5BNKA

Crystal structure of t75c mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
246
structure length
244
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGCGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 96
structure length 244
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bnkA00
3VNDA 2DZPA 4Q33A 1B4KA 3ANYA 4HIBA 4DF0A 2CLKA 3NZ1A 2JKPA 3MW7A 2E6AA 1FWNA 4CNPA 2IQTA 1ME8A 1W5QA 4Z1DA 2P10A 1PIIA 2Y89A 1CX9A 5F1UA 3PSVA 3P82A 1Z42A 3GKAA 3KX6A 5D2WA 4ONVA 2J24A 1ZJIA 4MLJA 4K37A 3SZ8A 1TQXA 4N6FA 1S5WA 3BW2A 3ZS4A 2DU2A 4JGDA 3IRDA 4AXKA 3HMJG 1HUVA 1VCGA 1VQTA 2E1DA 4ICNA 3W1XA 3EEGA 1GT8A 1KLYA 3CLMA 1ONRA 1XBXA 3KRUA 1FWTA 3GK0A 1TB3A 4CCDA 3TSBA 1KTCA 1VGAA 5TIMA 3QH2A 1K8YA 1OK6A 2E68A 4MOZA 3G8EA 3W2KA 3M1ZA 5FF4A 4IMDA 3MYPA 4J9JA 3O63A 2YPIA 1QMLA 1VZWA 4WY0A 3STFA 1JVNA 1JCJA 4IGHA 1X8FA 3FA5A 4GJ1A 2BX7A 2CLFA 4Z1AA 1WOBA 2NX9A 3VFLA 1XC4A 3M6YA 1Z48A 3TNOA 4Z0SA 3T44A 1TPDA 2W0UA 3PR2A 4NZJA 1YTKA 3W74A 4ZMGA 5F2LA 1BTMA 2VEIA 1TQJA 1LM1A 3ZWTA 2QF7A 3PVFA 1KFLA 4XQ6A 1L6SA 3N73A 3NPVA 2ZZ1A 3STGA 4E0CA 3LTYA 2Y61A 4RR4A 1QO5A 3W75A 4G1KA 2EAWA 4B5NA 1DORA 4YWIA 2YW4A 3M5YA 1DVJA 4LVGA 4BK9A 4IMGA 3NQVA 3IIVA 5DELA 2CFFA 5HWMA 1PCWA 1QDSA 4R53A 2NZLA 4NZFA 4CCCA 1R2SA 2V30A 3GX9A 2RDTA 2YX0A 1X6UA 4N9DA 5F4XA 3G1XA 3LB0A 4NJGA 3CB8A 4K38A 3R13A 1OF6A 1F76A 4O0ZA 1M5WA 1VCFA 4O8RA 3TH6A 3CQ0A 1XBVA 3MO7A 3T7VA 3NM3A 2B7NA 1EPXA 4JNMA 4UNLA 3S1WA 4FX8A 5U7SA 3HJZA 1T8XA 1Z41A 1EP3A 3KRSA 5GVJA 4UFIA 3TA6A 5BMXA 4K8HA 1W37A 1H7NA 3S1VA 5FEPA 3W7JA 1LZOA 1NAL1 3STCA 4UC5A 1O4UA 4S1FA 2V9DA 2JKEA 5CPNA 2V0TA 4MPQA 3HG4A 1DL3A 1R30A 1RD5A 3PC0A 3QM3A 4N4QA 4JTIA 3PSWA 5CSSA 3I6RA 1VCVA 1LORA 1SR9A 1UCWA 3KVJA 3C2EA 1TPEA 3PG9A 5HR7A 3G24A 2HMCA 1QPQA 2Q3OA 2YYUA 2ZZ5A 5CPOA 1TTIA 2VXNA 2E6DA 2NWRA 3P8JA 1XUZA 1W5PA 3E49A 5AHNA 3BW3A 1OYAA 3LBMA 5AYZA 2G97A 1T96A 4PEKA 4MY8A 2ZTKA 3GIYA 4OU1A 4P2VA 4JTTA 3ATZA 4LUJA 3EKZA 2V2CA 1GG1A 4O10A 2X1TA 2OJPA 4GWEA 3QW4B 4KWWA 4O15A 5K7JA 3L66A 4BR1A 4LOCA 4EVZA 3PF3A 5I3HA 1L2UA 4O28A 3KXQA 3TAKA 2V2HA 3I7RA 1G7UA 1A5AA 1G7VA 5G5IA 5CGQA 1FX6A 2W6RA 2YCEA 3C2OA 1OX6A 3QYQA 3TMLA 3MI6A 1KA9F 3RF9A 4UFMA 3THAA 4S2BA 2B4GA 2GUUA 2PURA 3W1PA 2RFGA 3KRZA 4UFLA 3MP4A 4UTTA 2I9EA 2V5LA 3UZJA 3TUUA 3DFTA 5DLCA 4QQ3A 1GQNA 1QFEA 1A50A 3BVJA 3OG3A 4OT7A 1TV8A 3DU0A 1KV5A 3SI9A 3NPXA 4FNUA 4OWGA 3W1LA 4LV9A 1GEQA 4JEQA 4LVAA 5LHFA 3LGEA 1FBAA 3GKFA 1MO0A 3SSJA 1N55A 2A85A 4GUFA 3WJZA 5D03A 3ZFHA 4NT0A 5AYXA 5G2HA 5K2ZA 5I3KA 2TYSA 3INPA 4HSOA 1L6WA 5C55A 2QUVA 1GTEA 4JTKA 1HG3A 4RKAA 3WK2A 3PBUA 3CIXA 1IXNA 5AYYA 4MY1A 3LRKA 4LVFA 4U28A 5D32A 5AOUA 5DBTA 3MI3A 3QQ1A 4LRTA 3LV5A 3PWAA 4RX0A 2QCCA 2QCEA 2A6LA 3SY5A 4JYDA 2A7PA 3PB2A 3B04A 3IIXA 3W22A 3LLFA 3S5ZA 1GOXA 3W7PA 1KV8A 4WY0F 4N6EA 3LV6A 2QUUA 1YXCA 3DI0A 3NPUA 1GTHA 3HPZA 3L5MA 3RLVA 4R33A 1FWRA 1WDWA 5KINA 3NVTA 3IVUA 5D38A 3NL3A 1PHQA 2VENA 5HWJA 3G0SA 4Q32A 3THQA 3K30A 5LNVA 1OFOA 2RDWA 5F4WA 4PL2A 2X1SA 3NM1A 3UNDA 4LY8A 3W83A 2A5HA 1OFAA 3OVRA 3UD6A 3UQNA 4IMFA 4MZ1A 3LHZA 1OX4A 3LXCA 1H7PA 1IIHA 4O12A 4OBTA 2QR6A 4JDBA 4N02A 2TMDA 4DXVA 1AW1A 1DHPA 3A5VA 2QCDA 2Z6IA 4EWND 4Y90A 5D05A 3L21A 3TAOA 1R2RA 3G22A 1OX5A 1Y0EA 1KM5A 3CEUA 4QITA 3DBPA 1FCUA 4JXCA 3IGXA 4FO4A 1O60A 1WBJA 1G4PA 2G5WA 2H3DA 3FJLA 3HG3A 3TR2A 1SO5A 3T40A 4E2BA 4IPJA 1JQVA 3CWOX 5DXYA 4JX6A 5HULA 2VFDA 5HR6A 3YPIA 4QIUA 4XTDA 1ZALA 3ZR4A 4LC6A 4YCPA 5F2GA 5F4SA 4DO4A 3B0UX 1FDYA 3NNTA 4JICA 3CIWA 5D37A 1TTQA 2VFGA 2H8ZA 4M6VA 5LHEA 2C0AA 5CG7A 1QR7A 1OFEA 3FFSA 4AHOA 3C6CA 3M7WA 1YYAA 1ZENA 3GXTA 4O14A 4XBKA 3L9CA 4PCFA 3W7KA 5A8GA 2CZFA 5LSMA 5H91A 4JD4A 4X3ZA 1SO3A 1TPH1 1H7WA 2BWGA 2ZRUA 1X1ZA 2ISWA 3QMSA 5FF2A 3PM6A 2H8XA 1K7XA 4UXDA 2WNZA 3LCXA 2FFCA 3EWBX 4E2DA 3TDFA 4HNUA 5HINA 4RZ4A 1D9EA 4UR7A 3LDVA 4M19A 2ZZ4A 3NDOA 3W1UA 4PL1A 1W56A 1TTPA 1QAPA 3EX6A 3MI2A 3W84A 2ZRVA 4HNTA 3NZRA 2E77A 2ZZ6A 3A22A 3HQ1A 1D3HA 3EWUA 3LTSA 4RZ5A 1KM0A 3I68A 3P8IA 3ATYA 3W70A 3N2XA 4CCEA 1TCDA 2VOMA 2BZNA 1HO4A 2WNNA 4N9CA 2CLMA 4ZQPA 4LC8A 5D09A 4K7YA 3R89A 3DHDA 5KMYA 4EOUA 2E5DA 1AW5A 2ZBTA 4JYEA 2ISVA 2DZWA 2PRHA 2WSQA 3TXVA 3TQVA 4YCOA 4CQAA 1CI1A 3W7QA 3IVTA 4O54A 3CM4A 5HNRA 4QNWA 3BGJA 3QEZA 4R34A 5K9DA 4NNBA 5AHIA 1EWEA 4FNTA 3PUEA 2J9ZA 1OFQA 3WK1A 1O5KA 2OMAA 2VEMA 5L6UA 5F2IA 2J9YA 5EL1A 1P1XA 3VI2A 2CLLA 3LI1A 4ZL1A 1B9BA 1FXPA 5E0KA 4KFNA 3P60A 2E6YA 3BO9A 3KVMA 3VE9A 3M5VA 3L0NA 1QPOA 4BWLC 3FLUA 2ZRYA 2YXGA 4AHQA 2J6XA 2YR1A 1TRIA 3W7CA 1LRTA 3P84A 2XFWA 2Q3RA 1OYCA 1O95A 1KBJA 2ZYFA 2WNQA 3N2MA 3N19B 4OGZA 4AF0B 1O5XA 5I3GA 3LI0A 1M6JA 2TPSA 3NQFA 3W73A 1UUOA 3CWNA 4FB7A 1UASA 4IX0A 4L4MA 3W72A 1VYSX 2CLIA 1K7FA 4OQVA 3LRMA 3DKLA 3OVQA 1LROA 5FEXA 1ZNNA 3TFXA 2Y7EA 5CZ0A 1Z44A 2Y70A 4H3DA 2FB2A 3M47A 2A1YA 2ZRZA 3CC1A 1SW3A 5H2ZA 4QAIA 3QMTA 1O94A 2ISSA 3S1XA 4TMCA 4C1LA 2F84A 4DEFA 4JN6A 3HIJA 1A53A 3GR7A 3VCRA 1PV8A 2QJGA 5AC8A 4UMAA 1H63A 3NPWA 4ADUA 5IM51 1P0KA 4FNPA 5D2VA 2NXGA 3B0PA 