5BU9A

Crystal structure of beta-n-acetylhexosaminidase from beutenbergia cavernae dsm 12333
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
338
structure length
338
Chain Sequence
ADLSLEQRVGQLFMVGTDAATAEQVTLDAITASHVGNVFLAGRSNAGVDATAAVVEQLTAAVTDEATGGVPLLVATDQEGGNVQVLRGPGFSDIPTALDQGALDPATLQADATTWGAELAASGINLNLAPVMDVVASPEAAAANPPIGYFHREFGYDAETVASHANAFSAGMRASGVETVIKHFPGLGRVTENTDTTAGVVDDVTTADDASVQAFAAGIDAGAAFVMTSTAVYSQIDPDAPAAFSREIVSDLLRGQLGFDGVVVTDDVSAAEQVQAWSPADRAILAIEAGTDIVLVSADPSIAAEMVAAVVAKAQADPDFAAIVDDAARRVLAAKGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-N-acetylhexosaminidase
publication title Crystal structure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333
rcsb
source organism Beutenbergia cavernae (strain atcc baa-8 / dsm 12333 / nbrc 16432)
total genus 124
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5bu9A00
3WLPA 4HZMA 4ZODA 5BU9A 3AC0A 3USZA 5FJJA 5BZAA 2X41A 3WLNA 1TR9A 4ZO9A 3NVDA 4ZOCA 1IEXA 4IIGA 4IIFA 4YYFA 4ZO7A 1J8VA 4GVIA 1IEVA 3WLLA 4IIDA 4IIHA 3WLRA 4GVGA 4GNVA 3SQMA 4MSSA 4ZOAA 3WLKX 3WLSA 4IIEA 3TEVA 3WLTA 3ABZA 4I8DA 3UT0A 3SQLA 1X39A 1LQ2A 3BMXA 2X42A 3GS6A 3ZYZA 5IOBA 3WLMA 3WO8A 5TF0A 2X40A 3WLJA 4ZO8A 3WLOA 5C0QA 1X38A 4ZOEA 3RRXA 3WLQA 4GVFA 2OXNA 4IIBA 4ZOBA 3LK6A 4GYJA 3U48A 5FJIA 3U4AA 5JU6A 1IEQA 3ZZ1A 1IEWA 1Y65A 4GYKA 3WLIA 3GSMA 1EX1A 4I3GA 5G1MA 4IICA 4ZO6A 4G6CA 4GVHA 3WLHA
chains in the Genus database with same CATH superfamily
1Q2RA 2XINA 2EKCA 3NIYA 4OUEA 4L1GA 4UTTC 4OOUA 2VRJA 3QGVA 3T05A 4WGXA 3RPDA 4LJ3A 4H19A 4DF2A 1R3YA 1UR2A 3T9PA 4M1RA 4ASTA 3TYUA 2J62A 3OQEA 3UD6A 2QCGA 5I2UA 1BYCA 1UIPA 4IMGA 1G4SA 3K1DA 1FWEC 3G22A 5I09A 5REQB 1PDYA 3B9DA 3DESA 4ADUA 3ANVA 1VF8A 1QPRA 3RCYA 4ICCX 3G77A 3WH9A 3RR4A 4F0LA 4OBTA 4HSOA 1X1NA 2OFJA 3MW7A 3SJ3A 1F5ZA 3T8QA 2WBKA 1DVJA 4HMNA 4JKMA 1UWQA 4JTUA 3VZXA 3QQ1A 2ACRA 4GX9A 3BTNA 3PJXA 5DO8A 1HIZA 1PB0A 5LA2A 4XISA 2WQDA 5G1TA 3BH4A 3WNMA 3M0KA 3REQB 2JBMA 5CZSA 1VHNA 3LPGA 4FNQA 1V51A 4LCQA 3WQPA 2ZA2A 1H11A 3GHUA 3B8UA 4H7VA 4GVHA 4LT9A 3WLHA 4IFOA 5AC8A 2PDXA 2OGYA 3C0JA 3NPXA 2VDGA 4HZMA 5HQMA 2YBUA 4PL2A 3AIRA 3C0SA 3B8IA 1JR1A 2CPUA 4QISA 5MHBA 3V0TA 1D3HA 2VVSA 3BARA 5CCZA 3TP4A 4AZCB 1N8WA 5GNXA 3CZLA 3DOPA 4GIRA 3KFTA 4LOCA 8XIAA 4MFDA 4A3YA 5D2VA 2XVGA 3GKFA 2Y5EA 3W70A 5H1WA 5JH2A 5AYBA 4K39A 3HF3A 3B05A 4UXDA 3LXAA 2CLIA 2BFGA 3OW1A 5AYIA 3UT0A 4G8TA 4HU4A 4UTLA 4LV4A 3CMGA 4FNSA 4OV4A 2OB3A 3FVDA 2HRWA 4CQCA 4LTSA 7REQB 4LANA 4TIMA 4XD4A 2X1SA 5GNZA 4Q8VA 3P0WA 4F0KA 3FV9A 2G5WA 3GFYA 3UY8A 6TIMA 2BXVA 3SN4A 1Q7ZA 1KBBA 2EGZA 2B7NA 5A2BA 4LUTB 4JDYA 4CU7A 3S9ZA 4HOWA 4IX2A 4DF0A 3AWNA 4DO4A 1KGXA 4O14A 1AZ2A 2O7SA 3R8RA 1Q6RA 3OVPA 3HG4A 5AHFA 5AYZA 2PB1A 3HMCA 3W72A 5E0KA 4QP0A 3NGFA 1FKWA 2PDWA 2QKFA 4RPQA 2YW4A 2QCLA 4ICMA 1PIGA 4RZ5A 5DMMA 2RAGA 3M0IA 1U33A 2NSOA 3TUUA 2BOEX 4A8LA 4IPIA 4GK8A 4A22A 3A64A 4UTTA 1J0YA 2Q71A 3PUOA 4GY0A 3WQVA 3U9IA 4GI8A 2IQ0A 4CCCA 3K4AA 8A3HA 3ARQA 1E6NA 1S1PA 1JNDA 3OVQA 1DIDA 1H5VA 1XLDA 2QCDB 3VNKA 5HOSA 5BXTA 1EDTA 4LUSB 2ESCA 1SW3A 1H7OA 2AL1A 4WOZA 4GUJA 3USBA 3GDTA 5A6BD 4E0CA 4JTSA 4DO5A 1E70M 1J2WA 5CSYA 2MANA 1AODA 1OD0A 2NUWA 4GIEA 5KINA 3BCFA 1KXTA 1TX0A 3UXLA 1FWTA 1GQNA 3ITLA 1VBUA 1F73A 3NCOA 3TJXA 1HKMA 3B8WA 3LLXA 4LAZA 3DU0A 4MWAC 4MZ1A 3LCGA 2BY2A 2NVAA 3PTDA 1XC6A 1OFEA 3LM3A 3VOIA 2ZA3A 4IMCA 1MQRA 2PDIA 4NUWA 1R8LA 3V1PA 4QLKA 1R2RA 4C6QA 1UMLA 5CLWA 1U5HA 1KRBC 4O1FA 1K02A 1U30A 2XU2A 3MANA 3NO1A 3CNYA 2DIJA 1XR2A 2VEPA 2P3ZA 4ZO9A 4DJDD 1MFUA 1Q7MA 4LF2A 3WKZA 1FDJA 2VI0A 2QMKA 4C6FA 4XWUA 4ZENA 4WEVX 2ZIDA 3DG3A 2H6RA 1EEPA 4LS2A 2POTA 2BODX 3I10A 2Z4GA 4YWIA 2C13A 2OR2A 3ARPA 2PGRA 2HE8A 4NX5A 3CB3A 1EJTC 4XTIA 2DSUA 2C91A 1ITCA 1KRCC 3NO5A 3FKRA 3VDCA 4FI4A 1B9ZA 1E4MM 1FH8A 1ICPA 1ZHAA 1TRDA 3UZXA 1ZCCA 3WEMA 5FA5A 3COTA 4NZ5A 4IISA 1A5OC 2AAAA 1HN1A 3KWSA 3PZUA 3W53A 2KAUC 5K9DA 3ZVIA 1MVYA 2A7RA 3IPWA 4M56A 2CZVA 2SFPA 2QR6A 3FA4A 4KCTA 3SCTA 1JG9A 3W1PA 3G1RA 2O9PA 3KEHA 4FLOA 4WQ6A 3WIJA 3VUSA 2V9DA 1B3YA 4UTWC 3ELFA 3W1LA 1EIBA 1HO4A 1TB3A 3EOOA 1E73M 1S39A 1XH2A 1TZZA 1VIWA 3KP1A 4NU7A 1GOQA 1E1CB 1M7JA 4QLJA 1MZRA 2CFFA 1EA0A 2E1WA 3W23A 4L6OA 4Q4KA 3W87A 3H23A 3FYPA 2WVSA 1ZALA 4CD5A 3MMDA 4J7RA 3W0KA 3WF2A 1W8GA 1O5KA 3ITCA 2NV9A 2OZ0A 2PTDA 3LSCA 5GPRA 2E3ZA 1WDDA 2CLPA 1ZJHA 3SQMA 2B7PA 3MUY1 4MPKA 4HNLA 1UH3A 3ZQ9A 3WK1A 4HZ8A 2D24A 2VZSA 4I8YA 3CAWA 5CC5A 3FYOA 1DE5A 2PGWA 1W1A1 4G7FA 3WO8A 3ANUA 3VO0A 2ZWYA 1Q5MA 3F5LA 2QGYA 2H90A 3WQ8A 4QCFA 4XSMA 3UG5A 1SGJA 4J40A 3VIPA 3IGXA 3CIWA 3FAWA 3Q45A 1I1XA 3N2MA 2ZTJA 3UYCA 2NQ9A 4LYPA 4A3QA 2HCVA 1IWPA 3VE9A 1JYWA 2QCNA 3A13A 5BRQA 1VBRA 3W7CA 3BLDA 2YDSA 3L4UA 8CGTA 5E9XA 4MWAA 4QRNA 2OEKA 3ZFHA 1B3VA 4YU1A 1Z89A 4PCSA 3S47A 5C7VA 1YQ2A 2PZNA 1BWVA 3U5YA 1M5WA 3PWGA 4U3CA 1XUZA 4PTWA 3QTGA 2V5JA 5JQ9A 4DWSC 1MO0A 3NSMA 1Q2SA 4GI6A 1DE6A 1JQXA 1RA0A 2GK1B 4YWSA 2WKGA 5BU6A 1PEZA 5AECA 3I7RA 1TR1A 2WPGA 4MUZA 3WF3A 5CPLA 2EO7A 4GBUA 1Q6EA 3K13A 3GVQA 2NUYA 1KBIA 5D33A 3H2FA 1MUMA 1PZ1A 5M3WA 2VT0A 3W2KA 3N3MA 1V6XA 