5IBXC

1.65 angstrom crystal structure of triosephosphate isomerase (tim) from streptococcus pneumoniae
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
250
structure length
250
Chain Sequence
SRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSASQDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALLDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title 1.65 Angstrom Crystal Structure of Triosephosphate Isomerase (TIM) from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae serotype 2 (strain d39 / nctc 7466)
total genus 89
structure length 250
sequence length 250
chains with identical sequence F, G
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ibxC00
4O28A 4Q4KA 1AK5A 2ZZ3A 5G2HA 2CLFA 1BWKA 1FDZA 1H61A 3R13A 1OFAA 1PVNA 3W7PA 3UY7A 2ZTKA 5AHLA 1SFLA 5CPLA 2C1HA 3GK0A 5EMUA 3JRKA 3LHWA 4EVZA 3VFLA 3S5OA 3MWAA 3BO9A 4CQ8A 3Q58A 5FEWA 3M1ZA 1ME8A 3M43A 3W9ZA 4KWWA 1ZHAA 3W23A 2V81A 3DFQA 5F1VA 1H1YA 2WKJA 2FJKA 3M5XA 2H3BA 1FWNA 1OFBA 3BG3A 3LHVA 5LSMA 1V5XA 3QJAA 1LM1A 4I7UA 4JDYA 4ML9A 4N9DA 3TSDA 4LOCA 4FXSA 4NXKA 4EIVA 3GNDA 1HFBA 1YTEA 2RKXA 1DOSA 1LYXA 5C6MA 1M5WA 1YADA 3TC7A 2V30A 3W88A 3C56A 2A5HA 1H51A 4PL1A 1F2JA 3HG3A 5FESA 1WXJA 2J27A 5E93A 2DP3A 3EX1A 1R46A 2Q3OA 1Y0EA 3NL6A 3LHYA 3NL3A 4K8EA 1OX5A 2ZZ6A 1B4EA 2Y63A 4S1FA 4C1LA 2QCDB 4KFNA 3QC3A 2DZUA 1IXPA 1TPUA 3NPXA 4Z1CA 2YW4A 1DJNA 3IIOA 1F6KA 3W7HA 4MY9A 3G3MA 2Y62A 1WBJA 1J2WA 4NJHA 2ATMA 2FB2A 4JEQA 2YR1A 3ABRA 3W7RA 1XBVA 3QW4B 1UB3A 4RZ5A 5U4NA 5I3HA 3QQ1A 3GIYA 3CPRA 3W87A 2AAMA 4M7SA 2GVLA 3C2RA 4LS0A 2VEIA 4O0ZA 1F6PA 3CTLA 4LVGA 1JQVA 1F76A 3L0KA 4PEKA 5HUPA 1SSDA 2JBMA 3QH2A 3EXRA 3HB9A 1VPXA 2YFOA 1ZAIA 1CW2A 3S1VA 1P4CA 4N6FA 4JS3A 3ELFA 1LCOA 4U4MA 2JKEA 1FDYA 2CLIA 3FKKA 3W7IA 3P61A 4TR9A 5TQLA 1QOPA 4ORMA 4O12A 3GYEA 4IWWA 2W6RA 3R8RA 3IIVA 3TSBA 4BWLA 4EF8A 4CCDA 3NQVA 1KBIA 2WNNA 3M5YA 5D38A 3WJXA 4KFPA 1VJIA 3PB2A 4JY8A 4O18A 1QWGA 3HPZA 3L21A 3G0SA 2P0OA 4XUGA 3W3OA 2A1YA 4JGDA 5D04C 1K8XA 3S8HA 2OJPA 5FEXA 1TJPA 3MYOA 3TQ0A 5G2WA 2TRSA 4LUIA 2Y7GA 2Y85A 1OYAA 4JIPA 4JTHA 3LI0A 1EA0A 2ZRYA 3W7KA 4JYDA 2YX0A 1FCBA 4IUOA 1TCDA 1YXDA 3IRDA 2JGYA 3UWQA 2CLHA 3BG9A 2DORA 3YPIA 1B9BA 3NM3A 3OVQA 3O07A 4XTIA 5D37A 1W8SA 5GVJA 3C4UA 1IIGA 3QPYA 3BV4A 1GYNA 1VYSX 3MHGA 4K7YA 4ADUA 1JCXA 3W1LA 1GEQA 3WJZA 4M6VA 1S3HA 2WNZA 3NPWA 3O15A 4OBTA 5IM51 3MYPA 2E6YA 3TR2A 4EF9A 4D2JA 1PHWA 2WJZA 3STGA 3VE7A 4PC8A 4X22A 3USBA 2WSRA 3NQ8A 3IIXA 3NGJA 3NQEA 2R14A 2CU0A 4CCCA 4BF9A 1RPXA 4HPXA 4FNQA 1KFBA 2ISVA 5KZEA 1JULA 3W7LA 1H1ZA 2B7OA 5EBUA 4P2VA 2Z2UA 3UXDA 3O6DA 5HR6A 1P5BA 5ABTA 4K37A 5AC7A 1EP2A 3MJYA 4AHPA 2JK2A 1ICQA 2DZSA 4MVAA 4LW7A 2ZRVA 2X30A 3FFSA 4EWND 2P1FA 1EUAA 1GG0A 3JS3A 3G1DA 1WOBA 4JIQA 5HJLA 4QQ3A 1QNVA 4FX7A 4HN4A 3GXTA 3QEZA 3W74A 5KZMA 4JY9A 1X7FA 3OVRA 2H6RA 1Z42A 4A29A 3FYOA 5BMXA 3W2JA 1VHNA 2NWRA 1H7RA 4JD4A 2QKFA 1Q45A 3GXNA 3NXFA 3IVUA 4GWEA 1TPEA 3QSTA 4U28A 1L6YA 5LGXA 4WQ6A 5D03A 1PV8A 4IOTA 3A5VA 1XBZA 1H7PA 2EKCA 5F1UA 1XXXA 3KAOA 4BI5A 4DEFA 3CQ0A 4NZFA 1F5ZA 4GUIA 3SECA 2V5LA 5G4WA 4A21A 3JR2A 3W7GA 3GR7A 4O14A 3NOEA 4OQVA 4O0KA 3SGZA 3P5ZA 1SZNA 2ZZ5A 2GOUA 3L65A 2C14A 1T96A 2C18A 4LNYA 4CCEA 1TTQA 2GQ8A 5CKSA 2QAPA 3FOKA 3L66A 3BARA 3CT7A 2Z6JA 3D0CA 5DCBA 2Y7FA 1I4NA 2FB3A 2NX3A 2B7NA 5TIMA 2GPTA 5CGQA 4IMEA 5EPDA 1KLZA 8TIMA 1YTDA 2DJXA 2EAWA 2A2IA 4GXMA 4I7VA 1DL3A 3VNDA 2E09A 3UQNA 4O50A 4O57A 1O94A 1SSGA 3DHDA 2NXIA 3S5YA 1KFEA 3SGUA 1FWRA 2C15A 4WXZA 5BW6A 4IJBA 1G4SA 4A22A 3CEPA 4J9JA 4XQ6A 3KVMA 3C6CA 2ZZ4A 3M41A 4O1BA 1L6SA 3L2IA 3LCIA 3MI6A 2ZYFA 3UPBA 3MW7A 1QPOA 1IXQA 4IXHA 3T40A 3LXBA 2H8ZA 3P60A 1YXCA 1KM5A 1O95A 2ZFAA 3BLFA 3L68A 2PRLA 4UTTC 4WY0B 5K9CA 3MBFA 1ZY9A 2QCDA 5G2IA 3LOTA 1G4TA 1KM6A 1XI3A 2VFDA 3G22A 5KMYA 3G1YA 3LXAA 4BI7A 3HG4A 3L5LA 5CSSA 3S1XA 5G5IA 4ADTA 3MP3A 1Q6OA 1ZENA 1R2TA 2Y7DA 4YWIA 3CIXA 4Y9AA 4IX0A 3TFXA 3LCXA 2RHGA 4K38A 3FYPA 5KSWA 1JUEA 3HJZA 3KVKA 4OU1A 1N7KA 4HSNA 3KVLA 2C0AA 4GC4A 3I7QA 1QAPA 5LNRA 1LRNA 3TCEA 2WO5A 3M9YA 1P0NA 5EL1A 3DI1A 3TUUA 4FO4A 3QMTA 1L2UA 3TFCA 2R94A 1ZALA 2QR6A 3LGEA 2NUXA 1SPQA 1XBXA 3C2FA 3PSVA 1W1ZA 3TXZA 4YL2A 3W84A 5H2ZA 1SZFA 2QCHA 5AOUA 3NQ7A 3UWVA 4JTFA 1P1XA 2QCFA 3FS2A 3UD6A 2XN2A 4UNLA 4GUJA 1C8VA 4S2BA 4W9TA 4OWGA 5D05A 4XBKA 1NAL1 4N9CA 4HHPA 3W1AA 3U2OA 4GE8A 1OJXA 4ZMGA 2BXVA 2NUYA 3DHFA 3DZ1A 3EKZA 2RDUA 2YPIA 4MY8A 5BOOA 1W3NA 1KFJA 1BWLA 2J9YA 1LBLA 3I65A 4O16A 4OV4A 3DAQA 3E49A 3NQ6A 4JN6A 3IGSA 1YPFA 4MJMA 2CLKA 1RD5A 4Z1AA 1OABA 2G97A 3R5EA 4HNTA 5D2VA 4RLIA 3O63A 1IF2A 3DGRA 5LHEA 1GVFA 3OA3A 1W0MA 2Y6ZA 3GAKA 1ICPA 2E6DA 1LZOA 1XCFA 3M44A 3DKJA 1OYCA 1WV2A 4FIRA 2W0UA 3KVJA 1PCKA 3LHZA 5AYYA 3N19B 3HG2A 1LORA 2PC4A 2VFHA 3PUOA 3L5AA 4K7VA 4LVBA 4KFOA 1TV7A 3M0ZA 4E0CA 2BX7A 3NQCA 2CZDA 3TSMA 3GDMA 4UTKA 4NQ1A 4AVFA 3DFOA 1I2QA 1R47A 5BRBA 2I1OA 1OK6A 2VEMA 3NA8A 3Q37A 4JX6A 3W1UA 1H63A 4FXRA 4O4VA 1FUYA 1NEYA 2ZQ0A 1TMHA 3EX3A 3W1QA 1ZNNA 2V2CA 5F4XA 3W7EA 3LCWA 4Z1BA 1K8ZA 1IXNA 4NUWA 5F2LA 1TRDA 2V8ZA 2HMCA 3IIPA 