2C3ZA 3IIPA 3TQKA 4NJKA 1JCNA 3B06A 1H50A 4WUIA 3UWQA 3S9YA 1S5TA 4PODA 3H54A 4BWLA 1IGSA 1OK4A 4RXGA 3S6DA 3LCHA 3SR7A 4DF2A 3LX9A 1OFRA 1G6CA 3TV8A 5AC7A 4O4VA 4TX9A 2HS8A 5IBXC 4A29A 5DY2A 1P0NA 3O16A 1VJIA 3P61A 3IGUA 4OV9A 2RDUA 4AWSA 2ZCGA 1DQXA 3OIXA 5D30A 1LBFA 4AWTA 3TE9A 1KM3A 3V75A 2ZRXA 3DFNA 2QJHA 3BG3A 5BMWA 1B57A 5MHBA 4DBEA 2QCMA 1P5BA 3NO5A 3MBDA 2J27A 4LTSA 3W7OA 3QSTA 1SSDA 3W1QA 4Y96A 3W88A 1LBLA 4LV4A 2TRSA 1FWSA 1TRDA 3M9YA 4KWVA 1SZFA 3VKJA 1GYNA 1WQ5A 4PC8A 1PVNA 2WV8A 3QW3A 4O1CA 3W7DA 5G4WA 2P0OA 1AL8A 5EKYA 4ALDA 3GB6A 2VFHA 1RV8A 3HPXA 2CZ5A 6ALDA 4I9AA 1LP6A 1RVGA 2V81A 2NXHA 3GNDA 3PS7A 4XTIA 2Y63A 2CLOA 3TIMA 1FQ0A 5HUOA 3TU9A 3B8DA 2ABBA 1BWKA 1DV7A 5EPDA 1A5BA 3TX9A 4IJBA 2J88A 3STEA 5C54A 3Q94A 1XXXA 3ABSA 4XKYB 5ABTA 2NUXA 1TPVA 1XFBA 3TSDA 4DPQA 1KM2A 1LLWA 3LHYA 4JX5A 3DI1A 4WQ6A 3NQ6A 1FCQA 1I2RA 2OT1A 3CT7A 3U6WA 1OG0A 1SW0A 1LOLA 2FPVA 3KVLA 2H3BA 1TO3A 1GVRA 4NU7A 5LNSA 3C3NA 1QNVA 2Y7GA 1Q45A 4TIMA 2FJKA 1TJPA 3S5OA 3TKFA 3UY8A 2DZSA 2AAMA 1G67A 1VLIA 3WJYA 4NJJA 4NX5A 2GVLA 1CW2A 4UFJA 1TV5A 2C15A 2Y6ZA 4IMEA 5K4ZA 2W79A 2JGQA 3C0JA 1XI3A 3KHJA 2ATMA 5A5WA 4YXGA 4JY8A 3HO8A 4Q4KA 1F5ZA 5DY3A 5KZMA 2AGKA 3G0XA 3W7EA 4XBSA 1U5JA 1V7YA 2FLIA 1ME7A 2O7QA 5K4XA 4CNNA 1LBMA 5HQEA 4UCGA 3NG3A 3KOFA 1SU5A 2YFOA 4JS3A 5AN7A 1JCMP 1KTBA 2R14A 1VS1A 1H51A 2CU0A 3DZ1A 2NXIA 4MJZA 1AW2A 1NEYA 4LW7A 1EX5A 1RR2A 4WOZA 3E9AA 4LNYA 3QFEA 5FEWA 3F4NA 1KM1A 3LCLA 2EHHA 4RCXA 1WX0A 4RZ6A 4UTJA 2PRMA 2DZUA 3KAOA 3S1UA 3HGSA 3W07A 5CSRA 2ZZ2A 4E38A 1D3GA 1FDZA 5CZSA 3HGJA 4GRSA 1XKYA 3JS3A 1H1YA 4N9EA 5HUPA 1KBIA 4UTWC 3TW6A 2QKFA 1WA3A 3UWVA 1XM3A 2YFNA 4WD0A 1Q6RA 1G4EA 1MEIA 1SFJA 2VEKA 1SO6A 3P67A 2X1UA 4FF7A 3RMJA 3F4WA 3QRHA 3A9IA 1MEWA 1OYBA 3V1PA 4O16A 1VHNA 5D33A 3N3MA 3FOKA 3L68A 1F2JA 3O05A 3C4UA 1XDLA 5KTLA 1LYXA 1SW7A 1ZAIA 1SQ7A 3DH7A 5G2IA 1F73A 2QAPA 3GDKA 1H1ZA 5EMUA 1OJXA 4O52A 2YDAA 2A4AA 8TIMA 2C18A 4HT3A 4MKNA 4AHPA 4CQ9A 3I7SA 3DKJA 3W7RA 2VFEA 3W9ZA 1KLZA 3UWYA 1GJPA 3GXPA 5J5DA 5FI8A 4O18A 4DO6A 2GVJA 4QJ1A 4O11A 1AMKA 2Y7FA 2A2IA 2GOUA 3L65A 1FXQA 5D2TA 3O6YX 4Y8FA 3GDLA 1TPB1 1G4SA 5FF7A 4CQ8A 3PY2A 3O07A 3PUOA 4K7VA 1QPRA 4UIOA 3HGRA 4ZQNA 4RK8A 1I8JA 4HHPA 2FIQA 1GWJA 3A23A 1C9DA 2PCQA 4JIQA 5CZJA 1KFBA 3PBWA 4LVDA 3EX4A 5F2MA 3QPYA 4NXSA 4BI6A 3B03A 4EF9A 5AFDA 2GQ8A 3MYOA 4WY0B 3M44A 3SIZA 3F03K 4AVFA 3LCFA 4Z1BA 3HOJA 2VFIA 4QNEA 4LS1A 3SGZA 3W3OA 1OF8A 4IWWA 4UR8A 2C6QA 3UWZA 3NYZA 3W6YA 1V5XA 2DJXA 1TPFA 3TXZA 1I2PA 2WKJA 4DBDA 3MMTA 4M7SA 1K7EA 3O1NA 4MY9A 1TMHA 1W54A 2CW6A 1W3TA 3PAJA 2OX1A 2DP3A 3RU6A 3W1AA 1PL9A 3MP3A 3TFCA 1ML1A 2FPTA 3HPSA 4NJHA 2JBMA 3W7LA 4MZ8A 3W2UA 1PCKA 4I7UA 2EPHA 5HMSA 1AL7A 1EWDA 1THFD 3TCEA 3MHGA 2NX3A 3G0UA 3DFOA 4FEZA 3W1NA 4BI5A 4UTKA 3O06A 4KKXA 2HSAA 1YXDA 1PS9A 2CZEA 1XDMA 4PTNA 3G1SA 1DJNA 4TU1A 3U8GA 4NNAA 4MFDA 2DZXA 1RQHA 5HJLA 3MWAA 4UMBA 3BLIA 2C16A 3G3MA 2GJNA 5D04C 3OVPA 3P7YA 1W0MA 4UTUA 4L4LA 3NAVA 3PBYA 1YDVA 1LLZA 2C13A 3QPZA 4JR5A 4O0KA 4JIPA 2DJLA 1FCVA 1K8ZA 2ZA2A 3G1HA 4GNJA 4WOQA 4NQ1A 1FY6A 5C5YA 3TJLA 4ZQMA 3OA3A 3DGRA 1LRNA 3PG8A 1YDNA 1HO1A 5AHFA 3R5EA 5BNKA 1SO4A 3OEXA 3UXAA 3I65A 1EIXA 2NV1A 3LHTA 4AWUA 1F74A 4O53A 1EEPA 3BW4A 3WJXA 1TPC1 3F1QA 5I3IA 3P62A 2Z0IA 3GR8A 1H7RA 4EIVA 1BEUA 1DKWA 1W5OA 4FIQA 4WZHA 5LZLA 2Z1BA 3M41A 3L0KA 1A5CA 2NUWA 2FTPA 4IXXA 3TK7A 1BWLA 3C2FA 1GVOA 3GDTA 1NSJA 4JTLA 3EX1A 4ZZ9A 2A7RA 4A2RA 4HNNA 1XCFA 3WJSA 3EX3A 2EGZA 4W9TA 4HPXA 4X9SA 4A3UA 3BGGA 5CPLA 3GDRA 1LCOA 3BG5A 4XZ9A 2YW3A 1W5NA 3QMRA 1QOPA 3NL6A 4WXZA 3O6CA 2Y85A 3ABQA 3FKRA 5U4NA 1YADA 1UB3A 3BG9A 4X22A 1FUYA 3LCWA 2VKZG 3C2RA 4GUJA 2V82A 4YMZA 3LBCA 4HPJA 3WFAA 4M6QA 3SGUA 1KTNA 3GXNA 3GLCA 1EP1A 4S2CA 2E6FA 4A21A 1Q6OA 5AHLA 1EA0A 4AMAA 5TQLA 3FJ6A 5TBOA 1IF2A 3R8RA 4O1AA 4JTSA 4UTIA 1Q6QA 2YSWA 1NFBA 1OHLA 4HN4A 3NL5A 5LNWA 1C8VA 5I3JA 5G1TA 3NQAA 1TPWA 3FKKA 3CTLA 3GNNA 1SPQA 3GYEA 3WK3A 4WX2A 2NUYA 1GVSA 3IIZA 3M0ZA 3T78A 3PUDA 1TSIA 2Z2UA 3LERA 3P74A 4GBUA 4JTEA 2WQPA 4LS2A 1ICQA 2ZQ0A 3EXTA 3FYPA 1H62A 2A6NA 4XUGA 1PE1A 2ZA3A 2WO5A 2X16A 1KFKA 4H6KA 5EBUA 1SFLA 2ZTJA 1WAUA 3NQDA 1LOSA 3ELFA 4IUOA 4Y9AA 4K36A 2NWSA 5L9FA 1VYRA 1VLWA 4MIMA 5K9XA 1B3OA 3JRKA 4Y6GA 5K9CA 3E96A 2A21A 3W7HA 3Q2DA 3GAYA 3BPWA 4GFSA 2F7FA 1DJQA 2GQAA 1BKSA 4NXKA 1SSGA 1W8SA 3NQ2A 5DN1A 1ICSA 5CPMA 1AK5A 2NLIA 1R47A 5EA9A 4HSNA 4ADSA 4ML9A 2PRLA 3G1VA 2V5BA 2Y62A 2UV8G 3C52A 4MYAA 2ZFAA 4I7VA 1F6PA 3W76A 3TMQA 1OFDA 3JR2A 3IIOA 3QQ0A 3G1FA 1I2OA 3TSMA 2J9XA 2XN1A 1TTJA 5G1YA 1L6YA 4ZQCA 2QUTA 3HG5A 1G69A 3QSRA 3BLFA 2PE4A 3G18A 1HTIA 2BLEA 4GC4A 4LWWA 1MZHA 3N9SA 3P81A 4PFMA 3S42A 1MSSA 3P5YA 4AAJA 1JCXA 3HGOA 2O7SA 1RQEA 3W2NA 4RV8A 4M6PA 2B7OA 4JYFA 1TIMA 4UNKA 2RKXA 1W3NA 4DPPA 3G1DA 2C1HA 5LKYA 3E12A 6TIMA 1EB3A 4ZQRA 4ZVJA 2HS6A 3DFPA 4AEOA 3LTPA 3H55A 4GE8A 2I14A 3O8AA 3C8FA 1OX4B 1ZAJA 1H60A 2ZZ7A 1X1OA 2EF9A 2AQWA 4I7WA 1WBHA 4MZYA 5DCEA 2R8WA 2XN0A 2G96A 4ADTA 2QCDB 5D2XA 3W2JA 1TJRA 5I3FA 3GAKA 1P4CA 