5BRBA

Crystal structure of q64e mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
243
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIENVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQRNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 87
structure length 243
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5brbA00
3CHVA 5KZDA 4A29A 1FWRA 4UFLA 2YW3A 3E12A 3W1PA 1K03A 1WV2A 4C1KA 3R8RA 2V8ZA 1WA3A 5TQLA 2A1YA 2ISSA 3W22A 3QRHA 1HO1A 4JIPA 3LHTA 4WJEA 6TIMA 4IMCA 4AWTA 5BOOA 2Y61A 3S1VA 1YDNA 1CX9A 1LCOA 3GXNA 7TIMA 2GQAA 1KFLA 3JS3A 4LC6A 4HNUA 4LT9A 1TRIA 3QM3A 4MFEA 1TTPA 3A24A 3C4UA 1OFPA 1R2TA 4K37A 4O12A 4R53A 5BMXA 3QC3A 5A8GA 4DF0A 4MY9A 1JCMP 1SPQA 1TPH1 4LRTA 4WY0B 5HWNA 1LLWA 3LBMA 4LVAA 4M6PA 3SY5A 1H50A 2YPIA 1ME8A 2R91A 3UPBA 2QCGA 2CLOA 3W2JA 2DZPA 4Z1CA 2P1FA 2X2GA 5EYWA 5D2WA 2Y70A 2ZA2A 3VI2A 5MHBA 2DZVA 1GYNA 3R2GA 1MZHA 2VFDA 1P1XA 3TAOA 1O95A 1R30A 3G1HA 1VCFA 1I4NA 4PC8A 2YSWA 3USBA 3G8RA 2OT1A 3NR0A 5FF2A 1H1ZA 1YDOA 4JY9A 3CT7A 5AHFA 4QISA 2NX3A 4K7VA 4N02A 3L5AA 3PUDA 2CLIA 3L67A 2J24A 1W54A 2RFGA 2YDAA 4OBTA 3KVMA 2GVLA 3IIZA 3LXAA 1XBVA 2BZNA 3IV3A 3PSWA 2ALDA 3GR8A 5FEZA 2V2HA 2HTMA 4NXKA 1SUXA 1ZALA 2C3ZA 2EGZA 1U83A 4MLJA 3ANYA 5KITA 2JGQA 4N6FA 4U28A 4AH7A 1JRBA 5K9DA 1FWSA 3LM7A 1TV8A 5D04C 3LRLA 3GDLA 1KM0A 2QF7A 1C29A 5EY5A 5AHLA 4CQ8A 2NV2A 1PVNA 2O7QA 5I3IA 1GEQA 1WAUA 2CFFA 3R12A 4Z0JA 1F5ZA 4I9AA 3QSTA 1QO5A 3L65A 1OX6A 1M5WA 1RZMA 3SW6A 3IVTA 1HL2A 3LCXA 4O4VA 2ISWA 4RZ6A 1SZEA 4WQ6A 5F2MA 3C0JA 2FIQA 3TMQA 5EA9A 4FIRA 4EF8A 4NT0A 2C14A 2C13A 4MYXA 3O6DA 4UIOA 3RMJA 3GXTA 3NM3A 3T4CA 4O10A 1KM2A 1UCWA 2ZRWA 3QQ1A 2JKEA 4UTUA 1G4PA 3W1RA 4O8RA 4M5PA 2FDSA 5G5IA 3BK0A 1TCDA 4BI6A 5HR7A 4K38A 1QO2A 3VE9A 3SZ8A 3DFNA 4N4QA 1T99A 1JRCA 5AC6A 1AW5A 5C54A 1W5NA 2E5CA 3L2IA 3P80A 5H2ZA 3P67A 1S5WA 3HGJA 4G1KA 4NXSA 1J2WA 2BWGA 4AF0A 3EWWA 4WUIA 3M0ZA 2YYUA 1XXXA 2CLKA 3G0UA 3HGSA 4ZL1A 4GE8A 1W3IA 4Z08A 5DBUA 3LTSA 2WSQA 4JY8A 3NDOA 1EWDA 1DHPA 4YXGA 4TO8A 4HT3A 3BVJA 3NQCA 5F1VA 2V9DA 2AQWA 3KHJA 2B0MA 3IVUA 3LV6A 3QEZA 3MP5A 4QM1A 3GR7A 1YXYA 3SSJA 2TSYA 2ZA3A 4JTTA 4GBUA 4Z1BA 1W5OA 4MIMA 3W2LA 3W7OA 4UTKA 3W1LA 1HO4A 2VOMA 2EF9A 3TA6A 4PL1A 2YW4A 3B0VC 2UV8G 3MBDA 3G24A 2W6RA 1ZAJA 3HO8A 3DFSA 4I7WA 3G1AA 1TPWA 1S5VA 3KRUA 4O19A 5F1UA 4K36A 2Y88A 1W5PA 2Y7GA 1YTKA 1KBIA 3AO0A 3ABQA 5D02A 4JTUA 4NNAA 1Q45A 1FXPA 1OK6A 3LCIA 3IIVA 2VEMA 1KV5A 1IXNA 1P0NA 3LBCA 4YMZA 1YXCA 2RH9A 2A5HA 1QFEA 3B05A 3G1YA 1JCLA 1U5JA 3NVTA 4WOQA 1OFRA 4ML9A 4FNQA 2CWNA 2ZRZA 1IIGA 2FQIA 2P0OA 2YXGA 8TIMA 2QCCA 3EX4A 1WYIA 2A0NA 1TSIA 3BLIA 5EPDA 3WJWA 4QAIA 1SW3A 2DZSA 1ZCOA 3C2EA 3NZ1A 3EB2A 1HUVA 4JX5A 2ZRXA 2WV8A 1OG0A 3FA5A 2AGKA 3W1XA 5E93A 3FKRA 1F6KA 3PULA 1YXDA 3QH2A 1FDYA 2E5DA 3GB6A 2PRMA 5K2ZA 4XBSA 4LS2A 4OV9A 4GUGA 5I3KA 2V81A 1LRTA 1W5MA 2Q3OA 3TK7A 4DF1A 1DOSA 1SFLA 3RLUA 3FIGA 3DFQA 3NPUA 3TE9A 4HNVA 3PUOA 1AK5A 5DXXA 1TPEA 3PB2A 2E68A 5CPOA 2ZZ4A 3NQ6A 2F84A 1EB3A 1PL9A 5C5YA 3IIOA 1KM1A 5F2GA 3S9YA 5G2HA 1GT8A 4IUOA 1JCXA 2QCDB 5AYZA 4YLWA 4JGDA 1GVSA 4AXKA 3A21A 4YWIA 4FF7A 1F73A 2CZEA 3LDVA 3NEVA 3C2VA 4RX0A 3GVGA 2I1OA 3M44A 2OJPA 4JYDA 5D30A 4DPQA 3UWVA 4R34A 1TMHA 2G5WA 1IXPA 5CZTA 4P2VA 3UZ5A 2CLMA 3O05A 5KSWA 1JR1A 4XKYB 4M6VA 3DU0A 1UJPA 4N9BA 1EP1A 3PB0A 2RKXA 4RKAA 2ZZ5A 5DCBA 5FESA 3NQEA 1YTEA 3NL6A 5LGXA 1QCWA 5DXYA 1C8VA 4Z0SA 1SW0A 1OFBA 3ABOA 4JTFA 1I45A 1G67A 4CNOA 3STEA 3L9CA 1SZFA 1EA0A 4WXYA 4E2DA 4MZYA 1PCWA 4EVZA 4N4PA 1TO3A 2WKJA 2ZZ2A 1TTQA 5EL1A 1RQEA 1WX0A 4BR1A 4I7VA 4NQ1A 1Q3NA 2EHHA 3B03A 3BGJA 5KMYA 5AHEA 3C61A 1KFEA 3GAYA 3JRKA 5DELA 4E0CA 5CZSA 4OV4A 3T78A 1KW1A 1VZWA 4RXFA 3MMTA 1A5AA 2GQ8A 3I68A 3NPVA 1MO0A 3W07A 2WJZA 3UXDA 3LERA 3TC7A 3KFTA 4ZQMA 4O1DA 1SSDA 3LRMA 1FCUA 4NX5A 1T0OA 3BG3A 5F4XA 1TPVA 1NFBA 3W7PA 3N9RA 4H6KA 1XDLA 4Z1AA 1GTEA 4NJIA 3I6RA 4HPJA 4UFKA 1GOXA 4DQWA 1Z44A 5ABTA 4FIQA 2V30A 1QR7A 2QCFA 5J5DA 4PFMA 2YFOA 1GVOA 2B4GA 4ORMA 4WY0A 1FCQA 1VCVA 1H1YA 3O07A 3W2NA 2QCHA 1JQVA 1L9WA 1YPFA 3W85A 2VXNA 1WBJA 4UMAA 4M19A 3UD6A 4ADUA 1KM5A 4YCOA 4LVBA 2J27A 3STGA 1G7UA 5DN1A 3DKLA 5K3VA 3BW2A 3O1NA 3PVFA 5HR6A 1KFCA 1OYBA 5KINA 1IIHA 3BLFA 1G6CA 2XFWA 1S5TA 3UZJA 4R33A 1ZENA 1TTIA 1R47A 4AHPA 1SQ7A 3QJAA 3L5MA 1DL3A 2A2IA 3TCEA 2ZZ1A 1QOQA 2YGYA 1W3TA 3P7YA 1W56A 4YL2A 3E49A 1WDWA 4JD4A 2Y89A 2NXIA 4Q4KA 2J9YA 3OG3A 2Z6JA 4IMFA 3W1TA 2X1TA 3QSRA 3C52A 1GZGA 4IPIA 4UR7A 3ZWTA 3TU9A 3GDRA 3NQ8A 3NQVA 4E2BA 3RNDA 4JN6A 1FWTA 3NQGA 2B7NA 2ZTKA 3PAJA 4FB7A 3C8FA 5LSMA 2Y7EA 3W87A 4A22A 2ATSA 3FFSA 1K3UA 1QDSA 4MY8A 2DJLA 5LHEA 4K39A 1B9BA 3HG3A 3DI0A 2B7OA 2WO5A 3TROA 4HSOA 3ATZA 4O4WA 2XN1A 3NL2A 1FUYA 4NVTA 5KZMA 5BMWA 3FYOA 1AW1A 1ICSA 2H8ZA 2A7RA 3I7RA 4UCGA 4J9JA 1YLVA 2NV1A 5G2WA 5HWJA 2NUWA 4EIVA 5FF7A 1B57A 3SGUA 3W7EA 4AHOA 1XBXA 3MI2A 4KKXA 4ZQCA 4ONVA 1Y0EA 1AL7A 4O17A 1DV7A 2FLIA 3OVQA 3LXCA 4HN4A 3H55A 4HSNA 4O1CA 2O7SA 2FB2A 3S8HA 5A5WA 2E09A 3MHGA 3QMTA 4AWUA 3L21A 4FX7A 2WSYA 2BTMA 5F4WA 