0A 3HB9A 5HWMA 3S0CA 4PCFA 1UUMA 3FLUA 3W7KA 2DZWA 1HTIA 4LS2A 1MO0A 4ZQRA 1H51A 3A5FA 4O10A 1Q45A 3Q37A 5I3IA 5AHMA 4O8RA 3NA8A 4PFMA 3OVRA 3UWVA 3EX3A 2J27A 4IUOA 2E5CA 2V81A 3QPZA 4DXVA 1OFRA 1EX5A 5E0KA 3L0NA 1QPNA 2UV8G 3G1XA 1OF6A 1XBXA 1H62A 3NQFA 5C55A 3GKAA 4FIQA 4FF7A 4JN6A 1KTCA 3EKZA 1VQTA 3M5ZA 3P5YA 1LOLA 4AWUA 1D3GA 3GAKA 1LLZA 1Z44A 4MZ1A 1QMLA 3L5AA 2CLOA 2V82A 4IJBA 4O0KA 4O1CA 4L4LA 3G8EA 3GDMA 1XFBA 4JTLA 5EYWA 4FX8A 1VRDA 4RZ6A 1RQEA 1OG0A 4WY0F 2FQIA 2C15A 1YPFA 1GT8A 3ZFHA 1YPIA 4A29A 4FNTA 1DHPA 4Y6GA 1U83A 1RD5A 1EB3A 1H61A 5LHEA 2A21A 1FWTA 1H1ZA 4I7WA 4PTNA 1FCQA 1B4EA 2YW3A 4X3ZA 1OYAA 3DFNA 3HGRA 2ZA3A 1H50A 1UCWA 4GFSA 3B0UX 1ONRA 3G1AA 3FA5A 3IIZA 4IMFA 1MZHA 1TTPA 4OT7A 1T99A 2QJGA 2EF9A 3ZR4A 3H55A 3WK3A 3OG3A 4Z1AA 3MI2A 3B0VC 2G5WA 3W87A 3LCIA 3G18A 2B0MA 5AHIA 4JYEA 3A5VA 2NV2A 3PG8A 2V2HA 5CZ0A 3TW6A 3DFSA 1X8FA 5HUPA 3LTYA 2XN0A 5D02A 3EWWA 2GJNA 5D30A 1MXSA 3VE9A 4WOQA 5HWNA 1SSDA 1WOAA 1JUKA 3G8RA 5FEXA 1M7OA 1RQHA 1Z48A 1ADOA 4O11A 1YDNA 1XDMA 3W73A 4BWLA 1PCWA 1M7PA 2ZCGA 4QSHA 3M5YA 5AYZA 4ZQCA 3W7NA 3LRKA 1OK6A 1OX4A 1NVMA 3HG2A 3D0CA 2GPTA 3W71A 3ABRA 2CLFA 3S9YA 3C4UA 1VLWA 2TPSA 2VENA 1SZEA 1K3UA 1KV8A 2YZRA 2DU2A 3TKFA 1Z41A 3T55A 3W7MA 1GWJA 4ONVA 3KOFA 3L2IA 4FNQA 3WJSA 3WK2A 1A50A 2YFNA 5D04C 4JDYA 2NZLA 3P8JA 2YSWA 3LHTA 2YR1A 1S5TA 1DOSA 2O7SA 2QJHA 1WOBA 2CU0A 1KBJA 1PE1A 4BFAA 3VFLA 1TQJA 1J4EA 4IX0A 4S2CA 5F4XA 4RR4A 3M5XA 3C3NA 2VXNA 2FJKA 4I7VA 3UQNA 2EKCA 3W1AA 1FWWA 5LNWA 1QCWA 2C13A 2NWRA 1WBJA 3UWUA 3W7GA 3RMJA 4MUZA 4LWWA 4K7VA 3RLVA 2GOUA 4MFDA 1T0OA 1Q6RA 3B04A 4RCXA 4XWUA 5K9CA 3TV8A 3IVSA 3P60A 5J5RA 1FCBA 1H60A 1XI3A 3LCFA 1PCKA 4UFLA 2ATSA 2C18A 3BV4A 3ATZA 4Y90A 1V5XA 2HTMA 1G69A 5D2YA 3R2GA 2G97A 1B9BA 4MFEA 3QQ1A 1IXNA 4IMCA 3VI2A 1TQXA 2ZBTA 3W9ZA 2C6QA 3PR2A 4UTKA 1QOQA 5FESA 3QMRA 3W07A 4NNAA 1ZNNA 5J5DA 3HGOA 3TFCA 1IIGA 4MYAA 4HNTA 5L9FA 4AWSA 3O8AA 5DCEA 1GPWA 5DN1A 3W1PA 2H3DA 1SFJA 1K7EA 3W1XA 4JYDA 3HMJG 4UNKA 4RX0A 4JTSA 5AC8A 1C29A 3W72A 4I9AA 4KFOA 4MJMA 4M6VA 1TIMA 3I7QA 4DPPA 3BLIA 2QDHA 3PUDA 1O94A 1G6CA 2V0TA 5I3HA 1N55A 1U5JA 5G2WA 1XCFA 1O95A 1WYIA 5EA9A 4K6AA 2DZSA 2Y89A 4NQ1A 3P67A 3HOJA 1L9WA 3MP5A 1Q6QA 3QMSA 1HO1A 4JD4A 4PL1A 4CQ8A 1H5YA 2NX1A 4YCPA 1R2SA 3W84A 3HGJA 1LZOA 2WPBA 3LCHA 4GC4A 4JTGA 3G1HA 2EAWA 3G1SA 5DY2A 3Q2DA 5KSWA 2J9ZA 3EX4A 4LU0A 3TCEA 4K8EA 4DBDA 5CZTA 3QFEA 2H8XA 1YXCA 3P8IA 3TW7A 2Q8LA 3GR8A 2YDAA 5BMWA 1SO3A 3I7RA 1F76A 4YL2A 1ICSA 3B8DA 2CLKA 4IXHA 4MZYA 1XUUA 2ZRVA 3LHWA 1FDJA 3GDLA 3I6RA 3EKLA 3NZRA 4IMDA 3DI0A 4X9SA 3W1UA 2BZNA 1F2JA 2TSYA 1BKSA 4OQVA 1KTNA 4UC5A 4JY9A 3TSMA 4IXXA 4RXGA 5CG7A 1W56A 1QFEA 3NAVA 4YLWA 3VCRA 1K02A 2FDSA 3HBLA 4RV8A 4IPIA 3KVMA 4A2RA 3F03K 3GDKA 4I7UA 1ZAJA 3W7JA 3QPYA 4YMZA 3TROA 4M5PA 1JUBA 1YXYA 2ZTKA 4PEKA 3PSVA 1EEPA 3EWZA 3GNNA 5DCDA 2A7PA 2ZDRA 4AF0B 5LNUA 3TC6A 4QM1A 3TX9A 4UTLA 2CLEA 3P5ZA 3LI0A 1PIIA 1H7XA 4JIPA 4JS3A 4NVTA 3W7QA 5D32A 2CW6A 4QJ1A 1MEIA 1QR7A 3C2FA 1XM3A 2R14A 3C2RA 1SZNA 5DXYA 3LBMA 2Y63A 2J88A 1QPOA 1KM4A 4H6KA 1I2NA 3LRLA 3N9RA 3G1DA 3LTPA 1O60A 2I9EA 1EUAA 3SFKA 2E68A 2C14A 2DZXA 1LRNA 2ZA1A 3G24A 4WY0A 1KFKA 1G4TA 3PBYA 2AGKA 1H7NA 4UFIA 1UJPA 1EIXA 1IIHA 1K8YA 2Y85A 1DVJA 1SFLA 3R89A 1VH7A 2CZDA 3FYOA 2B7PA 4B5NA 1KLYA 5D33A 3E96A 4OE7A 2WJZA 3QEZA 1EA0A 3JRKA 4UR8A 3A22A 4WJEA 1DJQA 4R7JA 1ME7A 2B4GA 3ABQA 2YGYA 5F2IA 5C6MA 4DO6A 1OJXA 5HULA 2RDTA 4OV9A 1FY6A 3W7CA 4HPXA 3OHIA 1ZFJA 2CWNA 4WQ6A 4BF9A 2QCGA 3W7LA 2QCNA 1IXQA 3S1UA 2ZFAA 3EX1A 2QF7A 4N2YA 2Y70A 2VEIA 4N9DA 3PC0A 3W6YA 1YADA 3SR7A 2WOQA 4LVDA 3IVUA 3NPWA 3MHGA 2FPTA 2A85A 3IIVA 2OT1A 1DORA 1OYBA 1XXXA 1KA9F 2F84A 3ELFA 3PM6A 2J6XA 3O1NA 1HFBA 5DLCA 1NEYA 4O12A 4NU7A 4XZ9A 2ZTJA 1TPC1 1TPVA 5IM51 3SIZA 2W6RA 2ZRZA 1WXJA 1G4SA 1X7FA 4Z0SA 1RV8A 1LBLA 4JTFA 3TAOA 3C56A 3WK1A 4LC8A 1GZGA 1S3HA 4XQ6A 4Z1CA 1TV5A 2GUUA 3NOEA 5AN7A 1JCJA 4LVBA 1KM5A 3F4NA 4C1LA 1TMHA 1L6WA 3NQCA 1FCUA 3G3MA 3QJAA 2YXGA 5IBXC 3CTLA 4IMEA 1KM2A 3EWUA 5F2LA 3PG9A 4WD0A 5D37A 3DAQA 4QNEA 4GNJA 1LTDA 1FX6A 1DV7A 1JRBA 2C1HA 3BGJA 5D05A 5C54A 1AL7A 1OFBA 3F1QA 1K7XA 3L0GA 2Z0IA 2QAFA 2PC4A 3B05A 3K30A 3W7EA 1MEHA 1S5VA 3KHJA 3L21A 2NLIA 5AHLA 3W1MA 1ZENA 4FO4A 4CNNA 3W74A 3NQAA 4UCGA 4DO4A 2WSYA 5KITA 3IVTA 3BLEA 1EP2A 2WNZA 3LB0A 3P74A 1S5WA 4HT3A 2ZRYA 5CPLA 3P82A 2W79A 2ZZ1A 