3SW6A 4BF9A 3CPRA 1G4TA 2QCHA 3HBLA 3RLUA 1M7OA 4RJEA 1I2NA 2V2DA 4GXMA 3NQ8A 3W2MA 4X2RA 3C2VA 1OFBA 2QDGA 1LRQA 2ZZ3A 2BTMA 3BARA 1YPIA 2P1FA 3KVKA 5FEZA 3NQGA 4UTLA 1E51A 3LXAA 3O6DA 2WSYA 3L5LA 4Z08A 4D2JA 4HNVA 1YPFA 5F1VA 5AC6A 3SECA 3NGJA 5IBXA 4NX0A 4TR9A 4NUWA 3N34A 5E1QA 2NV2A 2C14A 1K3UA 2JKAA 4IMCA 3EKLA 1UBSA 4PA8A 3LLDA 1IXQA 3QJAA 3EWXA 1JUBA 3EWZA 1N8FA 1YTDA 3DENA 1U83A 3EWYA 3NQCA 2VEPA 5DCBA 3OHIA 3EWWA 2YZRA 4YLWA 3IV3A 1WOAA 3A21A 2HTMA 1PHWA 4JTJA 2A7NA 1IXPA 3MHUA 3NQMA 1JCYA 3FIGA 1VRDA 4FNRA 1VR6A 2B7QA 3QC3A 3N9RA 1QPNA 1K02A 4FXRA 3W71A 1DBTA 3EXSA 5FESA 5AHEA 4OHQA 2Q8ZA 1J2WA 1ZCOA 3NA8A 2Q8LA 5D2YA 3RFAA 2E5CA 4UTTC 3EB2A 1IIGA 4RLIA 1F6KA 4GUHA 2E09A 2V8ZA 1DOSA 3BK0A 4Z1CA 3FS2A 5AB3A 3G1YA 1X7FA 3DAQA 2WSRA 3LXBA 3NEVA 3P80A 5K3VA 1FDJA 1GVFA 5KZDA 1OFPA 5KZEA 5EYWA 1MXSA 1QWGA 1TV7A 1WYIA 1F7BA 1W31A 3W1MA 3EX2A 4MYXA 4O57A 2YYTA 4MLRA 3SJ3A 3L0GA 1SZNA 1GVQA 3N14A 3NQEA 3AO0A 2A0NA 1YLVA 4WJEA 1VC4A 3GVGA 3KFTA 4H4IA 5LGZA 1QCWA 1KM6A 3BV4A 1ADOA 3UPBA 3HF3A 3M16A 1L9WA 1XBZA 1JUEA 2YGYA 2XN2A 2ALDA 4IQLA 1ZY9A 1JULA 3UYCA 1R2TA 4C1KA 4JTGA 4LS0A 2CWNA 3FEMA 5E93A 3HG2A 2NX1A 2VFFA 2FDSA 2TSYA 2X1RA 2H90A 3LM7A 1M7PA 3CHVA 1JRCA 5T26A 3G8RA 3LOTA 4A22A 1LTDA 3M5ZA 4O13A 1ME9A 1K8XA 2CZDA 3U2OA 1I2QA 5LGXA 4A2SA 3CEPA 3ABOA 4DQWA 4AF0A 4M5PA 2R91A 2RH9A 3TW7A 4FIRA 2C19A 4OV4A 3LHUA 2ZDRA 4LU0A 3M5XA 4UFKA 4O4WA 1UUMA 2QAFA 2X30A 1JRBA 2RHGA 3S5YA 1WXJA 2B7PA 3WK0A 2QJIA 1VPXA 2Z6JA 1ICPA 3W87A 2VC6A 1C29A 5D02A 4M7TA 4YL2A 1ZFJA 1GG0A 4IOTA 1S5VA 3B0VC 1F05A 4QISA 3MUXA 1KW1A 4PH6A 1MEHA 3LHVA 3DHFA 5LNUA 5FF0A 4XWUA 2PC4A 4MVAA 5CKSA 4RXFA 4CNOA 5HWNA 1RQBA 4LRSA 7TIMA 1FCBA 1EUAA 1Q6LA 3QF0A 1ZHAA 1VHCA 1XUUA 2VELA 4K39A 5BOOA 1TPUA 2WJZA 3Q58A 5FF3A 3WJWA 4ZQOA 1YTEA 4UTWA 3RNDA 4DO5A 4TMBA 1W5MA 4QM1A 3ZWSA 3H53A 4K8EA 1EP2A 3GDMA 4NVTA 4DF1A 1HL2A 2BXVA 3UY7A 1SZEA 1YXYA 4NNCA 4O50A 1S3HA 3S0CA 4HKPA 4O1DA 4JTHA 4JY9A 4FX7A 4FXSA 4MFEA 1GPWA 3NOEA 3RK8A 1NF0A 4OE7A 2Y88A 3LCIA 3Q37A 4BI7A 1JR1A 4FNSA 3L5AA 5BW6A 3L67A 2JGYA 4WXYA 2GVGA 1GZGA 2R94A 3I7QA 3VE7A 3GZ3A 2DORA 4NJIA 3A24A 2GJLA 1W1ZA 1SZGA 4MJMA 1J5TA 2QCFA 4O17A 5KITA 2DZVA 3TC6A 3NXFA 1W3IA 1NVMA 3LRLA 1XL9A 3R2GA 3T4CA 4UUIA 2X2GA 5DBUA 3TROA 4BFAA 1JQXA 4UFHA 2ABAA 4JDYA 3W2LA 1ZAHA 3L2IA 4POCA 4JTFA 1QOQA 3QZEA 4KFPA 2LLEA 4R7JA 3MJYA 2G95A 3G3DA 3C61A 3LHWA 3W7GA 3DXIA 1J4EA 3CU2A 5C6MA 3FYOA 2Y7DA 3PBVA 2H6RA 4O19A 5BRBA 1I45A 5LNRA 1SUXA 1B4EA 2WPBA 1WV2A 4O1BA 2BSLA 5J5RA 4XKYA 3P5ZA 2OT0A 1LDCA 3M43A 4N2YA 2GPTA 4UMCA 3A5FA 2KZHA 4KFOA 2DZTA 3UZ5A 1RZMA 4TO8A 2I1OA 1EUNA 3SFKA 1LOQA 3BLEA 2JK2A 2GQ9A 2QCNA 1KFEA 4ORMA 2FB3A 1QO2A 1RPXA 2ATSA 3B05A 3NL2A 3W7IA 2QEZA 1Q3NA 1AG1O 4UTMA 4MUZA 4IXHA 1JCLA 3E0IA 2WOQA 1KFCA 5DCDA 4QSHA 3B4UA 2QCGA 4DELA 3TC7A 3IGSA 3MHFA 3W7MA 2ZA1A 4AH7A 2ZRWA 1T99A 3UPWA 3D0CA 4K6AA 1H5YA 3W1RA 2QDHA 2CLEA 3PB0A 2B0MA 4JX4A 1KFJA 1VYPX 1FWWA 4Z0JA 5DXXA 2D73A 3UWUA 2OCZA 3IEBA 2OZ0A 5KSWA 4IX2A 1T0OA 3EXRA 4JTUA 1K03A 4UTHA 3TQ0A 3R12A 4LT9A 1OABA 1XBYA 1H61A 1UJPA 1I4NA 3C56A 4LVBA 1ALDA 3O15A 3W7NA 3ABRA 3PULA 4IPIA 4N4PA 1H7XA 3W23A 4EF8A 5SWUA 5C2XA 3G1AA 1GYLA 4P61A 1DQWA 1N7KA 3UWWA 1KM4A 4LUIA 5G4EA 2QCLA 5G2WA 3OBKA 5AHMA 2CLHA 3MP5A 3S5NA 3T55A 3TJXA 3USBA 3LCGA 3NQ7A 1TYGA 4AB4A 4GUIA 1HFBA 3E02A 1OVDA 1YDOA 2E5BA 3DFSA 3S8HA 5CZTA 3W86A 4N9BA 1R46A 5EY5A 1VH7A 3AJXA 2EKCA 1JJKA 1H7OA 3MBFA 1A5SA 4ORIA 3NR0A 2FQIA 2FPYA 4FNQA 3W85A 3IVSA 3UXDA 4U4MA 4GUGA 3DFQA 4FHAA 3W1TA 1TREA 1IXOA 3HB9A 4CLMA 1NF7A 4FX6M 1JUKA
chains in the Genus database with same CATH superfamily
2OSYA 4IQEA 3UW6A 3GD6A 3LUTA 1B31A 2P8BA 3NZPA 5EMLA 1NQ6A 4US5D 2E8ZA 4UR9A 5I02A 1GQJA 1KCLA 3PZNA 4B92A 4ZOBA 4S23A 5HOSA 3NTYA 1ODUA 2GK1B 2F9RA 1Z42A 1M3UA 1B54A 4MLJA 3V0SA 4KWUA 1U2YA 3MCNA 3SZ8A 1WDQA 1R86A 3NYDA 1ZS2A 1S5WA 4KCTA 3BW2A 2V5KA 1TJ1A 3HMJG 3UJEA 1VQTA 3M0JA 3GBEA 2ZUMA 5IOBA 3IUIA 4GY1A 8RUCA 4ICNA 4QROA 3RO8A 2FZBA 4DB7A 2XH4A 1TB3A 1KTCA 4LX4A 5FJJA 2P5NA 2E68A 4LYQA 4MOZA 3G8EA 1KGWA 2DY3A 2YPIA 4A8RA 3AROA 2CESA 3OW1A 1OT1A 4IGHA 3SN4A 2V67A 1X8FA 3E0WA 4GJ1A 1PZ3A 2CLFA 4Z1AA 2WWCA 5HA7A 1OCJA 4PTVA 3M6YA 3GHUA 3TNOA 1KC7A 4DI8A 3BGAA 1E3XA 1EQCA 1YTKA 4F0LA 3W74A 4KRTA 1BTMA 1Q63A 2QF7A 2QYGA 1KFLA 2Y0FA 4B3LA 3KWSA 2YL6A 4RL3A 4LUTB 3WMBA 2ZZ1A 2OXNA 3NFUA 3E3HA 1H49A 3UT0A 1OCBA 4G1KA 1GW9A 3N2BA 3PPCA 2R1LA 3UWEA 4G1NA 2YW4A 3WLLA 2WLZA 3AIWA 2YCLA 4NZFA 4DVOA 3GX9A 3EPOA 3TONA 2G50A 1CECA 2VMFA 3T4WA 3UG5A 1X6NA 1Y5WA 2PWEA 1JPKA 4O0ZA 3A9BA 1M5WA 3CQ0A 1KXHA 1EPXA 1O12A 2XIOA 3CT2A 2D22A 5U7SA 2EPOA 2YL5A 1XH2A 1IWAA 4IMAA 4UFIA 2J25A 3PZOA 2ZXBA 1G94A 3TYZA 1SFTA 3CHFA 3EAUA 3PN8A 1JF5A 3H4WA 2J7CA 3STCA 4OFCA 4S1FA 2VX5A 2QMJA 2HXTA 3BJTA 5CPNA 4MPQA 3S46A 3W81A 4C6LA 4N4QA 1JZ4A 2WHLA 4JTIA 5HNNA 3FSTA 5CSSA 1VCVA 1LORA 1DE6A 3WMCA 1SJBA 5HR7A 3U7BA 2QV4A 4LAZA 1NARA 1C7SA 2YYUA 5CPOA 1TTIA 3MCOA 3R0KA 4NAFA 1CLVA 3NIYA 1XUZA 9XIAA 2WC7A 1PYFA 