5U4NA

Crystal structure of a fructose-bisphosphate aldolase from neisseria gonorrhoeae
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
350
structure length
350
Chain Sequence
MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAPVIVQASAGARKYAGAPFLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFSSVMMDGSLLEDGKTPSSYEYNVNATRTVVNFSHACGVSVEGEIGVLGNLETGEAGEEDGVGAAGKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTSHGAYKFTRPPTGDVLRIDRIKEIHQALPNTHIVMHGSSSVPQEWLKVINEYGGNIGETYGVPVEEIVEGIKHGVRKVNIDTDLRLASTGAVRRYLAENPSDFDPRKYLGKTIEAMKQICLDRYLAFGCEGQAGKIKPVSLEKMASRYAKGELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-1
publication title Crystal structure of a fructose-bisphosphate aldolase from Neisseria gonorrhoeae
rcsb
source organism Neisseria gonorrhoeae
total genus 129
structure length 350
sequence length 350
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u4nA00
3SIZA 1K02A 3O16A 4NX0A 5TIMA 3H54A 4A22A 2Z2UA 4IQLA 3UXDA 3E9AA 2E5DA 1I2NA 2C3ZA 3ATZA 3KVJA 4LWWA 1JUEA 2UV8G 3HJZA 2QCMA 1J2WA 4FX6M 1P4CA 1K8XA 2E68A 1SW3A 4LUJA 3STGA 4JTSA 2DJLA 1ZY9A 4D2JA 1HO4A 2ZBTA 3PG9A 3W9ZA 1OVDA 3NZRA 1X1OA 1F2JA 1KW1A 1KFBA 1FCVA 1G7VA 4LS0A 5AFDA 2VC6A 3BG3A 1FWRA 1ZJIA 3GLCA 1XBYA 3BGJA 4UTIA 2YFOA 4CNNA 3B05A 2H3BA 3ELFA 2C14A 2J9XA 4NVTA 4GUFA 4O52A 3W22A 2YW3A 3O63A 4JD4A 3DFOA 3KRUA 4LVGA 2YYTA 5HJLA 4KKXA 3WJSA 5K9CA 1ICQA 2Q3RA 3TXVA 3LHWA 4MVAA 3M9YA 3G0XA 3E02A 1DL3A 2XN0A 2X30A 4X3ZA 5EY5A 2B7QA 2A1YA 1VLIA 3Q58A 3UD6A 2JGYA 1W5PA 2I14A 1XBXA 5ABTA 3W7LA 5HINA 3PR2A 1I2RA 3AJXA 3L68A 4Q32A 1VZWA 5U4NA 1KM6A 4O8RA 1TYGA 4WQ6A 5DY2A 1C29A 4A29A 3M5YA 1FWSA 1AW5A 1DQXA 1Z44A 2YW4A 4FIRA 3M47A 3W1QA 3TQVA 2V9DA 3W2UA 4I7WA 4OWGA 1XDLA 2J27A 3NQDA 4MY8A 1AW1A 5LZLA 1PV8A 2VENA 1TTIA 2WOQA 4UC5A 1UCWA 1KTBA 3TQKA 4N9BA 2NV2A 3C2FA 1SZFA 1XUUA 3WK2A 2G95A 5F4WA 1LP6A 2ZZ1A 4BK9A 3W7HA 4Z08A 3TC7A 3G8EA 4TR9A 3T4CA 4JTJA 3W7EA 1S5TA 1T8XA 5AHIA 3BPWA 3RLUA 3TDFA 5DCEA 4K6AA 3IIZA 5D33A 1JQXA 3QMTA 1R30A 1KBIA 4MY9A 3MHUA 3PBUA 4MYXA 2FB3A 1PE1A 3UWZA 3TAKA 3FYPA 3LCFA 2ISVA 3Q37A 2C1HA 3VNDA 1EUNA 5D2VA 3IIPA 4K8EA 4UTWA 3L0GA 4XTDA 4E38A 3W76A 3VE9A 2Q8ZA 4MYAA 4XKYB 2YXGA 1TCDA 3W1RA 3IGXA 2BTMA 2Y7EA 3BGGA 5D04C 4WX2A 2C19A 2ZQ0A 3OEXA 2Q8LA 3DHDA 4NZJA 3QPYA 4K7VA 4DEFA 4M7TA 3UWWA 4K8HA 3MP3A 3LXAA 5G1YA 3UWQA 2EKCA 3L5MA 3UWUA 3LGEA 1NF0A 4UFIA 2ZZ7A 3QPZA 3A5FA 5CPNA 3W86A 1YXCA 1XXXA 1LOLA 2V8ZA 2CLMA 4N4PA 3F1QA 1TRDA 2NX9A 3ABRA 3N2XA 2GPTA 3GK0A 4N6EA 6TIMA 5K3VA 4S2BA 3EWUA 2GUUA 2ALDA 4WOQA 4LU0A 1FUYA 1FQ0A 3RF9A 2A7PA 1VS1A 4HNUA 1B4EA 3LHYA 2R94A 5E0KA 3NQGA 1TRIA 5EBUA 3CPRA 3E96A 4MJZA 3EX3A 1I2QA 2RDTA 4AAJA 1EP3A 5FF7A 5DBTA 1GZGA 3RMJA 4RR4A 1OFOA 4UFLA 1Q6OA 3USBA 4RCXA 4FO4A 3MW7A 1F5ZA 1LLWA 1Z48A 2X1SA 4M5PA 3KRSA 3NVTA 4LV4A 3QSTA 4UTHA 3O6DA 4UTTC 4LVAA 3O6CA 1VCGA 1W1ZA 2V2CA 5FF0A 3C2EA 3W2LA 1W5MA 1SFJA 2VEPA 3V1PA 4W9TA 4WY0B 3EWBX 1FWTA 3W88A 3M5ZA 1TO3A 4IMCA 1VR6A 2RH9A 4QSHA 3FKRA 3C0JA 3FLUA 4YL2A 1LOQA 2GQ9A 1D3HA 3ABSA 1YTEA 3C56A 3W2JA 4FF7A 1IF2A 2NWRA 1UB3A 2QCDB 1XL9A 3M5XA 4O1AA 5AC6A 2H8ZA 2DZPA 4EF9A 2DZUA 3MBDA 1EPXA 2ISSA 4Z1BA 1D9EA 3UWVA 4RXFA 4LS2A 3SJ3A 2CLFA 5J5RA 4TO8A 2FB2A 2J9YA 1T99A 4NNCA 1W54A 3TJLA 3GDLA 1PS9A 3IIVA 5AN7A 3G1AA 8TIMA 5CPOA 2CZDA 1KM2A 1TTQA 3G1VA 2QCLA 4RXGA 1KM1A 1QOPA 5AYXA 4FNPA 3NR0A 3PF3A 4AWSA 3QZEA 3EXSA 1G69A 5I3JA 4BR1A 2YGYA 3BLEA 3RU6A 3GNNA 3L66A 2PRHA 1MEHA 3LHTA 2EF9A 2C18A 3JR2A 4U28A 3BLIA 2J9ZA 3LBCA 2VOMA 2RDWA 1WV2A 2E09A 1AK5A 1TPB1 1KM0A 3DENA 4QQ3A 2G97A 3NQFA 3L2IA 3KOFA 2QJHA 3A21A 1A5CA 2WSYA 4UMBA 2JBMA 3SZ8A 3MHGA 4XUGA 3LI1A 2WNQA 1OF8A 2H6RA 1YDOA 2A6LA 2H8XA 4OQVA 3HBLA 1KTCA 4O10A 3NQVA 1ME9A 2VFHA 1W5QA 3ANYA 4EOUA 4HPJA 1XI3A 3P74A 5DY3A 3NQEA 3NXFA 1MXSA 4CCCA 3CWOX 1ALDA 4C1KA 2OX1A 3LX9A 1A53A 3M7WA 3BW3A 1CX9A 1TTJA 5DCBA 4IPJA 3QJAA 3U2OA 1O5KA 2RKXA 1F05A 4AVFA 3B04A 2ZTJA 3WJWA 1ADOA 5IM51 4JTLA 4GFSA 3DFTA 5CPLA 4UFKA 3R8RA 4DF2A 1JUBA 1XBZA 1XC4A 1UUMA 3W7NA 3PBVA 2Y7DA 3PULA 3HQ1A 5F2LA 3HMJG 1OG0A 3VE7A 3KHJA 2C13A 3PSWA 4H3DA 5D2XA 1TTPA 3S5NA 4UNLA 3LCXA 2QEZA 2W6RA 3MYOA 4OHQA 1WBHA 3W7GA 1EX5A 2NV1A 1BWLA 4LNYA 1WBJA 4P61A 4BI6A 1L2UA 4O1BA 2EGZA 4K38A 1Y0EA 3QM3A 4IXHA 2J88A 5AHEA 3QF0A 4FXSA 1LROA 3TIMA 2TPSA 4ZQRA 4MY1A 1TPC1 2BZNA 5CKSA 4PL2A 4BWLA 3WK3A 3PAJA 2J6XA 2OJPA 5CZSA 3C61A 2D73A 4K39A 4WD0A 5D2YA 2NUXA 4NQ1A 2QUTA 3W23A 2VKZG 4IGHA 3Q2DA 1IXOA 2PRLA 3W74A 1FWWA 2WO5A 5G2HA 4DF1A 3PUDA 3L0NA 5E93A 1QO5A 1ICPA 1QNVA 1UBSA 2B0MA 4Z1DA 1A5SA 1KA9F 3DFSA 1K7FA 3NQ2A 1CW2A 3WJZA 1O4UA 2FJKA 3W71A 1QPNA 3T78A 1L6WA 4Z1CA 2E6DA 1VGAA 3S5YA 3NNTA 4WY0F 1J4EA 1R46A 1H60A 4LUIA 3G0UA 4CCDA 1K7EA 4JS3A 3BO9A 3B8DA 3PS7A 2ZDRA 4UIOA 5LHEA 5HR6A 5A8GA 5AHFA 2ZZ2A 2J24A 4LVDA 1LZOA 5CSSA 1HTIA 3QQ0A 1GTHA 1NEYA 3YPIA 4BF9A 2FIQA 2VFIA 3CEUA 2Y6ZA 4EF8A 3S6DA 3EX4A 3SFKA 4ZQPA 3M0ZA 2FDSA 4IMDA 4KFNA 3O07A 1JCJA 2ZRZA 4LRTA 4O0KA 4JNMA 1HFBA 4JYEA 1PHQA 3NM3A 4IUOA 4DPPA 3ZFHA 4UTUA 4OT7A 2FPVA 4E2BA 1LDCA 2CLHA 5FI8A 5KINA 1PCWA 1QFEA 