5U7SA

Crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
329
Chain Sequence
HHHMALISMRQLLDHAAEHNYGVPAFNVNNLEQMRAIMLAADATNSPVIVQASAGAPFLRHLILAAIEEWPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGADGKTPTTYDYNVDVTRQVVAMAHACGVSVEGEIGCLGSLETVLDHSQLLTSVEEAKQFVADTNVDALAIAVGTSHGAYKFTRPPTGDILAIDRIKEIHAALPNTHLVMHGSSSVPQEWLKVINEFGGNIGETYGVPVEQLVEAIKHGVRKINIDTDLRLASTGAIRRFMAENPAEFDPRKYFAKTVDSMKQICIDRYEAFGTAGNADKIRPISLEKMVDRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-1,6-bisphosphate aldolase
publication title Crystal structure of a fructose-bisphosphate aldolase, class II, Calvin cycle subtype from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
total genus 120
structure length 329
sequence length 348
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5u7sA00
3PBVA 2H3BA 4R53A 1SZEA 5D05A 5AHNA 3NL6A 5C6MA 4O54A 4WY0A 3SJ3A 3HQ1A 3FLUA 4PL2A 4EWND 3GDTA 1BEUA 3KRSA 1JCXA 2QUVA 2OJPA 1E51A 1O60A 1KV5A 4ICNA 1YTKA 1TPDA 2QR6A 3S1XA 4BWLC 3RF9A 3UPBA 3G22A 5K9XA 4O8RA 1WV2A 1HO1A 2ZRYA 4Y8FA 4Z08A 1FDZA 4XBKA 2A7RA 3MP4A 2DZWA 2YZRA 3QMSA 4Y90A 3PBYA 1FWSA 5BNKA 1VH7A 3GIYA 4RZ6A 1ZY9A 4N9DA 1F73A 4UTKA 4TMBA 2V0TA 4GUGA 1KBJA 1TTQA 1FWNA 4NNAA 4FHAA 2NV1A 3PM6A 4UNKA 4J9JA 3M5XA 3SW6A 2Z6JA 1G4PA 1CI1A 3W1QA 3MMTA 3GZ3A 3PULA 3THAA 3GKAA 1EIXA 4WY0F 5EA9A 3LLFA 3QPYA 3TK7A 3NZ1A 1F76A 5H91A 4OT7A 1H1YA 2ATMA 3T40A 3IIZA 3HO8A 5DCBA 2Y70A 3UY7A 1RPXA 3B04A 1SPQA 4EF8A 2E5BA 1KM0A 1RR2A 3MI3A 2VENA 3R12A 3N2MA 1GQNA 2QCGA 3IVSA 3QSTA 3E02A 4DO6A 1G67A 4CCEA 3PUEA 2VFFA 1TRIA 4N9CA 1XUUA 4BF9A 3I7RA 5HUPA 3WJWA 2JGQA 4WOZA 3ZFHA 5I3KA 2J24A 2GVJA 2CZ5A 4IMGA 5BRBA 3G18A 3CHVA 2FQIA 2X1SA 2BX7A 1ME8A 5LNWA 1OABA 3G24A 2J9YA 3IVTA 1C29A 2E6FA 4ZZ9A 3KXQA 4O19A 4I7VA 3QC3A 4AHQA 3LTSA 1OFAA 3BG3A 1X6UA 2DORA 3NQCA 1EP1A 3EXTA 2RH9A 3N3MA 4O0KA 3W71A 1DHPA 3NZRA 4RR4A 3OVRA 1ONRA 1EP2A 2H8ZA 3CEUA 1LOSA 3I68A 5D37A 3C8FA 5F2IA 3JRKA 2FPVA 1H7RA 3LRMA 4YL2A 4CNPA 3W2KA 4K36A 2NX9A 4GUFA 4UTHA 5KMYA 3W87A 3N73A 1GWJA 2NX3A 3OVQA 1NVMA 4I7WA 2VEPA 1PIIA 5AHIA 4QAIA 2O7SA 6ALDA 1SW3A 1KFLA 5CGQA 1JUBA 5C55A 4NXKA 1HG3A 5D2VA 4Z0SA 1BKSA 4O52A 3N34A 1XL9A 3O05A 2OT1A 1FY6A 3DHFA 1UUMA 1XBVA 1Y0EA 2P1FA 3B05A 3OEXA 4JYDA 4NJGA 1EA0A 2C15A 2R8WA 3M6YA 4AH7A 4MVAA 1WOAA 2B7QA 6TIMA 1DQWA 2VOMA 3ELFA 1OFQA 2BLEA 3GDLA 1YADA 1M6JA 4MFDA 3FJLA 5HWMA 1G7UA 2ZZ4A 1MZHA 3DXIA 4NQ1A 3NQGA 4I9AA 1W0MA 4HIBA 5D38A 3HIJA 4XQ6A 1OHLA 1XC4A 4LRSA 4PEKA 4RX0A 5I3IA 1D3GA 3CTLA 5C5YA 3TROA 4YMZA 3MYPA 3B0UX 1ICQA 3BG5A 1UUOA 3C2RA 2TPSA 4GRSA 4G1KA 4I7UA 4D2JA 1DBTA 3LRLA 3BW2A 2A21A 3BGJA 5CG7A 1MSSA 1W8SA 1UCWA 3L67A 4AAJA 2R91A 3L5AA 5L6UA 1I2NA 2Y61A 3MI6A 1FWTA 2GVGA 1QPRA 3RNDA 3M16A 4NVTA 4GNJA 3L9CA 4MY9A 3W2LA 1R2TA 4O1AA 1H7PA 3CM4A 4R33A 1H63A 2Y7DA 3DKLA 3PY2A 1W3TA 4JICA 7TIMA 3UQNA 1JUEA 5LNSA 2E68A 1FDYA 2H90A 1TTIA 3NDOA 2YDAA 4A21A 3NQEA 4M6VA 2DP3A 3W3OA 2VKZG 2JKEA 4AHPA 3N19B 1TREA 4UTTC 3P81A 4AXKA 3S0CA 4Q33A 2E5CA 4GJ1A 2J88A 3DFOA 4O1BA 4UFMA 1L6YA 3W70A 1H1ZA 4M19A 2AQWA 1ICSA 4LC8A 1L2UA 1VYSX 2B0MA 2A7PA 2Y7FA 1BWKA 4HNTA 1KFJA 4MOZA 2G5WA 2WNNA 3SZ8A 2C6QA 3PBWA 3L68A 1WBJA 5D2TA 1LRQA 3NQDA 4NUWA 2B7NA 3C6CA 2BTMA 4LU0A 5LNUA 2WQPA 5DXYA 3G3MA 3QMRA 3TQVA 4AWUA 3ATZA 4YWIA 5DBTA 4ZQMA 4UR7A 1Z42A 5AHFA 4K38A 2QDGA 4ZMGA 1TV8A 1OFDA 2YFNA 1OF8A 2UV8G 3UD6A 3HJZA 1FCQA 3L2IA 3U6WA 4JTHA 4YCOA 1G6CA 3C2OA 4JTJA 1VQTA 5DY2A 5L9FA 3HF3A 1LOLA 4GUIA 1OJXA 1KFCA 1B4KA 3IGXA 3LI1A 4BFAA 3BPWA 5C2XA 1DOSA 3LHTA 3HG2A 4K6AA 5D03A 3C2FA 2QCCA 4MKNA 3T7VA 1C8VA 3GXNA 2PCQA 4JX5A 4O16A 4Z0JA 4NX5A 4UMBA 1W3NA 1GG0A 2PRLA 3G0UA 3HGSA 4OWGA 5A8GA 2Y88A 1G4EA 2YGYA 1LRNA 4RK8A 3OA3A 4GFSA 4LV9A 1BTMA 2WSRA 2PC4A 4UFLA 4UFHA 3C3NA 2OCZA 2FB2A 1H7OA 1I8JA 5I3JA 4KWWA 2ZRVA 3WK0A 1XM3A 1B4EA 3CWNA 3NPUA 2WNQA 4UTWC 1AW2A 4QITA 1XI3A 3O06A 3KRZA 2FLIA 3HB9A 3HMJG 3W1LA 2B4GA 2ZRZA 3P84A 2ISVA 5FESA 2X1RA 4DO5A 3KVMA 4ZQNA 1IXOA 3W2MA 3NQMA 2YYUA 2CLEA 3NNTA 2Y6ZA 2NUWA 4A2SA 3EWXA 3P5YA 3N2XA 1OFBA 2ZCGA 2DZXA 3B0PA 4CCDA 4UTTA 2ZZ5A 3QMTA 2W79A 1X1OA 3FOKA 1J2WA 2DZPA 3W7QA 4FXRA 1MXSA 3TE9A 3PSVA 2ZA2A 5FEXA 2J6XA 2QJGA 1DL3A 3PG9A 1Q6OA 1IXPA 1XCFA 1GOXA 5LNRA 4N02A 1WX0A 4MPQA 1X8FA 1TQXA 4DO4A 3MYOA 4PFMA 2ZRUA 4M6QA 4UFIA 4UFJA 2QUUA 1GEQA 1IIGA 2JK2A 3RU6A 1AL8A 2NUXA 2WPBA 5MHBA 1F7BA 3T44A 2E6YA 2EHHA 3S5NA 2Z6IA 4K7VA 3P62A 3HGOA 2A5HA 1Z41A 2X30A 1TPC1 3B8DA 2EKCA 3ABRA 5CSRA 3CWOX 1RZMA 4O4VA 2LLEA 1SO3A 1RQHA 5IM51 5EBUA 1OX4B 1K3UA 3PB0A 1KFKA 4UC5A 4AVFA 2A7NA 5FEWA 4LUJA 4TX9A 2ZRWA 2PRMA 1LLWA 1PHQA 2E09A 4O57A 1Z44A 3ABQA 4NZJA 5F2GA 3EWYA 1O94A 1FUYA 2PRHA 3EX3A 3C0JA 3DFPA 4XUGA 1TIMA 1TQJA 4U4MA 3GXPA 3KHJA 4IX0A 4MZ1A 2CLHA 1VYPX 1KFBA 1ZENA 1KLYA 2VC6A 3SR7A 3QPZA 4DF1A 3UWQA 3W83A 3QF0A 2YW4A 1FQ0A 2DZTA 3NGJA 4JY9A 3AO0A 4RV8A 1TTPA 3QRHA 2NXHA 1Q45A 2WNZA 1WOBA 5AB3A 2TSYA 4LRTA 1KM2A 5AYXA 1OYCA 2WSQA 2ATSA 2Z0IA 2I9EA 3S5ZA 5HQEA 1AK5A 4IX2A 4CNNA 3LCHA 4R7JA 1P1XA 4K7YA 4QQ3A 4WX2A 3NO5A 1SR9A 1Q6LA 5CPOA 1JR1A 2Y7GA 1ZFJA 3QQ1A 3M7WA 