3ONCA 3E49A 4CD8A 7REQA 1OYAA 3GW0A 1SZRA 5AYZA 1FTXA 2IKJA 4GQRA 3AIVA 2ZTKA 4OU1A 3LA4A 4JTTA 2V2CA 4H19A 1Q2SA 2IQ0A 3H2MA 4LYRA 2X1TA 1JXKA 4LUSA 1W8GA 3VIGA 1R0MA 3KXQA 3LY0A 2C1IA 1P1MA 4HTBA 5G5IA 1XCWA 2W6RA 1JGIA 1P7TA 8XIAA 3C2OA 4Q8TA 3R8HA 3UF9A 1Q6EA 3THAA 4S2BA 2GUUA 1ELSA 4MM1A 3KRZA 4UTTA 4YTRA 2QJNA 1R3VA 3TUUA 1W1VA 3DFTA 1R3WA 3TZNA 3PAOA 5H1WA 2FHBA 4QSFA 1JXJA 1S5MA 4OT7A 2O0TA 3DU0A 4IFRA 3LEPA 3SI9A 4FNUA 1BFNA 1DXEA 1REQB 4YNGA 4RNIA 1E71M 4JEQA 4LVAA 3GVWA 2D3LA 1E6RA 5BXRA 1FBAA 3U48A 4HYWA 4L9ZA 1N55A 3WLNA 3AXKA 2IS7A 4AD5A 4YTTA 2G8ZA 4PGLA 5AYXA 5A6LA 5G2HA 1KKOA 4IP7A 4IL0A 3S1GA 1E5NA 5FOOA 5J8LA 1U22A 3WIJA 1HG3A 3KBMA 5T91A 1CNVA 1GQKA 3PBUA 1RCOB 1V03A 4LVFA 4Q6JA 1QRQA 1MNZA 3A4WA 2WJDA 2QCCA 3NSNA 4XAGA 2PDLA 3LLFA 2PPGA 1GOXA 3W7PA 1E56A 1KV8A 4N6EA 4TV6A 5E09A 1DWHM 2Q09A 3NSMA 3NPUA 2QW5A 1E73M 1VFUA 3RLVA 4R33A 1FWRA 1WDWA 3IVUA 5LA2A 4I6VA 3NL3A 3WQCA 5DF0A 4GGHA 3K30A 1OFOA 5BWAA 2HJPA 3UNTA 4IGMA 4P8XA 4LALA 2NQLA 1ECQA 3OVRA 1JDDA 2X09A 3LHZA 1RJQA 4GABA 1XIIA 3ZJ6A 1MXDA 2QR6A 2TMDA 2Z2AA 1NOUA 1TZ7A 5LIKX 3A5VA 2QCDA 4EWND 1XYZA 4Y90A 4Q8UA 3K4DA 1XRTA 1YKWA 1XRVA 3W53A 4QEHA 1XP3A 4D6FA 2BY1A 2AMGA 3LQLA 1UR9A 4F66A 1GCYA 3S47A 1WBJA 4WK9A 4QR6A 4BKNA 1TR9A 4EAMA 1JQVA 1HJSA 4KF1A 5HULA 1GKRA 2FYMA 2VFDA 4HHMA 5LIWX 3YPIA 4UTFA 2G41A 3AWOA 1KRCC 4HYVA 4JICA 1E6QM 4GISA 4WKAA 2VFGA 3H12A 2H8ZA 2O9TA 4M6VA 5LHEA 1LJYA 5ABGA 1TMLA 5CLWA 4H2CA 1OFEA 5CJ5A 3FFSA 5EFDA 2AOSA 5E6ZA 1I75A 4J7RA 4XBKA 5ENLA 3W7KA 2CZFA 3OP2A 4JD4A 1TPH1 4NZ5A 4F48A 2REQB 4UXDA 1GGOA 1CXIA 1XIMA 4MWAE 1MFUA 2J78A 2C1GA 4HU0A 4L64A 2BHUA 4AZGA 2ZVIA 1QAPA 2ZRVA 2CYGA 3NZRA 4J4KA 2VZTA 2ICSA 2ZZ6A 1DYSA 3GZAA 3BLPX 2HK1A 3LTSA 4RZ5A 1KM0A 4KCUA 3GVQA 3W70A 1T41A 3N2XA 1ENUA 1IGWA 1UH4A 2F2HA 3N2TA 2VOMA 1HO4A 2J66A 3BMXA 4N9CA 4ZQPA 1W3KA 1DP0A 5D09A 4K7YA 3R89A 3DHDA 5KMYA 2QJMA 2IKIA 2PRHA 2WSQA 4AYGA 1G9HA 2WM1A 1X97A 4CKQA 4F9DA 4O54A 5K9DA 2OQYA 2P3ZA 1EWEA 2Y5EA 3PUEA 3WK1A 4YWSA 5L6UA 2EPMX 4X2PA 5F2IA 2J9YA 4H00A 3UCDA 2OO6A 5HPOA 3KVMA 3SSZA 1QPOA 1GQLA 2PWGA 3FLUA 2QS8A 4AHQA 3LGDA 3RRAA 3FYYA 1XLMA 4LBRA 3EA1A 3GBDA 1OYCA 3JZEA 4PUDA 2WNQA 3RAOA 1HP4A 4OGZA 2TPSA 1EJUC 4CUCA 4Q4OA 2JQXA 1E9YB 2C79A 4H8UA 2YCJA 3W72A 4NHVA 4HQVA 4GK8A 4P8UA 1K7FA 1DWIM 2CBIA 3WD0A 3LRMA 4JN7A 3WLHA 6TAAA 1H2JA 2ANUA 4L4PA 5FEXA 3QBUA 1ZNNA 1QI0A 1PWLA 3TR9A 1YBQB 4BQ4A 5H2ZA 3QMTA 2ISSA 3S1XA 3ZIZA 3V5OA 5A6BA 4W7UA 4WSHA 1A53A 3GR7A 4I5XA 1PV8A 2EJAA 4UMAA 5D9PA 3NPWA 3BXWA 2V3FA 2C71A 4HK7A 2PDWA 3HQNA 2G3FA 3IRSA 5D2VA 3IIPA 3CQJA 3B06A 1H50A 4CN1A 1F61A 5JIPA 1IGSA 3LCHA 4DJDD 3Q4DA 4IPNB 3LX9A 3UG3A 1G6CA 4E4UA 3B8WA 4O4VA 4TX9A 4A29A 5A3HA 1TUXA 2IPFA 4B3ZA 1F3TA 1ITQA 1VJIA 3P61A 4OV9A 4BS0A 5JBDA 4XZLX 1DQXA 4IQJA 1H4PA 3OIXA 1QASA 5D30A 3PFRA 3K4WA 4C6IA 1B57A 4KW2A 3A47A 4M82A 4TQTA 4UQDA 4AFYA 2JF6A 3ALFA 3GTIA 3W1QA 1LBLA 2XHYA 4A4AA 1KR0A 1BXBA 1FWSA 5AKQA 4L1WA 4JFWA 4FOJA 5IDIA 2WHKA 3IAQA 1EOMA 5G4WA 3LLXA 3JVAA 3K1GA 5EKYA 4ALDA 4DY1A 3HPXA 4XD5A 3LS9A 3OTRA 4PMQA 3EYPA 2V81A 3IV8A 1F3EA 3EA3A 1E1CB 1VBHA 3TU9A 2Z1KA 3B8DA 3KL5A 4K3ZA 3H23A 3AYTA 1RD6A 1P0EA 4IPPA 4DI9A 1XXXA 1XFBA 3LPOA 4BY3A 3A3XA 4JX5A 1BWVA 3DDMA 1RA0A 5JUVA 1F4HA 2OT1A 2FTYA 3KVLA 5C9XA 3U4AA 4A8NA 4HA1A 1CXFA 3LG3A 2HE8A 2NV9A 1RHCA 1G67A 2J8FA 4NX5A 3IJLA 2GVLA 6REQA 3UPMA 4UFJA 3AXMA 1TV5A 2W79A 4LUYA 2JGQA 5TNVA 5A5WA 2ATMA 3LMYA 4I3GA 2AGKA 3G0XA 3H7UA 4FK9A 4EXAA 3W7EA 3VUPA 1VBJA 3RX3A 1UHVA 1B0IA 4LB4A 1NQKA 5K4XA 4GKTA 1LBMA 4CNNA 1V0NA 3KBNA 3KOFA 2ZX5A 4XAFA 4DWSC 1JCMP 1Q8JA 2Z24A 3PTMA 1AW2A 1NEYA 4AC1X 4MUPA 4LYPA 4QG8A 4FPSA 4LNYA 3TZFA 5FEWA 3F4NA 1KM1A 4RCXA 1ZCCA 2BBFA 1A3XA 3S1UA 2ZZ2A 1D3GA 1FDZA 3R6IA 3HGJA 1XKYA 1E3ZA 1KBIA 3UZZA 3AXXA 3TW6A 3ZJ7A 3LBOA 3M4HA 1XM3A 1Q6RA 1G4EA 4A8LA 1CZ1A 3WQGA 2VEKA 4BQ5A 4J3VA 4FOUA 3B0XA 5D33A 1UA3A 2C0HA 3FOKA 4FR1A 3WQDA 3O05A 4XAZA 3C4UA 3IUDA 3PUGA 4G7FA 5C0QA 1F73A 1UA7A 1PTGA 8TIMA 3VC6A 1FH9A 2E40A 3BURA 2EPNA 2FHCA 4IGSA 4AHPA 4KESA 2DIKA 4WF7A 1EGVA 3DKJA 3I7SA 5I06A 3UWYA 5J5DA 3ZO9A 2DDXA 4DO6A 2A2IA 2HDJA 1FXQA 5D2TA 5FF7A 1G4SA 2VOTA 2WCGA 4FOKA 3PY2A 5EGRA 4K7VA 3W24A 2WM0A 1I8JA 2X05A 4IFOA 4E2OA 1R87A 2FIQA 3LNMA 1C9DA 3TA9A 4X0VA 1YDYA 1ZP4A 1VBRA 1OD0A 5F2MA 4NXSA 4BI6A 1E0TA 3B03A 2HROA 4EF9A 4ASTA 3H4XA 2HWGA 4Q8NA 4QG6A 2NQ5A 3LCFA 3GXMA 1NTHA 2VFIA 3OZPA 4WKFA 1OF8A 3UWZA 3K4AA 1TPFA 3POHA 3PPFA 1EJ7L 3UJRA 3B8SA 3RN6A 3VDHA 4DO7A 2CW6A 1P6CA 2ALRA 1W3TA 4UOZA 1YNQA 2Y5SA 4AZ7A 4HNCA 2FPTA 4WJ8A 2ACQA 4MZ8A 1PCKA 4I7UA 2EPHA 2ZWZA 4PR4A 3EMQA 1THFD 3TCEA 4L9XA 2QDEA 1EJXC 4YHEA 2NX3A 2CKRA 3CZ8A 3FXGA 2A3EA 3WX7A 3C86A 4DZHA 4FLOA 2HZGA 1RK6A 3RR4A 1ZRQA 2CZEA 3I6TA 4PTNA 1YX1A 3T1GA 4MFDA 1RQHA 3L4VA 3BLIA 1Q6CA 1E0UA 2GJNA 3MKVA 3P7YA 3AZSA 4L4LA 3V0TA 3DUGA 2C13A 1LLZA 4W8BA 2WVVA 4V1YA 2VUYA 1K8ZA 2ZA2A 3G1HA 4WOQA 1P6BA 5C5YA 3TJLA 3PPHA 1X7IA 2AAAA 3OA3A 1F3WA 1YDNA 1A5MC 2HVMA 3VD4A 1HZYA 3KDOA 3WQ6A 2GDVA 4IG2A 