5AN7A 1PIIA 4LVDA 2VELA 1RQEA 3GR8A 5F2IA 4ICNA 4Z0SA 4G1KA 5G1TA 1Q6QA 1EP1A 5K9XA 1OG0A 1B3OA 3NZRA 4Z0JA 3M5ZA 1OFRA 2GJNA 2NX1A 1SQ7A 1FWTA 1ADOA 1XFBA 1TYGA 1RQBA 4FB7A 4DO4A 2HTMA 1TRIA 1EEPA 4QNWA 2QCMA 3W7NA 4WD0A 5T26A 1EX5A 4IX2A 3PM6A 3O8AA 4WXYA 1FY6A 1EPXA 1SZGA 1HL2A 3WJSA 2HS8A 3MP5A 4GUHA 3KRSA 4JTUA 1QPQA 4K36A 1OFDA 3AJXA 3W71A 3QFEA 2V0TA 1CX9A 4UXDA 3LERA 1G7UA 3W2KA 1VS1A 3BPWA 4MZYA 3OBKA 4LC8A 3LV6A 3TDFA 3UWWA 3PBVA 5C55A 2OCZA 2PCQA 1I2PA 4FNTA 2WV8A 4LRTA 3NQAA 5FF4A 3AO0A 1WX0A 2AQWA 1TPDA 3SFKA 1ZCOA 4E38A 3L9CA 4UR7A 5LNVA 2EPHA 1ME7A 2QCGA 1SO6A 1LDCA 3V75A 3H55A 5K9DA 2ALDA 2CWNA 2VXNA 2B4GA 4MLJA 4AB4A 5F2GA 2GUUA 4DF0A 3GDKA 3EKLA 3MHFA 4N4QA 4MUZA 4IQLA 3TKFA 4MY1A 4CNNA 3P81A 2QUTA 3FIGA 2X1SA 4M19A 4ZL1A 1GWJA 1VH7A 1HO4A 6ALDA 2G96A 5HNRA 1T8XA 4WUIA 2BSLA 4NNBA 1K8YA 4N2YA 5IBXC 3W1NA 3C2OA 1UUOA 2DZTA 3G24A 5A5WA 3L0NA 1ZAJA 2NV2A 3B4UA 3EWZA 5C54A 3HIJA 3BK0A 4UTIA 3DFPA 3KXQA 5I3IA 3LM7A 4AF0A 2A4AA 1TIMA 4LT9A 2HS6A 3TNOA 3O6CA 4UUIA 2E68A 3V1PA 1DQWA 2O7SA 3F1QA 4AWUA 4JDBA 3ATYA 3C8FA 1GG1A 4TMCA 3C2EA 2AGKA 5SWUA 3STCA 4WY0A 3CB8A 1ICSA 3UZ5A 3E9AA 5LZLA 4XKYB 3BW3A 2R8WA 3ABOA 3NO5A 3OEXA 2E6AA 3W7JA 1H50A 2TPSA 2C16A 2Y89A 3QSRA 3GKAA 5LKYA 3FJLA 2V5BA 2G95A 3HPXA 1H7WA 2R91A 3TW7A 1FX6A 3N14A 4FNUA 1SW0A 1Q6LA 1ZAHA 2ZDRA 4DPPA 1AL8A 3P74A 5DY2A 1QMLA 3W72A 3N2XA 5EA9A 1HUVA 2NV1A 3S5ZA 2Y70A 3NEVA 5CZJA 1F05A 4ORIA 3B8DA 2WQPA 4LVFA 5DCDA 1XC4A 1I8JA 4ONVA 3KRUA 3GVGA 5FEZA 1OF6A 1NF7A 1VLIA 1S5VA 1U83A 5CSRA 2ABBA 1H62A 3EEGA 4KKXA 3TH6A 3A23A 3CLMA 3BG5A 2QEZA 5I3FA 3CWOX 3HGSA 1KFCA 2E5CA 2ZRXA 5BMWA 4AWTA 1K02A 4JNMA 3E12A 1WA3A 5MHBA 1GVRA 4MYXA 5CZTA 3QW3A 4OHQA 3W76A 1KM1A 3RFAA 4MLRA 2C19A 5C5YA 1GVOA 3KHJA 4Q32A 2QCCA 4WY0F 2VOMA 3A9IA 4MJZA 1R2RA 3ZWSA 2Z1BA 2YZRA 4B5NA 1J4EA 1SR9A 1THFD 1W5QA 5HMSA 1S5TA 2JGQA 4IMFA 3OIXA 3LBCA 5J5RA 1W54A 1KV8A 2J9XA 1EWEA 4QM1A 2RH9A 1C9DA 1YLVA 3HO8A 4PH6A 3S5NA 3O06A 3BLIA 1JVNA 3GXPA 4RKAA 2CLMA 3DH7A 1FXPA 2CZ5A 4RZ6A 3TV8A 4PODA 3E96A 2FPVA 4P61A 5F4WA 3LLDA 1UBSA 4O17A 5AFDA 1PS9A 3IVTA 4NXSA 5K3VA 4BWLC 4M5PA 3W1RA 3LB0A 1JRCA 3T44A 2ISSA 2Q3RA 5FEPA 3EWBX 1W3TA 4TIMA 4NNCA 2A7RA 1TTPA 1EWDA 1U5JA 3I6RA 2I14A 2YSWA 1G4EA 3Q2DA 3G1XA 3NNTA 1L6WA 5K7JA 3T4CA 1QOQA 3GDTA 3PBWA 1DBTA 1LLZA 1W5MA 2E1DA 1AG1O 5K4XA 3EX6A 1UUMA 1GQNA 2YGYA 1S5WA 3PSWA 4PTNA 3W2LA 2RDWA 5F2MA 5KZDA 2GJLA 2FTPA 1KTBA 4HNUA 4E2BA 3SW6A 2A85A 3W7QA 1AW5A 1QPNA 3S6DA 3RK8A 4FX6M 5HR7A 3LXCA 4QIUA 4R53A 5D2XA 5EYWA 2LLEA 3W1MA 1W56A 3PBYA 3I68A 2OZ0A 3NAVA 3EXSA 1P0KA 3B0UX 2Y61A 3P5YA 1V7YA 3WK1A 1OFEA 3ABSA 1G6CA 3Q94A 1VCVA 1DJQA 2JKAA 5E0KA 1GZGA 2TSYA 3NPVA 4Y90A 4TO8A 4NJGA 4BFAA 3W2MA 2NXHA 1QCWA 1SO3A 2RDTA 3EWXA 2VFIA 3I7SA 1ML1A 3OHIA 3ZWTA 1ONRA 4AF0B 1WOAA 4UMCA 1XUUA 1KTCA 3QMRA 5AC8A 3LV5A 5HWMA 3RNDA 5FF7A 5HWJA 5KTLA 3OVPA 2PRHA 2WOQA 3TU9A 1ALDA 4XTDA 1A5SA 2DU2A 3UZJA 4PFMA 4HT3A 1PL9A 3TIMA 4UFJA 3GX9A 5DN1A 1G7VA 3S42A 4LS1A 1UJPA 2VC6A 4IXXA 2V2HA 3DXIA 4WJEA 1N55A 4K8HA 3P62A 3HPSA 3DI0A 3PULA 4XBSA 1A53A 3VE9A 1AW2A 4LV4A 1N8FA 1JCLA 3CU2A 3O6YX 3UWUA 3LCHA 3NPUA 2ZCGA 3N2MA 1GTHA 2A7PA 1XM3A 4UTUA 5L6UA 1NSJA 4WOZA 1MXSA 3SY5A 4GRSA 5U7SA 1LP6A 2E5DA 4O52A 4DBEA 3W2NA 2EHHA 4JX5A 4FF7A 1SUXA 5D33A 3S0CA 4UTWA 2VENA 2E5BA 5BNKA 4Z1DA 4IMGA 3ANYA 5FF3A 2DJLA 3NDOA 1OK4A 4LRSA 1QO5A 3QPZA 3N9SA 1SO5A 3STEA 1W5NA 2QDHA 3CC1A 3TXVA 3UY8A 1R2SA 4LC6A 1NFBA 4WX2A 1I45A 2QCNA 4ZQOA 2CLLA 1A5BA 3FKRA 1KFKA 4ALDA 4JXCA 3VKJA 1RZMA 3R12A 4NX5A 3MI3A 5D2WA 2ZZ2A 4GUFA 3TE9A 3KOFA 2NX9A 4FEZA 1DHPA 3MBDA 3FJ6A 4NT0A 4XKYA 4UR8A 4GBUA 1JRBA 2D73A 3WFAA 4MZ1A 3PG9A 3PBUA 4O13A 1H60A 4O1DA 5D2YA 3B03A 1PHQA 4LVAA 7TIMA 3DFNA 2BZNA 2B7PA 3UPWA 1M6JA 3SZ8A 1KA9F 3S9YA 1W5OA 1B57A 5LHFA 4JYEA 3MP4A 1CI1A 4UC5A 4R33A 4UFMA 4KWVA 4NZJA 3A22A 1EP3A 3NG3A 1QFEA 2H3DA 2VEKA 3HGRA 4FIQA 4X2RA 3TW6A 4FNRA 2OT0A 2J24A 1DQXA 4NJKA 4ZQCA 3T55A 4O4WA 3L67A 3SIZA 3TROA 1TPVA 1EUNA 3THAA 2YCEA 4GNJA 4L4MA 1VGAA 1H7OA 5DXXA 1TPFA 4UFIA 1MSSA 3E02A 2CZEA 1ME9A 3WK3A 5LNUA 2A6LA 3G1AA 5LNSA 3IEBA 2B7QA 4UFLA 4MKNA 4OV9A 4UTJA 3F4WA 2VEPA 1PE1A 5DELA 3EWWA 3L5MA 4QNEA 1K7XA 3HMJG 5D09A 2O7QA 4X3ZA 2WSQA 5CPNA 1KM3A 1MEWA 3IIZA 2KZHA 3M47A 4DF1A 3VI2A 2BLEA 1OHLA 1F73A 3ZFHA 1D3HA 3NL5A 5G1YA 2NUWA 1FCUA 3BVJA 1YYAA 4QISA 3LCFA 1KBJA 1A50A 4N9BA 1G69A 3B04A 4HPJA 4MZ8A 1KW1A 1TB3A 3SJ3A 4H3DA 1IIHA 5L9FA 5AHIA 1GYLA 3TJLA 1WDWA 4O15A 1QR7A 4TX9A 2BWGA 5FF0A 1Q6RA 4CNPA 2C13A 3FA5A 4HNNA 2W79A 3GLCA 3LRMA 1O5XA 1YDOA 5EY5A 5H91A 3WK2A 1C29A 4XWUA 4RK8A 3S1UA 2ZZ1A 3DKLA 3P7YA 1TPH1 2X2GA 3TAOA 1SZEA 1TREA 1WBHA 1Z41A 2ZA1A 1RVGA 3EX4A 2PRMA 3U6WA 5I3GA 3QZEA 2FPTA 1LBMA 3LX9A 4NJIA 2X1UA 3UWYA 1FBAA 1OX4B 3PY2A 3C0JA 5AHEA 1O4UA 2Z6IA 3MI2A 4L4LA 4CQ9A 1SFJA 5AHFA 2Q8LA 5CZ0A 4WOQA 2WSYA 3CM4A 3TX9A 1WYIA 4ZQMA 3NQMA 3P8JA 3QMSA 3R2GA 1X8FA 3PF3A 4N02A 3C61A 4UCGA 4BI6A 2C6QA 4TMBA 2H90A 2J9ZA 3HF3A 3S1WA 2GQAA 4R7JA 4JR5A 3CWNA 3LDVA 5D2TA 2ZRWA 4LTSA 4HNVA 1FCQA 3G0UA 3M5VA 3LBMA 3G8EA 