4HSOA 2XFWA 5HMSA 1K8YA 2V30A 3G1FA 2QCMA 1CW2A 2FB3A 5FF2A 2DJLA 4A29A 5U7SA 5KZDA 3H54A 3CC1A 5KZMA 1QWGA 4OBTA 3EB2A 3EWBX 4Q32A 3EX1A 3W07A 4IPIA 5IBXC 1Z48A 2RDTA 4E2DA 5J5DA 4E2BA 2J9XA 5HWNA 3O07A 3F4NA 5DCEA 2C1HA 1HO4A 1EEPA 5HWJA 3ANYA 2CW6A 4M7TA 3LOTA 2V5LA 3KVLA 3W23A 3W7GA 3NQ2A 3GXTA 1IXQA 3TW6A 1AW1A 1DJQA 5KSWA 1ZAHA 2XN0A 2CZFA 1XBXA 3G0SA 3P7YA 1R30A 1M7PA 3SIZA 3O6CA 3DHDA 4IMDA 4LS0A 5A5WA 2ZZ2A 4S2BA 3W1PA 1YDOA 3M5ZA 1QPQA 1TYGA 3UWVA 5LZLA 2JBMA 2V81A 1FXQA 4HPXA 2VFGA 1H50A 3MUXA 3QFEA 4AB4A 5F2LA 2QCDA 3E12A 1N7KA 4H6KA 5F4XA 2V8ZA 3GNDA 4JDYA 1XUZA 2P10A 4JTEA 3R13A 1W1ZA 1KLZA 1TV5A 3SGUA 3C61A 3M5YA 3GAKA 2VFDA 3V75A 3W85A 1RV8A 4EIVA 5K2ZA 1T99A 3L0GA 1OYAA 1SZNA 4O53A 4CQAA 5F4WA 3W7LA 3PUDA 2F84A 3ABOA 1PHWA 3QEZA 3IIOA 1VRDA 3S1WA 1EP3A 1RQEA 1L9WA 1W3IA 5BMXA 5G1TA 3NM1A 3OBKA 1G4TA 3PF3A 1ALDA 4MZ8A 2J27A 4FIQA 4JNMA 3M41A 4DXVA 5D33A 4MJMA 5DCDA 2QEZA 3A21A 2FFCA 5K7JA 2H3DA 3W7IA 2HSAA 3MI2A 5C54A 1K8XA 1TCDA 3CLMA 4WQ6A 3WFAA 4JIPA 5HR7A 3B4UA 1H62A 4XZ9A 3G8RA 5D04C 1O5XA 1T8XA 1ZCOA 2G96A 5D09A 2Q8LA 3K30A 1ZJIA 1VJIA 2WKJA 5TIMA 1S5TA 2Y89A 2H6RA 3A24A 3W6YA 4FF7A 4LS1A 4UFKA 4X3ZA 1Q6QA 4JX4A 1ZAJA 2DZUA 2VELA 3HOJA 3WJXA 4HKPA 5D02A 3KAOA 1TRDA 3E9AA 3LHUA 1GVFA 4IMCA 3W7OA 4PA8A 5AC6A 4YCPA 1TMHA 5HULA 2QDHA 4N2YA 4IXHA 3HG3A 2XN1A 2I1OA 3S9YA 5IBXA 1PV8A 2QCHA 3UZ5A 1SQ7A 2CZDA 3KVKA 4JTSA 3O15A 1I2PA 1G7VA 3NQAA 3L66A 4UIOA 4KFOA 3CU2A 5KINA 1YXYA 3PBUA 3SFKA 2WV8A 3IEBA 2OT0A 4LW7A 1C9DA 2OMAA 1YTEA 5D2XA 4CNOA 3T4CA 2DJXA 3TSMA 3TAKA 3LM7A 1SO4A 3F03K 3HPXA 4XWUA 1W56A 4BWLA 2C0AA 3YPIA 4GBUA 3VNDA 5EY5A 3SI9A 3LHWA 5DY3A 5I3FA 3GDRA 3BLFA 1NF7A 1WA3A 2ZZ6A 4PH6A 5HJLA 3LRKA 1ML1A 3IIVA 1XFBA 1ADOA 4HT3A 1GJPA 3FYPA 4OU1A 3TMLA 2J9ZA 3EEGA 1W5PA 4XKYA 4ADUA 1M7OA 2RFGA 1QMLA 1ZNNA 4JEQA 2W6RA 3DFTA 3BGGA 4W9TA 3TA6A 4KFNA 4GUHA 1TPH1 5LNVA 1VS1A 4KWVA 3GKFA 3O1NA 3GDMA 1KBIA 3G1YA 3A5VA 5FEPA 1O4UA 3W73A 1TJPA 4KKXA 3UZJA 3L5MA 1SUXA 4O15A 2X1TA 3MWAA 4QNEA 5FF3A 4AF0A 4QNWA 5EMUA 5LKYA 1NAL1 1QAPA 3I7SA 4O14A 1V7YA 4A2RA 3DENA 2ZBTA 1SO5A 3MBFA 3TMQA 2EPHA 3EX2A 4HNNA 1HL2A 2C19A 1QR7A 2YW3A 2BSLA 5G2HA 3Q94A 5F1VA 2YCEA 4NU7A 1NF0A 3DFQA 3NPWA 1GTHA 3C4UA 3THQA 4HPJA 3BVJA 3H55A 4ZQPA 1PE1A 3TQ0A 2QAPA 2CLKA 1RVGA 3JR2A 1D9EA 1SO6A 4RXFA 4GWEA 3M5VA 4ZL1A 4MLJA 4MY8A 5BMWA 1LTDA 3TSDA 2VFEA 4BR1A 1QDSA 3D0CA 4FIRA 4ADSA 3B06A 3PC0A 1Q6RA 3DGRA 2FPTA 4RCXA 2WJZA 5KITA 3NVTA 1VZWA 4GE8A 3S1UA 2PURA 3JS3A 3DH7A 1H61A 2Q3OA 4MLRA 1H7XA 3LHZA 3LHYA 1QO2A 4RJEA 5HINA 3UNDA 1NEYA 4WY0B 3GR8A 3LCXA 1N8FA 3P60A 3C52A 2Y85A 3P5ZA 1KM6A 3E96A 1KM1A 5BOOA 5SWUA 4MYXA 3UWUA 2YX0A 3PSWA 4Z1BA 1R47A 1WBHA 3SSJA 4DELA 1YXDA 4RXGA 4RKAA 1XBZA 3BK0A 3LXAA 4GXMA 2QCFA 2ISSA 2V2HA 5FI8A 2I14A 4BI7A 1GVSA 1GVOA 4UTJA 4N6FA 3W7CA 3LCLA 1A5BA 1VGAA 3OG3A 2QCDB 5K9DA 3W76A 2QJHA 4WXZA 3KX6A 2NWSA 3A22A 1LOQA 4ML9A 5G2WA 1ICPA 3O6YX 1VHNA 1SSDA 2X1UA 4Y9AA 3SECA 1TB3A 4X9SA 2GJLA 4X2RA 4JIQA 4OE7A 3QW4B 4ZVJA 1EUNA 4FNRA 4GC4A 4IWWA 3WJZA 3DZ1A 1OK4A 3NXFA 3FA5A 1A50A 5EPDA 3W7PA 3TH6A 2QF7A 4OGZA 3GB6A 4X22A 3C56A 3R5EA 3RFAA 3RK8A 3FJ6A 1EUAA 4NJKA 4NJJA 3LLDA 1V5XA 4IQLA 2ISWA 3ZR4A 4FB7A 1SFJA 4NJHA 1QOQA 5LHEA 3L21A 1UB3A 3S5OA 1K7FA 3NG3A 1A5AA 4C1LA 1DJNA 4FX6M 5F4SA 2QCLA 3RLUA 1ME7A 3W7EA 2Q8ZA 1VCGA 2V9DA 3G1XA 4RZ4A 2BWGA 4JTLA 5E0KA 3GK0A 1J5TA 1WAUA 1LROA 3W2JA 4LVGA 3W86A 2BZNA 4DF0A 1JCLA 2QCEA 1UASA 1TSIA 4H3DA 1RD5A 1TPWA 2F7FA 4O13A 3I6RA 3KRUA 2RHGA 2C18A 4A3UA 4K8EA 2R14A 4JTIA 3GLCA 5CKSA 1OX6A 5CZTA 3W74A 2ZQ0A 1O95A 5DELA 1SW7A 3M47A 3NOEA 2X2GA 3P8JA 1JCYA 1VCVA 3G1SA 4IUOA 4PODA 3O63A 2GOUA 3W7HA 2O7QA 1M5WA 5AOUA 4JYEA 1BWLA 4PCFA 3MHFA 4IMFA 3G3DA 3C2VA 2NUYA 4LV4A 3B03A 1EX5A 2NXIA 1R46A 2ZDRA 3S1VA 4EOUA 4QISA 4UTLA 3A23A 1X7FA 5TBOA 4K39A 3R8RA 1KW1A 5E1QA 4ORIA 2C14A 1KTCA 5H2ZA 1XDMA 4JYFA 5E93A 4IXXA 1X1ZA 1F6KA 3OIXA 4MFEA 3N9RA 1LBFA 3MJYA 5CZSA 4UTMA 3STGA 3HG4A 4P2VA 3W1AA 2CWNA 4FNTA 1XBYA 3NL3A 4MYAA 3VI2A 3A5FA 3TXVA 3P61A 3EKLA 1GTEA 2QCNA 3GAYA 3WK1A 1FX6A 3PG8A 1S5WA 3L0NA 1GG1A 3NA8A 5CPMA 2A0NA 4ZQCA 1N55A 3TFCA 2X16A 3UPWA 2FPYA 2AAMA 1MEIA 3O6DA 4EVZA 2CLFA 3W7KA 2BXVA 4CLMA 3CIXA 3E49A 2OZ0A 1H7WA 4XKYB 2ZTJA 4WD0A 4S2CA 1TPEA 1F6PA 1I2QA 1OFRA 2ZTKA 2WOQA 4RLIA 1K7XA 1TO3A 4N4PA 4UTUA 3UWYA 3QQ0A 2TMDA 4POCA 2CLMA 1KM5A 3W7NA 2YFOA 2QKFA 2GVLA 4UTWA 1KTBA 4UMCA 4O0ZA 5CPNA 1TV7A 4TU1A 2V2CA 5CZ0A 4OQVA 2YR1A 3MHGA 2E77A 1IXNA 4FX8A 3Q2DA 2A6LA 4AF0B 4MZYA 3U2OA 3QJAA 3LTYA 2GJNA 2NLIA 1TPB1 5ABTA 1KTNA 3TSBA 2EAWA 1JULA 3O8AA 4JTKA 4P61A 3TV8A 3UY8A 2GUUA 5K9CA 3NEVA 1K02A 1K7EA 3AJXA 2G95A 4O1CA 3P8IA 5AC7A 1B3OA 4LWWA 1W54A 4UUIA 2E6DA 2IQTA 3FKRA 3UWWA 3VE7A 1LM1A 3ABSA 3TDFA 3Q37A 1JQXA 1XXXA 1A53A 1EWDA 1SSGA 4HNVA 2CLLA 3LB0A 4UTIA 1I4NA 4FNSA 4Y96A 1EPXA 5KTLA 1JCJA 1UBSA 3BW3A 3CT7A 1OFPA 3F4WA 4O12A 2XN2A 2P0OA 4JN6A 4FNQA 1T0OA 2GPTA 3PUOA 5K4ZA 4YXGA 1Q3NA 3M43A 3OHIA 4FX7A 3B0VC 5AHMA 4FNUA 3W1NA 1PS9A 1R2RA 4IGHA 4O11A 2NXGA 2ZFAA 1JRBA 5G1YA 4CCCA 5HNRA 4DBEA 1LLZA 1JVNA 