4IXXA 1J4EA 4EF9A 5D03A 1XCFA 3QW3A 4CQAA 1LBMA 2PE4A 4DXVA 3M9YA 3F4WA 4JTSA 3LGEA 4O52A 1LOSA 1AL8A 2JKAA 4XQ6A 4S2BA 5LNSA 2ZBTA 2WSRA 1OFEA 4ADTA 1XKYA 3C6CA 4TMBA 4UTJA 4ICNA 5CKSA 3V75A 1LBLA 4GNJA 4A2SA 2NLIA 1G4EA 3IIPA 4MKNA 2JK2A 3P62A 3DGRA 5CZJA 2J6XA 5FEPA 1SO6A 3ABRA 1H7WA 1P5BA 3WJZA 3GDMA 2QDHA 1DQXA 2WOQA 5CSRA 2I14A 4XZ9A 1T8XA 5EBUA 2X1RA 3G1XA 3S6DA 4Y9AA 3G1DA 2CLLA 2ZCGA 3N3MA 5D05A 3A23A 1SZGA 4N9CA 3CWNA 4MVAA 4IMEA 4O1AA 5K9CA 5F2LA 1XBYA 3DI1A 1O60A 3INPA 2E1DA 3AJXA 3NL3A 3O15A 2NZLA 1JUBA 5KZEA 3FOKA 1Z42A 3WK0A 1W1ZA 3UWUA 3W2MA 3W76A 4JTJA 2NXGA 3PG9A 4GUFA 4LUIA 1TPB1 1A50A 5LNUA 1KM4A 5G1YA 3MP3A 1G69A 4N9EA 3O63A 3DAQA 3UY7A 5AYYA 2VFEA 4A2RA 1ICPA 1QMLA 3EEGA 3B04A 1OX4B 4LVGA 3UWWA 5SWUA 3TIMA 3NZRA 4TIMA 2CW6A 2YYTA 1QPRA 3TMLA 2E77A 1SR9A 4PCFA 3NQFA 1BWLA 2V5BA 1LLZA 2X30A 2QKFA 3IIXA 2NX1A 4E38A 2CLEA 5D2XA 1EUAA 4KWWA 4OT7A 4UC5A 4ALDA 3ZWSA 3TNOA 4O50A 1DVJA 1EP3A 2ZDRA 4QJ1A 3SFKA 4XUGA 1ME9A 1LORA 4O54A 4ORIA 5D2TA 3W88A 3M5ZA 3GNDA 3W7QA 4RV8A 2Y7DA 5KTLA 1RD5A 2BSLA 1TIMA 1XUUA 2DP3A 1THFD 2I9EA 2QAFA 4NJHA 3UNDA 3G1FA 4POCA 3C3NA 1KTCA 3GNNA 1I2RA 4QITA 4BF9A 2W79A 2BX7A 2QCLA 1KLYA 1ONRA 1SO5A 2V5LA 3BGGA 2QCDA 2HS6A 3DFPA 3HGRA 1F05A 3T40A 3EX2A 3N19B 3TX9A 1TPDA 1FDJA 2QCMA 5HUOA 3UPWA 1H7XA 1MXSA 4RZ5A 5HULA 5LNWA 4NZFA 1RR2A 2VEIA 3PF3A 4JTEA 4TMCA 3M5XA 2QCNA 4N2YA 4DO5A 1I8JA 3B8DA 2JGYA 2ATMA 5DCEA 1FY6A 2C1HA 3V1PA 1R2RA 1NEYA 3U8GA 1OK4A 2A21A 3GLCA 4QNWA 1RV8A 1XFBA 4LUJA 2C18A 5F4SA 3R5EA 2WNNA 3TH6A 4XWUA 2VFIA 4CNNA 1DKWA 4JIQA 2PRLA 4HHPA 2NUXA 2E6FA 4K6AA 4FX6M 2A85A 4O57A 3PY2A 5LHFA 3NA8A 3S42A 1GJPA 2TYSA 4JYFA 4MZ8A 3LI1A 3HB9A 2H3DA 5AYXA 2C16A 3B4UA 1TREA 1FQ0A 2A4AA 4MUZA 3NQDA 1IXQA 2J9XA 1Q6LA 3T7VA 1LTDA 5G4EA 3M16A 2AAMA 1OJXA 1OABA 1RVGA 1QWGA 5C6MA 2VELA 3STCA 4XTDA 1EP2A 3OVRA 2QCEA 1ICQA 3L0KA 3BPWA 2VFFA 1J5TA 4JEQA 3CWOX 2G95A 1EEPA 3NM1A 2QUVA 1BEUA 3TSMA 2C0AA 3L5LA 2QR6A 1IXOA 2RDWA 1R2SA 4IPJA 3GKAA 1AMKA 3NQAA 3BG9A 3DHFA 4BI7A 3WJSA 2GUUA 2X1SA 3NO5A 3IEBA 3GDKA 3W7IA 3SI9A 1A5BA 3NOEA 3Q58A 1GYLA 3NQ2A 1G4TA 3G18A 2J9ZA 4WXZA 3R89A 4NNBA 3TQVA 3S5YA 2Y6ZA 1L6WA 4JTLA 1M7PA 3CIXA 1VR6A 4CNPA 4PH6A 3LX9A 5LZLA 1GVRA 4UUIA 1W0MA 4UTWC 1OFAA 3IGSA 3N34A 2XN2A 3PBWA 1RQHA 1PHWA 1C9DA 3PWAA 3VCRA 1H62A 3FJ6A 5K4ZA 3LI0A 1JUKA 3RLVA 3QW4B 1NVMA 3HG2A 3MHUA 2YR1A 2WPBA 1DORA 2H6RA 1BTMA 2CZDA 3NNTA 1EPXA 3IGUA 3E02A 4UFHA 3O8AA 1M6JA 1SSGA 1YADA 2ZRYA 4A3UA 4AWSA 1PIIA 5L9FA 2ZRVA 1ML1A 2OX1A 3TC6A 5BW6A 4JDBA 2TMDA 2VEPA 4NJKA 2QEZA 2DZWA 3GYEA 2FB3A 1VPXA 4DF2A 4ZMGA 3CEUA 1PCKA 2FPYA 3Q2DA 3QMRA 1F7BA 1I2OA 2DZUA 5DY3A 2NX9A 3ZR4A 3H54A 2J88A 4FXRA 5FF4A 5GVJA 5C2XA 1LBFA 2TRSA 3ZS4A 1N8FA 5D33A 2E6YA 4PA8A 3BO9A 3CM4A 4UTLA 1UUMA 1B4KA 3L66A 3BG5A 3PC0A 1F2JA 4NJJA 5LNVA 4LRSA 1L2UA 4K8HA 4Y90A 3MP4A 4UFJA 2R8WA 1X8FA 4JX4A 3QQ0A 1XI3A 4UR8A 1QPOA 1VLIA 3MWAA 4JX6A 3N2XA 2CZ5A 4M6QA 2V82A 1TJPA 5CPLA 4XBKA 1DJNA 2Y7FA 3LCGA 2ZZ3A 1CI1A 2OT0A 4GC4A 1R46A 3C56A 3P8JA 2H3BA 5HUPA 1ZHAA 5IM51 2A6NA 4CQ9A 5D2VA 4DO6A 3I7QA 1FXQA 1LROA 3W7LA 1FCBA 1SZNA 4KFNA 1ALDA 2QUTA 4RR4A 1YDVA 3WJYA 1RQBA 2PURA 4LNYA 4O13A 2VENA 2VC6A 4IOTA 3FS2A 2IQTA 5BRBA 3CC1A 3QPYA 2OMAA 4PEKA 4BK9A 3OBKA 1NF0A 4IGHA 4FEZA 3LOTA 1CW2A 3N14A 3CB8A 1Z48A 3KVLA 3TJXA 1H7NA 2FTPA 4N6EA 5D09A 3QFEA 5EKYA 3L68A 3C2OA 2ZFAA 4LU0A 3P5YA 2QUUA 3RFAA 1W3NA 2Z0IA 3S1UA 3LTYA 4TU1A 2R94A 4WD0A 4JICA 1LYXA 4HPXA 3W23A 3HGOA 1WOAA 2TPSA 1T96A 3W1QA 3PSVA 4IX0A 4OHQA 4U4MA 2HSAA 4JYEA 4RXGA 1VYPX 1WXJA 2ZYFA 3DH7A 4TR9A 3W83A 1A53A 3M41A 1VHNA 3P84A 3LB0A 1OVDA 3FJLA 3QF0A 3LLDA 1JCJA 2F7FA 1SO3A 2DJXA 1P4CA 1JCYA 3E0IA 1KFBA 1H60A 5G4WA 2FFCA 2CLFA 1KM3A 3M43A 3MJYA 3G1SA 4UTIA 2FJKA 3DHDA 3W9ZA 3DXIA 2Z1BA 2CLHA 2KZHA 1LM1A 4BFAA 1YTDA 3QPZA 4HKPA 1H51A 1V7YA 1KTNA 1AW2A 2QJHA 4KWVA 3UQNA 3Q94A 4IWWA 4RCXA 3W84A 3DENA 5T26A 3NXFA 4LV9A 3E9AA 4B5NA 5HQEA 1XM3A 1Q6QA 3TAKA 1B4EA 3EXSA 2E6DA 4AEOA 3P5ZA 1HFBA 1SO4A 5D38A 3LXBA 5K9XA 4O0KA 1E51A 3MHFA 1H5YA 3A22A 2D73A 1GQNA 4A21A 1TPFA 3MI6A 3Q37A 3S5NA 3TFXA 2OCZA 4NU7A 3W75A 2GJLA 4R7JA 4GXMA 4NX0A 2GVJA 3WK3A 1K7FA 1M7OA 2DORA 3HQ1A 5CPMA 4L4LA 1KLZA 1VYRA 2QJGA 3N2MA 3EX1A 2PCQA 1Q6OA 2Q3RA 3TXVA 3ABSA 4GJ1A 4JDYA 2JBMA 3ATYA 3W74A 1QPQA 4OGZA 3LCLA 4L4MA 3H53A 4AAJA 3LHZA 4CCDA 3D0CA 3WK1A 4LOCA 4FNUA 3NGJA 5C55A 2B7QA 2W0UA 3KVJA 4Q33A 1FDZA 4XTIA 2ABBA 1HTIA 3YPIA 4LC8A 4RZ4A 3B0PA 3THAA 4TX9A 3KVKA 1XUZA 1MEHA 2LLEA 4EWND 1VYSX 3UXAA 3G8EA 3OA3A 5L6UA 3LLFA 1W8SA 3TQ0A 2GJNA 3TQKA 1LZOA 4K7YA 3QZEA 3F4NA 3DZ1A 2RDTA 5I3JA 5AC8A 1AG1O 3W7HA 4ZQPA 4OQVA 1OFOA 3MI3A 1DJQA 2BXVA 1X1ZA 1UUOA 4LVFA 3FEMA 4C1LA 2V2CA 2VKZG 1ZFJA 3TJLA 4M7SA 1MEIA 1Z41A 4GUHA 1WBHA 3W7MA 1FCVA 1JULA 3W1MA 5HJLA 3RK8A 3L0NA 4X3ZA 4NUWA 3HJZA 3WFAA 1JQXA 3S1XA 4Y8FA 3U2OA 2WQPA 3PM6A 4UMBA 1OHLA 3MYOA 1NF7A 3UYCA 3ZFHA 1TQXA 3VKJA 1MEWA 3A5VA 4IMGA 1OFDA 4DPPA 3T44A 3T55A 3PS7A 2QJIA 4LY8A 3NAVA 3G0SA 3GIYA 3P74A 4P61A 3LCFA 2A6LA 4PODA 