3N34A 4JDBA 4NXKA 3T44A 4O57A 1VYRA 3MBFA 3M43A 4P2VA 4CLMA 4LUIA 3UD6A 3LLDA 4CCEA 1IXOA 2FPVA 4UR7A 1ZAIA 3MP4A 3SJ3A 3YPIA 5I3GA 4UUIA 3EWYA 1XL9A 2PURA 4AHPA 3RF9A 4UFHA 1I2QA 2A5HA 4E38A 3P81A 2R94A 3LV5A 1SW7A 4KFPA 4MLRA 3W1LA 5D38A 2ZZ3A 4Z0JA 1PV8A 3UWQA 4M7TA 3O05A 2QCFA 5K9XA 3CM4A 3QF0A 1YDOA 3MWAA 3TIMA 4FHAA 4ORIA 4K39A 2H8ZA 2YYUA 1ZCOA 3OA3A 3UPBA 2G95A 1D3HA 1AG1O 2NV1A 4O17A 1FUYA 3F4WA 3WJYA 1OFAA 5DBUA 1G67A 1LROA 4AWTA 1PL9A 1MEWA 1JR1A 3GIYA 5K7JA 3G1YA 3CWNA 3CU2A 5TBOA 3EX6A 2BX7A 1QDSA 1QAPA 5G1YA 2JGQA 1P1XA 1P4CA 4PC8A 3EXTA 5DELA 1SUXA 3S1XA 4UTUA 1QNVA 4GJ1A 4DEFA 4ZZ9A 3E49A 3GK0A 3FIGA 2X2GA 4UFMA 1JQXA 2VFGA 3QSTA 3N3MA 3I65A 4N4PA 1TYGA 4JTTA 3N2XA 3W1NA 1SPQA 1LP6A 1SSGA 4P61A 4CCCA 1TPUA 3TE9A 2Z6IA 5I3JA 1K03A 1FWNA 4OHQA 3O6DA 5AB3A 1W3TA 4JXCA 1XDLA 4RXFA 4NNCA 3QQ0A 1F05A 2JKAA 4O14A 4IWWA 1TPWA 1TPH1 4M19A 4EF8A 4JTEA 5FI8A 4PODA 2BLEA 4BI5A 3BG3A 4DF0A 1KLZA 5AFDA 3MYOA 1TV8A 3TMLA 2ISVA 3L68A 3W88A 4LNYA 3QZEA 1NSJA 1TRIA 3NL5A 1ALDA 3CEPA 2VEKA 4IGHA 5D09A 1Y0EA 4NX0A 5KMYA 4AAJA 1CI1A 1EPXA 3PBWA 2AAMA 3W2LA 3HPXA 4WZHA 3S5OA 5DY3A 2QCCA 4UTWA 4KWWA 2QR6A 4LUJA 1W1ZA 2ZRXA 4MOZA 3CT7A 1GQNA 1A5BA 1HO4A 4GBUA 3WK0A 2A2IA 2FB2A 2YW4A 5CSRA 1WDWA 2A7NA 3C2EA 3NQEA 1KFLA 1WBHA 3ABOA 1RZMA 2B7QA 3W2JA 3IRDA 1KM6A 2A0NA 3KFTA 3DFOA 4L4MA 4HPJA 3TR2A 2Q3OA 2JKPA 1TSIA 4NJHA 1AK5A 2Y6ZA 3VNDA 5LNRA 4WXZA 3R13A 4ZQNA 5K2ZA 2J9XA 2A7RA 1QOPA 4FIRA 4UNLA 3QSRA 5I3KA 8TIMA 3KAOA 4JR5A 3R8RA 3S1WA 5U4NA 1GVOA 4N9CA 4DF1A 1OX4B 5FEWA 4XKYA 3LHYA 1Q6LA 4O0ZA 4GUHA 4ALDA 2QDGA 5HNRA 4HNVA 4HSNA 4QNWA 2GQAA 2Z1BA 3BW4A 3CLMA 2XFWA 2VFFA 3N14A 3MI3A 1TCDA 3NGJA 4LVAA 4FX6M 2GQ9A 3PBUA 4UTIA 3TQVA 3PWAA 3L9CA 1OFOA 1DQXA 2QEZA 4CQ9A 3W2KA 3NYZA 3HQ1A 3RU6A 3G0XA 1GEQA 1ME8A 1VS1A 3PSWA 2QKFA 4LOCA 5CSSA 3R5EA 4JTKA 1EP3A 1LM1A 1VR6A 4UTJA 1SZGA 3Q58A 5EPDA 3SW6A 5F2GA 1QPRA 1W37A 1VCGA 4BR1A 3DFQA 3PF3A 2ZZ4A 4LS0A 2WNNA 5HJLA 3LHVA 3BARA 3SZ8A 3GXPA 3HG3A 4O15A 1O5KA 3IGXA 3KRZA 1GVRA 2P0OA 3HPZA 3LXCA 5A5WA 4ZQPA 1VGAA 4GUGA 1F74A 1DL3A 3W7IA 3M0ZA 3CB8A 4TIMA 4N02A 4Q33A 1OF8A 4ICNA 2OJPA 4DELA 3T4CA 3FKRA 2VFEA 4JYFA 3GR7A 1LORA 1V7YA 3NQMA 4O4VA 2B7OA 3HPSA 4XBKA 1ZALA 1GVFA 4ZQMA 2E6DA 3OBKA 3IEBA 1LDCA 1TPFA 3DENA 3DFPA 3A24A 3G1VA 4O19A 4YCOA 3TJXA 4MZ8A 5U7SA 1UUOA 2B7NA 2VELA 4QIUA 3G0UA 5G4EA 2RFGA 2F7FA 5LGXA 1OFQA 3TH6A 2NX3A 3FJ6A 4FNUA 2Y62A 3TA6A 2YYTA 1TJPA 1GYLA 1QO5A 1ICQA 1N8FA 4O16A 3LTSA 3EWBX 5ABTA 2QCHA 3DKLA 2ZA2A 1LLWA 2TRSA 4CQAA 3GAYA 5C5YA 4JY8A 1NF0A 4ZVJA 4H3DA 4QISA 1JCNA 5CZSA 5I3FA 3BK0A 3MHUA 3M6YA 4KFNA 3EXSA 3FJLA 4HN4A 1FBAA 2A4AA 3W7OA 3STFA 2V2DA 3E02A 3O63A 1UASA 4AXKA 4Y9AA 3FEMA 3NXFA 4FXSA 4O18A 2J9YA 1FXQA 4A3UA 3CWOX 2QCDA 5H91A 5D03A 3GZ3A 2EHHA 3GKFA 1VC4A 3E12A 3AO0A 1R30A 4D2JA 5G2IA 3T78A 2NWSA 4CCDA 2R8WA 4TX9A 2E6YA 5C2XA 2HSAA 4UFKA 1NFBA 4LT9A 3QW4B 4K8HA 1DJNA 3O6CA 2Q8ZA 3B06A 3EXRA 3DBPA 4UXDA 3FYPA 3O15A 5FF7A 5CPOA 2BWGA 5FF0A 3FKKA 4IPJA 2OT0A 3DKJA 5CZJA 1FWSA 2ISSA 3U8GA 2X1SA 3W1RA 2TYSA 4JTHA 4WX2A 3LDVA 3NPXA 3QH2A 1Q6OA 1W5PA 5FF4A 5HR6A 5AOUA 3IIPA 1DKWA 2EPHA 4M7SA 4X2RA 4DPQA 3PUOA 5FF2A 5HINA 3UXAA 1A53A 3NL3A 1FQ0A 1RPXA 5CKSA 3I7SA 1EWDA 3C8FA 3H53A 3HF3A 4IOTA 4RZ4A 3G22A 4LW7A 1JCYA 5LNVA 4QQ3A 2WO5A 3DI1A 4KKXA 2NXGA 2DZTA 1BWKA 1JCXA 5LZLA 3NR0A 4ZMGA 1CX9A 2WSQA 4MJZA 1C8VA 2V8ZA 5BNKA 3RNDA 4ADTA 5A8GA 3GVGA 3RK8A 1F6KA 3DXIA 3FS2A 4Z1BA 1YXDA 2VFHA 4AHQA 1OX5A 3QM3A 2E6FA 4JGDA 4WY0B 2C19A 3G1FA 2WQPA 1GVQA 4JIQA 1W8SA 3NNTA 4NJIA 2RDWA 4HHPA 2GJLA 4K37A 5TIMA 3LCWA 3JR2A 2FLIA 4W9TA 1KV5A 3UY7A 1UBSA 2C16A 4IX2A 4E2DA 4O28A 4N9BA 7TIMA 1YTEA 1R47A 1VPXA 3GDTA 4MY1A 1BWLA 5D2TA 1RQBA 3EX2A 2ZZ7A 2RDUA 1H7PA 3M7WA 3S5NA 3UWYA 2CLHA 2XN2A 1R2RA 2WV8A 5D2VA 4OWGA 5GVJA 4HKPA 1KM1A 1GG1A 1ICPA 4A22A 1NF7A 4BI6A 1XKYA 1J2WA 3IGSA 1KFBA 1A5SA 5BW6A 3GYEA 4K7YA 4AB4A 2VC6A 1JCLA 4TU1A 1LOQA 1LYXA 1WQ5A 5F4SA 4FNRA 1R46A 4UMCA 2Q3RA 3W1TA 4JX6A 3TJLA 3TNOA 2ZZ5A 5AHNA 5DXXA 4NZFA 4GUFA 1TV7A 1SO4A 3SY5A 3LX9A 4JTJA 1IXPA 3BPWA 3TMQA 2G96A 3UWZA 3LGEA 3NM1A 4LV9A 1K8ZA
chains in the Genus database with same CATH superfamily