4IMDA 3W07A 3RF9A 3W22A 3LTYA 5E1QA 1X1OA 4HKPA 4K6AA 1NVMA 3O05A 3BGGA 1D3GA 1R30A 3PUEA 4AAJA 3LRLA 1LTDA 2B0MA 4JYFA 3O16A 3ZR4A 1FQ0A 1LLWA 3DBPA 2ZA3A 3B05A 2EGZA 4UNKA 4JTJA 2VFGA 3W1PA 3EWUA 1LRQA 3K30A 3WJWA 1KLYA 1O60A 3WJYA 1GVSA 3T7VA 3G1FA 5CZSA 1MEIA 1VLWA 4UFHA 2DZWA 3GDLA 2P10A 3PR2A 4PL2A 3PB0A 3CIWA 4EOUA 3FLUA 5K2ZA 4LY8A 3A24A 3PS7A 4DF2A 1E51A 3SI9A 1YTKA 1QO2A 2DZPA 3NQFA 1XBYA 1A5AA 3P82A 5HQEA 4FX8A 2QF7A 3TMLA 4H4IA 3C52A 5HULA 2NZLA 3G1VA 4JTGA 3ABQA 4A2RA 1M7OA 2V82A 3CEUA 3W86A 4YMZA 4A2SA 4YXGA 3TJXA 1JJKA 1LRTA 3UNDA 1RR2A 4UTHA 3C3NA 4I7WA 4GFSA 5AHNA 1TPB1 1RV8A 1NF0A 1K3UA 1OX6A 1UCWA 3PUDA 4BK9A 5FF2A 5CPMA 4NNAA 1F7BA 4GUGA 1BKSA 2A6NA 4N6EA 3GZ3A 4IPIA 3HQ1A 1JCMP 3LI1A 4YLWA 3PC0A 3W7MA 4JTSA 1Z44A 3W83A 1DORA 1W31A 5AB3A 4QAIA 1T99A 1OFOA 1H7NA 1OFQA 3HOJA 4RXFA 5CG7A 2ATSA 3TAKA 1KV5A 3EX2A 1KM4A 3MUXA 2V2DA 1XUZA 1TTIA 4IMCA 1KM0A 5DLCA 2CLEA 2DZXA 1TTJA 4ADSA 3M16A 4N9EA 5TBOA 1LOSA 3INPA 2XN0A 3HGOA 4NX0A 1Q3NA 1SU5A 4O1AA 3TA6A 3G0XA 4LU0A 1VZWA 1VRDA 4RCXA 1GT8A 5AYXA 2YXGA 3KFTA 5DCEA 4O11A 3G1HA 3W73A 3TQVA 4AHOA 1XDLA 3W2UA 1XDMA 1K7EA 3LRKA 3MO7A 3B06A 4FNSA 5AYZA 2ZTJA 3QRHA 1JUBA 4RZ4A 3CHVA 3GKFA 2FLIA 3NVTA 3IGUA 2YW3A 1LROA 3N3MA 4QITA 3LLFA 2J88A 3HG5A 1VR6A 3IVSA 2NXGA 2ABAA 4UFKA 4ZVJA 2V9DA 3DENA 2F84A 1TPC1 4TU1A 3PG8A 1FWWA 4M6PA 1TJRA 1TQXA 1YDNA 4M6QA 5DY3A 4UTTA 5DBUA 2TMDA 3R89A 5DBTA 2E6FA 1YXYA 3GDRA 3P80A 6TIMA 3QF0A 2IQTA 5F4SA 4IPJA 1G4PA 2I9EA 2OMAA 3WK0A 1TPWA 1TSIA 1KFLA 4LWWA 4RX0A 3B0VC 1DKWA 4NJJA 1GTEA 4UMBA 3RLUA 4MOZA 1QPRA 4CNOA 3G8RA 1AW1A 3RMJA 1L9WA 3M6YA 1JR1A 3HGJA 1OFPA 3MMTA 1UASA 1X6UA 4A3UA 3W7OA 3LHUA 4C1KA 3W70A 1KTNA 4K39A 2A7NA 4JICA 2QCEA 3GNNA 2ISWA 3KRZA 3G18A 2EF9A 1JUKA 4N4PA 4JTKA 4DQWA 1FWSA 5HWNA 3TMQA 4S2CA 3PVFA 3NM1A 3UWZA 2FDSA 3P8IA 3GAYA 5HINA 3PAJA 2C3ZA 5J5DA 2FFCA 1VQTA 3A5FA 3QM3A 4JTIA 3EWYA 4AEOA 1O5KA 3QYQA 3SR7A 5I3KA 4YCPA 4RXGA 3TK7A 4RV8A 2QUUA 2OX1A 4O10A 4O54A 2Q8ZA 3F4NA 4LS2A 3P67A 3P84A 3KX6A 1JCYA 4LUJA 4ZQPA 1XL9A 1MO0A 1VYPX 2QUVA 2Z0IA 3LTSA 1FDJA 3TC6A 4BR1A 3W7DA 1G67A 2WPBA 3G1SA 4LV9A 4OGZA 2YYUA 1X1ZA 5KINA 1OX4A 4DPQA 1IGSA 3RU6A 4CLMA 3NL2A 5EKYA 3RLVA 3FEMA 2QJGA 4ZQRA 1H7XA 2X1TA 2J6XA 2XN1A 3F03K 1VCGA 3BW4A 1K7FA 4XZ9A 1SO4A 2FIQA 2VFEA 3LTPA 2G5WA 1OF8A 1GVQA 2NLIA 3N34A 5FI8A 3STFA 1JCJA 2NWSA 2HSAA 2RFGA 3NYZA 3NQGA 5I3JA 3I7RA 4IGHA 4UIOA 4MIMA 2ZBTA 3VCRA 1VHCA 3UYCA 3C2VA 1HTIA 1LBFA 4WZHA 3DFSA 4QJ1A 4POCA 4UTMA 3NZ1A 1B4KA 3O1NA 4UMAA 4Z08A 5K4ZA 3DU0A 2YDAA 4CQAA 2ZA2A 3L0GA 1WAUA 1W3IA 2YYTA 4NU7A 3QQ0A 4Y8FA 1HO1A 1FXQA 4DO6A 4O53A 5HUOA 4YCOA 3LCGA 3THQA 4X9SA 3IGXA 4Y96A 3N9RA 1H5YA 4E2DA 3EB2A 1TQJA 3W6YA 2FQIA 5LNWA 2H8XA 3NQ2A 1A5CA 1J5TA 1GPWA 2A21A 2QJIA 4FNPA 4MYAA 2QJHA 4M7TA 5D02A 1OVDA 2GVGA 4GJ1A 3E0IA 3H53A 1YDVA 1VC4A 3ZS4A 5KITA 1RQHA 2XFWA 1AL7A 4JTLA 2GVJA 1TO3A 1AMKA 2QAFA 4DXVA 4JTEA 5D30A 3U8GA 1TV8A 3T78A 2F7FA 1DV7A 3M7WA 1MEHA 1VCFA 3B0PA 2QCLA 1W5PA 4HSOA 3W85A 1XKYA 2YFNA 5DXYA 4DBDA 2PE4A 4MFDA 4O8RA 4Q33A 4H6KA 4PCFA 2CFFA 3GB6A 1D9EA 1KM2A 2CZFA 3TQKA 5LGZA 2X1RA 3W1XA 2E77A 4OT7A 1ZFJA 2PURA 2VFFA 3EXTA 1Z48A 1WQ5A 1YPIA 3MHUA 3W75A 4HIBA 2X16A 1BTMA 2ZRZA 1T0OA 4FHAA 4Y6GA 2BTMA 1SW7A 1MZHA 4O1CA 2WNQA 4ZZ9A 3LHTA 4DO5A 5A8GA 4MFEA 3N73A 3SSJA 2UV8G 1GJPA 4RR4A 1ZJIA 2DZVA 1SW3A 2GQ9A 4QSHA 3W7CA 1BEUA 2Y7EA 4ZQNA 4AH7A 3LCLA 2ZZ7A 2VKZG 1K03A 3IV3A 1JCNA 2FPYA 1QDSA 1W37A 4OE7A 4I9AA 5AHMA 2OT1A 1GOXA 3BLEA 1I2RA 1IXOA 4UTLA 4PA8A 4AXKA 5CPOA 1HG3A 3H54A 1FCVA 1I2NA 3BGJA 3PWAA 4AHQA 1LOLA 1OYBA 2ZRUA 3A21A 3ATZA 4JX4A 2A0NA 3G3DA 4MPQA 4O19A 2QDGA 3OG3A 1VYRA 4AWSA 4R34A 4UTWC 2CW6A 5C2XA 1I2OA 5IBXA 4AMAA 3NR0A 3BW2A 3HBLA 1EB3A 2CLOA 3DFTA 2TYSA 1JQXA 3UXAA 4DELA 1LOQA 3NQDA 5D32A 4RJEA 3W1TA 1DVJA 5G4EA 4NVTA 1PCWA 1TV5A 4JTTA 5AC6A 1M7PA 1EIXA 2JKPA 2Y88A 1F74A
chains in the Genus database with same CATH superfamily
2J7DA 4O28A 3AUJA 1BWKA 3IARA 4MNKA 1PVNA 4PTWA 1EPVA 4HPGA 2ZADA 2ZTKA 4FSAA 1XG3A 2OELA 2C1HA 4ZFCA 2BVDA 3JRKA 3LHWA 3LZ5A 4MDOA 3M43A 3W9ZA 1ZHAA 4P8UA 4CVWA 2V81A 3DFQA 2RGLA 2WCSA 3M7SA 1I75A 1IWBA 4J2PA 3A64A 2BHZA 1OFBA 5DX7A 3LHVA 2QGYA 1V5XA 1TX2A 2ZX9A 1K8CA 5FJIA 1D8WA 4I7UA 1DIKA 1XC6A 3TSDA 2QIWA 4FXSA 4ZO7A 4XIAA 5C6MA 1ZSXA 2V30A 4PYSA 1IR1A 3W88A 4MNMA 1HL9A 4V33A 4PL1A 1WZLA 5E93A 1R46A 4L4OA 3LHYA 3NL3A 4K8EA 1B4EA 4C1LA 4HHHA 2QCDB 1YQ2A 1F4AA 4M81A 4DRSA 4C6PA 4JHMA 1D8CA 5HATA 3FA3A 2NQ5A 3K1GA 7ENLA 5G4HC 3W7HA 2XSAA 3VOGA 4AZHA 3N9KA 4JEQA 2ZOXA 3AIRA 3QQ1A 3QZAA 2PF0A 1Y65A 1FWDC 4PZVA 3DFHA 2ANUA 2IS7A 2Q01A 2GVLA 4PEEA 3C2RA 4LS0A 3VMPA 1PBGA 3CTLA 4LVGA 2JBMA 3EXRA 4ACZA 4F2BA 2CESA 3MKVA 2Y8UA 1PKYA 4FOJA 1VF8A 4CN1A 1E5JA 2G4JA 4TX8A 3MSGA 3GBEA 1LCOA 1FDYA 2P5NA 3FKKA 3GXDA 1U22A 3W7IA 3P61A 1PWLA 4O12A 4HA3A 1R85A 2VDIA 2P50A 2R1KA 4O1EA 3ZJKA 4AZBA 3R8RA 1S3TC 2WNNA 3DOPA 3E1F1 2XH7A 2O9RA 2EJ1A 1VJIA 3OQ8A 3RM4A 3QFWA 4O18A 4KETA 4X63A 4KWOA 2DUZA 2P0OA 3PTMA 1UMLA 1FHDA 2A1YA 3TYZA 3GH5A 4JGDA 1K8XA 2DVXA 3SRDA 5FEXA 1TJPA 