2E6YA 5KITA 4ZMGA 2NXIA 4O19A 3NAVA 1F6KA 3PB2A 5FF3A 3SECA 1KV8A 4O28A 2HS8A 5I3KA 3PWAA 2X1UA 2QR6A 1NAL1 3HGRA 1RR2A 3O6YX 4JR5A 5IBXA 1LORA 2GJNA 2WQPA 2X2GA 1YADA 3W7JA 3LCLA 4LS1A 4HSOA 3P5ZA 3QYQA 2JKEA 2QCDA 2ZZ3A 2DZXA 4RLIA 4WXYA 4MPQA 4LRSA 4PA8A 3B06A 5LNSA 3BK0A 1XBVA 1O95A 3G1XA 3MO7A 1EA0A 4O14A 3KVLA 4WXZA 5F4XA 1VYPX 2YSWA 1B4KA 1ZHAA 3A5VA 3W7MA 2BX7A 5CPMA 1TPVA 3HG3A 2VEIA 4PEKA 3W1PA 3GKFA 3QH2A 4UTKA 3P62A 2KZHA 1EWEA 1QMLA 4FNRA 4UTMA 3GKAA 2P10A 3G18A 4J9JA 4MLRA 2FQIA 2Q3OA 2IQTA 1DVJA 4JTKA 4O13A 3M1ZA 3MI6A 1IIHA 1KM3A 2A6NA 4ADUA 5AHNA 4Z1AA 1D3GA 3W83A 3MMTA 4NJJA 1KFLA 5FEPA 1OFRA 3S0CA 1YYAA 1RPXA 3D0CA 3LCGA 1XFBA 1FCQA 2FPTA 4RK8A 5EYWA 1JCXA 2AGKA 2HTMA 2OMAA 3IVSA 4O4WA 4AXKA 4OV9A 3L9CA 1XM3A 4RZ5A 1SPQA 4YCPA 3CHVA 3V75A 1AG1O 4JTGA 1TQJA 4P2VA 4FB7A 4PH6A 3QW4B 3SGZA 4XBSA 2Z6JA 1X1ZA 1OFBA 4R34A 3C4UA 1M5WA 5J5DA 2PC4A 4UTWC 5DN1A 3PUOA 2QAPA 2V2HA 4QISA 4NJKA 5LHFA 1F7BA 5C6MA 3MWAA 1QPRA 1VHNA 2CLEA 3S1VA 3GXTA 3TW7A 5LNRA 2Y89A 2F84A 2Y70A 1VRDA 3OVPA 3MP4A 1TPWA 3NG3A 3HGSA 1OX4A 3OVQA 1GTEA 3CM4A 4NT0A 1LCOA 5FF2A 4LOCA 3LXBA 3WK1A 3GZ3A 4JY9A 3H55A 3NQAA 4A3UA 1QPOA 1ZENA 1R2SA 3HPXA 1GEQA 5C54A 4EVZA 1TQXA 4OV4A 2R14A 2A5HA 4XBKA 4OBTA 2A0NA 4DQWA 1QR7A 4LY8A 1ZNNA 1LBMA 2NXGA 4JX4A 1LYXA 4N9CA 1O5XA 2C15A 2DZWA 4ML9A 1AMKA 2YR1A 4FNUA 2NUWA 4JX5A 5DXXA 2PURA 2HSAA 1FDYA 4O54A 4L4LA 2QCEA 1QPQA 3PM6A 3MBFA 4GC4A 1A50A 1S3HA 3HO8A 2YFNA 3QQ1A 1LRNA 4QITA 3VCRA 2ATMA 5FESA 1RZMA 2QF7A 4K37A 3Q94A 1OABA 3LV6A 1F6PA 1G4TA 4IXXA 2BXVA 3MJYA 3TFCA 3FEMA 4LV9A 4MZ1A 4FIQA 4UFJA 4I7UA 3G1FA 4IPIA 4Y6GA 1SUXA 3ABQA 4PTNA 4JDYA 4Q4KA 2ABBA 3PBYA 3B4UA 3M5VA 1GWJA 4ADSA 3W1MA 5G2WA 3FA5A 2RHGA 3WFAA 5G1TA 1G6CA 3N34A 3P8IA 3THAA 1OX5A 3RFAA 1NFBA 3CLMA 5F2IA 4ZQMA 3G3MA 2P0OA 2E6FA 1TV8A 2WV8A 3W73A 1IIGA 3NDOA 1KFJA 1BTMA 3EXTA 3IVUA 3PVFA 3OA3A 3MUXA 1DQWA 2VELA 4GUIA 1TPEA 1TV5A 1W56A 4O53A 1SR9A 3THQA 1F76A 1OYAA 3EWXA 3KVKA 4JYFA 1OHLA 4ONVA 3MI3A 3F4NA 3TR2A 1P5BA 1KM4A 1I8JA 3L65A 1WYIA 5AC8A 3P61A 3UY8A 4L4MA 3OHIA 4HKPA 1ZALA 5LGZA 4NJHA 4PODA 3NQMA 3IIOA 3PB0A 2JKPA 3G1YA 3S1UA 3LRKA 3OIXA 1T96A 4YWIA 3PG8A 1H7PA 3DKLA 4HNNA 1I2PA 1P1XA 5D2TA 3I7RA 4M6PA 5K9XA 1GQNA 1GG0A 3LB0A 3STFA 3GVGA 1WDWA 3AO0A 5BOOA 3N3MA 1YDVA 4GRSA 3LRMA 4EWND 4PFMA 3LCWA 3W75A 3ZWTA 1HL2A 3PBWA 4TMCA 2CU0A 1JCYA 4BI5A 4UTJA 3LI0A 2QUVA 3W1UA 3UYCA 5F2GA 4UUIA 3BG9A 5D03A 3IIXA 3GR7A 1GOXA 4AHOA 2BLEA 1H1YA 1H1ZA 4AEOA 2QKFA 1Q6QA 3W2MA 5AHLA 4AH7A 1L9WA 3A24A 1TIMA 1IXNA 3IV3A 4PC8A 3T40A 3KXQA 3LOTA 2Y63A 3PC0A 3T7VA 2B7PA 1TSIA 2HMCA 4KWVA 1Q3NA 1GPWA 4IOTA 1AL7A 1GVFA 4K7YA 3HGJA 1KFKA 5D02A 5I3IA 3SW6A 5BMWA 3TQ0A 5D2WA 2DORA 3HIJA 5FF4A 1TPDA 3C8FA 2EPHA 3NL5A 1N7KA 2YYUA 1G4SA 1H62A 3P80A 1I2OA 3KFTA 3S1WA 4DO5A 2ISWA 4QM1A 1OYBA 3W85A 4HHPA 2TSYA 3W1TA 4O18A 1SZEA 4DO6A 1K7XA 3HOJA 3IGSA 3EXRA 2Y7FA 1SU5A 3DZ1A 2DZSA 3CU2A 3PUEA 5EPDA 1BEUA 4BWLC 2RFGA 2TMDA 2AAMA 2Y62A 3NPUA 3TU9A 5K9DA 3L5AA 3NA8A 4IWWA 3DBPA 3GYEA 4LTSA 2ZZ5A 3FKKA 4I9AA 3KVMA 1K03A 1YXDA 1XKYA 3N73A 3W07A 1ONRA 5K4XA 2WSRA 4AMAA 3O1NA 3N9SA 5FEZA 4QJ1A 1YXYA 4UFMA 1HUVA 2E77A 1IGSA 4YMZA 1OX4B 1JJKA 4XTIA 6ALDA 2NZLA 3GDRA 3I68A 3IGUA 3TA6A 3QC3A 2QAFA 4HN4A 1KLYA 4JTIA 4MKNA 2C0AA 3SR7A 3NPVA 3B0VC 4LT9A 4R7JA 3HPSA 3H53A 5BW6A 1O94A 1OYCA 1U5JA 4Y90A 1I4NA 3S9YA 4JN6A 4N2YA 1G4PA 1OFEA 1SZNA 2YPIA 3W7OA 1DOSA 3TNOA 2GOUA 4A21A 2A85A 1ZFJA 5H91A 3DFNA 4FXRA 4ORIA 1H7WA 5DCDA 1EUAA 3EWZA 3LM7A 4RZ4A 3TSDA 5KTLA 4JIPA 2Z0IA 2Z6IA 4KWWA 3W7KA 1R2TA 1OFPA 3BG5A 4I7VA 1GYLA 4WOZA 4O57A 5EA9A 1FWNA 3TMQA 1DKWA 4UR8A 3TJXA 3TCEA 5DBUA 1GT8A 2DZTA 1W8SA 3L67A 4GBUA 2PE4A 3TV8A 2VFDA 1DBTA 3LERA 3S5ZA 3M6YA 1PL9A 1KFEA 1SO5A 4KFOA 4S1FA 1V7YA 4ZVJA 3LHVA 4HSNA 3LV5A 4UR7A 2E1DA 5IBXC 3U6WA 5EMUA 1FCUA 3KX6A 3B0PA 2JKAA 3C52A 1VJIA 4YCOA 5K7JA 1KTNA 3OG3A 4H4IA 2GQAA 4MIMA 4IX0A 3G1DA 3JRKA 1VQTA 1GYNA 1OJXA 5DXYA 3WJXA 4XZ9A 1MSSA 1L6SA 1W3IA 2NXHA 2ZA2A 4O11A 3QFEA 3I7QA 3P81A 3C3NA 4TMBA 5HWJA 2V81A 5D37A 3T44A 3TSMA 3TROA 3P7YA 3M16A 4AB4A 4Y8FA 1GVSA 3UPBA 4M19A 1VH7A 3G3DA 5FEWA 5F4SA 1HO1A 4N4QA 1P0NA 3SI9A 2XN1A 3BVJA 2XFWA 3SY5A 5KZEA 4BFAA 2E6AA 1E51A 2B7NA 2WNNA 4JIQA 4LVBA 3VFLA 3NL3A 4IMGA 5G4EA 2FLIA 3NYZA 3TFXA 3S8HA 5EL1A 3LCHA 3EKZA 4AWTA 3CTLA 1J5TA 5KMYA 2V2DA 1PIIA 4JX6A 2NLIA 1TB3A 5HUOA 5AHMA 3W3OA 4JY8A 1KV5A 3W6YA 4UMCA 2QJIA 1SFLA 3R2GA 1PVNA 4FX8A 4M6VA 2Y7GA 3MYPA 2BSLA 5G4WA 1H7XA 4H6KA 4MLJA 2ZYFA 5C5YA 1O60A 1C9DA 3UQNA 4IX2A 1VLWA 3CIWA 2GJLA 3LTSA 3UZJA 5D30A 3L5LA 1H63A 1LOSA 1YTDA 4O0ZA 1YPIA 4RX0A 1QOQA 3W1XA 1SQ7A 3GR8A 4JTHA 2A4AA 4MFDA 4JTEA 2GVLA 4DF0A 2QUUA 1V5XA 4M7SA 1QDSA 1BWKA 2NX3A 1I45A 1H61A 2QCFA 4NX5A 1C8VA 3LBMA 3N19B 1TMHA 5K2ZA 1JCMP 4UFHA 3R89A 5HMSA 3LHZA 1AL8A 4BI7A 4AF0B 1DV7A 1H5YA 2CLKA 4NJGA 3DKJA 2YX0A 3CC1A 3E12A 1IXPA 4GE8A 4XWUA 2AQWA 1SO6A 3EKLA 4O17A 5C2XA 3C2OA 1W3TA 3LLFA 1H7OA 1QWGA 4X2RA 4ZQCA 4MUZA 2I1OA 5HWNA 2PCQA 4B5NA 4FHAA 2VFEA 3PSVA 3GAKA 1UASA 3LHUA 5HULA 3WJYA 1QAPA 5LKYA 3P8JA 3O15A 4IMEA 1JQVA 2XN2A 4R53A 