3EBVA 1GTEA 4DO7A 4JX4A 3WENA 3L5LA 4HIBA 1K8XA 3MJMA 1Q6GA 3SSJA 4AZ7A 2CHNA 1K4HA 5CPSA 3AYVA 3ARQA 3N2MA 4DJEC 1I6NA 1OIMA 3CZJA 3H7UA 3CHEA 3I10A 3GX9A 1ECQA 2KZHA 3EKGA 3OEXA 3SGZA 1FCVA 3O6YX 1V51A 2F2HA 3S9IA 1XFCA 3LPOA 4ICMA 3NO1A 1KFCA 3QGKC 2C0AA 3KBVA 3W7RA 4DZHA 3T42A 1CT5A 4AY7A 5D8ZA 1WCGA 1DE5A 4V1YA 1UWIA 3N73A 1BG4A 2HK0A 4KMQA 1GONA 3UNDA 4PMUA 4S3DA 4DWSC 4ERAA 3D3FA 2ANUA 2EG7A 3C0LA 3CL7A 2I14A 4HMCA 2MANA 4AXNA 5HPCA 2PWEA 1Q3NA 1W3NA 2BFGA 2BGSA 3S5ZA 1ADSA 2XVLA 3ONBA 3U5YA 4OOZA 3VNKA 4GO8A 1JRCA 4IIDA 3UZ5A 1WA3A 3DHFA 5CBJA 2ADAA 1TRDA 3RO8A 2YIHA 4H4IA 3ALFA 1G4EA 4M6QA 3TK7A 1FHUA 2PDHA 2FVKA 1VLIA 2ATMA 3QHNA 4PMVA 1F3EA 1YE4A 3VDGA 3MUXA 3VD9A 2J24A 2DJLA 3H7RA 3KBJA 4HBKA 2PWVA 4OBTA 3ABXA 4ML9A 3QN3A 2V2CA 2IMRA 4US5D 3TSDA 3MBDA 4NNBA 4YJ5A 1REQB 3B0PA 4YIWA 2QUUA 2W4XA 1IYXA 1XUZA 3S2CA 3S5YA 4MWAA 4FS9A 3QV6A 3LPFA 2I5GA 3TOYA 4HJFA 1SZFA 2PLMA 2Z1KA 4JTQA 3DH7A 1EWEA 1SU5A 5C8BB 3LCLA 4BI7A 4H9YA 2H3BA 3WLOA 3C3UA 4QGCA 2DSZA 1A4MA 4O1EA 3T07A 3VVGA 6ENLA 4HSOA 3V1PA 2AQOA 4HNUA 5SWUA 2PDFA 4JQ3A 4OUEA 3H2FA 2ZUUA 1Q6FA 3GFZA 3N2OA 3TAKA 2VFIA 2HVOA 1LT8A 4LB4A 4S39A 1KKOA 3C2OA 3FK4A 1NWTA 1OABA 2OEJA 1TWWA 5ABFA 2GK1A 4S3EA 1G7VA 2CERA 3I68A 2J7DA 4U4MA 3S4TA 7A3HA 3PB0A 3VFCA 4ZB2A 1NQ6A 2Z7KA 3GC4A 4W7VA 1ZHAA 3NQGA 2PAJA 3ANYA 2OYLA 4GXMA 3O06A 4BCEA 1FH7A 4MGGA 2WM0A 2WC3A 5BWAA 1TO3A 1PHQA 3N3TA 2NUXA 2CZFA 5HWJA 1P0DA 3K4DA 3VIHA 1BGAA 2YJQA 3TZNA 3L65A 5GQBA 6TIMA 1W31A 2RHGA 3GB6A 1GJPA 4MY8A 3T0CA 1M1BA 2Y5EA 4NUWA 5E1QA 2ZZ2A 4Q7NA 1XYCA 2FTPA 2H6RA 4D8LA 2Z1VA 4AG0A 3OTRA 3BSGA 4WKHA 1XC4A 7ENLA 4Q8PA 3PVFA 3KOYA 4RDZA 2QJJA 3SRFA 1EP1A 4XB3A 2I1OA 2IPWA 2XYLA 3RPTA 3O07A 4GPNA 2R91A 4IH3A 4EPKA 2C3ZA 4O13A 1ZB5A 5G5IA 1FDYA 1K1DA 3AIBA 5BOEA 1BFNA 5JBEA 4BQ5A 4RK8A 1RXOB 4Z1YA 3L5MA 4F48A 2PFHA 2EPNA 1HL2A 2NUWA 3S6DA 3DCPA 3V75A 2VEGA 2Z7GA 2VDHA 4V28A 5MHBA 1OFPA 2QHAA 4C6EA 5E5CA 5AYIA 1RH9A 3AC0A 1JUEA 2XM2A 1RVGA 4JICA 3VAVA 1VJSA 3MI6A 8RUCA 1AZ1A 3QV9A 4Z2GA 4E8CA 2I9UA 1CB7B 4Y9MA 3AFBA 3NQVA 4IP7A 2JKEA 2D0GA 3KRUA 1UYQA 3NGFA 3WLTA 3UR7A 3UA3A 3L66A 4AZIA 3HU7A 2QGHA 4QEHA 5G2HA 2XU2A 2YB1A 1DTUA 2BXYA 1TB3A 3IK4A 3PFRA 1VFHA 1XD1A 3NO5A 5FACA 2Y1HA 4LF1A 4GYKA 1UR9A 5FEPA 4QJ5B 5H1WA 3GTNA 1TTIA 2QF8A 2A6NA 1UOZA 3IGUA 4NXSA 1SO5A 1HW6A 3M9YA 3HM7A 5H2ZA 4E8DA 4LYRA 4C6PA 1ZPTA 3EWXA 2X1IA 3FOKA 3IS4A 3N15A 3UWWA 1SMAA 1EUNA 2NV9A 4JTCA 1YTDA 3H54A 1LBFA 1W0MA 1YBQB 2DH3A 4GYPC 2ZC8A 1J0KA 2E1DA 4ZOCA 3OW1A 2YXXA 4DBEA 1MW0A 5A8PA 3WF1A 4QXIA 3NL2A 4LAMA 3EMCA 3WQ6A 2WKJA 4L56A 4JQ4A 1M9HA 3ATYA 3GSMA 3UPWA 5A8OA 1QK0A 4Q4QA 3ITOA 2CZEA 2QCDB 5AVNA 3T7VA 5FCZA 3A3WA 1N82A 5M17A 2Z1WA 4BWLC 4JTUA 2TMDA 1R2TA 3KTXA 4UTTA 3RITA 4X9YA 2OTDA 3E1F1 3O6AA 4UTWC 4QLKA 1VEMA 2H90A 3W7HA 4JIEA 3M0LA 2L5HA 1VB9A 4H6RA 4ZE5A 4JAWA 2PGEA 5LGZA 4NHVA 4HMDA 1PX3A 4NF7A 1ITQA 3W27A 3QKEA 3M0JA 5KZDA 3K4WA 1J79A 4AUBA 3WQFA 4GCXA 2OCZA 2E6AA 1NDZA 4LEFA 1WXYA 3TN4A 1F7BA 5BU9A 4GISA 1Z7AA 1GW9A 3L7RA 3UJFA 4J7RA 2RUSA 1NDYA 4BF5A 3CAKA 1F9CA 1KWKA 3KRSA 4AIBA 3N9SA 1IGSA 3T81A 5LIYX 1H4PA 3E0IA 4KS0A 4AMCA 1I75A 4RPPA 2G3JA 2R1NA 3TFXA 3PY2A 3LI1A 4OVXA 1X6NA 4UQEA 1S2CA 1AFSA 3BV7A 3SUWA 2VGBA 4HN8A 3NZPA 4PMNA 3QRHA 2Z2BA 4M6PA 1JAEA 3EDDA 4Y9OA 1KCXA 2HQAA 3L4VA 5H8PA 3FFSA 2NQ9A 1J5TA 1HJQA 3VCCA 3GLCA 3RR1A 3L23A 4I3GA 1SR9A 3KVLA 4A21A 2DZPA 1IT8A 2QV5A 3J7HA 2Y7EA 3LY0A 3THDA 3MVIA 1JJKA 4HPNA 3UG4A 3O9NA 1S2UA 3PANA 4C6FA 3OIXA 3SRKA 2WNQA 3UF9A 3ANUA 1GVSA 1GOXA 1NWRA 3N4EA 3BW3A 3NXLA 4UOJA 1CXIA 5MKGB 4LY4A 3AXMA 1BQGA 3ICJA 3C86A 1I2OA 3OPSA 1GOIA 4HP5A 3T1GA 2DY3A 3ZWSA 1B4KA 3NZQA 2G3NA 2CLMA 1H1NA 1KR1A 4J40A 3THAA 4AYSA 1LRQA 2VDIA 1E43A 3HB9A 5HWMA 1P0BA 3S0CA 3A64A 2NQHA 2DZWA 3VD7A 4R27A 4LS2A 1BRLB 1FVPA 5HAOA 5I3IA 3IARA 5A6BA 3NA8A 4F4RA 4GVGA 4PFMA 2ZX6A 1RY8A 1RA0A 2REQA 4CN6A 4H2CA 3GH5A 4QFUA 4H2HA 3WG6A 1Z8AA 4H8NA 4P7RA 1UPMB 3GKAA 8CGTA 2OEKA 4FF7A 4JN6A 5DMYA 1UH4A 1D3GA 1Z44A 1M65A 4HTBA 1Y5XA 2CKRA 1R38A 3DOPA 1EBHA 3UJ2A 4JTLA 3KP0A 4ATLA 4KWOA 1RQEA 4Q8NA 2FQIA 1GT8A 3VMNA 4A29A 3B9EA 3TP4A 1U83A 1RD5A 4H8VA 4PTNA 4I7WA 1XLCA 4X3ZA 3DFNA 3WL0A 3TYZA 4JQ1A 2QDDA 3APGA 3RAOA 3F5JA 3BWWA 2PC8A 4B9ZA 3CNYA 5HJYA 2W66A 4OT7A 1XQLA 2F6KA 3FN9A 4M81A 3ZR4A 3SRDA 3OG3A 3LBOA 3SUVA 5J04A 4Z1AA 2QT3A 3MI2A 2G5WA 4JYEA 1JEZA 1JPKA 3D47A 1MW3A 2B81A 4W7UA 1F3WA 2V2HA 4R7WA 1QBBA 3TW6A 3DFSA 2XN0A 4DI9A 3EWWA 5D30A 1SSDA 1M7OA 2J7EA 2VCAA 2CIPA 3V5CA 1YDNA 3EOSA 2AMGA 4CD8A 4IF2A 2GSJA 3EA1A 1CXFA 1EBGA 2QJMA 1L2QA 