3VAVA 3ABZA 1XYAA 4JL2A 5A8NA 1UWRA 4GABA 2JFEX 1BSIA 4JYDA 3N2TA 4RXGA 2FVKA 4M6VA 2HV5A 3AUJA 3TZNA 3KOFA 1KLYA 3CUGA 1XSJA 3G6MA 3M44A 1R3QA 4FALA 1J11A 1S5MA 4NRSA 1XQLA 9RUBA 3RLHA 4XBJA 4RE3A 2OCZA 3M5YA 4HK5A 2XZ7A 1IT7A 5HNNA 1P6BA 3GG7A 4UTFA 3K4WA 1KGUA 2Y0FA 4NJHA 3RAOA 3W2LA 1ICSA 3G1XA 2VZOA 1REQA 1L9WA 1A50A 3NM3A 3W27A 3HG2A 4AYGA 3L66A 4Z1CA 3W7MA 3FXYA 4X9SA 2JGQA 5CZKA 2CHNA 5DLCA 1O1ZA 2ZUMA 2ZUNA 1GYMA 2WHMA 1GTHA 1PAMA 4W8LA 5FCZA 4CLMA 3KHJA 1R3VA 1E9ZB 4RZBA 1EJWC 3L4XA 1MEHA 1FVPA 3EOLA 2AQWA 3NO3A 4JTIA 3MZ2A 2I5QA 2OWCA 4N02A 3W1RA 1GKQA 3LN3A 4O10A 2FZ9A 1W3HA 1X39A 4G1KA 3DERA 1GVRA 4ERIA 4ADTA 3A9BA 4C1LA 5E5CA 4JTEA 1YIXA 4E38A 3ZJ7A 1HJWA 1IZCA 3QKZA 4GVFA 4CU6A 1KFJA 2WMGA 2HDJA 4KFNA 2DP3A 2HPIA 4HCLA 4GO8A 2A0NA 5CPOA 4YVVA 2WQPA 3NSNA 5A2AA 3UZ5A 4QAIA 1BAGA 4C1KA 1RVKA 4P5UA 3B0UX 2J79A 5JIPA 3QFEA 3RU8X 3DYOA 1NTHA 4UOZA 1IXOA 2HXUA 1J6OA 3TJIA 2ONEA 3LCIA 3QZEA 5DRIA 1OY0A 4JX4A 2XUCA 1R85A 4U10A 4JHOA 4Q8UA 3CZ8A 1S5WA 2WJDA 1EF2A 3VCNA 3W6MA 1NIUA 2C1GA 2CKRA 1I75A 2HSAA 3UNTA 1DJHA 3T7VA 3LI0A 4JDBA 2WPBA 3C2EA 1OFBA 1SQ7A 1T40A 4X2RA 2HPMA 1OG0A 3UVIA 3MMWA 1B9BA 3AJ7A 4PSRA 2VX5A 1NELA 1EP2A 2WNQA 6XIAA 1WKYA 3BG5A 5KEZA 1BVZA 4ERAA 4MB1A 3BW4A 4OBSA 4PTXA 4YPJA 1XC4A 3TN3A 4WOQA 2JF7A 2D73A 1F2JA 3PR2A 4Z2HA 3AFBA 3H2EA 2YCLB 1G7VA 1ELSA 3GC2A 3R43A 4OGZA 1R9ZA 1XBYA 4YHGA 3BMVA 1NQKA 3BL3A 1V77A 3H12A 2G97A 3RF9A 2OXNA 4G56A 1HJVA 3VFLA 1WAWA 3T44A 3KHDA 3EKZA 3PY2A 2W4XA 1WKDA 4DZHA 4BZYA 1C9DA 4DBEA 3P61A 3DFSA 2CW6A 2Y8VA 4PSPA 3DAQA 3VTRA 5FEPA 1T0OA 1AUSL 1F4HA 5BROA 1TCMA 3UGRA 3OA5A 1PV8A 4J3ZA 2V5LA 3SZ8A 2JKAA 3FLUA 4AZCA 3N29A 1FWHC 5H8UA 3L5AA 3T4WA 4H8NA 3W7DA 3S2JA 3OTRA 3EXRA 2Y7FA 2FGLA 2JKPA 5AVNA 3IGUA 2P0IA 2X41A 4NZ3A 2D22A 2FPTA 3HPSA 1KCXA 1C8XA 4O11A 1GONA 1GYNA 4IIGA 4ILSA 2IKGA 4D6JA 1IGWA 3OYXA 5HA7A 7REQA 5FEZA 3L4VA 3TLLA 1F3TA 1MW2A 4LX4A 5LIKX 2Z6JA 3W29A 5HPOA 1Q45A 1NF7A 4AEOA 3RM9A 4XZWA 2GJXA 4GMEA 4M51A 1EO7A 2PDYA 1TCDA 3DG6A 4LUTA 2PEVA 1S46A 1C93A 1V02E 2ZVRA 3HPFA 4AB4A 1OX4A 1KXQA 3MBFA 3GFZA 3CZGA 1KTNA 3AOFA 1F3WA 1TWDA 5HINA 1DYSA 2J13A 1ONXA 1F74A 5CG0A 3EXTA 1V6WA 1HKVA 1WXYA 5FOOA 2BHZA 1P6CA 1JULA 5FACA 2BZNA 4NVTA 4CNPA 4OBRA 1MQQA 3MWAA 1AH0A 1IT0A 3MUAA 3PWIA 5FF2A 1F7BA 3R0DA 1HL2A 5I5RA 4FZIA 1RXOB 1B4KA 5I07A 1WZLA 4LV9A 3EMCA 3GNOA 5FEWA 4F48A 1OJXA 4MKSA 5J5RA 4GQBA 3OZYA 3QR3A 3NA8A 5CJ5A 4D6DA 1EBHA 1A4LA 5DY3A 4YMZA 5CGTA 3QGAC 1A0CA 4CVWA 3LG3A 1N8FA 4DJEA 2HNEA 3OYZA 3S1GA 2GSHA 1E56A 3U3HA 3PZVA 4QBXA 2D2JA 4PUEA 5IFTA 4ONVA 3AZRA 1F07A 5A8GA 1WV2A 1NEYA 1XLKA 3K8LA 1W9DM 3H7UA 1U83A 4HZ6A 2VC7A 1DJNA 1ISZA 1UD2A 4IJBA 1V3MA 3SFWA 3QRHA 1PZ0A 3SCQA 4MZ8A 5ABGA 1LBFA 2ZUUA 3L0KA 2RGMA 4Q4RA 1LP6A 5EFDA 4L6DA 3TH6A 3H7RA 2A6NA 1VGAA 2QAPA 4ES4A 4W86A 1YDOA 3AMGA 1EH9A 1OX6A 1TRIA 4UMBA 4IQDA 4UTKA 2H9AB 3ENLA 3UCCA 2UY3A 1UOZA 3MYPA 4XZHA 1J5TA 2MNRA 2FZ8A 4GZ7A 2VJXA 4PRRA 1QI0A 2F84A 3KVJA 4N2YA 2J88A 4MKNA 4X63A 2VX7A 2YCKX 2PTYA 1OGSA 1ZB5A 3R6IA 3AHXA 3SIZA 5C9WA 1VRDA 1XH0A 1R7OA 2FZBA 3WLPA 3RMJA 3K1GA 3LHUA 3AO0A 1ZFJA 1XIDA 4CN6A 3BAJA 4UB9A 2KX9A 3DFYA 1OSEA 3M0ZA 1BXBA 3SB0A 3KCOA 3WFAA 1KFLA 2X7VA 3R0KA 4DI9A 1DJYA 5A1AA 3PC0A 1WUFA 3UETA 4EXBA 1ZLPA 1JFXA 3VIIA 1VYPX 3AHTA 2QZRA 4MJ4A 3IJDA 3DH7A 1AA1B 4IIHA 1G1YA 3N2CA 1X7IA 1XG3A 2ZRXA 5HMDA 3FJNA 1E0VA 2IKHA 2NUXA 3CS2A 3IJLA 4W93A 3NZPA 1W1VA 1W1IE 5DF0A 3VE7A 4Y9AA 3PWAA 1JDAA 2PWDA 3KM8A 3F4VA 1BSLA 4LSBA 1TELA 1Q6OA 5AC4A 1JF6A 4L64A 1TREA 1XUUA 3NDZA 4WJXA 1Z7AA 1IWBA 2J8FA 5D09A 5H8MA 2ZX5A 1BYDA 1KRAC 3GDRA 4NZCA 3BQ6A 3NQAA 1GKRA 3NZRA 4HP5A 1Q3NA 3KL3A 3DHUA 3NYZA 3CASA 1XRFA 1E1CA 1Y0EA 3N6HA 3G8EA 5BYWA 4UFHA 2V68A 3O3RA 1GORA 3OLGA 3GDKA 5A6MA 1TV8A 3RIKA 1TPC1 2WMHA 1X97A 1FX6A 2Y5SA 3DC0A 3F1QA 4DBWA 3V35A 4MLRA 4AZGA 5BXRA 2Z25A 1PS9A 2HS8A 4YHEA 1T8QA 3CQJA 4WCJA 2X1TA 4FLQA 4NNCA 1TWSA 4C1NB 1OHLA 3CQKA 2H8ZA 3NVDA 4J35A 5DCEA 1GVOA 2I5IA 4XVEA 3TC6A 3WY1A 1PTGA 3N4AA 1ONEA 4JKKA 4W8BA 3E0LA 5D30A 3PBUA 5F2MA 3VC6A 2QLYA 3TAOA 2W61A 1E6SM 2YGYA 2ZRWA 1JUBA 1KC7A 2G96A 2R14A 4TXEA 3XINA 1SU5A 1GW9A 1W5OA 3SDOA 3EPMA 2ZOXA 1SVDA 4I90A 2YXGA 1CI1A 1GJUA 2FQIA 2DVTA 1VB9A 3IJ8A 3OVRA 4Z2KA 4L5ZA 1OC6A 4LC6A 4MFEA 1YTDA 1WUEA 1HG3A 4A05A 1YPIA 2X40A 4R27A 4ICNA 1BWKA 1F8MA 2D69A 2GVEA 1LCOA 3B06A 5EY5A 3M0HA 2ZC8A 1Q6CA 3STFA 3OZMA 4XZMX 3QLLA 3L0NA 2OG9A 1T7LA 3T0TA 2EKGA 1R0MA 1X96A 4RKAA 3RITA 4AVFA 2KZHA 2E6FA 1B3OA 4JIIX 3VINA 4ZE4A 3GB6A 1HJQA 3W37A 1V3IA 3SGZA 4QM1A 3T81A 3IV3A 1Y8BA 1P0DA 2OOFA 3ZJ6A 4EP8C 1Z44A 4K1WA 6A3HA 3VZYA 4HHPA 1TJPA 3QXBA 3ZWTA 4AWUA 1CGUA 2PC8A 1KM4A 1AJ2A 3T08A 1VQTA 1AW2A 3E96A 5AYYA 2WV8A 3PSVA 2W91A 2YR1A 3ITVA 3G2GA 5AHNA 1UA7A 5F2LA 3RCNA 3QYSA 2FZNA 1WXZA 1RUSA 2NXHA 2YXXA 1FWIC 2ZZ6A 1QTWA 3I3BA 3EWCA 2UY2A 3MSRA 2YCEA 1DJGA 1M9HA 2Z6IA 3GTHA 3UXDA 4GX8A 4PRTA 1O5XA 4X2PA 3VGHA 3QJAA 4PC8A 5H2ZA 3W7LA 5C9RA 3R7MA 1PKNA 3IJ6A 1PZ3A 4JNZA 3C52A 1R86A 4LY4A 2FJUB 5HBFA 3BSMA 1QOXA 4PCFA 4XIAA 3Q94A 4GKLA 4NJKA 2EQDA 3O2LA 3APYA 3B9AA 1HUVA 4A8IA 4D8AA 