3O6CA 3WJXA 1X7FA 3DFOA 1K7XA 4WY0F 3HOJA 1W37A 1K8XA 1O94A 3FYPA 3BW3A 4OU1A 5I3GA 3HPSA 3EX3A 1TPC1 4S2CA 4M7TA 2JKPA 3HG5A 2ZTJA 4UTTC 4QNEA 3MUXA 5HMSA 5AHNA 2Y63A 4O53A 3M47A 3W73A 2YX0A 3NPXA 5LNRA 5K4XA 1O5KA 3M5YA 4ZQRA 4O18A 1GG1A 3S5OA 3IGXA 3EX6A 3NYZA 1I2PA 1DBTA 1RPXA 3CLMA 2C6QA 2V2DA 1EIXA 3W7DA 5HNRA 3W2UA 4FXSA 1QAPA 2EKCA 1QNVA 4BWLC 1IGSA 1JJKA 3W7CA 3P8IA 1QOPA 3THQA 1V5XA 1TTJA 3S5ZA 5FF3A 3GZ3A 3K30A 5FI8A 3LHUA 3I7SA 3W7GA 1I2QA 1I2NA 1ZNNA 3GXPA 4KFPA 1KFKA 1VJIA 4CLMA 1VC4A 2E5BA 3R13A 4LTSA 2H90A 4UTWA 4QIUA 4CCCA 4NNCA 3CTLA 1GG0A 3CQ0A 3MBFA 4JR5A 1H7RA 3S0CA 3M7WA 3PUEA 3UWQA 4UXDA 4FO4A 4O16A 2ZRUA 1TV5A 4DBDA 4LS0A 1G4SA 1S3HA 2X16A 1OYCA 4RJEA 1F76A 3O06A 3HMJG 3TKFA 3W7KA 3LHVA 5TIMA 4Y96A 4LV4A 1XBZA 4XKYA 3W70A 3EWZA 5CGQA 3MO7A 4FNPA 4MYAA 1KBJA 1P0KA 3HIJA 1K7EA 2H8XA 1D9EA 1FWNA 3B0UX 3OEXA 3NQ7A 3W1UA 4UTMA 2YZRA 3M5VA 4QSHA 3KRSA 1TPUA 1BKSA 4O14A 3EXTA 1F6PA 5CSSA 3MW7A 5IBXC 1GVFA 5LGZA 3N73A 1KFJA 4K8EA 3G22A 5D37A 5J5RA 4DO4A 2X1UA 3NG3A 4Q32A 1K02A 3BARA 4HIBA 2A7PA 3C2RA 2HMCA 3EWUA 1OF6A 1W5QA 3JR2A 3KAOA 5FF0A 1F74A 1H61A 2DU2A 3EKZA 5DY2A 4UMCA 3L0GA 4X22A 4FNRA 4H3DA 1PV8A 3EWBX 1D3GA 1X1OA 4OWGA 1TQJA 3UWZA 3EWYA 5D2YA 2VFGA 1VQTA 3LHWA 3OHIA 3DKJA 1WOBA 4JS3A 3ELFA 2ZQ0A 5BNKA 4JTGA 5CZ0A 2ZZ6A 1KM6A 5AHIA 2RHGA 1B3OA 4KFOA 1UB3A 1EUNA 1FBAA 4FX8A 3B06A 4PTNA 1ADOA 4I7UA 2BLEA 3LCWA 3W6YA 3HBLA 4D2JA 4LVDA 2XN0A 4O1BA 1VHCA 3CEPA 1OF8A 4NZJA 3EWXA 3P60A 4IX2A 4UTTA 3W72A 2RDUA 3GKFA 4MPQA 1L6SA 1W31A 4MJZA 3SIZA 3W1AA 1VH7A 5AOUA 5LKYA 2V0TA 4O28A 4UNLA 3I65A 4UFIA 4IMDA 3P82A 1LOLA 3QYQA 1GPWA 1IF2A 3FKKA 1LRQA 4QQ3A 3F1QA 1XDMA 1HG3A 4JNMA 3TR2A 1VCGA 2G97A 3E96A 4BWLA 3TFCA 4FNTA 2YCEA 3KX6A 4UTHA 2OZ0A 1ZAIA 3O16A 2NUYA 3P81A 3SECA 3W71A 3W7JA 2PC4A 3N9SA 3TW6A 1O4UA 3IVSA 3TSDA 1FWWA 3PBYA 4GUIA 3TW7A 3STFA 1TYGA 4GUJA 5FEWA 1N55A 4AF0B 3W2KA 4AMAA 2DZXA 4O11A 4N9DA 4Y6GA 3VE7A 4O15A 1NAL1 4BI5A 2HS8A 3LCHA 4H4IA 2C15A 3SJ3A 3TV8A 4GWEA 1D3HA 1OYAA 2ZZ7A 2QAPA 1ZAHA 1BWKA 3W3OA 4S1FA 2Y85A 1H63A 3SGZA 2EAWA 2QDGA 3DBPA 5AHMA 4EOUA 4FHAA 1XL9A 2A7NA 3CIWA 4O0ZA 4X9SA 5E1QA 4DBEA 1LP6A 2VFHA 1H7OA 3QMSA 4LS1A 4Z1DA 2R14A 4CCEA 3C2FA 3LRKA 1K8YA 5U7SA 1UBSA 4ZQNA 4ZVJA 3CU2A 2Z6IA 1LOQA 3G3DA 5DBTA 5CG7A 3TSBA 1PS9A 3PBVA 2NWSA 3VFLA 4IJBA 2FPTA 3GX9A 2VEKA 1YYAA 5IBXA 1YPIA 3RF9A 3GDTA 4HNTA 2DZTA 3BV4A 5D32A 5AN7A 1SU5A 4DEFA 4AB4A 3U6WA 1MSSA 3A9IA 4WX2A 3TUUA 4MJMA 4DELA 3S1WA 3PG8A 4MY1A 3EKLA 1KV8A 1TRDA 3LHYA 1G7VA 4LWWA 2Q8LA 1VGAA 1GTHA 2FPVA 3KRZA 5DLCA 1ZJIA 5H91A 6ALDA 2Y62A 1OFQA 5G2IA 4JTKA 3W7RA 5I3HA 1N7KA 5AB3A 2C19A 3LV5A 4NJGA 3NPWA 1X6UA 3GK0A 3M6YA 4YCPA 2YFNA 3KXQA 3P61A 2CU0A 4W9TA 2ABAA 4FNSA 1H7PA 1KTBA 5CPNA 3O6YX 4UNKA 3WK2A 3KOFA 5FEXA 3PR2A 1Q6RA 3HF3A 5AC7A 3W7NA 1NSJA 3HPZA 1SW7A 1TV7A 5HINA 3MYPA 5DCDA 1OX5A 4RLIA 1XC4A 4WZHA 3UWYA 4ZQOA 2ZA1A 3LTPA 2NXHA 2PRHA 4IQLA 1JUEA 1L6YA 5E0KA 3HG4A 1JCNA 1FX6A 5AFDA 4ZZ9A 4AHQA 1WQ5A 3GAKA 4MZ1A 3G0XA 1VLWA 1JVNA 3RU6A 4JXCA 1GWJA 3CPRA 5I3FA 2EPHA 2GPTA 2B7PA 4MLRA 1VRDA 1TJRA 4OE7A 2CZFA 5F2IA 1EWEA 1QPNA 1GVQA 3G1VA 1ME7A 3EXRA 2WNZA 2E6AA 5TBOA 2WNQA 1A5CA 3OIXA 3F03K 3BLEA 2Q8ZA 3HPXA 1TB3A 3W1NA 1UASA 1OX4A 2GOUA 2Z2UA 3W86A 4AVFA 5EMUA 5K7JA 4UFMA 4WOZA 3BW4A 3PBUA 1O5XA 1SFJA 4ADSA 3TXZA 4RK8A 3NQMA 3NL5A 3FLUA 1ZY9A 1EX5A 3G3MA 4JTHA 4X2RA 5G1TA 4IXHA 3IRDA 3M1ZA 3TDFA 1KA9F 1LRNA 1DQWA 3SR7A 4PL2A 3DFTA 1LDCA 3UY8A 3VNDA 2P10A 1VS1A 4MOZA 3A5FA 2G96A 4MFDA 1K8ZA 4LW7A 5U4NA 4GRSA 1PE1A 2ISVA 2NWRA 4GFSA 4HNNA 1A5SA 2GQ9A 4JTIA 3OVPA 1PHQA 5HWMA 2GVGA
chains in the Genus database with same CATH superfamily
3WN6A 3UJSA 5KZDA 4QDPA 1EX1A 3W1PA 1QI4A 2WBGA 2I5QA 4RV3A 5TQLA 1BVWA 4KCVA 1A0CA 2ZVRA 1JXJA 1DWGM 3LHTA 4IMCA 3UJFA 1CX9A 2E4TA 1LCOA 2Z24A 5FL0A 3AROA 3GHSA 4CD6A 2J7BA 4DAFA 1I0BA 3E2VA 1AJ2A 3LMYA 4ACYA 4O12A 2INFA 1W8GA 3FY1A 5A8GA 3BUVA 3QR3A 5I5RA 1JCMP 4WY0B 3SUTA 4PUJA 1LLWA 3LBMA 4LB4A 4LVAA 4M6PA 4PTVA 4NIRA 2J79A 3ABZA 1ME8A 2R91A 3L2MA 5HMDA 4C6CA 2CLOA 2DZPA 4LBRA 5D2WA 2Y70A 3VI2A 6XIMA 3CQHA 5E6YA 2DZVA 1GYNA 3BXWA 1R30A 1EPVA 3S9IA 4LY4A 2GGHA 1VCFA 1W3LA 4XSLA 1I4NA 4PC8A 3EB4A 5FF2A 2WZEA 1MXGA 4CCZA 1YDOA 3MJMA 3G2GA 1XLCA 3EOUA 1UKOA 1XYCA 1YX1A 5A2CA 1W54A 2YDAA 3WLSA 2HISA 2VWTA 1BGGA 1XQLA 1XBVA 2BZNA 2PD5A 2QV4A 2CBVA 4CD7A 2ALDA 1EF2A 1RHCA 3PAOA 1ZALA 2EGZA 9XIAA 1H5VA 3ANYA 4XIAA 2DZAA 3I6EA 3URQA 2FHCA 1RBOB 4K3ZA 3LM7A 1TV8A 4ZA0A 1BHGA 1TV4A 3GDLA 3FVMA 3C5QA 1KM0A 1C29A 5AHLA 2CHOA 3K5XA 5I3IA 3AC0A 3U2CA 4DVOA 4IQEA 3D3FA 4IM4A 3HV8A 1JCTA 1QO5A 2V3FA 1IQ8A 1RZMA 2PWDA 3H26A 1FWAC 3GZAA 3IVTA 4O4VA 2J7FA 1Z89A 3UEQA 2WHLA 3R0UA 2F6KA 4IFRA 1GONA 4MYXA 3O6DA 1FWJC 4L5ZA 1MXDA 4UR9A 4AIOA 3T4CA 1KM2A 4GKTA 2ZRWA 1YDYA 2POZA 5CC6A 4YVXA 1E1CB 5C7VA 1B9ZA 4FPSA 2G0WA 3E2RA 4BI6A 2CIPA 3U4FA 1SMDA 3Q65A 3VE9A 4MMWA 2V5DA 3TEVA 4PUEA 1JRCA 3OTRA 4CU8A 5AC6A 3STPA 3ZJ7A 5C54A 3BLLA 3L2IA 4DUOA 3ANUA 2VX6A 2TODA 3E2SA 1J6OA 1TJ0A 3P67A 