2CLOA 2YZRA 5K4ZA 5F1UA 3CQ0A 2EAWA 1VYSX 4UTLA 4NJIA 4YLWA 5D09A 1WX0A 2VEMA 2YDAA 1UUOA 3G1HA 4TIMA 2H90A 3EX1A 1IXQA 1FBAA 1NVMA 2ZFAA 4TX9A 1XCFA 4GUGA 5AB3A 1W5NA 4OE7A 1A5BA 1DHPA 3FFSA 4O4VA 4MOZA 4Z0SA 4AWUA 1WOAA 3LCIA 1W37A 4GWEA 2V30A 2VXNA 4NNBA 3STEA 1B3OA 3HG2A 5L9FA 2ZCGA 4GNJA 4Y9AA 1JULA 2JGQA 2V82A 2GVJA 1QCWA 3F4WA 4DO4A 1OF6A 1F74A 3NQ8A 3M43A 3UWYA 1ICSA 3K30A 1CI1A 5LSMA 3UY7A 4NXKA 3LTYA 4FX7A 4ZZ9A 1FDJA 2I9EA 2V0TA 3W72A 5H2ZA 2TYSA 2P1FA 1VCVA 1PCKA 3W84A 3MP5A 2CLIA 2X1RA 1JVNA 3EWYA 5CGQA 4O1DA 2WJZA 2CLLA 4DBDA 4POCA 3STCA 3FS2A 5F2MA 3QMRA 3DFQA 3KAOA 5HNRA 3U8GA 2A21A 3GAYA 4OU1A 1ME8A 2B4GA 2G5WA 4DXVA 1Z41A 4K36A 4AHPA 4CQ9A 1RQBA 3W7RA 1SW7A 2JK2A 3A22A 3W70A 4O16A 3W87A 4CLMA 3G1SA 5HR7A 5EKYA 4MJMA 4LC8A 3T55A 3QSRA 4Z0JA 5DELA 3ATYA 5TBOA 2ZTKA 3CT7A 4CQAA 3O05A 1GVOA 2HS6A 2V5LA 1DORA 4DBEA 4FNQA 1GVRA 4NZFA 2Z1BA 3F03K 4UMAA 4ADTA 3LTPA 1VCFA 3VI2A 2WNZA 4GUHA 4MFEA 3ZR4A 5KSWA 3TUUA 4CNPA 4ICNA 2DJXA 4X22A 3IRDA 3S5OA 4HT3A 4HPXA 5D05A 5AYZA 1SSDA 1GG1A 3C6CA 3TXZA 3TE9A 3KRZA 3FJLA 1N8FA 2QDGA 3C2VA 4HIBA 4NXSA 3W7QA 3NQCA 2ZA3A 3GDKA 3HF3A 3W7PA 3GX9A 2G96A 3SSJA 5D38A 1WOBA 1LTDA 4GUJA 3BW2A 2OT1A 1ZAJA 4O1CA 1YDNA 4UNKA 3M41A 3NQ6A 2DZVA 2CW6A 1YLVA 4YXGA 3MI2A 4JXCA 1SZGA 3HPZA 3EX2A 2GQ8A 4NU7A 4E0CA 1B57A 3W1LA 3DAQA 2ZRVA 2ZZ6A 3BLFA 2W0UA 5HQEA 3TMLA 4JYDA 2ZRUA 3BW4A 3HGOA 4JICA 2BWGA 1MEWA 2VFFA 1JCNA 3FYOA 1X6UA 1XUZA 3UNDA 3P82A 1M6JA 3M44A 3UPWA 2R91A 1WAUA 1THFD 1W5OA 2O7SA 3EX6A 3O06A 2ZZ4A 3ABOA 2WSQA 5T26A 1Z42A 1Q45A 7TIMA 1EIXA 5I3GA 4FNTA 3N2MA 4QNEA 1LLZA 4ZL1A 1F73A 3N14A 1FXQA 3TC6A 5KZDA 3P84A 1NF7A 1WA3A 1MO0A 5KZMA 5DLCA 1EP1A 3A23A 3GXNA 4Q33A 3E0IA 1Q6LA 3G8RA 5I3HA 3TKFA 3TSBA 4RV8A 3G22A 1H7NA 1WXJA 4LW7A 2ZRXA 3DI1A 5CZ0A 3RLVA 4E2DA 2ZRYA 3NL2A 1VPXA 1Q6RA 2FPYA 2OCZA 1JR1A 1QO2A 1R47A 1EEPA 3DU0A 2RDUA 1ZAIA 1YPFA 5AC7A 1L6YA 3NOEA 1FY6A 4MZYA 1FXPA 4AF0A 1SO4A 1TPFA 1P0KA 2NWSA 1K8YA 1JRBA 3O8AA 4WZHA 3NPXA 4XQ6A 4UTTA 2CFFA 2OZ0A 3UZ5A 3NQ7A 5TQLA 2A2IA 5BMXA 4O12A 1H7RA 3S42A 4DELA 3BARA 2VFGA 1H50A 4C1LA 4LVFA 1DJNA 3R13A 1TJPA 1W31A 5LNVA 2R8WA 1OX6A 2YCEA 1KBJA 3LXCA 4JTFA 2E5BA 1RVGA 4CCEA 4N6FA 4CNOA 1TPH1 1LBLA 2H3DA 4RJEA 1DJQA 4JGDA 4PL1A 1ZCOA 3R12A 5E1QA 3VKJA 4QIUA 1SSGA 3NGJA 1AW2A 1T0OA 3TAOA 5LNUA 1N55A 2C16A 1NSJA 3CWNA 2ATSA 3W1NA 1FCBA 3OVRA 4JTUA 3W7DA 2FFCA 4O15A 3LDVA 2WKJA 1TREA 2X16A 3B0UX 5CSRA 4OGZA 1JUKA 2PRMA 5AOUA 2CZFA 4GXMA 3EWWA 2QCHA 3GDTA 3INPA 3NZ1A 3LLDA 2DU2A 4KFPA 2WPBA 3TX9A 5CG7A 1A5AA 4UXDA 4G1KA 1GVQA 2QDHA 1U83A 3SGUA 1RV8A 1YTKA 4RZ6A 3IEBA 4M6QA 1H51A 3NO5A 2NUYA 2ZRWA 1LBFA 3HB9A 2A7RA 3DGRA 4JDBA 1KM5A 5BNKA 1SW0A 1OK4A 1XDMA 3QRHA 1M7PA 3I6RA 3W7CA 3E49A 1FDZA 3JS3A 2Y85A 3NPWA 4RKAA 1ZAHA 3DH7A 3GDMA 2OT0A 2QJGA 3WK0A 3CB8A 2CWNA 3PY2A 1WQ5A 3CEPA 3RK8A 1EP2A 3BV4A 3TK7A 4S2CA 4WJEA 5G5IA 1EB3A 2CZ5A 4UCGA 5G2IA 2QCCA 5LNWA 1PHWA 3NL6A 1OK6A 1RQEA 3L0KA 4EIVA 1JCLA 3OBKA 3R5EA 4JEQA 3EB2A 5L6UA 1G4EA 1OFDA 1ML1A 3GIYA 4DPQA 4HNTA 2NX1A 3W7IA 3QEZA 3CIXA 1S5VA 1VYRA 4X9SA 4FEZA 4ZQOA 4QAIA 5LGXA 3P5YA 4XKYA 2O7QA 2CZEA 3LRLA 2ZA1A 2B7OA 1UJPA 3G24A 4MZ8A 3W2NA 3DHFA 1B9BA 1K8ZA 3EEGA 1RQHA 1FX6A 2VEKA 2C6QA 4HNVA 3TH6A 3FOKA 1TPUA 1JRCA 4WUIA 2E5CA 4NUWA 4O50A 1OFQA 1M7OA 2DP3A 3B03A 1SO3A 4PCFA 4U4MA 3A9IA 3ZS4A 4AHQA 2A7NA 1GJPA 3FIGA 5GVJA 1VHCA 3GB6A 4FNSA 2V5BA 4GJ1A 4Y96A 2Y61A 5C55A 1G67A 5U7SA 1KLZA 1OFAA 3P60A 2GVGA 3GXPA 5I3FA 5HUPA 3W1AA 1W3NA 3MHFA 3N9RA 3G0SA 4NNAA 4QNWA 2ABAA 3P67A 4ORMA 4ALDA 1RD5A 2QCGA 4N9EA 3DI0A 3HG5A 1MZHA 2TRSA 3I65A 3RNDA 4A2RA 3NEVA 4ZQNA 1LRTA 3GNDA 3NM1A 1S5WA 3L21A 2EHHA 1ME7A 5FEXA 1TJRA 1K3UA 4IJBA 4N02A 4CQ8A 3S1XA 1LRQA 2W79A 5HWMA 1X8FA 3HG4A 4N9DA 4TU1A 1W0MA 5CZTA 1MEIA 3DXIA 4IMFA 3QW3A 3C2RA 2FTPA 1KFCA 1TV7A 5CZJA 1G7UA 3W2KA 5MHBA 1HG3A 2QCNA 3I7SA 4WY0A 3QMSA 5SWUA 4JTTA 2F7FA 2Y88A 5BRBA 1VC4A 3UXAA 1X7FA 3ZWSA 3DFPA 1LM1A 5A5WA 1EWDA 1R2RA 1BKSA 4LC6A 5F1VA 2LLEA 2X1TA 5D32A 3FJ6A 3TW6A 4R33A 4A2SA 5AYYA 3IVTA
chains in the Genus database with same CATH superfamily
1M41A 5JIWA 4A22A 3EBVA 2ZX6A 3ARRA 4L1GA 3RM9A 1DXEA 3SUWA 3UYIA 5D9MA 2EQDA 3HJZA 4TTGA 2PDMA 3CV1A 3NYDA 2HE5A 4BEUA 1EDGA 4LUJA 4JTSA 1OT2A 3ME3A 2DJLA 3UZXA 4HZMA 3VNKA 5I79A 4XIMA 1X1OA 4LYPA 3R7MA 1ZP3A 1F2JA 1KW1A 3VNJA 4R27A 4LS0A 3QGKC 1F3EA 1ZJIA 3GLCA 3TA9A 2EG7A 4J2PA 4UTIA 4HYVA 2BMBA 3VUSA 2J9XA 4GUFA 2VD9A 2REQA 4O52A 3U5YA 3WSUA 4LVGA 2BOGX 1MRAA 4Q4OA 3WJSA 1FH8A 1R5YA 2XVNA 1M1BA 2GK1B 3TXVA 4U5KA 3AIBA 1TWDA 4IFOA 2B7QA 1VLIA 1ISZA 1W5PA 2I14A 3KM8A 3W7LA 5HINA 1BAGA 5B80A 5A95A 3L68A 4GGHA 3AMDA 4DJEA 5U4NA 4O8RA 1ZTVA 4HN8A 2ZVRA 4FIRA 5C9RA 4Q8VA 3W1QA 2V9DA 4Z2KA 3BZJA 3MO4A 4CUCA 4I7WA 3H24A 1XDLA 3NQDA 2O4MA 3EOLA 2GQ3A 1PV8A 3VKAA 1K77A 1IEIA 2G8ZA 3KZSA 4DM2A 3NSNA 1B3YA 1TTIA 4U10A 2BFGA 3GG7A 1UCWA 3QTGA 1BLIA 1E0WA 4N9BA 5I06A 3C0SA 2BBFA 2EBNA 3W7HA 1W1B1 3G8EA 5JIPA 1BPLB 4HMEA 3N13A 4MADA 3W7EA 3EWCA 1S5TA 4PN2A 1T8XA 3RLUA 2VX7A 5LA0A 5DCEA 3IUHA 4PB3A 1R30A 3MHUA 2ICSA 3CZ8A 1Q6FA 3UWZA 3VDCA 3APTA 