3ZVHB

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
415
structure length
414
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
total genus 162
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
B PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhB02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhB01
2OQYA 3P3BA 4KT2A 3UJRA 3MQTA 3JW7A 2PMQA 3UXLA 3H70A 4HCDA 3GC2A 2OZ8A 2RDXA 3MUCA 3U4FA 4MGGA 2OZTA 2XH4A 4E4UA 1JPMA 1NELA 3CT2A 1JCTA 3OPSA 3UJFA 3FCPA 3D46A 5FJRA 3TCSA 3FYYA 3P0WA 4HYRA 3D47A 3TOYA 4ZA0A 2GGIA 3T4WA 3OP2A 3NO1A 2PS2A 4HNLA 3CYJA 3BOXA 2GGGA 2P3ZA 2P8BA 4IL2A 5FJOA 3MZNA 4KWSA 2HZGA 1L8PA 1OEPA 2GGJA 1RVKA 1ELSA 4KEMA 3T6CA 3DGBA 3SSZA 1E9IA 5EU9A 4ZCWA 3R10A 3QN3A 3NZGA 4DHGA 3T8QA 3MSYA 3NFUA 2PODA 2NQLA 3FXGA 3ZLHA 1EC8A 3CAWA 3RCYA 3DG7A 3P93A 2OG9A 4DXKA 1KD0A 3VCNA 2ONEA 3R1ZA 3THUA 2PA6A 3H7VA 3VCCA 2HNEA 3PWGA 3CK5A 1JPDX 2GGEA 2AL2A 2HXTA 3DG3A 2XH0A 1TZZA 3DESA 5BOFA 1SJAA 2OKTA 3SQSA 3IK4A 3TTEA 1YEYA 4ROPA 3UXKA 1NU5A 3RITA 3OW1A 3RO6A 2GSHA 1R0MA 3I6TA 3PFRA 2CHRA 3DERA 4IL0A 2PU1A 2PTXA 3TWAA 5FJTA 4A3RA 3BJSA 1W6TA 4GYPC 3Q45A 1MNSA 3Q4DA 2OX4A 4MMWA 2ZC8A 3TJ4A 3I4KA 2OLAA 4E8GA 4IP4A 3R0KA 2PGEA 2PCEA 2AL1A 2DW6A 3H12A 2AL2B 4IT1A 2PGWA 4M0XA 4HCHA 1MDLA 1DTNA 4GGBA 2QJNA 2P0IA 3MY9A 4J1OA 4H2HA 4H19A 4YWSA 3IJLA 3DIPA 2QDDA 2POZA 3SBFA 4E4FA 1XS2A 3RR1A 3OZMA 2OZ3A 2MNRA 3I6EA 4HCLA 3R11A 4A35A 3ZLGA 3VC6A 2PTZA 3SJNA 1MDRA 1EC9A 2O56A 1KCZA 3V5CA 2QGYA 3JVAA 3TJIA 1PDYA 3N4EA 1TKKA 3VC5A 1EBHA 1MRAA 4DX3A 3S5SA 2PTYA 2QJMA 3DFHA 3GO2A 3OTRA 2AKZA 3V5FA 3DDMA 1R6WA 2OVLA 4F4RA 4K2SA 5ENLA 1ONEA 1MUCA 3ES8A 3ZVIA 3EEZA 4GISA 2DW7A 4K8GA 3S47A 4HNCA 3FJ4A 6ENLA 3GY1A 4GMEA 4KPLA 3FVDA 2XH7A 1SJDA 1P43A 3RRAA 1XPYA 3DG6A 4ENLA 2XGZA 3ENLA 4DN1A 3TW9A 2FYMA 2PP1A 3EKGA 4GIRA 3MKCA 3B97A 3V3WA 1PDZA 4JN8A 2OO6A 4DWDA 4FI4A 3DEQA 4G7FA 4H1ZA 2PSNA 1KKRA 4IP5A 3OZYA 3ZLFA 2P88A 3JZUA 2MUCA 3ZVHA 2XH2A 5IDZA 3VFCA 4A6GA 2XSXA 4K1WA 1WUFA 4FP1A 3UGVA 4MKSA 2GDQA 3R0UA 3UJSA 2QDEA 3QPEA 5FJPA 3DFYA 3N6HA 2PP0A 1KKOA 2ZADA 4GYPA 1SJBA 2QVHA 2I5QA 3CXOA 2PU0A 3GD6A 3IJIA 2AKMA 3HPFA 3SN0A 3T9PA 7ENLA 4IZGA 3UCCA 1FHVA 3BSMA 1BKHA 3ZVHB 1EBGA 4GGHA 2QQ6A 3VDGA 1WUEA 3ES7A 3CB3A 2PTWA 3QLDA 4JHMA 3SN1A 3N4FA 1ECQA 1F9CA 3STPA 1JDFA 4E6MA 2PPGA 3MWCA 1TE6A 1BQGA 4HPNA 2P8CA 4Z1YA 3R25A 3QKEA 3RGTA 3N6JA 3PWIA 4E5TA 4J3ZA 2HXUA 3PK7A 3QTPA 3SN4A 4JN7A 5FJUA 4H83A 3TWBA 4DYEA 4HN8A 4Z17A 4X2PA 1EC7A 3K1GA 2OPJA 4G8TA 2FKPA 4IHCA 1P48A 1SJCA 2PP3A 3UCDA 5J04A 2OFJA 4GFIA 5BOEA 2GGHA 3KUMA 1IYXA 3V4BA 3VA8A 2GL5A 3UJ2A 3FV9A 3U9IA 3H8AA 3NXLA 4M6UA 3TQPA 2QJJA 3UJEA 1FHUA 3IJQA 2OQHA 4EWJA