2OLSA 1S5WA 3HGJA 1L8PA 1XIBA 1J2WA 1UC4A 1BWVA 4WUIA 2Y8UA 1U2YA 3M0ZA 3G0UA 2Y0FA 3OHMB 3KBVA 4ZL1A 4GE8A 1VP5A 2O4QA 4US5A 3EGJA 4HT3A 1XSIA 5M03A 5FACA 2FZDA 2WLYA 4UQAA 2V9DA 3QEZA 4UZSA 1W1PA 1YXYA 3FEQA 3APYA 1EFZA 3KW3A 1U22A 4OVXA 2TSYA 3EOOA 4HGXA 2ZA3A 3CMJA 3SCOA 1XW8A 4UTKA 1YW1A 3W1LA 1JDFA 1PO9A 2VOMA 3EDKA 4PL1A 3RRAA 1JZ3A 3G24A 3AFBA 4KESA 3G1AA 3WG6A 2Y88A 3RLGA 2Y7GA 3ITLA 3AO0A 3ABQA 4HU0A 5D02A 1BVNP 1D8CA 4JTUA 4NNAA 1HJSA 3KP1A 4GIEA 4YNGA 2VEMA 3BMWA 2I16A 2RGLA 1P0NA 3H2MA 4D6HA 4LALA 5I0DA 1KGWA 3G1YA 1CTNA 4ZEPA 4MTVA 3WLRA 1DJXA 2FQIA 4IFKB 4DY1A 1WYIA 4EP8C 1XIEA 4QAIA 3LQLA 5CSUA 1V6TA 3EB2A 1J18A 3V5CA 4AZ6A 5DT5A 1OG0A 2OU4A 4DXXA 2ZUWA 1HVQA 1RLCL 4YTRA 3PULA 3VINA 1YXDA 1NOFA 1FDYA 2P88A 4JQ2A 2ZE0A 4HD5A 2PP0A 5I3KA 1V0KA 3EOSA 1JNDA 3ITVA 3BC9A 3RLUA 5HBFA 2QV5A 6CGTA 3NPUA 2DVXA 4XAFA 5CPOA 4ZO7A 2ZZ4A 1V77A 3BAKA 1KM1A 2QJMA 3B40A 2OVLA 3V1HA 3ES7A 4JGDA 4AXKA 3A21A 1JG9A 4GVHA 1X97A 5ABGA 3NEVA 2J7GA 2VRQA 3GVGA 2I1OA 4A3YA 2OJPA 4WHBA 4IH3A 2I5GA 1IEVA 1YRRA 3UWVA 4DPQA 1HJWA 4PBFA 4EACA 1W9UA 2CLMA 3CUHA 3TZNA 3O05A 1HJUA 3T09A 3PB0A 2RKXA 5DCBA 3ARYA 4P8VA 4FI4A 2WHMA 5DXYA 4GYJA 3RM4A 1OFBA 4QROA 1GJWA 4E3VA 1XCXA 3KZPA 4WXYA 3WQOA 3UT0A 1SZRA 1TO3A 3GG1A 5CPQA 3ID7A 5EL1A 2XSXA 4NQ1A 3BGJA 3B03A 2R9RA 1K77A 5H6HA 2W5FA 3JRKA 5CZSA 3T78A 1S2WA 5C0QA 3BMVA 3PWGA 3M0XA 4JQ3A 4X9YA 3FA4A 4F0KA 1CGUA 1WDSA 1E4NA 2WJZA 1QU4A 3UXDA 3LERA 4ZE5A 3KFTA 4C1NA 4L6HA 1JF5A 2QS8A 4NX5A 3BLPX 5F4XA 3N9RA 5IHRA 5BU9A 1GTEA 3AHXA 4M1RA 4UFKA 3ICJA 2HPIA 4XIMA 3UU0A 2V30A 2YFOA 1R9ZA 3UZXA 3T07A 1FCQA 4ILSA 3O07A 5HXMA 2R1MA 1JQVA 1UPPA 1ZU8A 3LNPA 4IG2A 3W85A 4RZBA 3FVDA 1V0NA 1BD0A 1WBJA 2VX5A 1TZ9A 4W89A 1OCNA 1KM5A 2V5JA 3FHQA 8XIMA 5DN1A 4OUEA 3BW2A 3O1NA 5CLTA 3UR2A 5HNTA 1V3LA 1KB3A 1REQA 5HOSA 4FS9A 1TTIA 3APGA 4CN1A 3TJIA 3SURA 3L5MA 2ZDSA 2WZIA 1QOQA 3GVRA 1W56A 2NV9A 1HGYA 1K4HA 2J9YA 1P0BA 3W1TA 1RSCA 1KNWA 1D2KA 2ZX7A 5FL1A 1PUDA 4WR3A 4YJ5A 4IPIA 4PTMA 3TU9A 3NQVA 3TTQA 3TJ4A 4R85A 2ZTKA 3HPAA 3PAJA 1PDYA 3W87A 2ATSA 3FFSA 1BVZA 1QDSA 5CAHA 2JIWA 2DJLA 2WO5A 1ZRQA 3PPCA 1JXKA 3ZT5A 3S2JA 4XV0A 5BMWA 3UR5A 1ICSA 3DESA 4WKFA 1H4PA 3I7RA 4UQDA 4YU1A 2NV1A 2YL5A 5HWJA 3REQA 1VBRA 1TKKA 4KKXA 4KWOA 4B2DD 2FJUB 4DLMA 2V3DA 3OVQA 1MW3A 3NOYA 2VOTA 3U5YA 3VDGA 4ASTA 5A5WA 2E09A 5GNXA 4FXJA 4AWUA 3L21A 3E3HA 3VD7A 1MYRA 2FZMA 3B8WA 1Q8AA 4P8XA 3QW3A 2PTYA 1NELA 4DXVA 4CD5A 4UB9A 4JTSA 1E1EA 3WFLA 5A94A 4O52A 4HA3A 2Z4GA 3MMUA 4GHRA 3TYDA 4S2BA 4S3KA 2WSRA 3B0YA 4H00A 3TCSA 1VJZA 2C91A 1G4EA 4GO8A 4JFVA 4P7QA 2GZXA 4GNVA 3KP0A 2JK2A 3FYYA 3P62A 5CPSA 3APTA 2PD9A 2WSKA 4MNKA 5FEPA 3VYLA 1V3HA 3AALA 1H7WA 2QDHA 2WOQA 5CSRA 2I14A 5EBUA 4Y9AA 2CLLA 2BY0A 1O5RA 4Z2KA 3R58A 3CWNA 2XPKA 4MVAA 2PI6A 2Y1HA 2PWVA 3AJXA 3HTWA 4B91A 2XDFA 1XQKA 3UWUA 3W2MA 4DM1A 4KCWA 4WDUA 4DNMA 3LN3A 1KM4A 5G1YA 3O63A 4JIHA 1GOMA 3TNBA 3E5PA 1AZ2A 3UY7A 5AYYA 1C7TA 3ZSSA 4PRTA 3WBXA 2PDWA 4L6OA 4LVGA 3U57A 5SWUA 3TZFA 3AXKA 1ODZA 1QPRA 4XD3A 2E77A 3B8SA 4LCRA 2EG7A 3QZ6A 1HP5A 2W61A 4J40A 1LLZA 4FF5A 3F5JA 4Z17A 3IIXA 1TR1A 1GKQA 2VT0A 5D2XA 3SCSA 4XD4A 3VGEA 1MFUA 1ZBCA 1VBUA 3AMGA 1H2JA 5BXTA 1DVJA 3DEQA 1IV8A 3SFKA 4XUGA 1MNZA 1LORA 4ORIA 1M7XA 4KF1A 1AD1A 2E9MA 5D2TA 1V02A 5HK4A 3GNDA 4PRRA 3PZMA 2Y7DA 2BSLA 4GK8A 2DP3A 3KWSA 2VNCA 4Q8WA 2QAFA 3GC2A 4US5D 3G1FA 4QEEA 4W8AA 1Z9AA 4RPQA 4UBPC 1KQZA 1ONRA 1R3YA 3GE7A 1V6VA 4JAWA 2BVDA 3EEZA 4UQBA 1U5VA 3N19B 4BJHA 5HUOA 1JFHA 4RZ5A 1A4LA 6REQB 4JTEA 1QOXA 3B8DA 4XZLX 5LXEA 5DCEA 3CWHA 1BYBA 1ZPTA 1R2RA 1PKNA 2XIIA 3VOGA 2FGZA 1MDRA 4R88A 1LQ0A 2AQVA 4TTGA 1X39A 2VFIA 3EB3A 1DKWA 4IJCA 4JIQA 1XLKA 1BLIA 2PRLA 3W02A 3WNKA 4MAZA 4R9OA 3VTRA 4FX6M 4CU6A 1XP3A 1X6LA 5LHFA 2Y2WA 2CCRA 3UCDA 3LI1A 4WSJA 3ARUA 1TREA 1FQ0A 1KGXA 4JPGA 5I24A 2J9XA 3UNTA 4C7GA 1VRXA 1XLAA 3BQ5A 1CBGA 2AAMA 4NP7A 3RN6A 3STCA 3OVRA 3QTPA 3RX4A 3AOFA 1AUSL 1LL6A 2VFFA 1Q6GA 2MANA 2ZC8A 3NM1A 3GG8A 4UQ9A 2C0AA 3DC0A 3L5LA 4KEUA 4XUYA 3NQAA 4XX6A 7A3HA 4GXPA 3UJ2A 3GDKA 3GHTA 5BZAA 4Z2LA 3O6AA 1RK6A 4C6FA 3I3EA 4Z1YA 5LIXX 3Q58A 3OJGA 4LYRA 3G18A 1VIZA 3S5YA 2RJGA 1M7PA 1ZP3A 2Z2BA 3LX9A 5LZLA 1GVRA 1OFAA 3IGSA 3KHDA 3PBWA 2J13A 4GX9A 1H62A 3CAKA 4MDPA 3OOQA 1XCWA 3FJ6A 5K4ZA 2V67A 2ZXBA 1CEOA 1CGYA 1GW9A 3IS4A 1VBHA 3HG2A 4H04A 2BG5A 1AQMA 3N2CA 4KEZA 3H2EA 3LA4A 4UFHA 1FHVA 1M6JA 2G8ZA 2EO7A 3ZLHA 3SRFA 1W6TA 7CGTA 1ML1A 4JN7A 3QPEA 2W27A 2X7VA 3DGBA 2DIJA 2VEPA 1TMQA 3USZA 3GYEA 5M2FX 4LX4A 2QGYA 3CEUA 2FPYA 3Q2DA 1E70M 2HK1A 1F7BA 3VVGA 3D46A 2YBUA 4FXRA 2CERA 2WJDA 4PA8A 1RJRA 3CM4A 4UTLA 1UYQA 2A3AA 2OSYA 3PC0A 1F2JA 4NJJA 5LNVA 4LRSA 1L2UA 2P53A 4UOJA 2HV5A 1FFQA 4ZGYA 4UFJA 3B9AA 2HVOA 2J66A 1VLIA 2X42A 2G3IA 1TJPA 3M0KA 4GG9A 1AA1B 2ZZ3A 3WO8A 3I6TA 3C56A 4C90A 2XWDA 5IM51 4DX3A 2FDMA 3WLQA 4DO6A 3I7QA 1FXQA 1IHIA 1N2VA 3R10A 1FCBA 4QCFA 4S38A 2PURA 3BZJA 4O13A 2VENA 2VC6A 4CNUA 1XRFA 5BRBA 3QPYA 1CIUA 3TYAA 4AZCA 2QQ6A 3AWNA 3LOTA 3N14A 1TX0A 5TAOA 3ONBA 3CB8A 2WZMA 