4A8IA 1JDCA 1EIXA 3PHAA 4AWUA 1UR3M 1EEPA 1TPC1 3WLOA 4EIVA 3AHXA 3WNNA 3M6DA 1E6XM 3KW3A 4IIHA 3M41A 3L0KA 5CPTA 4WHBA 1JZ5A 1BWLA 3C2FA 1GVOA 1NSJA 8CGTA 1AD4A 3VKDA 3WQOA 2WVSA 1EF3A 3CUFA 3GTNA 5KZ6A 4HPXA 4A3UA 4FMVA 4LAOA 5A6MA 4LCSA 1YNYA 1W3HA 4IPLA 1NDVA 2EJ1A 3QMRA 1QOPA 4PB3A 3NL6A 2D24A 3ITGA 2VC9A 3MJMA 3WQEA 2I9UA 2J7EA 3GHTA 3GWQA 1GHSA 3KE0A 4X22A 1IT7A 5M2FX 3LCWA 3C2RA 3CZEA 3O0KA 3MVTA 2CKSA 4HPJA 1J18A 3V5FA 4M6QA 4BQ3A 3GLCA 1IWBA 1EBHA 3GC2A 5TQLA 3WNLA 3A4XA 4JTSA 2FVLA 1Q8AA 2YSWA 1W9BM 1NFBA 1PYMA 4HN4A 3FDKA 3NL5A 4XO7A 4M3PA 2FVMA 2PWVA 3KEHA 3GNNA 4LXFA 3ES7A 2XVLA 3LENA 3HA1A 4H8VA 4GBDA 3LERA 2WQPA 4LS2A 1ICQA 1JFXA 7XIMA 2A6NA 1TE6A 2WO5A 2ACUA 4H6KA 4LBSA 5M1TA 2QVNA 4HJWA 3K13A 2I57A 4RDWA 4S3AA 5CAKA 5FAGA 1FH8A 5E0CA 3PNUA 3EOUA 5LYRA 5IFPA 4TVCA 1BPLB 3ZT6A 1BKSA 5HJYA 1W8SA 4J3WA 1AK5A 1PJ9A 4GI9A 5EA9A 4ADSA 5AYBA 1NWTA 4HOXA 2FMNA 7CGTA 2PWHA 3DESA 1R85A 2UV8G 1Z32X 3APGA 2ZFAA 4JTRA 5FSDC 2XN1A 5G1YA 2QUTA 4DM2A 2XVKA 1R3RA 1VFFA 3W27A 3P81A 3S42A 1MSSA 4AAJA 3HGOA 1HVXA 3IJQA 2O7SA 1RQEA 1WKEA 4RV8A 1ZJAA 1FWIC 3L4TA 1TIMA 4UNKA 4UBPC 4ECLA 4DPPA 1WDSA 3E12A 3DFPA 3LTPA 2E25A 3BE7A 3C8FA 3ZR5A 1OX4B 1ZAJA 3WNMA 4AQLA 4LAKA 2ZZ7A 3LQGA 2EF9A 4L80A 1TV2A 4MZYA 2XN0A 3DC0A 1DTNA 3SUWA 5I3FA 1P4CA 3APTA 1QNOA 3SW6A 2WMKA 4GVIA 1GOIA 3SN0A 1QUMA 4RDVA 2BV9A 1UR4A 1EO5A 3VNZA 1JCTA 1DJWA 5CC3A 1F3XA 4X2RA 3URQA 3C2VA 1A5OC 2XGIA 1OFBA 4UQBA 2W67A 2BTMA 3KVKA 3NQGA 4UTLA 3O6DA 2WSYA 2WZMA 1CGYA 3L5LA 4F79A 3HPAA 4HNVA 5F1VA 3SECA 3NGJA 5IBXA 5HANA 4UOQA 3D46A 3E0VA 4TR9A 4NUWA 1TMQA 3S6TA 2I5IA 3U2CA 3XIMA 1IWPA 1L0PA 3LLDA 3QJAA 3EWXA 3TN4A 1MWOA 2GJXB 1EZWA 2VZUA 4GY7A 3NQCA 4ZE5A 1VFOA 2E0PA 3A64A 1CYGA 4Q4SA 4I9MA 1IXPA 4LY4A 3FIGA 1VRDA 2XFFA 3EBVA 1EHAA 3QOKA 1JDFA 1ZP3A 3N9RA 3KL0A 4F0KA 1ZJBA 3VMOA 4LNCA 3FAXA 3W71A 1DBTA 4ATLA 4PBGA 2PDCA 2Q8ZA 5REQA 3NA8A 2Q8LA 9RUBA 1ZUAX 3MSYA 1FHUA 1F6KA 4QXIA 1LG2A 2XJ7A 5A6KA 3SUVA 4KPLA 3AHVA 4AD4A 4EPKA 3U7VA 2OEMA 3DAQA 1BSIA 2H9AB 3BLOA 3TTSA 4D6IA 1B3XA 3GG1A 3AUJA 4BF7A 1O1HA 1SMDA 4A3QA 1OFPA 4H7VA 4PULA 1WYIA 4MYXA 4O57A 3SJ3A 3CYVA 2FKPA 3BZJA 1VC4A 3SUTA 3GVGA 3KFTA 3AXIA 3BV4A 1TVLA 1ADOA 1WO2A 5M17A 3MZ2A 2X7WA 2ALDA 1IEQA 3CIVA 5CLTA 3G6MA 2ZXDA 3UYCA 4C1KA 2CWNA 5E93A 2QDDA 3HG2A 3E5PA 2TSYA 1TV4A 4TX8A 2CXEA 5T26A 3G8RA 3LOTA 2Z29A 4A22A 1W3JA 2DH3A 3FA3A 3XINA 4O13A 4P7QA 5M03A 5LGXA 2XTKA 4M6UA 3ABOA 5CH9A 4DQWA 4AF0A 2YB4A 3GU2A 4KWOA 1PBGA 3TW7A 3WEOA 2C19A 4OV4A 3QVQA 3QLDA 4CU6A 3LHUA 2ASHA 3CUIA 4XZMX 1JI2A 1QHOA 5IHRA 2B7PA 2QJIA 1VPXA 2Z6JA 4W89A 1C29A 3AQUA 4M7TA 2BDQA 1GG0A 1B3VA 1MI3A 2JIWA 4GY0A 5D8ZA 2VVSA 1KO0A 3MSDA 1QOXA 2O4QA 4XWUA 1V02A 5CKSA 2IMRA 1YE4A 3PJUA 1RQBA 1DPMA 3ZMRA 3S9ZA 3DFHA 7TIMA 3BAWA 2OX4A 1Q6LA 4PMJA 1TJ2A 1XUUA 3ARUA 1FWGC 4MAVA 3NQBA 4ZQOA 1YTEA 3RNDA 1ZPTA 4B2DA 4H9MA 3MKKA 1DWGM 2QPXA 3IWPA 3IK2A 4C6PA 3HN3A 3RCNA 2AL2A 3PZQA 2UY4A 3CL6A 2KX9A 1UUQA 2PTYA 1HL2A 3CV6A 4GX9A 1OZMA 4CVWA 4M8UA 4ZENA 4NNCA 3KS5A 4B9YA 4RDYA 1XPGA 1JR1A 2OYKA 3AXHA 1OB0A 3L67A 2GVGA 1GZGA 5HPCA 3VE7A 2DORA 4NJIA 4PB5A 5FAJA 1AJZA 4H9UA 5DO8A 1BG9A 3WUEA 2DZVA 3Q65A 3TC6A 1Q5MA 1HKWA 1EGZA 4XZBA 3TTQA 4YVPA 4Z2LA 1NVMA 2AKMA 2CEQA 1XL9A 4BFAA 1YPXA 1E9LA 1JQXA 4JDYA 1QXLA 2QUNA 1ZAHA 3L2IA 3L2MA 1OT2A 4KFPA 3GDBA 1EC7A 2LLEA 4YTUA 1NWRA 1PX3A 4EACA 1ITXA 3V18A 3APYA 5C6MA 1TELA 4XV0A 3PBVA 2HE5A 1VEOA 5LNRA 1CLKA 4KERA 1D8WA 3IANA 1QWKA 1WV2A 4I8DA 4O1BA 4A35A 4B3KA 1CGWA 5J5RA 2PDIA 3SRHA 2NQZA 2Z1WA 5GNXA 1E4LA 4U33A 1ZGDA 4TO8A 2I1OA 4AD0A 4U5IA 2VP8A 2BVWA 1DJGA 2XSBA 2JK2A 1EH9A 2QCNA 3WD4A 1GW1A 3QHOA 5CSYA 3W7IA 4UTMA 3ZJ8A 1U1JA 1V77A 4QSHA 4DELA 3IGSA 3UBPC 1E4NA 2EKGA 2PF0A 4D1JA 1H5YA 1SGJA 3VTRA 3ZM8A 2OZ3A 4MF4A 3UG4A 1KFJA 3QGAC 4Z0JA 3ARPA 5DXXA 1TVNA 3N12A 2X0YA 4GYPA 2OZ0A 4IX2A 1T0OA 2E9LA 1K03A 2F6KA 1OZQA 4PEEA 3UA4A 4DUWA 4DXXA 1Y7VA 4Q8OA 4N4PA 1DWJM 4C7FA 1W1B1 5SWUA 3G1AA 2YCKX 3UWWA 4LUIA 4MWAC 2Y24A 1UZDA 1EHNA 4GGBA 3M7SA 3MP5A 3S5NA 3TJXA 1HJXA 5C7HA 3H26A 3N29A 1J0HA 4GJIA 4AB4A 1KCXA 1YDOA 2E5BA 4J2PA 1VFTA 5CZTA 3W86A 4N9BA 3WELA 3EB4A 1H7OA 1V3MA 4ZODA 2BFGA 4ORIA 2FQIA 3IVSA 2BGQA 4GUGA 4S3BA 4H6EA 4CLMA 3ISIX 4G2DA 2XDFA 2DZBA 1P48A 5CZKA 3ZLFA 1WAWA 2QNEA 2WZHA 4B5WA 3IPWA 4OUEA 4DF0A 2CLKA 4D71A 1EBGA 3LPFA 5DMLA 5CQ1A 5ECUA 1FWNA 4CNPA 4RV3A 4Z1DA 3H7VA 3C0QA 2DUXA 1E40A 2Y89A 2Z7KA 1CX9A 4OBRA 4XX6A 4BF5A 4ZXLA 2XM2A 3KM8A 1YIXA 3P82A 4Q8VA 3CZGA 2V69A 1ZJIA 4S3FA 1C93A 1TZZA 4JFSA 4AY8A 2YZ5A 3DG3A 2VD8A 1TQXA 4MWAA 1XYBA 3EOSA 1IT0A 4AXKA 4KIRA 2EG7A 3GYCA 3PTDA 2NQJA 3WDQA 3QV8A 1H0IA 1TA3B 3EEGA 1GT8A 2Z26A 4PTDA 3KRUA 1FWTA 2VD9A 4CCDA 5TIMA 4ES4A 3QH2A 1K8YA 3R4IA 4C7GA 3M1ZA 4IMDA 4WGXA 4EXQA 3O63A 3ANVA 3STFA 1JCJA 1LWJA 2QV5A 3QV7A 3FA5A 1EDTA 3ICJA 1XC4A 2V3GA 1Z48A 4PUMA 4Z0SA 3T44A 2W0UA 1IEWA 1XLIA 3VM7A 2VEIA 1TQJA 1LM1A 5I6SA 3QGVA 3E0LA 4H2HA 4US5A 3VIFA 5I79A 1U1UA 2Y61A 4RR4A 1QO5A 2VHLA 4B5NA 3MZNA 3LSBA 3M5YA 1DVJA 1LQAA 4BK9A 