5IOBA

Crystal structure of beta-n-acetylglucosaminidase-like protein from corynebacterium glutamicum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
335
structure length
316
Chain Sequence
PTAEDLARAQIPEQQRDQVASLMMVGVANYDQALDALNQGVGGIFIGSWTDENLLTEPGRNIEALREAVGRDFSVSIDFEGGRVQRATNILGDFPSPRVMAQTMTPEQVEDLAEILGTGLAAHGVTVNFAPVVDVDAWGLPVVFSNDPAVAATYATAFAKGLSKVGITPVFKHFPGHGTPALDELKTYDLIPYGQALSETDGAVMVGHMIVPGLGTDGVPSSIDPATYQLLRSGDYPGGVPFDGVIYTDDLSGMSAISSPAEAVLASLKAGADQALWIDYGSLGSAIDRVDAAVSSGEYPQEQMLASALRVQLLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucosidase-related glycosidases
publication title Crystal structure of beta-N-acetylglucosaminidase-like protein from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
total genus 96
structure length 316
sequence length 335
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5iobA00
4ZOCA 4ZODA 5TF0A 3WO8A 3WLLA 2X40A 3U48A 4GVIA 5FJIA 4YYFA 3WLPA 3WLMA 1X38A 3GSMA 4GVHA 3WLSA 3AC0A 1IEVA 4ZOEA 4GYKA 1Y65A 4G6CA 4ZO8A 5FJJA 1X39A 3ABZA 4I3GA 3TEVA 4IIGA 5BU9A 2X42A 4IIHA 3WLJA 3USZA 3LK6A 1J8VA 5G1MA 3SQMA 4IIFA 5IOBA 1EX1A 3WLOA 1LQ2A 3ZZ1A 5C0QA 3NVDA 4MSSA 5JU6A 4I8DA 1IEWA 4GNVA 3WLTA 4IICA 3UT0A 3U4AA 4ZOBA 4GYJA 4ZO9A 3ZYZA 1TR9A 4ZO7A 4IIDA 3RRXA 2OXNA 3GS6A 2X41A 3WLKX 3WLQA 4IIEA 1IEQA 1IEXA 4GVGA 3BMXA 3WLIA 3WLRA 3WLNA 4IIBA 4ZO6A 4GVFA 4ZOAA 5BZAA 4HZMA 3WLHA 3SQLA
chains in the Genus database with same CATH superfamily
1G7VA 2Y5EA 1MXSA 5GNXA 1TPWA 2QUUA 2HISA 3UWZA 2YA0A 4Y96A 4HKPA 2OFJA 3FXGA 3IIOA 2D1ZA 4AZGA 2WCGA 4Z08A 2NX9A 3FGCA 3NO1A 1MW3A 4JCMA 5C9RA 1J12A 4GZEA 2WWCA 4UR8A 3K1GA 4ERIA 3G8EA 2HS8A 1JPKA 2ZOXA 3THCA 3IK2A 3W2KA 3G0XA 3QRHA 4H9XA 2UY2A 4G6CA 4ADUA 4HOZA 3YPIA 4ORMA 2J77A 3CYJA 4KWUA 2XIBA 3MVIA 4FP1A 2J74A 2OJPA 2WVTA 2P3ZA 1DJHA 2ZWYA 1PX8A 3F5KA 2DSUA 4NZFA 2Y61A 1S1RA 3MP4A 3HFTA 4QROA 2I17A 3NQEA 4V1YA 3IV3A 6REQA 2Q09A 3MCOA 4NILA 4LEQA 1QI3A 1Q6FA 3WNPA 3CO4A 3I68A 1I8JA 2CYGA 2CZVA 3FEQA 3GXDA 1DWGM 3R13A 3WD2A 4RXGA 1CTNA 2D20A 5CPTA 3ARYA 3AXMA 3GG7A 3HQNA 4YTRA 4NZ5A 2ZZ2A 2HVMA 2VD9A 3NO5A 4AZBA 4KEMA 1NDWA 1ITCA 1EJSC 1B3XA 3EDEA 5IBXC 1TV2A 3C2VA 1BKSA 2OB3A 4JKLA 1JR1A 4AZCB 1WB0A 3EX2A 1H7RA 4CCZA 3S0CA 1UG6A 2G0WA 1LJYA 4Q4PA 1VJZA 3OLEA 1VBJA 2WBGA 3PVFA 2IPJA 3A3HA 2AKZA 2NSXA 3KBMA 1GG1A 1TO3A 3P7YA 4MLRA 4IXHA 3QH2A 1X6NA 3QMSA 4LS2A 1AD4A 1NF0A 4BR1A 5BRPA 3QTGA 1OWQA 4O13A 2HRWA 3CK5A 2YR1A 2JF6A 2QW5A 1HKJA 4E3VA 1FP9A 1HFBA 1SM9A 3B8WA 3MJMA 2Y89A 3B3DA 5JXQA 1CGUA 1XLLA 2YLAA 5I07A 3W6YA 1YDYA 4W88A 3DECA 3BC9A 2C19A 3A21A 2WZIA 4DLMA 4K8HA 1GEQA 2WVUA 3OYZA 3VKKA 2VX7A 3GUGA 3P0XA 1Q6EA 1W2PA 4D71A 4DWDA 3ZWTA 1UOKA 3AI0A 4GX9A 5M1TA 4DM1A 2CLHA 4DELA 1CPUA 2J13A 1KTBA 3GW3A 1OFDA 1I2QA 1D3GA 1KM5A 1LTDA 2XIOA 4NP7A 4PUUA 2P1FA 3W9ZA 5EMJA 3AAMA 3BAXA 3KL3A 2Y7GA 3GU9A 4IGSA 3CT7A 4NRRA 2AKMA 5FCZA 1I2OA 3POHA 5MKGB 2BX7A 3VGEA 2WC3A 3PR2A 1EHNA 3O6DA 3SI9A 1KQZA 3BXWA 2VURA 3H70A 1TMHA 2Y7FA 4LNCA 4CU7A 2CLKA 3D6NA 3TW9A 2PURA 1NM9A 4A3YA 3DENA 4WSJA 2VFDA 1E1CA 1E72M 4LBSA 3CZEA 4DLFA 4MWAB 4FXJA 3PZVA 4UOJA 3IUDA 4AD1A 4BQ3A 2GJRA 2BODX 2X16A 5F2LA 4YL2A 4J5NA 4HB7A 7A3HA 3DYOA 1N8IA 2VGFA 1KBLA 3ITXA 3OQEA 3DH7A 2FTYA 4PRWA 4W8BA 3RX2A 3KRUA 4D6JA 4YVXA 4HPHA 3VE9A 5DMMA 2A7NA 4PN2A 3O0FA 4TV6A 6CGTA 5E1QA 1WDPA 1UWUA 1F5ZA 4TVUA 1R38A 1TMLA 3EWZA 5EMUA 3SZ8A 3NDYA 4OWGA 2PA6A 3L0NA 4JR5A 3FAWA 5CC5A 4Z2GA 1LL4A 4FR1A 2CPUA 2W91A 1W9VA 3WLLA 3RM8A 3DGRA 7XIMA 3L23A 3S9ZA 5FA5A 3C86A 3WK2A 3OGSA 1OYAA 2PI6A 2GJXA 2AL2B 1EJVC 3GBEA 2FLIA 2O9OA 4KPLA 4LCQA 4NXKA 1B2YA 2ZUVA 3OTRA 2ZRZA 3FV9A 4C1KA 2RGMA 3VK5A 1Y7VA 3CH0A 1S38A 1B5TA 3SRDA 4KCVA 1LROA 4Q4MA 1M1BA 3CC1A 5HJYA 1XBXA 4S3GA 4FS9A 4DZHA 1BRLB 5I23A 2GL5A 2DVUA 1MQPA 3EKGA 3IIXA 3P0WA 4GINA 1V7AA 4HMDA 4PMJA 3WD4A 1BHGA 1W1IE 3TJXA 4CQAA 4JTJA 2Z0IA 1BTCA 4DBUA 1ONRA 4ML9A 1R3QA 1HKMA 4MVAA 1HJXA 4XTDA 1NWSA 4TU1A 4QISA 1E40A 3H26A 1JPMA 2ZZ4A 1BKHA 3AHXA 1D7KA 1SJCA 3WDPP 1J18A 2X1UA 3DC0A 1VIWA 3RDKA 5HAOA 1WZAA 3EXTA 5KZDA 4O1FA 4G8TA 4GBUA 3CUZA 3W1XA 3ZT6A 4AB4A 4XIMA 1QK0A 3HF3A 1CWYA 1FRBA 3WQFA 2GDVA 4JTSA 4US6A 1V77A 5A8NA 2YCLB 1TZZA 3M0LA 3S9YA 4R9OA 3RNDA 2XH4A 5D9OA 4R7OA 4WY0B 3V0SA 1CXIA 4Y9AA 1XYMA 6XIMA 3H2EA 3B0VC 3OG2A 3UG4A 3CIVA 3LBOA 4M29A 4C60A 3JUGA 3KFTA 1UIPA 1XRVA 2HPMA 2J66A 2GOKA 3RO8A 5REQA 4V1XA 2WKGA 3W7IA 4AYGA 4P61A 3ARTA 1FWTA 1UR3M 1IWBA 1QJWA 4L9YA 4GNKB 5G1MA 1IXPA 1RZMA 4V2XA 4JICA 3ZLFA 1VLWA 4NZ1A 1V4YA 2RDTA 1PEZA 4DN1A 3VOJA 5CJ5A 5CPLA 2O4MA 3DDMA 4JNYA 5KZ6A 3V0UA 3N34A 1ZLPA 1G69A 3VO0A 4QEHA 1EF2A 2XH7A 2NQZA 5HR6A 4BQ4A 1M7OA 5ABHA 3ARSA 4BI5A 2VXNA 5HPOA 1DQXA 4ATWA 2WVVB 4ZMGA 3CO8A 1PSCA 1XCXA 3ZJ7A 2R1NA 4RK8A 1PXGA 4QNEA 2WXDM 4JYDA 4MPQA 2OQLA 3WYZA 3KVLA 4GXPA 1S5VA 2QCFA 3VOGA 2KX9A 2W63A 1I60A 4TXEA 4GFSA 3TNBA 1ADSA 3VKBA 4F2BA 4NXSA 5C71A 4LVDA 4MZ1A 3U48A 2HCVA 4GUIA 4MKVA 2VGGA 4OE7A 3VXGA 4TUFA 4P5UA 2WMFA 5CPSA 1W1YA 3FN9A 5DEZA 1OFPA 1JZ7A 4C6KA 1QO2A 2QGHA 4GPNA 2ADAA 2G96A 3RYSA 3BLDA 1Q6GA 3A4JA 1BYCA 2YJQA 3AOFA 1UZ4A 