3L0GA 3KLLA 4XTDA 4NZ4A 2YCJA 1UWIA 3N6QA 4GQ0A 4R7WA 3T07A 3MB9A 1XRSA 4NQ1A 4O15A 4ZQRA 1POKA 9XIMA 4IQJA 1TG7A 2EG8A 2R91A 4J9JA 1H50A 3M0JA 4C6KA 4LBSA 5K3VA 3ARUA 4JN6A 5G1MA 2DH3A 1LJYA 3LENA 2F6KA 5DMNA 2YLAA 3QZAA 2Z1BA 4R3UA 3B0YA 4LUJA 5IM51 2PWVA 3JRKA 4N42A 3VGFA 3TC7A 4NX0A 3G1VA 3TXZA 3W1NA 1LQAA 2JE8A 5LIXX 5DBTA 1PVNA 4HTBA 1YEYA 1UPMB 2NX3A 3DYPA 1VAHA 1O95A 1J8VA 5G4EA 1E43A 4IPNB 5ABTA 3IGHX 1TVPA 4XUGA 2WHKA 1FA2A 3WD3A 5IDIA 3B0XA 1QFEA 4BCEA 3BLIA 2I16A 2NWRA 3IVTA 4GFIA 3OO2A 1VEOA 3TOYA 1RJRA 2V5KA 1PIIA 1WP6A 2PF8A 4RR4A 3LXBA 3GXDA 5JXQA 5AC5A 3VNZA 2VDIA 4DYKA 4ORIA 5C9UA 3S83A 1UR9A 1LL6A 2DFAA 3TSBA 1GNXA 2B4GA 4J27A 4DI8A 5MF5A 3A21A 1VR6A 5GNYA 1VLIA 4GCXA 4GYJA 5TD4A 1UR0A 3W7QA 3E2QA 1KFBA 3T8LA 3B04A 3RR1A 5BOEA 3IIVA 3PS7A 3GSMA 4PMJA 5HMFA 1Q7QA 4XX6A 2HWGA 3ZT7A 1V3JA 4QG8A 3PPGA 3L4WA 3OGVA 4U5IA 1XLFA 1V3HA 3AS3A 4CGTA 3KOYA 4L1WA 1SPQA 4UUIA 2W62A 3KL0A 3QHMA 2QCFA 4ACYA 1RHCA 3W7GA 4N7QA 1XLCA 5CPQA 3UXIA 2E9BA 3GIQA 4HN4A 3L2IA 3NQ2A 1M1BA 2Y1HA 2YCLA 3VIOA 2W79A 1VLWA 1P0BA 2C19A 4X3ZA 2CZEA 5AYXA 2IPJA 4DNMA 4MKVA 5FKYA 1KFEA 2CLMA 1QUMA 1OK6A 3FKKA 4CNNA 1WPCA 1BKSA 3GC5A 3QFWA 4C90A 1OK4A 3BCJA 3THDA 4ZEPA 1UD8A 4I8DA 4R34A 1RD6A 4HNUA 3TROA 3UJSA 2CBJA 4QLLA 5LA0A 1JCXA 3GXIA 1Q66A 5AY7A 2OJPA 3PTKA 1AW1A 1ONWA 1GTEA 3RO6A 1UD3A 3LZ5A 2EJAA 5I02A 4A8RA 3EWWA 2J6VA 2FB2A 1H0IA 4HQVA 4BF9A 4GGHA 5TBOA 1EUNA 1KR1A 2DZXA 3VYLA 4ACZB 1GZGA 1J0IA 3T4CA 3MO4A 2BY3A 3OODA 2FFCA 3BQ5A 2GFTA 7ENLA 1TTJA 1ZJBA 3FA5A 2D2GA 2PP1A 5HNUA 5KZEA 3TYAA 4ZSUA 2F9RA 4OECA 3A9IA 4F66A 3NXLA 1EIXA 3PHAA 2Z1WA 3H4XA 5M5DA 2NQ5A 3OJGA 5DT5A 1FHUA 4F8XA 1AH4A 4DX3A 2Y8KA 1UIOA 3P2VA 1L2UA 3M7SA 4Y9NA 4RV8A 2IKJA 4OZOA 3ALFA 2TRSA 3RX4A 3W85A 3TA6A 3H6OA 2HK0A 4H8VA 5I7GA 1HT6A 1Y5XA 2CYGA 2V2HA 3BAKA 4FNRA 2ZTKA 3I6EA 1KCZA 4O1DA 2JEPA 3TMQA 3KBVA 1H62A 4W89A 1D7FA 4V1YA 1THFD 1GVQA 4R5EA 1KCLA 2EG6A 4B4HA 3BVJA 3D3FA 5JBDA 1XLLA 4JIEA 1JXJA 2PD9A 3F4WA 5CH9A 3TSDA 4XAFA 1FCVA 4BWLA 3NR0A 1H61A 1W37A 3IARA 1LBMA 2V63A 5CC6A 2JALA 3K4DA 2PCEA 1US2A 1OWQA 3FIGA 4ZB2A 4JN7A 3N04A 1OZQA 3STEA 4Q4SA 3RJXA 2BSLA 4KT2A 3W1MA 3QOMA 4Q3MA 2WJZA 3MBDA 2DPEA 7CGTA 1P5BA 2GDVA 2EPMX 7XIMA 2VMFA 4K8HA 2YDAA 1HKJA 3LV6A 1D8WA 3EOUA 1NM9A 2Y5JA 3BAIA 3TR2A 5EPDA 2CERA 1OFDA 2BBFA 4B5XA 1Q85A 1EPVA 1UZ4A 3HTWA 4LALA 2QMJA 3TYEA 3OHMB 1QI4A 3SUTA 2DT1A 3GH5A 3WLRA 4WDUA 4JQAA 1HNYA 4TR9A 1OT1A 3KX6A 4JY8A 3PBYA 1SFTA 4PR4A 4QE5A 3KZSA 2H9AA 3VC5A 2FTWA 5ABFB 1CLVA 3E0IA 3TQPA 2C7FA 4OJYA 3HJEA 3AMDA 1XSKA 1XIBA 1K9DA 4O12A 1JAEA 3LD5A 4HB7A 4I9TA 4Z1DA 4I9AA 3O9NA 3SFKA 1LWHA 1XBXA 2V5BA 1QR7A 2YDQA 4RLIA 4B5TA 4MNMA 1IXQA 4BY3A 2R1KA 3ZXWA 4LVDA 3WEOA 1QAPA 2UBPC 3RO8A 2FGBA 3CTTA 4LF1A 2R6OA 2HK1A 1GQIA 4ZXLA 2W0UA 1YDNA 4U31A 4D72A 2ZXBA 4JX5A 3KVKA 4H6QA 4DIAA 3FA3A 1T6MA 2VUYA 3H2MA 1WQ5A 4OUIA 3BG3A 3AHZA 2BHUA 2PF0A 4EACA 1YRRA 4XKMA 1RD5A 1ZCOA 1O6IA 1PCWA 4MB3A 3ABQA 3HZ3A 4HSNA 3VMOA 2TMDA 3EB4A 3H4WA 4DM2A 1VD6A 4IWWA 1CEOA 2ZQ0A 2DSWA 5FIPA 1K6AA 1H09A 3VI2A 1AH3A 1SR0A 1JCTA 3AXXA 2ISVA 1SR9A 4XKYB 4FXRA 1Q6DA 4WJEA 4HCDA 2GZXA 1Y5WA 1QOQA 5DANA 2V0TA 4Z1YA 4DPQA 2C16A 1U5VA 1W9PA 4QIUA 3U2EA 1XLGA 3OA3A 4WJ8A 3QBUA 1ME7A 4DF1A 2BV9A 3CZEA 3IRSA 4GZEA 2Y7EA 3GC4A 1SM9A 4GJ1A 1YE6A 4RK8A 1HF6A 3UPWA 2OYKA 1J79A 3GW0A 1MW1A 3W2UA 3OIXA 5C2GA 1ZAIA 4S39A 4IFKB 3MWCA 1F3XA 3QQ0A 3RU6A 2PU0A 4C1NA 3PZNA 5I0DA 1FQ0A 3MUXA 4EXQA 2Z2BA 1TV7A 1TX2A 1O5RA 4FMVA 4QROA 2OX4A 4R33A 1DPMA 1Z9AA 3UG4A 1H5YA 3UYIA 3OZOA 3WD1A 3IVSA 3VMNA 2HVOA 3MP5A 5D4YA 5I3HA 3SY1A 5XIAA 1VH7A 3B9OA 3PBGA 3LOTA 3PZ9A 4AMCA 4B9ZA 1IZKA 4MY1A 4EWND 2VWSA 2GQ8A 2PFHA 5I24A 1BG9A 1JQVA 1UWSA 4DJED 2VZUA 1CXEA 2PE4A 1IXNA 3MHUA 2ZRUA 4FP1A 2FFIA 3GZ3A 3P84A 3WBYA 2VXNA 3ZYZA 3FK4A 3MUIA 2PD5A 3OQ8A 4S2CA 4ZQMA 1J0ZA 2WW5A 3WLJA 4U4MA 3ZOAA 4DJDC 2Q01A 2WSQA 4IMAA 4PRWA 3TWAA 4D6GA 1K1DA 1UD5A 2WZTA 3AHYA 3UWYA 1X1OA 4W9TA 2E28A 1AQHA 5ECUA 4XAYA 3SIMA 1HL9A 2FHFA 3VD3A 4AZ7A 1TJ0A 3S2MA 4E6MA 1NFPA 1JPIA 4E8CA 1GPFA 1XHGA 2QXWA 3DG7A 4HOXA 1ZUAX 1SZGA 4QFUA 1DP0A 5M1TA 3UR7A 3GTNA 4GZJA 3CTLA 4XB3A 3NL3A 5HAOA 4NYYA 4PGLA 2DH2A 4BF7A 1XPYA 2DVXA 1B3ZA 2J7FA 3W6LA 1OQFA 3S2NA 1S2WA 1XYCA 3G24A 2GGHA 4QR6A 5E0FA 1R3WA 1G7UA 3GXNA 1NARA 5DFAA 2XFYA 3JZEA 4M0XA 5ECVA 4KW2A 3T0BA 4DZIA 5ABEA 1C8YA 1BQCA 2I9EA 2F6UA 4NJIA 3I4EA 2VFDA 3EDJA 3C0LA 1MNZA 5DRCA 4HCHA 4O52A 3VNMA 2V38A 5EKYA 3CEUA 3T2QA 3WENA 5XIMA 3ABXA 2O9TA 2QDEA 2D0HA 2PMQA 4BI7A 4GPNA 3AIBA 4HN8A 3B0PA 2VZTA 1C90A 4DZ5A 4EIVA 3SECA 3LCHA 4YTQA 3IEBA 5HR6A 4O1EA 1E40A 1FWNA 2XFFA 4NJGA 2QT3A 1EGZA 4UFKA 1S2VA 1P7TB 5AZ1A 4YVPA 4D2JA 4H9VA 3HFYA 1VCVA 1UA3A 3V5FA 1IV8A 4IMFA 1NH6A 3CHDA 4J4KA 3O7UA 4H9ZA 4HOZA 2FYMA 3O0KA 1KKRA 3OVGA 4O1BA 3SGUA 3LHWA 4J3VA 4B5NA 3RFAA 5FF4A 2WHLA 3GBDA 4JTFA 5LYRA 3QSTA 4FNPA 3WQDA 4C6EA 4ZB0A 5JH1A 3NL2A 2C79A 3VKKA 4M24A 3B8TA 4OVXA 3MPGA 4DZAA 3LY0A 5D2XA 3TA9A 3WDIA 4TQTA 4EWJA 2REQB 2VD9A 3S5OA 2J7BA 3NPVA 5FD0A 3UBPC 1Q6FA 3CXOA 4JTDA 1ISVA 2ZWZA 1RA5A 2I57A 1H1ZA 1Q4NX 3S5ZA 4Q8NA 