2UY5A 5DELA 2PBGA 4WDTA 1R3YA 4JTAA 4MADA 1AQ0A 4D72A 3IJ8A 2NZLA 4MNKA 2PWDA 1R2SA 3NUKA 2RDTA 1ZJHA 4UZUA 1W2VA 1X6UA 4GVHA 4LAMA 4YTSA 4X9YA 1OCNA 3TWBA 3VABA 2UY2A 1F76A 1K77A 3TNBA 2WKLA 3EEZA 1XBVA 3T7VA 1QJWA 4FX8A 5ABFB 1EX1A 3B8TA 4JQAA 5LA1A 1W37A 3PBGA 3S1VA 1QI2A 1X1NA 1DWFM 1OCQA 2V9DA 3OYZA 3STPA 3A13A 4AZCA 1GOMA 1RD5A 3PC0A 4RE4A 3PSWA 3ZVHB 4HA0A 3WUBA 4S3DA 3C2EA 5AZ1A 2QGYA 2G3NA 1Z9AA 4MKSA 4MB4A 2ZZ5A 2E6DA 2GSHA 1XLGA 1PSCA 1DXFA 3H2EA 1JNEA 2UWFA 4JHMA 3EDFA 2VM8A 1E4MM 3NGFA 3CH0A 1RA5A 4LUJA 2OWCA 1GG1A 2DPEA 3GH5A 1J0YA 2OJPA 3QW4B 4O15A 3A12A 5K7JA 1AUSL 3DX5A 3M0LA 4LOCA 4LF2A 4AU0A 1L2UA 4AY1A 2A3CA 1CXLA 2V2HA 3TCSA 2PTXA 1UD8A 3LPPA 1XICA 4UCFA 1YHTA 4RNFA 5CGQA 2YCEA 4I9TA 4TOQA 2X8RA 1OX6A 3KOWA 2Y2WA 4UFMA 4IH3A 5CBBA 2RFGA 3MP4A 5JBFA 1B30A 2EPLX 5GJPA 2O9OA 4QQ3A 3OG3A 3NPXA 3W1LA 4LV9A 1VPYA 1GEQA 2B81A 5T9BG 1US0A 1PZ2A 2GUBA 3N25A 3R8GA 1MO0A 1WKFA 3WJZA 1XIBA 5D03A 3ZFHA 1FRBA 3VA8A 2AKZA 4GYKA 1TIWA 3L12A 5I3KA 3M0XA 2TYSA 3INPA 4RPQA 2WVUA 1JZ7A 1R7OA 1GKPA 1OG6A 3WK2A 5FL1A 5AYYA 4MY1A 4ZB0A 3MI3A 4HU3A 3PWAA 2QCEA 4CD7A 2HVOA 2A6LA 3SY5A 1FH7A 3CTTA 4JYDA 2A7PA 3PB2A 3SO7A 3CXOA 3W22A 3S5ZA 1CXEA 3S3GA 4WY0F 4ZFMA 3OU8A 3VD9A 3HPZA 4REQB 3OPSA 3RU8X 3ZYZA 1J0KA 3E6EA 5F7UA 2JE8A 1XIJA 2VENA 4Q32A 3THQA 2RDWA 1FWHC 1AQHA 5F4WA 4PL2A 4J3XA 3RPDA 1J11A 2VURA 3NOYA 3UQNA 4IMFA 1IIHA 4ZA0A 4JDBA 5HQMA 1EIBA 1AW1A 1DHPA 2Z6IA 3KHDA 3II1A 3VFCA 5D05A 1R2RA 2PDUA 1OX5A 1Y0EA 1KM5A 4ZB2A 2C7FA 3QHMA 4F8XA 3DBPA 3DHPA 4ACZA 1EC9A 2FTWA 1DWAM 3TN5A 4XD4A 1T6MA 1S38A 5AZ0A 4RDZA 5JVLA 3GVRA 4GNVA 2TODA 4LC6A 5F2GA 3GO2A 4XG1A 4JTCA 4IT1A 3MY9A 3LM3A 3N4FA 4WDXA 3WBXA 5CG7A 2BG5A 4QTGA 2CBUA 3GU9A 1XLEA 4C90A 3QTPA 3KP0A 1GPFA 3L9CA 5H91A 4O1FA 3VDGA 3REQA 1SO3A 1BRLB 3N2CA 2PD5A 2ZRUA 2OSWA 4X0NA 5FIPA 3VK5A 2ISWA 1HJWA 1BLIA 1OD8A 1K7XA 4YHGA 2WNZA 4LCRA 3CZJA 1TG7A 3TDFA 5BOFA 1MZRA 2PP1A 4HNUA 1QW9A 1D9EA 4UR7A 3H2AA 2ZZ4A 3LMZA 4PL1A 3KCLA 1W56A 1V93A 3U57A 1HW6A 4Z42C 4HNTA 3ZLGA 2Z1SA 4KGLA 3ATYA 1VFSA 2G3MA 5H8MA 3E38A 3TTYA 2ZBTA 4JYEA 1AD1A 2ISVA 3TXVA 5DT7A 1CI1A 3ES8A 3UZWA 3W7QA 2PWFA 3CM4A 4CD4A 3BAXA 4QNWA 3AS3A 3A3HA 3QEZA 4R34A 5AHIA 3F4VA 3DC8A 1O5KA 3B9DA 5I23A 2GL5A 4PN2A 5EL1A 2CLLA 4ZL1A 1NFGA 1RP9A 3UXIA 4DAIA 4IP5A 2O9RA 3ARXA 1OC6A 1V0MA 3M5VA 3L0NA 4M24A 3GH7A 2ZUUA 3NEHA 4GZ7A 3CYJA 3SY8A 1CIUA 2J6XA 2XFWA 2Q3RA 5GQBA 4AZ5A 1O95A 4E8CA 1O5XA 4D8ZA 1M6JA 1W32A 4Q4PA 3KP1A 3NQFA 3W73A 4OBSA 1XX1A 1POJA 3ARQA 4PRTA 5A1AA 4IX0A 3RRXA 3LN3A 1E0XA 2CLIA 5GNZA 1X98A 3OVQA 3W00A 2IW0A 1QI3A 2VDGA 4DWSB 3PFMA 2Y70A 1J0IA 5DFAA 2BOEX 4NAEA 1LL6A 2J7DA 5KEZA 3KTSA 6CGTA 1O94A 2PDGA 4TMCA 3HFYA 1LL7A 1PEZA 4QE4A 4YVVA 3VCRA 2QJGA 2JEPA 5AC8A 2OOGA 1KD0A 2Y1HA 4ADUA 5IM51 1P0KA 2UY3A 3WLTA 1UP2A 3B0PA 2C3ZA 3K8LA 1JCNA 2CXGA 1Z8AA 2OEKA 2EBNA 1XG4A 5LA0A 3AICA 3MDWA 4HOZA 3T8QA 2BVTA 1XSKA 3TV8A 1GVEA 3T0TA 5A8MA 3DOPA 2A3BA 1KKRA 1GZ1A 2DSZA 3DBNA 1IHIA 3O16A 1QBAA 1SYTA 3IGUA 4NF7A 4HPHA 4L9YA 3GQYA 1LBFA 3DFNA 4JHOA 1O66A 2WMHA 5I03A 3L4UA 5MHBA 1P5BA 3FNDA 2OO0A 3BAJA 3SCUA 3W7OA 5J04A 1VENA 3VGDA 3W88A 4MGGA 1TRDA 3M9YA 3AIEA 5AECA 3WNKA 1VD6A 3VKJA 3FV9A 3AYRA 4PC8A 4XB3A 1PVNA 2IPJA 2EEXA 4O1CA 3TYBA 3POCA 1BYAA 4L56A 2P0OA 4XKMA 3W26A 4ACYA 2PS2A 3T0CA 1RV8A 4XISA 5BZAA 2P50A 3M0MA 3WF4A 1LP6A 2D2JA 4E2VA 2NXHA 1CXHA 4XTIA 2Y63A 3IJ6A 5HUOA 4NRRA 4QG9A 1BWKA 2XSXA 3E2RA 2FGBA 4J3UA 1VJZA 5EPDA 4DJDA 3TX9A 2BGNE 4FI4A 4QGCA 4R7WA 1IZKA 1OIFA 3TYUA 3ABSA 4IQDA 1XW8A 1KM2A 4C1NA 2J8TA 3DI1A 1WZKA 3ITTA 2R82A 2ISDA 3NVDA 5BCAA 2FH8A 4J2MA 3VGGA 2PMQA 3U6WA 1SW0A 2FPVA 1E6SM 4JFVA 2YL8A 1LUCB 4XSMA 5LNSA 4HPGA 1Q45A 2XH0A 2FJKA 1TJPA 3T09A 4LYKA 3UJFA 1FWFC 3UY8A 2EPKX 2AAMA 1VLIA 3BQ6A 3QR0A 4ZOEA 4IMEA 5K4ZA 2W9MA 2HBVA 1DE5A 1LT7A 4JY8A 1TWIA 1F5ZA 5DY3A 2FZMA 3VNJA 3ORWA 4D6GA 4XBSA 6PTDA 2QZRA 4P7LA 4RW5A 4C5ZA 2FLIA 1ME7A 5HQEA 3FXYA 3NG3A 4C6EA 2XINA 2A3AA 4JS3A 2Z1VA 2R14A 3N2OA 1HJUA 4G56A 2CU0A 1JYWA 2NXIA 4MJZA 1E4IA 1M9HA 2OQLA 3GTFA 3E9AA 4XBJA 1VIZA 3QFEA 4OECA 1VJSA 3GTXA 2EHHA 3THCA 2INFA 4RZ6A 1QNPA 4UTJA 2PRMA 3KAOA 3GXDA 3HGSA 4HMEA 5D9NA 4LBUA 1PUDA 3ABZA 1BQGA 1HX0A 5CZSA 3JS3A 2ZUNA 4UTWC 4GCXA 2VJXA 2ODOA 3S2JA 3UWVA 1DJIA 3AYVA 4OJYA 1SFJA 1Q65A 1FFRA 4FF7A 3A9IA 3T81A 3DEQA 1LT8A 4C6OA 4AVNA 5BOEA 4XVDA 3L7RA 4O16A 4H04A 1VHNA 4D8AA 4CEUC 3I4KA 1F2JA 2HISA 4CU8A 4R9OA 1H1NA 1ZAIA 3EOOA 1NDYA 1SQ7A 5G2IA 3OZYA 3TWAA 3V3WA 3GDKA 4B5SA 1OJXA 4O52A 2YDAA 1OSEA 1FWBC 2C18A 4HT3A 4LFYA 1C90A 4CQ9A 1S2AA 3W9ZA 3GR4A 2XIBA 2WVTA 3OGSA 1PIGA 1VP5A 3WL0A 1PKYA 1UROA 2GOUA 3L65A 5DMYA 3N15A 1GHRA 3GDLA 1U33A 2QIWA 5EU9A 3PUOA 3FHAA 3VO0A 5TF0A 4B5UA 3T6CA 3SGGA 4LVDA 1ONEA 3QPYA 2V3DA 3ZVIA 3EZ4A 5AFDA 1D3CA 3MYOA 4WY0B 3CO4A 3VM5A 4AVFA 1GZJA 3T8LA 4Z1BA 2NVDA 3WDHA 3BSGA 5CCZA 1XD0A 4EK7A 3AS1A 2W66A 4IWWA 5A2AA 3NYZA 4NILA 3TXZA 1WZLA 1S2WA 4DJEC 2XVNA 2VRQA 2WKJA 3MMTA 4M7SA 4MHBA 4G6CA 4PTMA 2DT2A 4AMCA 1XDJA 4NP7A 2OX1A 3TFCA 