3KVLA 2DFAA 2XFRA 2WMIA 1PPIA 4HHLA 1YBQA 2POTA 3AZRA 2GQ3A 3QFEA 1UJQA 2GUBA 5GPRA 4IGMA 4K1GA 4I8YA 3O3RA 2BGQA 4WIWA 1XGZA 3BLDA 3S1UA 3LTYA 3HGOA 4OHQA 4U4MA 3T81A 4W8LA 3DH7A 3M41A 2OEJA 3K13A 3RITA 3FJLA 3EWDA 3POCA 3VK5A 2DJXA 4NZ1A 1P4CA 1JCYA 3E0IA 1A0DA 1H60A 5G1MA 1KM3A 1FHLA 3ZVHA 4PTWA 2FJKA 3CV1A 3DHDA 1JZ8A 4PE8A 4C5ZA 3MV11 3KL3A 2NSOA 1SYTA 1LM1A 1B2YA 4L1GA 1XYMA 4MKSA 5C9UA 1KTNA 2WCSA 4KWVA 3UQNA 4RCXA 4WGXA 3DENA 3GSMA 2FZ8A 4ROQA 4KMQA 5FAJA 2CBJA 3E9AA 3TAKA 2E6DA 5LA2A 2JF6A 2Q01A 2CWXA 5K9XA 2PTXA 1UR4A 2D73A 2UBPC 3LYEA 1TPFA 3MI6A 2GWGA 5IHSA 4FLOA 3UYIA 1EIBA 4AU0A 3S5NA 1US2A 4NU7A 1H49A 4QJ3B 4ERIA 4NX0A 1UWQA 1CLVA 1K7FA 1M7OA 1XPYA 2DORA 3HQ1A 3IK4A 2GVYA 4KW2A 5CPMA 4ERGA 2QJGA 2GSEA 1R8LA 4HZMA 4FA3A 2YZ5A 2ZUUA 2Q3RA 4TX6A 4GJ1A 4JDYA 3ATYA 3ARRA 4OGZA 3LCLA 4L4MA 5JMUA 2PGWA 3WK1A 4NZCA 1PWLA 2B7QA 2J7DA 4D6JA 4F3HA 2WC3A 4OUIA 4F2TA 3WFZA 3YPIA 5CGMA 4H9XA 7REQA 2OELA 4GH1A 1QT1A 2HRWA 3FDGA 1SGJA 1W8SA 3TQ0A 5KZ6A 3TQKA 3CTTA 5FSDC 1J01A 1B31A 1UD6A 4MNMA 1S46A 3CZJA 2OGYA 2V6AA 2O92A 5FA5A 2UY3A 1UWAA 2JIEA 4OQVA 4JKLA 4E4FA 1DTUA 1E71M 4WVXA 1JPIA 2V2CA 3MMDA 3TJLA 5AKQA 3WELA 4Q7IA 1WBHA 3W7MA 4M56A 1JQXA 3S1XA 1WZLA 1HKVA 1JGMA 1E6ZA 3E5BA 1ADDA 4E2VA 4C6LA 2IS7A 3CQKA 4FLQA 4JIRA 3A5VA 1OFDA 3T44A 3H70A 1W3HA 1VKFA 3PS7A 2QJIA 4LY8A 3RUBL 1VB9A 3LCFA 1M9HA 3F4CA 2XZ9A 3WL1A 1K7XA 3CL7A 2PDCA 4YTUA 3I3DA 3AJ7A 4OU1A 4UQEA 1LG2A 3EX3A 5CXPA 2BFGA 4FAMA 1IEXA 1AJZA 1HNYA 3CNYA 3HG5A 2ZTJA 5CBBA 3KL0A 2YB4A 3WKZA 5DT7A 1JIBA 1Q7ZA 3BSMA 4U10A 2YX0A 3VOHA 3NPXA 5K4XA 1O5KA 1Q6FA 4ZQRA 1GG1A 3BCFA 2DIKA 3S5OA 2XH7A 1AMYA 1DBTA 2BGNE 1RPXA 2X7WA 1Z7AA 4JNYA 2V2DA 1EIXA 4BQ5A 1PJ9A 1BRLA 2YDSA 4KEMA 3RJXA 3PJWA 4HYRA 5FKYA 1JYVA 3W7CA 4MB3A 3THQA 3ZZ1A 1VENA 3S5ZA 4IL0A 2BDQA 2VUNA 2XFFA 4AZIA 4HNOA 3BGAA 1I2QA 4PN2A 4GJIA 4CNSA 2QUMA 4LTSA 3LM3A 4UTWA 1C3FA 4QIUA 3W24A 3CTLA 2ACRA 3CQ0A 4JR5A 3M7WA 2WVVA 3PUEA 1TV5A 4DBDA 1G4SA 3KLLA 5E0FA 1FOBA 1V6YA 1FP9A 3TKFA 1O66A 2JALA 3LHVA 4KRZA 3GG7A 3M0VA 2D2OA 3R79A 1M03A 3EWZA 5CGQA 3IPWA 4PMUA 2HDJA 3MO7A 3H21A 3A6OA 5AECA 2H8XA 1FWNA 3BLKA 3GXMA 3QR1A 3ARPA 4QSHA 2VGGA 4HJWA 1BKSA 4J3VA 3W4RA 3LENA 3N73A 4K8EA 4WJXA 5LGZA 1I75A 5D37A 5J5RA 1UIOA 4JN8A 1W9PA 4GCAA 1K02A 1GCYA 1Q7MA 1E0WA 1W5QA 5HAOA 1AH4A 1H61A 2DU2A 4HU4A 2NQHA 3VABA 3R0DA 4X22A 1PV8A 1Y5VA 3EWBX 2D2GA 4K2SA 2HQAA 3FCPA 1UKPA 3LHWA 2DPEA 3ELFA 4AZ7A 5BNKA 1DWJM 2ZZ6A 5B7ZA 4Q22A 1KM6A 4IJRA 3DBNA 3VGDA 2RHGA 2XVGA 3ES8A 4FX8A 3HV9A 3UW6A 3H7RA 3B06A 4E5TA 3WL0A 3F2CA 3FGCA 1P6CA 3VGGA 4M3PA 5T9BG 4O1BA 1VHCA 1CXIA 4KBXA 4UTTA 4JKKA 5EMMA 1J2BA 4MPQA 1UWRA 4ZCWA 3SIZA 4KIRA 3W1AA 1AH3A 1LL4A 1L8NA 1VH7A 2PDMA 3OYXA 3NSNA 2L5HA 5XINA 3QYQA 1WDRA 1GPWA 1IF2A 3NURA 5BWFA 4OIFA 3FKKA 2NVAA 1KO0A 2JE8A 3B8IA 1HG3A 4JNMA 4J3WA 4MNJA 4H2HA 4PB4A 3VMNA 4E4PA 4CEUC 3TFCA 2NVCA 1CGTA 2X0YA 1DIDA 3WNOA 1M3UA 3O16A 3P81A 3SECA 2HEJA 3TW6A 2HBVA 3PBYA 3MANA 1DHKA 3UF9A 3STFA 3T0DA 1DXIA 3WLKX 1FWHC 4HQVA 4Y6GA 3N4EA 2DSWA 4BI5A 4H4IA 4XZNX 3GNXA 1SFTA 4GACA 1D3HA 3I4EA 3M46A 1KRAC 1ZAHA 4NRRA 6PTDA 1UA7A 2YL8A 3SGZA 5GQBA 4DHGA 5AHMA 4FLSA 3WQ5A 4FHAA 1O5QA 2EJ1A 2A7NA 4O0ZA 5FIPA 3RX3A 1VEMA 1R3TA 4IIEA 5A2AA 2WW5A 3N04A 4D1JA 4F0MA 1OT2A 2WVSA 3LRKA 3MY9A 5I03A 1UBSA 4ZVJA 1BYAA 1LOQA 3G3DA 2FH8A 5CG7A 3TLQA 1PS9A 2FGLA 5IBXA 3GDTA 1SU5A 4AY1A 4JQAA 3T9PA 3TUUA 3O0KA 4MJMA 4JKMA 4L6DA 4MY1A 1BXNA 1KXQA 2ALRA 3AZTA 3MUCA 3LHYA 3WQFA 1G7VA 1MW0A 1DTNA 3WUEA 1GTHA 4L9YA 1S2AA 2A3LA 5JBDA 4C91A 2Z26A 1E3XA 3OQEA 3QOMA 1TE1A 4Q8VA 5AB3A 2C19A 3NPWA 5EB8A 3TTSA 3GK0A 1XHGA 4X0VA 2YFNA 3XISA 3ZJ6A 4YCPA 3P61A 4C65A 4W9TA 1XR2A 1NH6A 2CKRA 4LF1A 4H83A 3SRHA 3UJRA 3DDMA 5FEXA 2NSXA 3PR2A 3FX4A 2VEFA 3LU2A 1SW7A 5IDIA 1VAHA 1NWUA 2QPUA 4DWDA 1KCZA 3PANA 1Z8AA 3WLPA 2PRHA 1JUEA 1W3JA 2ESCA 1C91A 3BOXA 4RNFA 1FX6A 4S3FA 5AFDA 4ZFCA 1UQYA 3IJ9A 5HATA 1KBLA 4BQ3A 1QNQA 2QIIA 4JXCA 3CPRA 1EH9A 4C5YA 2B7PA 1VRDA 4H7CA 4OE7A 3WUBA 2O0TA 5F2IA 3L2LA 1ME7A 3GY1A 3EXRA 4KT2A 3VMPA 5TBOA 1A5CA 3F03K 4QSFA 1TB3A 1OX4A 2BHZA 3OGRA 3W86A 1HJVA 1GJUA 4UFMA 4WOZA 4URIA 3PUGA 1WE5A 4BCEA 1JDAA 2XM1A 3TXZA 4BS0A 1KKRA 3BJTA 1WDPA 2HZGA 1ZY9A 2VZSA 3DYMA 3CBWA 1MNSA 3SR7A 2WMKA 3EDFA 3SGGA 3VNDA 1VS1A 3A5FA 3UVIA 2NWRA 5JIWA 2Z7KA 4H6RA 2O55A 4UTWC 3CHVA 2ZICA 4ZENA 3RPMA 3WZ0E 4A29A 2V5KA 3M0YA 1KFWA 2ONEA 4KQNA 4C1KA 2V8ZA 1WA3A 3SCPA 2A1YA 1KXHA 2ISSA 3W22A 1HO1A 4GINA 3CUXA 1BG9A 3SRKA 2NLYA 5D9OA 2X09A 1A3WA 4AWTA 1I1XA 4R7WA 4LSBA 1GOIA 2Y61A 3S1VA 3UG8A 2ANUA 4C1NB 3GXNA 1P6WA 3VNKA 2GQAA 4XZWA 4PSPA 2F6XA 4R7OA 1QRQA 4TUFA 4LUSA 4DF0A 4W85A 1DJHA 3M64A 1SPQA 1TPH1 4M80A 1TELA 2QDEA 4HHHA 2NQLA 1H50A 3SY5A 5IDZA 2EXOA 4WGHA 2C0HA 1EJ7L 3W2JA 1EF3A 4Z1CA 2PFHA 3BOLA 1VBJA 4OBSA 2R1LA 2ZA2A 3LY0A 2QNEA 3R2GA 3AYSA 3KOXA 2OB3A 1FH8A 2PDKA 3U2EA 2IQ0A 1ZJAA 1WP6A 3WQ6A 1W1B1 4DUWA 1H11A 4CQBA 3G8RA 3SCWA 3NR0A 4JY9A 2OEMA 1P48A 2XYLA 7TAAA 4F0RA 2GSJA 2J24A 4GIYA 4OBTA 3KVMA 1D7KA 3U48A 3IIZA 