1JCMP 1YPFA 4TO8A 5I3HA 1KA9F 5FF0A 3DAQA 3GVGA 4E38A 1AMKA 1TPUA 1S5VA 3FKKA 4AMAA 3F1QA 3P67A 4QIUA 3GNNA 5F2MA 4AHOA 1CX9A 4LVBA 5EL1A 4O28A 5D2YA 1LBLA 3S5YA 1IGSA 4BI6A 3EWZA 4QM1A 1TJRA 1LDCA 4KFPA 4O4WA 3VE9A 5K3VA 1O5KA 3M9YA 3LV5A 3NAVA 4WUIA 1EB3A 3NQ8A 4LOCA 3QSRA 3CEPA 2A2IA 2VEKA 1QFEA 4EF9A 5G2IA 3TFXA 1OFEA 4MUZA 4K37A 2QJIA 3NQFA 5G4WA 1KM4A 4HHPA 3MHUA 5TQLA 1YPIA 1WYIA 2CLOA 4HNUA 1KV8A 2HS8A 1K8ZA 3BLEA 3FYOA 3HGRA 2C3ZA 5J5RA 3TC7A 1VCFA 2VXNA 1SW0A 3WJYA 4RZ5A 1YDVA 1VC4A 3W1MA 3TR2A 4JY8A 4OHQA 3WJSA 4JD4A 3TC6A 4GUJA 4Y6GA 1DV7A 1FBAA 1YTDA 5BW6A 1WXJA 1QCWA 2YPIA 4BI5A 4R34A 1I45A 1KFEA 2B7PA 1QNVA 4L4LA 2QUTA 4B5NA 2VFIA 3O16A 1VR6A 3GR7A 3STCA 4TR9A 3IGSA 4JX6A 3A9IA 3V1PA 2FDSA 5KZEA 3W75A 4LNYA 3G0XA 3L65A 3CQ0A 1FWRA 4M6PA 3WK2A 3NYZA 1JRCA 2AGKA 3FFSA 3TKFA 3W88A 4A22A 4O10A 3LXBA 2ALDA 3LCFA 4JTUA 3BLIA 1MO0A 4NNBA 3BV4A 4YLWA 1OX4A 1XDLA 1OG0A 2A6NA 3QZEA 2GQ8A 1QPNA 4CQ8A 4NXSA 5FF7A 1VHCA 3LV6A 2YYTA 3UXAA 4WZHA 4HSNA 3UXDA 3W84A 3P82A 4IJBA 3USBA 3STEA 4ZQOA 4S1FA 3ZS4A 2ZA1A 5HR6A 3MP3A 4ZQRA 2WO5A 4TMCA 3PR2A 5K4XA 3ZWTA 3NR0A 4MJZA 1H51A 4JXCA 3W9ZA 2RDWA 2ZA3A 3UWZA 1P5BA 2HTMA 3G8EA 1P4CA 3VKJA 3W72A 4FO4A 1YDNA 3BG9A 5I3GA 3DFSA 3ZWSA 4AWTA 3L5LA 3W2UA 2B7OA 1VYRA 3M0ZA 5G4EA 1PL9A 1FXPA 1VLWA 3DI0A 1W5OA 4U28A 3W7JA 3GDKA 2CFFA 1LP6A 2C16A 5G5IA 5U4NA 1IIHA 2EF9A 3DU0A 3R89A 3TNOA 1S3HA 1J4EA 1LRTA 3CIWA 3MW7A 1P0NA 3BO9A 3W1XA 1ME9A 1A5CA 2R94A 3NM3A 1AW5A 3BARA 2A4AA 3W7MA 1W31A 4MIMA 4N6EA 1OK6A 4DPPA 3G1AA 1L6WA 3TJLA 1F05A 1TTJA 1GVRA 2CU0A 1B9BA 3QYQA 3FS2A 4OV4A 4N9EA 2ABAA 4DBDA 4O18A 3W1TA 2GQ9A 3Q58A 4DEFA 4Z1DA 4DQWA 3W7RA 2NV2A 3BW4A 1GZGA 2YXGA 3IIPA 1YXCA 1XKYA 1AG1O 1GYLA 3LX9A 1FCBA 1OYBA 1LYXA 3S8HA 1W5NA 3FEMA 1ZALA 3STFA 2Y62A 3TU9A 4L4MA 3TIMA 4FEZA 1DORA 1SFLA 3CB8A 4JTTA 2ZRXA 4PTNA 3CPRA 1LBMA 1TPFA 3QW3A 1LZOA 2A1YA 4UMAA 3IGUA 1JJKA 4Z1CA 5EYWA 3LBMA 1LORA 4O17A 4AEOA 2CLIA 4NZFA 3NL5A 1VLIA 3MO7A 5FF4A 1OF6A 1IF2A 1K03A 4E0CA 3TJXA 1PVNA 3R2GA 5LGXA 4QSHA 4Z1AA 3NQ7A 4NX0A 5FEZA 4JTGA 3TUUA 3L0KA 1WQ5A 2CZEA 3ATYA 4PL1A 3E0IA 1F74A 2FTPA 3OVPA 3TQKA 3UYCA 1UJPA 3WK3A 2NX1A 2H8XA 1A5SA 1DVJA 1PCWA 3DBPA 4UXDA 4NNCA 4JS3A 5DXXA 3P80A 5D2WA 3TX9A 1MEWA 5CSSA 3EWWA 4TIMA 3EXSA 1F5ZA 3EX6A 4LY8A 3HPZA 1JCNA 3W1RA 4BK9A 3G1HA 1G69A 4O50A 1AL7A 4LUIA 1TPVA 1VPXA 3SGZA 3INPA 1SZFA 4ORMA 3PB2A 1T96A 3G1DA 1I2RA 4LVDA 3IVUA 2ZZ3A 4IPJA 2V5BA 4LS2A 4UNLA 3S6DA 3N9SA 4M5PA 2KZHA 2JGYA 3EWUA 3GX9A 1H5YA 2Y63A 5LHFA 3LCGA 2Z2UA 1FCVA 4NT0A 3RLVA 1SZGA 5DBUA 5AC8A 3IRDA 4C1KA 2Z1BA 3W1UA 4CQ9A 5HUOA 3W2NA 3KFTA 2FJKA 2V2DA 3T78A 5T26A 1KM3A 3SY5A 2TRSA 2PE4A 5CPLA 2HS6A 8TIMA 1MEHA 3DKJA 2A85A 4QJ1A 4LT9A 1EWEA 3LCIA 2ZZ7A 4DPQA 2GQAA 2JKPA 4WJEA 5EKYA 4K8HA 1NFBA 4UR8A 3VCRA 3FIGA 4HN4A 2Q3RA 3VFLA 3M1ZA 1U5JA 1GT8A 3TAOA 1ZAIA 4PC8A 3QM3A 3HPSA 3LTPA 2C13A 3NQ6A 1P0KA 1GVQA 3IV3A 2EGZA 3RMJA 3T55A 3PS7A 3TW7A 5D32A 3NL2A 4ADTA 1ZHAA 3QH2A 3N14A 3C2EA 3KOFA 1B57A 1YYAA 3I65A 3NPXA 2JKAA 3GYEA 2VFHA 4N9BA 1QPOA 2W0UA 5GVJA 3LDVA 1HFBA 3M44A 1HTIA 5DLCA 1W37A 1W5MA 1YLVA 4FXSA 5AYZA 2RKXA 3HG5A 2YSWA 2ABBA 5F1UA 4ALDA 3H53A 4JGDA 1DQXA 3LHVA 2G97A 3TCEA 2E5DA 3KVJA 5AHEA 2ZZ1A 4IOTA 5CZJA 4UCGA 4FNPA 1QO5A 1JQVA 3EXRA 3W7DA 2ZYFA 2OX1A 2DU2A 4LTSA 4DF2A 4LC6A 4WXYA 3DFNA 5AYYA 3S42A 3MP5A 3HBLA 1L6SA 3P74A 3TXZA 5AFDA 1HUVA 2QAFA 5AHLA 1THFD 1OFOA 1DKWA 5LSMA 1OVDA 4Q4KA 1D3HA 3MBDA 3LI0A 4N4QA 5LGZA 2DZVA 1FWWA 1WDWA 1LCOA 4OV9A 3U8GA 4M7SA 3LGEA 1FDJA 3PAJA 3G1VA 3NPVA 4O1DA 3EKZA 1H60A 1GYNA 1FCUA 2VEIA 3EX4A 3LERA 4JR5A 2E6AA 4JDBA 1QOPA 2V82A 3W22A 1SU5A 2E1DA 2Y7EA 3DI1A 5DN1A 4LVAA 1R2SA 3LXCA 1I2OA 2D73A 2VEMA 1GPWA 1G4SA 1F2JA 3NQVA 1H7NA 1PCKA 3LCWA 3I7QA 4XTDA 4WOQA 4H4IA 4IMEA 1NSJA 3PVFA 2WSYA 2FIQA 1RQBA 2HMCA 2NWRA 2DZSA 3PWAA 4ONVA 1W5QA 2TYSA 5D30A 1OX5A 4MY1A 1JUKA 4JTFA 4NJIA 3LBCA 5AN7A 3IIXA 4XBSA 2RDUA 4LVFA 1U83A 2NZLA 4XTIA 4AWSA 3HGJA
chains in the Genus database with same CATH superfamily
3PBVA 2H3BA 1QW9A 4R53A 3WLKX 1Q7MA 1OD8A 5AHNA 1JF6A 1XLMA 1BF2A 4AZGA 3GDTA 1BEUA 3VD7A 1LL4A 2J47A 4JNYA 3OOQA 2QR6A 2WBGA 1HVXA 4Q7BA 9XIAA 4J3TA 4BWLC 3UPBA 1XLHA 4HMDA 3VD3A 2CIPA 5ABHA 4Y8FA 3VIMA 2DZWA 2YZRA 4Y90A 3GIYA 4RZ6A 1B54A 3UFYA 1V6YA 4GBDA 4LUSA 3GVQA 1A3WA 1KBJA 1TTQA 4NNAA 4B2DA 2QPSA 1XC6A 4GQBA 3PM6A 4DAIA 3MO4A 4J9JA 3M5XA 4EKJA 4PB4A 3KRBA 1TVNA 3GZ3A 2PTDA 2YL5A 2FTYA 3TYAA 3GKAA 1QNRA 1EF2A 1EIXA 3EWDA 5FJPA 4LB4A 4KQNA 1F76A 4UQAA 4OT7A 1H1YA 2ATMA 3BAXA 3T40A 3IIZA 3SRKA 4FI4A 2E5BA 3AHYA 3OP2A 3HPFA 1E5NA 2JQXA 1GQNA 3IVSA 3QSTA 1F4AA 2C1IA 1IR1A 2VFFA 1TRIA 1RBAA 3R7MA 4U5KA 3WJWA 4E8CA 2JGQA 4HA1A 3N29A 3ZFHA 2J24A 2J7BA 4IMGA 3CHVA 2BX7A 1ME8A 3W82A 3H2EA 1XKJA 2J9YA 4ZZ9A 1IEXA 4M1RA 2VEFA 3PJXA 3WLRA 3QC3A 1DWJM 3BG3A 4NAFA 2O9RA 4R7OA 2KX9A 1DHPA 4RR4A 3WFZA 1MNZA 3I68A 1GGOA 2WC4A 5F2IA 1XF0A 4CNPA 4K36A 3UESA 1ZBCA 2D2OA 3AMGA 3W87A 3N73A 7A3HA 1GWJA 1HGYA 2DV0A 3ZT6A 3OVQA 4FR1A 4WDXA 4I7WA 1OCNA 3G6MA 3SO7A 2O7SA 3M4HA 2V3DA 4CNSA 4CN6A 1KFLA 4XZNX 1VBJA 