4NXKA 3W3OA 2PWUA 3WUFA 4XG1A 1PL9A 4L80A 3PAOA 3EMQA 1K77A 2PRLA 2DZWA 2RHGA 5HUPA 2G37A 2BXZA 5GVJA 3TV8A 4AHQA 2BVWA 3FHAA 2WC7A 3W22A 4HNNA 1VBHA 2WLZA 2WSPA 2RDXA 2TYSA 5EMLA 5HNRA 1NWRA 3TN6A 1I2QA 4J1OA 3SGGA 3OHIA 3VGEA 3H2CA 1H2JA 3KCLA 3PG9A 3SO7A 1J6PA 2QJNA 3PNUA 1CZ1A 1ME9A 4JHMA 3UVAA 1QO2A 3KUMA 5AC7A 3ZR6A 3WQFA 2BGNE 4PFHA 4GLEA 3W86A 2VP8A 3RCMA 4WLCA 2O0TA 2VQTA 2CWXA 4WVXA 1XP3A 3LB0A 2OSYA 5LHEA 1K8XA 3GYEA 4KF1A 3MVTA 2ACQA 3M43A 3MJMA 3WX7A 5E93A 4AY8A 1IEVA 4NYUA 2QCHA 3NTYA 4QXIA 4AU0A 4DN1A 3TXVA 1EPXA 1R47A 1GWJA 1SJDA 3PAJA 3GK0A 4IM4A 2BY1A 3S9IA 3WLKX 4IIEA 4YN5A 2HVNA 3SUUA 2AQVA 3W28A 2QDGA 2HS6A 4CCEA 2GGIA 4JCLA 3THCA 1ZU8A 3ZR4A 4NIRA 1QI2A 1W3JA 3O06A 3HU7A 1V79A 3CUXA 2YB4A 3WLOA 2OLAA 4ALDA 1QW9A 5A8MA 5IXEA 1XIEA 1WDQA 5DEZA 5F7UA 2V3EA 5LNSA 1BKHA 4M19A 5T8GA 4RUBA 2G3IA 3S42A 3TC3A 2W5FA 5EGRA 2OKTA 1JD7A 1ZJAA 5C9ZA 3TYDA 3IUDA 4IP7A 1I2PA 2O4MA 1XCXA 3B8SA 1EJ7L 4D8ZA 1E0XA 2GQAA 3WFLA 1G5AA 2PP0A 3KTCA 3EWXA 1X6UA 2V2CA 1FP8A 3L7RA 4JL1A 3SW6A 4BF5A 1XSIA 2OYLA 4RDVA 3B8DA 3SEPA 3TYCA 3WH7A 3WQCA 4CQ8A 4RNJA 2UZ9A 5CQ1A 2X1IA 4G7EB 4YS1A 3W71A 1QBAA 1GVFA 3AXHA 4QEEA 3FJLA 4Q8OA 3P14A 4LRSA 3DYMA 1FWJC 1EDQA 2PCQA 2QPUA 4GVIA 4CQ9A 4FLSA 3CZJA 3R13A 1ISYA 4E3VA 4O53A 1H60A 3GIPA 3M0XA 3IIOA 1VFOA 1DJWA 1E3ZA 2VCBA 3AYSA 3H2OA 3M9YA 4K7VA 3ZLGA 5C54A 3G3DA 3WF0A 1XLJA 2GQ3A 4J2MA 2HNHA 4MOZA 2E6AA 5FJRA 4J3UA 1A3WA 2B81A 2F38A 1DL3A 1QT1A 5K4XA 3VGGA 3TN5A 3TW7A 3ZT6A 4L4OA 1H7PA 2HMCA 5HMSA 3W00A 1JCMP 1N82A 1J0HA 1Q6LA 3OLDA 4QG6A 3LCWA 2XVNA 4RE0A 5F2GA 1OX5A 4IJRA 1P1XA 1WBHA 2DDXA 3W4RA 4GUIA 2JQXA 1A3HA 3LTYA 5FL0A 3NVTA 5HWNA 1XYZA 2OZ3A 2DQWA 1EJUC 1MWOA 4UQAA 3H54A 2QVHA 5DELA 3A4XA 1UW9A 5C7HA 1E55A 4HHMA 1HGWA 4QNEA 1ZPTA 4W87A 4PUNA 1WAUA 3A6OA 2XGBA 1BLIA 1JYNA 5ABFA 2V3GA 3GG1A 3W7JA 1AL8A 1M7PA 1MUCA 2V69A 1TTIA 3UWEA 3B0VC 4NZJA 4H00A 2ZZ1A 4RNIA 4PUKA 3HG3A 4NP7A 3AYVA 2HROA 4RE2A 2DV0A 2QULA 1TWIA 3OBAA 3CUZA 3H4GA 1AMKA 1WX0A 4RNFA 3CUJA 4JY9A 5D02A 1RK6A 2P53A 2Y88A 3N14A 4CQBA 5BRPA 1SZRA 4KGLA 4PUJA 3AUOA 3BLKA 5E0CA 2FVMA 1LQ0A 4TV5A 3QR1A 2DZPA 4M1BA 1DWGM 1UZDA 3ITYA 1K70A 1TPB1 1JD9A 2WCSA 4KMQA 3S2CA 3AIQA 4GG9A 2E7FA 3I7QA 5LA1A 2XSBA 3CJPA 1W31A 4UC5A 1G6CA 4MAVA 2Y85A 1TIWA 2H8XA 4GKTA 3W1QA 3NQMA 4IXXA 4Q4OA 4IJCA 2WMJA 1FP9A 4QG9A 3HGJA 5A8OA 1WA3A 2C71A 3FVMA 4KFPA 1RQBA 5KZMA 1J2BA 5FJPA 5JUVA 1ECEA 4XKYA 1E5JA 1IGSA 5D37A 4GWEA 4KIRA 1LORA 4P8UA 3TTOA 5LIUX 3JU2A 4O0QA 3UZYA 3NDOA 2YB1A 4Z0SA 1VENA 1OIFA 3URQA 2DIKA 3A3WA 4ZOAA 3WD2A 2YDRA 1LBLA 1E9LA 3R0UA 2J7EA 4UTJA 3TU9A 1TE6A 3LQLA 4LS0A 5FSEC 3SR7A 4H9TA 4KS0A 1PO9A 4HA0A 4NNBA 3TTYA 2YA1A 5GJMA 2DVUA 3LRMA 2NSXA 1XLEA 4LWWA 2XTKA 3PP7A 1EX5A 3VMPA 4DXVA 3P82A 3H55A 4F2UA 3CV1A 1MXGA 1GGOA 1JZ6A 2HZGA 4QITA 1Y65A 4WX2A 5DY2A 3THUA 3L2LA 3VIHA 2Z1XA 4YVXA 1T41A 1PJ9A 2DUZA 3W7IA 3J7HA 1HKKA 5AZ0A 1EJSC 1QK2A 3URNA 1DWIM 3EWDA 1M04A 3CK5A 1A80A 3F4NA 3G1HA 2A79A 3S5YA 4FXSA 3USZA 2YCIX 4D6EA 4RE4A 3W24A 3UCQA 4WKAA 1XBVA 2EXOA 3BOLA 1SMAA 4GUHA 5C71A 3TWBA 4LAUA 4ZO7A 4R88A 3TAKA 7ODCA 4KGJA 1ODZA 3WQGA 1GOOA 4V1XA 3OLIA 5G2HA 1VFSA 1T96A 3CUFA 5GJNA 4C6JA 3GX9A 1W9BM 2BXYA 3T40A 4EAYA 1AMYA 2QUMA 3ECQA 4M82A 1OCQA 2E6YA 2ODOA 4JYFA 4Z0JA 3GH4A 1M53A 2NX1A 3F5KA 3HO8A 1IE7C 2VQUA 3A23A 2C0HA 2RDUA 5I3IA 3U2OA 1A5UA 1TPFA 3WJSA 4N9EA 5IRPA 4M6PA 5JMUA 4IQEA 3CL8A 1S2CA 3VGDA 1JEZA 3EXSA 4XO6A 3ARSA 3WQOA 4UCGA 3AZTA 1CXKA 1BVWA 4JTAA 3S46A 1BEUA 1Q65A 3LBCA 3MYOA 2XIOA 3UR8A 3QW3A 2IMRA 4YLWA 1GOMA 2VCCA 3P0XA 3AU6A 6ENLA 2J78A 4RDZA 1ML1A 2GUBA 4QDMA 3FN9A 3QY7A 3GO2A 5CG7A 4TX9A 1TYGA 1C7SA 3A4WA 1A5KC 3U6WA 2PI6A 2C14A 3EWZA 3P3BA 3DGRA 5F1VA 4WY0F 4PMUA 1SW7A 3ERPA 1TMQA 2PPGA 2GPTA 2HEJA 2GDQA 3AISA 1F76A 2VEFA 3W7EA 3M6YA 3CB8A 3KBNA 3VXGA 1QNVA 1P6WA 1TIMA 1UWTA 3QMSA 3PTQA 1ODUA 4HJFA 2ZRVA 3CPUA 3E2RA 3TN4A 1ZS2A 2WK2A 3OBEA 3PJTA 5DXYA 3F2CA 3PANA 1UYQA 4PMQA 4A8NA 3N13A 4FS9A 2OOGA 1W9UA 2XH7A 3WQEA 2ZRYA 4UIOA 2ABAA 3SAZA 4UFLA 1UZ1A 1LTDA 3VK5A 1Z6KA 2NLYA 4LNCA 3AMCA 3QEZA 3DFTA 3AIVA 3GY1A 4TMCA 2PTWA 3O6CA 4WSHA 2HTMA 4IMEA 2C18A 3ID7A 3G1AA 3AXIA 3LLDA 1KFWA 4LVAA 1ONRA 1V6UA 4US5A 2ZXQA 1UC5A 3GDLA 1N2VA 3O07A 4KWOA 4FEZA 2CHRA 2GOUA 3A3HA 1RCXB 1CXHA 3S6OA 5HJYA 4ZSTA 2B7OA 4B92A 2VFHA 1OCBA 1UASA 4H01A 5D9PA 3C6CA 4AF0B 1TPEA 2A5HA 7TIMA 1KGWA 1LRQA 3IIXA 5BWFA 1W2VA 1JPKA 4V15A 2WJFA 2XISA 4A2RA 4GIYA 1K3UA 2ACUA 3FEMA 2R1PA 1UP3A 1XV8A 3MSDA 2OPJA 4B2DA 1P0EA 4BQ3A 4IZGA 2QW5A 5HANA 3LTSA 4W4QA 3BLOA 3W07A 4L6HA 1KTBA 4A2SA 1GJPA 1XLIA 4GC4A 1YBQB 3GKAA 2QUNA 3N18A 4RNHA 2WSYA 4IGHA 2TSYA 1UQYA 3W83A 4JQ1A 1B2YA 4Q32A 4QSFA 4S3DA 5FESA 2CNCA 5EL1A 4LGXA 1MQPA 4MNLA 2VZVA 2ZC1A 3UQNA 3VD5A 3O0FA 1DTNA 3VOHA 4R7JA 4A21A 4B3ZA 3I6TA 2FDSA 2QJMA 3L12A 4K3ZA 2AL2B 1UUMA 4IP4A 1W32A 5J04A 1BTMA 2D1ZA 1F6YA 5LNUA 4IF2A 1SJAA 5BZAA 3ICJA 2HXTA 3V1HA 1ZP3A 5HDRA 1YNYA 2NT0A 2RH9A 3DX5A 2XM2A 3EA1A 3SBFA 3FX4A 2R94A 2RGLA 3A12A 3ZO9A 3VKCA 3NQGA 4PTMA 1IT8A 1FWWA 4NHVA 4BKNA 5DCDA 2VX6A 5EMMA 1JJKA 4I6KA 4GYPA 3CIXA 3W73A 