1GJUA 2VT0A 1TZZA 4IQJA 2WKGA 2IS7A 1RCOB 3S9YA 1M68A 3C4UA 3PZVA 4FPSA 2VENA 4DUVA 4INFA 2YZRA 4FLOA 3EEZA 3TKFA 1YNPA 1B3XA 2Y8UA 3KOFA 4FNQA 3MB9A 2A3BA 3AMCA 3WFLA 3GDBA 4PUKA 1S5TA 4JNZA 1KBJA 4JQ2A 1ZZMA 1TQJA 5CC7A 4X0VA 2HROA 3WUEA 5A2AA 3M5XA 3M0YA 2ZUMA 4J2MA 4XKMA 1K9DA 4E8GA 5LNWA 4YTSA 2NSXA 1TZ7A 2NVCA 5BROA 1WBJA 3N4FA 4UZSA 1XPYA 3W7GA 2I5IA 1W9PA 3M0VA 3WNKA 4LWWA 1W9DM 2F38A 3RLVA 1TVLA 1JAKA 2POZA 3IVSA 5GNYA 4US5A 4P7OA 3P60A 1QPKA 5J5RA 1H60A 3LN3A 1JYVA 3TYAA 3H8AA 2E9BA 1V5XA 4ROQA 2ZUTA 1NQKA 4MFEA 3VIKA 1N8WA 1EGMA 1AQHA 1TQXA 2ZBTA 4DAIA 4ZTXA 6A3HA 3VC5A 1QOQA 4NNAA 4XZHA 4LUTB 4MYAA 7REQA 5L9FA 3O8AA 4PUNA 3W1PA 1SFJA 3W1XA 1H0IA 3C5QA 4UNKA 4AFYA 5DX7A 4TXEA 4I9AA 4M6VA 1KBLA 3W38A 3BLIA 1QHPA 1O94A 2ZWZA 4MKSA 5CZKA 2Q6ZA 4CD5A 1WYIA 4F0HA 1VFUA 3HOJA 3P67A 3W00A 2PEVA 1PKLA 3QMSA 4DNHA 4H04A 1GYMA 1H5YA 4DBUA 1R2SA 3UGVA 3FAWA 5HXMA 3KBMA 1PYMA 1LQ2A 5DY2A 1UP0A 4LU0A 4Y8EA 3BJTA 5CZTA 4OFCA 4HGXA 5CC3A 1YXCA 4HSHA 2Q8LA 3GR8A 4B92A 3IK2A 5CJMA 1SO3A 4WDXA 1ICSA 4MZYA 4S3FA 3LHWA 1FDJA 3I6RA 1MRAA 4X9SA 3W1UA 2TSYA 1BKSA 4MHBA 5HMEA 1QFEA 3NAVA 1EDGA 1K02A 3EDKA 3ERPA 5IDIA 1VPQA 3ISIX 3HBLA 4RV8A 3SQMA 5ABEA 3VGHA 3WD0A 3F03K 1C7TA 2CBJA 4UCFA 4I7UA 1ZAJA 1Q8JA 4DZ5A 4F2TA 4Q8MA 3AHVA 2ZTKA 1D3CA 3H2AA 4G1NA 5DCDA 3RCMA 3CMGA 3MMWA 1ODZA 4UTLA 3BTNA 1ZCCA 1E6QM 2WXDM 3OGRA 1E72M 1F4AA 3P5ZA 3S9ZA 1PIIA 1H7XA 4F2UA 1QR7A 3C2FA 3CUHA 1SJBA 2DFAA 4QS6A 1PKYA 2EO7A 2BXZA 2BASA 4GI4A 3CMJA 3LRLA 3N9RA 2WMGA 1JFXA 1O60A 2I9EA 3SFKA 2GL5A 1R6WA 1DWFM 1T7LA 4XK2A 1KFKA 4AX7A 1H5VA 2AGKA 4N0RA 4CU8A 4K3ZA 1UJPA 1EIXA 1MRQA 1PB0A 2ICSA 5TF0A 1IIHA 2D0FA 1R9XA 4DNMA 5DMMA 1XIHA 3NO3A 3IJ9A 3UESA 5AZ1A 1DJQA 4R7JA 3DYOA 5F2IA 4HA3A 4DO6A 5HULA 1CGYA 1FY6A 2DSWA 4Q4SA 1DJGA 2QCGA 4C6KA 3GXFA 3WEMA 3WEZA 4KETA 3I3DA 3EX1A 2QF7A 2Y70A 1PO9A 1YADA 4H19A 3IVUA 3S5SA 2FPTA 4GZIA 2V38A 1DORA 1XLLA 4WKFA 3SCUA 3U48A 4ZO7A 4WSJA 1IEXA 4I8DA 2ONEA 4K8GA 4O12A 2VRKA 4XZ9A 5IM51 4IPPA 2W6RA 3R8HA 3MSYA 3LU2A 4Z0SA 1BF6A 3FGCA 4XQ6A 2V5KA 1V3HA 1A5UA 1W32A 5AN7A 1MNZA 4LAZA 1OT2A 4Z2HA 4YVVA 2HNHA 2HJPA 3QQWA 3WH5A 1K6WA 4Q6XA 2J7HA 1UKOA 5IBXC 3WZ0E 2ZADA 5LA1A 3EWUA 1CGUA 1JZ2A 2VD9A 3UCCA 1XCXA 3DAQA 4PBGA 4PMZA 1XIJA 3UU0A 3ZVHB 3EDJA 4J2PA 1OFBA 3F1QA 5BXTA 3TN6A 4XAFA 2Z0IA 2PC4A 3H24A 3W7EA 2VX7A 1MEHA 3KHJA 3L21A 2DPEA 5B80A 4FO4A 4FLSA 2E0PA 2AL2B 2WSYA 1MXGA 3G2GA 3LB0A 1HP5A 1S5WA 3PTDA 2ZRYA 2XUCA 4GIAA 4RDYA 1HKKA 1GHSA 5D9PA 1ZUAX 2W79A 1EJVC 2ZZ1A 1J12A 3WQ5A 2OB3A 3T44A 3ZVIA 4YTRA 1GOKA 3M43A 3MBFA 1SJCA 2ZX8A 3WKZA 4DHGA 3DGBA 2OZTA 2AKZA 1IXOA 2KAUC 2FPVA 2PTYA 2WYSA 3WH7A 3N11A 1R7OA 3VIPA 3VOGA 3FXYA 3MSRA 5DANA 3RM8A 2VWTA 4W93A 1UIPA 3RF9A 4UFHA 3II1A 2A5HA 1NDVA 5EFFA 4E38A 1SW7A 4EAMA 3GVQA 4F0KA 2ZZ3A 2FTYA 2EEXA 4PTWA 1J0JA 1PV8A 3IJQA 3S2JA 1JPDX 3UWQA 4HVXA 2WMJA 1F8MA 3G6MA 4GZ7A 4Z2KA 1KCLA 4DB7A 1XYBA 5A6MA 1REQA 1V79A 3URAA 3MANA 2WANA 3T9PA 3RX4A 2YYUA 3WQ8A 1WE5A 3UPBA 3WYZA 1D3HA 2NV1A 3SCWA 1FUYA 4RPQA 1G67A 4AWTA 1PL9A 1UWRA 2PBGA 1XRFA 3GIYA 3U5UA 3G1YA 2D0HA 4W7WA 2YL5A 3VIMA 3CUIA 3N2TA 3EXTA 5DELA 4UTUA 1Q85A 2ZKMX 1P6BA 4DEFA 4ML4A 1JGMA 2DIKA 1JQXA 3SFWA 5IDZA 5DF0A 1CZ1A 4IPNB 4ZO6A 3W1NA 1SPQA 1LP6A 2JF7A 4CCCA 2OFJA 1J6OA 2Z6IA 1QW9A 1E15A 1XDLA 4G8TA 4RXFA 4F8XA 3QQ0A 4IWWA 1W91A 1TPWA 4M19A 3ARRA 1V6YA 3ZQ9A 2BLEA 4XAGA 3ITGA 4HHLA 4BI5A 2E4TA 3I4KA 2IKGA 5FA5A 1HJSA 1DYSA 3TLLA 2WC4A 1QXLA 1ALDA 1Y0EA 2C7FA 4D6GA 1DJZA 1V77A 3NOYA 1CI1A 2OWWA 1RAKA 3B8SA 1YPXA 1OCBA 4HOZA 4MOZA 2OO0A 3I3EA 3CT7A 3JZEA 3OQEA 2A2IA 4GA8A 1EYEA 3NQEA 1KFLA 4M1BA 4WKAA 1GGOA 1V6UA 3W2JA 3CO4A 3IRDA 3PZTA 2XIIA 2JKPA 3E0VA 1XRTA 4Q8QA 1TE6A 1TWDA 4JOMA 3VNDA 3U2ZA 1OC5A 1A0CA 1E71M 4FIRA 2IQ0A 4L6DA 1PX4A 4JR5A 3S1WA 4EP8C 1AH3A 3LHYA 3QLDA 1XGZA 1L6FA 2PTDA 4HSNA 2Z1BA 3CLMA 4HU4A 2XFWA 3N14A 2W9MA 3NGJA 4DYKA 2GQ9A 3ARUA 1UZHA 4N42A 3NYZA 1XINA 3HQ1A 2WZHA 2J8TA 4E5TA 1S46A 4JTKA 1VR6A 2OLAA 1HKMA 5EPDA 1W37A 1ONXA 2V6AA 5IRPA 1Q4NX 2GGGA 5FJJA 3CAWA 1RUSA 1E40A 1TJ2A 2VUNA 3HN3A 7CGTA 2ZZ4A 2WNNA 1ZP4A 3SZ8A 3HG3A 4O15A 1O5KA 3IGXA 3XINA 3HPZA 5A5WA 3IWPA 2PB1A 1BXBA 3W7IA 6XIAA 4TIMA 1VF8A 4N02A 1OF8A 2VRQA 1E0TA 1KGUA 3A3XA 4K2SA 2VFEA 3GR7A 1PKMA 3UXLA 1ESWA 1X39A 4O4VA 2B7OA 3HPSA 1YQ2A 3PZ9A 1OGBA 2XJ7A 3OBKA 4H9XA 3DENA 3TJXA 2OG9A 2WWDA 3WLHA 2HVMA 