1LLOA 3FYPA 3HFTA 3N4AA 3VNDA 2RDXA 3IIPA 2FH6A 3VD5A 4E38A 4F4RA 3VE9A 1I0DA 2VWSA 2CBIA 1ONEA 2YXGA 5GNXA 2BTMA 3BGGA 4PMNA 2VEFA 2WCGA 3N29A 3OZMA 4DLFA 1RA0A 3GSMA 2C19A 2Q8LA 1J0IA 1H49A 2OEKA 4K7VA 3HU7A 4B4FA 3H7UA 5CJ5A 2XFYA 5G1YA 1ZQ5A 3W29A 2EKCA 4V2XA 2OEJA 3QPZA 5CPNA 4CQDA 1V8EA 1HW6A 1HKMA 5LIYX 4N4PA 3UXLA 1TRDA 4UQAA 6TIMA 2QZRA 2GUUA 1H2JA 2PDNA 4EX4A 3WMCA 1HKIA 1B4EA 1W91A 2R94A 3LHYA 5E0KA 3URAA 4D6GA 1PYMA 3CUJA 2PWFA 2PTXA 1I2QA 4P7QA 1CGVA 4B3LA 5FF7A 3K4WA 1KXHA 4QEEA 4AQLA 4AYGA 1Q6OA 5A6TC 3USBA 2WK2A 3V18A 4RCXA 2G4FA 4FO4A 1F5ZA 1Z48A 4I9TA 2BY2A 1GZ1A 1W1ZA 3C2EA 3V35A 2X7WA 2VEPA 2ZKMX 2BNJA 3EWBX 5J04A 3ES8A 3N6JA 1VR6A 2RH9A 3FKRA 3FLUA 3V0SA 4YL2A 4V28A 3C56A 2RGMA 1B31A 1CENA 1J10A 4TV6A 1GONA 3MT1A 2DZPA 4YYCA 3MBDA 1I0BA 4LS2A 4MNKA 2W3ZA 1XD1A 3IAQA 6XIAA 4TO8A 1U22A 3CNYA 1T99A 3U0HA 3PPHA 1PS9A 3NURA 1QNPA 4C7DA 4IIFA 8XIAA 4Z2LA 3VKDA 1TTQA 1EOMA 2QCLA 3G1VA 1KM1A 4FNPA 4INFA 3QZEA 3DESA 2XINA 2AAAA 5I3JA 3FK4A 3L7RA 3L66A 4BJHA 1SFTA 1MEHA 1MNSA 4W84A 3JR2A 3IGHX 3K4DA 3KCOA 4HD5A 3ONCA 2CITA 1TMLA 1XR2A 3WMBA 3MU7A 1KM0A 3L2LA 8A3HA 2G97A 3K8LA 4IF2A 3A21A 3NZPA 1A5CA 3ONBA 5HMFA 4H19A 2WNQA 1OF8A 1VPQA 1XIGA 2OQYA 4RL3A 3OA5A 3VGFA 3WBYA 1YDOA 2A6LA 3GU9A 1KTCA 4ZB2A 3VGDA 2VFHA 5LIUX 1GQKA 5DY3A 3NQEA 4D6IA 3A4WA 1E9LA 3VIMA 2R6OA 1RXOB 1ALDA 2D22A 3WUGA 2OX1A 4WSKA 3M7WA 1DQUA 2FZDA 3N4FA 1TTJA 5DCBA 3LGDA 4GIRA 3LK6A 3KOXA 5EMLA 1R3SA 1HKKA 2RKXA 1F05A 3TJIA 3N11A 1E0UA 3WH5A 4IFKB 3DFTA 3N4EA 3BH4A 1V7AA 5CC3A 4DF2A 1FWCC 1JUBA 1XC4A 3SIMA 2EJ1A 2XWEA 1ADSA 4WDUA 2UBPC 3HQ1A 2E7FA 1QJWA 1FKXA 1UC4A 2PGFA 5BXSA 3S5NA 2WHKA 4MB1A 1E15A 4YIWA 2W6RA 1Y65A 4OHQA 3WZ0E 3ZT5A 3W7GA 3TTYA 4B9ZA 1T8QA 2GSHA 4UNIA 2WZMA 1S2UA 4P61A 4A4AA 4CNTA 4BI6A 1L2UA 2FTYA 2J88A 4FXSA 2TPSA 3PZOA 4ZQRA 4OZOA 4S3AA 3ZXWA 5CKSA 3WK3A 4JFTA 4TX6A 1OIFA 2J6XA 1A0EA 1AH0A 1CGXA 1XLJA 1IXOA 2PRLA 3H21A 3W74A 3VINA 1EQCA 2Z1WA 4S3EA 2BS9A 3L0NA 3QTPA 1U1JA 2OSWA 1UBSA 2P3ZA 4XBJA 1A5SA 1UPPA 1GNXA 1I1WA 5DT7A 2RUSA 2OWXA 1JNDA 1QPNA 1B3VA 3T78A 4Z1CA 3UF9A 2E6DA 1QWKA 3NNTA 1UD8A 2DVXA 4L6HA 1J4EA 2GGEA 3K46A 4LUIA 4ZOAA 3G0UA 4JS3A 3BO9A 2IPFA 5LHEA 5A8GA 1CEOA 5AHFA 2ZZ2A 2J24A 1LZOA 5CSSA 1KWGA 4WJXA 9CGTA 2XJ7A 1UROA 3F2DA 1VIWA 3YPIA 1G01A 2VFIA 1UKPA 3CEUA 3W25A 4A35A 4RE4A 2OXNA 1FFQA 5AKQA 2FDSA 4GXPA 4KFNA 3WN6A 1WUEA 2ZRZA 1HFBA 1E6XM 3OBAA 1PHQA 4IUOA 3I4EA 1H4PA 3ZFHA 2PF8A 1K1DA 4E8DA 5FI8A 2CLHA 5BU6A 2QW5A 5KINA 3GBDA 2WVUA 3WNNA 1QFEA 3IV8A 2E6YA 4FOKA 2NXIA 1MFUA 1OC5A 3ZVHB 4GNKB 2Y8UA 1GORA 1KV8A 2QR6A 4WKFA 1PXGA 5IBXA 4FLOA 2GJNA 2NT1A 2FZNA 2WQPA 2HJPA 3MV11 1M7XA 3S83A 4UB9A 4LS1A 1IZKA 3QYQA 1JCTA 2QCDA 1XDJA 2ZZ3A 4RLIA 4WXYA 1UBPC 1V6XA 2YDRA 1C90A 1R0MA 3U57A 1O95A 4CU6A 2HK0A 3TONA 1MFVA 3L4UA 3G1XA 3HTWA 5A6LA 3TYUA 1S3TC 1ZHAA 3RILA 1HL8A 1M03A 3W7MA 1XCXA 5LIKX 1Q6DA 4UTKA 2FMNA 2PDJA 2CHNA 2VQTA 4GA8A 4AD2A 4MLRA 2FQIA 2Z29A 3M1ZA 3MI6A 3W83A 1V6TA 3CUHA 4NJJA 1RBOB 4H6QA 4U3CA 5FEPA 2OO0A 4GNVA 1OFRA 3S0CA 1ESWA 3Q65A 1XYCA 3PPCA 1YYAA 1IV8A 4B5TA 3AMKA 1FCQA 1ECQA 2AGKA 4DB7A 3IVSA 3GHRA 1QK2A 5JH2A 3NIYA 4RZ5A 3AISA 4AZCA 4YCPA 3WL1A 3V75A 1AG1O 1E43A 3O7UA 3QY7A 3AC0A 2YOCA 4PH6A 5M2FX 4QRNA 3NVDA 3B0XA 3VIKA 3AJ7A 2Z6JA 2HVMA 3GFZA 2WMJA 3SCOA 3A3WA 1RPKA 5D9NA 5DN1A 2QDDA 2V2HA 4HU4A 1XGDA 4NJKA 5LHFA 5C6MA 3MWAA 1QPRA 3WMLA 1VEMA 1XRSA 1F6YA 4QE5A 2WHLA 3SCVA 1OX4A 3OVQA 2WSKA 3CM4A 3CZLA 4LOCA 4P7LA 3WK1A 4HHLA 2XHYA 3GZ3A 4JY9A 3NQAA 4A3UA 1QPOA 5AZ1A 4W86A 2Y24A 1TQXA 5A6AA 3USZA 4FALA 4XBKA 3WLJA 4QX4A 4CU7A 4LY8A 1QPKA 1LBMA 3N9KA 4JX4A 1LYXA 4QE4A 1K4GA 1G0CA 1GJUA 5DXXA 4PTWA 2OYMA 4A8LA 4L4LA 4IJRA 1QPQA 3GXFA 3PM6A 1ZJBA 5FAJA 3OLEA 1EC9A 1W8GA 3VNMA 1NDWA 2VO5A 3QQ1A 4WGXA 4CEXC 4QITA 4FR6A 1BG9A 2V63A 2P53A 1F9CA 1EXBA 4QDPA 3H8AA 1OABA 1X6NA 3LV6A 2BXVA 2D2OA 1SJCA 4LV9A 3H2MA 1MZRA 4AW7A 2HISA 3G1FA 3WMSA 3ABQA 1E56A 4JDYA 4OFCA 3C2YA 3CHEA 5BXTA 5M03A 3STPA 1OIMA 4V1YA 1JZ5A 5G2WA 1XYMA 2RHGA 2OQLA 3OZYA 3B8UA 2I57A 3P8IA 3L4YA 3HPAA 1CXIA 5F2IA 5CXPA 2I17A 2P0OA 3HJEA 1TV8A 3LNMA 3REQB 1V3HA 3NDOA 4CU8A 4K3ZA 3EXTA 7A3HA 4ZENA 3ZYZA 1VFHA 2JQXA 2BVWA 2VELA 3VOCA 4GUIA 1YEYA 4O53A 3DG6A 3QR1A 1TX2A 4XAYA 3TR2A 1X38A 1QXLA 3P61A 4L4MA 3VMPA 4Q4MA 3BANA 3GUGA 3VM7A 4NJHA 5FL1A 4YTRA 3IIOA 5A2AA 2JKPA 3OQEA 3LRKA 1OCJA 2QJNA 5CAHA 3LEPA 1QATA 3I7RA 4GACA 3GRIA 1AD1A 3VO0A 3HN3A 1PTDA 4LF2A 4M6PA 3BLLA 3IACA 4ZB5A 2QGYA 5H6HA 2YDQA 3QKZA 3AO0A 4TOQA 1EBHA 1Y7VA 4HP5A 3BLDA 2XGZA 4EWND 1HL2A 4J5NA 4M8UA 3EDKA 5I77A 1A4LA 4MWAD 3BG9A 4KS0A 3IIXA 1V6UA 4K1WA 2ZXBA 2BLEA 4XV0A 1H1ZA 3BCDA 4QQUA 2QQ6A 3GNXA 4JKLA 5IDIA 3FGCB 2I5GA 3PZTA 2BV9A 4NASA 3CQJA 3WQVA 3KXQA 1S5MA 3LOTA 1T41A 3SSZA 3PC0A 3QKEA 2B7PA 1OZQA 2HMCA 4MB3A 4KWVA 4NL1A 1Q3NA 3KTXA 1V02A 1AL7A 4GYJA 3HGJA 5BMWA 2HBVA 2J7DA 5D2WA 1PYFA 2ACUA 4WIWA 3NL5A 1N7KA 2VP8A 1G4SA 2PD5A 1HXJA 3PN8A 1C9WA 4DO5A 2ISWA 1HJVA 1LJYA 4AD1A 1K7XA 4HYRA 3FAXA 3DZ1A 3CU2A 2TMDA 2AAMA 3NPUA 3G5EA 4ILSA 3CHFA 2ZZ5A 4I9AA 4NZ3A 3KVMA 5C9ZA 1YXDA 1AJ2A 2IPWA 3OP2A 1ONRA 