4JTHA 1SFLA 1C91A 1FXQA 5EYWA 1PZ2A 1SZNA 3C2FA 3G1SA 1SO3A 4Y9PA 1U1UA 2CWNA 1BHGA 2QIIA 2YFNA 2PDMA 1UPPA 1LWIA 3Q4DA 1IZJA 2WC4A 1HKWA 4XZNX 1DWJM 2VC9A 4DJFA 2A85A 1PUDA 2PDGA 1D8CA 1GZJA 1HL8A 3VX1A 4C6MA 4JAWA 1W17A 2BP1A 1KBLA 1GYLA 2X2YA 2Q09A 2FZMA 4G7EA 5DN1A 3P62A 1EX1A 2FTPA 2PWFA 1OVDA 1UR4A 1GZ1A 4FSAA 2W27A 3WL1A 3WMLA 1CGXA 3JR2A 2R82A 3PBMA 3S1VA 4D6HA 4PMDA 4NZFA 1Q6QA 2DSKA 3B9EA 4KEVA 2PGFA 5HJLA 1LOLA 2E8YA 4HA3A 2O56A 4IPLA 4JFUA 1E9IA 3TQVA 4K1GA 2ZZ2A 3V4BA 1TJRA 3OGRA 3GHTA 4HYRA 1DJQA 5T91A 1XDLA 3QC0A 5E09A 3WBWA 4Z2GA 3SN0A 4O8RA 4XZLX 2GGEA 4ZGYA 4CN1A 1E6XM 3C8FA 1W5QA 2A7NA 4PTVA 3MZNA 1SSGA 3C56A 1KV8A 2WWCA 5TF0A 3PFRA 3A5FA 4Y96A 1BGGA 3WNNA 1NDVA 4E2OA 4K2SA 3WLQA 3UJFA 4W5ZA 2PWEA 3CWHA 1E4IA 5HQLA 1LROA 1W1PA 2PDPA 2OO6A 2WO5A 3DENA 1ZRQA 4QJ3B 4EX4A 5KZ6A 2Y8UA 1OEPA 4MF4A 3FGCB 5A95A 4ZTYA 3PSWA 5M17A 1E6RA 1XGZA 3SQSA 5BCAA 1RJPA 4EAMA 3EPOA 1A5SA 2VYOA 3VKJA 1AZ1A 3TKFA 2XPKA 3M16A 4E8GA 1XINA 4UQDA 1J96A 4PEKA 5EU9A 2QCMA 3PUDA 1E6QM 3OG3A 5HWJA 4AD4A 4OT7A 1QRQA 2R24A 3GR7A 3BW3A 3E74A 1PPIA 2V5CA 3EZ4A 2E1DA 2ZUWA 1BQGA 1R9XA 1AD4A 4JX6A 3TIMA 2OZ8A 3GNRA 3M0VA 3FXGA 3N2BA 1HVXA 3MP4A 1YYAA 3WQ6A 4S3CA 3NXFA 3HV9A 3LXCA 1W5PA 2E68A 2DSVA 3ZT5A 5I03A 3LUTA 3V5OA 3WBXA 4LPCA 3VVGA 4OIFA 1SZFA 3KAOA 5IHSA 1NDYA 4B16A 3VD9A 1O68A 5CEWA 4L9XA 4HPNA 4F2BA 4Y6GA 2XFWA 3AZSA 3HIJA 3P93A 1WDRA 3THAA 2WZIA 4PN2A 3RPTA 3RDKA 1WE5A 4H9XA 1QBBA 3MDWA 4HK7A 1L2QA 5EMUA 2QHAA 3EMZA 2DJLA 4NZ1A 4LB4A 2ISWA 4GINA 2OQYA 1XG4A 1Z41A 1V0KA 2PS2A 3IJIA 2XDFA 2OGJA 4AZHA 1NF0A 4JEJA 2FMOA 1YE4A 3M6DA 4R9OA 1OADA 1R46A 3VM5A 2FTYA 1XIHA 1BYAA 4UR9A 3NZGA 3PZTA 3V3WA 3BAXA 1LM1A 3ES7A 3R8HA 4GY7A 1UP0A 4HYVA 2ATSA 2ZXDA 4RCXA 4BQ5A 4QJ5B 3BLEA 3FEQA 3W7KA 1ITUA 1DWAM 1I9CB 2R1MA 5K7JA 4ATDA 4KH2A 1EFZA 3B8VA 3KTSA 2CLFA 3A5VA 1UKPA 1W2PA 4Q4PA 4MAZA 1YDVA 2X0HA 4PBGA 4JHZA 1V4YA 2INFA 5DBUA 5AKQA 3R58A 3M4HA 4KWWA 1OABA 2ZUVA 1P48A 1H7WA 2G3NA 1EC8A 3KBWA 2ISSA 4UQEA 3PNZA 4UMAA 5T26A 4PZVA 1EWDA 3AWOA 3N12A 4Q7NA 1A49A 1OFRA 1M68A 3URAA 3IJ9A 4WKHA 3BAYA 1Z69A 1FFRA 4B3KA 1OYCA 3MCOA 1CLKA 3M64A 4WF7A 3ISIX 4LH8A 4HVXA 3L67A 2Z7KA 3PPCA 1ZENA 3DFQA 3G1DA 3AQUA 1U1JA 4CUCA 1PKYA 3JS3A 1BG4A 1I6NA 4I3GA 1UD4A 5LIWX 5F1UA 3TOPA 3NZQA 4AVNA 4MB4A 4JS3A 2B7QA 4TTGA 3O6YX 1E72M 5HNTA 1FHLA 3LYEA 3EYPA 4YYCA 3RN6A 3SCUA 1V03A 4J5NA 4PFMA 1R5YA 4UTIA 3LDVA 5FF7A 3OBKA 3TE9A 1E3XA 1UG6A 3LZ3A 4IIFA 1B3XA 1FHVA 1ZAJA 1NQ6A 4AUBA 4F4RA 3MV01 1UHVA 3EA3A 1TWWA 4S3KA 1QU4A 1PCKA 3BV7A 4M80A 1LDCA 3B9NA 4WHBA 1XDMA 4H6EA 8RUCA 3UZWA 4KRUA 4I5XA 3N11A 1TJ1A 3U57A 2UY5A 3VFCA 3POHA 4JTCA 4GI9A 4JICA 3QMTA 4US6A 3RPMA 2OX1A 2R8WA 1GT8A 2QV4A 3EDEA 3EKGA 4PCPA 2CLKA 1JL8A 4YNGA 3LK6A 1DWHM 4K7YA 2YA2A 1ZAHA 2ZE0A 1XRTA 2E5CA 2PRHA 2VENA 1OF6A 1KM1A 4H04A 4Y7EA 2FPVA 3LI1A 4IL0A 2UY4A 3QH2A 3IANA 1JGIA 1G4EA 3CO4A 3WK3A 1AW5A 1X1ZA 6ALDA 1JPMA 1ITQA 3GVVA 4LBRA 3N4EA 1FWDC 3FCPA 2PDLA 3QY6A 1XRVA 2XSXA 2WZHA 3KS5A 3HPZA 4WUIA 1XIFA 5BU9A 3LERA 5LNWA 5G1YA 3W7NA 1TUXA 3UWQA 4IPJA 3S8HA 1M6JA 1TA3B 3ABSA 3A47A 3TCEA 1B57A 2DT2A 5EMYA 3WUEA 2PU1A 3RJYA 5LXEA 1ZP4A 1TO3A 1JFHA 1FCBA 1T99A 4H2CA 3CU2A 3RYSA 3LPOA 2RFGA 3IJ7A 1SZEA 4BA0A 1HJSA 3WNPA 3TQ0A 4AW7A 1TTQA 3W82A 3WMCA 1QPKA 2F7FA 3DFHA 2PDJA 3HQNA 3E0FA 2EJ1A 1XH1A 1TJ2A 3LBMA 3WF1A 5HXMA 1AQ0A 1CGYA 4JTGA 2JKEA 3KBMA 3M5ZA 3QMRA 4QJ4B 3AYRA 1TQJA 3VKBA 1DXFA 3LHVA 2W63A 1KW1A 1FUYA 3VIGA 3TYBA 2VWTA 4DJEC 4EK7A 3M5VA 1OFPA 5REQA 3IV8A 1UP2A 2CITA 3QC3A 1W0MA 3H21A 1CGWA 1I60A 3FS2A 3ARXA 4DB7A 1P4CA 1QATA 5D03A 2G95A 3WD4A 4AHPA 2WM0A 1QPQA 1V6TA 3O63A 3TFXA 4YL2A 1XD0A 1Z42A 5FJJA 3FJ6A 3ONCA 3G0SA 5XINA 3N73A 2GVLA 2X16A 2WSRA 3ZLFA 4CD6A 4XZ9A 1RP9A 4PBFA 3UWUA 1D7KA 4JQ2A 1CLXA 3STCA 3NQBA 2I7GA 2DGAA 1EYWA 3GD6A 1W5NA 1DIOA 3EAUA 3PZGA 4CU8A 4NNAA 1WZKA 3REQA 1UKQA 1XF0A 2IXUA 2O9OA 2PLMA 2QDDA 3HJZA 4P7RA 5FSDC 2ALDA 1B31A 4LYKA 4OFCA 4AC7C 1BD0A 2GOKA 4N6FA 5IHRA 3EWYA 3ARZA 4INFA 3E9AA 1CW2A 1FWRA 3S4TA 2J6XA 3E5PA 4YTUA 3PJUA 3LGEA 2Y63A 5HATA 3MI6A 4ZE5A 4GE8A 1OZMA 7PTDA 4RW3A 2AKMA 2G3FA 1MDRA 1EC9A 3AIEA 5FI8A 1F6KA 3BZJA 3L4ZA 1VFLA 2TODA 4EKJA 3LCXA 4UNIA 3KBSA 4NF7A 3ONBA 4GUGA 1EB3A 5U4NA 1Q8AA 1IXPA 2WNWA 3VPLA 3H26A 3VM7A 1DTUA 1WCGA 1TKKA 3POCA 2WMIB 4O0KA 5C2CA 4J28A 2DIEA 4U2ZA 4GNKB 4PMOA 3WN6A 1ISWA 1UCWA 4RZ6A 2WXDM 1PHQA 1TSIA 1FH9A 3U0HA 1SO6A 2VNCA 1US3A 3LMZA 2CU0A 3HM7A 3UP8A 2Z27A 4KFOA 3NQDA 3IUHA 4TUFA 1BPLB 1RAKA 2CZ5A 2XFRA 1UJPA 3MUCA 4CKQA 2Z0IA 3P5YA 2EF9A 3HGOA 2G3MA 1Q6GA 1QHOA 1FDZA 2Y2WA 3A4JA 2WC3A 3P7YA 2J77A 1GW1A 2DJXA 4E4UA 1MRAA 4MWAB 2DZTA 4XQ6A 5IBXA 3W38A 4GYFA 3LRLA 1O94A 1JI1A 2J75A 4AEFA 5CC3A 2PURA 1H63A 2F61A 1GOWA 1LQ2A 1JZ4A 3WBEA 4QJ1A 2YYTA 1UKSA 2YPIA 4F0HA 4P7LA 4M6QA 1GKPA 2A4AA 1TVLA 3FJ4A 3AU2A 3RGTA 4U3AA 2ZICA 4Z2IA 3HGSA 2W92A 1WNOA 2RJGA 2Z24A 3LMYA 1ALDA 3VKDA 4M29A 1JUEA 1E1EA 4H4IA 1E4LA 4XD5A 4MVAA 1TVNA 2HBXA 1D3CA 5C70A 4QSHA 4PE8A 2QCDA 1OGGA 1WOAA 4JFSA 1K03A 4FX8A 2I14A 2G4FA 3GWQA 4LUSA 5F2IA 3RRAA 2V8ZA 4NL1A 3C2YA 1WDSA 1BF6A 4N4QA 