3S83A 3ZJ8A 1OFQA 1J96A 2JQXA 3ITCA 2P88A 2G50A 1LQ0A 3OB8A 4JFSA 3VPLA 4AZGA 4F40A 2EPKX 1X7IA 3DKLA 4DLFA 2ZA2A 1ISYA 3WDHA 4CQAA 1BF2A 1YBQA 4WDTA 5C5YA 4GQRA 4JY8A 1NF0A 5BYWA 3O7UA 3RO6A 3PJUA 4L6HA 1C93A 3N4AA 3SCQA 3MT1A 5I3FA 4NZ4A 3MHUA 4JCMA 2CITA 2G4JA 1QI4A 3M6YA 1FH9A 4LJ3A 4JKKA 4KFNA 3EXSA 4E4PA 4HN4A 4ATDA 4PTMA 1W9VA 2V2DA 2J7CA 2HE5A 2PLKA 4FR1A 4WJXA 3FEMA 4FXSA 1F8IA 2QCDA 5H91A 2XG9A 3NEHA 3M7SA 4IL2A 4V27A 3QGVA 4TX9A 4DJDD 1OD0A 1CDGA 1B9ZA 2HSAA 4KBXA 4UFKA 2HZGA 3QW4B 3O6CA 2Q8ZA 3UWEA 3L4TA 5EMLA 3EXRA 2GVYA 3O15A 4QG9A 2J7GA 5CPOA 2BWGA 5FF0A 3RM4A 1QASA 4DWSB 3U3HA 5A94A 2ISSA 1W6TA 3U8GA 1JNEA 2V5JA 3QHOA 4WX2A 3FVMA 1L8PA 3RM9A 1MQRA 3IIPA 1DKWA 1U5HA 4P8UA 4Q3MA 4DPQA 3IUIA 3KW3A 3VGFA 4XISA 2OQHA 3I7SA 5I7GA 1EWDA 3H53A 3HF3A 5HPOA 4LW7A 2WPGA 1P0EA 3VGEA 3MSGA 4ZSTA 1QNSA 1XIEA 2DZTA 1E9YB 1BWKA 3JVAA 4ZEPA 3VKAA 4ASTA 1CX9A 4MJZA 3B8TA 2V8ZA 3W25A 4PUWA 2WZIA 5JH1A 3WLSA 1F6KA 3DXIA 1XYMA 1HJVA 2CXGA 2E6FA 3DC8A 1GVQA 1TWIA 1W8SA 3VU2A 3LEPA 1HGWA 1KFWA 3NSXA 9CGTA 5CEWA 1KV5A 7TIMA 1YTEA 1R47A 3GG1A 3W26A 3GDTA 4MY1A 1BWLA 3LNPA 2VD8A 4KCUA 5D2TA 1RQBA 1K8CA 4PULA 1DJWA 3WIJA 2QVNA 3S5NA 2XN2A 3GUWA 4GVHA 2WV8A 3DUGA 5D2VA 1IEIA 3T08A 3CPUA 1KM1A 1XQKA 4BI6A 3H2EA 3E38A 2OSYA 3IGSA 1KFBA 1A5SA 1ODUA 2PU1A 1XLBA 5CAHA 5I2UA 1TFVA 3USZA 5AVHA 3AIVA 4TU1A 3LPPA 1FWCC 5F4SA 2HBXA 1R46A 3T0TA 2O4QA 2WLZA 5MKGA 4JX6A 2WKLA 4AZCB 2PDKA 1FH8A 4PUUA 1SO4A 4PCSA 3KRBA 2XGZA 3BPWA 4F66A 4XSLA 2J7FA 3POCA 2YB4A 3UWZA 2FGLA 2XWDA 4WSHA 5I5RA 4WHBA 3KVKA 1BRLA 5FL0A 1I45A 5BZAA 4LRTA 5FF3A 5HK4A 4MYXA 1XIIA 3CYVA 2P5NA 4WRHA 2GDUA 2PRHA 3RR4A 1QI2A 4W8LA 2CLLA 3TYUA 2V5LA 3VNZA 3O3RA 1OK4A 2XDFA 3HO8A 1J9YA 3W6MA 4PCNA 3TEVA 4IL0A 4C1KA 4U3CA 3PPFA 2IPGA 4JZ5A 1I60A 3IANA 2VX4A 3GNXA 4GQGA 3GWQA 3QZ6A 3E0WA 4CUCA 1LLOA 3W2MA 3Q67A 3W83A 1GOQA 1AJ2A 3MMTA 5CPMA 3SECA 3AI0A 5M2FX 3MCOA 4IZGA 2XGIA 4PH6A 2GQ8A 1EXBA 1L6YA 4AD4A 1VHCA 1A49A 1HG3A 4H1ZA 1T96A 4DIAA 1TG7A 4ES4A 2CPUA 4CNPA 4LALA 1KFJA 4QS5A 4CEXC 2JGYA 3OLGA 1S2VA 3TTEA 3ZS4A 5AY7A 1XF0A 5A2BA 4WOZA 4MVAA 1N7KA 3BOFA 4WLCA 5AC6A 5KZMA 2W61A 4AU0A 2ALRA 2V9DA 4EWJA 4N4QA 4UTTC 2YPIA 1SGJA 1KRAC 3VUPA 4HNCA 1R3WA 1ZJIA 2HPMA 3SCVA 3S47A 5HQMA 2E77A 3MC5A 5LXEA 1NARA 3SN1A 3ZJ6A 4QP0A 4IP4A 3RUBL 1SR0A 4LY8A 1TIWA 4I6KA 4ERGA 1F6PA 1L2UA 1V0LA 2IKJA 4QROA 4GOAA 1V0KA 2IXVA 2Z1XA 3N6QA 2NXHA 1WKFA 5F1VA 3C52A 3BCDA 2QCLA 4W8AA 3NZGA 3SI9A 3MYPA 1P0NA 1XISA 1MUCA 4JNYA 3TU9A 3M0IA 1E51A 3CEUA 1W3IA 3LV6A 1XYAA 1JPIA 2V3FA 3ORWA 3SCOA 2FGZA 4ZBCA 2X16A 4EK7A 3C2VA 1TPEA 1A5LC 1LWHA 4Y96A 5KINA 4Q8WA 3NTYA 3TWBA 4UQBA 1P7TB 1PHWA 3EPMA 3T6CA 2EQDA 1MFVA 2P10A 5KETA 2PCQA 3ABSA 1WAWA 1UR2A 2E5BA 2VVNA 1GOWA 3M5VA 2A3CA 2QV4A 3CAVA 1PSCA 4DJED 4DZAA 1OWQA 1JZ8A 3VE7A 1FWEC 1Z42A 3DYPA 3EOOA 2LLEA 1VFTA 3C61A 1ISZA 3GBDA 4DF2A 2FB3A 1JFHA 4TO8A 3S2LA 3EA3A 1CGVA 2Z00A 2PDBA 3VNMA 1EXPA 1WAUA 2GJPA 3SGGA 3SN0A 3LCXA 1AMKA 3MCNA 4Q4MA 4BF7A 4JX5A 1CW2A 4GH1A 1I4NA 2QCEA 1UUQA 1PJ9A 2WB5A 3LXBA 4DWSD 3RU8X 3ENLA 1A5AA 4XG1A 1EFZA 2EPOA 4M1RA 1W54A 3D46A 5AC7A 5BU6A 2UZ9A 1R8LA 5LSMA 2OX4A 2ZQ0A 4KCTA 4L65A 3EEGA 5HNUA 4XZNX 4M56A 1R9YA 3FHQA 3OVQA 4CD6A 4A3HA 4UTHA 1JL8A 2EBNA 1GTHA 5LHFA 4J9JA 4F3HA 3E9AA 3URNA 2WBGA 1I0BA 3PULA 2CHOA 3TQKA 4PTDA 4C6NA 1JZ7A 4I90A 2GVLA 1QW7A 4KF1A 3TQ0A 3L4WA 3NPUA 1J8VA 3M16A 3GIPA 2ISDA 3A9IA 2HS8A 1KM0A 1MNSA 4EPBC 1DIOA 2OQYA 1V03A 2D2OA 3GC2A 1IEQA 1X96A 4QE5A 3ZWTA 3RG6A 3U6WA 2D23A 2QUTA 1XLKA 3NQ6A 3PZIA 3VD5A 4JEQA 3WJWA 1FWAC 1AW2A 3GXDA 4I8YA 3UZWA 1BLIA 1TMQA 5AHEA 1C8QA 2ISWA 4EVZA 4GRSA 3MJYA 1RD6A 4NJGA 2Y4SA 3M1ZA 4UMBA 1S39A 4GIYA 3G0SA 3U2EA 4FA3A 1IEWA 2GDVA 3CZLA 3MKVA 1AUSL 4Q8VA 4RLIA 1DXIA 1X8CA 2G37A 4YNGA 4D8AA 3TZFA 1U33A 1SZRA 5FJOA 3R58A 1BVNP 2BVYA 2XH4A 3VKJA 3OGSA 3WQPA 3NVTA 2OR2A 4S1FA 1FP8A 1DIDA 3BAXA 2DZBA 4KERA 4O50A 2AOSA 3VOJA 2RGLA 1EZ2A 2Y7DA 1VYPX 4Y8FA 2FPYA 2INFA 1G7UA 4MJ4A 3W7PA 1XLEA 1JXKA 3H70A 4M0XA 4XVEA 2HS6A 4B3ZA 3QYSA 4AZ6A 4M51A 3PTMA 3UR8A 4YWIA 3NURA 2BDQA 3EMZA 4Q6JA 4POCA 1V3JA 3ZR6A 3STPA 4YTTA 5LA0A 1ZU8A 3STEA 2QYGA 4HQVA 3BAWA 2VKZG 4MIMA 4BQ2A 5LKYA 1XRVA 1X38A 5AHFA 2FFCA 2DH2A 2NQLA 2WVVB 3MUAA 4M6UA 1IZCA 4G1KA 3S42A 4O1AA 2ZRUA 4KPLA 3OLIA 1KB3A 1W1PA 1P6CA 3W22A 2X8RA 4HMNA 2Q09A 4HZ6A 2OYMA 1B2YA 2DQWA 4CQDA 4UQCA 2VNCA 2NVDA 