3R0UA 1BTCA 4AMAA 3EEZA 3T1GA 3S9ZA 3UXIA 2BODX 4HU0A 4ECLA 2F9RA 1Q7MA 4MJ4A 1DIEA 1IGSA 1JJKA 1SJAA 4XTIA 4AZ6A 2NZLA 3WDIA 4R85A 3QC3A 1NWRA 3EGJA 2QAFA 1R9YA 4LEQA 1BYAA 1XYAA 3GHTA 2DSVA 4S3GA 3SR7A 4GVFA 3RPTA 1TJ2A 3H53A 5BW6A 3ORWA 1O94A 1U5JA 2C79A 3SUUA 4JN6A 4H83A 1RVKA 1G4PA 3LMZA 1SZNA 2YPIA 1CXKA 3W7OA 1F8MA 4J3VA 4PCSA 3TNOA 2FGLA 1MUMA 1UZ1A 4O8AA 2GOUA 1C8XA 1E6QM 1SVDA 4GKLA 4DBWA 2NT0A 3DFNA 3R94A 5HANA 4IHCA 3EWZA 4MAZA 1R2TA 4I7VA 4JN7A 3CZKA 4WOZA 1FWNA 1DKWA 3TCEA 1GT8A 1ZGDA 2DZTA 2YCLB 4Z2GA 1UD2A 1DBTA 2G0WA 2VGFA 3N2BA 3S9IA 1OCQA 1PL9A 1KFEA 1V3JA 1IEVA 5IFPA 3ZLFA 2E1DA 1ISYA 4S38A 1C91A 1TVLA 1EPVA 3C52A 1VJIA 3IJQA 1KTNA 4H4IA 3ISIX 1KWKA 3W02A 3WH8A 5C71A 1GYNA 1OJXA 3JZUA 1L6SA 2NXHA 4O11A 1A47A 2HDJA 2P5NA 5HWJA 2V69A 4WDTA 4PMUA 4Y9OA 5IOBA 3TROA 2F6UA 4GI9A 1V03A 1E5JA 5G4HC 4M19A 1VH7A 3AS2A 3GVVA 2PZNA 1K9TA 4GJJA 5FSDC 3SI9A 2AOSA 1QW8A 3SY5A 4BFAA 2BDQA 2WNNA 4JIQA 3VFLA 1XF0A 3NL3A 3TFXA 2FLIA 2BASA 2GGJA 4GO9A 5EL1A 2XH0A 3CTLA 6REQB 5KMYA 2NLIA 1TB3A 4AC1X 1OC7A 1KV5A 2QJIA 5CPQA 4FK9A 1PVNA 2FZBA 1FHVA 3EAUA 4H6KA 1DIOA 2ZYFA 5C5YA 4F0MA 1MI3A 3LTSA 2XM2A 3OQ8A 3UZJA 3R25A 4O0ZA 1I60A 4YS1A 2OQHA 4REQA 1YE6A 3GR8A 3K8KA 2BGSA 1B30A 2NVAA 4QLLA 4FOJA 8XIMA 2G3MA 3CH9A 2V38A 4NX5A 1C8VA 3EOEA 1RD6A 3VK5A 3F7JA 1VFSA 3WF4A 3R89A 1H5YA 4NJGA 2DSWA 1XQLA 3SEPA 1V4YA 1SFSA 4E8GA 4DJFC 2Z1SA 4JFSA 5EMYA 1PX4A 1SO6A 2OYLA 1H7OA 3A3XA 2PCQA 4B5NA 2FDMA 4M80A 4PMOA 3P8JA 1L0PA 3SN0A 4B2DA 1WO2A 3CS2A 4X61A 4B15A 2XN2A 3OLIA 2YZRA 1R3RA 3PUGA 1PIGA 4UTLA 1UR9A 3V0TA 4NJIA 3WD2A 4E4FA 5D09A 3P3BA 1UUOA 4TIMA 3MTWA 1FBAA 3NOYA 2FZ8A 4TX9A 5HPCA 4GUGA 1BFNA 3MKKA 4LUYA 3FFSA 4O4VA 1QVBA 3OG2A 4CGTA 2VXNA 4NNBA 2NV9A 2X1IA 2PLJA 3STEA 5L9FA 1AODA 4QEHA 4Y9AA 2F2KA 4UBPC 1H0IA 2WBKA 4TTUA 5HJYA 4B91A 3TN6A 3T2QA 3UWYA 1Q6CA 4JN8A 2A3LA 5HQMA 4JIHA 4F0LA 3K30A 3TYEA 5LXXA 1CI1A 5LSMA 5AC4A 2Z27A 1XW8A 3UY7A 4FX7A 5CH9A 4X63A 5H2ZA 2P1FA 5ENLA 1VCVA 1UZ4A 4MWAB 1YNPA 4DHGA 3N15A 3PJTA 5CGQA 2WJZA 1VFUA 1V3MA 3RX4A 3EPOA 3DFQA 1TE1A 3KAOA 1ZRQA 1RCOB 2ZUVA 4EE9A 4IIGA 3VGBA 2OOFA 2VX4A 1RJPA 4CQ9A 1B9ZA 4DN1A 3W70A 4LEFA 5DT5A 4JKMA 4Y9NA 3W87A 2J8GA 4CLMA 3PZ9A 5EKYA 2W91A 4Z0JA 5EFFA 1Q85A 2J7HA 4UOJA 3CT7A 2R1PA 4CQAA 3O05A 2PGRA 4JIEA 4DBEA 3PWGA 3NZQA 5ABFA 2P8CA 3F03K 4UMAA 4AEFA 2DVUA 1IR2A 5I09A 3ARUA 3DYPA 4H1ZA 4CNPA 2DJXA 3IRDA 4ENLA 3S5OA 4HT3A 5AYZA 2A3CA 3TXZA 5H8MA 3TE9A 3RUBL 5CC5A 3OZPA 3A3HA 5CGMA 1TUFA 2HVOA 4HIBA 1GW9A 5A8QA 1AFSA 1J18A 2D0FA 3W7QA 1CCWB 3NQCA 2DSKA 4V1XA 4LXFA 3S2LA 2CXEA 3HF3A 3W7PA 1BVNP 3GX9A 1ZJAA 3PZMA 1ISVA 3SSJA 5D38A 3J7HA 1XX1A 2WMIB 2DH3A 1O5RA 1YNYA 4LBSA 3ARSA 2OT1A 4I6VA 3NTYA 2GL5A 1VJSA 3M41A 3GBEA 2CW6A 4RNIA 4JXCA 3B8WA 3ES7A 4JL2A 1SZGA 1ZBWA 4NU7A 3AIQA 3DN5A 1B57A 2YCKX 2ZZ6A 3BLFA 3AHYA 5FOOA 2ZRUA 5CGTA 3JVAA 3H22A 1KRAC 3LSBA 2BWGA 4HMDA 4MJ2A 1TVNA 5A6SA 4PMZA 3FYOA 3UNDA 5AYIA 1M6JA 1GQLA 5REQB 2R91A 1XS2A 2GVEA 1KFWA 3KLKA 4KCTA 2ZZ4A 3W00A 2WSQA 1WKYA 2HNHA 2IW0A 5T26A 2XZ9A 2ZADA 1W3LA 3CQIA 3N2MA 3GVWA 3KLLA 4HPNA 1J2BA 2V5KA 4KQNA 4XZBA 2YA1A 2PP1A 3ITVA 1J01A 4KEUA 4FLSA 1EP1A 3EDDA 4Q33A 3E0IA 1JAEA 4IT1A 4LJ3A 4JTAA 1J9YA 4MDOA 1H7NA 3TZFA 4J40A 2ZRXA 3DI1A 4F8XA 2WHJA 2Z25A 4E3TA 2WWCA 3GHSA 5AC7A 4NYUA 3NOEA 3CYJA 1FY6A 4GY0A 4MZYA 1FXPA 1SO4A 1TPFA 2NWSA 4P8XA 2I56A 3W38A 4JQAA 2IQDA 4XQ6A 4AY1A 2POTA 4UTTA 2VRKA 3UZ5A 3NQ7A 5BMXA 2IPGA 3IJ9A 4XZWA 3S42A 4DELA 4B5XA 4XSMA 1H50A 4C1LA 1E71M 3CUXA 3PFMA 3RJXA 2HRWA 1TJPA 3QV6A 1UUQA 2R8WA 4YTUA 1CDGA 3BSMA 2YCEA 1KBJA 3GH5A 3AOFA 3RX3A 2E8ZA 2VZTA 3A47A 3UG5A 1XH2A 4CNOA 1TPH1 3WLHA 2H3DA 1DJZA 3WY1A 4PL1A 3NCOA 3SRHA 5E1QA 4QIUA 5LNUA 1XFCA 3ARQA 1AQFA 3ITLA 2C71A 2GK1A 3W1NA 4DIAA 3OVRA 4JTUA 1XIMA 2FFCA 3CASA 5CSRA 2VWTA 3K8MA 4W8BA 3W0KA 4PB4A 2CZFA 2J62A 3CMJA 3ARXA 3INPA 2VL4A 3LLDA 3B4YA 3TX9A 1JIBA 4AZ7A 1B1YA 1U83A 4W4QA 2ACQA 2F6XA 2J66A 1IZJA 1K8CA 1QU4A 1KGWA 2YDSA 3A4JA 3DGRA 2XZ7A 1QNRA 4QG9A 3QRHA 3I6RA 2ZC1A 3KBNA 4RKAA 1EJWC 3DYOA 3GDMA 3WK0A 4NZ4A 3R0KA 3LG3A 1KXQA 3U7VA 4G7EA 3GY1A 2A3BA 3VU2A 3H23A 3WO8A 3RK8A 4W88A 1EP2A 3TK7A 4WJEA 3T9PA 1EB3A 3ICJA 2IKHA 4PMRA 5FJIA 3L0KA 4JEQA 3BAKA 5XINA 1OFDA 1IEXA 3FHQA 4DX3A 3AICA 1R3YA 3W7IA 4DJDA 2CCRA 1S5VA 2BY0A 1VYRA 2OZ3A 5AY7A 3VGGA 4FEZA 4ZQOA 3V36A 3WBEA 3QV9A 4P7NA 1WKDA 4Q4PA 2CZEA 2DQWA 3G24A 4JQ3A 1B9BA 3F4VA 4GJIA 1K8ZA 1RQHA 2YCIX 3TTOA 2C6QA 1OC6A 3PZNA 4HNLA 5T9CE 5A8MA 1BHGA 2PGWA 1JRCA 5CBJA 1W3JA 1HL9A 1Q6EA 3MCNA 3IJ8A 4LAZA 2GJRA 4CEUC 2DP3A 3B03A 1SO3A 4U4MA 4Q4QA 4NZ5A 1DIKA 2VURA 4M3PA 1GJPA 2DDXA 4HOXA 4XZHA 4V15A 1N8WA 5HUPA 4QNWA 4ORMA 4ALDA 1EA9C 4Q3MA 4KESA 3HG5A 4DYEA 3VA8A 4MG4A 1RK5A 2O4QA 1UR4A 3PBMA 5HATA 3NEVA 3GFYA 4W5ZA 5MF5A 5I7GA 1LRTA 3B40A 1HNYA 1IT0A 3KS6A 3HQPA 1TJRA 5FEXA 3S1XA 4IIDA 2OGJA 1LRQA 1GW1A 1OZMA 3U4AA 4NY2A 1POKA 3HG4A 1EEXA 5D9PA 3VOIA 1RY0A 5CZTA 3T0CA 1MEIA 3BCJA 1TV7A 4D6JA 2Q71A 1HG3A 1MXGA 1U2YA 2QCNA 2WKGA 5MHBA 2F7FA 1VJZA 1AJZA 2Y88A 3MJMA 5BRBA 3L4ZA 3WYZA 5F1VA 1BKSA 5CCZA 2FVLA 5AYYA 1J0KA 3O16A 2DSZA 