3OG2A 2VRKA 1BKSA 3N34A 1XL9A 2OT1A 1FY6A 3DHFA 4G8TA 2IKIA 1K8CA 4TX6A 1UD4A 2GFTA 2R8WA 2D3NA 4MVAA 1PKLA 1WOAA 6TIMA 2VOMA 3ELFA 4LFYA 3GDLA 1HJXA 2F6KA 1XDJA 3KBMA 4GKLA 1QJWA 5BOEA 3GO2A 1MZHA 4JL1A 3E5BA 4GIYA 4Q8QA 3T42A 4DWSC 1WDPA 4C6QA 4IG2A 1CLVA 4RX0A 2WWCA 2CHOA 3CTLA 3R0KA 3SCVA 1TKKA 4D2JA 1XX1A 3LRLA 4FOUA 1EXPA 1MSSA 3L67A 2R91A 5L6UA 4XAYA 3RNDA 2W91A 4Q4QA 4IIFA 1GKRA 4MY9A 4M0XA 4O1AA 1H7PA 1C8XA 3DG3A 4IP7A 3PY2A 4F0SA 1BGGA 3AJ7A 1FDYA 5A6TC 3NQEA 4N7QA 3W3OA 3QV8A 4PCNA 1K1DA 2E5CA 4XSMA 3DFOA 3N6JA 1VB9A 1VFUA 2J8FA 4AQLA 1XIJA 1H1ZA 2KAUC 4M19A 3MUY1 5BZAA 2BHZA 1ICSA 4LC8A 4PMZA 3QY7A 1KKOA 3ARVA 1KFJA 2GLKA 2G5WA 2WNNA 1EF3A 1ONWA 1OC5A 5I23A 1GQLA 4W89A 5EMJA 1GZJA 4NUWA 3C6CA 4LU0A 4AZ6A 3TYEA 3G3MA 4EPBC 3TQVA 4AWUA 5DBTA 4ZQMA 5C9ZA 1NOFA 3P93A 2ACUA 2PWVA 2XIOA 3QR3A 4L4PA 4W93A 1UC5A 2UV8G 3B8VA 3RU8X 3C2OA 3TR9A 4ZO9A 5DY2A 4I6KA 1JIBA 3HF3A 2D22A 2PDYA 1A4MA 3MSGA 3W02A 3KL5A 2CETA 3RLHA 1B4KA 4BFAA 4CD5A 4K2SA 4JKMA 1QBBA 2Z1KA 1Z89A 3VNIA 5M03A 1CB7B 2WAGA 5D03A 3WF2A 1JYWA 3CZGA 4JX5A 4O16A 1C8YA 1W3NA 3G0UA 4Y9OA 2YGYA 4MB4A 3OA3A 1KRMA 1B31A 4GFSA 4LV9A 1PXGA 4UFLA 2FB2A 3A12A 4BHYA 1B4EA 4UTWC 2EPLX 1EJSC 3KRZA 3HB9A 2B4GA 2DT2A 5FESA 2QF8A 2Z2BA 3VGBA 4ZQNA 4Q8OA 2IKJA 3VIFA 2CLEA 3NNTA 2WMGA 2Y6ZA 4YTUA 4A2SA 3AYSA 1MW0A 4E8GA 3N2XA 3B0PA 2XH2A 1LF1A 4UTTA 4PTMA 1LWHA 4A05A 4H41A 1TVPA 3FOKA 2P8BA 4ZO8A 4ZB0A 4OJYA 3PSVA 3CQHA 3OTRA 1DL3A 2JE8A 4I5UA 1GOXA 1WX0A 2YCLA 2QJNA 1TQXA 3EZ4A 4PFMA 2ZRUA 4M6QA 4UNIA 3NSMA 3LBOA 4HTYA 1AL8A 3I10A 4V33A 2NUXA 3N12A 2WPBA 4IQJA 3T44A 4W7WA 1XLJA 2OTDA 3BSMA 2Z6IA 4K7VA 5A2CA 1W32A 3P62A 1K6AA 2A5HA 3S4TA 3SBFA 3EA2A 1U2YA 1NP2A 4KCTA 4ACZB 5CSRA 2LLEA 5IM51 1Q85A 3RCYA 3PB0A 1KFKA 2A7NA 1YNYA 4RPPA 1FWJC 3WH8A 2PRMA 4LY4A 3T1GA 1PHQA 2WANA 4JZ5A 3EWYA 4GK8A 3HFYA 2E8YA 1RP8A 1FUYA 1UWQA 1JI1A 3P0WA 4M82A 1GK8A 2Q02A 4XUGA 5IFTA 4Y9PA 4XAPA 3T05A 3GXPA 4IX0A 4MZ1A 3W0KA 1KFBA 3JZUA 2VC6A 3SR7A 4WKAA 3W83A 2YW4A 4WCJA 1FQ0A 3QRHA 1Q45A 4QBXA 3TOYA 3SUTA 4ZE5A 4H8HA 1X6LA 1KM2A 1OYCA 2WSQA 2ATSA 4GH1A 2Z0IA 2EG8A 3S5ZA 4IX2A 4X60A 4P8WA 3NO5A 4N0RA 2C1GA 1MFVA 1JPKA 3R1ZA 3AIVA 3UWEA 3M7WA 4HSOA 2OWWA 5HMSA 1NJJA 1CW2A 2FTWA 5FF2A 1XIDA 2DJLA 5DT7A 2W9MA 1UKOA 3GS6A 5KZDA 1B9ZA 1EX1A 3EB2A 2ESCA 3EX1A 3BJTA 4UQ9A 5CC3A 4DUWA 3GVWA 3F4NA 3UXKA 3NZPA 1EJTC 3U7BA 3GFZA 1YX1A 5C7HA 3W7GA 1UMYA 5JIWA 2R6OA 5ECUA 2D2GA 1AW1A 5KSWA 1ZAHA 2XN0A 3P7YA 2G3NA 4S3FA 3GD6A 3O6CA 4IMDA 4J3SA 2ZZ2A 3W1PA 5M2FX 1TV2A 1QPQA 1BG4A 3M5ZA 3UWVA 4HHLA 1JXKA 1UC4A 2VFGA 3NGFA 2UWFA 3QFWA 3AWOA 1N7KA 4H6KA 2I16A 1QNPA 1J6PA 3RYSA 2XWEA 3SGUA 3C61A 3SQLA 3M5YA 3O7UA 1S2CA 3VIOA 2VFDA 4RNFA 2BXZA 3FVMA 4EIVA 2PBGA 5K2ZA 4CQAA 3PUDA 2F84A 2YB4A 1S2TA 3UXIA 4W8BA 3VKBA 2G3FA 1EJVC 2JIEA 1L9WA 3PTQA 4HN8A 3PF3A 2ZIDA 3I3DA 4DXVA 3BSGA 2FFCA 3GHRA 4S3GA 3PUGA 2HSAA 5C54A 1CZ1A 3URAA 1K8XA 4PYSA 4JFUA 3CLMA 4WQ6A 3FV9A 4XB3A 6A3HA 3FA3A 4BEQA 5D04C 3G5EA 1BYAA 2Y8KA 2G96A 3WELA 2A3EA 1XRTA 2Q8LA 2YOCA 1HJWA 1XSIA 2CC0A 3UZYA 5T9CE 3ARWA 2WVTA 1JL8A 1KCLA 3W6YA 4FF7A 4X3ZA 4JX4A 3AIQA 2GGEA 1M7JA 2DZUA 3HOJA 1QNSA 5D02A 1RVKA 4JIHA 4Q8NA 1GVFA 3IGHX 1J18A 3W7OA 1YBQA 4GCXA 4N2YA 2AQVA 1OZQA 3T2OA 4D6GA 1XFCA 4AISA 3KLKA 1P6WA 2CZDA 2R82A 3CUJA 3FDGA 3AIBA 3REQA 4F0LA 3L66A 2D0FA 4KFOA 2J13A 1WKEA 4JQ4A 1C9DA 5D2XA 4OUIA 4GVFA 3UCQA 4X61A 3TSMA 1OSEA 3ZJ8A 1SO4A 1B30A 3F03K 3HPXA 4HNOA 5B7ZA 3GTNA 4BWLA 3MKKA 2CXEA 2XVPA 3VNDA 1FWCC 1RLCL 3LENA 3LGDA 1DIEA 1NF7A 4V1YA 3WF0A 1JPIA 4QGCA 3TN3A 3CZKA 3CZLA 3H2NA 6CGTA 4OTKA 1M7OA 1QMLA 4KGLA 1QVBA 2FFIA 3OA5A 1NWTA 3BGGA 2H9AB 4GUHA 1TPH1 5LNVA 4ZGYA 2VL4A 4KWVA 1POJA 3GDMA 1ISWA 1VFOA 4REQB 1O4UA 1SJDA 4KKXA 3UZJA 3U9IA 1SUXA 2X42A 4O15A 3GXFA 4AF0A 4QNWA 2EEXA 1QAPA 1NU5A 1S38A 3KP0A 3TW9A 4C6DA 1RY0A 1RXOB 3V5FA 1ONXA 3MBFA 4IL2A 2EPHA 3CYVA 5IDZA 2JEQA 3CXOA 4CVUA 4GD0A 2BSLA 3ZOAA 3BGAA 3EMQA 3KTSA 5CJNA 2YCEA 3AC0A 4GXPA 2WXDM 4HOXA 5REQA 1M53A 8RUCA 4HA3A 4L64A 3W25A 3C4UA 3THQA 1QPKA 4HPJA 3BVJA 2DZBA 2QAPA 4ATDA 3C0LA 3FXYA 2O0TA 1CECA 5HK4A 1RVGA 1OGSA 1W1VA 2BFGA 3JR2A 3WDQA 4RXFA 2VGBA 4MLJA 1QNOA 1LTDA 2VFEA 1QDSA 4ADSA 3KOWA 1UZHA 1DWFM 4FXFA 1HIZA 1VKFA 4A8NA 2WJZA 1BF6A 5EBAA 1VZWA 3B0YA 3EDJA 1LL6A 1S1PA 3JS3A 1GQJA 5CPSA 1KCKA 5IHSA 1QO2A 1W9DM 3LUTA 4WLCA 3AU6A 3T2PA 4V2XA 1OT1A 1UWRA 1VEPA 4PSRA 5JBEA 3E96A 5SWUA 5EMYA 3UWUA 1RLDA 3PSWA 5AECA 4HZMA 1ISZA 1TX0A 1XBZA 3TYZA 3LXAA 5PTDA 3KCLA 3IAQA 3CJPA 1ONEA 3ITGA 4N6FA 3HA1A 5EFDA 1A5BA 4AD0A 3UR5A 1QXLA 2DZAA 2QCDB 3W76A 2QJHA 1LOQA 2VJXA 2DW6A 5G2WA 4XZWA 3PPGA 5A2BA 2X1UA 1OD0A 4OVXA 3SECA 4X9SA 5IDIA 4JIQA 3KTCA 1YNQA 4OE7A 3OBEA 2Y4SA 4HOWA 1MQPA 3DZ1A 3FA5A 1A50A 5EPDA 2R24A 2OOFA 3WD3A 3C56A 1E70M 1TZZA 3AROA 3BLPX 1W9XA 1D3CA 2CERA 4GZEA 2EG7A 4GX9A 2IKGA 2VX6A 3FJ6A 1EUAA 1J5SA 1V5XA 3AHVA 2Z1XA 4CVWA 4W5UA 2DUXA 1E56A 2A3LA 2Z27A 2X41A 3NG3A 1A5AA 4NYYA 4FX6M 1TWWA 1XISA 3W7EA 1HX0A 1VCGA 1CT5A 3G1XA 4IH3A 2VUYA 3CMFA 4JTLA 1XLEA 2DT0A 3GH4A 3B9DA 4W85A 3V16A 2QV4A 1LROA 4X63A 3K8KA 