4L9ZA 1M68A 3LXAA 4JOMA 4HSHA 2BGSA 3IV3A 5FEZA 2FVMA 1D8WA 4MLJA 3MSDA 4C6IA 5CGTA 5KITA 3ZIZA 1NWSA 4N6FA 4ZTYA 4MWAA 3PZ9A 5K9DA 4M0XA 3WF4A 2PGFA 1ITCA 2QF7A 2PDIA 2XVLA 3CUZA 1YQ2A 1GEQA 2A3BA 1F5ZA 2FMNA 1EJVC 3L4XA 1Y5WA 2VC9A 1OX6A 3SW6A 4GBDA 4ZO9A 3BAYA 3REQB 2ISWA 4HK6A 1YPXA 1SZEA 4WQ6A 1KQYA 3AIVA 3UA4A 2HROA 3NDZA 2FIQA 3IWPA 1EEXA 4C6KA 4UIOA 3GXTA 1QK0A 1K8CA 2PLCA 3NZPA 4YPJA 1MW2A 1UCWA 2CETA 3L23A 4N0RA 3WD3A 3VAVA 8XIAA 5E6ZA 1Q4NX 4KRUA 5D8WA 2ZC1A 5HR7A 4K38A 3EPOA 3SZ8A 3VCNA 3DFNA 4N4QA 4AC1X 2I56A 2ZXAA 4JIIX 4B9YA 1JYXA 3WUFA 1UMYA 3BV7A 3R1ZA 4G1KA 4NXSA 4AF0A 4DB7A 2RDXA 3U0HA 2OQLA 2HJPA 3WNLA 1W3IA 2F6UA 4Z08A 3VM5A 1CECA 4C6QA 3G1RA 4IIFA 1DHPA 2BXYA 3BVJA 1QI3A 3GM8A 2QPSA 4AX7A 5HPCA 5F1VA 2CESA 4ZTXA 3FNDA 2B0MA 3IVUA 3GR7A 2PP3A 4H6QA 2A3HA 3F7JA 4JTTA 1F3TA 4GBUA 4Z1BA 4CD8A 1W5OA 3W2LA 3W7OA 4A8LA 2NQ9A 4W84A 1A80A 1NP2A 1WZMA 1HO4A 3TTYA 1KR0A 3TA6A 3EDDA 1QHOA 3T0AA 2UV8G 2ZVIA 1GK8A 3NSMA 2QF8A 4WLCA 1S5VA 3DX5A 1XF0A 5F1UA 4TVDA 3WLJA 3L7RA 1EXPA 1W5PA 9XIMA 5CZKA 3WQEA 1XRTA 1KBIA 1NARA 2CC0A 3F4VA 5I3DA 1Q85A 1R7OA 1AFSA 3IIVA 1UD4A 1MRQA 3ZMRA 3VPLA 3LBCA 2RH9A 3LGDA 3NEHA 4KCTA 2VX7A 3B05A 3OYZA 2W92A 1JCLA 3P93A 4O1FA 2X0HA 1UH4A 3NVTA 4WOQA 2CWNA 3H2OA 3VNJA 2QCCA 2A0NA 4U3AA 1GGOA 1UH2A 1SW3A 1ZCOA 3C2EA 3NO1A 4RUBA 1HUVA 3V7PA 1KKOA 2WV8A 2J8FA 4IPPA 1E9LA 1QW7A 3FKRA 3A4AA 2WHJA 1J0ZA 3QHNA 5HQLA 4AZGA 2PRMA 4LS2A 2V81A 1LUCB 4D8ZA 2GK1A 3TK7A 3WUGA 1X98A 2F84A 4WJ8A 1EB3A 5GNZA 2QYGA 5C5YA 3GU1A 1GT8A 1JCXA 4V1XA 4YWIA 4N7QA 1NFGA 3AUJA 1NIUA 2GLKA 4PB3A 1J8VA 1J11A 1J0IA 2W9MA 3L4YA 4JYDA 5GJPA 2JEPA 2I7GA 1UP2A 3EBVA 1TMHA 3RILA 2G5WA 3TN5A 1XDJA 1GKPA 5CZTA 3AXXA 5HDRA 3KDNA 1JR1A 4XKYB 4M6VA 3QLDA 3DU0A 4N9BA 4P8WA 2ZZ5A 5FESA 3H7UA 1L6FA 2VCBA 1E6SM 1QCWA 2B31A 2ZADA 2XINA 2YCIX 3B9EA 5A8OA 3ZO9A 1SW0A 4JTFA 1R7AA 4M51A 3ANVA 2XG9A 1ITQA 1VJSA 4N4PA 1WAWA 4H01A 1E4LA 1QNOA 2WKJA 2ZZ2A 1NFPA 5I00A 1WX0A 4BR1A 4L64A 2DIEA 2CKSA 1T8QA 5AHEA 3AIBA 3GAYA 3GUGA 1YMYA 4QDWA 2J47A 3QC0A 3PTMA 4OV4A 4QTGA 5DMYA 2ZOXA 4Y8EA 1KW1A 2G3MA 5I78A 3I68A 2G3JA 3LQGA 3MU7A 5I06A 2IMRA 1VFOA 3LZ5A 4MNLA 4ZQMA 4HA1A 1SSDA 2ZWYA 3FSUA 3LRMA 3XINA 1OGBA 3W7PA 1UIPA 1XDLA 4Z1AA 4NJIA 4HPJA 4GFIA 4ENLA 4DQWA 1Z44A 1FFRA 5ABTA 4RW3A 5J5DA 4E8GA 2WVUA 2Z00A 1US0A 4HP5A 1H1YA 3G6MA 2QCHA 3SCNA 1VEPA 3E6EA 2BOFX 1BYDA 2OGJA 3ITCA 1RCOB 2YBVA 3UD6A 5IRPA 2ODOA 3K8MA 4LVBA 3STGA 1XLJA 2FTYA 2RAGA 1W32A 3ONCA 4NAEB 1OYBA 4PBEA 4S39A 1TWIA 3BLFA 2XFWA 1S5TA 3CYVA 3UZJA 4KWSA 1ZENA 1R47A 4IHCA 1HP4A 4D6CA 1GHSA 3QJAA 1BFNA 1DL3A 3V5FA 2A2IA 2OWCA 1W3TA 3P7YA 1WDWA 1WKFA 2Y89A 1V03A 4IMFA 4AD5A 2WMFA 1BXCA 4B9ZA 1PZ3A 1CPUA 2GDVA 3A12A 4DBWA 3QBUA 2X05A 3V18A 4F8XA 1A5MC 4AD4A 1FWTA 3CJPA 4I5RA 1IWAA 3C8FA 5LSMA 2Y7EA 4R27A 1E6XM 3URAA 4A22A 1K3UA 2GJPA 4MY8A 4AWEA 1XYBA 4JFWA 1VFUA 5M1TA 2WKGA 1UD5A 2PZ0A 3HG3A 3DI0A 2B7OA 3ATZA 1W9DM 3CHEA 4GVIA 4IZGA 4S3BA 1FUYA 5KZMA 5A6MA 1AW1A 3V0TA 2H8ZA 2GDQA 5CCZA 4PMNA 1WXZA 1NDVA 4UCGA 3MCMA 3WBWA 4J9JA 2XGZA 2OLAA 2AAAA 5FF7A 4EIVA 1B57A 3SGUA 3W7EA 4ZQCA 1XYZA 4O17A 1OC7A 1V0MA 3V16A 2IUZA 1FWBC 3H55A 4O1CA 3AIEA 2FB2A 3Q45A 3QMTA 1JAEA 4OZOA 2BTMA 5F4WA 3U5UA 4PULA 4K8GA 5D03A 3VIKA 4UOZA 1XIIA 3T42A 1RY8A 3B8UA 4WF7A 1UC5A 3LGEA 4RE0A 1CGXA 1EJWC 1TA3A 4XQ6A 3F4DA 2VZOA 4J28A 3MUY1 2CXGA 1LJYA 1XKYA 4TMBA 4UTJA 4ICNA 3CUGA 2REQA 1J0HA 3KBMA 2NLIA 4A2SA 1XV8A 3IIPA 4AZCB 3SCQA 3M0IA 3QYSA 4GYPC 1ISWA 3OIHA 3DGRA 5IOBA 3CV2A 3RPTA 4IQJA 3ABRA 1P5BA 1XIGA 3WJZA 3GDMA 1XH0A 1YBQB 2VM8A 2OG9A 3T0BA 3S6DA 3JU2A 3K1GA 2AKMA 1CXEA 1EHAA 2ZXQA 4MWAD 3VILA 2D2JA 2AQOA 2PLMA 1JD7A 3EMQA 1A5KC 3CPUA 3CL8A 5H8PA 3O15A 3OO2A 2P0IA 4XK2A 5H1WA 3FOKA 1Z42A 3N2BA 1W1ZA 3B8VA 4S3JA 8RUCA 2A3EA 1GOOA 4JTJA 3PG9A 4LYQA 2YDQA 4S3DA 5LNUA 1TWZA 3MP3A 1G69A 1XLBA 1HX0A 4PEEA 3DAQA 1PZ0A 3MUZ1 3IGHX 1Z3NA 3ZVHB 1YNYA 1OZQA 3URBA 3FV9A 4YYFA 3WH5A 3DG6A 4PMQA 2OEKA 3UWWA 3NZRA 3VNYA 2DUXA 2YYTA 3TMLA 1O1HA 2DSUA 5JUVA 2WCAA 4WK9A 2JF7A 3MQTA 5JU6A 2TAAA 2Z27A 2NX1A 4E38A 2X0SA 3TP4A 3WLMA 4C7FA 3UERA 3ZWSA 4O50A 3AMLA 3RYSA 3GXFA 1XSJA 1EP3A 2ZDRA 4QJ1A 1J0JA 1G1YA 1RUSA 1KBKA 1AD4A 3M5ZA 3KCLA 1R0MA 5KTLA 4FALA 4CEXC 5BXSA 3W28A 1RD6A 1EBHA 4NHVA 4G7EB 1KTCA 2ACQA 3EAUA 4BF9A 2W79A 4GI9A 2D0FA 2QCLA 1KLYA 4S23A 1SO5A 4YS1A 3T40A 3TX9A 1TPDA 1VFHA 2QCMA 1JZ2A 2J78A 4ZOBA 5HULA 3HM7A 5LNWA 1RR2A 3PFRA 3PF3A 1AVAA 1K9EA 4TMCA 3N6QA 1EJSC 3AAMA 1FY6A 1W2VA 2I5IA 3U8GA 4LUJA 5MKGB 4DBUA 3R5EA 2VZTA 2FZNA 4Q4QA 2UY4A 3LG3A 4XWUA 1M1BA 3EA1A 4I9JA 1U1HA 1OIMA 2IXVA 2B81A 4J4KA 1KD0A 1JPHA 4JTDA 1IZKA 4O57A 1MUCA 2C7FA 4EXBA 4YTSA 2TYSA 3MWCA 2QJJA 3FHAA 5AYXA 4MUZA 3SQSA 3NQDA 1IXQA 1F4HA 3KM8A 3T7VA 1LTDA 4W8BA 3M16A 3VGFA 2VL4A 1RVGA 1BSIA 3H2NA 4LGXA 5LIWX 4GVFA 1H3GA 2FHFA 1J5TA 2VI0A 1RY0A 3SQLA 1EEPA 3PZOA 2MUCA 1XIFA 1IXOA 2RDWA 1UZDA 1R2SA 4IPJA 5CBIA 1BYCA 1KC7A 3B9OA 4OOUA 4JTCA 3MUAA 4BI7A 3IAQA 4B5TA 3IEBA 3CS2A 1BQGA 1A5UA 5D4YA 3UG5A 3ABXA 3IJQA 