2X2YA 5LA2A 1NDVA 2C3ZA 3KVJA 3QR0A 1LL4A 4DZ5A 2QCMA 2WMHA 5A6BD 3S2JA 4FX6M 2FVMA 3KBMA 1K8XA 2E68A 4GYKA 1BYCA 3T0DA 1ISXA 1EJ7L 6PTDA 4D2JA 5BRQA 4H6RA 4O1FA 3PG9A 3NZRA 4R9OA 3ZIZA 2ZXQA 4CNUA 3I10A 2WCSA 4KWUA 1BQCA 4PBGA 5TNVA 3ZJ6A 3BG3A 1FWRA 4C6DA 5I23A 1BYBA 4AISA 1UKTA 4CNNA 1KD0A 4AZBA 3ELFA 2C14A 3HM7A 3CL8A 1K9FA 3RO8A 3MVIA 4UQCA 3W22A 4JD4A 3MUIA 5HJLA 2MNRA 1ICQA 4NSBA 1GHSA 4EACA 3G0XA 1DL3A 2X30A 1D7FA 1NWSA 3GTXA 2QXWA 1XBXA 5ABTA 4BF7A 3PR2A 1EO7A 3MY9A 2DT2A 5DY2A 1OQFA 1UJQA 1AW5A 2Y0FA 4I8YA 4S39A 3M47A 1E72M 2VT0A 2PDQA 3KUMA 3O0FA 2ZIDA 4IFKA 3I6TA 5LZLA 4HA4A 3QPEA 3AXIA 3C2FA 1SZFA 3WLIA 1FH9A 5F4WA 1LP6A 4BK9A 3BXWA 4Z08A 2D2GA 1UQZA 3T4CA 3ZR6A 1EIBA 1KBKA 2HCVA 4JTJA 3WLMA 1GEHA 4K6AA 3IIZA 3T8LA 3TP4A 1N2VA 3QMTA 1KBIA 4CN6A 3PBUA 3KWSA 1PE1A 1ITCA 4WSJA 3TAKA 2CBUA 3NUKA 1M7JA 1BGAA 3AIWA 3LCFA 3Q37A 1E6ZA 2C1HA 4Q7NA 4DBUA 4XTDA 4UTWA 3MVTA 1JI2A 3D47A 3NWRA 3WUFA 2Y4SA 1O12A 2VJXA 3UGVA 1D8WA 2R82A 1TCDA 3IGXA 2Y7EA 1IWPA 1RUSA 1W1YA 5E70A 4Y8EA 1R87A 3DHDA 4NZJA 3QPYA 3B0YA 1TV2A 3MP3A 3UWQA 1XIFA 3L5MA 3LGEA 4KPLA 1NF0A 5HNTA 4OIFA 4UFIA 2P0IA 4QLKA 4Q8NA 3ZR5A 4ICMA 4F79A 3I3EA 3F1QA 2NX9A 4UZUA 3N2XA 3GK0A 4G2DA 1OCNA 2ALDA 3I6EA 4LU0A 3EYPA 1VS1A 4HNUA 4L4OA 2WBGA 1CECA 3BJTA 3CPRA 3E96A 1GQJA 1RP9A 2QNEA 2UY3A 1DPMA 1MDLA 1L8PA 1F3XA 1TMQA 3FA4A 1JF6A 1GZGA 3RMJA 4RR4A 3MUCA 3PTQA 4QGCA 3MW7A 5BRPA 1LLWA 1JYXA 2BGQA 3ZLGA 1ECEA 2J47A 3GTFA 2AMGA 4NYYA 4LVAA 1VCGA 4AD5A 2XFFA 1HGYA 4IM4A 5ECUA 3TTEA 4AMCA 3N18A 1W5MA 4E5TA 3T42A 3CUZA 4OUEA 3W88A 3ZVHA 1V3IA 4IMCA 3RPMA 3C0JA 1XYLA 1D3HA 2OO6A 1YTEA 3G1RA 2QCDB 1AJ0A 1HF6A 3RN6A 2FFIA 4IPNB 3T08A 1EPXA 4N42A 3UWVA 2XYLA 2PDKA 1UKSA 2HV5A 5HAOA 4G8TA 1CXLA 1UH4A 4FPSA 3TJLA 4LUTA 4PUMA 3G1AA 4MNJA 1KM2A 3DG7A 5IRPA 5AYXA 1ODZA 3PF3A 4AZHA 3UJRA 1W1PA 1KRMA 3EXSA 2QV5A 5CBBA 1M68A 2X41A 5HMDA 3BLEA 3ARPA 3C86A 2R1LA 1LG1A 3GZAA 2WKLA 4U28A 1XIDA 3BLIA 4E2VA 1I9CB 3D46A 4NAEB 1WV2A 4HB7A 1E6NA 1AUSL 1TPB1 3EOUA 3DENA 3L12A 3MKCA 3NQFA 2CIPA 3L2IA 4OBRA 3KOFA 4DWSC 2J7EA 4W5UA 3S2NA 2JBMA 4RPQA 3MHGA 4XUGA 2H6RA 4EAMA 5TF0A 2H8XA 4OJYA 5I78A 1KB3A 3HBLA 1CGYA 1W5QA 3ANYA 3AS3A 1XI3A 3P74A 1EGVA 1A3WA 4DAIA 3CLWA 3NXFA 2C7FA 3CQHA 1A53A 1OB0A 3BW3A 1YKWA 2E67A 1EC8A 2FHBA 3QJAA 1DXIA 3U2OA 2A3EA 4S23A 1Q8JA 3GIPA 4AVFA 3MDWA 3VCCA 4JTLA 3VD4A 5CPLA 3BAIA 3R8RA 2Z7KA 2XSAA 3URQA 1XBZA 4XVDA 2OSXA 3W7NA 4MDPA 4QJ5B 1LT7A 2D3LA 2WYSA 4AWEA 3S2CA 1WPCA 1ZZMA 2O9RA 2FZMA 4P8WA 5F2LA 3HMJG 3KHJA 3R0DA 3XIMA 3PSWA 1R86A 1TJ0A 2Z2AA 4UNLA 2ISFA 3LCXA 3AHVA 1PZ1A 3PBGA 1WBHA 1ADDA 4AD0A 4GY7A 2PBGA 1CTNA 1WBJA 3VNLA 5ABEA 3GXMA 4O1BA 1J8VA 1Y0EA 4IXHA 3QF0A 3SCSA 3V5FA 5D4YA 3C61A 5AZ0A 2XPKA 2NUXA 4NQ1A 3N3TA 4H9ZA 1XSIA 3W23A 2VKZG 4D1JA 4IGHA 3Q2DA 1MQPA 1CLXA 3IJ7A 3KCLA 2WO5A 4B5WA 5E93A 1QO5A 2Y5EA 4I90A 1O7AA 5BOFA 2XH4A 3L23A 1B0IA 1O4UA 1XH1A 1V6YA 4BF5A 1L6WA 2PWGA 1VGAA 3S5YA 4D6EA 3VIHA 1WDSA 4UQBA 3HPFA 2PTZA 4MUPA 1R46A 1UOKA 1B5TA 1K7EA 1XLCA 1L6GA 4LF1A 2G3JA 7PTDA 3VDBA 1S38A 3PS7A 4UIOA 5HR6A 4C6MA 5DMLA 1A0DA 1UMLA 4C6NA 1TR9A 3ANUA 4LVDA 3UWEA 5FJOA 2R1MA 4HZ6A 1IWAA 3V3WA 4W85A 2R1KA 3KBSA 4EF8A 1ZBCA 2WMKA 4ZQPA 3M0ZA 1XHGA 3WQGA 5AVNA 2VTFA 4LRTA 1FHUA 4JYEA 2WNWA 3RXZA 5EGRA 4UTUA 3MMWA 4I3GA 4E2BA 3UZYA 2V3DA 4GIEA 3TTSA 2D0HA 3SRFA 1F6KA 1GOIA 2DIEA 5AYBA 1MYRA 1GOOA 3WUBA 1J0HA 3SECA 1J79A 4PB5A 1HJUA 2HS8A 5I3KA 2G3IA 1Z3NA 2DIKA 3HGRA 4ZFCA 1UOZA 1RR2A 1SJDA 3A6OA 1LORA 1P7TB 3RITA 3W7JA 2MUCA 4ZR8A 3GW0A 2JKEA 4U2ZA 3HA1A 3SO7A 4I8DA 4MM1A 4UWMA 4MPQA 3OYXA 4LY4A 3B06A 3T81A 4AZGA 1VEOA 3LQLA 3BK0A 4F66A 2QHAA 1EA0A 4GPNA 4O14A 3KVLA 5F4XA 1YX1A 1B4KA 1C7TA 4DJEC 5CPMA 3ZO9A 3R11A 4AIOA 4GABA 1W9UA 3HV8A 3QH2A 3P62A 1REQB 3TVAA 2KZHA 4XK2A 3U7BA 5CLTA 1DWHM 4E6MA 4UTMA 1EBGA 4DY1A 2GJPA 3G18A 4J9JA 2Q3OA 3S3GA 1V0LA 3W81A 1IIHA 3D3AA 4ADUA 5AHNA 3CXOA 1W1TA 2V5CA 1JZ2A 3LLXA 5HNNA 3MANA 2WVSA 1EFZA 3CO4A 1QNQA 1RPXA 3DG3A 1A5KC 1RJRA 3UA3A 2VDHA 1JCXA 1ONXA 1CT5A 1QHPA 2OLHA 3PZVA 3SRKA 4AU0A 4KGJA 3LPFA 1V02E 4D6CA 1O1ZA 4P2VA 4FB7A 4WGHA 1JDCA 3R58A 4Z2JA 2FGBA 1JAKA 1X1ZA 4HOZA 4LSBA 1LQAA 3UJSA 4NIRA 4QISA 3BOXA 1F7BA 1E4NA 3GXTA 3NEHA 3TW7A 1LQ0A 5LNRA 3ZOAA 4H8VA 2F84A 2Y70A 4KT2A 2ACSA 3PNUA 2E9MA 3EA1A 3QVQA 4M24A 3OO2A 1W3KA 3RAOA 3NG3A 4QG8A 3RR4A 2VC9A 3N12A 4U33A 3LXBA 3KBJA 4KERA 3H55A 1R2SA 3G2GA 1F4HA 2VC5A 3M46A 2PS2A 1R9XA 4OBTA 1QR7A 3SUTA 2NXGA 4N9CA 2DZWA 6A3HA 3HURA 4ML9A 3P2VA 4JX5A 4GINA 2PURA 1FDYA 4O54A 5LIXX 4GC4A 4F2TA 1TZ9A 1A50A 4PBEA 2YFNA 1XG3A 4H6EA 1ONWA 3SBFA 2ATMA 3MV01 4RZBA 1RZMA 4QCEA 3Q94A 2YCLA 5E5CA 4L9ZA 4KIEA 3AIUA 2AL2B 3E6EA 4PTNA 4Q4KA 2ABBA 3H7VA 2INEA 2PWEA 3ALFA 4X9YA 3WBAA 3IUIA 3FA5A 3QHMA 1QRQA 4TV5A 1G6CA 3POHA 4IIEA 3MWCA 3KTSA 1OX5A 3QGAC 4J28A 3RFAA 1NFBA 2PEVA 3CLMA 3B9OA 1UA7A 3VC6A 3PVFA 4WJ8A 5CJNA 4L9YA 1TPEA 1MWOA 2OEMA 2CERA 1SR9A 3THQA 1F76A 2WLZA 3KVKA 2ALRA 2KX9A 3RX2A 1R9ZA 3F4NA 3M07A 3UCQA 4DUVA 2Q6ZA 1Q4WA 1P5BA 1EHAA 1WYIA 3CV2A 3UY8A 4EK7A 3P6LA 2E0PA 3WEMA 1ZALA 1V79A 5E6YA 1VBGA 3NQMA 3PB0A 