4ADSA 1BGGA 1E1EA 1SQ7A 4UFJA 4H9UA 3GNDA 2V5BA 3P62A 2XH0A 1CB2A 3CIXA 3EOUA 1HJXA 5G4WA 5HUOA 3WD3A 1Y5VA 3GHTA 4YXGA 1L8NA 1PZ3A 3Q94A 5F4WA 3HQOA 3HTWA 3AUOA 3INPA 2EXOA 1UKSA 4UOQA 3N19B 1OHLA 2PSNA 2BXVA 1B54A 3TUUA 3KCOA 3V36A 2FFIA 2W62A 4EIVA 1PZ0A 2EGZA 3BAJA 1CXKA 2YZ5A 3PFMA 4XV0A 4FEZA 1KD0A 2WMHA 1PTAA 4OUIA 1DQWA 1FWJC 3LA4A 2XVNA 4FXFA 3QYQA 5CJ5A 1I2RA 4Z17A 2E1WA 1ZY9A 1NJJA 3U57A 4PTXA 5G4HC 3EDFA 3L0KA 4DJDA 4ZSUA 1FKWA 4GACA 1THFD 5A2CA 4RZBA 4EPEC 5T8GA 3VZZA 1O7AA 1GG0A 1C9DA 2J8FA 3CK5A 1KNWA 3ZVHA 2Q01A 3SY1A 1KW1A 1BTMA 1IEVA 3STGA 1OY0A 4KWVA 1MXDA 1OFDA 4M29A 4EKJA 4N7QA 3WBAA 1TWSA 3CC1A 1BVZA 4CNOA 3NZ1A 2GJXB 5EMMA 1K70A 2YFOA 2POTA 2CWXA 4GIEA 2F8QA 2IW0A 3NJ3A 2AL2A 3DZ1A 3ME3A 5BMXA 3DG7A 1MW2A 4HU3A 4UMAA 4JHOA 3W70A 3HGSA 1JDFA 3UYCA 2DW6A 3W2NA 3THQA 4NASA 3LHUA 2ZRWA 2ZXDA 4GXWA 3GXNA 2DP3A 5GNZA 1G4PA 4PL2A 3M46A 3ZLFA 4H00A 1K7FA 1LRTA 4I6VA 3G5EA 2ABBA 4KIRA 3O0KA 1V3MA 4HPHA 1W8GA 3O16A 3FLUA 3FVDA 3E2RA 1MO0A 1EX1A 1JDAA 4DY1A 2BVTA 3A5FA 3WLLA 4L1GA 5AHMA 4B90A 1WP6A 4AC1X 3SO7A 3UWVA 3MV11 2WZTA 1VFMA 2E5CA 2V81A 3VKKA 1K9FA 3CLWA 3FY1A 5E0KA 3N04A 5H8MA 2YKKA 1MUMA 4YPJA 1QPNA 5CJNA 3G1XA 5EMJA 3SQSA 1OF6A 1XBXA 3NQFA 2FKPA 3E5BA 2A79A 3CUJA 4BQ4A 1KTCA 4HHHA 1VQTA 2D20A 3PP7A 2XISA 4IJBA 4O0KA 4Q8OA 2E8ZA 4L4LA 2VC5A 2VZUA 1S3TC 5EYWA 4FX8A 1VRDA 1NWSA 3SQLA 1XC6A 2GGHA 2TODA 4NKCA 4JIIX 4LYPA 4Y6GA 5CBBA 1UP3A 4Y9PA 2VR4A 1EB3A 1QT1A 2A21A 1FWTA 1H1ZA 4RNIA 5ENLA 1OYAA 3HGRA 2ZA3A 1H50A 3UP8A 1E9IA 4GFSA 3TA9A 1W3HA 3CGTA 3B0UX 3A4AA 3IIZA 4IMFA 4ZR8A 2DIJA 2QJGA 3VIOA 2DSUA 1UD4A 2VR5A 3WK3A 4BY3A 2P53A 3U7BA 3HZ3A 4AD3A 3W87A 1OCJA 2B0MA 5AHIA 3KBSA 3OZYA 3A5VA 1ITUA 3FEQA 1EIBA 1V02E 5HUPA 1A5NC 4IGNA 3AMKA 4L1XA 4JIRA 1MXSA 3CZGA 3VE9A 2FJUB 3FDKA 2PGRA 2DVXA 3G8RA 3GTFA 1Z48A 4H7CA 4TVUA 4HPGA 4P7NA 1XDMA 2O0TA 3AS3A 4I5UA 1J5SA 3M5YA 4G56A 4QX4A 4DBWA 5AYZA 3TC3A 1KXQA 4WGHA 3BMXA 2XFRA 3D6NA 3UR2A 2PLCA 3GM8A 1LT7A 3T0BA 3ABRA 1KWGA 3VABA 4M8UA 1WKEA 1SZEA 1ITXA 1KV8A 1Z41A 3KDNA 3QVQA 3B3DA 3MQTA 1GWJA 3WLMA 1QUMA 2OEMA 4YTUA 3CQIA 3LHTA 2YR1A 1DOSA 1G01A 1E5JA 1WOBA 1OIFA 1PE1A 1RCQA 4BFAA 3CPGA 1WNOA 2XINA 4S2CA 1LG1A 4IMAA 3TR9A 4HA0A 1JD7A 1Z69A 5JU6A 2WAGA 1FWWA 1UQYA 4M80A 1U2YA 2BV9A 5LIUX 2XGBA 3G77A 4BHYA 1RSCA 4K7VA 2GOUA 2ZXQA 4MFDA 4C6BA 3URBA 3WNOA 3B04A 4PSPA 4LCQA 2C91A 2XFFA 3PWGA 2JEPA 1Q5MA 1XI3A 4MPKA 4ZXOA 2ATSA 3QZAA 1AQ0A 4FI4A 4I9JA 1G69A 1W1VA 2JALA 2G97A 3OIHA 3QQ1A 4EPDC 4U5IA 1BTCA 1S2WA 3AZRA 2YA0A 3V5OA 2O55A 1UROA 1NFGA 3QMRA 1VBUA 5H6HA 3W6LA 5J5DA 3OZOA 2E28A 1IIGA 1H3GA 2X05A 4J3WA 5DCEA 1GPWA 2H3DA 4R9XA 1K7EA 4JYDA 1OT1A 3AS2A 1V0NA 4RX0A 2FZ8A 3W72A 3C0QA 5AC8A 4KFOA 1ZJAA 4DPPA 3P2VA 1JYWA 1WUFA 2V0TA 1N55A 1U5JA 5G2WA 3K8KA 1XCFA 1O95A 1UD6A 1W9UA 3KBNA 4M3PA 2DZSA 4NQ1A 1ISXA 3KOXA 1L9WA 1Q6QA 3VOFA 1HO1A 1CIUA 1IZJA 2NX1A 2KX9A 4XSMA 4XAZA 9XIAA 4NI8A 3LCHA 4LF2A 4GC4A 3G1HA 2EAWA 2PP1A 2J9ZA 3EX4A 4U33A 1WDSA 3TCEA 3WUFA 2VO5A 1US0A 1QU4A 2VDGA 1V3KA 5FL1A 2QPXA 4AZHA 5I77A 3CIVA 5BMWA 1F76A 1UH3A 4L80A 3B8DA 2TAAA 1R9ZA 2ZRVA 4MDOA 1E4IA 3DI0A 3LSCA 4PBEA 3U4AA 4DWSA 1F2JA 4Z42C 3GBEA 4OQVA 4GYFA 2VVSA 3OBEA 1XLDA 2HVNA 4UC5A 4JY9A 2OWXA 4OTKA 4IXXA 1QVBA 5CG7A 1ISVA 1P48A 3H4GA 4ATWA 3NQBA 1Q6EA 3OYXA 3U9IA 2FDSA 1F6YA 1V7AA 3KVMA 2PDWA 1AQFA 4HB7A 2V69A 4YMZA 3TROA 2OELA 4M5PA 1JUBA 1YXYA 2VOTA 2FZ9A 4JQAA 3PSVA 3EZ4A 3GNNA 2A7PA 4AF0B 4HA4A 2YA1A 1B3WA 4YWSA 4RUBA 2O92A 4B4HA 5CC6A 3F4CA 2CLEA 1U1HA 1JF6A 4NVTA 3W7QA 1BSIA 4H01A 4PUDA 2CW6A 2UY3A 4QJ1A 1MEIA 4NSBA 2GWNA 2PPGA 3C2RA 5DXYA 2HBVA 3LG3A 3GS6A 5F7UA 1ZRQA 3CUGA 1KM4A 4K1WA 2ZUVA 4H6KA 4AC7C 3LTPA 4XX6A 2C1IA 3UETA 4C6QA 3SUTA 1LRNA 3I4EA 1G4TA 3PBYA 1H7NA 4UFIA 5JIPA 4L4PA 1RP8A 1K8YA 2YCLB 1DVJA 3KM8A 3SBFA 4C5ZA 3FYOA 4W86A 4B5NA 1KXTA 4ZFCA 3UJEA 4O1FA 5HQLA 1PYFA 5GJMA 3WX7A 2WJZA 1RBLA 1EA0A 3A22A 4KH2A 4WJEA 5DT5A 3ABQA 4PUMA 4PUEA 1FHLA 4PMDA 5BOFA 3IV8A 4DUXA 3ZLHA 1IXQA 3S1UA 2FH8A 1OCQA 3CL8A 1E0UA 1D8WA 1TR1A 2VEIA 4N9DA 5I78A 3POHA 2WOQA 4LVDA 4J3UA 3MHGA 1UW9A 1EF3A 2A85A 3IIVA 3UCDA 2Y8KA 2FHBA 2ESCA 1OYBA 1XXXA 1KA9F 3VMPA 1VENA 4W84A 4AZCA 3O1NA 3AOFA 3IAPA 3GVWA 1NEYA 1O68A 1CGWA 3CQHA 1TPC1 3SIZA 1CGTA 4QHRA 1WXJA 2GSHA 2XSBA 4FK9A 4ILSA 3M6DA 5HBFA 1CBGA 2BP1A 4FSAA 1X7FA 3V16A 2VX6A 1ZSXA 1RV8A 3BZJA 1E3XA 3TAOA 1GZGA 