4NF7A 2QCEA 5H6HA 4AZIA 3BLKA 4XSLA 4H3DA 1TPWA 3I6RA 2V68A 3N3TA 2Q01A 4YU1A 2RHGA 4A3UA 2ZVIA 3WD2A 2YB1A 3E0FA 2VR5A 5CKSA 1DIDA 3QHMA 1WDDA 1O95A 5DELA 4U31A 1V93A 1VCVA 1A0CA 3MSYA 3SJNA 2O7QA 1M5WA 2QLYA 1R3SA 3BQ6A 3DG7A 4LV4A 1EX5A 3RX3A 4IIHA 1EQPA 5TBOA 1P0EA 2CHNA 4Z1YA 5GJMA 4K39A 3OLEA 3K5XA 5H2ZA 1UROA 3WENA 1W17A 1X1ZA 1F6KA 3QVQA 2RJGA 3MJYA 1W2PA 2CWNA 2P88A 4KIRA 1B1YA 1NOUA 4RE3A 3U4FA 3P61A 4HA0A 1GTEA 2QCNA 3PG8A 1C7SA 1GOKA 1N55A 4IP5A 1DXEA 1R0MA 2CLFA 2G4FA 1RALA 2BXVA 3VTRA 1CGWA 4CLMA 3CIXA 3E49A 2G3JA 4XKYB 1JD7A 3DFHA 1N82A 2GGJA 1W8GA 2JF7A 3DFYA 1U33A 2FZDA 3QQ0A 3L4XA 5LA1A 1KM5A 3BOFA 1A5MC 4UTWA 4LYRA 2OQYA 1M7XA 5CPNA 1BAGA 3H26A 1L0PA 3MHGA 3WLSA 3MTWA 1JG9A 3PBMA 4PMRA 2VNCA 3U2OA 3LTYA 3LPPA 1TPB1 2GYIA 5ABTA 1QUMA 2Q6ZA 1C3FA 3A6OA 2WCSA 3UY8A 2GUUA 5JH2A 1FWBC 4CD8A 3OO2A 4QS5A 1GORA 1JZ5A 3FKRA 3UWWA 1LG2A 1A53A 4HNVA 4PMVA 2CLLA 1LUCB 5HMEA 4HYWA 3A4JA 4FNSA 4C5ZA 1K9EA 1TZ7A 3UERA 3CT7A 1WZLA 5HJYA 2P0OA 2Y1HA 4QG6A 2ASHA 3ABZA 4GX8A 3T0BA 3PUOA 1OGGA 2CEQA 2UBPC 3MV01 4EK7A 3ZLFA 3E0VA 3B0VC 1V02E 2OODA 1R2RA 4O11A 1NQKA 2ZFAA 1JRBA 1LLZA 2WMIB 4C5YA 4RW5A 4TO8A 3VDHA 5GJNA 5CPQA 2DH3A 1AMKA 1S5VA 3FKKA 4QIUA 1Q4NX 3GNNA 4HK7A 1CX9A 4H19A 4M8UA 1MXGA 3WQ8A 5D2YA 3S5YA 1AJ0A 2YA1A 1IGSA 3DDMA 4S3DA 1LDCA 1AQFA 4DZAA 5K3VA 1O5KA 3NO3A 1KWGA 1UWUA 3NQ8A 3QSRA 3CEPA 3ANVA 2A2IA 4GPNA 3WH5A 3GBDA 4YVPA 4HCDA 2VCAA 3HU7A 4AIEA 4EF9A 2VC7A 1PZ3A 4C1NB 1EO7A 5G4WA 1K77A 4D8AA 3UXLA 4MNMA 3LEPA 4GVIA 1YPIA 1WYIA 3F4VA 3FYOA 3VZXA 3CH0A 1SW0A 3WQ5A 3WJYA 1VC4A 3WJSA 2OX4A 3B4YA 3CUXA 1FTXA 4GUJA 4Y6GA 2QMJA 1DV7A 4F40A 1YTDA 2FGZA 3GRIA 1H5VA 4UQBA 4KIEA 1IWPA 2J7HA 4R34A 5HQMA 1KFEA 2B7PA 4L4LA 2QUTA 3NVDA 2GGIA 1VR6A 3GR7A 3STCA 5I06A 3N15A 4JX6A 1EGZA 5TD4A 1HT6A 2WWDA 1EH9A 4LAOA 2YJQA 3CQ0A 2PDBA 4M6PA 3NYZA 1JRCA 2AGKA 4ACZA 3GR4A 1K4GA 3LCFA 1CTNA 1SM9A 3CO4A 1FP9A 1QPNA 4D9PA 1US0A 5FF7A 4L9ZA 3E38A 3LV6A 3RJYA 4EXBA 2YYTA 4U33A 1BLIA 3UXAA 4LGXA 1ZP3A 4OBRA 4HSNA 2PSNA 3P82A 2BGSA 1PIGA 3PZIA 3STEA 3CPUA 4S1FA 2DT1A 2OEJA 1VFSA 2PGWA 3PR2A 1H51A 2RDWA 3G8EA 3AS0A 3KUMA 4MSSA 5I3GA 4Q8MA 4JAWA 2EQDA 4GQ0A 5G4EA 3M0ZA 1XLIA 1TJ1A 1VLWA 3W7JA 3W00A 3CS2A 2CFFA 1LP6A 3VNLA 5G5IA 5U4NA 3PZNA 1GOWA 1S3HA 2VDIA 1J4EA 1V0KA 3MW7A 3SUUA 3SCTA 2DSWA 4LUYA 4LSBA 5FD0A 2R94A 3BARA 3CYJA 2HVMA 5A3HA 4S3CA 4PUKA 3WEZA 4L5ZA 3TJLA 3S2NA 1B9BA 2MNRA 1TV3A 1KXHA 2FHFA 2RDXA 5B80A 1DEDA 1YXCA 1XKYA 4QFUA 5HNUA 3HURA 1JDEA 1OYBA 5KETA 2WVVB 5IOBA 3SCUA 1W5NA 4E4UA 3OLDA 1KO0A 1PDYA 4L4MA 1SFLA 2YDSA 3O2LA 1KFWA 4PTNA 1TPFA 3QW3A 3EYPA 2WC3A 1D7FA 3ARYA 1H0IA 4L1XA 4MKVA 2IW0A 5EYWA 3LBMA 1OGBA 2CLIA 1DWIM 5FF4A 5C9RA 1ISVA 1P6CA 2CYGA 4UCFA 5AYBA 1PVNA 1PUDA 4Z1AA 4DUVA 2VVSA 5FEZA 4A8LA 1WQ5A 4PL1A 2FHCA 3OVPA 3ZSSA 1A5SA 1WXYA 1ZB5A 4PB5A 5DXXA 1MYRA 5D2WA 3EWWA 4IGNA 1IZJA 3EXSA 3EX6A 4G7EB 1UR4A 3BSHA 4QG8A 1PPIA 2OYMA 3W1RA 1G69A 4PMDA 1TPVA 3WBEA 3SCOA 2D2HA 3SGZA 1UOKA 3RR1A 2PDKA 2YL9A 3G1DA 4L9YA 1EDTA 2ZZ3A 4HGXA 5A69A 4ILSA 4IPJA 4S39A 4A3HA 3S6DA 5CH9A 2DUZA 3OIHA 2JGYA 1AD4A 1H5YA 5LHFA 4CGTA 2Z2UA 2OLHA 1SZGA 3QGKC 4CCZA 3NSXA 2QJMA 5FJJA 4CQ9A 3NYDA 5D8WA 3T78A 1KM3A 3WQ4A 1WZMA 1H3GA 2TRSA 3DKJA 3TYBA 2A85A 3ARTA 1E0UA 3GG8A 2QIWA 1G01A 1Z32X 4DPQA 5AC5A 2JKPA 3EDDA 2P8CA 2WCGA 3FIGA 4DBSA 2VRJA 3N4FA 4X9YA 3M1ZA 3M7SA 1U5JA 5FACA 3KDOA 4B4FA 3N2OA 3TAOA 5MKGA 3QM3A 3OODA 2C13A 3KOXA 4PBEA 4DJED 3ARXA 3T55A 4W88A 5D32A 4ADTA 1GHRA 4LUTA 3ITVA 1E71M 3NPXA 3KLLA 2GUBA 4N9BA 1QPOA 4E5TA 4NZCA 1KBKA 4B2DD 4J3XA 3L4TA 4DRSA 3ZVHB 2Y24A 1W37A 3JW7A 5DF0A 5AYZA 4GZ7A 2ABBA 3H53A 4JGDA 3LHVA 3VX0A 4QCEA 3LMYA 3KVJA 2H9AA 3OU8A 1A3HA 3V0TA 1QO5A 4L6DA 4REQA 2YL6A 2XSBA 3EXRA 4US5A 1I1XA 2OX1A 1HL9A 1SJAA 2IPGA 3S42A 5TF0A 3QGAC 1SMDA 1HUVA 4UZUA 5AHLA 1OFOA 5HATA 1D3HA 5A1AA 3HPAA 3O0FA 1G5AA 3CL6A 3QOKA 4EX4A 4CQCA 4A8RA 1GNXA 1IT0A 3GNPA 1Q66A 3PANA 4DIAA 4C6FA 3WBAA 4UQCA 2V6AA 4DJDC 2ON3A 4LJ3A 3G1VA 3NPVA 3SURA 1X7IA 1H1NA 3LERA 1PWMA 3DBNA 4JR5A 5FAGA 2EBNA 3K13A 3TA9A 4QJ3B 1EHAA 4YJ5A 1JZ7A 1I2OA 1UP3A 4W8LA 3AISA 4B3ZA 3L23A 3CQKA 4R9XA 1FH7A 1PCKA 2YXXA 2OU4A 1L8NA 3CO8A 1E9YB 1XICA 3D3FA 5D30A 3CNYA 2IKHA 2XIQA 3IIXA 4LVFA 1PTGA 1Q5MA 2IPWA 2NZLA 9XIMA 1OZMA 4AZCB 1V3JA 1P7TB 4IF2A 4S3BA 1JAEA 2XTKA 3RM8A 4U2YA 1JCXA 3LM3A 1O60A 2NQHA 2E28A 1EYEA 2PDCA 2EKGA 3WDJA 4D6EA 2WHJA 1KCZA 1J0ZA 3PHAA 4C6JA 3CUHA 2YCJA 4JFWA 3UJRA 1HO1A 3USZA 4XBKA 1PB0A 5BNKA 3URNA 4KRTA 1ZY9A 4N9DA 4UTKA 3MANA 2V0TA 2F2HA 3WF1A 4GUGA 1FWNA 3K46A 3QKEA 4UNKA 3F5KA 1C93A 1RJRA 3SW6A 5XIMA 1UP0A 3W1QA 3PULA 3EOEA 4CD6A 2TAAA 2QGYA 3IJDA 4JIIX 3KWSA 1LJYA 2ISFA 3UY7A 1SPQA 4EF8A 3MI3A 5A2AA 5TNVA 2QZRA 3V36A 3N2MA 4Q8TA 3OHMB 4A8IA 1G67A 1WZAA 3W6LA 2O9TA 1XIFA 5EMMA 3ITOA 4BF9A 3TJ4A 4JQ1A 4WOZA 5I3KA 5CAHA 1XJBA 4GQGA 3G18A 3GG7A 3UZXA 1J6OA 2E4TA 3URBA 1FWEC 2GGGA 1ITQA 4I7VA 3LU2A 1FOBA 3LTSA 1X6UA 2DORA 4HP5A 1EP1A 3EXTA 1NWSA 3N3MA 1JEZA 3NZRA 4GIEA 2DEPA 1EJRC 1LOSA 1WXZA 3C8FA 3JRKA 1U22A 3LRMA 2J79A 4YL2A 3VC6A 2NX9A 1RJQA 1E4LA 2XVLA 