3WNMA 1K1DA 1G4TA 2J9ZA 3R89A 4MF4A 4F9JA 1E40A 3VOJA 3NO3A 4PH6A 2IQDA 2PB1A 2PCEA 4B5XA 2WANA 1RQHA 3BAIA 1S2UA 3IJLA 4S3CA 3PWAA 4M8UA 2WAGA 4GI8A 2XH4A 2E28A 4ACZB 2DGAA 2QXWA 1LWHA 4IMAA 1MQRA 2YR1A 1ELSA 1JPKA 1WUEA 4MUPA 4XBJA 2WPBA 1DORA 2H6RA 4ROPA 2ZX9A 3BJFA 4H8UA 2CZDA 1EPXA 2DT3A 2ZRYA 4AWSA 1Q8JA 2E1WA 1RCXB 4RPPA 3CZEA 3LPPA 2OX1A 1EQCA 1GOKA 2FB3A 1VPXA 4DF2A 4ZMGA 4IICA 3H23A 2E9LA 2NX9A 3VXGA 1TWWA 5A6AA 2I17A 5C2XA 1LBFA 2TRSA 3ZS4A 3PTDA 5D33A 2VCCA 2FVKA 5JIPA 2CITA 1UUMA 4REQA 5C2GA 3V4BA 4Y90A 3MP4A 5FAGA 4GMEA 2CZ5A 3WQDA 2V82A 4DXKA 3EDJA 1UR1A 2O9OA 2W66A 1J6PA 3LZ3A 1CI1A 4CNTA 4GC4A 3BAJA 3VUPA 1W2PA 3CUJA 3P8JA 2ZXDA 2H3BA 3SO7A 5HUPA 4V27A 1ZHAA 2A6NA 3AI0A 4GYKA 5DX7A 5D2VA 3VD3A 2OLHA 3UESA 4FZIA 1LROA 1SZNA 1ALDA 3ZXWA 1QPKA 3BZGA 1RXOB 3R4IA 4RR4A 1T6MA 3PWIA 2HBXA 4IOTA 5DMLA 3W6LA 3CC1A 4U5KA 2CHNA 3FGCB 5C71A 4BK9A 2GDUA 2D0HA 4PCPA 3AWOA 2OZ8A 3ZSTA 4FEZA 1VFFA 4D1IA 1CW2A 1UROA 1EL3A 4RNJA 3B4YA 4CU7A 4N6EA 4DIAA 1KCXA 1DXFA 5D09A 3C2OA 3SADA 3NJ3A 4LU0A 4PTDA 3V0SA 2QUUA 1KWGA 4ZXOA 2Z0IA 2IKJA 3I10A 2R94A 4WD0A 2OYLA 1LYXA 4LUTB 2FTWA 1WOAA 2TPSA 4B5WA 4FOKA 1LQ2A 1V93A 3PSVA 5BROA 4ZBCA 2QVHA 1VYPX 3WF1A 3TTEA 1MW1A 2WCGA 1VHNA 1VBGA 1PEZA 3OPSA 1OVDA 4XZMX 2W4XA 3T2QA 3DYPA 2F7FA 1A5NC 3P14A 5HQMA 1SO3A 2NQZA 2CYGA 3DG7A 1KFBA 3S46A 1SMAA 3MKKA 3R94A 4DUVA 1NOUA 3B9DA 1EJXC 4DI8A 1A3HA 3DXIA 2Z1BA 3MSGA 3ZR5A 4BFAA 3B8TA 4PCNA 4HKPA 1H51A 4CN4A 1J12A 6A3HA 3NXFA 5AYIA 1Q6QA 2PAJA 1B4EA 2Z1WA 3WD1A 3WD0A 4NI3A 1OT1A 3WYZA 3KBWA 2XZ7A 4LAUA 1E51A 3MHFA 1H5YA 3ZOAA 3ARQA 1GQNA 3RR4A 1IT0A 1E1CA 3TFXA 4NAFA 4R7JA 2XJ7A 3WK3A 2V3EA 1KXTA 1V3JA 4L4LA 1KLZA 3MS8A 3N2MA 3EX1A 3WIJA 3TXVA 3ABSA 2JBMA 2Y5JA 3UJEA 4AAJA 3LHZA 3F2BA 3NGJA 2ZIDA 2W0UA 4CQCA 4K68A 3SIMA 4XTIA 1QNRA 2ABBA 4GYFA 3PK7A 3B0PA 3THAA 5J8LA 1R86A 1E3ZA 2LLEA 2QT3A 4XAYA 2GL5A 3THDA 3IUHA 2XH0A 1JPMA 5L6UA 2DT2A 1S5MA 2HVNA 1TG7A 1KRBC 3DZ1A 4NRSA 3BWWA 1ZB5A 2NVDA 3SUWA 5HPOA 3Q4DA 2QULA 4RDZA 1DJWA 1SFSA 3MI3A 1DJQA 1ZP4A 2YCJA 4LVFA 1H1NA 1ZFJA 1C8XA 2PDBA 3MO4A 3T2PA 3ZM8A 1V7AA 1FCVA 5HJLA 4DM2A 1Q5MA 4NUWA 1JGIA 1QTWA 3WFAA 1FWFC 5ABFA 5A2BA 4U5IA 3RCNA 3RRXA 4UMBA 1QWKA 3BURA 5DRIA 3IRSA 1NF7A 1CCWB 2HVMA 3GC4A 1MEWA 4IMGA 3CUFA 3QY7A 4ZO6A 3G0SA 3GIYA 3P74A 1HT6A 3PZUA 1MVYA 3OZPA 2Z28A 1X6NA 4WY0F 1W1A1 1W37A 1O94A 3FYPA 3BW3A 4OOZA 5I3GA 2UY2A 1TPC1 3GNOA 4M7TA 2JKPA 3NZGA 2E67A 4QNEA 3BANA 4B92A 4IFKA 3W73A 1POKA 4RE3A 1B5TA 1TWDA 4ES4A 2EPOA 1AH0A 3RGTA 3GVQA 3CLMA 2C6QA 1EJTC 4Q6XA 1WKYA 3W2UA 4FXSA 1AQFA 2EKCA 4HHMA 5I2UA 1IGSA 4IPLA 3SJNA 1JJKA 2QW5A 3P8IA 1QOPA 3BICA 1AZ1A 1RA0A 3ARZA 2GSHA 4JQ1A 3SCVA 7ENLA 3K30A 3LHUA 3I7SA 4W7WA 4KFPA 3P3BA 3GXPA 1KFKA 1VJIA 1VC4A 2H90A 3LK6A 4CCCA 3M07A 1IE7C 1GG0A 2IXUA 4JL1A 4O16A 4LS0A 1JNEA 3VUSA 4U3CA 2X16A 4RJEA 4TVCA 1F76A 3W7KA 1CLKA 3MZNA 4Y96A 4LV4A 2W91A 3W70A 4AQLA 1HVXA 4QR6A 2PU0A 1NU5A 1KBJA 1SR0A 1E4IA 5CBJA 4OKDA 3B0UX 3OEXA 3N12A 3M5VA 3U7VA 1TPUA 1T40A 3N18A 1F6PA 5JXQA 3MW7A 4UNIA 1GVFA 3M4HA 1KFJA 2XISA 3VDCA 4Q32A 3RO6A 1E9IA 4QLKA 3K2GA 3C2RA 3VOCA 3WQ4A 5ENLA 3KAOA 3UGVA 1QXLA 1F74A 2OKTA 1JZ6A 3QVQA 3TR9A 3EKZA 3L0GA 1C90A 4FNRA 4H3DA 1VFMA 3H4XA 1UR8A 4QFUA 4KERA 3ENLA 5ECUA 2VFGA 3PTKA 1VQTA 4JS3A 1NDWA 3LEPA 1GEHA 4WKAA 2PDLA 1G9HA 1UB3A 3OQ8A 5DEZA 4XO7A 1PTGA 2GYIA 1FTXA 4Q4MA 2DQWA 2BLEA 2DQXA 4D2JA 3DHPA 3CEPA 1OF8A 1GKRA 1QBBA 3W72A 2RDUA 1HKIA 1OBAA 1L6SA 4AC7C 4MJZA 3C8NA 5AYBA 4H8VA 5AOUA 3P0WA 1B3WA 2UY5A 2V0TA 1BF2A 4O28A 4HA0A 4UNLA 3I65A 4B16A 1DJYA 1J79A 1QHPA 1XYFA 1X38A 3F1QA 3VFCA 3CZ8A 4BWLA 1PWMA 4FNTA 2OZ0A 4S3EA 1UOKA 3WQ8A 1ZAIA 2J8GA 1XFCA 4QG6A 3W71A 5IFTA 3W7JA 4W7VA 4D8LA 2PC4A 3IVSA 3TSDA 1FWWA 3WQVA 5BWAA 3HN3A 3GH4A 3ZT7A 1IEWA 3K4WA 2PS2A 4GUJA 3SUSA 1N55A 4AF0B 3MDWA 3DFYA 4O11A 1ISXA 2DSKA 4QGCA 3UZWA 4O15A 1NAL1 1QW9A 3TYZA 1X7IA 4EXAA 4CGTA 3SJ3A 3TV8A 3CMFA 3XIMA 2EPMX 2QAPA 4M1BA 1BWKA 3W3OA 3WBEA 3MC5A 2QVNA 3DCPA 2EAWA 2QDGA 3DBPA 3H6OA 4Q4OA 2P50A 1LP6A 2VFHA 3KCOA 3WMLA 1UD2A 4LS1A 2ZE3A 4Z1DA 2DH3A 3C2FA 2QMKA 3A4XA 4C6DA 5U7SA 4ZQNA 3AU6A 5AZ1A 2Z6IA 5DBTA 1J96A 1LQAA 1A4MA 2EPLX 2VP8A 3TONA 2ZWZA 3U9IA 3PBVA 3VFLA 1PBGA 2VEKA 1YYAA 3RF9A 4HNTA 3BV4A 1E5NA 3BSGA 1SJCA 4AB4A 2DSZA 3U6WA 4X0NA 3UCCA 3S1WA 5REQB 3EKLA 1KV8A 5JBFA 1VGAA 3KRZA 3M7SA 3QXBA 3FDKA 1ADSA 1DJZA 1ZJIA 1GUVA 5RUBA 4DZAA 2Y62A 6ALDA 4FXFA 5G2IA 4JTKA 3W7RA 5I3HA 3WD2A 1KCLA 4EPBC 1BAGA 4NJGA 3M6YA 2PTDA 4GH3A 4XAGA 2CU0A 4IGNA 2XIBA 1KTBA 5CPNA 3O6YX 4IF2A 3WK2A 1Q2SA 2CLPA 3PPGA 1ECEA 1XYAA 1DQUA 3BDKA 1QJWA 5LXXA 4YWSA 5GJMA 4RLIA 4WZHA 4ZQOA 1PDZA 2NXHA 5E0KA 2OYMA 3HG4A 1MMFA 1S1RA 2GK1B 4ZZ9A 2X40A 3VGHA 3RU6A 1HN1A 5I3FA 3CHCA 4MLRA 1XLEA 3MKCA 4QS5A 2DH2A 3URNA 2WNZA 2E6AA 4HOXA 7XIMA 2F9RA 1ZBVA 3AS0A 3HPXA 1PB0A 1S2VA 2Z2UA 3EDEA 4JCLA 3VD5A 3UCQA 4BQ2A 1O5XA 2G37A 4ADSA 1WNOA 2WSPA 1CENA 4D6FA 4RK8A 2ZUVA 3QFWA 4Y9NA 2FFIA 4X2RA 3GG0A 3FAWA 1XG4A 4IXHA 1KA9F 1PIFA 1DQWA 5A8PA 3AISA 4ZXLA 3GO2A 