2ZX7A 3MUCA 4ZO8A 4LUTA 3W28A 1F6YA 2WNWA 2DSVA 3W2UA 1BXCA 3MO4A 3GG0A 1WNOA 3COTA 4GACA 3MHGA 2OSXA 3G0UA 3W1NA 4BI5A 4KKXA 1YXDA 3WL1A 2YXXA 1BD0A 1PB0A 1XDMA 2FZDA 1DJNA 1R5YA 3USZA 2DZXA 3RHGA 5HJLA 4QLLA 4UTUA 3EMZA 4JL1A 4Z2HA 3R58A 2ZXQA 1YDVA 1Q4WA 3GUGA 1V51A 2XIMA 1FCVA 4GNJA 1XIDA 1LLOA 3AU6A 3DGRA 1D8CA 1ADSA 3MUZ1 4V1XA 2J74A 3BWWA 3VUSA 1JZ3A 1RY0A 2YLLA 1DHKA 3H2NA 4HHLA 3GG8A 3OEXA 4GI4A 2PTWA 3UXAA 1US2A 3I65A 2UZ9A 1AJ0A 4C6CA 4M1RA 4O53A 3AIQA 5I3IA 3F1QA 3GR8A 4ZFCA 1V6UA 4WZHA 4ZBCA 3OQ8A 1A5CA 2NUWA 4I9JA 2D2OA 4IXXA 1OWQA 2E1WA 4WRHA 4ZOCA 3V1HA 3MC5A 3WJSA 4LB3A 3EX3A 1FKXA 4JKLA 4JTDA 4X9SA 5CPLA 3GDRA 3WN6A 1J9YA 1MMFA 5CJNA 1R9YA 1EDGA 3C0SA 2Y85A 2BXZA 2R9RA 4PZVA 3VIMA 4DJFC 1JDEA 2FVKA 1FUYA 2VKZG 5A6BD 1RVKA 4YMZA 1SR0A 1X39A 2YCIX 3WFAA 3OLGA 4D6JA 3P3BA 1KTNA 3GXNA 4S2CA 1Q6OA 3CUZA 1EA0A 2OG9A 3FJ6A 5BYWA 3S83A 3OGVA 2WBKA 1Q6QA 4AIEA 2CETA 1AH3A 1Y5XA 1TPWA 4JKMA 4N7QA 3CTLA 1XIHA 4U3AA 4AIUA 1SPQA 3WK3A 3GSMA 3L2LA 5C9UA 2V5JA 1GVSA 2GGJA 3VOCA 3OJGA 3T78A 2DQXA 1TSIA 1S39A 3B40A 3P74A 4GBUA 3TLLA 5A8QA 1AA1B 2PDHA 3FYPA 4FSAA 4FALA 4NIRA 1PE1A 4IUGA 2J6VA 4OUIA 3LPGA 1SFLA 4IIDA 1PO9A 1TV3A 1WAUA 3NQDA 3JU2A 3K46A 4Y9AA 1E72M 3HZ3A 4MIMA 3CAQA 4GI6A 3GAYA 1XPYA 4DJFA 3BPWA 3FGCB 3E2SA 1JZ2A 2B31A 4GYFA 4IIBA 5DN1A 2GOKA 2ZX8A 3TJIA 3H6OA 2NLIA 1ONXA 2HQAA 1JIBA 2PD9A 3W0KA 1XLJA 2FFIA 5A69A 4ML9A 2NSXA 2V5BA 3H22A 1WXZA 3SAZA 1I0DA 1MQQA 4MYAA 4E4FA 1F6PA 3W76A 5XINA 4Y7EA 3HFTA 3IIOA 3QQ0A 4OTKA 3TSMA 1TTJA 2GUYA 1EFZA 2Z4GA 4ZQCA 3HG5A 1G69A 3I4EA 3BLFA 1BGGA 2PE4A 3PTKA 4C91A 4GC4A 3N9SA 4PFMA 1A4LA 2VWSA 5T9CE 2GWGA 1EJVC 3ARSA 2VX4A 3ID7A 2RKXA 1W3NA 2BMBA 4HMCA 1EB3A 1JL8A 2HS6A 3D47A 3AWNA 3LGGA 2I14A 4KEVA 3U5YA 4C65A 3KZPA 5DCEA 2G96A 4ADTA 2PGRA 2X42A 2WAGA 3BJFA 3KOZA 1O68A 4GIYA 3GAKA 4BF9A 3QZ6A 2QCHA 2V3EA 1H0GA 5H8UA 3MCMA 2OGYA 1I2NA 4GXMA 2X0HA 3NURA 3OVGA 3W2MA 2YIHA 4H7ZA 1XWYA 1H5VA 1LRQA 2PDPA 2ZZ3A 4KS0A 2P1FA 4R7OA 4F2TA 4M29A 4D2JA 1T5AA 1FOBA 1M7XA 1YPFA 2XGZA 3KWXA 3BLDA 2VI0A 3FJ4A 4AZ6A 2PF8A 4WDUA 1K4GA 4IMCA 4PBFA 1K6AA 1IXQA 1N8FA 3SCVA 1D2KA 4AD1A 1A49A 2OEJA 5DCBA 3OHIA 1POKA 3EWWA 2ZE3A 3NZGA 2JF7A 3SCTA 2HTMA 1PHWA 3NQMA 4FNRA 3DGBA 4BJHA 2REQA 3OIHA 4YS1A 3TYCA 6XIAA 1K02A 4E6MA 2PAJA 1CTNA 4FXRA 3F4CA 1V02E 3EXSA 5AHEA 4OHQA 4HD5A 1HXJA 1K70A 1J2WA 1UPMB 3BL3A 1SM9A 5D2YA 2ADAA 4GNKB 2E3ZA 2E5CA 4UTTC 5E5CA 3WBEA 4XZWA 4RLIA 4W93A 2E09A 2Y4SA 1OQFA 4Q4RA 1R38A 3FS2A 2WSRA 4AEFA 3BV7A 4JCLA 4B91A 4DWSD 3PK7A 1FDJA 3RPMA 3UA3A 1BYDA 1GVFA 3WFLA 5KZDA 1S46A 5EYWA 1KRMA 1MXSA 2XG9A 1QWGA 3VXGA 3RUBL 1V6TA 4Z17A 1JZ8A 3CO8A 5DMMA 3TYAA 4C6DA 3NQEA 3AO0A 2PLMA 2A0NA 4JQ1A 2OLSA 3M0VA 3UPBA 1KFWA 4Q8WA 1B5TA 1ISXA 2QQ6A 4LS0A 2YA1A 4UZSA 2FDSA 1KXVA 1M7PA 4DZIA 3CHVA 3CNYA 3QV9A 3N6HA 4G8TA 3HQPA 2Z1XA 4QCFA 1LTDA 2PCEA 2CIPA 3M5ZA 3ZXWA 2CZDA 4HK5A 1PIFA 5C9WA 2Z00A 1JG9A 1I2QA 3N04A 3T0AA 4V27A 3R79A 1XSJA 2ZDRA 3M5XA 4TVUA 4UFKA 3TJ4A 3VMPA 1UUMA 2QAFA 2X30A 2RHGA 1WXJA 5C70A 3H2CA 1R3QA 3SRFA 3CV1A 4KEZA 4YL2A 1KWKA 1DIOA 3B0VC 1OIMA 3S6OA 1YBQA 4HNOA 3LHVA 3E2VA 5LNUA 4MVAA 4RXFA 1GJUA 4CNOA 5HWNA 1KWGA 3WZ0E 4KEUA 3VCCA 1EUAA 2CWXA 3QF0A 1ZHAA 1VHCA 4K39A 1J96A 5BOOA 3WH9A 3Q58A 5FF3A 4D6EA 4F2UA 3JUGA 2Q01A 4FLSA 1E9IA 4CVUA 4TMBA 1W5MA 3AIUA 3DYPA 4K8EA 1DXIA 1EP2A 3WQ4A 4NVTA 4QQUA 3B8VA 5A95A 2WMIB 1JPIA 4JIIX 3UGVA 5FJRA 5XIAA 4MFEA 3NOEA 2D2GA 1NF0A 4OE7A 3R11A 2W5FA 4QE1A 1V4YA 3SADA 2PZNA 4MPKA 4NASA 5DANA 2JGYA 4JQ3A 2KAUC 2TAAA 2EO7A 3FVDA 2R94A 3GZ3A 2W92A 1MUMA 2Q6ZA 1BF6A 3KCOA 5C8BB 1J5TA 1NP0A 4AVOA 3F4DA 3NXFA 1XYAA 3HV8A 4V28A 1W3IA 1XKJA 3LRLA 5JMUA 3EPNA 2X2GA 5DBUA 1K6WA 3TROA 1IQ8A 1UKQA 1EJWC 4UFHA 2ABAA 1TCMA 1UP3A 1QOQA 3R0DA 1S5NA 3WG6A 1EJSC 4MNLA 5I0DA 3W7GA 3DXIA 3UP8A 3FYOA 4QP0A 3RX4A 1E1CA 3KBJA 2H6RA 4O19A 1I45A 1UWTA 1J79A 1B4EA 2WPBA 4E5TA 2WK2A 4GQBA 3P5ZA 2OT0A 5A2CA 1LDCA 4N2YA 4UMCA 2PGFA 4KFOA 3DG7A 4IGNA 4A3RA 1XH0A 2JFEX 2X40A 1LOQA 3BLEA 2WZTA 4W88A 1HNYA 4ORMA 2ATSA 3B05A 3NL2A 2QEZA 2WOQA 1UMLA 3B4UA 3MHFA 3WF0A 3W7MA 4QBXA 4W87A 1UOKA 2ZRWA 3UPWA 1XIEA 2DVTA 2X41A 3W1RA 2V63A 1WP6A 4BEQA 3PB0A 4KT2A 1VEPA 2B0MA 3B0YA 3CHEA 3T2PA 4QCEA 3FSUA 4YTQA 5KSWA 1UZ4A 5H6HA 4PE8A 1K9EA 1K9FA 4UTHA 3TQ0A 4MNMA 1OABA 1XBYA 2E8YA 1H61A 1I4NA 1PKMA 3GFXA 4LVBA 1UWIA 2PLKA 1TE1A 1UD2A 2CBVA 4IPIA 3GH4A 5C2XA 1GYLA 4UB9A 1DQWA 1LQ2A 3CPGA 3AS0A 3N1AA 2DT0A 5G4EA 2R1MA 3OBKA 5AHMA 2CLHA 3WENA 1A0DA 4ZO9A 3USBA 3NQ7A 1L8NA 1E6PA 4GUIA 3GHSA 1OVDA 3L4YA 3BDKA 3BCJA 2QUMA 4I5RA 3AJXA 2EKCA 2NQ9A 3MBFA 1HJQA 3NR0A 4FNQA 1E5JA 3UXDA 3RR1A 1XLDA 1TREA 3HB9A 4B5XA 1JYXA 3S2CA 5D9MA 3AMGA 4YPJA 3ME3A 5G4HC 3ECQA 4HSNA 1JUKA 3RU6A 4PSRA 1R3TA 2DZPA 3UEQA 2CHOA 1RJRA 2BHZA 1TWDA 3IJIA 2GVYA 4HIBA 2UBPC 1MDLA 2VEGA 3NZ1A 2PC8A 2IQTA 1W5QA 1FWCC 1NJJA 2J7HA 3QPEA 3V36A 5F1UA 3PSVA 3J7HA 4GMEA 3GKAA 3KX6A 1AZ1A 4ONVA 2J24A 1A47A 1Y8BA 4K37A 2AQOA 3CBWA 4N6FA 1BYCA 1J0ZA 3ITCA 4GQQA 4ZR8A 3R94A 3B8UA 4HBKA 1XIGA 