2CBIA 2FMNA 5G2WA 4JBRA 2Y7GA 3L23A 4YPJA 1X6LA 3LI0A 2WJDA 5FACA 1JYVA 1FCBA 4IUOA 5C7HA 4PTXA 3KLLA 3AQUA 2JGYA 3T81A 4EPBC 4HMCA 2DORA 3WDIA 4US5A 2CCRA 1B9BA 3NM3A 3FVMA 3MY9A 3EGJA 1IIGA 1GOOA 3CMFA 5EGRA 1S39A 5CH9A 4K7YA 4HD5A 3WJZA 4M6VA 2WNZA 3O15A 4W85A 4OBTA 5IM51 3BCJA 3LSCA 3MA8A 1PHWA 3STGA 3VE7A 3CASA 4AZCB 4Z2IA 3NQ8A 5EMYA 1OIMA 3OW1A 3A6OA 4NKCA 3KOYA 4BF9A 5CXPA 4JEJA 2GJXA 1KFBA 5A1AA 4D8LA 4YN5A 2XVPA 3GRIA 3O6DA 1H09A 4B2DA 4K37A 4J27A 5AC7A 1EP2A 1H49A 2DZSA 1GOWA 3WKZA 5AY7A 2X30A 1EO7A 1UKTA 3E3HA 4QQ3A 4QRNA 4FX7A 3W74A 5M03A 5BMXA 3W2JA 3EOUA 3LD5A 2D0FA 4JD4A 4HOZA 3GXNA 2CBUA 4H9ZA 4OZOA 4ATWA 2HE8A 3QSTA 5LGXA 1XQKA 5LIWX 1E5NA 1XBZA 2BS9A 4REQA 5F1UA 2BDQA 1H0IA 3AFBA 2HNHA 4DEFA 1Q85A 3UA3A 4RNIA 1F5ZA 4GUIA 3SECA 3VD7A 3JR2A 1V77A 1X97A 4QG8A 1NQ6A 5HJXA 3SGZA 3P5ZA 3VGDA 1MQQA 3L65A 1T96A 4M24A 1ESWA 2XUCA 1XRTA 3GUGA 3GW3A 2KX9A 3FOKA 3CT7A 3PZUA 3ZMRA 2WHLA 3VK5A 2Z6JA 1ECQA 2WZIA 1GVIA 1QHZA 2J7HA 4LF2A 5TIMA 4JIIX 4MB1A 4IG2B 8TIMA 4J3WA 1JPMA 3ENLA 2XM1A 2A2IA 4GXMA 3L4TA 3UQNA 4XUYA 3WH5A 1PX8A 2I57A 1RA5A 3DHDA 2C15A 3KS5A 5BW6A 4A3HA 3KUMA 1AJZA 3KVMA 1J0KA 1E71M 4QCEA 4W8AA 3KOZA 3LCIA 4LALA 1UZDA 2HBXA 3RUBL 3GHTA 3KTCA 2IPGA 1QI2A 5DRCA 4GI9A 3GWQA 3LXBA 3N2CA 4R7WA 5FKYA 4UTTC 3WLKX 5K9CA 1ZY9A 2QCDA 3MBFA 1V3LA 2BBFA 3L5LA 2J62A 4S3EA 2QUNA 1ZENA 1W17A 2Y7DA 4YWIA 4D1JA 4K38A 3FYPA 1A3WA 3ZT7A 3HJZA 1N7KA 1OGSA 1QAPA 3TCEA 4BS0A 2WO5A 3QV7A 1V51A 1PAMA 3VKBA 3CMGA 3WBEA 1US2A 1KR1A 2DT2A 3TUUA 4FO4A 1EHNA 1P48A 2PWHA 3QMTA 3MCNA 2WNWA 4GZJA 1EQCA 4RE4A 1Q6GA 1ZALA 1HJWA 1W9VA 4WF7A 1E56A 5FJOA 4GABA 3FW6A 1W1ZA 1ZBWA 3W84A 5H2ZA 1SZFA 3MMUA 1TUFA 3NQ7A 4F40A 3HURA 3UWVA 3LNMA 4Q4MA 1P1XA 4F2UA 2QCFA 3HU7A 2HDJA 4JKMA 1JD9A 3UD6A 2XN2A 4UNLA 2ACRA 4W9TA 3SQMA 3AXMA 3OLDA 4HU4A 1GZ1A 3BL3A 5BXPA 3COTA 3EB4A 3DHFA 2YBVA 4YU1A 3DZ1A 3GXIA 5BOOA 3SQSA 1KWGA 1KD0A 2PI6A 3WDQA 2PDQA 3ZT5A 3NQ6A 5B80A 1NWSA 4Q4OA 2QPSA 3VIKA 1IF2A 3RM9A 5LHEA 1GVFA 1W0MA 3GAKA 1ICPA 3ARZA 3N15A 2QW5A 1YEYA 4IP5A 4RL3A 3RO6A 1XDJA 3FHQA 5G1MA 2OPJA 3W25A 2Z1SA 4NASA 5AYYA 2PC4A 4K7VA 3L5AA 4E0CA 4J3TA 2BX7A 4DUOA 3VPLA 3TSMA 2W67A 3GDMA 4NQ1A 1I2QA 1R47A 5BRBA 2BASA 4OOUA 3Q37A 4JX6A 4S3GA 1H63A 1V3HA 4O4VA 1OC7A 1RCOB 3E5BA 1CXIA 4WKAA 3CXOA 5F4XA 3W7EA 3AS3A 4R9XA 1E6SM 4JL1A 4JKLA 4NYUA 1J10A 2FZDA 1B9ZA 3VCCA 1KRCC 4Z0SA 4G1KA 1Q6QA 4TV6A 1ZB5A 3U2ZA 5K9XA 1OG0A 1JGIA 5AC5A 1M41A 3C8NA 4XG1A 3NZRA 4Z0JA 1E4LA 2GJNA 3W29A 4E5TA 1M9HA 1ADOA 1XFBA 3KL0A 1RQBA 2J7GA 4YVPA 1W9XA 1TRIA 4D6FA 4DJDC 1FY6A 2C1GA 2E1WA 1SZGA 3TW9A 1ITXA 1HL2A 3WJSA 1XYMA 2OEJA 4INFA 2J8FA 3VABA 4C6LA 3SCSA 2AGTA 3G2GA 4QROA 4LYKA 1OFDA 3QFEA 4NAEB 3RPDA 3IPWA 4H8HA 1Z6KA 2QULA 1JAKA 4MZYA 3VCNA 4LC8A 3LV6A 3RM8A 4D8AA 3UWWA 2FKPA 2PDWA 5FIPA 1TV3A 3OP2A 2PCQA 2YBUA 4U3AA 5FF4A 3SFKA 1WX0A 3M0IA 4C65A 2EPHA 4CN6A 4H7VA 4EAMA 1E0UA 1UHVA 2UY4A 4HJFA 1VPQA 4NYYA 1RBAA 4AB4A 2BVTA 4DF0A 1XIJA 3QY7A 4CNNA 3ZR5A 2QUTA 2G3IA 3N18A 4M19A 1Q7MA 1NDVA 4H2CA 4JHZA 4DXKA 1LQ0A 1T8XA 4IG2A 4UWMA 1T40A 5IBXC 2EQDA 3C2OA 3L0NA 4W8BA 3B4UA 1GKRA 2FJUB 4KBXA 4QBXA 3K8KA 3ORWA 3BK0A 4UTIA 2YXXA 1EF2A 1WKDA 4IGNA 5XIAA 2HS6A 1GONA 2INFA 4JNZA 2E68A 4FR1A 4GO8A 2O7SA 3F1QA 2Z2BA 4AWUA 4H00A 1IEQA 4JDBA 4HOWA 3C2EA 4DNMA 3L4ZA 4J5NA 5SWUA 3EOLA 1ICSA 1DXEA 1SR0A 4GI8A 5LZLA 2F2HA 3MCOA 2R8WA 3NO5A 3CLWA 1UD2A 4Q4RA 1J12A 3P0XA 1AQHA 3W7JA 3ZM8A 6PTDA 5LIYX 1CLXA 2C16A 2Y89A 4ZTYA 3ZLHA 3FJLA 1CB2A 4XZNX 3HPXA 3TW7A 1FX6A 2VX7A 1ZAHA 3CUFA 3P74A 3MO4A 3LM3A 4DNHA 2YB4A 1JXKA 3BTNA 5EA9A 3VINA 2WQPA 5DCDA 1EJWC 2D20A 4ONVA 3GVGA 1YNQA 2FH8A 1TIWA 4CNTA 2YCIX 4KKXA 3LGGA 2REQB 5TD4A 1LWIA 1RBLA 4C6EA 3E12A 2I7GA 5MHBA 1WDPA 1CXEA 3VIOA 3DBNA 5C9ZA 1LF1A 3RRAA 1E1CB 4W87A 5HQLA 3UYIA 4MLRA 3WLPA 1GVOA 4M0XA 1CZ1A 4WY0F 1CGXA 1LL6A 2EPMX 1VBJA 3SEPA 1PIGA 4KPLA 2YZRA 3M0MA 1VD6A 1THFD 1S5TA 3GHRA 3OIXA 3LBCA 3APGA 1DJIA 1W3LA 2R9RA 4QM1A 2RH9A 2YKKA 1YLVA 4ZO6A 3VUSA 3PPFA 1J0JA 1GQIA 4LF1A 2HVMA 4FOUA 3F5KA 2VURA 1W3KA 4P61A 4O17A 4MF4A 5K3VA 3W1RA 3LB0A 1UOZA 4D6JA 2Q3RA 5CZKA 3AMLA 1XLGA 4S3JA 4NNCA 3KM8A 4AZGA 1EWDA 1U5JA 1UR0A 3I6RA 2I14A 1G4EA 3NNTA 2J78A 4W86A 2X40A 4Y9NA 4PMYA 3GDTA 4AXNA 1DBTA 1BVWA 4LYRA 1XH0A 4QDWA 1W5MA 1EYWA 1CPUA 2YGYA 1GKPA 4RDZA 2FTPA 1KTBA 1WUEA 2OO0A 1IT8A 4TOQA 3RU8X 3SW6A 3W7QA 3RK8A 4U2ZA 3R1ZA 5DFAA 5HR7A 1C7SA 1J18A 3DFYA 3WX7A 2XFRA 1E40A 5I2UA 3ARVA 1L8NA 4WDWA 1V7YA 2BGQA 2JF7A 1ZS2A 2P0IA 1G6CA 4Q8VA 1DJQA 1DWIM 2DQWA 2Z1WA 4WLCA 5E0KA 4L1XA 4Y90A 4TO8A 3Q45A 3WLNA 3WMLA 4S38A 1SO3A 2RDTA 3VNMA 4NAFB 3EMCA 3NTYA 4AF0B 6ENLA 4NAEA 4IIFA 1F9CA 1MXGA 2WZHA 3OVPA 3L2MA 4H9TA 2I16A 3UZJA 4HT3A 1PL9A 1EYEA 3GX9A 4H41A 4GQRA 5D9NA 1R3VA 2ZX7A 4IXXA 3DXIA 3IRSA 4K8HA 4XBSA 3UW6A 3LPGA 1HW6A 4HHMA 3N2BA 3E74A 5AECA 1T8QA 3OO2A 3O6YX 3UWUA 1DWHM 1AVAA 1D7FA 3GFYA 1Q6DA 4UTUA 5L6UA 4LYPA 4WOZA 3T1GA 3SY5A 1WB0A 1HJVA 2W66A 4YTTA 1TWIA 3H2EA 1SM9A 4JX5A 2E5BA 2E0PA 5BNKA 2OYKA 3NOYA 3SRHA 3KBMA 5JBEA 1K77A 2QVNA 1JI1A 4HP5A 4OFCA 2WMKA 5M3WA 