2OSWA 4EE9A 1XYFA 1FH7A 1WDWA 2PDBA 1S38A 4O18A 1HP5A 2WJEA 3VDAA 1GQLA 3PN8A 4UWMA 1IF2A 3KBJA 2XG9A 4AHOA 3GVGA 1Q13A 3KLKA 4US5D 2PWHA 4XZBA 1NU5A 3QKEA 4GXWA 3M46A 2X8RA 2VFFA 1MI3A 1OFAA 1QCWA 3DIPA 5AN7A 4R7OA 1DKWA 4WRHA 1KWGA 4LEFA 1VFFA 1SFSA 3QZ6A 3NQ8A 3LU2A 3I68A 2QJJA 3UPBA 4GQGA 3CZKA 3OIHA 3CWNA 1W56A 4V33A 4PUWA 4C6IA 1OT2A 4O57A 1EBGA 4J3SA 1EDGA 3FGCA 4ZCWA 2X42A 1VBGA 5CC7A 2JK2A 1QWKA 2QNEA 1RBLA 1G69A 3BSHA 2ZRZA 2IQTA 3SCSA 3KXQA 1V02A 1EGVA 3LA4A 4B2DD 5TNVA 3GG0A 4HKPA 1F8IA 3F5JA 2VOTA 1VFHA 3MKKA 1KXHA 3WK0A 1WOBA 5DMLA 1EOMA 1L6YA 2XJ7A 1GOKA 1RK5A 5FF3A 4M81A 4B5UA 1L6WA 3GAKA 3WMBA 4JZ5A 4ZO6A 3CBWA 4LC8A 3E49A 1LWJA 1K8ZA 1KQZA 4Z17A 3ZWSA 3W88A 4MADA 1JAKA 3RM8A 4FNTA 1UOKA 1AG1O 1J4EA 4FO4A 1MEWA 4PULA 3B97A 2WYSA 4OTKA 4MY8A 4AD1A 3R1ZA 4Q8QA 4CCZA 3BMWA 3O8AA 2V30A 4JCMA 3HV8A 2BDQA 2G50A 4G9PA 2P5NA 2W9MA 1WO2A 2J8TA 4JBRA 3R89A 3P74A 1QHZA 4QDPA 1U22A 4C5YA 3FNDA 3KVLA 3C5QA 2X05A 2VGBA 2WLYA 5CGQA 1TV4A 4PCNA 1BWLA 2G8ZA 4KQNA 4XUYA 1HQTA 1D2KA 2Z1VA 4LCSA 4AD0A 1UKTA 1Z48A 1W3IA 1FWGC 1V3KA 2QEZA 4D6FA 1JIBA 4DWSB 1MXDA 3ZZ1A 1XXXA 3TTEA 4PA8A 3HGRA 2QAFA 4CNTA 3V36A 3W7OA 4GFSA 4DJFD 5G4HC 3QQWA 4LVFA 2YX0A 4JQ4A 3DFPA 1SJBA 1DQWA 1RVGA 1W9VA 4AXNA 4B90A 1XYLA 2DZVA 3LHTA 5K4ZA 2DW7A 2ZZ3A 4IICA 1FWSA 1V3LA 1Q4WA 3C86A 3QV9A 3UA4A 1PWMA 2Z28A 1XKYA 4OKDA 2F2KA 3W75A 4JOMA 4XIMA 1OINA 2VVNA 1RZMA 5CBJA 3N3TA 3P5ZA 4IL2A 1JDDA 5I3JA 3LTPA 2P50A 1MFVA 5K9XA 2YZRA 3HPAA 1IEXA 3RX3A 1KNWA 1PWLA 1WB0A 3THQA 3VD7A 1XGDA 3S5NA 4GIAA 5CJNA 4E8DA 1XPGA 2OQLA 1NWTA 3BGAA 4F9DA 7TAAA 2E8ZA 2HISA 3G1FA 1QASA 5A8PA 3CL6A 2ZDRA 4HHHA 1HO1A 1LYXA 5CSUA 1EF3A 3ZSTA 5C8BB 3W7HA 4B4FA 4ZO8A 3II1A 4AY7A 1ENUA 3GNPA 3QV7A 2GK1A 3PUGA 1ZZMA 3VZZA 3ARVA 1A4MA 5I00A 1GG0A 4P7OA 5A6TC 1UR8A 1KR0A 2AGKA 3PPHA 3BCDA 3C8NA 3NQCA 1C9WA 3MC5A 1M7OA 5D8ZA 3PZQA 1L0PA 5HMEA 1RJQA 4QE1A 4AQLA 2GJXB 4RJEA 2YFOA 1ICQA 4IPPA 1JZ8A 4ZXOA 5I77A 4ZODA 4TMBA 3MP3A 1R3SA 3EDKA 4Y90A 1PTDA 1X8CA 1OX4B 1TPWA 4NSBA 3QPYA 2ZXAA 1NFBA 1WXJA 3IUIA 1IR2A 4LXFA 1K4HA 3W02A 2AMXA 3GTXA 1XFBA 4Q22A 3VOCA 3T6CA 1N7KA 1OCNA 2J9ZA 3H2NA 1M01A 4X60A 4AYSA 2OYMA 4X0NA 1TPUA 2NQJA 3ANYA 3GR8A 3TZFA 2QV5A 1C3FA 3BC9A 1JPHA 3SJNA 4C91A 4HTYA 4AIUA 1TTPA 4MNKA 3UWWA 3EOEA 3WJWA 4KEUA 1E0WA 3BV4A 1UC4A 3GBEA 4LS1A 3A24A 4S38A 4Q7BA 2G0WA 3CMFA 2GUUA 1TE1A 2J8GA 1TFVA 1ZJIA 4OWGA 5BRBA 3HPXA 1XIIA 2ANUA 1JGMA 2FH6A 2PDFA 2UWFA 4DRSA 4S3JA 1DXIA 1WKFA 3AAMA 2J7CA 3QHNA 1TZ7A 1C92A 1HXJA 3W1TA 3WJZA 4YXGA 1PIFA 1XCWA 1TA3A 4MDOA 3S9YA 4O4WA 5FAGA 1RR2A 4DAFA 4PMVA 2ON3A 2QVNA 4J3WA 3W81A 3STPA 1XM3A 1K8CA 4S2BA 1W1B1 1CENA 3JW7A 4OQVA 1QVBA 3BUVA 5FL1A 2D20A 2WM1A 1VJIA 4QHRA 2ZA1A 4IT1A 3PB2A 1RPXA 4BWLC 1ZTVA 5MKGB 2V82A 3APGA 4KBXA 4ZOCA 3N15A 2X0YA 5IFPA 4JIQA 1FDYA 2BNJA 4KEMA 5A5WA 1LG2A 1A5AA 1CXIA 5DMYA 3G18A 3A4AA 3CAKA 2OEJA 4K8EA 4C60A 1C8VA 1IIHA 1Y5VA 2OT1A 3S1WA 1RSCA 1QWGA 1DV7A 1AL7A 3FAXA 4X22A 4FF7A 1VPXA 4R53A 3SCWA 1H3GA 3UR5A 2YXOA 3WUGA 1PYMA 4EF9A 4L9YA 4ROPA 1XISA 3BMXA 4W8AA 4HSHA 3EX6A 1DHKA 4AMAA 3BXWA 1T8XA 1ZNNA 1VCGA 1M65A 3BLFA 4A3RA 3DFNA 3RX2A 3RG6A 3V18A 5CZJA 3AXMA 3UEQA 1SO5A 1NFGA 1UBPC 3DI1A 5CGMA 2YIHA 3CQIA 1LF1A 4P8VA 1K7FA 3O05A 2ZUSA 2DORA 1G4TA 3MCMA 4MWAE 2VELA 4AZBA 4L4PA 3I65A 5I06A 3MVIA 3MA8A 3SRFA 4U5KA 1MNSA 1T5AA 1MW0A 3NJ3A 4XD3A 1G0CA 3WYZA 2QCEA 4PTNA 1R2SA 2ZX8A 3NEVA 4Q7IA 3Q2DA 4V28A 2VO5A 4LVGA 1F9CA 2W66A 2Q6ZA 4JTKA 3GXMA 3TJLA 1J9YA 5B80A 1EQCA 5AVHA 1QMLA 1QPOA 2X30A 1J5SA 4LEQA 4ROQA 3CIVA 1NP2A 4Q4MA 1UD6A 3HQ1A 2QS8A 3NNTA 2ZKMX 3WLLA 4QQUA 3KS6A 2V3FA 1RLCL 3H70A 4LAOA 4XV0A 4CNOA 2G41A 1M3UA 4M7SA 4UMCA 3VNIA 1RV8A 3WLSA 2VKZG 2P8CA 1E5NA 3CLMA 4RW5A 3VA8A 5LGZA 3LV5A 3CLWA 3MJYA 3Q37A 3E12A 1DWFM 4HNOA 1WYIA 2FIQA 5CPTA 1VC4A 4FA3A 1DJXA 3GHRA 1QJWA 4XBKA 3CUHA 1JZ5A 1VS1A 1US0A 4QCEA 3IACA 2HE5A 2WMIA 1QI3A 4B5SA 4LW7A 3TK7A 3TTQA 4W5UA 5CPMA 1OBAA 1UB3A 4DWDA 3TONA 5KZDA 3CUIA 1F4AA 3G0UA 1YW1A 4HPHA 1ADDA 3DKLA 3C0QA 3DEQA 4H3DA 1JCYA 5KETA 3WJXA 1UUOA 4G2DA 2Y61A 5A69A 3VGBA 3G3MA 2OZTA 3TVAA 1GOXA 4GJJA 3S5SA 3PZMA 1EEXA 1W1YA 5M2FX 4GQRA 2J9YA 2Z1KA 1S2AA 4GBDA 4LUIA 1KA9F 4DVOA 2G3JA 1JRBA 2C15A 4O16A 1E6PA 2I5GA 2IPFA 4QDWA 3R94A 2IUZA 1AFSA 2GWNA 4UTHA 2E40A 4PTDA 4DO7A 4JKLA 3N19B 2EPLX 3MCNA 3WEZA 3OP2A 2JIWA 3EWBX 4DM1A 2AQOA 1E15A 4LYRA 4HGXA 3EBVA 3D3AA 3L68A 2NLIA 2NVCA 2WVUA 3TJ4A 3WLMA 4GCAA 4MJZA 1IEIA 3QHOA 2X1RA 1W1TA 4D6CA 3UJ2A 1I2OA 3OG2A 4UQCA 3T1GA 4Q8MA 3IAQA 2V5DA 4O1AA 3G5EA 3RUBL 3MQTA 2J74A 1TPDA 1OYBA 1VHCA 2A3AA 5KITA 5AHMA 2OLHA 4D71A 4Z1BA 1V5XA 5I78A 1XBZA 3OU8A 2VDHA 1G4PA 1CYGA 4GNJA 3FFSA 2PDHA 3T0AA 1D9EA 4MIMA 3QSRA 5LHFA 1PDZA 3BW2A 4EOUA 1NDWA 2AKZA 4DO6A 1H4PA 3M7WA 4MZYA 2PBGA 1GQJA 1YNPA 3LEPA 4C6BA 3V75A 4PODA 4N9DA 1JZ2A 2WVVB 4KPLA 1XICA 2MUCA 2J4GA 5AOUA 4Y9OA 1UH4A 3QN3A 3KRBA 4UFJA 2R1LA 1KM6A 1VPQA 3UFYA 1LOQA 3DGBA 3ALGA 1AK5A 3ATZA 1ZL1A 2IW0A 1RCQA 1CXLA 1E0UA 3AS2A 3F03K 1NAL1 4UTWA 4UQ9A 1RBAA 1MSSA 4HYWA 3MKCA 3BLLA 3RLGA 1CECA 3VUPA 1S2TA 4JIPA 3HN3A 3VOJA 2PLJA 