1T5AA 1E6RA 3LU2A 1DIDA 4M56A 3H4WA 1I2PA 4L80A 5HQLA 1JI1A 3KOWA 3GO2A 5K9XA 5I0DA 4PTXA 4D6FA 4E4UA 1GQNA 1GG0A 3LB0A 4QJ3B 3STFA 1WDWA 4ZGYA 1IQ8A 3GC4A 3HQNA 3RG6A 1X8CA 3AU6A 4REQB 1JCYA 3ZQ9A 2Q01A 1P6CA 4ZTXA 1R85A 4IP4A 3LI0A 2QUVA 4H04A 3UYCA 5C0QA 4URIA 4WDWA 5D03A 2XH7A 2BHYA 5FCZA 4ZSUA 2YA2A 4F0KA 5CBIA 2PDCA 1VKFA 4U2YA 4AEOA 4XO7A 3ARYA 3WLRA 1NP0A 3BMVA 1R3QA 2TAAA 3V7PA 1L9WA 3A24A 1TIMA 3KBWA 3CAWA 3OGRA 3PZUA 1QTWA 3MSDA 3T7VA 2PP0A 1ELSA 3GXIA 3WELA 3GNRA 4F9DA 3UG4A 4Y2WA 3F2BA 4K7YA 4HPHA 1EDQA 4AFYA 5I3IA 5I07A 2CHOA 2QULA 3HIJA 4B5UA 1TPDA 3C8FA 4XIAA 1FH7A 2W62A 5FJPA 1EF3A 3B3DA 2WVTA 2GOKA 1H62A 1E3ZA 1I2OA 1PX8A 1MW2A 3S1WA 3OLDA 1VD6A 3BAJA 1EJTC 4D8LA 3B8IA 1YIXA 1SZEA 3QFWA 4JIRA 3HQOA 4FF5A 3HOJA 3T4WA 2DZSA 4PTVA 5HPOA 3M0IA 1MNZA 2RFGA 5BWAA 3TU9A 3NA8A 4LAUA 3DBPA 3WDHA 2R1NA 3THDA 2C91A 2ZX9A 4H8UA 5K4XA 2WSRA 1EYEA 3H4XA 3W4RA 3UR8A 5FEZA 1A0CA 4QJ1A 3MS8A 1RA5A 3GVRA 2QPUA 1VP5A 1YMYA 4YMZA 1T7LA 1FWJC 3WQWA 3S6TA 6ALDA 3S4TA 5PTDA 4PGLA 2VVSA 1Z9AA 3GDRA 1YW1A 3I68A 3U4FA 2Y8KA 1UD6A 2XSBA 1C8QA 1JGIA 4HN4A 2BG5A 2YB1A 4JTIA 3JU2A 1KCZA 3B0VC 3BAYA 4LT9A 2QUMA 2UY4A 4Y90A 3LMYA 3S9YA 4MWAA 4N2YA 1OFEA 3QZ6A 3B8SA 1DOSA 2HXUA 4PTDA 4WRHA 2XUCA 1HJXA 1OGGA 5I2UA 3E0LA 5CZKA 2A85A 4HA1A 4LALA 4ORIA 2FH8A 3V5CA 1OFPA 4DLMA 4O57A 5EA9A 5GJPA 3KL0A 4ZSTA 5ABFB 1F4AA 3H4GA 4RE2A 5EB8A 3VKKA 1HN1A 4ZO8A 3LERA 2ZUWA 2PTWA 4E4PA 1SO5A 3WENA 4KFOA 4S1FA 4ZVJA 3ZZ1A 2QGHA 3DC0A 3LHVA 4CD5A 4UR7A 5IBXC 3O9NA 1JD7A 1FCUA 3KX6A 4Q6JA 3AYVA 3UCDA 4B92A 1JPKA 3B0PA 4XB3A 4YCOA 4H9YA 3M0VA 3OG3A 2QJMA 4Q7IA 4L6DA 3TOPA 3G1DA 3JRKA 1DHKA 5DXYA 4ZEPA 4IZGA 5BXPA 4J3UA 2VZOA 1A5MC 2WMIA 1VIZA 3P81A 3ITYA 3NO3A 3T44A 3JUGA 3P7YA 3M16A 4AB4A 4Y8FA 2OPJA 3FW6A 3KEHA 3CWHA 1VENA 2GZXA 2WPGA 5FEWA 3VPLA 2PTYA 1Q8AA 1HO1A 5M1TA 1CGWA 2EO7A 2B7NA 4IMGA 3NYZA 2CBVA 1Z89A 5C2CA 4AWTA 1J5TA 5REQA 2V2DA 1OGBA 1S2AA 4JX6A 3IK2A 5BROA 1IE7C 4HTYA 2W5FA 4C7GA 4FX8A 3E3HA 5HNUA 2Y7GA 3F4DA 4GVIA 2X0HA 2D2JA 1E9YB 2OR2A 4IX2A 4IJCA 4DUXA 3CIWA 4JZ5A 1DE5A 3L5LA 4LGXA 4IG2B 1QOQA 3W1XA 1DWJM 1DTNA 1SQ7A 1AQ0A 4JTEA 3UR5A 4M7SA 1BWKA 4J3WA 2E3ZA 1I45A 4BZYA 1PKYA 3ARZA 4ATWA 3UW6A 1JCMP 4UFHA 3LHZA 2YJQA 3DKJA 2YX0A 2NQ5A 4PCPA 2PODA 4GE8A 2VRJA 3EKLA 5DMYA 3C2OA 2MANA 3LLFA 3SJNA 4CVWA 1S2VA 4FHAA 1XIIA 2VFEA 1UASA 5BZAA 3M0XA 4J3ZA 1VBHA 3O15A 1JQVA 3BMXA 3MC5A 3EDFA 2GSEA 1VYSX 2XIQA 3SRDA 4YLWA 4YU1A 1NY1A 3PZGA 4IIBA 2H90A 1NVMA 2E9LA 1XCFA 3ZVIA 3S6OA 5AB3A 1W5NA 4OE7A 3H26A 3WLPA 4MAVA 5JQ9A 4M1RA 2FZ9A 1EC7A 3Q4DA 1Z32X 4MOZA 4AWUA 3WQ4A 3E38A 3LCIA 4GWEA 1JYWA 2KAUC 4CD8A 4GNJA 4WEVX 1JULA 3T09A 2V82A 2GVJA 3NGFA 1XIEA 4DO4A 1O68A 2C1IA 4JCLA 5E0CA 1UR2A 5CLWA 4NXKA 4QBXA 4EXBA 2V0TA 3AIEA 3W72A 2CC0A 4G7EB 1HKJA 1PCKA 4D9PA 2X1RA 1XLLA 5FL0A 1EGMA 4O1DA 4POCA 1K70A 3STCA 5I00A 2PCEA 1W9XA 4GQBA 4ZE4A 3U8GA 2A21A 1UQYA 4A8NA 3FNDA 3VNYA 1TV3A 1ME8A 2G5WA 3K1GA 1U1HA 3QQWA 4AHPA 4K36A 1RQBA 3W7RA 1E0VA 4F40A 3P0XA 1V51A 1UWAA 4JNZA 3T05A 3G1SA 5HR7A 4MJMA 1RCXB 4ASTA 4FLQA 3ATYA 5TBOA 2ZTKA 2HPIA 3IANA 1X39A 4PUDA 4PFHA 1GVOA 1GOMA 2V5LA 3E0VA 3R6IA 4FNQA 3WDQA 1FWGC 3VI2A 4GUHA 3ZR4A 4LYKA 1IGWA 4ICNA 4GYPA 4X22A 8CGTA 4HPXA 1GG1A 1TJ1A 1KBBA 4HNOA 3DERA 2ANUA 3OGVA 5JBEA 1N8FA 3KDNA 2V3EA 4NXSA 1DP0A 1H0GA 3ITXA 1ENUA 1T40A 3EMZA 1BKHA 3GVQA 4GUJA 2P76A 1DWFM 3RGTA 4PTMA 3PFRA 3P0WA 4PMQA 3VXGA 3NQ6A 5CPTA 2DZVA 4YXGA 5CJMA 4DUWA 4OOUA 3HPZA 4E0CA 3RRXA 3AWOA 3UERA 3VILA 5I24A 3E2VA 3E1F1 3TMLA 2IKJA 3BW4A 3N1AA 4I5XA 1GCYA 4GG9A 5FSEC 5CEWA 2XSXA 4Y9MA 4ERAA 2F2HA 1XUZA 1K6AA 3P82A 4Y7EA 1CYGA 3UPWA 1WAUA 1THFD 3UVIA 3EX6A 3D6NA 3O06A 4HMCA 2CPUA 4B9YA 3QLDA 4L65A 1Q45A 1EIXA 3CAQA 4J4KA 2CXGA 3TYZA 4FNTA 4QNEA 1LLZA 1KR1A 3BQ6A 3TC6A 1B3WA 3QHOA 1NDZA 2J7BA 4B5SA 1WA3A 1MO0A 1UR1A 4UZSA 2O92A 5FIPA 5A6MA 3G8RA 5T8GA 2BXZA 3TKFA 3TSBA 4XZMX 2YXOA 2CHRA 2CBJA 5CZ0A 2HK1A 2ZRYA 3RLVA 4E2DA 5LXEA 2OCZA 1JR1A 4KWSA 2CLPA 1IZCA 1UC5A 3ARVA 3DU0A 4ZO9A 4GI4A 1ZAIA 1L6YA 3EMCA 2Z1XA 3GFXA 2FGZA 3OW1A 4EWJA 4AF0A 3NJ3A 1H09A 5FA5A 1JRBA 4DWDA 3O8AA 2J4GA 4R7OA 3B97A 3R8HA 3VYLA 2OKOA 2OZ0A 4DM1A 3I4KA 2A2IA 4O12A 1OT1A 3BARA 2VFGA 4OVXA 4BA0A 4PUKA 1AMYA 1OX6A 3T0TA 1OBAA 3BCFA 1P0EA 4EAYA 1CGTA 1ZP4A 4N6FA 1LBLA 2DH2A 4JGDA 4P7OA 1DTUA 3R12A 7XIMA 4ROQA 1T0OA 2C16A 3S46A 2E40A 3AXXA 3CWNA 1EJVC 4PE8A 4HPGA 1E40A 1FVPA 1OEPA 4TXEA 3WQ8A 4GHRA 4DZAA 1TREA 3IJIA 3B0UX 3CHCA 3AHXA 5FAGA 1JUKA 1Q6GA 2PRMA 3UBPC 2O9PA 4GZIA 3H7RA 4H8NA 1AD4A 3SQMA 3TLLA 4Q8QA 2O0TA 1IWBA 3GDTA 2XISA 2DU2A 4AC7C 1A5AA 1JFXA 1XC6A 1E3XA 2QDHA 3AMCA 4WF7A 1YTKA 4H9TA 2JALA 3HB9A 2A7RA 1UD4A 1KM5A 1SW0A 4S3CA 1OK4A 1XDMA 1M7PA 3JS3A 2Y85A 3NPWA 1ZAHA 3FY1A 3LBOA 3T07A 4S3FA 4LB4A 1HVXA 2CWNA 4C65A 3PY2A 3CEPA 4H9XA 3BV4A 4S2CA 1E70M 5G5IA 1QK0A 2CZ5A 5G2IA 1QNOA 4AZ5A 3NL6A 1PSCA 4MB5A 3OBKA 5L6UA 1G4EA 2VD8A 3GIYA 4H2HA 2OYKA 4AEEA 3L4TA 3APGA 4OOZA 3WKZA 2WJEA 3GTIA 4KEZA 2WSPA 3VOHA 4EP8C 4JHMA 1O6IA 2CESA 1LUCB 3AS0A 3P5YA 1TKKA 3UG3A 2ZWYA 2ZA1A 2B7OA 3W2NA 2Y8VA 4O1EA 2VGBA 4NKCA 2VEKA 3TH6A 