3C2YA 5E09A 2GDVA 3GC5A 4K3ZA 1W5NA 1UWRA 1QATA 3UY8A 1R2SA 4LC6A 1I45A 1QBAA 3EOEA 1EGZA 4BHYA 5I6SA 4HCDA 4QG6A 4HMEA 2ZZ2A 1EXBA 1W1IE 3AHTA 1OT2A 3NO1A 4GBUA 1JRBA 3N11A 1QI4A 3N12A 2NSXA 1RLDA 4AVNA 1X98A 5TF0A 1H60A 1A5NC 3S2LA 4CQDA 2XH4A 4UC5A 3H23A 4KWVA 4PMXA 3NG3A 1V02A 3AC0A 6REQB 3HGRA 4EAYA 1QASA 1YDYA 4Q8OA 4FNRA 3JZUA 4Q4PA 3L67A 3AYVA 2Y8KA 2VCBA 1TPVA 1VGAA 1H7OA 4CU7A 1MSSA 1HGYA 3PTDA 4UCFA 4NRSA 3E2SA 2A6LA 3E0WA 1VBHA 4M1RA 1K6WA 3DN5A 4JFTA 3USZA 4E8CA 2I5QA 2QGHA 4V27A 2WCAA 3AIWA 3ZJ8A 1CDGA 3OZPA 1VEOA 2O7QA 4X3ZA 2WSQA 5DRIA 3OPSA 4KW2A 1EBHA 4ERIA 2OVLA 1IIHA 3ITTA 1UZ4A 3CHFA 2HV5A 3HMCA 3KRBA 2BWGA 4DAFA 2PDIA 4C6IA 2C79A 4L1GA 2VZTA 5A8PA 3QN3A 3U7BA 3AU6A 3CYVA 4Z2HA 5JIWA 1WDSA 1A49A 1O5XA 5BOFA 2X0HA 5EY5A 5H91A 3UJEA 2HPIA 1SYTA 4GH3A 4RK8A 3P7YA 1V6XA 3TAOA 4KF1A 1TREA 2OEMA 1B2YA 1WBHA 1T6MA 1RVGA 3U6WA 5DT5A 1E9IA 3UVAA 3GU9A 4NJIA 3UWYA 1OX4B 1XICA 1VEMA 5AHEA 4IGSA 3H26A 2Z6IA 3MI2A 4GH1A 1MQRA 3W01A 1NQKA 1NDWA 5AHFA 3TX9A 1WYIA 1RALA 4MUPA 2QPXA 3K1DA 3SADA 3AIVA 1X8FA 3PF3A 3C61A 4GVGA 4P7NA 1OC6A 1M7JA 1PWMA 3UG5A 3WQ5A 2W61A 2VOTA 3CWNA 3LDVA 1P7TA 1XRFA 3NZGA 4GISA 1G5AA 3R6IA 1BF2A 3BXWA 1AMYA 3W22A 1JL8A 2CLPA 2XIMA 1NVMA 3BGGA 1K70A 1LTDA 3D3FA 4GXWA 4W4QA 1LLWA 3KOWA 3D47A 1UIOA 3GTIA 4GD0A 1L6FA 5TAOA 3CZKA 3WNKA 3EWUA 4OBSA 3WJYA 4MSSA 1PSCA 4AY7A 2CZVA 2FHFA 4QJ3B 2OB3A 2P10A 1PXGA 3TN5A 5LIXX 3CIWA 1J9YA 3FXYA 4EOUA 1JPIA 1U5VA 1F4HA 4WDXA 4E6MA 1QO2A 3GHSA 3NQFA 1XGEA 1FH9A 3QXBA 1A5AA 2WM1A 3QV6A 1YIXA 2NZLA 4JTGA 3NUKA 1BD0A 3VKDA 1C92A 2V82A 3W86A 2XWDA 4A2SA 4YXGA 3HTWA 2HJPA 3R7MA 4LUYA 4C6NA 4AD5A 2X0YA 5CJNA 3TYCA 3H4XA 1E0VA 3TYUA 4IGMA 1NELA 5FF2A 4PULA 3H8AA 1PB0A 4NNAA 4KH2A 4GUGA 3MWCA 4IJCA 2XZ7A 1ZPTA 5A95A 3HQ1A 3MUCA 4OOZA 4D1IA 3EPNA 1Z7AA 3F5JA 1Z44A 3MS8A 2VQUA 1PZ2A 1TVPA 4QAIA 1T99A 3VM7A 1OFQA 3BV7A 4XZMX 2D3NA 1R3SA 1UP3A 1KM4A 1US3A 3QHNA 4UQAA 3U4AA 1HP5A 3AUOA 1E72M 4BJHA 2O55A 3CK5A 1Q3NA 4KEVA 3AYRA 3TA6A 2O0TA 4W84A 1VZWA 4MWAD 5XIMA 4RCXA 1IT0A 2YXGA 4MADA 3KFTA 3ZVIA 5HNNA 1T7LA 4AHOA 1MRQA 4GZEA 2IUZA 4GJIA 5AYZA 1XIEA 2ICSA 2J75A 1WPCA 4QHRA 3IGUA 1J79A 1Z32X 3MV11 3H2FA 5AVHA 2CHRA 1DWFM 1VR6A 2NXGA 1FP9A 2ABAA 1I0BA 4GQBA 1BXNA 3DC0A 4B3KA 1ONWA 1O1ZA 4U33A 5FOOA 1C91A 5C7VA 1FWWA 4OTKA 4Q3MA 3MV01 4UTTA 5DBUA 2TMDA 3B8SA 3R89A 2E6FA 2WB5A 3W4RA 1UD6A 3P80A 6TIMA 2WLZA 4HMDA 4XV0A 2IQTA 5F4SA 4KRTA 1G4PA 3AIUA 1TPWA 3WBAA 1TSIA 1GPFA 2WQDA 1DKWA 4NJJA 4UMBA 2P53A 3RLUA 4F0LA 2GVEA 2FTYA 2NW0A 2RUSA 1B0IA 1S2WA 1IV8A 4L9ZA 3MMTA 3UXLA 1F3EA 1O7AA 3VGHA 1RJQA 4JOMA 3W70A 1KTNA 4K39A 4LY4A 1UG6A 1QK0A 3KRZA 3OOQA 4JTKA 3BURA 4DQWA 2NT1A 2R1NA 1W1PA 3WO8A 3P8IA 5C70A 3PAJA 2C3ZA 2FFCA 3QC0A 4PSPA 1HKJA 1OCBA 3EWYA 5I3KA 4YCPA 4RXGA 3LNPA 2XVKA 1W6TA 2GOKA 2Z00A 2XIIA 3F4NA 4A8LA 2JF6A 3KX6A 1HXJA 1MO0A 4NG3A 1G0CA 1UP0A 3KDOA 3ZSSA 3W7DA 2VHLA 1G67A 4LBUA 4EPDC 2YYUA 3ARPA 1OX4A 4DPQA 3H21A 4PGLA 1MDRA 1H7XA 2XN1A 3F03K 1VENA 1NARA 3CV2A 4XZ9A 2VR2A 2FIQA 5C8BB 2DZBA 2G5WA 3AU2A 4LH8A 5DMYA 3HN3A 1GVQA 4NY2A 2RFGA 1XYBA 1NY1A 4M1BA 4IGHA 3UCDA 4UIOA 3VCRA 1QI5A 4E3TA 3SO7A 3UYCA 4YVXA 4D6GA 2OZTA 5GNYA 4B5UA 3AXIA 3O1NA 5K4ZA 1V3MA 3K46A 2VTFA 2ZA2A 3PWGA 3PZOA 1W3IA 3QQ0A 1KB3A 1HO1A 1FXQA 3BAYA 5HUOA 3IGXA 4Y96A 3N9RA 2OWXA 4YNGA 4H6RA 2D24A 1OY0A 5LNWA 5A3HA 1W1A1 4W8LA 4B16A 2OZ8A 4CCZA 2WC3A 3NYDA 4IMAA 3VZZA 2GVGA 4GJ1A 3H53A 4QP0A 2BP1A 3A13A 5KITA 4AMCA 2WWDA 2XFWA 1AL7A 1FTXA 3WQWA 4I6KA 1TO3A 3ABZA 3IK4A 1AMKA 1CXLA 3WQCA 3WLIA 4JTEA 3S47A 3T78A 3LENA 4GINA 4JCMA 1TWSA 1W5PA 2WHKA 1FFQA 4HSOA 4QEEA 4ZO9A 2YFNA 5DXYA 4KIRA 4O8RA 4MAVA 2PUZA 3JVAA 4LCSA 3KS6A 4X0VA 2C0HA 1H2JA 2X1RA 3U57A 1R3QA 3CUIA 2GSEA 1V08A 2GK1B 1YPIA 2QS8A 3N17A 2X16A 3TA9A 3GXFA 1BTMA 2ZRZA 4FHAA 3WLJA 4RUBA 4Y6GA 4DI9A 1PUDA 5C71A 1V3KA 2V5CA 1XLEA 1LUCB 4MFEA 1BQCA 4KMQA 3N73A 2F61A 1O6IA 3HPAA 4PBFA 1SW3A 4QSHA 3SCTA 1IEIA 5HPOA 4ZQNA 2E25A 3LCLA 4XD3A 1U1JA 2V6AA 3Q4DA 3P93A 4B91A 4R9OA 1JCNA 3V0SA 3TTSA 1M65A 4JQ2A 4I9AA 5AHMA 4S23A 2J13A 1A5OC 4UTLA 4PA8A 1B30A 2DZAA 3DGBA 2VGFA 4G2DA 5CPOA 1LLOA 1NFGA 3IJDA 3BGJA 3CPUA 1US0A 3WELA 1ADDA 4EWJA 2G50A 4MPQA 3II1A 4GYFA 1VYRA 4AWSA 4UTWC 4F3HA 1GGOA 2X0SA 5IBXA 3MSRA 4F79A 4GACA 1IYXA 4DVOA 1JYWA 2VZOA 3BZGA 4ZOEA 5G4EA 1TV5A 2XHYA 2DIJA 1FKXA 5G2HA 2CLFA 4AW7A 1K4GA 1XF0A 3EBVA 3BSHA 1OFAA 2QIIA 1JDEA 4DBUA 3BMXA 4C90A 3F2DA 5AHLA 2I56A 3WF1A 2Z27A 3V4BA 3AIBA 3GK0A 4C7GA 5EMUA 4EPKA 3VFLA 4GC3A 1RVKA 3ARYA 1X8CA 5FEWA 1ME8A 4L9YA 3ITOA 4KWWA 1H1YA 3CV1A 2WKJA 2H3BA 1FWNA 1B3VA 3BG3A 5LSMA 3T0TA 1ZBCA 4BA0A 3WDHA 1FH7A 4A3QA 3WH9A 5A6AA 4NXKA 4EIVA 5LA1A 1HFBA 2J8GA 4RZBA 2RKXA 1DOSA 1UA3A 3P6LA 1M5WA 1J0IA 3TC7A 3FX4A 2Z1VA 3C56A 3HG3A 1WXJA 2Q3OA 3NL6A 3K4WA 4S1FA 4S3KA 4KFNA 2I17A 3R79A 3SGGA 1XCXA 4AIEA 1G01A 4UQBA 2ZVIA 3U3HA 3CO4A 2YW4A 1DJNA 3BWWA 3AMKA 2WMJA 3G3MA 2Y62A 1WBJA 5I79A 2FB2A 4H2HA 5E5CA 2AQOA 3QW4B 2VM8A 1W2PA 4RZ5A 3GNRA 5U4NA 5I3HA 1K4HA 2DSZA 2HCVA 3PUGA 5FAJA 3W87A 2AAMA 4M7SA 4H19A 4O0ZA 4I9JA 1DIOA 