3UA4A 4ROPA 2V68A 4D8ZA 4UWMA 2GJRA 1JCJA 4LVBA 1R3YA 1RA5A 4ICCX 3DHUA 4ZA0A 4C1LA 3K13A 4MB3A 3QJAA 4PBFA 2FVLA 1UWQA 1YMYA 2YXGA 3RXZA 1KM2A 5F2LA 3PZUA 1WZAA 4H83A 3CXOA 3PG9A 4WD0A 1LTDA 1E6NA 3F4VA 1XSJA 1M7XA 4XUYA 1DV7A 2PDJA 2C1HA 3BGJA 3FGCB 5I3DA 3L0GA 3T8QA 5CSUA 3K4AA 1OINA 3B05A 3K30A 1RPKA 3WMSA 5I00A 1V6TA 3NSMA 1S5VA 2JF6A 4IGMA 3N6JA 3W1MA 4CNNA 2CKSA 4UCGA 4V1XA 4DO4A 1L0PA 4RNHA 2WNZA 5D8WA 1YEYA 3CQJA 3W82A 1XDJA 2WSPA 4HT3A 4NL1A 3UT0A 3CB3A 3MV01 3H2MA 3R43A 5E09A 3UD6A 1ZAIA 5I3GA 3WY1A 5I23A 4UUIA 1XL9A 2PURA 3H4XA 4AHPA 1XH1A 3I3BA 4MAVA 2BMBA 3ZT7A 3TTOA 1XIBA 3CASA 3CBWA 3LV5A 3BC9A 2YOCA 3BLKA 1C92A 5XINA 1KO0A 4Z0JA 2G8ZA 4AD1A 4M7TA 3QF0A 4LPCA 3V4BA 3PJXA 4GGHA 3VKCA 4XZBA 3VIGA 4XO7A 4FHAA 4BEUA 4LFYA 1PZ1A 1ZCOA 3D3AA 4GH3A 4CGTA 4CVUA 3WJYA 5DBUA 4LB3A 4RW5A 2Q8XA 1V0MA 5TBOA 3EX6A 2BX7A 4TTUA 4LGXA 1QAPA 1FOBA 4MB1A 5MF5A 1KGWA 3S1XA 1QNVA 2WK2A 4GJ1A 4ZZ9A 3QTPA 3GK0A 2BHYA 2VFGA 4AD5A 1JF5A 4N4PA 1M3UA 3WNLA 4ACYA 4GYPA 1TPUA 3TE9A 5DRIA 5I3JA 4ZXLA 3UJSA 5AB3A 1KCKA 4JXCA 1S1RA 4LNCA 1FFRA 3PAOA 4NZCA 3EAUA 3PNZA 4RE2A 4EF8A 4JTEA 1P7TA 3ZLGA 3BG3A 2Y0FA 5CSYA 1PWLA 1PDZA 3VA8A 4DI8A 4DF0A 2BVWA 1GQLA 5AFDA 3MYOA 1CNVA 3L68A 1JNDA 2Y2WA 2VEKA 3PZGA 3GHUA 4GVIA 1FTXA 3AXKA 1NDWA 2OGJA 2BVDA 3QTGA 5DO8A 1UOKA 1DWHM 1UH2A 4L9XA 4UTWA 3GXIA 1W1ZA 2XZ7A 2Z1SA 2ZRXA 3CV2A 4GBUA 1EJ7L 4U31A 2FB2A 3ES7A 5CSRA 1WDWA 2A7NA 2P8CA 2PDGA 1WBHA 3ABOA 2B7QA 2A0NA 1X98A 3DFOA 4ZOBA 1O5RA 1HJWA 4HPJA 2PODA 4NJHA 3MUY1 1AK5A 3EMQA 1E5NA 2YCJA 3KAOA 1TMLA 1D8CA 3GHSA 3R8RA 3TN3A 1M03A 4NILA 1CLKA 4N9CA 4DF1A 1OX4B 3BJFA 2IQDA 1IWPA 3GYCA 1Q6LA 4O0ZA 3FA3A 5AECA 5HNRA 3WH8A 4HNVA 3RJYA 2GQAA 4IGSA 2FHFA 3UEQA 4FAMA 1RHCA 3UCQA 2YL6A 1TCDA 4R3UA 3S1GA 4FX6M 3PBUA 1QOXA 3TQVA 1DQXA 4LYKA 3AZTA 1J01A 1GEQA 1VS1A 1MI3A 2BHUA 3SW6A 4GX9A 3RLGA 1W17A 3S2MA 3AU6A 2DT0A 4PMYA 3JZUA 3GXPA 3ZJKA 3F2BA 4D6EA 1U22A 3AIWA 1O12A 2FZMA 4IIHA 1F74A 2XVKA 3CB8A 4S3CA 4CNUA 1JCTA 1CEOA 2ZX9A 2ZXBA 2CNCA 4KRZA 5A8NA 2PGFA 1SFTA 3NQMA 4XBKA 1GVFA 1ONWA 2E6DA 4EXAA 3IEBA 3VD3A 5H8UA 3ZT5A 3G1VA 3QLLA 4QQUA 3UPMA 4MZ8A 5U7SA 1UUOA 2B7NA 2VELA 4QIUA 2RFGA 5LGXA 3TH6A 3RCNA 2BHZA 2Y62A 4V2XA 1LL7A 3A4WA 1ICQA 1N8FA 3W37A 3OLEA 3UNTA 3LTSA 3EWBX 1Q63A 1RP9A 2Z29A 4GG9A 2XIQA 2V3EA 3VGDA 1K8ZA 1FRBA 1OC6A 4DXXA 4AZBA 1ZLPA 1MYRA 1QJWA 4JBRA 3W7OA 5E6ZA 1LWJA 3O63A 3ZXWA 2C79A 4IHCA 2HXUA 3PPHA 3IJ7A 4AXKA 3KWXA 4Y9AA 3NXFA 4O18A 3CWOX 3GG8A 2E8YA 3MY9A 5D03A 2WVVA 3OOQA 3WDJA 3W53A 5IOBA 3E12A 4OZOA 4D2JA 1TX2A 5G2IA 3T78A 1JXJA 1FKXA 4CCDA 2R8WA 4C5YA 3WLJA 4K8HA 1DJNA 2DT1A 4UXDA 5A8QA 3FKKA 1FWSA 1TVPA 5C7VA 4AZ5A 2TYSA 2I7GA 3LDVA 1V3LA 3VNJA 3QH2A 3PBGA 3LNMA 3AYTA 2YCKX 2VR2A 4MKVA 1ENUA 1PIFA 3CO8A 2J78A 3U7VA 3PUOA 5HINA 3WLNA 1A53A 1FQ0A 5AZ0A 4C91A 4IIGA 1RPXA 3Q4DA 4Q7IA 5C9ZA 1GZJA 1QI0A 4IOTA 3SUUA 5C7HA 3AIRA 3ONCA 5LNVA 1VPYA 3WDRA 3DI1A 1DWAM 2PDIA 2NXGA 1JCXA 5BCAA 2C71A 5LZLA 4EANA 1XLMA 2OVLA 4ZMGA 3I6TA 3WD4A 4W5UA 5AKQA 1K4GA 3QY8A 2VC9A 5A8GA 2VZOA 3RK8A 1YXDA 4H9MA 1OX5A 3ARVA 2ZUSA 5JH2A 4JGDA 3VIFA 1VFFA 2C19A 3G1FA 4S3JA 4JIQA 1UD3A 3NNTA 2V3GA 2XVGA 2RDWA 3HFYA 2GJLA 5TIMA 3LCWA 3DC0A 4EXQA 2FLIA 1UZDA 2ZIDA 3UY7A 3ZZ1A 3OA5A 2C16A 2HXTA 4E2DA 5I24A 4N9BA 1VFLA 4I9MA 3ARSA 1VPXA 1RLDA 4P7QA 3XIMA 2ZZ7A 4X63A 1VRXA 2GFTA 2RGMA 4V15A 7ODCA 1EEXA 4QRNA 4CQBA 1CXLA 1R2RA 1X97A 2FMOA 4JKMA 4OWGA 5GVJA 3V0SA 1A5MC 3UBPC 2GJXA 1R3SA 3V0TA 1ICPA 4A22A 1NOFA 4KCWA 1PUDA 1E0VA 1XKYA 1DE6A 2BGNE 1J2WA 3UGRA 4JFVA 3GYEA 3VGGA 4B9YA 1F61A 2DQXA 5D9OA 4DLMA 5HOSA 5LIWX 1LOQA 1LYXA 3SURA 4GLEA 3VM5A 3H12A 1WQ5A 3R4IA 4UMCA 3TTSA 3K1GA 6PTDA 3W1TA 3TCSA 4B4FA 4MDPA 3TJLA 3DFHA 4W89A 4GNVA 2ZZ5A 3N17A 5DXXA 4U2YA 4GUFA 1TV7A 3S3GA 3LX9A 3GTXA 4JTJA 3D5HA 4J3XA 3TMQA 4D71A 2O56A 4GVFA 1CYGA 2W67A 3NM1A 4LV9A 5GPRA 3WBYA 1BSLA 3VNIA 4LYQA 3VX0A 4G7EB 3BW2A 3GY1A 1V6XA 2PRLA 5XIMA 3QOKA 2BG5A 1B0IA 2INEA 2PP3A 4GUIA 4GKTA 3K46A 3NYDA 5A1AA 1PPIA 1QI3A 2EG6A 5I6SA 5DCBA 5CPTA 4ZL1A 4AMAA 3BMVA 1TPDA 3QC3A 3WEOA 4XD3A 1MFUA 3AICA 1H11A 1QO2A 3GU1A 2Y7FA 3LMZA 1UR3M 4A8NA 1X1OA 2X1TA 2VEPA 4B5TA 4MNKA 1QW8A 3BUVA 2CC0A 2E40A 3KBWA 5EMYA 5M3WA 1ZBCA 4LRSA 1EHNA 3JUGA 3QMTA 5LNSA 2YL8A 4IFKB 3UZXA 1U30A 3P84A 3NM3A 5FJUA 5F1UA 3AS1A 1TPB1 3FCPA 2QAPA 1C8YA 1TV4A 3OBAA 3VXGA 1M6JA 4Z2JA 2BY0A 5FJPA 1UIOA 