3LG3A 5LGZA 4Z17A 3W7HA 5LIYX 2E3ZA 4ATLA 3ARVA 4C6OA 5D02A 3KEHA 5AVHA 5GNZA 4WF7A 5A8GA 4P7QA 5JUVA 2V8ZA 3D47A 3DG6A 1NJJA 1R87A 3IRDA 3P62A 3WF3A 1RA5A 1ZUAX 5DT5A 3CT2A 3EXSA 5CJNA 1UR9A 2H9AB 3SUUA 4DNMA 5BYWA 3LXCA 5EKYA 3B03A 3IJ6A 4I7VA 4IFRA 4IGNA 3PZGA 1W1TA 3PC0A 4U5IA 3W2NA 1BGAA 2XU2A 4ADSA 3U3HA 3MC5A 2PFHA 3V1PA 1I1XA 3QC3A 4S3BA 4LV4A 3L7RA 4QNWA 2GVYA 1JGMA 5KEZA 3M9YA 4UTWA 4CU8A 3L67A 1XYZA 1TJRA 2XM2A 3UCDA 4D6HA 3P6LA 1TVPA 4JIQA 3UVIA 3N3MA 1XGEA 5TNVA 4AG0A 1EJXC 2CWNA 2P10A 4BEQA 1FDJA 3DGBA 1PVNA 3OJGA 5FJIA 3P60A 1XQKA 3QHOA 1P6WA 3SGUA 5A8OA 4S3AA 4MG4A 3CHDA 1C92A 1EP3A 3TOYA 4C6CA 4L1GA 4HU3A 4ZB2A 1DHPA 2EPKX 3UJ2A 4S3CA 3II1A 1KWGA 1LBFA 1E0VA 2QULA 1O5KA 3L66A 3GD6A 2QZRA 1J0HA 3DCPA 2C8NA 4NI8A 2FB3A 2FZNA 3S5NA 4IQLA 5DF0A 1UD2A 4L9ZA 4FLRA 4OBTA 3GKFA 4JFWA 2EJAA 3R79A 3ERPA 4X0VA 3VNYA 5HR7A 1UJPA 1EEXA 5HDRA 1WZMA 2CKRA 1R2TA 3NM1A 1RXOB 3HN3A 5FEWA 2QR6A 3EB4A 3LLDA 3IGUA 2QMKA 5DX7A 2OSYA 4XV0A 5AYZA 5AFDA 3NOYA 5FJOA 1L9WA 5T26A 3SY8A 4PB5A 4GFIA 4HOWA 3BDKA 4WD0A 4HK5A 1FXPA 2GUBA 4W7WA 1W5QA 4BWLA 4UBPC 2Z7KA 3URNA 1RLCL 1H50A 4LB4A 3QVQA 1G5AA 1EBGA 2FFIA 4FOJA 2BHUA 3RITA 4CNPA 5EGRA 1WAUA 2P88A 1PYMA 3G8RA 1A47A 3KBSA 4YS1A 5DO8A 4YPJA 1ISXA 3UWEA 2NXGA 2PEVA 1QBBA 1HJVA 3VNDA 2FGZA 4X2PA 1VD6A 5AC8A 1A5MC 2VHLA 4AYSA 2QVHA 9CGTA 4KEUA 3EAUA 1DJYA 3G1YA 3KVMA 3PB0A 2HXUA 1XBVA 3VD4A 4GYKA 4DEFA 2PWEA 3W7KA 4A35A 3FS2A 4ML4A 2B7PA 3OODA 2ZQ0A 2BVYA 1KBIA 1OFQA 2WQDA 1U22A 2DZXA 3GVVA 1QU4A 4HA0A 4GUGA 4ADTA 3SRFA 1CGYA 4CN4A 4RL3A 4BZYA 5G5IA 3W38A 4UFKA 1A49A 3SY1A 1QW8A 4W8LA 3S47A 3NG3A 4A8LA 4JQ2A 3TAKA 3FY1A 3DHPA 3PNZA 2ZZ5A 4Q22A 3AROA 4GNVA 3FDKA 5I77A 4KW2A 2FPVA 3SFKA 4NZJA 2GGGA 2O7SA 3UWUA 2PU0A 2V9DA 4IIDA 3CS2A 1U5VA 2OZTA 2VEPA 3SIZA 3T09A 1Q6OA 1D8CA 4WDTA 3CL8A 1XXXA 2ZTJA 4RNHA 4HA4A 4DHGA 5FJPA 3N4FA 3WQGA 5XIMA 4DF1A 5LIXX 2DZPA 1MUMA 3CGTA 4IM4A 1AJZA 3I3DA 4JS3A 5BOOA 3GH4A 1SU5A 1U30A 2DSKA 3VAVA 3RGTA 4N7QA 4A3RA 3RJXA 4X61A 4DUOA 1LM1A 2BV9A 1GOMA 1OF6A 1PX3A 1L8PA 3GDRA 3VA8A 3VIHA 4N6EA 1TIMA 1XLMA 3F1QA 4ICMA 3SJNA 4D6IA 1H11A 1JRBA 4WLCA 4FNUA 2AQVA 2DSZA 3QV6A 1OZQA 2PCEA 4IXXA 3BLLA 1V0KA 3DAQA 2E40A 5FACA 4WR3A 2WSRA 3DU0A 5M3WA 4LUSA 1GYLA 4AY1A 5DANA 2ZIDA 5LA1A 3RX3A 4IG2B 1OVDA 1JF5A 5C70A 3CPRA 1OD0A 1Q7MA 3PULA 4RZBA 1T41A 1HP5A 4MY1A 3W75A 3DHFA 2QJNA 1CXKA 1W3TA 3W3OA 5FKYA 3CLMA 4XKMA 1DJGA 5F1VA 4RPQA 3PBYA 3R11A 1LRTA 1KFLA 5D9PA 3OZMA 4OHQA 3C5QA 1OK4A 1Y8BA 3BOXA 3WJZA 3T0AA 3ZYZA 4MB1A 5I0DA 5JBDA 4JHMA 2DJXA 1X97A 1EBHA 1IXNA 1NFPA 1E0WA 1OIMA 1L2QA 3WF1A 3C2EA 3OEXA 1Q4NX 2VRKA 3MS8A 4FLOA 4ICNA 4Y8EA 4UTJA 4M3PA 2VVSA 1NQKA 4Z2LA 2FVMA 4TX9A 1GYNA 2WOQA 4AVNA 2UZ9A 5HNNA 4IX2A 1O94A 4KRZA 4OKDA 1QBAA 2H3BA 3ABXA 3PAJA 1ZL1A 4U2YA 1R3RA 4GGBA 1HO1A 1T5AA 2EEXA 3O3RA 2QCGA 2Q01A 2Z1SA 5DMNA 2YYUA 1R0MA 5CAHA 5FI8A 2D0FA 1OT2A 1T96A 2X30A 5A8QA 1SPQA 1CGVA 2Z1VA 4B91A 2CLPA 3OBAA 3SECA 3GTHA 1W5OA 2VCCA 4XZNX 3A4WA 4KGJA 4S38A 1GVYA 3THAA 1FWWA 2WHKA 3EOOA 2D0HA 2WMHA 1F4HA 3MYOA 4MF4A 4GWEA 5K9CA 4FX8A 1HL9A 4F0RA 3BICA 4RR4A 2Z1KA 3THQA 5TQLA 3VDHA 3L21A 3UPBA 1NOFA 1OK6A 4IX0A 1MEWA 2XISA 1T8QA 3G1FA 5T8GA 1QHOA 3G6MA 1IEWA 2DV0A 4ZA0A 3O05A 4QE4A 4GUHA 4ZQNA 3RLUA 3BOFA 2EXOA 2B31A 1Z3NA 4PFHA 1YMYA 1JI1A 1KM4A 3RRXA 3BAWA 3CLWA 3NPWA 3T8QA 1ONWA 2PDKA 1BYDA 2POZA 3IGSA 2XDFA 2V30A 3MDUA 3HTWA 1FWAC 1DEDA 3BAKA 3E38A 1R85A 1T40A 3SURA 1TJPA 2H8XA 4PFMA 4RCXA 4AD0A 3LZ5A 3FHQA 4M1BA 3ATZA 3B9DA 4MNMA 1QO5A 4XQ6A 3W1RA 2OT1A 3DEQA 2AMXA 1H7PA 1MMFA 4IUOA 3BGJA 3VC6A 3NR0A 3UR2A 2D3NA 2X0SA 1P48A 4L6OA 3GWQA 4Q8VA 2QJJA 5TBOA 1OM0A 2FGBA 1TWIA 1KM2A 2FJKA 5AC7A 1UWQA 2QJHA 4O11A 1DIEA 1TA3A 3R10A 2V67A 5HINA 4WKHA 2HQAA 4LW7A 3W2JA 4ALDA 4AHQA 1XIHA 4MWAC 1UZHA 4LS0A 4WKFA 1KXVA 1SGJA 1LG1A 1FWSA 1TVLA 1BXCA 3G0SA 1OFOA 3C4UA 2W66A 3UA3A 3DBPA 4OECA 5E9AA 4KFOA 1IR2A 4EOUA 1Q6DA 2VGBA 4W87A 3EX3A 4KETA 2YOCA 1UWIA 3UT0A 1KTCA 2J88A 4DUVA 2QCDB 4ZO9A 4DF2A 5HNRA 1CLKA 4JTCA 3W76A 5EPDA 1Q4WA 1YQ2A 3EPMA 1EC9A 2WLYA 4Y9PA 4UFIA 5D8WA 2HDJA 2ZX6A 4FPSA 2XGZA 4RDZA 1QW9A 2WVSA 2Q71A 3U2ZA 5I5RA 4DJDD 3A13A 1V0MA 1H7NA 3RLGA 3LHYA 1R5YA 4UMAA 2A6NA 3P5ZA 1NWRA 1T6MA 5IBXA 1FDZA 1DWAM 8RUCA 1S5WA 2V3FA 3JRKA 2WV8A 4LAOA 2ZWZA 4Q8WA 1P4CA 4E6MA 1EP2A 4BCEA 1GKPA 3QY8A 1RBLA 5HANA 2WNQA 3AIBA 1GW9A 3TWBA 4JTAA 4ZOEA 1W5PA 4GXWA 3S3GA 2IMRA 3ARUA 5KMYA 1QNRA 1YNYA 1VBHA 4XO7A 3EX4A 3RM9A 2XN2A 1ZY9A 2GWGA 1R8LA 1OC7A 3W24A 4U5KA 1R86A 5EBAA 3G1DA 2PD5A 1Z69A 4E4PA 4DVOA 3WQ5A 5MF5A 2CCRA 1GYMA 2NV2A 3B4YA 4KIRA 2E4TA 1UKOA 1V02A 1PIIA 3AMLA 1MSSA 3W86A 3HJZA 2W6RA 1UR0A 3H55A 3LX9A 3SN1A 1W91A 1UYQA 3BCDA 3PWAA 2MANA 2VOMA 4O14A 4MGGA 2CKSA 4BF7A 1F74A 1ICSA 3FIGA 3GS6A 1KM6A 4ZL1A 3W1NA 3ZXWA 4MY9A 4Z2JA 2WANA 1NARA 2GJXB 3LGGA 3PSVA 3EB3A 1D3HA 4V33A 3FA5A 3WLNA 1GUVA 2PBGA 4WOZA 3ICJA 1V3JA 3B8TA 1OB0A 3OVGA 2WNNA 1KR0A 5FSDC 4PTMA 2GGHA 1XGDA 3C0LA 4YTTA 4B9YA 3S2LA 1TV4A 4HCHA 1C8VA 2AGTA 2HVOA 1DORA 1A0CA 4MIMA 4QJ1A 2HPIA 4JCLA 5E0KA 3T2QA 2X2YA 3M0ZA 1GW1A 1UUQA 2NUWA 6TIMA 4GY7A 