3GQYA 4UTHA 5KMYA 2NX3A 1MRAA 4CKQA 4QAIA 6ALDA 3ITTA 5LIWX 1SW3A 5CGQA 4KEZA 1A0DA 4GINA 4HA4A 3O05A 3IJIA 3GVVA 1UUMA 1XBVA 1Y0EA 1E3XA 3B05A 5GJPA 3OEXA 4JYDA 1CCWB 2C15A 5J8LA 1V0NA 3M6YA 1LT8A 4AH7A 2DW7A 4WGHA 1DQWA 3XIMA 2QUNA 4KEUA 3QOMA 1J9YA 3AMCA 3T2QA 3UJSA 3M64A 4NQ1A 3NQGA 4I9AA 1W0MA 3TWAA 3HIJA 4E6MA 4XQ6A 1JF5A 3QR0A 4DB7A 1XLLA 4DHGA 2OSXA 1ODZA 4Y2WA 5C5YA 3TROA 4DX3A 3B0UX 1UUOA 4XZLX 4GRSA 1DBTA 2PA6A 3BW2A 3GU1A 1XS2A 3LD5A 2VZUA 4AAJA 4B91A 3L5AA 4CQDA 4S3JA 1FWTA 2GVGA 3NEHA 4GYFA 1PZ2A 1HF6A 3N2TA 3W2LA 1E4NA 4H1ZA 3TTEA 2ZKMX 3CM4A 4ERGA 3MV11 1XRVA 4WSJA 3DKLA 3VUPA 1W3TA 1VP5A 7TIMA 1V8EA 2QQ6A 2E68A 2H90A 2W67A 3NDOA 3S6TA 1LLOA 2DP3A 2OGJA 1CENA 4LEQA 3N19B 4AXKA 4Q33A 2XG9A 4GJ1A 3AMKA 5BOFA 4ZCWA 2ZADA 1LUCA 1EDGA 4XIAA 2C91A 3MB9A 2B0MA 2Y7FA 4LB3A 3F2CA 4MOZA 1ZP4A 3PBWA 3L68A 1R7OA 4PTWA 4HHMA 4AC1X 3UGRA 2VVNA 2YCKX 2BTMA 4CU7A 1UD3A 3CQJA 5DXYA 5I07A 2WMIA 4S3AA 1Z42A 3RLGA 5AHFA 4F0RA 3FEQA 3K8LA 2OEKA 5CGTA 3VOGA 2QDGA 4ZMGA 1EIBA 1HNYA 2Z00A 3KS5A 1XG4A 3KBJA 3U6WA 4JTHA 4YCOA 4JTJA 2VMFA 4EAMA 4DY1A 5GNXA 1NTHA 4F9JA 4QLJA 2HNHA 4XD4A 3PZMA 5E9XA 1OJXA 1KFCA 4C6KA 5CCZA 1V6TA 4J40A 4PGLA 3ZSTA 3KBWA 1E1EA 2CLPA 3BPWA 5FJTA 1IE7C 5C2XA 4RPQA 4ICMA 1C8QA 1KB3A 4K6AA 4M29A 3HQOA 4AIOA 1S46A 3UYIA 2OO0A 1ZCCA 4GFIA 1VFMA 4NX5A 4UMBA 2PRLA 3UW6A 5A8GA 2Y88A 1G4EA 3UETA 4F48A 2PCEA 2WVUA 3VK5A 1O1ZA 2POZA 2WSRA 2PC4A 4UFHA 3C3NA 4C65A 2OCZA 5CEWA 1I8JA 1UMLA 4LAUA 2OPJA 3CV2A 4AD3A 4JHZA 4MAVA 5EMLA 3M0MA 3HV8A 4QITA 1RY8A 1XI3A 3O06A 1IGWA 2XDFA 1HKKA 4PCTA 2ZRZA 1TMQA 4JHMA 3ARUA 3Q65A 2X1RA 3PZTA 3GHUA 4DO5A 3V35A 2HE5A 2WLZA 4PSPA 2YYUA 2HXUA 3LG3A 1JI2A 2XYLA 1Q4WA 2Z24A 2NUWA 5HJXA 3IJ8A 3M0XA 3UA3A 5A6SA 1O5RA 3MMDA 2ZCGA 2DZXA 4ZENA 2DUAA 5AKQA 2QHAA 1XP3A 4PZVA 2ZZ5A 1KGUA 3HZ3A 1PTAA 1X1OA 4V27A 5DQPA 1J2WA 2XVNA 4JKKA 3W7QA 1N2VA 5T91A 1R86A 4NAFB 3TE9A 2ZA2A 2J6XA 3WLPA 2QJGA 3PG9A 2O92A 1OCQA 4DLMA 1HZYA 1IXPA 4M3PA 4N02A 2PLCA 2YLLA 3QY6A 2HWGA 3RDKA 4A6GA 1XGZA 4H04A 4UFJA 3ZLHA 2QUUA 3WQPA 1YHTA 1CXIA 1TUFA 2J7DA 4MMWA 3DERA 2E6YA 2EHHA 2BVWA 3S5NA 4CU8A 1BVZA 4IT1A 3QGVA 2VWSA 2W66A 1SFSA 3M0KA 1Z41A 3GUGA 1AQHA 5JBFA 1BYBA 3B8DA 2EKCA 5CG0A 1I9CB 3CWOX 1SO3A 4ERIA 1V03A 1OX4B 1K3UA 4HK6A 5FEWA 2V67A 4TX9A 2ZRWA 3WQ6A 1QBAA 5F2GA 1MXDA 4ZO7A 3DX5A 1MWOA 8A3HA 2ALRA 3BANA 1TIMA 5J04A 1R87A 3KHJA 1VBUA 1ZENA 1KLYA 3RM9A 2I7GA 4DF1A 1X8CA 3QF0A 4IG2B 3FVDA 2NXHA 1UR0A 3H4WA 4HTBA 2YBTA 5AYXA 3OZPA 4YTSA 4H2CA 3R25A 4XBJA 1P1XA 4QQ3A 3QTGA 4Y8EA 4WX2A 4IHCA 3BLLA 3OVGA 2XFWA 1HGWA 2WVVA 1K8YA 2V30A 1PJ9A 2FB3A 2GK1A 2WMJA 4A29A 3LGGA 1EYWA 4IPIA 5IBXC 2RDTA 4E2DA 2XUCA 4R85A 5HWNA 3O07A 1XV8A 3G6LA 2PDMA 1HO4A 3QXBA 4IL0A 3ANYA 2P53A 2VGFA 3R11A 3WL1A 2UY5A 2V5LA 1YQ2A 4WGXA 1ADSA 1IXQA 5CC5A 4BS0A 4WEVX 1DWAM 3A64A 5JVLA 2CZFA 2BHUA 3G0SA 1J2BA 4B3LA 1M7PA 1FHLA 2VDHA 3PZUA 2NLYA 1F4HA 1YDOA 5LZLA 2JBMA 1FXQA 4XX6A 1F8MA 3IJ7A 3R79A 2OR2A 3QFEA 3E12A 1GW1A 3RX4A 2ZX7A 3ALFA 2P10A 3E2RA 4JTEA 1K4HA 1FRBA 5FCZA 1VBGA 4ZOBA 4U3CA 3GAKA 4O53A 1IQ8A 4GVGA 3W7LA 4N42A 1HJSA 3ABOA 3WDHA 3QEZA 1RQEA 4NL1A 1Z7AA 2YBUA 5G1TA 4GC3A 3NM1A 4LEFA 2XSAA 3APTA 3OQ8A 2J27A 3DOPA 5D33A 1FHVA 5DCDA 4DNMA 2QEZA 3EGJA 2HVNA 5H8UA 4JTAA 8XIAA 3IJ9A 3LZ5A 3WFAA 4JIPA 4JEJA 4XZ9A 3WH6A 3MY9A 4E3TA 3AIWA 1DJYA 4GISA 1O5XA 1T8XA 1YIXA 1E9ZB 3UJFA 3QKZA 1B3VA 2ZWYA 3K30A 1K9DA 2WKJA 3VCCA 2BBFA 1KBLA 2VZTA 1N8IA 2Y89A 3A24A 3THUA 1Q6QA 1ZAJA 3WJXA 1GKQA 1TRDA 2FMNA 1TWZA 1BVNP 2HBVA 1AZ2A 4F0KA 5AC6A 4NRSA 4YCPA 1TMHA 5HULA 2PZ0A 2Z1WA 2XHYA 3HG3A 4CN1A 2QCHA 4G2DA 3KVKA 4LCSA 1G7VA 1YE6A 4UIOA 3WQOA 3AICA 4JN8A 3PBUA 2WV8A 3IEBA 2OT0A 2I17A 3TOPA 2VCCA 4CNOA 3POHA 1QHPA 1KRBC 4XO6A 2PLKA 7XIMA 3ZR6A 1UD8A 4MNKA 4XZBA 2HRWA 3YPIA 4M24A 1A5NC 5EY5A 3LHWA 5DY3A 4C6NA 3MDWA 3BLFA 4L56A 4PH6A 1XPYA 2YCLB 4BEUA 2VC5A 3VOHA 1PSCA 4OU1A 2J9ZA 3EEGA 1W5PA 4B5WA 1MW2A 3E0WA 4YS1A 2W6RA 1NY1A 3TA6A 1VS1A 3GKFA 2V5KA 1SR0A 2BY2A 1KBIA 1ITXA 3G1YA 2BVYA 2ICSA 1TJPA 3GXMA 1XYLA 2XGZA 4FSAA 4FALA 1DTNA 3RCMA 2J78A 4L9XA 4L1GA 5FF3A 4HJFA 3GH7A 4OUEA 5EMUA 5A94A 4ATLA 4O14A 4H7CA 2CCRA 4A2RA 1T40A 3RPMA 3V4BA 4WDWA 2ZBTA 2FZBA 2XFFA 3TMQA 3WF4A 2YW3A 4GQQA 1JGIA 4YVVA 4RDZA 2REQB 1P7TA 2VR2A 1NF0A 4PTXA 3NPWA 1GTHA 3GWQA 3E2SA 4PUDA 4RNIA 2BODX 3GFYA 4E2OA 4ZQPA 1PE1A 3DHPA 3KCJA 3KBSA 2CLKA 4HK5A 3GHTA 1NELA 1DPMA 1D9EA 4GWEA 3M5VA 4H01A 3RAOA 3TSDA 3BUVA 1FH9A 2OELA 2AKMA 3B06A 1XRSA 5I5RA 4Y9NA 3WEMA 2ZDSA 1X97A 5FIPA 5KITA 4GE8A 4BF7A 3AFBA 5FJUA 1NDYA 3DH7A 3ZZ1A 1E6SM 1QASA 3WIJA 5HINA 1G0CA 3IPWA 3WY1A 5ENLA 4D6DA 3UNDA 3H7VA 3LPFA 1N8FA 3P60A 3C52A 4TVUA 3MCOA 4GYJA 2DPEA 1KM6A 3ITYA 1KR1A 2GSJA 2YDQA 1JGMA 3H2FA 1R47A 3UU0A 4RKAA 4GXMA 1RJPA 4CNUA 2QCFA 4JCMA 3CL8A 1TE1A 4H9ZA 5FI8A 1Q6GA 4BI7A 2P5NA 4UTJA 1L6FA 3LCLA 4IUGA 3SCWA 5K9DA 4AY1A 2YCIX 4INFA 4WXZA 3EEZA 2E7FA 3KX6A 1UD5A 3MSRA 1Y5XA 3E74A 4ML9A 1AVAA 3PPHA 5HDRA 1PAMA 4Y9AA 3OYXA 4ZOAA 3L12A 4ZVJA 2X7WA 3CT2A 5H8PA 2W27A 2AL1A 3R5EA 2OB3A 1E6PA 3RFAA 1UQZA 1E4MM 1PIFA 1SFJA 1GVIA 