1XLMA 3FOKA 3NDYA 1DWIM 4H9VA 4WUIA 3GQYA 4X2PA 3VABA 5H1WA 4XD4A 3A9IA 4AHQA 2PWVA 3FIGA 1VHCA 2V5BA 4GJ1A 1VF8A 1NELA 3P60A 2GVGA 2VDIA 3GXPA 5I3FA 2P3EA 3EA3A 3W1AA 3MHFA 3CYVA 3N9RA 1E9ZB 3G0SA 2ABAA 4HCHA 4PMXA 3WQ5A 3DI0A 1R38A 2VYOA 2INFA 4GZJA 4L9XA 1WDQA 3RNDA 5E9XA 3TTQA 1QI3A 4BY3A 2CYGA 1NWUA 1J6PA 1EJXC 1TCMA 3IJ6A 1F07A 1ME7A 1K3UA 4IJBA 4N02A 4CQ8A 2J79A 2W27A 2J7CA 4BKNA 2FMOA 2J25A 4TU1A 1A3XA 5C8BB 4IMFA 3QW3A 2FTPA 2PLMA 4NI8A 1KFCA 3VKBA 1G7UA 3W2KA 5SWUA 3I7SA 1HJSA 3MUAA 1M3UA 4XAZA 1UH3A 2AGTA 3VIOA 2LLEA 1V6WA 3FJ6A 4A2SA 3SIZA 1K02A 5TIMA 1OD0A 3E9AA 2IUZA 1JPDX 3PTKA 3WQ6A 1I2NA 3VX1A 3ATZA 4LWWA 4LUTB 3AWNA 2EPNA 3OLGA 3E0FA 4US6A 1J2WA 1P4CA 1UWTA 1PZ0A 1SW3A 3STGA 2OKTA 1O1HA 4PUNA 3W27A 1ZY9A 3PHAA 1HO4A 3VCNA 2QS8A 4QE1A 2PDFA 4GK8A 1KFBA 1G7VA 5AFDA 2VC6A 3GWQA 2J6VA 3EPNA 1XBYA 4XZNX 2YFOA 4B16A 4NAEA 3B05A 2BY3A 2BHZA 3QOKA 4K2SA 2YW3A 3O63A 1DWGM 2YYTA 5M5DA 5K9CA 1QI5A 2Q3RA 4M51A 4FXJA 4MVAA 4S3BA 3Q58A 3ZSSA 3SCUA 3AQUA 3IWPA 5DRCA 3AJXA 3L2MA 3NZGA 1VZWA 2YL9A 1K9DA 3H2CA 2BOFX 3M5YA 1FWSA 1NOUA 3DEQA 1Z44A 3UU0A 4P8UA 4XD5A 1CPUA 4G7FA 2J27A 2WM1A 3MSGA 1AW1A 2QJJA 3EZ4A 3GH7A 1JZ6A 4IISA 2XIOA 2WOQA 4QAWA 3TQKA 4X60A 2ZC8A 2NV2A 1XUUA 3WK2A 2ZZ1A 1R8LA 3TC7A 4J2MA 4F2UA 4QP0A 5EFDA 1QUMA 4GFIA 4G56A 4C6PA 1GKQA 3OVGA 1W2PA 4MYXA 2FB3A 1WKFA 5A6BA 4HHMA 1FWDC 1OINA 1TFVA 3OZOA 3ITOA 2CKSA 3WF0A 1LF1A 2ISVA 1J93A 3PJUA 1NP2A 5H8UA 2Q8ZA 2ZUSA 3H2AA 4GQ0A 4MYAA 3UZWA 4KF1A 3QN3A 2JEPA 1W9BM 3W6LA 2FHFA 3M0JA 4IL2A 5D04C 2OZ8A 2VNCA 3QV7A 4WX2A 4DO7A 1RK6A 4V33A 2DT1A 4PMJA 9XIAA 3VFCA 4DEFA 2DT3A 5FJJA 3UWWA 4ES4A 4ZXLA 1BXBA 1UIOA 1FWBC 2DUZA 2QMKA 2ZZ7A 3VZZA 3A5FA 3KZPA 4IIHA 1EJSC 3ITCA 3W86A 3WQDA 1YXCA 3Q45A 1LOLA 2V8ZA 4N6EA 5K3VA 2P50A 3BAXA 3GG0A 4WOQA 1FQ0A 1Y5XA 3NQGA 1X7IA 4C6IA 1TRIA 1P0BA 5EBUA 2PWDA 4MJZA 4JQ2A 3EX3A 2VX6A 2RDTA 1U5VA 4AAJA 1EP3A 2D3NA 5DBTA 4Q8MA 4LAMA 1OFOA 2VM8A 4UFLA 3CV6A 1TA3B 2OZTA 4LYRA 3KRSA 3ARWA 3TYCA 3CZJA 4LV4A 4UTHA 3VOFA 3O6DA 4UTTC 4HU8A 4XISA 1CB2A 3AMLA 5FF0A 3W2LA 1MXDA 3V1PA 3LZ3A 4W9TA 4HNCA 4WY0B 1FWTA 1QASA 1GPFA 3M5ZA 3H12A 2QIIA 4P8VA 2V5DA 4QSHA 1HP4A 1KRBC 1LOQA 3ABSA 4LB3A 4FF7A 1W9PA 1DJIA 1UB3A 5AC6A 4O1AA 1P7TA 2SFPA 4Z1BA 1UWSA 4MKSA 2P8BA 1OGSA 3V4BA 1D9EA 3O3RA 4RXFA 5F7UA 3SJ3A 2FB2A 3BLPX 1EO5A 5BCAA 3AI0A 2J9YA 4NF7A 1A3HA 2J74A 3QBUA 5HA7A 4NNCA 1Q66A 2PLCA 1GK8A 3IIVA 2VEGA 2IS7A 5CPOA 2CZDA 7CGTA 1GKPA 1CB7B 1S1RA 3N04A 1Z6KA 2XGIA 5EMJA 4M81A 4BR1A 2YGYA 5AECA 3LHTA 1REQA 4FI4A 2C18A 2J9ZA 3LBCA 2DY3A 2RDWA 2E09A 1UWIA 1AK5A 4QQ3A 1FWFC 1XD0A 1W2VA 2J7GA 4UMBA 1XGZA 1AQMA 3GS6A 5E0FA 1KGUA 2BHUA 4AY7A 1UHVA 3W37A 1WXYA 1ZPTA 1B3ZA 3MPGA 4OQVA 1UWRA 3NQVA 2XIJA 3SQSA 4C6LA 4HPJA 1Q65A 4ZOBA 3KW3A 3AIRA 3CWOX 3T2PA 3VNIA 1Z7AA 1C3FA 3OIHA 2PU1A 1W6TA 1CX9A 1P1MA 4IPJA 3MQTA 3OU8A 4DJDC 3BURA 4K1GA 4PULA 5JMUA 1FA2A 3B04A 3WJWA 3LPOA 5IM51 4C6JA 4UFKA 1UUMA 2BGNE 3IRSA 3ITGA 1DEDA 3PULA 1XP3A 3W28A 3OHMB 3WD0A 1X96A 4H3DA 4L61A 5D2XA 1TTPA 3WEZA 2QEZA 3MYOA 4I5RA 4DZIA 3DBNA 2X05A 2NV1A 1WZLA 1BWLA 4LNYA 5M17A 1JDAA 1OD8A 3BJFA 2EGZA 2QT3A 1MMFA 3QM3A 5AHEA 1NQ6A 4BCEA 3TIMA 4DNHA 4FAMA 4MY1A 3U3HA 1TPC1 2BZNA 1PKNA 1XRVA 4PL2A 2O56A 4BWLA 1XIBA 1W9DM 2OJPA 3CUFA 5CZSA 5MKGB 2EPKX 4K39A 4WD0A 5D2YA 3ZSTA 2QUTA 4HGXA 4XG1A 3BZGA 1FWWA 2W4XA 5C7VA 4DF1A 4M1BA 5C70A 3WNPA 2B0MA 4BHYA 3N6QA 1WE5A 3DFSA 1K7FA 3NQ2A 2OOGA 1PO9A 4FSAA 3W71A 3RU8X 1B3XA 2WM0A 3ZT7A 3RCMA 1E1FA 4NP7A 1RLCL 1H60A 2AL2A 4ACZB 5XIAA 1POJA 1G5AA 3BC9A 5T9BG 4UOQA 2ZDRA 1F3TA 4AX7A 1JG9A 5JBDA 3S47A 2FJUB 3UVAA 1HTIA 1NEYA 4BF9A 2FIQA 2WC7A 2Y6ZA 1TWSA 3PAOA 4GY1A 3GR4A 3BSGA 3QZAA 4O0KA 4JNMA 4RDYA 4KEVA 1GQIA 2VVNA 5DMNA 4OT7A 2FPVA 4GVHA 4I6KA 3MUY1 3VAVA 2PDIA 5CAKA 4O19A 3K13A 5FF3A 4JFWA 3I3DA 3CZEA 4O28A 4DJFD 3PWAA 6CGTA 2X1UA 2RJGA 1NAL1 2AKMA 4RUBA 3GDBA 1YADA 4FA3A 3LCLA 4GIAA 2XVKA 3GUWA 1W17A 3FHAA 1WB0A 5A1AA 4LRSA 4PA8A 3TN5A 4AZIA 5LNSA 3H2NA 3LYEA 1XBVA 2PDBA 4PUWA 1VYPX 2YSWA 3FDGA 2C1GA 3A5VA 1KQZA 2BX7A 3RYSA 1AH3A 1JF5A 4PEKA 2G37A 3FXGA 3CPGA 2GYIA 3N17A 3GKFA 3W1PA 4CKQA 1QMLA 3B9NA 4FNRA 4NAFA 3GKAA 4WKHA 3SY1A 1CGUA 3DUGA 4EXQA 2UWFA 3KDOA 2I16A 2UZ9A 2QLYA 1KFLA 2XWDA 4P5UA 4GH3A 3TOYA 3CMFA 4QS5A 4YHEA 3D0CA 3LCGA 4RK8A 5EYWA 4DZHA 4FP1A 4O4WA 4OV9A 3L9CA 4C6KA 4JTGA 1RY8A 2EPOA 2G41A 3RDKA 1Y5WA 3CPUA 1OADA 3QW4B 1UPMB 3SGZA 4XBSA 4QDMA 1WCGA 4W89A 1BVWA 4XUYA 4R34A 1VBJA 2F6KA 4RE3A 4UTWC 1NTHA 3PUOA 1DJXA 3SDOA 3P14A 1NM9A 3V0UA 1NWTA 1RH9A 2Y89A 1VRDA 3N2TA 1TPWA 1UD3A 4PBFA 5ABHA 3PZIA 3HGSA 1GTEA 2W63A 3I3BA 4NT0A 3BJSA 1LCOA 1V08A 4AVOA 3V1HA 2PDUA 4GZEA 3AXMA 1ZENA 1GEQA 5LYRA 3T0AA 4IQDA 1V3KA 3THUA 4CQCA 4EVZA 4PSPA 1PPIA 1FOBA 4LANA 2JFEX 1EGZA 2R14A 2A0NA 4IGSA 4IGMA 4DQWA 1ZNNA 4JCMA 1O5XA 1P43A 1VEPA 2C15A 3E5BA 2YR1A 4FNUA 2HSAA 1QBAA 2QCEA 5BOEA 1XLEA 3MBFA 4MWAE 2E8YA 1TWIA 3DYMA 1LRNA 1BRLB 3CH0A 3N25A 4QJ4B 5FESA 3U2ZA 1TX0A 2QDEA 4AY8A 3BDKA 4K37A 1F6PA 1G4TA 3MJYA 4PEEA 3TFCA 4MZ1A 1VBRA 3VZYA 3RO6A 4Y6GA 3WH9A 2ZVIA 1SUXA 3LY0A 2I7GA 3LZ5A 3M5VA 3NQBA