1CXLA 2Z24A 1XICA 4UOQA 2EQDA 2B7NA 1FHLA 2GWNA 4R9XA 1EXBA 3KHDA 4I5XA 2R1PA 2A3HA 4H41A 1RA0A 3QJAA 3WF4A 1XUUA 1W3HA 3SCTA 1ICQA 1OX5A 5CSSA 1JD9A 1M04A 4AD4A 3TQVA 4LOCA 3W7CA 2PP3A 4PMDA 1TUFA 2GSEA 2WKLA 3WLQA 4ZQMA 2OSWA 3P14A 1NWTA 1IZJA 2GPTA 2A3LA 3IK4A 1DJNA 1YNQA 2WJFA 5IM51 1BFNA 3UPWA 3ARWA 1OYCA 1ENUA 4K3ZA 2QAPA 2OMAA 3EXRA 3G22A 5DLCA 3MMDA 1KFWA 2RGLA 1M41A 4BF5A 2VWTA 3G18A 4L61A 3GR7A 5BXTA 3LSBA 4BKNA 3L5MA 4PUNA 2D2GA 1FWEC 1K9TA 2HBXA 1VCVA 2R82A 5DBTA 4F0KA 5EMLA 3TEVA 1K02A 1JCJA 2ZZ7A 1W9PA 4A4AA 3FA4A 4IT1A 3BANA 3WZ0E 3L5AA 2NXIA 4LPCA 3J7HA 1XLCA 1ZAIA 1K4HA 2G4JA 4JNMA 3SQMA 4JGDA 3PZNA 3EOLA 5HQMA 1OC5A 1H5VA 1RJRA 4U31A 4W84A 1RD5A 3DG7A 4DRSA 5B7ZA 3GZAA 2Z00A 2UY5A 1J0IA 2PGEA 4HGXA 4LJ3A 3U2OA 2B0MA 3QV9A 3UCQA 1DHKA 2PB1A 4J4KA 1TWDA 5E0FA 3I6RA 4QDPA 1C9WA 4RDYA 4Q6XA 3AU2A 1M68A 1BWVA 1GKQA 4DBSA 1TWZA 5D9MA 4WJEA 5J8LA 1YHTA 3B97A 3KRBA 4JFTA 1DTNA 1PS9A 4IQDA 3W1TA 3F4VA 3TCEA 4UR9A 1M03A 2RH9A 3FEMA 3WD3A 1JJKA 1EGMA 5H91A 1J11A 2J47A 4QS5A 1C8XA 1HJSA 4S2BA 1HKWA 4F9DA 2BLEA 3ATYA 3C52A 4JNZA 4PRRA 1V51A 1Q5MA 2XGBA 1O60A 3PZIA 1YDOA 2Y88A 3O63A 1Q13A 3EOUA 3N6QA 4J40A 2OSXA 3GNPA 4XG1A 3L9CA 4M8UA 3DIPA 1YXDA 3W1QA 3SRHA 3TFCA 3LK6A 1WOAA 4MNKA 1G9HA 5K7JA 2DW6A 2OX4A 3IIZA 1PKLA 3H2OA 3UGVA 1S2AA 3ELFA 3IIPA 2INZA 2IQTA 2PTDA 4IJBA 4XZMX 4EXBA 2Y6ZA 2I57A 4NJHA 1YPFA 1BF6A 4AC1X 4C5ZA 2ZX8A 3CMGA 4LGXA 2KAUC 4AXKA 1RH9A 4I5UA 2RJHA 5F2IA 1S39A 3LXBA 3ITLA 3DFHA 1OSEA 4GI6A 2YCKX 1SSGA 3RRAA 4C7DA 4K37A 3TC7A 1XI3A 3S6TA 4C6JA 1W54A 1L0PA 2JK2A 3DYMA 4YYFA 4NNCA 3E49A 3QPYA 4JFSA 5FF3A 3MPGA 3FFSA 3OBKA 2JGYA 3BV4A 3TTYA 1E4LA 4I7WA 1XLJA 1GVSA 4RUBA 4U10A 2Z27A 4FNRA 1ZHAA 3HPAA 2D3LA 2OPJA 1K8ZA 2O0TA 3W00A 1QPNA 3W7LA 5KZMA 1FDYA 5H8MA 3EDDA 2BDQA 1W31A 4B3KA 5FESA 4PMUA 1UUOA 4LC8A 2IKJA 2JEQA 3NNTA 2PWVA 1EC7A 5DMYA 3LEPA 3ARXA 4NAEA 4PC8A 1OEPA 4FNTA 2XIQA 4IPIA 5E9XA 2XJ7A 3KZSA 4NU7A 2PDYA 2RUSA 3ZR5A 1LOLA 3GXPA 1UA3A 1BG9A 5DFAA 3SY5A 5AZ0A 1E6QM 2C14A 1KC7A 3EKZA 3TAOA 1X1ZA 4HA1A 2NVAA 4GJIA 4DAFA 1H1ZA 4I9AA 1YE4A 3TQ0A 3K4WA 1GVRA 1HJUA 1XG3A 5FJTA 2WKJA 1R3SA 1EO7A 4TIMA 3IUIA 5DY2A 4JTGA 3R7MA 3AS0A 3N2XA 4PTWA 3OOQA 2D73A 4NZ3A 1G4SA 5F4XA 4HP5A 4H4IA 3TP4A 2DQXA 1KBKA 4G7EA 1YW1A 3AJ7A 4F66A 4R5EA 1HNYA 1FY6A 3NXFA 3GU2A 4JTQA 4B4FA 4LUIA 4UZUA 3NOEA 4QQ3A 4TTUA 1DYSA 1U83A 3M5XA 4HU0A 2OEKA 3SN4A 2CNCA 3KBVA 5E93A 1V3LA 1REQA 3DXIA 1R3WA 2PWDA 4QX4A 5BCAA 5K4ZA 4LAKA 1QNOA 2VZSA 7REQA 1IYXA 4H7CA 4CCCA 1TQJA 3PN8A 1ZP3A 3V4BA 1ZJIA 4QXIA 7CGTA 3FK4A 3TOPA 3QXBA 2J6XA 4KCWA 5A6SA 3W27A 1J8VA 1LZOA 3BLFA 1US3A 3K5XA 1POJA 4PODA 3QGAC 1F73A 4FNSA 5AOUA 2QIIA 4ATDA 4I8DA 4HHMA 3PTDA 4P2VA 3WIJA 1XH1A 4ZBCA 4H1ZA 4DX3A 5A1AA 5CEWA 1TMQA 2J7BA 3CB3A 4DZIA 1PTAA 1HZYA 3ARPA 3GTIA 3EDKA 2I16A 5FIPA 3NGJA 1U1JA 5BRQA 4UXDA 2ACQA 2XG9A 5D04C 1OJXA 1OHLA 3BCJA 3O9NA 4Q4QA 3QQ1A 4PSRA 2DSVA 2CESA 3AS2A 5FJRA 2PUZA 4L1XA 5A6KA 3WH6A 2B7QA 1L6YA 2QYGA 4N9CA 3W70A 1Q8JA 1AQHA 1SYTA 3W85A 1UC4A 1I0BA 2ISVA 4LBRA 4LUSB 3PSWA 5JH1A 4Z1CA 3GNDA 1L6GA 3UXIA 3VIJA 2G37A 4HHPA 2PPGA 1JYWA 3PZMA 3RLVA 3W1LA 1EJRC 3TMLA 3BV7A 3KRSA 4PULA 4REQB 4P7NA 3AUOA 2DVTA 4GCAA 1XLDA 1JXJA 3PBGA 2X42A 2NVCA 2WZEA 3QPZA 4GXMA 3AQUA 3WH7A 3MSRA 3F4WA 4HNTA 5E0CA 4QJ5B 4V28A 3UXDA 1TCMA 1R30A 3OPSA 3K2GA 2ZTKA 1ZRQA 2BZNA 5G1YA 2J7FA 2HNHA 3BLEA 3MMTA 1BXBA 1SFLA 4JQ4A 1XCFA 3VFCA 2KZHA 4JAWA 4FXRA 1DP0A 1Z41A 4HNVA 1UZDA 3LLFA 3GC5A 4FOUA 1RK6A 3UQNA 1VPQA 1FVPA 3UGRA 5CC7A 1ZBKA 2Y8VA 2Z4GA 5CZJA 4PMQA 2OEMA 1J9YA 4B90A 3A5FA 2OO0A 3AMDA 4ZOAA 4PTXA 3GUWA 5DELA 5GJPA 3E1F1 2JBMA 2DIEA 4UC5A 1Z89A 3GR4A 4DY1A 2DFAA 3OQ8A 3L4XA 3IVUA 2EKGA 1S1PA 2XTKA 3NURA 4O50A 1WQ5A 4B3LA 1A5LC 3F2BA 4PCNA 1TZ7A 3AYRA 2ZE0A 5M17A 3W0KA 5ENLA 3O6CA 2XSBA 1PCKA 3PJTA 4TTGA 3F03K 4WEVX 3AJXA 5K4XA 4XK2A 4XUGA 3TZNA 3N73A 3RPTA 1KM0A 1SVDA 4ENLA 4NYUA 4M6QA 2PRLA 2C13A 1SR9A 3O0KA 3SUWA 3W7PA 2WCAA 3CWOX 4CGTA 1EO5A 1T0OA 3G1VA 3GFZA 3SSJA 1GT8A 4HMNA 3LHWA 4FK9A 3ANYA 1Q7QA 3TNOA 2W4XA 2XSXA 1QTWA 3LMYA 5HATA 1RQEA 4H7ZA 5C6MA 1XIIA 1TJ2A 1RPXA 4J1OA 3R43A 4HHLA 2QF8A 3RJYA 2WNWA 2BG5A 3SCOA 1GOWA 1KBBA 3VYLA 1KGWA 4LBUA 1GGOA 3T0DA 4C6FA 1MFVA 3TXVA 1NDYA 3CQIA 3NEVA 2OELA 1NAL1 6TAAA 3S6OA 4TR9A 4KBXA 3TFXA 5DXYA 4LU0A 4W5UA 4BEUA 4J3VA 4RW3A 4KWWA 3H8AA 4MPKA 2VEMA 1TV8A 3G1RA 5BU6A 4AZCA 1UOZA 3S9IA 1TA3B 3TONA 1FP8A 3LRLA 3WQEA 1AFSA 1QNQA 2OOFA 2QT3A 4UQBA 4GOAA 4FA3A 3C8FA 3CAWA 4FX7A 4IGMA 2GQ9A 5A6BA 4I8YA 3EMZA 5EFDA 1B4KA 3Q94A 4A8NA 4B9ZA 3WELA 1J2BA 1H41A 4Z1DA 1E9ZB 3USZA 4JYEA 4BQ5A 4UFHA 1PYFA 1CIUA 2EG6A 2RHGA 3W4RA 1XFCA 3O8AA 4H7VA 3JS3A 2NV9A 1I4NA 3BSHA 3VOFA 4O52A 4N42A 1G94A 1RLDA 1XINA 3AIQA 3I7RA 2X1SA 3KOZA 1S2WA 4CN6A 3QGKC 1CZ1A 1NQ6A 7ODCA 4V27A 1BG4A 4QRNA 4B5TA 2PLKA 1CI1A 1XW8A 1PDZA 1KLZA 2OODA 1PKYA 1ZNNA 2X2GA 1MW1A 5AYBA 1O7AA 1DWJM 1QHPA 1OINA 3M0KA 3ZR6A 4AU0A 1PCWA 3N18A 3TA9A 3NQAA 2MUCA 3O15A 1P0BA 2PU1A 4NY2A 2PDWA 3W7JA 1Q45A 3ZT5A 5PTDA 1Z48A 1J4EA 3UBPC 1AMYA 4QJ3B 1JNEA 1QT1A 4PMNA 3TVAA 5LNSA 1PJ9A 3UR8A 2OCZA 