4IQLA 4WXZA 2B0MA 2GDUA 4IGSA 3AHVA 3VNLA 2VRQA 4O0ZA 4Q6JA 3AICA 2D0GA 4GA8A 4PYSA 3VNYA 1GUVA 2VGFA 2FVLA 5D8WA 3BAWA 1B54A 3UXKA 4KERA 1RALA 2E09A 3OGSA 1YPXA 4MUPA 4C7FA 5C55A 4BR1A 3W6YA 4L61A 3NPUA 4AWSA 4GYKA 4YCPA 4JTRA 3CHEA 4NAFB 1MDLA 3CH0A 4E3TA 3LM7A 5A6SA 2VR2A 3P60A 3F7JA 2ZADA 1O5QA 4JTTA 1CDGA 4L9ZA 3ZJKA 4GOAA 3PBWA 3SCOA 2PDKA 4R85A 3WNKA 2J27A 4IHCA 3SCPA 3LX9A 3CAQA 1JXKA 4PB4A 3WLNA 5EBAA 1TMHA 1SO4A 4OE7A 3BJFA 3NWRA 2XWEA 2D23A 1H41A 3LBOA 4DUOA 3SI9A 2CBIA 5DXXA 2AAMA 2D2OA 2CHOA 1JYXA 5B7YA 5CXPA 4C6LA 4ZFMA 1FKXA 1YX1A 1QPNA 2XIIA 2XN1A 1XFCA 3STGA 2VTFA 1A5CA 4DWSA 2DZSA 4FOJA 1OFQA 4NT0A 3VDBA 5E6ZA 3ARTA 4A35A 3DUGA 1EUAA 3RNDA 1LLZA 4C6OA 4JGDA 1XLBA 4KWSA 1DHPA 1X38A 2QUTA 2VOMA 4HNCA 1PX3A 4EF8A 2P10A 5HWMA 2J7DA 2PWGA 3E02A 4MYAA 3C2OA 5FJIA 5D2TA 4CCDA 2INZA 3U4AA 3BGJA 4TV6A 1CNVA 1H51A 4PMYA 4ZVJA 5L9FA 2NW0A 3HFTA 4C7DA 3ARYA 5B7ZA 2O4QA 3M0MA 3KE0A 2ADAA 4Q33A 3AIWA 1MMFA 1I4NA 4J3XA 1R38A 3KTXA 3D5HA 3LSBA 2X09A 1C7TA 1LG1A 4FPSA 1QNPA 2E6DA 3RM4A 4S23A 2H3DA 1Y7VA 2WAGA 3WDRA 1TUFA 1X6LA 3GTIA 5D32A 3GAYA 1M7XA 1Z3NA 1PHWA 2CZDA 3P6LA 1XCFA 3O15A 1CPUA 3SUVA 3LPPA 2XZ9A 2YL8A 3L23A 3LNMA 2PRMA 4BEUA 2I56A 1KBJA 2PA6A 1OF8A 1JPDX 4ML4A 3UGVA 3BJSA 1DJZA 3EDFA 2XGZA 5C6MA 3W9ZA 3P67A 3DFOA 4IG2B 3F2DA 1LRNA 2VEKA 3MTWA 2IS7A 4ADSA 3GHSA 4JYEA 4NI8A 4HJWA 2PDNA 5CZTA 5JVLA 1SUXA 4IUGA 4ML9A 1FWAC 1Z32X 4AY1A 4AZIA 1G9HA 9XIAA 1CGTA 1W5MA 3FY1A 4P61A 4D6IA 1L6SA 4Y2WA 4ZOBA 1E0TA 1YADA 2Y24A 3V0SA 2BTMA 4AIOA 3ZVHB 3R5EA 2GJPA 4DNHA 4IFRA 2VRKA 3BOFA 1X6NA 5HPCA 1AQMA 8TIMA 2ZDSA 4AISA 1OFOA 1IR1A 2ABBA 5LSMA 5A2CA 1BF2A 2YW3A 2E67A 3F4CA 1A53A 3HQOA 1KV5A 5G5IA 5J5DA 2YYUA 4F2TA 2VGGA 5BXPA 2PLCA 2FPYA 4GUFA 1DEDA 2VR5A 3QY8A 1QHPA 2ZX9A 5L6UA 5BW6A 1DOSA 1A47A 3IIZA 5A6JA 4AWTA 1JDEA 3IJQA 4JFTA 4BQ4A 4EANA 2IQDA 3MMTA 4O50A 3FDGA 5E6YA 2BS9A 3Q67A 4YCOA 4JQ3A 1FWCC 5BMXA 4XAZA 4YYFA 4E4PA 2QJHA 1POJA 1SYTA 2ZX7A 3WJYA 4BQ2A 5FEXA 5CBIA 1WZAA 3LHYA 3T42A 1MRQA 5DQPA 2IPGA 3UY7A 4WIWA 1UJQA 2C1IA 2D3NA 4UCFA 2PC4A 3BE7A 4XAGA 3V0UA 1O12A 2XWDA 3CQ0A 3N25A 4EPDC 5JBEA 2CXEA 3BZGA 2YBTA 2BVYA 4N0RA 4LVBA 1NOUA 2WNZA 1ZY9A 3P80A 2Q8ZA 3N2XA 1K9TA 3MV11 1UBSA 4HIBA 3SY5A 3CM4A 2VHLA 3RXZA 1W1ZA 3DI0A 4QE4A 5A6LA 2DUXA 1LUCB 4L4LA 1CT5A 3DBPA 3NQFA 3VNDA 4FXJA 1EA9C 4Y8FA 3S6DA 4FK9A 5T9BG 3WZ0E 2EPKX 4XK2A 1JNEA 1GVYA 2BGQA 4HU3A 5MKGA 4P8WA 4MG4A 5F4SA 1KFCA 4FLRA 3PTMA 4PMZA 3UA3A 5KSWA 3NZ1A 1EJXC 3L65A 3EB3A 1I0BA 3U8GA 1MUWA 3HBLA 5GQBA 2LLEA 3C61A 1HJXA 5AHLA 3QM3A 4HA4A 4BEQA 1I1WA 3QV6A 3UCDA 5CSSA 1XS2A 5FF0A 2ICSA 2A3CA 4IGNA 3H2AA 4HD5A 5D05A 3LQGA 5BMWA 4FB7A 4F79A 3C2RA 3DBNA 2ZE3A 3DDMA 3INPA 2DZAA 5A94A 4MJ2A 2NQLA 3GZAA 3T2OA 3D47A 6REQB 3WDQA 3MKVA 4GVGA 4U28A 4F0SA 3GM8A 1J93A 3CV2A 4IOTA 1W54A 1EKOA 2WCAA 4U2YA 4ZB5A 3UF9A 2YA0A 3PZOA 1DQUA 2VEGA 3WMSA 3M5XA 5G4WA 3NL5A 3KCJA 2PDQA 4NG3A 3GG8A 3EX4A 3URBA 2YKKA 2IKIA 3I6RA 4ZMGA 3AIUA 4HNVA 2X7WA 2XN2A 3R10A 1JDCA 1DXEA 1WKEA 1QOPA 3UJRA 2P76A 1E51A 3GNXA 4LFYA 3NG3A 1EWEA 3TW6A 1VFUA 4DELA 3PULA 2CLEA 1TZ9A 3H53A 3WLIA 4OOZA 3TQKA 1LT8A 3O1NA 3EKLA 2GYIA 3G0XA 3MI2A 3ZLHA 3MO7A 4R9XA 1UROA 2CBUA 2C8NA 2ALRA 1ZBWA 4GZIA 4CNUA 3S0CA 2FGZA 3WH5A 1FTXA 4NXSA 2DSZA 2RJHA 3L4YA 2XVKA 2D3LA 1QNSA 2VL4A 7A3HA 5CPNA 4ZQCA 2Z1SA 2A3BA 1W3TA 5CKSA 3RLUA 4H41A 4WSJA 1OIMA 4ZQPA 5LGXA 3EEZA 3GXTA 1J12A 2Q3OA 3T78A 1JZ3A 4PMXA 2VURA 2PDCA 2CKSA 4B91A 2HJPA 3IS4A 3KRUA 3LNPA 4ACZA 3QOKA 4REQB 1GG1A 5HULA 1RP8A 3HMJG 1XYMA 5K9CA 2WMFA 1XLMA 3AS1A 4EPKA 1PXGA 3QF0A 4S3EA 3TSMA 4FAMA 3RLVA 3AROA 3WNLA 2DZBA 1UMYA 4AC1X 2PUZA 3IRDA 3VOFA 5ABHA 1KTCA 2CETA 1IWAA 2C3ZA 3UG8A 1FY6A 1OC7A 1A5BA 1XYBA 1EP1A 4QX4A 2GLKA 2BVTA 3WD0A 2WBGA 4HMCA 2ZVIA 2W3ZA 3P8IA 2FHBA 3DHPA 1G94A 4GXPA 2FZDA 2V81A 1QNOA 1EP3A 2BLEA 1W6TA 1RBOB 2Y4SA 3AI0A 5H91A 4Z1AA 3EDDA 3WL0A 3ZMRA 1O1HA 4AWEA 4FNUA 3DN5A 3VIFA 4XO7A 4TX6A 1B4EA 3CYVA 3EA2A 2UV8G 4AIBA 3GU1A 4MPQA 1C29A 3T2PA 3ZR5A 4UQBA 2ZBTA 4D1JA 1V7YA 1XIMA 3N1AA 4M8UA 1CWYA 4X61A 4PMNA 4S3AA 3SM0A 3T0CA 3WLTA 3F2BA 3IWPA 4H9YA 4JNMA 1UKOA 5AC6A 2BASA 5G2WA 4LNYA 2EPOA 3I7SA 4F0RA 2GQ9A 1UWAA 3E2SA 4WSKA 4WGHA 3Q58A 1HTIA 1D3GA 3M07A 3VIMA 4AEEA 2YZ5A 3G6LA 3PG8A 4GY1A 4N6EA 1BVNP 2DY3A 1YTEA 2WVVA 2AMGA 4F9JA 3IGSA 3W1XA 4XZIA 3E5BA 5I3GA 2DT3A 3KDNA 2PP3A 4ATLA 4E2DA 2AGTA 3HG5A 5EA9A 3NDYA 3N4FA 3TCSA 2E5BA 5H8PA 3DZ1A 2X1UA 1YMYA 3L4TA 3BLPX 1QI5A 3UPMA 2CLLA 4K68A 4DXXA 4O54A 4AX7A 3W2MA 5M03A 4KRTA 1LLOA 4DPPA 4O4VA 1B1YA 2QYGA 3S1UA 2BGSA 1ZBCA 1UWUA 1V93A 2BOFX 4ORMA 1V8EA 1TPH1 3G8RA 3KOZA 4MSSA 3L2MA 2BWGA 4DBUA 1S5VA 2E9LA 4K37A 4DHGA 1XX1A 3ARWA 5A6AA 4FIRA 4DBDA 1JVNA 2FB3A 2XIJA 3T0DA 3BSGA 3OB8A 3RRXA 4NAFA 1HW6A 2IPWA 3SCVA 4CD4A 4TU1A 1IEQA 1H1YA 1L8NA 4AD5A 3KRSA 4PL1A 4BI6A 4JIRA 3E3HA 3S2LA 4IX0A 3MY9A 2PGEA 4ERGA 4X0VA 2BMBA 5BXSA 4CQAA 4GH1A 2Q02A 2ZFAA 2QJIA 1A0EA 3EPNA 4C65A 2YSWA 5A8QA 2OWWA 1NSJA 3CO8A 3UG3A 3NGJA 4UZUA 2B31A 1XLAA 1IHIA 4QQ3A 3UZZA 4O1CA 1GK8A 1YXCA 3BG9A 1X98A 4B3LA 4AAJA 2BX7A 1ITXA 4L56A 2WHJA 4JXCA 