3HJEA 4B3LA 2W63A 2OLSA 3QW3A 1HKVA 2WHKA 1LCOA 4XUGA 4DQWA 1UD5A 4Q4RA 2YBUA 2PDCA 5G1TA 3TXZA 1BPLB 1W5QA 3QFWA 5C2CA 3IJ6A 3VOCA 1S2TA 1Q7QA 5F2MA 1E4NA 3NQ2A 3W85A 2A3AA 1UWUA 4HCHA 5EB8A 4BJHA 4YVXA 1HUVA 2YX0A 1AH4A 1AW5A 1VYSX 3L2MA 1IR1A 3SIMA 4EF9A 2BS9A 8A3HA 4AEOA 2IKIA 4KGLA 3B9NA 3MVTA 1DIEA 4UTMA 1WZMA 1KBKA 2A1YA 5TNVA 4Y2WA 2HMCA 3PUGA 4AHOA 3C6CA 4M82A 3WLQA 3M4HA 2Z2UA 1KRMA 3MP3A 1W2VA 4HYWA 1K77A 2PDUA 4N6FA 1FDZA 4EE9A 2XIBA 3G6LA 4K36A 3CQ0A 4AY8A 4NT0A 5CG0A 1UQZA 4PA8A 4HA1A 3BJSA 1RJRA 1XBVA 3QPEA 4PGLA 3DHPA 2DUXA 2Z6JA 3TC7A 3E5PA 1BAGA 4BA0A 2RAGA 4DJDC 1AH0A 2XPKA 1IGWA 1VP5A 2X1RA 1Z9AA 3W75A 2OMAA 1H63A 2XTKA 2O7QA 4JFWA 1BYAA 1BYBA 1G9HA 3A4JA 3BG5A 3PB2A 1X1ZA 5FJIA 1FWDC 3AUJA 4YHEA 5L6UA 1NP2A 3CZEA 4F79A 2PWHA 4AW7A 1I8JA 4PMJA 2GUYA 1PVNA 5TAOA 4DWDA 4G2DA 1DWJM 3ARYA 5A6AA 3T40A 1Q13A 1QBAA 3HV9A 4MLJA 3FNDA 4LVGA 4Z2IA 2YBTA 1ELSA 4KIEA 4WUIA 2IKHA 3WJZA 4PE8A 1A5KC 4O1DA 4QDWA 1US2A 4XKYB 2BOFX 4P8WA 4H9ZA 2VRJA 3S8HA 3KS5A 4D1IA 2Y7GA 4NIRA 1JVNA 3ZT6A 4EOUA 3NSNA 1A3XA 2A6LA 4LBRA 1JZ6A 4TVCA 1F73A 3IAQA 1KBIA 1IT0A 3BLFA 1WDDA 1CPUA 2V30A 3GNOA 4HNNA 5IBXA 3NIYA 1EQPA 4ADUA 2WJDA 2ZX5A 4U2ZA 3LMYA 4PYSA 4EWND 1G1YA 1B1YA 3KTCA 1TJRA 3WQGA 1VZWA 5A6KA 1B5TA 4TMCA 2JIEA 5BXRA 3Q45A 3W3OA 3BL3A 3TVAA 3BG9A 3BAKA 2ISFA 2PWDA 3HIJA 1AD4A 3WL1A 3WJXA 1PEZA 1OGGA 3IIOA 4MF4A 4JTIA 4OGZA 1Q65A 1NWUA 3VK5A 3ITYA 4C65A 5TQLA 3UY8A 3LRMA 1YDVA 3R7MA 2DSKA 3L4UA 1OM0A 2ZVRA 3B8IA 2CHRA 4PN2A 4DJFC 4H7ZA 1Q6DA 2PDYA 4TX6A 4FNSA 4HU0A 2J77A 2QCMA 2CESA 3NPVA 1N8IA 4AF0A 2VC7A 1NM9A 4DM1A 1XYZA 3CYJA 1LJYA 2R82A 3WFAA 4FB7A 3N12A 3QC0A 1FWRA 4ZODA 1WPCA 3TTYA 3FHAA 3A23A 4MJ2A 3VDBA 2EPMX 4S3BA 5KZEA 2FZBA 5E93A 4O1BA 3V35A 2D73A 4CN1A 1JULA 4PB5A 1TV2A 4RZ5A 1C3FA 1YNYA 3USBA 1FWBC 2ABAA 4KCVA 3HFTA 5E9XA 5DBTA 4GUJA 1GKQA 1GW1A 2YCLA 4CD7A 3LBCA 2DJXA 2G3FA 4XTDA 3BLLA 1ME9A 3W1QA 4E0CA 4ZO9A 3KL0A 3PJWA 5EL1A 1DWGM 2QUVA 3H2OA 2UY2A 3M07A 2EKGA 4IJRA 5A6TC 1XIGA 3TYBA 3M47A 3PBVA 2OSWA 3KXQA 2HPIA 2WMIB 3KOWA 4R34A 1LWIA 3UVIA 4R85A 2RH9A 3JW7A 1A80A 2Y61A 3IIXA 3N2CA 2UY5A 4NJJA 4MNJA 1MWOA 2WSKA 4S2BA 2XN1A 4NZJA 4JNMA 1NELA 2O4MA 1QPQA 4XTIA 3AJXA 1QWGA 3WQOA 1OX6A 2NUYA 1EJRC 4O54A 1RLCL 3NFUA 7PTDA 4GHRA 3BZGA 3PAJA 1JD9A 2JBMA 1XGEA 4O8AA 3CPRA 1GEHA 2PZNA 4MB4A 1CGXA 4G7FA 3W7DA 2XHYA 2VEMA 3GXTA 1D9EA 3GFXA 1AZ2A 1WV2A 5LXXA 3VDHA 2CBIA 2CZVA 1E1CB 4MTVA 3LXAA 3TXVA 1LG2A 4C1NB 3ARPA 3OO2A 5LYRA 2FVMA 4PCTA 3IUHA 1SO6A 1B3VA 1OZMA 2G3MA 3NQ8A 3UZJA 1PKNA 2VCCA 2OZ8A 1LBMA 2PTXA 3MPGA 1XBYA 5T26A 1M5WA 3C0JA 3B9AA 1WXZA 4LBUA 4WVXA 3SUSA 4LCRA 3SJNA 3HQNA 5JBDA 5I06A 4R88A 4N6EA 4Z1DA 4YYFA 3C8NA 1OGSA 3AZSA 5CPNA 1NFPA 1QATA 1EH9A 1E4MM 5M03A 2AGTA 3WDQA 1VHNA 3FA4A 3PS7A 5REQB 4CD4A 2YCIX 3THCA 3LK6A 4REQB 2VOMA 1WZLA 3BAIA 2Z2AA 4GE8A 2JEQA 1GK8A 3AYSA 3MW7A 1V08A 1R87A 2X1UA 4Q32A 3HG4A 1VFSA 3AJ7A 2W0UA 3DG6A 4ZGYA 1OFEA 3MZ2A 1F07A 1KR0A 1NP0A 4PCFA 2PTWA 1K9EA 1HTIA 5FOOA 4ZQRA 1H51A 1QI5A 5I0DA 2PDMA 4O10A 3EYPA 1Q45A 3Q37A 4O8RA 1DP0A 2E67A 4WDWA 1OD8A 3NCOA 3EX3A 1EDTA 2F6UA 2J27A 3BLOA 4DXVA 1UKPA 1OFRA 1EX5A 4NZ5A 5A3HA 1J93A 1QWKA 1AA1B 2UV8G 1BG9A 1PX8A 3E2SA 2BBFA 3ANVA 1UR4A 1H62A 3WF4A 4A05A 4NAFB 5C55A 2O9PA 5T9BG 3EKZA 5C9XA 3P5YA 1VBRA 3R11A 3GAKA 4MZ1A 1QMLA 3L5AA 3GH7A 3GUGA 4O1CA 4XZLX 3G8EA 3GDMA 3V1HA 2XZ9A 3KCJA 1B90A 1OG0A 2VWSA 3CWHA 1C9WA 1OQFA 2C15A 1YPFA 3KOZA 3ZFHA 1YPIA 2Q02A 2J13A 2PLJA 3BLDA 4FNTA 3SM0A 5HMFA 1IQ8A 5LHEA 3AHZA 1B4EA 7XIMA 1PTDA 1WKYA 2ACQA 3KHDA 4QLJA 5ABHA 2F9RA 3R79A 4B3KA 1TUFA 4D6IA 4BQ3A 5A6LA 1ONRA 3T4WA 2P76A 1UC4A 3G1AA 3GE7A 3QBUA 4LANA 1T99A 3F7JA 4QCEA 2EF9A 3B9DA 3GQYA 3W29A 2WHMA 1TX0A 4WSKA 3NDZA 3WQEA 5HA7A 2QIWA 5GJPA 3FV9A 3QR3A 1JIBA 1MQQA 2C1GA 3H26A 4JHZA 4J1OA 3RYSA 2V3DA 1KXVA 1A0EA 3LTYA 2IUZA 3M0XA 1R3VA 4XAYA 4X60A 5HWNA 1JUKA 4JHMA 5AYBA 4UR9A 2PWUA 4GFIA 1XG4A 1PCWA 1M7PA 1JDCA 5HATA 1JG9A 3W7NA 3VUSA 2GUBA 1PAMA 3LRKA 1E3ZA 1OK6A 1OX4A 1UMLA 4EACA 3HG2A 3D0CA 4D6DA 2GPTA 2HISA 3PHAA 4C60A 2WZMA 1K3UA 4XD5A 2WMKA 3VMOA 3T0DA 3REQB 1J0YA 1AJ0A 3TOPA 5BXSA 1A50A 2YFNA 3HURA 5D04C 1DEDA 4HK6A 2NZLA 3KS6A 4RL3A 3P8JA 4DN1A 1Q4WA 2QJHA 1MQPA 3A6OA 3VFLA 3ZR5A 1DXEA 4IX0A 1E1FA 3G1RA 4RR4A 3MWCA 2QPUA 2WCAA 3MUIA 3SSZA 2FJKA 4I7VA 1A47A 3W1AA 4G6CA 3TYCA 2C13A 2PBOA 1TJ0A 3RMJA 1UKTA 3TYDA