1KFKA 2IKGA 3EWUA 4H9UA 3N6HA 1XD1A 3O07A 2V5BA 3G3DA 5IFPA 4IIGA 1GORA 3MSDA 1ME8A 1N55A 2ACRA 4MWAA 4ZZ9A 2G3NA 3M0MA 3M5YA 4E4UA 2PDPA 1ADDA 4QQUA 2YKKA 4CD8A 5ABTA 4BJHA 2VVNA 2XGIA 4JX6A 1XIJA 3OZYA 3VC5A 3LN3A 3TUUA 2QVNA 1OGBA 1N8FA 4M81A 1JPIA 1TJ1A 1M9HA 2EPMX 1KCLA 2J8GA 4QDWA 1WUFA 3WFLA 4GIRA 8TIMA 4EPEC 1PPIA 3LTSA 1SZEA 4GQRA 5D03A 1FCBA 1G01A 2BOGX 1OCQA 3U0HA 1U1UA 2A3AA 3RU8X 4DPQA 2DZUA 3P3BA 4IH3A 4AY8A 1NFBA 1LWJA 2V3EA 3BSGA 1QI0A 1E4IA 4ZQOA 1TPVA 3BJSA 4JIIX 3W1MA 3WLMA 1JZ4A 4H83A 3KDNA 2ZC8A 4KESA 4DUWA 1JUKA 2WC4A 1KGUA 3NL6A 3WH9A 1F4AA 4O4WA 3ZO9A 3RXZA 3IJIA 1GVIA 1N82A 3W72A 3SUVA 3E2RA 2EBNA 1BEUA 2C79A 1Y5VA 2ZX7A 2GSHA 2A2IA 2ZXDA 5A94A 3UNDA 3M44A 3KS5A 3TQPA 5AECA 4JN7A 3MVTA 1T7LA 4EPDC 2WC7A 3OP2A 1DJQA 4DPPA 5IOBA 1NEYA 1KNWA 4EP8C 4Z1BA 5KTLA 2O55A 2GVEA 3PJWA 2CERA 3F5JA 1KV5A 4L6DA 1TELA 4JY8A 1V3KA 4L4LA 2NQLA 4H9MA 3N9RA 1R6WA 4L65A 3AIEA 1LBLA 3PZUA 2OXNA 2BY2A 4QCEA 1M53A 1BF2A 5EFFA 3EGJA 1S2TA 4HT3A 4F9JA 4LYQA 2FGLA 1Q6QA 1GQLA 1TQXA 2YB4A 3WQ8A 3M0IA 3CXOA 1UC5A 4UQEA 2G3MA 5KZEA 4WJXA 3OA5A 1LOSA 2QMJA 3P5YA 1Y0EA 4XVEA 4DWSD 1YRRA 1NFGA 2GLKA 3JZEA 3HPFA 4WY0A 4AEOA 3N11A 1BTMA 4WIWA 3HG5A 4DJDC 3LZ3A 4QTGA 5FOOA 2X1TA 1ZP4A 5LHFA 2DU2A 4PBFA 1JUBA 2PRMA 3S2JA 4E2VA 3TC3A 3WSUA 2HVNA 1DIKA 3NSNA 1FUYA 3OVRA 4O1AA 4IMGA 1J6PA 1YYAA 4S3JA 2PWGA 5KSWA 4EAMA 1NOWA 3BE7A 2Q3OA 2W27A 3OO2A 1O5QA 3S4TA 2D2HA 3WFZA 3KOYA 2RKXA 2YDQA 3G1HA 3WNNA 4EPKA 1UKQA 2QDEA 3AYVA 3UEQA 1KWKA 3I6EA 5JBEA 1QWKA 1A5SA 1JZ2A 1TPUA 4KWVA 3VIPA 4IICA 1ITXA 5C2GA 2PCQA 3A12A 2L5HA 4AW7A 2WVVA 5A2BA 1NIUA 2IQDA 3ISIX 4QAWA 1JDEA 4GABA 1R3YA 3FVDA 3ANUA 2WMGA 4C6QA 2BY3A 4EXQA 3BZJA 2VL4A 3WBWA 4QE1A 2EHHA 3JR2A 1XPGA 3SFWA 4HBKA 3W23A 4QM1A 1UQYA 4UCGA 1S5MA 4ZOCA 1F6PA 1P0DA 2WO5A 3GBDA 1XBYA 4XKYA 3LI0A 3EX6A 4JDYA 3BARA 1PV8A 3LB0A 5BRBA 3O7UA 2PMQA 5CG7A 2INFA 3E5PA 4QG6A 2CLMA 4ROQA 4YJ5A 1XYLA 4JBRA 5FAGA 2XFYA 2VI0A 4M5PA 2HE8A 2PDIA 4HNOA 1P43A 1F9CA 3NQDA 3FOKA 5EY5A 5A6TC 3VMOA 2E6AA 4ZVJA 3DFQA 4DI8A 2H9AA 1FQ0A 1C9DA 1RP9A 2FZDA 3F4CA 3TW6A 1MEHA 3ZZ1A 1MI3A 4FF5A 1JF6A 1GTEA 8XIAA 4LSBA 1LCOA 4I7UA 4GCXA 2OG9A 2DPEA 4X63A 3Q37A 3QR3A 1GOKA 3VIOA 3FCPA 3DFYA 2VX4A 2CHNA 4QITA 3XINA 5DCDA 2GGEA 4JXCA 2E8YA 3VI2A 3C2OA 2VX6A 1ZBVA 3WNOA 3B40A 3PG9A 2WSPA 2FJUB 3T1GA 1M7JA 4OTKA 3M7SA 2F6UA 2PWUA 1AG1O 1DJXA 2H8ZA 2WMJA 5CQ1A 1XIDA 3N1AA 3C3NA 2BWGA 3ABOA 2C0AA 3B9OA 1ODZA 2XWEA 5C5YA 1TE1A 3ZSSA 1X96A 2PF0A 4NAEB 3VTRA 3AHTA 1XLKA 2CLOA 5LHEA 2DZVA 1XRFA 4YIWA 1NWUA 3UPMA 4KEZA 1LG2A 3LPPA 2RJGA 4Y9MA 4HSNA 4TOQA 1AW5A 1KO0A 4J3TA 2I5GA 1F3EA 4N4QA 1DV7A 2EPHA 4RZ5A 1XYAA 4UFMA 2VYOA 1GCYA 3FXYA 3VDGA 5FD0A 3PAOA 1ZCCA 3LNPA 3RILA 1VP5A 3IAPA 5JU6A 1HIZA 1Q6LA 5FJUA 1US0A 2PBOA 3CAQA 5D32A 2OZ3A 2YL8A 4GACA 3DKJA 1EX5A 3TV8A 1I1WA 4FZIA 3W1UA 3LQLA 7TAAA 4X2RA 2CZFA 3RM4A 4G7EB 2B7OA 2VZUA 4Z0SA 3GLCA 3AIWA 4LTSA 2IS7A 4JEQA 2XVPA 1IWPA 3S5OA 2QDHA 4LVGA 2XH2A 1MZRA 4ZTXA 4UFLA 1KXTA 3TSMA 1XLFA 3H2FA 1ZS2A 2QS8A 3KM8A 1D9EA 1REQB 1F6YA 4FNPA 3S42A 1XD0A 1F3XA 7REQB 1P7TA 2FZMA 3UYCA 3VNJA 2WM0A 4O0ZA 1E3ZA 3L4VA 4LAZA 3N17A 5CZ0A 3SDOA 2BGNE 5LA0A 2Y2WA 1NF7A 1Y65A 3QYSA 1IT8A 4PTDA 5I03A 5FL0A 2BXYA 3KTXA 2E77A 3WG6A 3RO6A 1XHGA 3AHYA 3IUHA 3ES7A 3P61A 1CXHA 2C3ZA 4MTVA 2ZVRA 5KITA 1PAMA 2OO6A 3WLJA 4BK9A 4M19A 2DEPA 2VFIA 4O1EA 3I3EA 4B15A 1ZJHA 3CHEA 3VIMA 1VFFA 4WSKA 4XIAA 4FI4A 4AY7A 1U2YA 3ABSA 3V16A 5L6UA 2G3IA 5HJXA 2OYKA 2JGQA 3NQVA 3L0GA 2JIEA 3AUJA 2VR2A 4ZCWA 1ZPTA 2AL1A 4U28A 3V5CA 1LYXA 3NYZA 1OF8A 3HM7A 3TA6A 3K13A 2BVDA 2QF7A 3AU6A 1UZ1A 3ITTA 4GI8A 1JQVA 1CXEA 3EDJA 3PPHA 4W7UA 4MNJA 2FH6A 2FTWA 4PYSA 4IL0A 2ZVIA 1O68A 1W6TA 1WV2A 3WNLA 5GPRA 2PDHA 3TTOA 1NU5A 3VNIA 1ISWA 5K9XA 1QI5A 1GJWA 4JTIA 4ZSUA 1R7OA 4W5ZA 4FSAA 1P0KA 1PL9A 3AWNA 1MXDA 3TLQA 1Z42A 3WLSA 3VABA 1B54A 2WJZA 3LCIA 4DF0A 2WBKA 2WQPA 3PPCA 1EGVA 4HJWA 1R2RA 4A21A 3SN0A 1DQUA 3W1AA 4B5WA 1G67A 1H62A 3UU0A 4TX6A 3LA4A 4IG2A 5LNUA 1H49A 5HNUA 1PHWA 3H6OA 4H04A 3P93A 4S3EA 3DFPA 1F76A 4M82A 2ISFA 4F40A 1HP4A 1I0DA 3WUGA 4QG9A 1EL3A 4TVDA 3GR8A 3WQDA 4RXFA 4ERGA 2YDAA 1ITQA 2Y5SA 3KUMA 5BXRA 4LH8A 1AVAA 4JTRA 3V7PA 3I65A 2XM1A 4AD3A 1PZ2A 4NUWA 4H8HA 2J27A 3AXXA 2BSLA 5CPMA 4AEEA 3MT1A 2GUUA 2W92A 1K8XA 4YN5A 3SJ3A 6XIAA 2ZCGA 3AISA 4JTFA 3H2AA 4C6BA 2ZYFA 1YXYA 3PK7A 4Q33A 3SCUA 2ALDA 3PBUA 2NXHA 4AEFA 2OWCA 3DZ1A 2JKPA 1EB3A 1X6LA 5MHBA 4GYPC 1FWIC 4GH1A 1YE6A 3QOMA 4GUJA 1B3OA 4XISA 5ECVA 3HG4A 1RVGA 3AMCA 4MHBA 4I9TA 3K8LA 2YCJA 3L4UA 1E6RA 7ENLA 2HNEA 1M7XA 3GNNA 3UJRA 4BFAA 4DJFC 4AFYA 5F1UA 3WJWA 2Y63A 4GISA 1D2KA 3EYPA 2TMDA 1FWRA 3GYCA 1OCBA 1WKDA 4XAFA 1RAKA 2EPLX 1GJPA 4UMCA 2VZVA 1ZENA 3W7RA 2E0PA 5CSUA 5G4EA 1XPYA 1YKWA 3SO7A 1IF2A 1OY0A 2QDGA 2XIIA 1V6YA 5A2CA 4S2CA 1KR1A 4IP7A 2PZ0A 1SJBA 3QZEA 1B57A 4J27A 1MNSA 1C91A 5GQBA 4AIUA 2YGYA 1QPRA 4RX0A 4IL2A 5FEZA 4NQ1A 2J75A 1XDLA 1A0EA 3FX4A 4PL2A 1HJQA 3AMGA 3V1HA 2BOFX 3KL5A 4CKQA 3GIQA 5CKSA 2CZ5A 4PBEA 4YTUA 2DT1A 3V36A 4LALA 4JD4A 4IGHA 3ZSTA 3FLUA 3PJUA 4GGHA 5C55A 4X9SA 4AVOA 3RF9A 