4J1OA 1BQGA 1UB3A 4K8GA 3N4AA 1UP2A 3RLUA 1DP0A 1R3QA 1SGJA 1ME7A 5CGMA 4ZXLA 4FR6A 2VI0A 2WYSA 4RZ4A 1KGWA 3WH9A 1X1NA 3T81A 4YWSA 1Y5VA 3W86A 4DF0A 4U10A 4H6RA 2CPUA 4GJJA 1RD5A 3RILA 1REQB 3SQMA 2C18A 4K8EA 3VZYA 2R14A 4QRNA 3W74A 3TQPA 2ZXAA 3GU2A 4C60A 3NOEA 2X2GA 1JCYA 3G1SA 4JL2A 4EPKA 3CGTA 3UBPC 4C6LA 2Z1VA 3MU7A 1BTCA 4D6FA 3ABXA 1BXBA 4M80A 3URQA 1JPDX 4J3WA 4PB3A 4DNHA 2NUYA 3B03A 3BZGA 5B7YA 4LQ1A 1IR2A 2WZIA 2NQ9A 2Y5JA 1OQFA 3ICJA 4FLQA 4JYFA 1CGYA 4I8DA 4L4OA 2A3BA 2NT1A 1LBFA 3STGA 1HW6A 4F3HA 4IZGA 4FNTA 3NL3A 3ID7A 4MYAA 3EKLA 3WLOA 3GAYA 4S3KA 1W3HA 5CPMA 3I6TA 4ZQCA 5LA2A 1D2KA 3U2EA 3O6DA 4EVZA 3SADA 1H7WA 2OOGA 4WD0A 2PB1A 4B5TA 2ZTKA 1K7XA 1ESWA 4UTUA 4PRWA 3U0HA 2CLMA 1D8WA 1Y8BA 3W7NA 5JU6A 2YFOA 1M1BA 1EL3A 3SN1A 3ZVIA 5LIYX 1W1B1 3M0HA 5CBBA 4RNHA 4OQVA 2YR1A 2E77A 4GIRA 3GVRA 3Q2DA 2A6LA 3BTNA 5DMNA 4AF0B 1S5MA 4MZYA 1VJZA 3TC3A 3QJAA 3APGA 1KTNA 2BV9A 2EAWA 3O8AA 4JTKA 5DX7A 3EMCA 5KEZA 1K02A 2ZC8A 1ZRQA 2GUYA 3AJXA 3RPDA 2GWGA 3P8IA 5ABFB 1B3OA 1W54A 3WBWA 4UUIA 1J0JA 5CC7A 2E6DA 2IQTA 1UKQA 3VE7A 4AWEA 1EC9A 3GXIA 1H41A 1EWDA 5M17A 3HQPA 4XKMA 1QT1A 5REQB 3LB0A 1V6WA 2EJ1A 3ZXWA 4Y7EA 4Y96A 4HMEA 2HNEA 3BW3A 1D7KA 4O12A 2XN2A 3BJSA 1U1JA 4FNQA 3B40A 3UJEA 4DJEA 4YXGA 3QZAA 4BZYA 4FX7A 1LT7A 4IGHA 1KR0A 1MDRA 1R3WA 3B8TA 2NXGA 4HJWA 1UH3A 2J75A 1I60A 4DBEA 2GJRA 2V5CA 5HNRA 3NURA 1LG1A 5C2CA 2PMQA 2XISA 1E6XM 1W1IE 4DO7A 1BYDA 1TJ0A 4C90A 3VGEA 3OJGA 4C7DA 3P67A 1HQTA 4DAFA 1GKPA 1AMYA 1DYSA 4ZTXA 4QE4A 2PGRA 2E1WA 1BRLB 3WL0A 3WQVA 3NAVA 4WUIA 1EB3A 4FP1A 3LNMA 5DMMA 3KWXA 4H8VA 1KXQA 3SB0A 4LAMA 2P3ZA 1IYXA 1M04A 3AAMA 3TFXA 1OFEA 4H6QA 4H6EA 4K37A 1KM4A 1AA1B 4HHPA 1XW8A 1TA3B 1VFLA 3MHUA 3MJMA 4JTQA 1KV8A 3AHXA 1K8ZA 1R6WA 2NQ5A 4IGSA 2C3ZA 2ZX9A 2DT3A 5J5RA 3TC7A 2B81A 3WNPA 2XIIA 1E40A 3W1MA 3OZOA 1EJUC 4OHQA 4FMVA 1CLXA 4FZIA 3MKVA 3LZ3A 3BOXA 1FBAA 4P7RA 3MS8A 4BI5A 4QTGA 1I45A 1QNVA 3MZNA 1GOOA 3O16A 3DCPA 3V5OA 1R9YA 3F7JA 1H0GA 2XSXA 2FDSA 5KZEA 1HJUA 2NQJA 2E9LA 4LNYA 4H7ZA 1Q7QA 2XH4A 5HBFA 3AUJA 1E6NA 3L65A 3KW3A 1OBAA 4HU0A 2ACQA 3TKFA 4A22A 4O10A 2OKOA 4JTUA 4V1XA 1TCMA 1TR1A 1OX4A 1XDLA 4IM4A 3KZSA 1PWLA 2PP3A 4MWAC 2GQ8A 3ITCA 4CQ8A 2ZUVA 4Q8VA 1TELA 1BYCA 1ZBWA 3QV7A 1JZ2A 3U3HA 3UG8A 3ZS4A 4JN7A 5E0FA 2WM0A 4ZQRA 1GOQA 4TMCA 1CXFA 2C8NA 4MJ2A 3ZWTA 7ENLA 3M0VA 4KGJA 1P5BA 4XK2A 3W72A 3M07A 1HKJA 3UG4A 2PDJA 5JH1A 1B3YA 2W92A 4GIAA 3DFSA 1J0YA 1DWHM 3H23A 4X2PA 4XZHA 1PKMA 3VIHA 3DI0A 5F7UA 1HVQA 4U28A 4C6PA 2Z7GA 3LLXA 4Y9MA 1AJ2A 1CXHA 3DU0A 3R89A 4J4KA 4JIEA 4MNLA 2ACRA 3IK4A 3OLIA 1P0NA 1CBGA 3W01A 3WLNA 3BO9A 2PP0A 4MIMA 4N6EA 3FSTA 1OK6A 3G1AA 2NW0A 2CBVA 1TTJA 3QYQA 2J4GA 1C91A 2ABAA 3W7RA 2NV2A 1IZKA 1GZGA 3BW4A 5CSYA 4UZSA 1GYLA 3M0JA 3AYVA 1FH8A 2IPFA 2PUZA 2DQWA 3S8HA 3SCNA 5JMUA 2Y62A 4DJFC 1R5YA 3OZYA 5EU9A 3S9IA 3ZT7A 5DT5A 3IUIA 3PTDA 3R8HA 1LZOA 1E6ZA 3UEQA 5T8GA 3IGUA 8CGTA 4O17A 4U3AA 4US5D 1RUSA 4NZFA 3Q67A 3NL5A 2PGFA 3GTIA 3NWRA 2VGGA 2WHMA 3T8QA 2HV5A 1OWQA 4DYEA 3TUUA 3AIEA 2CZEA 3ATYA 4TXEA 1GJWA 3EAUA 1QRQA 1F74A 4G9PA 1UJPA 4FOKA 2NX1A 3GG1A 3FAWA 3DBPA 3ZJ7A 3EB3A 1MEWA 1BXNA 2VHLA 1T6MA 4TVDA 1RCOB 3UVAA 4LCRA 4TIMA 1F5ZA 3HPZA 1JCNA 1C92A 4O50A 4LUIA 2CZVA 3B8UA 4P8XA 5BRPA 4ORMA 1OCJA 2GGHA 3PB2A 3PWIA 1I2RA 4LVDA 3RX2A 2NVDA 3C5QA 3CIVA 2P3EA 5FJIA 3GDBA 1XYCA 2PWEA 4LBRA 2G50A 3QLDA 3GX9A 3NZQA 2Y63A 1KRCC 1FCVA 3RLVA 5DBUA 1MQRA 5HUOA 4Z2HA 2V2DA 3QLLA 5C9XA 3BAKA 4MHBA 5LIKX 3B0XA 4QJ1A 4IPNB 1BQCA 2GQAA 5EKYA 1U1HA 2AKZA 3VCRA 3VO0A 3N6HA 4HN4A 4Q6XA 2C71A 2Q3RA 3N25A 3UR7A 3ZJKA 3HPSA 3NTYA 3L4VA 1P0KA 1GVQA 3IV3A 3P2VA 2XPKA 1IEVA 3WNLA 3NL2A 1UPMB 1ZHAA 3QH2A 4GJIA 3C2EA 1YYAA 3I65A 3ONBA 1CGVA 3A3XA 3DUGA 4ZO6A 3AYRA 1EGMA 2IUZA 3LDVA 3SCPA 3M44A 4P5UA 4RE2A 5FAJA 1W5MA 1HL8A 4AD5A 2ZX5A 4ALDA 5E6ZA 1I1WA 2HROA 2WC7A 3TCEA 2G97A 3UT0A 2D3LA 3LNPA 5AHEA 1E5JA 5CZJA 3S9ZA 4Q6JA 4P7LA 3W7DA 3WD4A 4MADA 4LTSA 4LC6A 4H9UA 1JFHA 3DFNA 3MP5A 3HBLA 5AFDA 3TXZA 4HQVA 3BAYA 3AS2A 1DKWA 2F6XA 4N4QA 2DZVA 3EKGA 1UD6A 1XYFA 4RZBA 3VMOA 4TTGA 3VD5A 4OV9A 4Z2IA 5IFPA 4DBUA 4QAWA 6TAAA 3U8GA 4HU8A 3LGEA 3PAJA 4O1DA 3PFMA 3D46A 2AMXA 2VEIA 3EX4A 1FFQA 1OY0A 4HMCA 2D2JA 3W22A 2REQA 2E1DA 2Y7EA 3DI1A 4DUXA 4LVAA 3QV6A 3TZFA 1R2SA 1RSCA 3HV9A 1SJCA 4YTTA 3CHEA 2D73A 3CH9A 1F2JA 1H7NA 1W91A 1RBLA 4H4IA 3PVFA 2FIQA 1RQBA 2ZVRA 2HMCA 1QI4A 2O4MA 2DZSA 4B3KA 5CJ5A 4OECA 4TV6A 4AXNA 1IEIA 1WDRA 1HKVA 3N6QA 4JTFA 1LQAA 5AN7A 4LH8A 3NQBA 2RDUA 4LANA 3SN4A 1U83A 4XTIA 1XLCA 4A3RA 4W7UA 3SJ3A 4KRZA 4D6HA 1HKWA 3FLUA 2WW5A 3H2OA 4HU3A 4PL2A 1IHIA 3S46A 3WDRA 2QUVA 2OJPA 1E51A 1KGXA 4ICNA 1VFTA 1YTKA 2XINA 3DGBA 3S1XA 5DO8A 3RF9A 4O8RA 2ZRYA 2WMHA 3NDYA 3GNOA 3MP4A 5MF5A 3PBYA 1FWSA 1VH7A 4TMBA 2BASA 4FHAA 4PBGA 1C7TA 2OWXA 2NV1A 2A3CA 3WD0A 4C6MA 2J7FA 2Z6JA 4F4RA 3VOIA 2ISDA 5CPTA 3THAA 4WY0F 3GTHA 5EA9A 3QPYA 4L1WA 3SRHA 2Z7KA 4UQEA 4PCPA 5DCBA 3WUEA 1RPXA 3B9AA 1RR2A 1OC6A 2GL5A 4TTUA 4XIMA 5DRCA 3R12A 1RD6A 2QCGA 3E02A 4DO6A 4CCEA 3PUEA 4YVXA 3ZO9A 4EACA 1VPQA 1X98A 1TFVA 3QV9A 4OZOA 3OBAA 2GVJA 