3V0UA 1VCGA 4B4FA 1UH3A 3CPUA 4X60A 3W1XA 1CCWB 1KLYA 1ONRA 1XBXA 2XM1A 3ARYA 3TSBA 1VGAA 2Z2BA 1OK6A 2WMFA 4P7NA 5FF4A 2ZICA 2WCAA 3MYPA 2HEJA 4J9JA 3ITVA 1QMLA 1Y65A 1VZWA 1X38A 1Q85A 2BX7A 2ESCA 4W5ZA 4H9TA 4PTXA 2XWEA 1TPDA 3ITYA 2WCSA 4AD2A 4ZMGA 5F2LA 3ZWTA 3PVFA 4HTYA 4XAYA 5HDRA 3N3TA 2VRKA 3VIOA 4E0CA 3LTYA 1HJVA 1EA9C 2EAWA 1JAKA 3I3DA 4YWIA 4F0SA 4LVGA 4IMGA 4ATDA 3NQVA 1QNSA 5AVHA 2YDSA 5HWMA 4WSJA 1QDSA 4CCCA 4EP8C 2V30A 3CS2A 2YX0A 4N9DA 5EMKA 4F40A 4KRZA 3W25A 3LB0A 1MW0A 4GCAA 2CC0A 4XIAA 3R13A 3LYEA 4QHRA 3MKCA 1VCFA 1U30A 2VDHA 4O8RA 3TH6A 1XLHA 3NM3A 3ABXA 4JNMA 5FA5A 3UETA 3RILA 3S1WA 4YJ5A 1LQ0A 3L4ZA 3F5JA 3HJZA 1JPDX 4DYJA 1DJZA 1T8XA 1TJ0A 1XLAA 1Z41A 1EP3A 3KRSA 5GVJA 7PTDA 2VNCA 4LF1A 3SN1A 1FWDC 5BMXA 1V6WA 4ENLA 1H7NA 1HN1A 3W7JA 3BAKA 1XYCA 5DQPA 4UC5A 3T2OA 5M5DA 3F5LA 4LEQA 2NT1A 2V0TA 2HK0A 2E7FA 3QM3A 4Y9OA 1YNPA 5AVNA 3I6RA 4H9XA 1ZLPA 4FXJA 2GWNA 3QN3A 4BCEA 1C3FA 4W7VA 3G24A 3PZTA 3SCNA 2HMCA 3CUGA 1QPQA 2Q3OA 2BP1A 1B1YA 3RJXA 1XCXA 2HCVA 3SCWA 1A0EA 2PB1A 4JOMA 5AHNA 4IP4A 1KCKA 1RLCL 3LBMA 4PTWA 4P2VA 2Y8VA 4AD3A 3EKZA 4H8HA 1Q6GA 4GWEA 4W4QA 1VB9A 4KWWA 1C91A 2BASA 4UWMA 1QATA 4B2DD 4EVZA 3HMCA 2VDIA 3MB9A 5I3HA 4O28A 1P0DA 4HK6A 3TAKA 3JW7A 1G7UA 1US3A 1UD5A 4HHHA 2PDKA 2RUSA 1GONA 4F0HA 4RE3A 3TMLA 3MI6A 1KA9F 3RF9A 4GH1A 1XLBA 3ZT5A 5DLCA 4MB5A 3KDNA 2ZX9A 3NDYA 1KV5A 4OWGA 3BANA 1UH2A 1OGSA 4EPDC 3CV2A 4YVXA 4H6RA 1YW1A 3GKFA 4IJRA 1AFSA 2R1PA 4NRSA 4NT0A 4GC3A 1MRAA 5K2ZA 1EKOA 4Q8PA 4HSOA 1GQIA 2ZVRA 1UZHA 1E15A 1JYNA 5C55A 2QUVA 4JTKA 1GEHA 2GGGA 1IXNA 4U28A 6ENLA 5AOUA 5DBTA 3QQ1A 3LV5A 3QQWA 4W5UA 8XIMA 3WEMA 4F3HA 4RX0A 2J7GA 3WYZA 1Z89A 3B04A 1HL8A 3ZOAA 1NM9A 1K8CA 2QUUA 3UERA 5B7YA 3DI0A 1GTHA 3MSRA 3L5MA 3AIBA 4PRWA 5KINA 3NVTA 4CQCA 3MU7A 3CLWA 5D38A 1W1TA 3MA8A 1BSLA 4G7EB 5HWJA 3WLMA 3G0SA 1TZ9A 5A8OA 5LNVA 4MTVA 4S3KA 4Q8MA 1JZ6A 4ZTYA 3URNA 3SQLA 4EWJA 4PUWA 2ZX6A 3UNDA 2I5QA 3W83A 1QT1A 1OFAA 3UD6A 1OX4A 4AW7A 1VRXA 3LXCA 3R7MA 4JBRA 3VNMA 4N02A 3EDJA 5E70A 3M0KA 4DXVA 3TC3A 4UNIA 2YA0A 3CL7A 4GA8A 3WCZA 3TAOA 2W27A 1V3IA 4MAZA 3GM8A 3AOFA 3GE7A 4JXCA 1V08A 4WCJA 4FO4A 4ATWA 4CEXC 2Y8UA 1O60A 1G4PA 4DWDA 4BA0A 4GG9A 3FJLA 3TR2A 4GH3A 1SO5A 3T40A 2P53A 4E2BA 4IFKB 1W3LA 2INZA 2ZDSA 4JX6A 4PBEA 4WJXA 5HR6A 4QIUA 1ZALA 1WDRA 3VIPA 7TAAA 5F4SA 4DO4A 4A05A 4C60A 5D37A 4MDPA 5DEZA 1KCZA 2DEPA 2D20A 4MDOA 3RITA 1L2QA 2DGAA 4AHOA 2ACSA 3C6CA 4O14A 1JPHA 4DLMA 1OC5A 2GJXA 5LXXA 4C6MA 1VFHA 5LSMA 2NVCA 3N18A 2BWGA 5A94A 3V16A 3LK6A 4J35A 2G3JA 3QMSA 5FF2A 3V4BA 2H8XA 1GUVA 3LCXA 4E2DA 3T07A 3RMEA 5HINA 2VCCA 4RZ4A 5CC6A 3LDVA 1B9ZA 4PCTA 3NDOA 2WSKA 5JH1A 3S9IA 3W1UA 1TTPA 2VGIA 5D4YA 1UD6A 3W84A 4F9JA 4B9ZA 4KETA 1SJAA 3A22A 3HQ1A 5GJMA 4CGTA 1GNXA 3I68A 3P8IA 2H9AA 2D0GA 2X1IA 3SBFA 2HVNA 3U2ZA 2BZNA 3FCPA 1W9PA 1S2UA 2WNNA 5MKGB 2CLMA 3SURA 5M3WA 2WJFA 1NU5A 2DQWA 3BJSA 1AW5A 1VBGA 2DZWA 4MWAD 4DM1A 3TQVA 4LANA 4CQAA 4YCOA 5XIMA 5HNRA 2VZOA 4XZHA 3DG6A 4W8AA 4NNBA 4P7RA 4FNTA 2J9ZA 1OFQA 1WZAA 4DUVA 4C6QA 3VD3A 2OMAA 1P1XA 4LH8A 3VI2A 3QR3A 2WQDA 3WLSA 3O0FA 2I56A 5E0KA 3OLIA 1MDRA 3SJNA 3P60A 3VCNA 2PBOA 3BO9A 1J5SA 2NW0A 2ZRYA 1UBPC 5BXPA 3K5XA 4TXEA 4ILSA 4NZCA 3RJYA 3F2BA 2WXDM 2YR1A 3P84A 4AIBA 3VKKA 2ZYFA 3MPGA 4C6FA 3N2MA 4C6BA 3N19B 4DYEA 3N6QA 1G0CA 3CWNA 4WIWA 1UASA 1UJQA 4IL2A 4L4MA 1VYSX 2FDMA 4XZIA 3DKLA 2PZ0A 1SFSA 1LROA 3GFYA 2Y7EA 5CZ0A 1Z44A 2DVXA 2A1YA 3F2DA 3CC1A 2DIEA 1SW3A 4IJCA 4QAIA 1R3SA 3VGBA 4Q4QA 3SIMA 3QGKC 4J40A 4C1LA 2F84A 3CV7A 4DEFA 3W6MA 1I6NA 4CD6A 1FWJC 3VKAA 3IJDA 4FXFA 1H63A 1UR2A 2PP3A 3ALGA 2VZSA 4BZYA 5I2UA 2NXGA 1H11A 2RGMA 1EGMA 3TQKA 4NJKA 2WMGA 1E55A 4PMZA 2NLYA 1OK4A 3EMCA 4RXGA 2I7GA 3SR7A 4B16A 3XISA 4DF2A 2HPIA 1EJTC 5AC7A 4JQ4A 2OLHA 3WQWA 2VR2A 2HS8A 3WDIA 5IBXC 3IK4A 1MVYA 2XIQA 5DY2A 2OGJA 3GNOA 4ZOAA 3IUHA 1Q7QA 4L5ZA 3UXKA 4F0MA 2RDUA 2QJJA 3DYMA 2VX7A 3KTCA 1ITUA 1OINA 4AWSA 2ZCGA 4R85A 4E8GA 4AWTA 4FP1A 1KM3A 3GU1A 4JIHA 4CNSA 4H8NA 2WKGA 4JNYA 1PTAA 2VUNA 3VOIA 4DBEA 4DN1A 3MBDA 2J27A 3GC4A 5EB8A 3E2QA 3QSTA 2F61A 4D6HA 4PMVA 4LV4A 3TTOA 1R7AA 5C71A 4KWVA 2XZ7A 3AUOA 1SZFA 1X8CA 3CAWA 2EXOA 3CWHA 1GYNA 1WQ5A 4PSPA 4QJ3B 1EXPA 2WV8A 2DIJA 1ITCA 3H24A 3W7DA 5JBEA 4KWSA 3M07A 5BXTA 3GB6A 6ALDA 4I9AA 4HCHA 1A3WA 1RVGA 3GNDA 3PS7A 1AZ2A 1FQ0A 2FGLA 1JF6A 5DX7A 3N17A 3VZXA 3UR5A 2BOFX 1SVDA 1S3TC 4KBXA 1A5BA 4G9PA 1GVYA 3AYSA 4ROPA 4XKYB 3PP7A 2NUXA 4AYSA 1NOWA 3TSDA 4DPQA 1LLWA 4DUXA 4WQ6A 5BWFA 3WLIA 3NQ6A 1FCQA 1I2RA 3WUGA 3MTWA 1LOLA 2XU2A 1TO3A 1GVRA 4XD6A 2YBTA 3C3NA 4TIMA 4J3SA 1TKKA 3M64A 3TKFA 3FHQA 1EZ2A 2QF8A 1V3KA 4HZ8A 3ITOA 4NJJA 2J4GA 1Z69A 4HSHA 4N42A 1GOKA 1HKMA 4C6KA 2O55A 4PMNA 4OOZA 3C0JA 4TVDA 4HMDA 1XI3A 4DBUA 3HO8A 3HURA 4L1GA 5KZMA 2IUZA 3CHDA 3UCCA 2GZXA 2POZA 4PMXA 3VX1A 2O7QA 3BOXA 4UCGA 2D0HA 2PGEA 1B90A 1SU5A 5AN7A 1CPUA 1KTBA 3N11A 1H51A 1RR2A 1QW8A 2BVDA 3W82A 4GIEA 4L65A 2OQHA 3LCLA 2R1KA 1ZSXA 2X2YA 4QE5A 4GIAA 4E38A 4AX6A 4R3UA 2W3ZA 4N9EA 1H1YA 4OKDA 5ECVA 4DNHA