1XC4A 4E0CA 1F07A 1IEVA 4IMCA 3TCSA 4WK9A 1AUSL 4KWOA 1O95A 3QOKA 5HQLA 2FVLA 4CQBA 3GNOA 4I3GA 4O16A 3LY0A 4A8RA 4NVTA 5F4WA 1F2JA 1F6KA 2X1RA 2Y24A 3QY6A 3NL5A 1C29A 2OVLA 4RZ4A 4NZ4A 5D09A 3MUCA 3ITOA 4KH2A 1DBTA 1GK8A 1VCFA 4GQGA 1W5MA 4J2PA 1HG3A 3WUBA 3HPSA 4UUIA 4DZAA 1PIGA 5HMSA 4J35A 1NP0A 2G8ZA 1EIXA 1QNPA 1XLAA 2QCDA 3TR9A 4J7RA 2PWFA 3N2MA 3MDWA 4GI4A 1H1YA 3OVQA 4U33A 3TJ4A 5LYRA 2R1LA 2OEJA 4OBSA 4J3WA 4WHBA 1IIHA 1I2NA 3GVGA 4UB9A 2OU4A 4GVGA 3UY7A 4C6IA 5JBFA 1SQ7A 3QKEA 4LCRA 3WEMA 5AZ1A 5E6ZA 1H60A 1OFEA 2BTMA 3PTQA 2B81A 2OKOA 4H00A 3M0YA 3LQGA 1B31A 4RNIA 3STFA 1OT1A 4UFJA 4JIPA 4QGCA 3E74A 1DWFM 3S1WA 4HPJA 3SCNA 5BW6A 3S5YA 5A8MA 3CU2A 3GDLA 5F7UA 1IXOA 4ECLA 3M6DA 3UVAA 4F2TA 4B5XA 1JD7A 2WPBA 3QHMA 3MYPA 4GJ1A 4WCJA 3EWCA 4ZQRA 4US5A 1W3IA 1X1OA 3RG6A 2PDJA 2WZTA 3AICA 1QFEA 4CVWA 1Y5XA 3T07A 1WA3A 1C8YA 3KHJA 1DE5A 3V18A 1DWHM 3BWWA 1H2JA 3T55A 2VC9A 5A2AA 2E68A 3WLOA 1OABA 3SGZA 2V5LA 4LY4A 1OBAA 1FX6A 1WDWA 5LXEA 2ZRWA 4YTQA 2HBVA 1A5CA 4O19A 1POKA 3C0JA 1XLEA 4UTTC 3QEZA 4XBKA 3QW4B 3WDRA 1S3HA 1NOUA 3WH8A 5K3VA 3WEOA 3VZXA 3T0TA 5CGMA 1UCWA 3W87A 1RD6A 4FB7A 3TC6A 3NQBA 3UJFA 1EYWA 3WLHA 2YBUA 1JGIA 1XR2A 3TTSA 4JHZA 1Y5WA 1XDMA 3PUDA 4FHAA 1OD8A 3R89A 3WF2A 1JXKA 3QQ0A 4OUIA 1QMLA 3K4DA 2PS2A 4YLWA 3F4DA 4HOXA 1ZU8A 2PP1A 1IIGA 3UWQA 4Y6GA 1C7SA 1A5NC 1CEOA 3LENA 2VC5A 2W79A 3KRZA 3TJLA 1FHDA 4LANA 4UTFA 1MRAA 5TIMA 2OKTA 4GG9A 4C6NA 3B0XA 5LIUX 3NQ2A 4R7WA 4MB3A 4PEEA 4NL1A 1GOOA 3HJEA 3XIMA 4IIFA 2GYIA 2HV5A 5IDZA 1E4NA 5DMLA 4XBJA 1T99A 4JIRA 1WNOA 2ZUTA 1VJSA 4CNUA 4UTKA 3R25A 1A5BA 3N4EA 3JU2A 3DFSA 3WMBA 2YL5A 4L5ZA 1EUAA 3GDTA 4O0QA 3P2VA 3N2BA 4PRTA 4KEVA 4JL2A 2FYMA 4HK7A 1MXGA 1BQCA 1TWSA 3VCRA 3IV8A 2DUZA 1OG0A 5I7GA 4C90A 3O06A 3LGDA 3C8NA 2XZ9A 1L6WA 1ELSA 1RY8A 5A3HA 2YIHA 4IUGA 3R12A 4QLJA 1WUEA 2VZOA 3GDBA 5BROA 4NX0A 1EHAA 3LBCA 1WZLA 2XVKA 4P7LA 3NZQA 3C0SA 3H4GA 1VLIA 2CBJA 4J2MA 4PMXA 4Q4RA 3OHIA 1G6CA 3BLOA 1D8WA 4WDUA 1XV8A 4HK6A 5I3FA 2CITA 3RIKA 3HQ1A 4BHYA 4URIA 1KRCC 1LWIA 2JALA 3Q4DA 3P82A 4EX4A 1DJWA 2FH8A 2QJIA 4JX5A 9XIAA 4EKJA 3UWWA 4ZEPA 4Q6JA 1K8YA 1QI4A 3GXFA 4MJMA 3LHVA 2CWXA 1Q2RA 4IMFA 3PPGA 1GONA 2ONEA 3I7QA 3CWHA 4XKYB 5H6HA 4UNLA 1QDSA 1TTJA 4WSHA 4GQBA 4JTUA 1D7FA 1K03A 3CV1A 4JOMA 4PUKA 4UR7A 3B8IA 3CYVA 4HZMA 2A3CA 3OHMB 2OX1A 1G7UA 4Q8QA 1E6NA 4QHRA 3ZVIA 2REQA 4PMOA 4QS6A 4XB3A 4B16A 4F0MA 4DO7A 4QJ4B 1G1YA 1VYPX 3ORWA 5DN1A 3IWPA 2PDGA 4J3SA 3AALA 2ACUA 4IQJA 2R94A 4EF9A 3BW4A 1FBAA 2WK2A 1AL7A 4KF1A 3W82A 4PUWA 2IPGA 4DJDA 4D6DA 3GG0A 1BYBA 3BLKA 4ZGYA 3W7EA 3A6OA 3GYEA 1M5WA 4Y2WA 4GNJA 1NDZA 4YCOA 4ZENA 1JRCA 3T8LA 3R4IA 1YIXA 2YX0A 2OLAA 4WJ8A 1IT7A 3U7BA 2QUVA 5HMDA 1ZJAA 3QW3A 3NPXA 2NX1A 2FHFA 4GE8A 4N9BA 3AS1A 1IXQA 4CD7A 3GTNA 3ZJ8A 4CCDA 4M7SA 1UP3A 3EKLA 4AXNA 3L5LA 4NKCA 2A21A 4O18A 1QOPA 2J79A 3MW7A 3GAKA 4KCUA 3M43A 4NJJA 3JZUA 4O15A 3PFRA 4BQ2A 1UWAA 4AHPA 2PDXA 1J2WA 2QUNA 3K8KA 1W2VA 2ZUUA 2FB2A 5I3DA 3G2GA 2Y8UA 3W71A 2EG8A 4LUTA 3VGFA 1A5AA 3ARRA 2PAJA 3WUEA 2WB5A 3FA3A 3W28A 3VIFA 3QY7A 1UD6A 1ZJBA 2E8ZA 1LRQA 1IHIA 1EA0A 4HPGA 1IQ8A 1ZAHA 4PBGA 1J10A 4JIEA 3MUZ1 3IJ7A 2GGJA 4E2BA 3APTA 5D8ZA 1D3CA 2BHZA 1XM3A 1XIEA 3KCJA 2E9LA 3PF3A 3PTKA 3MP3A 1UKPA 3HG2A 2C7FA 3A47A 4XZWA 2QCHA 1FHVA 1LWHA 1JYXA 4GQ0A 1GEHA 3KLKA 3BJTA 1O1ZA 4L4OA 2VM8A 1ME9A 3GXMA 3MV01 3UNTA 1ISVA 4DWSC 5CCZA 4L6HA 1QK2A 9XIMA 5A6AA 1NVMA 1E9IA 4RNFA 5FF0A 1TREA 1IGWA 3SADA 3EWXA 3STCA 3T0CA 3UJEA 1LQ2A 3ALFA 4MSSA 3ZIZA 2OR2A 3EMQA 1VBGA 5LNWA 3R0UA 4HN4A 4IP4A 1DJZA 3WL1A 4DXVA 4IPPA 5IHRA 5E5CA 1PB0A 1XYCA 4UQAA 2NVDA 1RQBA 2DQWA 1P7TB 2Y8KA 4CNOA 2R1MA 4GUFA 1H09A 4B2DA 1MUWA 4QSFA 1UHVA 3BTNA 3L65A 3CHVA 1TTQA 3UR7A 1G4TA 4BI7A 1B3VA 1A5UA 1BVNP 4V15A 1J79A 2VTFA 5ABGA 2EKCA 1W5NA 2P0IA 4S3FA 3IANA 5SWUA 8CGTA 4POCA 3ITGA 1U1HA 1JDAA 1TIWA 2XIJA 3UA4A 4IQEA 1WBJA 3BK0A 3WK0A 3ZLHA 3EX1A 4PGLA 1LOQA 3UP8A 2UY4A 1M6JA 3EB2A 4IF2A 3W7QA 5EBUA 4MAZA 3AIUA 2WAGA 2CU0A 3H7VA 5BOFA 3B06A 3UXKA 3CAKA 4JIHA 4ZR8A 2I7GA 1KFCA 1ZBWA 4CLMA 4QEEA 1AZ2A 1FH8A 3STGA 1W9BM 4Z1YA 1GOXA 5C9UA 5C0QA 1H61A 5I2UA 2ZRXA 4LF2A 4O1BA 3LCFA 5B7YA 3HV8A 3CZKA 1VQTA 4KFNA 4PUJA 4EPBC 1T8XA 3T4WA 4ZQPA 1TUXA 4L1WA 3W7DA 1VH7A 3TYUA 3GXNA 3M46A 3PPFA 4H9VA 1XJBA 1KCKA 4OUEA 3CV7A 1FHUA 3OW1A 3NQMA 1E6SM 3IGHX 2VWSA 3WL0A 2A7PA 3KVJA 5LGXA 3LTPA 5FF2A 2Y7DA 4D6CA 4IPLA 1G0CA 3CM4A 2WW5A 2P50A 4EIVA 1FH7A 2J7CA 1ZFJA 3CQJA 4JKMA 4QFUA 4W7VA 1UH2A 3TZFA 2W67A 3VUSA 4PA8A 1L2UA 3BCFA 3F7JA 5BXSA 3G0UA 2YA1A 1FXQA 3VDBA 4REQA 2V5JA 1XLGA 1YLVA 5G2HA 4JTTA 2OT0A 3RPMA 4LAUA 4O54A 2GDQA 1HXJA 5HULA 1SZGA 3ES8A 2V2HA 4D1IA 4H19A 4Q7NA 3F5LA 4N9DA 3FKRA 1RCQA 1NSJA 4FX6M 4P8WA 4PMRA 1OFAA 3SM0A 1KFJA 2X7WA 4LQ1A 1H3GA 4NNBA 4MUPA 5D05A 4BF9A 3HGOA 2ZA1A 1AODA 3H22A 1H4PA 4JPGA 3DFNA 1FWDC 5I24A 2WPGA 2YA2A 1ZALA 4CQ9A 3GVRA 4DJED 1CECA 2PLMA 2QUMA 4H6EA 3CTTA 3MI2A 1LL6A 3NZRA 1A5OC 2PTZA 4W8AA 4XBSA 3ENLA 3ZR4A 1RK5A 1X7IA 4HZ8A 5IRPA 6PTDA 2HSAA 2P0OA 4MDPA 1JCTA 4GVIA 5AHIA 3DC8A 3VD3A 3CL7A 1W3NA 2CIPA 3MCNA 2XSAA 1GHSA 1P5BA 