1JQVA 1F76A 2QLYA 3QV9A 4JQ4A 1SSDA 4PEKA 4LAZA 1E70M 4J4KA 5EMLA 1A3HA 2YFOA 3I6EA 4G9PA 1OQFA 1E4MM 4N6FA 2QV4A 2OSWA 2JKEA 3ARUA 1AH0A 1QOPA 4ORMA 3B8UA 3GYEA 3IIVA 3M5YA 3B0XA 4R85A 4QTGA 4ATDA 2ZXBA 4DUVA 1GOMA 1UJQA 3CHEA 3RX2A 1KNWA 2GSHA 3L21A 4B15A 2EPNA 3WEOA 4DYEA 1A5MC 4LBSA 1QW9A 2YOCA 2V69A 3IGHX 4CNUA 2OSYA 3KP1A 1JFXA 3VDAA 1XP3A 4J2MA 1EJ7L 3MYOA 3WD0A 5D9MA 4P8VA 1E6QM 2TRSA 4LUIA 4Y9MA 3SUTA 3R10A 4HPHA 4JIPA 1GZJA 2Y24A 4YS1A 5A94A 2ZRYA 4JYDA 1QNOA 1FWGC 3AS1A 3IRDA 4GKTA 3UWQA 3AS0A 4PN2A 4UR9A 3SN0A 3YPIA 4XTIA 5D37A 5GVJA 1HIZA 2FGBA 3C4UA 3QPYA 4B3ZA 4HK6A 8XIMA 1ISWA 4F66A 3PJTA 3W82A 2O56A 4CEUC 3NPWA 3KP0A 4A05A 3M64A 3QV8A 4EF9A 4D2JA 5H1WA 3UJSA 4NL1A 4X22A 1XLHA 1DTUA 2R1PA 3IIXA 1H11A 4GA8A 3WG6A 4WR3A 2W27A 2CU0A 1RPXA 4GIRA 4PRWA 4FNQA 1YHTA 5KZEA 2GVYA 3W7LA 4GLEA 4JFVA 5EBUA 4K1GA 1X96A 3UXDA 3BJSA 3UCCA 2XINA 2AAAA 4PCNA 2BVYA 3C0SA 1LUCA 2ZICA 3TONA 3PTQA 3RR1A 1ICQA 4LW7A 1PIFA 3WNMA 3NDZA 4PUNA 4FXJA 3JS3A 3G1DA 4JIQA 5HJLA 1QNVA 4HN4A 4J35A 3GXTA 4XZLX 4JY9A 3OVRA 1Z42A 1ISXA 3BMVA 1VHNA 2NWRA 4H8UA 4Y2WA 1H7RA 1Q45A 3H70A 4H9YA 3TTQA 1TPEA 3F5LA 1NOWA 4WQ6A 4IOTA 3A5VA 1NTHA 1I9CB 4JIRA 2EKCA 4KCWA 1XXXA 1QI0A 3M0JA 4BI5A 5CPTA 4JFWA 3I3EA 4NZFA 1D7KA 2DIKA 3GY1A 4GYPC 4H7CA 4A21A 4ZOAA 5CC5A 3W7GA 3GR7A 3EMZA 3NOEA 2PDGA 4PUKA 5CSUA 2C18A 3AYTA 3VUPA 3AIQA 1TTQA 2QAPA 2FGLA 1KRBC 2BY0A 3NSNA 5HMDA 2PDLA 5DCBA 1QUMA 3NEHA 1KR0A 2NX3A 2W63A 4G7EB 1F8MA 2NQHA 1YTDA 3ARQA 3VNDA 5FSEC 1SSGA 3DERA 1KFEA 3SGUA 1BYDA 3UJFA 1G4SA 3BLKA 2FYMA 5BWAA 5FJPA 1BRLB 3M41A 4DJFD 3MU7A 1UMYA 1CBGA 1XRVA 3MI6A 2P3EA 4XD4A 4FOKA 1N8IA 1QPOA 1MFUA 3WQFA 5FD0A 2A79A 1IXQA 4LB3A 1I1WA 3T08A 3T40A 2POZA 1FWHC 1GQKA 1GORA 3P60A 1YXCA 1O95A 1P0EA 4WY0B 4AZ7A 5G2IA 3LOTA 4MB5A 1R3YA 1AQMA 1C8XA 3HG4A 3S1XA 2BG5A 4GYKA 5CSSA 2HWGA 3VKKA 1NDZA 4HOXA 1HX0A 2Y0FA 1Q6OA 4FP1A 4S39A 4Q4SA 4IX0A 2FZ9A 3LCXA 2DH3A 5KSWA 1JUEA 1K1DA 4OU1A 5DT7A 5LNRA 2L5HA 1V02E 3M9YA 1J0YA 3DI1A 1NIUA 3UVIA 1GUVA 5CPQA 3QGKC 1KGWA 2JQXA 2XDFA 5GNZA 1Q6FA 2QR6A 3LGEA 3S3GA 3QLLA 1SPQA 1XBXA 3TXZA 3VNZA 3ITLA 3ME3A 1J93A 2OR2A 3R8HA 5AOUA 5FSDC 4JTFA 3WEZA 5ABFB 3UR8A 1TMLA 3CL6A 2WAGA 4OWGA 4XBKA 3ARXA 1NAL1 2NQZA 3WMBA 3O6AA 3H2NA 2VO5A 3VOHA 3OYXA 3MDWA 1AH4A 2J9YA 4O16A 4UNIA 3NZPA 3AALA 3ITGA 4MJMA 1YPXA 1BG4A 3UR5A 2CLKA 3R5EA 4WHBA 4HNTA 4RLIA 3MDUA 3O63A 2PDCA 3ZSTA 2Y6ZA 2VGGA 3AXKA 2E6DA 2UWFA 1XCFA 4PTDA 3WQ8A 1W9DM 3PZQA 4ZXLA 3LHZA 3LUTA 1EOMA 3WLLA 5E9XA 1POJA 1TV4A 3VIPA 3AOFA 3WQ6A 4KFOA 1UC4A 2PLMA 3AI0A 2PBGA 3KOXA 4E2OA 1P1MA 4AVFA 3FAXA 2I1OA 2WPGA 4AUBA 3W1UA 1Q6CA 4IH3A 3NURA 2ZQ0A 5FA5A 3W1QA 1ZNNA 5M2FX 4Z1BA 1FKWA 3TN3A 1K8ZA 1WP6A 4A3RA 4Y7EA 5F2LA 1TV2A 1W2VA 2HK0A 2HMCA 4WGXA 1X38A 1PIIA 2VELA 4PCSA 3GR8A 5F2IA 1UWSA 2WSPA 2UY3A 4JTDA 3MUY1 1E1FA 2SFPA 1EP1A 2VL4A 3U0HA 3PZMA 2E4TA 1B3OA 3AISA 1C93A 2FTWA 1SQ7A 3LSBA 5DEZA 1TYGA 1GK8A 3WZ0E 3QTGA 3CUZA 2QCMA 1S1RA 5T26A 3PM6A 1EPXA 5AC4A 5IOBA 4IM4A 3LA4A 2VRJA 4JTUA 1WE5A 5JIPA 3CQIA 3W71A 3WD4A 2V0TA 1E6NA 3E0VA 4F0RA 3W2KA 3BPWA 3OBKA 3QOKA 3ZIZA 3F4DA 4HMNA 5C55A 1SZRA 5JVLA 4KCTA 4LRTA 3M0VA 3ITYA 2WMFA 3L9CA 4CU8A 4DI8A 1ME7A 4Q8NA 2FHCA 4Z2KA 1SO6A 1LDCA 1XPGA 1TWWA 2D3LA 2F8QA 3H55A 1TR1A 2VXNA 4DWSD 1PKMA 4DUWA 3BICA 4N4QA 3QY8A 1U1HA 4MY1A 1CGWA 1E4NA 1GCYA 3CQKA 1DIEA 1E6XM 3LG3A 4G7EA 4ZL1A 4IFKB 2OGYA 3EOOA 1VH7A 1VIWA 5HNRA 5DMMA 1H5VA 4WUIA 4NNBA 7REQA 4N2YA 1OCQA 2PODA 3IJ6A 4C6FA 1QHPA 2VZUA 1ZAJA 1NOUA 3OTRA 2OO6A 4W89A 4GJJA 3F2CA 3HIJA 1WAWA 3DFPA 3ARSA 4AIOA 3KXQA 3LM7A 4R5EA 3CIVA 4LT9A 2HE5A 3TNOA 2PP0A 1JNDA 3GSMA 3V1PA 1KBKA 5C9UA 4ZTXA 4HQVA 1QW7A 3SRFA 3VDGA 1GG1A 2AGKA 3TTEA 3S46A 4WKFA 1K9TA 2DT3A 3QGVA 4WY0A 1BTCA 3CB8A 2IQDA 1DJZA 3BW3A 1CGUA 1Q5MA 3A12A 3R94A 4L6HA 2E67A 2TPSA 3WNOA 2WLYA 1W1TA 4LUSB 5HMEA 3QSRA 3TR9A 1MUWA 2DVTA 4HB7A 4FNUA 5CC7A 3BSMA 2ZDRA 4DPPA 2PDXA 2ZUSA 3VDBA 1KXHA 3N2XA 1DXIA 3W72A 1HUVA 5H8PA 2XGBA 4ORIA 1XLAA 3PPHA 3PFMA 1XC4A 1XV8A 4JPGA 1I8JA 5FEZA 3KRUA 4HVXA 1NF7A 5TNVA 4DAIA 3N2TA 2E7FA 5CG0A 3GYCA 1E73M 3A23A 3CLMA 2QEZA 5I3FA 5BMWA 4AWTA 1K02A 1Q4WA 4JNMA 3UZYA 1WA3A 5ABFA 5HXMA 4IIHA 3DCPA 3RRXA 1KCXA 1EDGA 2D22A 3QW3A 4Z2GA 3W76A 3ERPA 1A0EA 4HK5A 5A6BA 3ALFA 1JYNA 3KHJA 2C7FA 1UOKA 1R2RA 5I03A 4B5NA 1REQA 4V2XA 2JGQA 4IMFA 4LAKA 4O8AA 1KO0A 1GW9A 4G5DA 3XIMA 2J9XA 2EG7A 1R7AA 3URAA 2OLSA 3FYYA 3VILA 1HT6A 2WMIA 4PH6A 3CUHA 4K8GA 3GVVA 4W88A 4NZCA 3DH7A 4KWSA 2EBNA 2JALA 3MJMA 2WSKA 1Q4NX 4S3DA 4DYKA 4FLSA 4LYQA 2FPVA 4KGLA 5F4WA 4GY7A 3AHZA 1UBSA 5AFDA 3IVTA 4NXSA 3T0BA 4F0KA 4BWLC 1JRCA 3H7VA 3CZLA 4GY0A 3WQDA 5FEPA 3GNPA 1R0MA 2E40A 2A7RA 1UWTA 4UOJA 4HTBA 4UQDA 3KBNA 3SB0A 4LJ3A 4C1NA 3G1XA 3NSXA 1L6WA 2BXZA 1QOQA 3E2VA 2V5JA 2ASHA 3O0FA 2E1DA 4LUTB 3UPMA 1AG1O 3AYSA 4D6HA 3ECQA 1UUMA 1VFUA 3AWOA 3PSWA 5F2MA 4DJED 3N6QA 2ZXDA 4HNUA 4Z2JA 4H9UA 1B3ZA 2H9AB 3LLXA 3UESA 4XISA 3S6DA 1ZBKA 3UG4A 1XKJA 3LXCA 4R53A 4KRZA 2LLEA 3OLGA 2OZ0A 3NAVA 1P0KA 3B0UX 1OFEA 2OODA 3RO8A 1VCVA 2JKAA 3PZVA 4L6DA 4BFAA 2NXHA 4C6CA 