4PL2A 3H24A 3DFTA 3KWXA 2BNJA 1UPMB 3CIVA 1F6YA 3ARTA 4MFDA 5LIKX 5E9AA 1GPFA 5U4NA 2O4MA 4GRSA 4GFSA 4YYCA 1A5SA 5HWMA 3VD9A 1GVEA 3QY8A 4P7LA 1OM0A 2GVGA 3W81A 1CGWA 2OOFA 1FWRA 2HPMA 1R9XA 3T8LA 3VIPA 2G50A 1K03A 3R8RA 4KIEA 1U1UA 3VIMA 3M0HA 4J3SA 3E0FA 5LIUX 1UHVA 2VRJA 3RMEA 1DE6A 1PYMA 2YB1A 4LC6A 4HNUA 4LT9A 1TRIA 3C4UA 4DLFA 1R2TA 4R53A 5BMXA 3QC3A 1OCBA 4NYYA 4DN1A 4MY9A 2ON3A 1UKSA 2ADAA 4D6DA 5HWNA 4XZBA 1S1PA 2IKGA 3R25A 2PDNA 3H8AA 2QCGA 2PODA 2P1FA 5JH1A 5EYWA 5MHBA 1OQFA 3FK4A 1MZHA 2VFDA 1P1XA 3TAOA 1O95A 3G1HA 2BP1A 1GQKA 4AX6A 2YSWA 3QZAA 4GX8A 2R1KA 4K1WA 2OT1A 1LWJA 4WKHA 2AMXA 5AHFA 4AEFA 1BPLB 1XIHA 2PGEA 5HA7A 3UPMA 1BSLA 4IT1A 2OX4A 2D23A 3PUDA 4Q8UA 2J8TA 2GVLA 2YL6A 4JIEA 2GGIA 1A47A 3PSWA 1BF6A 2V2HA 1SUXA 3LNMA 1U83A 1O68A 3RM9A 2R1NA 1PX3A 1W9VA 4AH7A 9CGTA 2HNHA 4PMRA 5T9CE 1EQPA 1QVBA 1FWSA 2Q8XA 4ZOAA 4DJDA 5D04C 3SEPA 2OWXA 3B9NA 5EY5A 2EKGA 4BF5A 2OOGA 4M24A 2EPKX 3OA5A 1PVNA 2J62A 5BU6A 3R12A 4Z0JA 1XIMA 3AU2A 1Q65A 4I9AA 1E0TA 2WWCA 3QGKC 3HU7A 5DRCA 1M5WA 3OODA 4B15A 3DC8A 3LCXA 4RZ6A 5F2MA 4Q4SA 1XINA 5EA9A 4LAKA 3QV7A 4EF8A 4NT0A 4NY2A 2C14A 1A49A 3NM3A 1UD3A 5BYWA 1XWYA 3EMCA 1V8EA 2NQJA 1RJQA 3UZZA 1RALA 4UTUA 4GKLA 3LGGA 4M5PA 4ZODA 4LPCA 4P5UA 3BK0A 3T6CA 4QCEA 3W0KA 1QO2A 3QKEA 2C1IA 4B5SA 1T99A 4QE5A 1CB7B 1OC6A 3SN4A 2VQTA 1E5JA 5CC5A 1AW5A 3FJNA 1W5NA 4C6OA 4L80A 3P80A 3AMKA 3QOKA 5H2ZA 3VOFA 2YOCA 2BWGA 5A6KA 3EWWA 1ZLPA 2PU1A 2YYUA 2CLKA 1UZHA 1F9CA 3ZVIA 3S9ZA 2XUCA 4DWSA 3NDOA 4F79A 2F8QA 4YXGA 4HNCA 4TO8A 3R0KA 1ZBWA 2PWGA 1ONXA 3MT1A 1BG4A 1OADA 3UETA 2YBTA 3AHYA 3KHJA 3LV6A 2Z1KA 2QGHA 5CC7A 3CAWA 4TVUA 2PDGA 3R8GA 3TLLA 4EPKA 1E0UA 4PMYA 1KBBA 4I90A 2FKPA 2EF9A 4B3ZA 3A47A 1TIWA 3MBDA 3VZZA 4X61A 1ZAJA 2Q6ZA 3HO8A 4PUMA 5A95A 1E9ZB 1DWAM 4AFYA 4K36A 3EYPA 3POHA 1E6RA 1WZKA 1Q45A 4BEQA 2BODX 1FXPA 3AYVA 2E25A 2QPXA 1ZZMA 4LAMA 1IXNA 4PR4A 3RHGA 2DV0A 1KRCC 5FJRA 4QS6A 3LPOA 4YMZA 4CVUA 2A5HA 1QFEA 5M17A 1UW9A 2BASA 3UGRA 4Y9PA 1OFRA 4ML9A 2PWFA 5MF5A 4FNQA 5C70A 4O0QA 1IIGA 5FJOA 2YXGA 2GWNA 4A8IA 3BLIA 1TSIA 3WJWA 3VIIA 2DZSA 3GHRA 3NZ1A 3SCRA 1XSKA 3GD6A 4WSHA 3SBFA 3VIJA 4UZUA 2AGKA 1F6KA 4HYWA 1YKWA 2PBGA 1BGAA 2E5DA 3RR1A 1W1TA 5K2ZA 1MUWA 4XBSA 4HOZA 2QJNA 1H09A 2Q3OA 3U3HA 1SFLA 3FIGA 2BXZA 3GBDA 5AC5A 3PUOA 4HNVA 1TPEA 3PB2A 2E68A 3NQ6A 4HN8A 5LA0A 4GC3A 4WDXA 5FOOA 4XVEA 5G2HA 4EK7A 3UR8A 5AYZA 4YLWA 1GVSA 3UR7A 4FF7A 1ITUA 1F73A 1EGVA 1XGEA 2VQUA 3LDVA 4RX0A 3M44A 4XAPA 3M0JA 5GNYA 4AZHA 4UTFA 5BOEA 1IR1A 1JFXA 1PKMA 3A64A 4P2VA 4UOQA 4HTBA 2CEQA 4AMCA 5E09A 1UJPA 4ATDA 4X63A 1V08A 3RCYA 4DI9A 1IGWA 1F3WA 3GU9A 1PZ2A 4LH8A 3M0LA 4XZHA 1MDLA 4JQ4A 2HE8A 4Z0SA 3ABOA 1SJDA 1G67A 2WYSA 4YIWA 4MJ4A 5B7YA 4EVZA 1Z6KA 4LYKA 3CB3A 3RO8A 1RQEA 4I7VA 3S6OA 2VGBA 1Q3NA 3DIPA 5KMYA 1E72M 1B54A 3C61A 1KFEA 4E0CA 4AD2A 1E73M 3GUWA 4PMDA 3MMTA 1PX8A 3NPVA 5HNUA 3CXOA 2BVTA 3W07A 3RCMA 5DO8A 1C8YA 3WDJA 3HPFA 3TC7A 1XG3A 4O1DA 4F9DA 1T0OA 4J27A 1TX2A 1NFBA 1B90A 1I9CB 4PUNA 4A4AA 4H6KA 3ARWA 3DECA 3I6RA 4GCXA 3C0QA 4FIQA 3SQMA 1QR7A 4G8TA 2QCFA 3TWBA 2B4GA 4ORMA 4D6EA 3WH7A 2WXDM 1VD6A 1VCVA 4DJEA 4LUYA 2PZNA 1SJBA 4M19A 4ADUA 2V3GA 3MPGA 1G7UA 3N6JA 5K3VA 2PUZA 3PVFA 3LSCA 5KINA 1IIHA 2AMGA 3WQWA 3TW9A 4JEJA 4NYUA 3S1GA 1SQ7A 1XS2A 1QUMA 3N15A 3VMOA 2ZZ1A 3D5HA 4YL2A 1E6PA 4Q4KA 4DJDC 3OG3A 2W62A 2X1TA 2BB0A 2X1IA 1IZJA 1GZGA 1UZ4A 3VOIA 1ISVA 3GDRA 4E2BA 3RNDA 4JN6A 1GORA 2FMOA 3OB8A 2B7NA 4FB7A 2GUYA 2BV9A 2PF0A 3W29A 2AOSA 4IP7A 4HPHA 3ZJ8A 1ZS2A 3VO0A 1EXBA 4K39A 1B9BA 1JDEA 4ZFMA 3TROA 2XN1A 4NVTA 4I9MA 3PNZA 8CGTA 3LPGA 1YLVA 4D72A 3MCNA 2NUWA 4REQB 3J7HA 1V3IA 2OZ3A 1XBXA 4GOAA 3ZT6A 7ODCA 1OGGA 5BXPA 1DE5A 1DV7A 2FLIA 3LXCA 4HN4A 2GGJA 2F2HA 3RU8X 3S8HA 1QBAA 1UR3M 3VC5A 4HBKA 3W26A 4FX7A 2WSYA 4F66A 4IXXA 1J4EA 4EF9A 1XCFA 1V6XA 4CQAA 1RJPA 3M9YA 4A8NA 4B2DA 4EX4A 1LOSA 1AL8A 2JKAA 3KZSA 4DWSC 4QP0A 5LNSA 3LLXA 2ZBTA 1OFEA 4D6GA 4H6EA 3ITTA 5C7HA 1VPYA 1LBLA 4GNJA 5EBAA 1JDCA 3BCJA 2QIWA 4MKNA 2XGBA 4W5ZA 3G6LA 3N17A 1W3KA 2WLZA 3G1DA 4KGLA 2OO0A 2ZCGA 1CXHA 5D05A 3A23A 3LMZA 4N9CA 4IMEA 4DJDD 1DEDA 3GDBA 5K9CA 3DI1A 3INPA 3IJ7A 3IANA 2E1DA 3NL3A 1CWYA 3UFYA 3C2YA 1JUBA 2FZBA 3H2FA 4NASA 3W76A 2NXGA 4GUFA 1A50A 5CG0A 4N9EA 5F7UA 3NXLA 4AYSA 2VFEA 3RXZA 4HB7A 1O12A 4A2RA 1NQ6A 3L4ZA 3B04A 2ISDA 3MTWA 2BMBA 2WC4A 1EC9A 4TIMA 1EZ2A 2CW6A 3CGTA 1JYNA 4PCFA 1P7TA 1HXJA 4MDOA 1BWLA 4PRWA 2X30A 4LNCA 2GGEA 1TE6A 2P5NA 2CLEA 4RNHA 5A6JA 5HJYA 4BEUA 4KWWA 3GS6A 4IIGA 5EMLA 1H41A 4CD4A 3TNOA 3CV7A 3WX7A 1K6WA 1J0KA 3QKZA 4GD0A 1ME9A 4FK9A 4C6JA 3TVAA 2QMJA 2H9AB 3W88A 3C3UA 4MG4A 4RV8A 1RD5A 4OECA 1XUUA 1S2TA 4NAFB 3BLOA 1DIOA 3PTQA 1THFD 4DWSD 4POCA 4INFA 4KPLA 4MKVA 2D0GA 3GNNA 1I2RA 2WC7A 2J74A 3A13A 1EA9C 2QCDA 3HGRA 4R9XA 3W6MA 1F05A 3UG3A 2WM0A 3WH6A 1I1WA 1FDJA 1H7XA 1MXSA 4GY1A 1GHRA 3AUOA 4NZFA 2VEIA 4ZOCA 3CMGA 5CJ5A 4J2PA 4N2YA 1I8JA 4F0SA 2JGYA 2ATMA 3QTGA 3LBOA 2C1HA 4LEQA 3V1PA 3UG4A 1ZGDA 1WDDA 4QNWA 1XFBA 5F4SA 2C18A 4FMVA 4ECLA 3DUGA 4J3ZA