3WQVA 5IXEA 1W1VA 3LCLA 2V2CA 3W2MA 3MZ2A 3PM6A 1MNZA 3B8SA 1W9DM 3EWBX 2CBVA 2CHRA 1TPC1 3D3AA 1ZQ5A 4JN8A 4MWAD 1YTEA 4GO9A 2ZBTA 2NZLA 1F7BA 4I9JA 3CUJA 4NIRA 3T05A 1SO6A 2A1YA 3WBEA 3AZTA 5M03A 3KDOA 4H2CA 3W81A 4WX2A 6ENLA 5CBBA 3K1DA 4PCSA 3QN3A 2RDUA 2TSYA 4D2JA 3LU2A 3GQYA 3IS4A 3K8MA 5CPOA 2CLEA 3NGFA 1BXNA 4E8CA 4PE8A 1XGZA 2QPXA 4A2RA 4FALA 4P7RA 5AN7A 5I3GA 4GJJA 3UR5A 4YYCA 1UASA 3NQCA 3QM3A 3WBXA 3R8GA 1E71M 2HJPA 4C6MA 4PMVA 3ZOAA 4H6KA 3WDJA 5E6YA 4GKLA 1O1HA 2BP1A 3S2NA 2YW4A 5M5DA 1RY0A 3SIMA 1OADA 3MUXA 3KTCA 3TW7A 2QV4A 4L80A 3GSMA 3CZGA 4GYPA 5M2FX 1V5XA 3GAYA 3LLXA 3E9AA 1WOBA 4XZBA 1A53A 4B5NA 4DM2A 1UB3A 3BJFA 2IW0A 1JUEA 3R94A 4FO4A 4TVCA 1YX1A 3EOEA 4J3UA 1A3XA 1QPOA 4NT0A 4AF0A 3HO8A 4DJFA 3POCA 3BMVA 3ZJKA 3LPGA 4HTYA 5G1TA 3CIWA 5GNYA 3L2MA 3WJSA 3IPWA 3R5EA 3BPWA 5E70A 3G1SA 2ZDRA 3GO2A 2Y7EA 1JPDX 4E5TA 3KE0A 5CG0A 4L4PA 2POTA 3BGAA 2VQUA 1QI2A 2BNJA 3N13A 1SZRA 2P5NA 4GD0A 4XVDA 1W9UA 2E5BA 1TR9A 4E2DA 4XAYA 3VM7A 1KTNA 3SW6A 4WXZA 3DOPA 2W5FA 5A5WA 3N9SA 1DIDA 1CLVA 1E70M 3UETA 3W53A 5LIWX 4O57A 3ZWSA 1S2CA 4GZIA 4UTMA 1V6TA 4ACYA 5D37A 3WY1A 2XPKA 3VD5A 3MKKA 1BPLB 1XYFA 3CUGA 2Z1WA 3NSMA 3ZLGA 1F3WA 1GNXA 4Q8PA 2XVLA 5D38A 4JEJA 4OOUA 3N3TA 1EF3A 4KERA 3UG3A 4Q4SA 1K1DA 5CBIA 2J6VA 4GZ7A 3W26A 2E25A 1KA9F 1WYIA 3V35A 3H53A 3WK1A 1XLBA 2A4AA 2WHLA 6A3HA 1AD1A 1XCWA 4QIUA 1QW7A 3CHCA 3AFBA 3PNUA 3Q65A 3OLIA 3A3XA 3H7RA 1E3XA 3P67A 1S46A 2ANUA 2CC0A 2WHMA 2BVTA 2FQIA 3PANA 1MYRA 5KINA 3SQSA 3PUGA 4QR6A 2WZHA 4CN1A 3G6LA 3BGGA 1XWYA 2V5CA 2R24A 4U3AA 1EDGA 1LP6A 2ZRUA 4IMDA 4M6VA 2DT0A 4Z2HA 1P1MA 2H90A 3T6CA 2W62A 3WNKA 3LSCA 3USBA 1AW1A 4JQ1A 5H8PA 3W7GA 1F8MA 3H24A 3WQWA 3FSUA 4CNTA 3GKAA 4Q4OA 2HXTA 2PTXA 3GHRA 1YEYA 1A80A 3VKCA 3UESA 1EDQA 2BVWA 1E56A 1EWDA 1PE1A 4IHCA 1Z9AA 5DRIA 1R47A 4O1DA 3Q67A 1J0ZA 2BB0A 3RR4A 2PD9A 4DB7A 1TPEA 1U5HA 2NUXA 3MMUA 1LLZA 1W9XA 4PR4A 1O4UA 2EAWA 3PHAA 3SGGA 4EWJA 8A3HA 2GDUA 4LRTA 1V3IA 1M3UA 4LYKA 3VIKA 4FIQA 2I9EA 2C1GA 4CQ8A 1JCNA 1ESWA 3FYPA 3MCMA 4PMYA 1WCGA 3NDOA 3LYEA 5IDIA 4CD5A 5HNTA 1X39A 3VKJA 4INFA 3OLDA 2YL6A 1RVKA 1N7KA 1M7PA 4LVAA 4KS0A 3S1GA 1UP0A 2ZA3A 1E0UA 2F38A 4IIHA 3VMNA 2YBTA 1QRQA 4DYEA 1JL8A 2PDNA 1L6SA 1EGZA 2QCCA 3PZ9A 1WO2A 4MUZA 4F2UA 4RE3A 1EKOA 4S3KA 2QQ6A 1FA2A 4WUIA 3U2EA 1QHZA 2I5QA 4CQDA 3AXHA 2GQ8A 3MI3A 4KQNA 3SUTA 4HSOA 3KP0A 4J3ZA 2ON3A 3RFAA 3WEZA 1A5KC 2Z2UA 1MEIA 2Z2BA 4XX6A 4ACZB 4UTTA 3STEA 1KM1A 2IUZA 3D0CA 1GVEA 1CW2A 2DW7A 1TX0A 1NH6A 1E0XA 3EWDA 3C3UA 3TTQA 2VEKA 3WN6A 1EEPA 4FXSA 4IIBA 3G77A 2OLSA 4R34A 2X0HA 1RBOB 3UERA 3B8DA 2I9UA 4KMQA 3ABQA 2QLYA 3HGRA 3GH5A 4WY0F 3TXZA 1ISYA 5FEXA 2SFPA 2DJLA 1XL9A 2EJ1A 1ONEA 1AZ1A 1PZ1A 2VFEA 5ABFA 1XC6A 4R3UA 1B1YA 2QDDA 2QAFA 4JTDA 3WDIA 1FCUA 4YCPA 3Q58A 4CEXC 1KKOA 4M6PA 2V5KA 4XZHA 3GH7A 1SO3A 4M51A 4N9EA 2Y70A 2ODOA 1W3JA 1B9BA 1W32A 3M64A 3H54A 1MQRA 3TN6A 3MSGA 5FL1A 3MBFA 2B4GA 4A3QA 1TTIA 4GY1A 2ISSA 4Z42C 2ISWA 4XAZA 3LDVA 2CLIA 1OGSA 3NZGA 4MMWA 1RSCA 4K8EA 1FWGC 1JZ5A 1XKJA 3S5ZA 3MUIA 2ZX9A 1HN1A 2WJDA 1VZWA 5CGTA 3L68A 4CVUA 1PX4A 2NQJA 3CV6A 3NPVA 3NCOA 4HCDA 4W86A 2REQB 1AJ2A 2J7GA 5T9BG 2DH2A 5DQPA 5HUOA 1YBQA 1BSLA 4Z1AA 4U2ZA 1JDCA 2VEFA 2WMIB 1VJIA 1XSIA 2VR4A 4X9YA 2HEJA 2XHYA 1KFEA 3HPXA 3KX6A 5BWFA 1SW3A 3MU7A 4AIOA 3PZOA 1ADOA 1H51A 3T0BA 1WXYA 2C1HA 4R33A 4CNSA 2JKEA 4FAMA 4PCTA 2GVLA 4HYWA 3T42A 4DBEA 4AWSA 3VCNA 2VEGA 4KIEA 3DBNA 3VMPA 3NZ1A 2ZXQA 3TTEA 2CBIA 4K36A 1FOBA 2YW3A 4H8VA 4JFVA 4AWTA 3CWNA 1SW7A 4MJ2A 4YNGA 2Y5JA 1TG7A 4K7VA 4JX4A 2Q6ZA 1DOSA 2GGIA 4IWWA 4ASTA 3CUHA 4A3UA 1E1FA 4CD6A 3CEUA 1WXJA 1JFXA 5EL1A 5F2MA 1DTUA 2EPNA 2TPSA 3U6WA 1PBGA 5D30A 4O0KA 1EZWA 1PIFA 4ZTYA 1ODUA 4MJZA 4ORIA 2YZRA 3RK8A 5I3KA 2QGYA 5G2IA 3PZQA 4LUTB 1C90A 1XDJA 2V68A 1W8GA 2DIJA 3MHGA 1B3YA 2YLLA 3CUIA 1MDRA 3B04A 4Q8UA 4RNJA 3CL6A 1BSIA 3WD1A 3B4UA 4D8AA 2ZX5A 4C7GA 1NY1A 4X0NA 1U5JA 5I79A 1K9DA 1V93A 4C6LA 4EAYA 3WLIA 2RAGA 1V7YA 4AIBA 4XO6A 3TH6A 5D2XA 2RFGA 3NIYA 2J62A 3F2DA 1OGGA 4R85A 1M01A 2VUNA 4HPNA 3AIVA 5BOEA 5AYXA 2V2DA 2WHJA 2FZ8A 3N6JA 1RUSA 1VF8A 4HU4A 3BLIA 3A23A 2XN1A 1S2VA 1DIOA 3U8GA 1LT8A 4NF7A 1XIBA 2VT0A 1PHQA 1A0DA 4OOZA 2XUCA 4ZB0A 3RUBL 2I5IA 3KBNA 1BD0A 3C0QA 1VENA 3E0IA 3GVQA 3VX0A 1E51A 4PEKA 3ZVHA 2ATSA 1V79A 3VGBA 1QAPA 2Y1HA 3GC4A 5AHEA 4X22A 1DL3A 4F79A 4D6EA 1X8CA 4QG8A 4TX8A 5AHLA 1VPXA 1B4EA 1IE7C 4HMEA 4DQWA 1QR7A 2WMKA 4HNCA 4UNIA 4JY9A 3WMCA 2XVNA 4GIYA 1OG6A 1LLOA 4JHOA 3WFAA 3MJYA 3CQ0A 4R88A 3TROA 2VD8A 4GKTA 2O92A 1E4MM 2FMOA 3VGHA 2FVKA 3GIYA 2ZADA 1VEPA 4MB5A 3W01A 3EA1A 3LV5A 4W9TA 1IEQA 1F05A 2EO7A 4WKAA 4NSBA 5G4HC 4Q7BA 1CYGA 2MNRA 3LPOA 2GJNA 1AW2A 1EOKA 3F4NA 1H7WA 5EB8A 2FPYA 1ZCOA 1XG4A 3L4ZA 2VO5A 4DUXA 4KT2A 3ALGA 4UZSA 2X09A 1L8NA 3VIIA 3W83A 1ECQA 3M7WA 1VBRA 2BFGA 3PBMA 4KRTA 3VNMA 3HFYA 1J96A 2PDFA 1JFHA 3E2QA 5A69A 1AH4A 4Q8NA 4P7OA 1KGXA 2C1IA 3W07A 1EFZA 2IKIA 2BY0A 1ME7A 1AQMA 3W25A 2NV1A 3TYCA 1PWLA 5FF4A 2VR5A 4M56A 4DWSA 2A0NA 1WKFA 3HGJA 3QQWA 1DJIA 3VNLA 2R1KA 2INEA 4E2OA 3VNKA 5AB3A 1K70A 4UMBA 4BA0A 3TIMA 1TV5A 3WDHA 