3NM1A 3FHQA 3FDKA 1FBAA 3ARRA 4IFKA 1E9YB 3GDMA 4MWAD 1A5MC 3W1AA 3KZPA 3ZS4A 4HU8A 4NASA 5KMYA 1FFQA 3GUWA 3MU7A 3AJXA 3K46A 3Q65A 2NQHA 4LB3A 1XD1A 4RXFA 5TIMA 4TX8A 2E0PA 1AJZA 2EPHA 1KBKA 1VZWA 2NXGA 2BY0A 4Z2LA 4TOQA 1JI2A 1JYVA 5HJXA 2BHYA 1LLWA 2JEQA 4I7VA 2VGIA 1BFNA 4IH3A 1R3TA 2PAJA 4ATWA 1AVAA 1JCLA 1GOIA 1O4UA 2HBVA 4A6GA 1VKFA 3CMJA 3BGGA 1W8SA 3NPWA 4FHAA 4YTTA 4QS6A 4TVUA 6CGTA 1MXSA 1QW8A 4BHYA 1KO0A 5U7SA 4M3PA 4HNTA 4CD7A 1S5NA 1XDJA 1IQ8A 1JCJA 2DQXA 1PKMA 1XL9A 3H24A 4H9UA 4C6DA 2NWSA 2BVDA 2DEPA 1NOWA 3ABRA 1M41A 1OG6A 1R6WA 2VCAA 2VC6A 1GJWA 5T9CE 4NRRA 4IG2A 3UZJA 2GGJA 4S3GA 4AD2A 3WQ4A 4RDWA 1BRLB 3CV6A 1K9EA 4PH6A 3K30A 4X9YA 1KKOA 5LNRA 1SSDA 1K4GA 2DT0A 1DJIA 2XH4A 1KM3A 3NOYA 3VOGA 3O6DA 2WKLA 2GJNA 1A5LC 1S3TC 4W85A 4O13A 3TEVA 3ZVHA 2Q3RA 5E9AA 5I3FA 2Y6ZA 3SQLA 3UR2A 3ES8A 3C2VA 1H7XA 4O17A 2OSXA 4H8UA 5I79A 5CBBA 4C6CA 2GJLA 4YIWA 4AFYA 1BTCA 1I2RA 2FDMA 3GNDA 1LL7A 1QO5A 2QUUA 2J47A 2YL6A 3QLDA 5EFFA 4ZQNA 4CQDA 3P81A 3CL7A 3LHZA 3NOEA 4IUOA 2C0AA 1F05A 1R87A 1ME8A 1V6VA 1Q63A 4ECLA 1E6ZA 2XYLA 3LCFA 1J0KA 1GVSA 2OO0A 4IP5A 4QEHA 2QF7A 4A3HA 4F40A 3CEPA 3SCNA 1XIGA 2Z2AA 3CQHA 5IDZA 3K8MA 4GYPC 1GPWA 3TR9A 5I6SA 3L9CA 4BS0A 3E1F1 4MMWA 1VYSX 3FYYA 3WFZA 2P88A 4S1FA 5EMJA 3MDUA 3UWVA 1S3HA 3B40A 1XGEA 2NV2A 2I9UA 2PSNA 1QXLA 3LGGA 5CPSA 3TYZA 3UJEA 2A21A 1P7TA 1XJBA 5G2IA 3G1YA 3MHGA 1IYXA 4POCA 3E38A 4DJFC 3VCCA 1CGVA 1ADOA 3FSTA 3V5CA 3NSXA 1ISXA 1R9YA 1J10A 4GH3A 1S5TA 3SRDA 1A5NC 4H9MA 1GQKA 1HVQA 4LCRA 2GVJA 5LIYX 1LUCA 2Y89A 4FR6A 4KKXA 4PCTA 1ZQ5A 4ZL1A 1DIEA 3DHDA 1S2UA 2V6AA 4LYQA 4NAEB 1IIGA 2D0FA 2F2HA 3GIYA 2TPSA 1R3RA 2L5HA 4DWSD 3I4KA 3GDBA 3EX3A 4FOUA 4P7QA 3O6AA 4KETA 2REQA 3NQEA 3EOSA 2XVPA 4H1ZA 1ZGDA 2NQZA 4CN4A 5C5YA 2CCRA 2QDHA 4UNKA 4LBUA 2ZX6A 3ITTA 1L6FA 1U2YA 3E0VA 4DBSA 1KXVA 5EMKA 5FJTA 1H0GA 1DBTA 4RZ4A 4G1NA 1BXCA 3R25A 5AFDA 4HA1A 1LZOA 1XLHA 2E77A 1L6GA 1FOBA 3GH7A 2NZLA 1DQXA 2EEXA 2J25A 3NYDA 2W6RA 2C6QA 6REQA 3MUZ1 2R9RA 3D6NA 3U5UA 1ADSA 2FJKA 2Z26A 4HPXA 4ZR8A 3MI3A 4RPPA 5A3HA 5CLTA 4PUUA 2OKOA 2ZZ4A 4K6AA 3ME3A 3N9KA 3S3GA 2I17A 2X0SA 3GQYA 3FSUA 4WDWA 4UNLA 4XSLA 2NT1A 1EZWA 2J7HA 2VM8A 4IIDA 4H6KA 3AMKA 1UUQA 4DQWA 3U4FA 1BGAA 4NJJA 1R7AA 1ECQA 1DORA 1UR1A 2F6XA 2FLIA 1V7AA 1VYRA 1KQYA 3W84A 2W67A 2JGYA 2OELA 4WY0B 4DEFA 2GJRA 3N2OA 1NY1A 1LOSA 2Y7GA 3ORWA 2A6LA 4GD0A 2ACSA 4JTLA 1RQEA 3JZUA 3TX9A 5HR7A 4W84A 4PB5A 1FRBA 1O66A 2XIBA 4HPJA 2PZ0A 1NJJA 3EX2A 5JU6A 1NDZA 5FJOA 2XN0A 1DIKA 4FR1A 3WF4A 1TQXA 5I3DA 3L21A 1QDSA 3C3NA 4JTQA 1GVEA 3OLEA 3R4IA 2ASHA 3WSUA 4XAPA 3PVFA 1VCFA 3D46A 3MSGA 2GSJA 3EEGA 3E0WA 4JD4A 2WZMA 2EG7A 1PKLA 2A1YA 3V16A 2GUYA 2ZZ5A 4REQA 2ZYFA 4AIEA 4E2VA 6TAAA 3CH9A 4UOQA 4DYJA 1HP4A 2VR4A 3A3XA 3K2GA 3SADA 3QGKC 4BJHA 2D2HA 4K38A 4XBSA 1B30A 3XISA 1EL3A 3W01A 4MDPA 4DXKA 1EXBA 2O92A 2WVTA 3WDJA 4DUWA 2FKPA 3NUKA 1YDYA 1RCOB 4JNYA 4WK9A 5ENLA 3HOJA 4V27A 1VJSA 2PTXA 3ZIZA 3NQVA 4I7WA 4GO9A 2WNNA 1FWBC 3GYCA 4ZFCA 1EO5A 4O28A 3W2JA 3VCRA 4C5ZA 1PBGA 3UWZA 4HMEA 1SW0A 4AG0A 2XIQA 2A2IA 1TV5A 2OLSA 1WBJA 3S1XA 2BB0A 4ZA0A 5BOFA 3IAPA 3LGDA 4KEZA 2PTZA 3TFCA 4DLFA 1RY8A 1UQZA 4JFWA 3CHCA 3CAVA 3JVAA 2AOSA 1O60A 1KD0A 3EB2A 4AZ6A 1HZYA 4IGMA 2XGIA 2DW6A 5TQLA 1RPKA 3SRHA 1LT7A 3UERA 4DUXA 1GEHA 4ZQOA 3BJTA 1FCUA 2QPXA 3AC0A 2H3BA 3APTA 2Q8LA 3ITOA 3SCRA 3GTFA 3GXFA 1TV3A 1V6YA 4DY1A 2QF8A 4CD8A 3YPIA 4MGGA 4GGBA 1N8IA 3KOWA 1KM2A 3GVWA 4LU0A 3UW6A 3R79A 3C4UA 3VDGA 4AD3A 1W9XA 2I1OA 2WKJA 5AHIA 2WMKA 3HA1A 1CB7B 3ZSSA 4ZZ9A 1U5JA 1CTNA 4Z2JA 4L65A 4U33A 2EPNA 4JEQA 1K6WA 4O8AA 4Q8WA 1JZ7A 1K7XA 3H22A 3QTPA 4YTRA 2C1HA 4QTGA 1KFKA 4H8HA 4KWUA 2X2GA 3NQ7A 1K7EA 1HX0A 3PM6A 3VABA 3VDHA 1FXPA 4M6UA 3KOXA 2CLHA 5HQEA 3SN1A 3VIJA 4TVCA 5D04C 3DC8A 4FXFA 2J24A 3E2VA 2V2DA 4W7UA 5I3KA 1OGBA 3R12A 2A3HA 3KWXA 4DLMA 4MM1A 5KTLA 4WD0A 4Z08A 3W26A 4C6NA 1FHDA 1H7NA 4PMRA 3W2NA 3CV7A 3W1UA 3FW6A 3TMLA 4TO8A 3HQPA 4WXYA 2FH8A 4HZ7A 6XIMA 3KDOA 1HKIA 1EHNA 1TR9A 3SSZA 1V0NA 3GUGA 4GXMA 1XWYA 2GVYA 3QPZA 2E5DA 1K9FA 2QJGA 1GCYA 3V7PA 1XI3A 3OOQA 4HT3A 2QQ6A 4CEUC 4HK6A 3UESA 3WH6A 2OEMA 4I5UA 2HVMA 2XM1A 3NL6A 1AQFA 4A29A 1O7AA 3M47A 5A6BA 1S1RA 3M0YA 1PTAA 1EXPA 2A3LA 3GE7A 3IIPA 4Y8EA 1W3KA 4D8LA 3PUEA 4W7VA 3HURA 4LAMA 1GHSA 4MNJA 3ZJ8A 4GJIA 1X7FA 4F3HA 4CNSA 2PODA 1CBGA 3GU9A 1OC5A 2CLOA 1HFBA 3HB9A 1L8PA 2POZA 3CPGA 1YXYA 4GI4A 3T09A 3T55A 4RX0A 4LAKA 3P8JA 4Q8TA 1EJRC 4L7ZA 2P0OA 2VX4A 1EOKA 4A4AA 2O9RA 4G5DA 4M5PA 1CXFA 3U7VA 1P43A 3VD4A 1QK0A 5D9OA 3W7PA 3A22A 5EB8A 1KM0A 2Y70A 3U2CA 3TNOA 3LLFA 4PUMA 1YKWA 4DJDA 1KWKA 3RK8A 4UTMA 3ITGA 1BXNA 1VFTA 3PZIA 2F8QA 3QW4B 2E25A 3BPWA 2A3EA 1W3NA 3CHVA 4MHBA 2PLKA 4L1XA 4KWVA 4BK9A 1G01A 3W7RA 1FWFC 4ZTXA 2OQHA 1NWSA 4BI5A 1V0LA 3R2GA 1B90A 5D9MA 5H6HA 1E1FA 2RDTA 2EAWA 4DUVA 5K2ZA 1P0NA 1PE1A 1EJVC 2Q8XA 2IXVA 1U1HA 1I0DA 4RDYA 1RY0A 3IVUA 2VEIA 1BYBA 4V2XA 5IOBA 1RLDA 4S3FA 4Q8PA 5C2XA 2VEMA 4IMDA 4I7UA 6PTDA 2Y7DA 2J7GA 5I23A 4LUYA 2ATMA 4XD6A 3MMUA 2VFEA 3GXPA 1P1MA 2EHHA 2INEA 4Z42C 4O19A 4Q6XA 3QR0A 3UXAA 5BNKA 4OV9A 4GRSA 1VEMA 4JN8A