2CZ5A 5BRBA 1W6TA 2FQIA 2X1SA 1UUQA 3TWBA 5LNWA 3AXMA 3IVTA 1C29A 3FHQA 3KXQA 4NRRA 3MKCA 2R1PA 2I57A 4QP0A 1Z9AA 1REQA 3BLOA 4NIRA 5FJOA 3H7UA 1W1YA 2OSYA 1HJVA 3OVRA 4X0VA 2H8ZA 4RE4A 1ISYA 1CNVA 3VD4A 2J74A 3TN4A 5D37A 2FPVA 4PTDA 1A4LA 3MVIA 1YMYA 2VEPA 1V3HA 5AHIA 3RIKA 3PNUA 1EBHA 5FL1A 5JXQA 1LQ0A 4M51A 3WQGA 2PLMA 1HG3A 3W38A 4Z0SA 3VC5A 3WUBA 1RHCA 2R1NA 2P1FA 5MKGB 4NJGA 4B5VA 4ENLA 4QROA 3F4DA 4GNKB 4OOUA 1ELSA 2VR4A 2E25A 3AXXA 3UJ2A 4QJ4B 1OFQA 4LUTB 2WKLA 5I0DA 1M6JA 4YHGA 3E2QA 1MFUA 4MF4A 4MFDA 5HWMA 1G7UA 2HEJA 3ZM8A 4KEVA 2V3FA 4HIBA 5D38A 3RITA 1OHLA 1EO5A 3CAKA 4PEKA 1UKTA 5LIUX 1D3GA 4ZFMA 4YMZA 3MYPA 3IUHA 1J12A 3GIPA 2TPSA 4G1KA 3VM7A 3ORWA 3BGJA 1W8SA 2CNCA 1UCWA 4BCEA 2I56A 1I2NA 1Y7VA 2Y61A 3MI6A 3TYDA 1A5OC 1QPRA 4I6VA 4XISA 5A8OA 3M16A 2VOTA 1EXBA 2VQTA 3AMDA 4R33A 1RCXB 1ZLPA 3UR2A 5C7VA 2D0HA 1ZTVA 2GJXA 2Y7DA 3NUKA 1J0HA 2IXUA 2YZ5A 3K1GA 3K2GA 4Q4SA 2YDAA 4A21A 3NZGA 5ABFA 4AHPA 1O5QA 1TREA 1UBPC 4UTTC 3P81A 1EGVA 4AZHA 1V6VA 2J88A 2YDRA 3V7PA 3ARZA 1XH2A 4O8AA 4AX7A 1QU4A 3W70A 4Q4RA 2V5JA 1O68A 1W3KA 2HISA 1L2UA 5I3DA 2A7PA 5CSUA 4XD6A 3EBVA 1BWKA 3SM0A 2YKKA 4F0HA 4H9YA 2DVUA 1CXKA 1PX3A 4LPCA 1WBJA 3SUSA 4U5IA 1LRQA 4L65A 4NHVA 2B7NA 4MGGA 1L6GA 2WQPA 2PWUA 1A49A 2Z29A 1CYGA 4UR7A 2PTZA 2PPGA 4K38A 4R9OA 2WJFA 3IANA 1K6WA 4I9TA 3N17A 1P43A 1TV8A 2YFNA 4H8NA 3GFXA 1OF8A 1S2WA 3UA4A 3LS9A 3UD6A 1H09A 1FCQA 2XM1A 1WNOA 1YKWA 1VQTA 5I78A 4LBSA 3A3WA 5EGRA 5L9FA 1LOLA 3W4RA 4Z2LA 4FLSA 4L6HA 1BRLA 1E6RA 3H12A 3FNDA 1M9HA 1B3ZA 2UZ9A 1MW1A 3RO6A 1CWYA 3LHTA 3HG2A 5HA7A 3W26A 4DWSA 2QCCA 3VYLA 1M65A 4UOJA 1NOWA 4MKNA 2P0IA 1EOKA 1C8VA 2PCQA 5I02A 4Z0JA 1GG0A 4WKHA 1TA3A 4OWGA 4C6BA 4RK8A 2WMFA 1BTMA 2Y0FA 4KCVA 5A6KA 1XQLA 1H7OA 5I3JA 2ZRVA 2VX7A 4L80A 5I09A 3CWNA 4OFCA 3T6CA 3ERPA 3I3EA 1AW2A 5M5DA 1HN1A 2D24A 4GYKA 3COTA 3CV1A 3WF3A 2FLIA 3OW1A 4QG9A 3WBYA 3P84A 2FMOA 1XYBA 1IXOA 2DIEA 3NQMA 4GY1A 1J01A 1R85A 1W1A1 3P5YA 1OFBA 4YN5A 3MUIA 3KE0A 4US6A 3QMTA 2W79A 3VIJA 5CZKA 4FXRA 3VA8A 3KDNA 1MXSA 1NWRA 4QSFA 4DJFA 2WPGA 3KZPA 1TX2A 5FEXA 1V3LA 1Q6OA 3KOZA 4AEEA 1XCFA 1OG6A 5LNRA 1TMLA 4MPQA 1X8FA 4G1NA 3VAVA 4DO4A 4WDTA 3AIRA 2PODA 5BU9A 3RHGA 1GEQA 1IIGA 2JK2A 3N2BA 4PUWA 3FK4A 5LXXA 3HFTA 5MHBA 1F7BA 4YYFA 4R3UA 1H11A 4CUCA 1A0EA 3K1DA 1BPLB 5HQLA 2OFJA 4RE0A 1F3WA 2X30A 2IS7A 5E6YA 1A3XA 3AZRA 3WUFA 3FJNA 3MCNA 2WCAA 1RZMA 4O4VA 1XLDA 4S3EA 5EBUA 3LQLA 1BXCA 2Y5EA 4LUJA 3JUGA 1LLWA 4O57A 4X0NA 1Z44A 1B5TA 3ABQA 3AS3A 4JIRA 2PRHA 3EX3A 1WPCA 3U5YA 5H1WA 1TQJA 3R0UA 5FKYA 1VYPX 3QPZA 3U48A 5LA0A 4Q3MA 4RV8A 1TTPA 4OOZA 5TAOA 2WJEA 2WNZA 1WOBA 1ODUA 1XIMA 5AB3A 2TSYA 4LRTA 1E0WA 1FFRA 1R9XA 2I9EA 5HQEA 4K7YA 4XAGA 1Q6LA 1JR1A 3QQ1A 1ZFJA 2EPMX 3OB8A 1S2UA 2OYKA 3TTQA 1XCWA 4C7FA 3SAZA 4G56A 4C6CA 3LSCA 4AC7C 3MC5A 2BB0A 5U7SA 2Q71A 3CC1A 2HE8A 4B9ZA 5KZMA 1QWGA 4CNTA 2J9XA 1YRRA 5A95A 3ECQA 1O6IA 2C1HA 1EEPA 5HWJA 4LF1A 3BLDA 2W63A 2CW6A 4M7TA 2V63A 3LOTA 4KETA 3KVLA 3UG3A 3E0LA 3GXTA 4NI8A 4E2VA 3TW6A 3AWNA 1PX4A 3EOLA 3WLHA 4LAKA 1XBXA 4AVNA 1R30A 4GABA 1T8QA 3SN0A 3R10A 3D5HA 1TYGA 2FH6A 2BXYA 4H2HA 3LN3A 3DHUA 3M0YA 1H50A 4CD4A 3MUXA 1NFPA 5F2LA 5C8BB 2V69A 2V8ZA 3GNDA 4RW3A 3U4AA 3TZNA 4JDYA 4W4QA 1Z69A 4LYKA 3R13A 1W1ZA 4NAEB 2VD9A 1TV5A 2WMKA 1IWAA 1SZRA 4KESA 3UGVA 3W85A 3WMLA 1RV8A 1BWVA 2C7FA 1SZNA 5F4WA 4WIWA 1PHWA 4QDPA 3WLIA 4HSHA 4GI6A 3IIOA 4DUOA 3S1WA 1EP3A 1P48A 1W3IA 1DQUA 4HPNA 4WF7A 2IMRA 1G4TA 1HKMA 1ALDA 2VP8A 4HB7A 1EOMA 3C8NA 3L7RA 4MZ8A 4FIQA 5HANA 3M41A 5A6AA 1BG9A 2PTWA 4W86A 1R3TA 3RO8A 3RPTA 2H3DA 3W7IA 1JZ3A 3QHNA 1POKA 2V3EA 3MI2A 1G9HA 3T08A 3THCA 1KQZA 4PMQA 1QHOA 2AL2B 3MT1A 1E0VA 3OGRA 1ZCOA 3CV7A 4XAZA 1E72M 2J62A 3MA8A 3AALA 4CN4A 1VJIA 5TIMA 1S5TA 4S23A 3EPMA 2GVYA 3BCDA 4UFKA 3PZGA 4GO8A 1P1MA 1E73M 3VCNA 4GKTA 2AQOA 4HKPA 3R43A 3KAOA 1ZU8A 3LHUA 3VZZA 3C0SA 3N18A 4PA8A 4WKFA 3IS4A 2QDHA 4PULA 5M1TA 2XN1A 1TR9A 3L4YA 2I1OA 3GXDA 3S9YA 1MI3A 3CZ8A 2DGAA 2GDUA 4JTSA 1I2PA 3O15A 3NQAA 4MB3A 5KINA 1YXYA 2FGLA 1G94A 4LW7A 3PWGA 2OMAA 1YTEA 4P8VA 3QYSA 1DJZA 3CHDA 3TAKA 4NG3A 3VM5A 2PAJA 3LM7A 3ARPA 1W56A 4AY7A 1ZSXA 2ZOXA 2BOGX 2J7GA 2MUCA 3GDRA 4JHOA 1WA3A 2ZZ6A 1ZS2A 4A35A 3LRKA 1V7AA 1ML1A 3IIVA 1GVEA 1VJSA 2HDJA 3FYPA 1FWHC 3K4DA 1ZNNA 4JEQA 3DFTA 4W9TA 5GNYA 2E9BA 3AUOA 3S2JA 1UR1A 3O1NA 1K70A 5FEPA 3ENLA 4C6OA 3W73A 3VKAA 3H24A 3W28A 1BFNA 1KBBA 1AODA 1F07A 1E9IA 3A13A 1QTWA 3L5MA 1J10A 1XWYA 2X1TA 3TVAA 4BA0A 1Q65A 4I90A 3AHTA 4RV3A 3KM8A 5LKYA 1NAL1 7ODCA 2GDVA 1B0IA 3N2CA 1RCQA 1FWDC 3I7SA 1V7YA 2AOSA 3DENA 2W4XA 4YTRA 3VXGA 1JAKA 2NVCA 3KP1A 3WG6A 3EX2A 4K68A 2G37A 4HNNA 3TTYA 2C19A 1QR7A 2O9OA 3BMVA 2BMBA 4ECLA 3GUWA 3PZVA 2PD9A 3RCNA 3Q94A 4DWDA 4NU7A 1GVYA 3H55A 1AH4A 5I6SA 2PWHA 4IPLA 5ABEA 4PRRA 3TQ0A 1KCXA 4LYPA 1NWUA 4A3QA 3U57A 3SCSA 4ZL1A 4MY8A 4GZJA 4FIRA 5A6BA 4JTRA 3PC0A 1Q6RA 2GK1B 3DGRA 3GZAA 2FPTA 4RCXA 1UOZA 2VX5A 3NVTA 3ZIZA 5JBDA 1GOIA 7TAAA 2Q3OA 4MLRA 3LHZA 3LHYA 1JNDA 1NEYA 3M6DA 2FVLA 4WY0B 3E1F1 2Y85A 4QR6A 3P5ZA 5D9PA 4DXKA 1C90A 1XIIA 3WKZA 3IUDA 4MYXA 1FHUA