3L2LA 2PDQA 4UIOA 5CZTA 1ALDA 4C1NA 2WM1A 1VFMA 4TQTA 3N2OA 3OVPA 4LYPA 2Q3RA 3BW2A 3S6DA 2O4QA 1AQFA 2QUTA 1K9EA 3BAIA 4AZHA 1XS2A 4M1RA 4AX6A 4LY8A 1EJ7L 3JVAA 2G95A 1B0IA 2X41A 4FNQA 3VGDA 4LVFA 1GHRA 1VEOA 1PTGA 4IJCA 1EXPA 4RJEA 3EPNA 1TWWA 4G1KA 4C91A 4GC4A 5T91A 4HQVA 3BG9A 2ESCA 1S5NA 1KRAC 1UBPC 2FHBA 3W02A 4IFOA 1TPFA 2DGAA 1O12A 4OJYA 5FF7A 3I3BA 4DAIA 2HK0A 1OX4B 2VFFA 2CFFA 3R0DA 3KCOA 1XRTA 2PE4A 1HT6A 4W89A 1CDGA 1I9CB 3QMRA 4X3ZA 4HPXA 1K8CA 4IMAA 5AHMA 1UA7A 4NHVA 2J25A 4W93A 5C2CA 1F8IA 4OIFA 2V3DA 4R7JA 3M0XA 3QR1A 4AIEA 2E67A 1A4MA 4UOZA 1KV8A 2PLCA 2FIQA 1EOMA 3A64A 1H1NA 1KCXA 2QIWA 2NX3A 1HGYA 1FWHC 3NVTA 3LI1A 4NG3A 1KKRA 2BOEX 2E5CA 1MO0A 1X7FA 3GHTA 1YPXA 1Q2SA 3NDZA 4CQCA 1RJPA 3VZYA 1XLIA 2BXZA 3GW0A 1MZHA 4I5RA 4JKKA 2FFCA 2F61A 3ZM8A 1H7OA 3WLRA 1QOXA 1WDQA 5AVNA 4E8GA 1KLYA 3EWYA 1EJWC 3MHFA 4A22A 1KXHA 3G5EA 5TF0A 2C71A 1E15A 3M0HA 4LUJA 1B30A 3GDKA 4MYXA 3KBJA 2CEQA 5JIPA 4ZSTA 5JVLA 3R58A 3URAA 4C7FA 4O8RA 3FNDA 1V3HA 1EPXA 4L9XA 4K8GA 3APGA 1BWKA 2F9RA 3RMJA 1UBSA 1LQ0A 4PTVA 4US5D 1JDDA 2Z1BA 1E5JA 4EK7A 1IGSA 5U4NA 2E6DA 1CLXA 3OB8A 1JULA 3VOHA 1MFUA 4S3DA 3UXLA 3OYXA 2WSQA 2G41A 4H8NA 3QMTA 1GZJA 3DKLA 4LC6A 3GHSA 2XFRA 4U4MA 2WYSA 2PDCA 3IJ9A 3GC2A 3IGXA 2UWFA 3KOWA 3C2RA 4B4HA 2J8TA 4LXFA 4C1LA 4RV3A 3DX5A 3IJQA 2JKAA 2EG7A 4FMVA 4Y7EA 4WXYA 4UTIA 3FYOA 3WENA 3PJXA 2PP0A 3TE9A 1AH0A 1XF0A 4FIRA 4X60A 3WF0A 2YSWA 3KS6A 3UW6A 2DVXA 4EXAA 1QXLA 1VPYA 3LXAA 3SCQA 2BGSA 5HUPA 2ABBA 1BVZA 1WPCA 5AHFA 3N2CA 1Q6RA 1K6WA 4MAVA 4FLSA 3WMSA 2VRQA 3WLPA 2BS9A 1X38A 2QHAA 1VCGA 5FEPA 1QPKA 3QYQA 4AF0B 4H9ZA 1VKFA 2PDMA 1OFBA 3FGCB 5J5RA 3CB8A 3WBYA 4DZ5A 1IWAA 1XISA 4OV9A 2VFHA 4PTNA 1XSKA 1ZGDA 2GQAA 1FWCC 4ZB5A 4O53A 2YDRA 4EE9A 3IARA 3KWSA 5LA2A 3PUOA 4IZGA 1LRNA 3W1PA 2VOTA 1OYBA 3HB9A 3W2UA 4NYYA 2D0GA 2NUYA 4H9TA 3GK0A 1VFUA 3TR2A 2Z28A 4XZLX 3CUFA 4ROPA 3KOXA 6REQB 1R9XA 3MV11 2P53A 1W3KA 2YXGA 1V0NA 3SCSA 3W22A 2BXVA 3PG8A 5HK4A 3TYAA 4H01A 1I45A 4HJFA 1GPFA 3LD5A 1UH3A 2J9XA 1X8FA 4RE4A 1BWLA 1G4EA 2XN0A 3HGSA 1TTPA 3AZRA 1IZKA 1OQFA 3TU9A 5AC4A 4M7TA 5CJMA 4ZO6A 3DI1A 3S2CA 1N8WA 3VU2A 3COTA 4N02A 2X7VA 3NEHA 1VYRA 4UWMA 3QPEA 3ME3A 5G2WA 4UQ9A 3SUSA 5H1WA 2YYTA 4GQQA 4AWUA 1BAGA 1EJTC 3E0FA 1JZ3A 5F4SA 2J9ZA 4DJEC 4QDMA 1DXIA 2C0HA 1P0NA 4B5VA 4HA3A 2E7FA 1HL2A 4Y90A 4Q4KA 5BNKA 3V0TA 4YHEA 3GIPA 3VPLA 1UQZA 4Q8TA 4O17A 1LDCA 3DYPA 2VKZG 2ZXBA 2E6YA 2G3FA 4IPJA 5CXPA 3ITYA 4GX8A 3TJIA 3DFTA 3E0VA 3CUXA 1W1ZA 4NJGA 2O7QA 3A9IA 2NWSA 4QAIA 2FKPA 2YL9A 1XUZA 2Q02A 2V69A 3IEBA 1QOQA 4O8AA 4CU6A 4JTKA 1LUCA 5CSYA 2HWGA 3RCMA 4YHGA 3I6TA 1EWEA 1XBZA 2WLZA 2V6AA 5HWJA 5CPQA 2XINA 2ZUMA 3TQKA 3ZS4A 1KBJA 3CZLA 5A8PA 4XWUA 2ACSA 4GY0A 5CBJA 3C56A 1CX9A 1FCQA 2PC8A 1KM3A 3WK3A 4P8XA 4RV8A 2ZA2A 5ABEA 3MA8A 3LGEA 1P6CA 4FXFA 3GXTA 4RE0A 4IIEA 2CXEA 3GTXA 3ECQA 3FHAA 1F61A 2VEIA 4IPNB 1UWSA 1TRDA 4UTUA 3QBUA 5IHSA 3MB9A 5J5DA 4UQDA 5CC6A 5C8BB 3IIVA 4KGLA 4MKSA 3FJ4A 3H12A 4H9YA 3QKZA 2JF7A 3HURA 2PF8A 1L6FA 1MRQA 3QV7A 3C2YA 4I6KA 4C6PA 4N4PA 3K46A 4R53A 1TB3A 2PTWA 1S2UA 1C7TA 2AGKA 3GVWA 4GO8A 1Z44A 1TPH1 3SCPA 3QGVA 2J7DA 4WGXA 1FH9A 1RBAA 4ZO8A 3MBDA 4LT9A 2GZXA 4DBDA 1ICPA 4Q3MA 1QASA 1J5TA 4N2YA 1E1CB 1GQJA 4LEFA 1I75A 3TN3A 4UCFA 3BLPX 2ZRYA 2WJEA 4F8XA 3NJ3A 1C3FA 4CNNA 3VNZA 1AH3A 1UUMA 5BMXA 3V3WA 1XRSA 3CPUA 3UY8A 5AHNA 1AJ0A 2OZ0A 1SO4A 6ALDA 3AZSA 1GJUA 1E43A 3R8RA 3BOLA 3EOSA 4PUMA 3B0UX 4K2SA 2DUXA 1CNVA 3H23A 2QEZA 2ZZ1A 4GIEA 4HN8A 4FF7A 1Q6CA 1S3TC 2VZTA 1YDVA 3T78A 1ISZA 1X1NA 3NFUA 5DBUA 3N2TA 5ABFB 3DESA 3P8IA 3SQLA 1J0JA 1JAKA 3CASA 5JIWA 3R0KA 1A50A 1OCJA 3M5ZA 1IEIA 4B5UA 2OWWA 3WCZA 1DKWA 3N14A 1WBHA 4J9JA 3EMCA 1V02E 3CH9A 1OC6A 1TR1A 1DQWA 2E9MA 3VKDA 3K4AA 3T2OA 4Z0JA 2Q8XA 3PUEA 2OLHA 3LTYA 2A3EA 3CQKA 2TAAA 5CH9A 2WSKA 3T81A 3VOIA 2X1IA 4XTIA 3GM8A 3BH4A 1B90A 2GSJA 4MY8A 1PDYA 1UWRA 2DY3A 3VKAA 1DVJA 4E3TA 2O9PA 4JFUA 3BW3A 3GFYA 3U7VA 1YBQB 3BO9A 2QCEA 3RHGA 2FHCA 1CENA 3QZAA 1UD8A 1SFSA 4JN6A 1QUMA 2X05A 5RUBA 1EJUC 3SBFA 1VFHA 5AYYA 3DN5A 1HQTA 2R9RA 2F6KA 3OLGA 3OIXA 4UTHA 3QR0A 4YWIA 5HMEA 3VZZA 1UR4A 1RCXB 3IAQA 2AAMA 3KBWA 4GLEA 4B2DD 1W8SA 4DI9A 3MKVA 4H8UA 2JQXA 3SCRA 3T2PA 3REQA 1JI2A 5CSRA 3LHUA 1VAHA 1E9LA 4MADA 4XD6A 1GG0A 2I14A 2PDBA 4PL1A 1WX0A 4AHOA 3BSMA 4F0SA 1W56A 3OZOA 2E1DA 4GVHA 3CMJA 3N29A 4MKNA 2CBUA 5FAJA 3CPGA 2V81A 3MWCA 3FSTA 3D3FA 1VHNA 4QP0A 4EVZA 1VEMA 2ISDA 4EWND 3W6MA 3CJPA 2Y4SA 4ZXLA 2R8WA 3TMQA 3SB0A 5REQB 2PGFA 1IT0A 3NAVA 4NI3A 2DIKA 1Q8AA 4D1JA 3EPOA 2CXGA 4MDOA 3TYDA 2F2KA 4LWWA 1M65A 2VDIA 2TYSA 4BS0A 4CCEA 4MZ8A 3RAOA 1KQYA 1YTDA 2ZE3A 2OGYA 4LCSA 3A3WA 1XX1A 3VILA 3URQA 3H2CA 1R9ZA 4G5DA 5A6LA 3ITCA 1VFOA 1MVYA 1DWIM 3A22A 4G2DA 3WQCA 1KXQA 3HOJA 1TJ0A 1I2RA 4Y9OA 2VMFA 3WD0A 1O5XA 4AZ6A 3WJXA 2R14A 4MOZA 4I9MA 1XIFA 3G3MA 1RP8A 3UD6A 3SCVA 3PY2A 1V08A 5D9NA 5BXPA 2HS6A 1QNSA 1W1B1 3F2CA 1VBUA 1E6ZA 3KOFA 3TYEA 3RCYA 1VR6A 3WBAA 1CGTA 1TX2A 1HVXA 4CD4A 3VCCA 4IP5A 1MDLA 3ZVHB 1UKTA 3UZXA 3IVSA 5DRCA 1JNDA 1FWNA 3UYIA 3RN6A 2VDHA 5H2ZA 1VRDA 3THUA 3T08A 1WP6A 2J78A 3B05A 