2UY2A 2DT1A 3I7SA 1ML1A 1PTGA 1ONRA 1WOAA 2A3AA 1KTCA 4L4PA 3RNDA 5FF7A 3POHA 5KTLA 2PRHA 3MPGA 3TYBA 3PN8A 3M0XA 1A5SA 4LPCA 2PLKA 1G7VA 3S42A 1PDZA 2HVOA 3WH7A 2VC6A 5IDIA 5JBDA 2OX4A 1EDQA 3RAOA 3HPSA 3PULA 3TN6A 5LA2A 5A69A 3EWDA 1K9EA 3WY1A 3FY1A 1N8FA 3CU2A 2PDPA 2PFHA 3N2MA 3KLKA 1NSJA 4IFKA 1TUXA 1MXSA 3D5HA 4FI4A 1LP6A 3LMZA 3Q67A 2E5DA 4O52A 3VD5A 4LGXA 3W2NA 4RNFA 5FJTA 4FF7A 1M7XA 3CB3A 3S0CA 4UTWA 3BDKA 3V36A 3OVGA 4Z1DA 4IMGA 3HQPA 5A6SA 1JZ6A 1QO5A 3VNIA 5A6MA 4WCJA 3U2CA 1SO5A 3NCOA 2QDHA 3MSDA 1I60A 4RW5A 3RHGA 1A5BA 3FKRA 4JXCA 4JTQA 2GSJA 1RUSA 3M4HA 4MNLA 1NWTA 4GUFA 3CZ8A 3KOFA 2GZXA 4ZXOA 3S6TA 3EOSA 4MKVA 3FJ6A 4M80A 2EG6A 3GBDA 4MZ1A 1PX4A 4BCEA 3PBUA 2XSBA 3IUIA 4LVAA 3BAXA 3GC4A 2BZNA 3G5EA 2B7PA 3UPWA 1T41A 2UBPC 1PYMA 3SFWA 1B57A 1SMAA 4JYEA 1CI1A 4WVXA 4U10A 1KKOA 1TMQA 1EP3A 3WL1A 3KZPA 4XIMA 4GHRA 3TW6A 4X2RA 3EDJA 2PGFA 3IUHA 1XGZA 2J24A 3GVRA 4ZQCA 3T55A 3ARRA 3I6TA 3SIZA 3TROA 1EUNA 4J3XA 4GNJA 2IPWA 4B92A 4L4MA 3VIGA 4UFIA 3ARWA 3JUGA 5LNUA 3LGDA 2ZDSA 5REQB 3FHAA 3GS6A 2B7QA 4UFLA 3BZJA 4UTJA 3F4WA 3REQA 3L5MA 3AJ7A 4QNEA 4AD3A 4AD2A 1OHLA 3NL5A 4DIAA 4QISA 5ECVA 4IFOA 4N9BA 1Q13A 2FZBA 1KW1A 2PWFA 4H3DA 5L9FA 3KL3A 3VZYA 1W8GA 1JF6A 1BWVA 2D2HA 4CNPA 2E8YA 1HJXA 2C13A 3L4UA 1EJUC 1AZ2A 4GIAA 1AD1A 3LRMA 4P8WA 4I8YA 3TOYA 1GVEA 4F9DA 2PBOA 1YDOA 1MNZA 3PAOA 4GX9A 4TV5A 3WK2A 4XWUA 3V5CA 4WSKA 2X2GA 3UGRA 2ZA1A 2G3MA 3QZEA 4UZUA 3T0CA 2C1IA 1UKSA 2X1UA 1XLKA 4LCQA 3C0JA 1TFVA 3GH7A 4G56A 1YBQB 4MB4A 3OGSA 1SFJA 2MUCA 2Q8LA 3CM4A 3T0AA 1SFTA 3KZSA 3QMSA 4W5UA 3IWPA 2D2GA 2J9ZA 3HQOA 4HN8A 3HF3A 1F07A 5FJUA 3S1WA 2GQAA 2Z29A 3ZYZA 2XIOA 4JR5A 2H9AA 3BMWA 2BOEX 2ZRWA 3TLLA 3WDJA 3LMYA 4HNVA 3F4VA 1Q65A 1I1XA 1NOFA 3LBMA 3W07A 1CLKA 3IV8A 4AYSA 5E0FA 3VOIA 4Q8TA 1EQPA 3OBEA 4K6AA 2V5KA 1EHAA 2B0MA 4JYFA 3O16A 1KWKA 3B05A 3W27A 5JBFA 4UNKA 1POKA 2VFGA 3W1PA 1WXZA 1LRQA 1XLCA 1O60A 4A3YA 3G1FA 1OB0A 2YDSA 3C86A 3GDLA 3OU8A 3BGAA 3WLMA 4QE4A 4EACA 4HYVA 3UBPC 3S9IA 4D72A 3PS7A 1E51A 2WHJA 3FA4A 2GL5A 1ISYA 3K4DA 4U3CA 1JXJA 4FX8A 2QF7A 3TMLA 3C52A 3SCWA 2YIHA 1ONEA 1M7OA 4GX8A 4JTRA 3T0DA 2P88A 3TJXA 4A8IA 1LRTA 4UTFA 1UZHA 4UTHA 9RUBA 4B90A 4I7WA 5D8WA 3RN6A 1RV8A 4IPPA 4HZ8A 1K3UA 1F7BA 2X8RA 3HJEA 1J2BA 1BKSA 4XAFA 8A3HA 3GZ3A 1UR1A 4YLWA 4EANA 1O12A 2RGMA 4GYPA 3W83A 5AB3A 1H7NA 5BOEA 3HOJA 2QDEA 4GQ0A 3TAKA 4DUXA 3R0KA 4JNYA 1TTIA 1ITCA 4IMCA 5DLCA 2E28A 2CLEA 1TTJA 2PLJA 2ZC1A 3KTXA 3EMQA 3W02A 4N9EA 5TBOA 3EDDA 4I5UA 4QAWA 4NX0A 4AY1A 2ZKMX 3G0XA 4LU0A 4MWAC 2C8NA 4ZE5A 2G0WA 4CNSA 5EMJA 2J7EA 2CKSA 5AYXA 3LY0A 2VX4A 1R86A 4YTQA 1MQPA 4O11A 1EL3A 3T05A 4E4PA 3FGCB 2IW0A 1XDLA 3W2UA 1K7EA 3LRKA 3MO7A 3DG6A 4PTVA 4FNSA 3A4WA 3QRHA 3S2JA 4DXXA 1JUBA 4ZFMA 2AKZA 4RZ4A 3CHVA 2FLIA 4EXAA 1ZQ5A 3RITA 1LROA 3VVGA 3LLFA 1GJWA 2J88A 3OODA 4S3FA 5HJYA 4GYJA 2DW6A 4Z17A 3K5XA 1GEHA 4ZVJA 2EJAA 2V9DA 2FGZA 3DENA 1U30A 4Y9OA 3GFXA 4GCXA 4LEQA 1TPC1 3PG8A 4MNJA 4M6PA 4ENLA 1TJRA 1YDNA 2XSXA 4M6QA 4G8TA 4EP8C 4DY1A 5REQA 1R7OA 1R9ZA 3QF0A 3VA8A 1HVXA 5FJJA 2I9EA 2Q6ZA 2V3FA 3VGFA 4BQ3A 4RX0A 5D9OA 1QPRA 4CNOA 1WKEA 2RJGA 3G8RA 2BHUA 3TYEA 1V0KA 1AW1A 1L9WA 3M6YA 4C5ZA 2WVTA 4KS0A 2EKGA 1OFPA 4CQCA 1UASA 3W7OA 2X7VA 1BLIA 4XBJA 1DP0A 1JUKA 2FVKA 3U5YA 1FWSA 4S2CA 2EPOA 2DGAA 3CJPA 3NM1A 1DXFA 3P0WA 2NVCA 2OQLA 5E9AA 1UH4A 4LNCA 1VQTA 4XZBA 3VGEA 4AEOA 1GOIA 3QYQA 3TK7A 4RV8A 2QUUA 3UXKA 2OX1A 5I3DA 3P84A 6CGTA 1JCYA 4LUJA 1YE6A 3RDKA 1FDJA 3TC6A 2X41A 1EEXA 4YTSA 2ZUVA 3V5OA 1EDTA 4ZR8A 2PDUA 4CLMA 3NL2A 4KESA 3RLVA 4ZQRA 1HVQA 2X1TA 4ZOBA 4GNKB 1XHGA 1NWUA 4QG9A 2VVSA 2VFEA 3STPA 1UD8A 1R3WA 1J6PA 4IL2A 3URBA 1JCJA 3N13A 3BJFA 3EDKA 3WNPA 4OUEA 1TJ1A 2ZBTA 1AFSA 1XFCA 2NVDA 2YJQA 4POCA 4UTMA 3ITCA 4Z08A 4AY8A 1FH8A 1K9DA 3SIMA 4CQAA 7PTDA 5H8MA 3EYPA 2YB1A 1XSIA 2XJ7A 4O53A 4F9JA 4YCOA 3LCGA 1NP2A 4X9SA 5IHRA 1EOKA 2IKHA 3E0FA 1CGTA 3SCVA 2XZ9A 2PGEA 1QHOA 2FQIA 2DUXA 2H8XA 4XX6A 2PP3A 5KEZA 1YNYA 3THCA 3NQ2A 1A5CA 3D6NA 2A21A 2QJHA 1S2UA 4M7TA 4H1ZA 1OVDA 4BEQA 1Y5XA 3ES7A 2GGEA 3OB8A 3E0IA 4ZB2A 4RDWA 4EXBA 1VC4A 3MUIA 3APTA 1ENUA 4TQTA 2ALRA 2GVJA 4DXVA 3H22A 4B5TA 3ONCA 2EO7A 1TV8A 5J8LA 1VRXA 1DV7A 3SUUA 4YTRA 1VCFA 4XSLA 1MI3A 3FJNA 4F8XA 1E9ZB 3QBUA 2IKJA 3ANVA 2XIBA 3N2OA 4L65A 4H6KA 2YL5A 5BXRA 1VPYA 2YA2A 4PCFA 2DW7A 1WKFA 4LANA 3W1XA 2E77A 5FL0A 1HKVA 1V6UA 3QGAC 1WQ5A 5CAKA 3MHUA 1OEPA 3KHDA 5LIKX 3N1AA 4AX6A 1MZHA 4XZHA 4O1CA 1PX3A 2WNQA 1BPLB 3LHTA 2INZA 5C2GA 4Z2LA 1CNVA 2VC9A 2GQ9A 3ITXA 3W7CA 4AH7A 4C60A 3LQLA 2VKZG 4B9ZA 3GIQA 3SRKA 2WW5A 3UWEA 2IXUA 4LX4A 1E6RA 1IXOA 2IMRA 2WKLA 4AXKA 3CL7A 1L0PA 2OSXA 1HG3A 3H54A 4NI3A 3UJ2A 4B9YA 3B8WA 1IZKA 3A3XA 3A21A 3K4AA 3VKAA 3G3DA 2QDGA 3OG3A 1KCZA 2ISDA 3FGCA 2HXTA 4R34A 2CW6A 1I2OA 1RK5A 4XAYA 2XTKA 4AMAA 1XISA 1YRRA 2AL2B 2Y8VA 2VD9A 4F0MA 1WDRA 4AZCA 2CHOA 4YYFA 4WIWA 3RLGA 1JQXA 2CITA 5A8OA 5D32A 4RJEA 3MC5A 1XSJA 1M7PA 1EIXA 2JKPA 2IPJA 1TJ0A 2FH6A 2HK1A 4Q4KA 1AK5A 4NF7A 1H61A 2G4FA 3R13A 2WZTA 1WZAA 2CC0A 5CPLA 5LXEA 3FDGA 1VAHA 3F2BA 4EVZA 1MW3A 3ALGA 4TTUA 