2C16A 2AMGA 2UV8G 4D8LA 4Q7IA 3AWOA 3RMEA 2YPIA 3NQ6A 2DZTA 3H4WA 3UZWA 3PS7A 2OQHA 3GE7A 1GPWA 3E3HA 3E0LA 1A3HA 5H8UA 1JZ8A 1ZSXA 4JL1A 4TO8A 1RPKA 2ZZ3A 1DPMA 2C91A 1Z6KA 4F0HA 2YXOA 5T9CE 3E5BA 3U5UA 1MW2A 5EU9A 1XFBA 3M6YA 4ZO7A 4K7YA 4LVBA 3UZZA 3UZYA 3L12A 1ONXA 1WAWA 2CLLA 3APYA 1QNVA 3G24A 1DXEA 2NSOA 1R9YA 3B9AA 3LCXA 3U5YA 5LNVA 3ARQA 3ZFHA 1SFTA 3L4WA 4IFKA 2F8QA 3CIXA 1U33A 4ZODA 1GOQA 2YFOA 1OCNA 4PCPA 2HTMA 2R6OA 4B3ZA 4RE2A 3KAOA 1EPVA 4DYJA 4DWSB 4XAGA 4JTLA 2G5WA 3A5VA 4HNNA 3EWWA 4Y8FA 3GZ3A 1RQHA 3S1XA 4Q32A 4HCLA 1PKNA 4AH7A 5FJJA 2VRJA 2XIMA 2D24A 3ZT7A 1AL8A 1E1EA 2XVGA 4C1NB 3HV9A 3AYTA 3V75A 3U57A 1TPDA 3EZ4A 2JIWA 1WDSA 2X0YA 1LLWA 3I4KA 5A95A 4JQAA 3GDMA 3M4HA 1QPQA 1VHCA 1BVWA 3W7NA 5C7HA 3UG8A 3UF9A 3D5HA 2E5DA 2J8FA 1KW1A 5HJLA 3U4FA 1W1PA 1GQKA 3WLTA 1NDVA 5K9DA 1XIMA 4OBRA 3UZJA 2AQWA 3NL2A 2E1WA 1HF6A 2QXWA 3WQ4A 2E6FA 3RPDA 5EMKA 4HIBA 4ZE5A 4UQCA 1VFSA 2VJXA 1OZMA 4NX5A 5U7SA 1MW0A 3QZ6A 2V63A 1XYBA 4J3XA 1S5TA 1SSDA 3LV6A 2Z6IA 4QCFA 4AD2A 7TIMA 2G3JA 3GG1A 5C7VA 4L56A 1AQ0A 4I6VA 4KRUA 2AOSA 2GK1A 2ICSA 2V3GA 4F48A 2G97A 3XISA 3S83A 2IKHA 2BY1A 4XD3A 1XH2A 1AMKA 3M07A 4PCFA 4J28A 4D6GA 1NELA 1EZ2A 3CZJA 3OGVA 3H4XA 3ABZA 4LAMA 4ZE4A 1OFRA 1TV3A 3QSRA 3M47A 1FKWA 4DJFD 4MB4A 5EA9A 2NLIA 1RV8A 1UKSA 4DO5A 3W74A 3OG3A 4OU1A 4IOTA 2PGRA 2OYMA 2ZZ6A 5CLTA 3E6EA 1Q65A 2P8BA 4G7FA 4EACA 1KB3A 4O28A 3MY9A 4GYFA 3S1UA 1K6AA 3B8UA 3FAXA 4OV4A 5GJMA 2GJLA 4ZQCA 2E28A 3RLHA 2DT2A 4LUYA 3BQ5A 1E9YB 3NA8A 3P81A 2D23A 3KZPA 3OBEA 2VGIA 9RUBA 3DUGA 1EQCA 3EEZA 2PC4A 1EIBA 3TSBA 1WKYA 3NXLA 1HTIA 3S1VA 3UCCA 3TKFA 3MSYA 1FWBC 1VC4A 3AXKA 2CETA 5LSMA 3U9IA 1UPPA 5G4WA 3GNRA 3DFOA 4N6FA 1MQQA 2G4FA 5I6SA 4GRSA 2TRSA 4F0LA 4B92A 5BWAA 2JE8A 5HWMA 4NAFA 3HMCA 1TPB1 2WSYA 2CZEA 3O6YX 2ALRA 3ZJ6A 2RDXA 3MTWA 2NLYA 2DT3A 2F2HA 4UTLA 3TYZA 1UR2A 3VVGA 5AYIA 4H6QA 1FKXA 8XIMA 3LRKA 1RALA 3TLLA 3SR7A 5KETA 4L7ZA 1Q3NA 3VDAA 1UJQA 3I4EA 3R8HA 4C65A 1XSJA 1SUXA 5I3IA 1VRXA 5I00A 5EMMA 2ZDSA 3R2GA 4P8VA 2I1OA 5LIKX 5A6MA 4KCTA 3EEGA 2BASA 5C9XA 2PDLA 4C6EA 1EX1A 4S23A 4QSHA 2VQTA 2C15A 1B3WA 1SO5A 1GVQA 4ZXOA 3EDFA 4HYVA 4RDVA 1JPHA 5D2YA 2NWRA 4AAJA 3SSZA 4YTSA 3LBMA 3WDQA 4Z2KA 5I3JA 1FTXA 1H0GA 4CEUC 2Y85A 2XWDA 5DCBA 2QNEA 3GXIA 1NP2A 3UFYA 1CB7B 2GJPA 3AS3A 4WRHA 3P80A 2ASHA 1Q63A 4KWSA 3CV2A 3ONBA 5D33A 3BMWA 3KP1A 4WDXA 2FDMA 2VNCA 4FOKA 2HROA 4LNYA 4OVXA 1J93A 1UW9A 4XSLA 3B0YA 1KRBC 4IISA 2QCNA 3IJLA 4YU1A 3LM3A 5BMWA 3SCWA 5HWNA 4NASA 1JIBA 2QCLA 3QSTA 1SJAA 1G4PA 3BAJA 3CZ8A 3WNMA 4WZHA 4NJKA 1UD4A 3LMZA 4YVPA 4BI6A 1EYEA 3A4XA 3I7SA 2A6LA 4B5SA 3GNXA 4O1CA 3T4CA 2Z26A 3GU1A 1THFD 5AC6A 3HG3A 3LCHA 4JZ5A 3G1XA 3I10A 1J5SA 3NVDA 1PKMA 2FPTA 4HNLA 4PH6A 1KD0A 1PZ3A 2VELA 1JDFA 3N4AA 4G1NA 4AX7A 2V5DA 3AHZA 4M24A 3VDCA 3NTYA 3M0JA 4GHRA 3AHVA 2E09A 1ZZMA 5AKQA 2GFTA 4YXGA 4QBXA 2FZBA 3C6CA 3TN4A 3TK7A 4G56A 3NSXA 3H7UA 3BMXA 1GVOA 5I09A 3WQPA 4K39A 5DT7A 2YDSA 4EF8A 1QCWA 1UMYA 4GIAA 1F3TA 4AD5A 5E09A 4OZOA 3GY1A 3MO7A 1IV8A 1J6OA 1OIFA 1CGXA 2GOUA 1Q66A 3W84A 2WCSA 3W29A 1CB2A 1E5NA 1JVNA 3E2SA 3KWXA 3OZPA 3AYSA 1FWFC 1JQXA 3W2LA 3GTFA 3LPFA 4AZ5A 3V5FA 4GK8A 3S2MA 3M5VA 2Q8LA 5JH2A 1IR1A 1SR0A 2HK1A 1CGWA 2ZKMX 3VE7A 4GI9A 3AXIA 4RKAA 5I02A 1LUCB 3L2IA 2YXXA 4YWSA 1P1XA 2DZWA 4AWEA 3HBLA 5I3HA 3L4TA 3THDA 4XUYA 2VC6A 5HXMA 3FJLA 1N2VA 3Q2DA 3NO3A 5CZSA 2P76A 3CAVA 5LXXA 3QV8A 1R2SA 2QJGA 5J04A 5HA7A 4PSPA 1YNPA 1C93A 1OX6A 5I06A 1EUNA 1K7EA 5EMYA 3ITVA 1PWMA 3OGRA 1CBGA 3LHZA 1XIGA 4DIAA 2ZICA 2Y0FA 1E73M 4HYRA 2FZ9A 4GH3A 2CZDA 2WZMA 3HA1A 5D2WA 2J9YA 3AIRA 2FTPA 5LNRA 3INPA 2PDUA 3BVJA 1ECEA 3BUVA 4AVFA 3O1NA 3WO8A 3MANA 1QATA 3NQGA 4MNLA 2NT1A 4U3CA 3CQHA 1TYGA 5ECUA 3STPA 4DJEA 2HZGA 2PRHA 3ID7A 1TZ9A 4MLJA 3W73A 2GVGA 4XZ9A 3WMLA 2W0UA 3LERA 3L4YA 1QVBA 4A29A 3NL3A 3HU7A 4D72A 2PODA 1HL8A 1O6IA 3HMJG 4OFCA 1GQNA 3MUAA 5DY3A 4HVXA 3C61A 4JQ3A 3VD9A 2QKFA 2XYLA 3MKCA 4DBWA 4BY3A 2D2JA 3A9BA 5MKGA 2D69A 1UR1A 1KCZA 3UJSA 4M0XA 2NQ5A 1EC8A 2PTYA 3SEPA 1K9FA 2X8RA 2VFGA 4DO6A 5C9ZA 1KRMA 4L4MA 3IACA 3MHUA 3B8VA 2YBVA 4AQLA 4ES4A 2JFEX 1WDDA 2IQ0A 1KFBA 4GYJA 2O9TA 2OGJA 3KXQA 1TSIA 4O4VA 4ACZA 1O5RA 3VINA 1WXZA 3LOTA 3IJDA 2J7EA 3HQPA 4H3DA 3VM5A 3GHUA 1IZCA 1TVNA 5JQ9A 2VCBA 3GX9A 4MFDA 4AISA 3CMFA 1ZB5A 3NYDA 1J0YA 3ANVA 2O9RA 1ZBCA 1O66A 3O2LA 5C9WA 4FEZA 1TKKA 2XZ7A 2H6RA 4MWAE 1ZTVA 3IJ8A 1WDRA 4D8ZA 4A3HA 3QTPA 4RW5A 1XKYA 4JYFA 2OYLA 1P6BA 3PBWA 3FDGA 4R27A 4MFEA 2VC7A 1V3MA 1MWOA 1B9ZA 1QWGA 3G1AA 2XH0A 1A3WA 3BG3A 2YCEA 4AMCA 1YADA 3FVMA 1R46A 1GQIA 2AL2A 4AZ7A 4ZFCA 1PTDA 4MJ4A 4L64A 2UY3A 1H5YA 1RCOB 1LL7A 1X98A 3T9PA 2ZRVA 1JCXA 4LX4A 1FFQA 3NQFA 3N04A 4A6GA 1TCDA 2EPOA 2XFFA 2I56A 4PB4A 2ZUSA 1P0EA 4DXKA 3E2VA 2F6XA 3B9NA 3FYYA 4NRSA 3FKKA 3REQB 4DNHA 1BRLA 4FLQA 1WE5A 2V0TA 2ZUNA 2F84A 3A4AA 4WGHA 2ZC1A 3NPUA 1HW6A 3BQ6A 4H2HA 3MMWA 3URBA 1UD5A 5B80A 3UZ5A 2H3DA 4AC7C 1WZKA 2UBPC 4WVXA 3S8HA 1H63A 1Z32X 4F4RA 3ABRA 2WMIA 4I90A 3BG5A 2IPFA 4K6AA 3BURA 4F3HA 5BZAA 2Z6JA 5CLWA 4O12A 1HKKA 1K3UA 1UPMB 3VFLA 3TSDA 1UIOA 3EBVA 2ZUWA 5HMFA