1SJCA 3BO9A 4CQ8A 4ZSTA 2PC8A 1RLCL 3Q58A 3SN4A 2VVNA 3WQPA 5F1VA 1UH3A 3GDBA 2FJKA 3M5XA 3UT0A 4H9XA 3WDRA 4C6OA 3QJAA 4JDYA 4ML9A 3BAWA 4LOCA 1DJYA 1YTEA 4JCLA 4FF5A 1LYXA 5JUVA 1YADA 1F6YA 1AZ1A 5FESA 2POTA 1Y0EA 3QYSA 1CEOA 2ZWYA 1ODZA 2V5DA 1OX5A 4NI8A 3UZZA 4F48A 2PWEA 5ENLA 2DZUA 1TPUA 3NPXA 2X09A 3TCSA 1MNSA 1PPIA 3A4AA 2W9MA 2Y4SA 1V3IA 3E38A 1XLMA 4HA0A 4NJHA 2ATMA 1O1HA 2YR1A 3W7RA 1XBVA 3RCMA 1UB3A 3L4XA 1EJSC 3H2AA 3CPRA 5IHSA 4WEVX 4ZODA 5ABGA 3CZJA 5CLWA 3B9OA 2VEIA 2PMQA 2VRQA 1F6PA 2C91A 3L0KA 1XD1A 1ZP4A 2VZVA 2P8BA 3A47A 4V28A 3WN6A 4BQ5A 4N42A 3QH2A 4LFYA 1VPXA 2PTYA 2PD9A 3G6LA 1ZAIA 3KCLA 4E8DA 1CW2A 3S1VA 9XIAA 4JS3A 3ELFA 4U4MA 3EDFA 1T5AA 4FR6A 5TQLA 3O2LA 4QEHA 3MVTA 4HGXA 1TE6A 2PDBA 4IWWA 4AD4A 2W6RA 3TSBA 4BWLA 2CEQA 4CCDA 4PUJA 5D38A 3WJXA 4US6A 1JG9A 2QYGA 1ZP3A 4KFPA 3WCZA 3SUWA 3PJUA 1NM9A 4UQ9A 4JY8A 4KEUA 5AYBA 1EX1A 2VI0A 3HPZA 2DFAA 3G0SA 1EGVA 3VO0A 4ML4A 1U5HA 2ZXQA 4IL0A 3AIEA 5D04C 1GKQA 4MJ2A 3S8HA 2OJPA 1JD7A 1HJUA 2Y85A 3DECA 2Y2WA 4ZENA 3W7KA 1TA3B 3VIIA 4PMNA 2YA1A 2CLHA 4PMQA 2A3CA 3OVQA 3PTKA 1W8SA 3CV6A 5B7ZA 3IJQA 3BV4A 4NSBA 3MHGA 3W53A 1GEQA 2VC5A 1S3HA 1KBBA 3SURA 2E6YA 5KETA 2WJZA 4PC8A 5T9BG 4QLLA 5FJRA 3PK7A 3USBA 2WSRA 1U1UA 2VCCA 3W28A 3NGJA 3NQEA 5AYIA 3B0YA 4CCCA 3KTSA 1HF6A 4HPXA 1N8WA 1JULA 1H1ZA 2IQ0A 1MW1A 4P2VA 2Z2UA 5FCZA 4ZE4A 1P5BA 4B5SA 7TAAA 3DIPA 3W81A 1S1PA 1F61A 3MJYA 4QX4A 4AHPA 2JK2A 5JH2A 4MVAA 4H8VA 1OG6A 3LZ3A 2ZRVA 3FFSA 4EWND 2XPKA 1GG0A 3F4CA 4WK9A 1J8VA 5KZMA 4AYGA 1W91A 4N0RA 3FYOA 4A6GA 3ICJA 3B8TA 3OQEA 4AX7A 2QKFA 4J3SA 1SJDA 3VKCA 4U28A 3EZ4A 4HJWA 2A3HA 8XIAA 6TAAA 1H7PA 2CKRA 3KAOA 3TYDA 1H0GA 3CQ0A 2PZ0A 4ZBCA 4XAZA 5G4WA 3KW3A 1SZNA 2ZZ5A 4PE8A 2GOUA 4LNYA 2VJXA 4CCEA 3T2PA 4GMEA 2BMBA 2QV5A 2EPLX 5CKSA 1EZ2A 3G6MA 3CTTA 1OADA 5A6BD 3QPEA 2ZC8A 5C9WA 2Y7FA 4F0SA 1KQYA 1I4NA 3M46A 5CGQA 5EPDA 5EB8A 1E0TA 2UZ9A 4QE5A 2J6VA 1KLZA 2FZMA 4KCUA 4MWAB 4I7VA 1DL3A 2E09A 4O57A 1O94A 5E6YA 2IKGA 1VFSA 4CD8A 3S5YA 2NXIA 1FWRA 2AMXA 5GNXA 2D0HA 4GQGA 4PUEA 4QLKA 5ABHA 4J9JA 2Q09A 4ACZB 2FVMA 1MZRA 2ZZ4A 2YL9A 4DJFC 3V1HA 3L2IA 3EA3A 3WQEA 3QVQA 2ZYFA 3UPBA 2RJHA 3MW7A 5CPSA 1ZCCA 4GKLA 4IXHA 1Y7VA 4IIEA 4X0NA 1S2TA 2H8ZA 3HFTA 3BLFA 3L68A 2PRLA 3JZEA 3UG8A 1GVYA 3FXGA 1KM6A 3G22A 5KMYA 3G1YA 4HPNA 3LXAA 3MZ2A 4FPSA 2D2OA 4ADTA 3MP3A 5CJ5A 2YDQA 3FSUA 1R2TA 3RIKA 1TZZA 3CIXA 2G3FA 4Y9AA 4AC1X 4QSFA 4CUCA 2G3NA 2RHGA 1SJAA 3O0KA 3TP4A 2C0AA 3VDHA 4GC4A 1LRNA 3CUGA 3T2QA 1P0NA 1HKMA 3M0LA 3BLOA 1NFPA 1L2UA 2VWTA 3TFCA 3WSUA 2R94A 2NUXA 2F6KA 1DJWA 3C2FA 2QCHA 4R88A 1EJXC 3PZGA 2BGNE 4C6JA 3LU2A 5CGTA 3H7UA 4S2BA 5D05A 4D6IA 5A6JA 4D71A 4N9CA 7ODCA 4HHPA 3U2OA 2GJPA 1OJXA 3W0KA 4PRTA 2NUYA 3R8GA 1IWPA 3EKZA 4MY8A 1IR2A 3EDEA 1ITQA 1BSIA 1RY8A 1LBLA 3ZJ6A 3I65A 3W00A 1V4YA 3DAQA 3E49A 2ZX5A 4JN6A 3OHMB 3RXZA 3APYA 1Q6EA 3TZNA 2G97A 5D2VA 3DGRA 3OA3A 1LZOA 3M44A 3DKJA 4FIRA 2W0UA 1MFVA 4FA3A 3N19B 3HG2A 4RNHA 2VFHA 3V0UA 2JE8A 3WNNA 3PNZA 3NQCA 2REQA 3ZR6A 2CZDA 5A6KA 3AAMA 3GU2A 3SJNA 4UTKA 3FAWA 2DY3A 4JFUA 3CH0A 4AWEA 1OK6A 2F6XA 3RPTA 1QPKA 4PUUA 7A3HA 4UQEA 1E1CA 4M8UA 2YL6A 2ZIDA 1WDQA 2DPEA 3LCWA 5BU9A 1IXNA 2Y5SA 2YZ5A 4NUWA 4XAGA 4I9MA 1TRDA 2HVNA 2V8ZA 2CETA 3IIPA 1A5UA 5AN7A 2D2JA 3N25A 1VFHA 4GVIA 4PBEA 2J79A 5G1TA 4C6QA 1S46A 4KQNA 3UJRA 4TVDA 5GQBA 3HV8A 1EZWA 5T91A 1M04A 4M56A 3HQNA 1XLJA 3NJ3A 3UA4A 4QNWA 3W7NA 4WD0A 1AQFA 3RR4A 3AS2A 2VRKA 3O8AA 4GZIA 4WXYA 4IFRA 5GJPA 2XGZA 3JW7A 2C71A 2HS8A 3MP5A 3OZOA 2WWCA 1QPQA 1B90A 2XH2A 4PCPA 5F7UA 1I0DA 1FP8A 3WD2A 1CX9A 5D8ZA 3LERA 1G7UA 1VS1A 1Z8AA 3TDFA 3DHUA 1QNSA 3OG2A 2FVLA 4RDVA 3LEPA 1IHIA 2OCZA 3R43A 3H7RA 3WYZA 4DBWA 4FALA 1C9WA 3NQAA 4UZSA 1ZL1A 1TPDA 4Q8QA 1BGGA 3GG1A 4UR7A 3WQOA 2DT0A 1M53A 1AODA 2QCGA 3VNLA 2WC4A 4CQBA 1V6WA 4IUGA 2ZXAA 2VEFA 2ALDA 4DWSC 2CWNA 2B4GA 4MLJA 1B3YA 1TVNA 3NVDA 4R3UA 5F2GA 2GUUA 3RILA 3GDKA 3E2QA 3QKEA 3TKFA 4HTYA 4CN4A 4O0QA 2X1SA 4IQJA 6ALDA 4YIWA 3VOFA 3WQGA 1UA7A 4MWAA 2OU4A 2V63A 1XLFA 3W1NA 4MAZA 4UB9A 3VX0A 1HNYA 2W4XA 2NV2A 2V68A 4IPLA 3EWZA 5C54A 3VFCA 1E9YB 4D6EA 1JEZA 2YCLB 4BQ4A 1XLLA 2PTXA 3U7VA 2WVUA 3GHUA 3IJIA 4NAFA 4AF0A 2XVNA 4UUIA 1F8IA 1H4PA 3C5QA 3DHPA 5IFPA 3F7JA 3STCA 3NFUA 4D6CA 1DTNA 1RJPA 4GGBA 4L61A 4U5KA 4Q7NA 4GBDA 3UZ5A 4IISA 3ZO9A 3E9AA 3BCFA 4XKYB 3VTRA 4RPQA 3ABOA 2VZSA 4FLQA 1H50A 2J77A 4K68A 3S83A 2YXOA 1BXCA 3TTYA 1BKHA 1OCJA 3CUXA 3ID7A 1TWZA 3N14A 5DQPA 2ZUUA 1SW0A 4LSBA 5M1TA 1XX1A 2PLCA 1AL8A 3GD6A 2E3ZA 5DY2A 1QMLA 4WSJA 2W92A 4J28A 2NV1A 3S5ZA 2QXWA 1XD0A 2Y70A 2PWVA 1F05A 4HBKA 4DZHA 3B8DA 4LVFA 2FZ8A 5MKGB 3VNKA 1S5VA 5CSRA 3MUAA 4ZB0A 2ABBA 4QJ5B 1EJTC 1H62A 3EEGA 3RPMA 3TH6A 3BG5A 3HGSA 2E5CA 2ZRXA 5EU9A 4AVOA 3T8QA 2GLKA 2EG8A 1GVRA 4EK7A 3C0QA 4MYXA 2OOFA 3R4IA 2JIEA 3RFAA 3SAZA 5C5YA 1RCXB 2YLLA 4Q32A 2QCCA 4BKNA 1VFLA 3UEQA 4MJZA 1ZBVA 3ZWSA 7CGTA 1SGJA 2Z1BA 1HQTA 1SR9A 2BY2A 5HMSA 1AJ0A 3O7UA 3SY1A 4HK7A 1G94A 5J5RA 1O68A 3OIHA 2HEJA 1A3XA 1C9DA 1BXBA 3HO8A 4S3AA 1R87A 3SCRA 3S5NA 3O06A 3ARTA 3BLIA 4EKJA 1OSEA 3GXPA 2ZUMA <