chains in the Genus database with same CATH superfamily
1XDMA 1IWPA 1KM6A 4L4LA 5FA5A 1NWSA 1BZLA 2PMQA 3T4CA 1V93A 1C8QA 3WKZA 1G01A 3AXIA 4DZ5A 3BURA 3NQ8A 1YDYA 3L4VA 3M0LA 4K7YA 1X6LA 1ICPA 4Y8FA 1A49A 1DQUA 2V5CA 3IUHA 4EPKA 2XHYA 3NXFA 3AYVA 4B4FA 2PRMA 4IXHA 4MNKA 1OK4A 2TMDA 1TCMA 2C0AA 3BV7A 1HT6A 1WDPA 4Y9MA 4YTTA 1B3VA 1BYAA 4J57A 4REQB 3MO4A 1JDCA 3R4IA 4U31A 3V35A 2R91A 1U5JA 3KOZA 1ME9A 1GGOA 3S1XA 2GGGA 2G0WA 1F5ZA 1UKTA 1IZKA 2YQUA 3PZNA 5FJOA 4PR4A 7PTDA 1WDRA 1Z3NA 1ZTVA 3VD3A 1L8PA 4UCGA 3MSGA 2PLKA 1KFBA 1SZNA 3T6CA 1S1PA 2BC0A 3G18A 4JTKA 4X61A 4DHGA 4OGZA 1V6XA 3CUHA 4Q4SA 3V0UA 3T8QA 4PMUA 4MDOA 2GR1A 3HFTA 1J01A 2VENA 3NL6A 3HPXA 4NI8A 1JAKA 3GNXA 3QHOA 2Z26A 4MKNA 3XINA 1V3JA 1C3FA 4LEFA 3H7VA 4QJ4B 5SWUA 2W9MA 4BURA 2TPSA 3RR4A 3TE9A 4JTUA 1I75A 1W17A 4KFOA 4A4AA 4F8XA 5EBUA 3VX0A 2HXTA 1STZA 1T7LA 1TZZA 1LUCB 1B57A 2RABA 2DPEA 1A5AA 3GU2A 4MWAB 1X2GA 1BLIA 4RJEA 1FY6A 3ERPA 3ZOAA 1LRNA 3RITA 1MSSA 2VEGA 3EXSA 4U3AA 3GTFA 1HKMA 4C60A 2JQXA 4JQ4A 2V63A 3G0UA 4NNBA 4W84A 4A3RA 3MMUA 5FF7A 1AQMA 2VI0A 3UEQA 3WLIA 4O52A 3G1FA 2VCAA 1OT2A 3GXPA 3AROA 5AYZA 2OU4A 1C91A 3I4KA 4I6VA 3RM8A 3W1XA 2WVSA 2D0HA 1KCLA 1WO2A 4PBFA 3KWSA 2C1HA 2F7FA 2JE8A 4IT1A 4RV8A 4NSBA 2PGWA 4UZUA 3U0HA 5C8BB 1MDLA 2TAAA 5EL1A 1N8FA 1EB3A 4GIYA 3KBVA 1QI0A 1Q65A 2GWNA 2POZA 3B0PA 2VVSA 3SBFA 4NVTA 4XSMA 4MPKA 4L6HA 1EJ7L 9XIAA 4H9XA 4HCLA 4AAJA 4XBJA 1XH1A 3VC6A 3S5OA 3APYA 2V3EA 4JYEA 1SMAA 4YTUA 4F48A 3TKFA 5EFFA 5LIYX 1DHKA 4Z0JA 2VGFA 3VNJA 1PDYA 1YDOA 2NVAA 4GVHA 1MRAA 2W61A 5CGMA 3N25A 3FDKA 3GDRA 4C6DA 2GQ3A 2PCQA 1IR2A 1XFBA 2DZAA 4AHPA 3MKVA 4MADA 3ARXA 3BOFA 3PY2A 1GCYA 1GOWA 2Z1WA 3ZVIA 1HJWA 3P6LA 2DZTA 2NQ5A 4EM3A 1E3ZA 1KBKA 1VCFA 2CITA 4E2DA 3LZ5A 4GE8A 3HGSA 3Q58A 3M0XA 4ZOEA 4XUYA 4JYFA 1UIPA 5EBAA 8XIMA 1IXNA 2EJAA 5GRTA 3WNNA 3HA1A 4W88A 2D3LA 3LSCA 5J5RA 4M1RA 4O1DA 1NWTA 4CNPA 1PX4A 4DWSC 3BAIA 3WH5A 4HOWA 1JEHA 4HQVA 3IRDA 3IANA 5I78A 3CZJA 4JYDA 1J11A 3HW2A 2WJFA 1KM4A 4RUBA 4RLIA 2FTWA 2CLMA 4PUKA 2JIEA 1C8XA 2ZVIA 4NXSA 3OG3A 4GA8A 2QUNA 4NEWA 2YXXA 3VFCA 2QUTA 1TX2A 1ZY8A 3GLCA 3W28A 1GOIA 3W7PA 1IZCA 3K4DA 1EOMA 1Y8BA 2AGTA 1KW1A 1VYRA 3G77A 2J47A 4YCPA 4LC6A 4ORMA 2PDMA 3PHAA 1JCLA 4D6DA 1DL3A 1LQ2A 3NIYA 5C9RA 4DJEA 1WXZA 5FSDC 4O13A 1TWIA 4J9JA 3UXAA 4F0MA 4A8NA 2OR2A 2VZOA 3I7SA 3HPFA 4IQEA 4Z2JA 2YCEA 3G24A 4HNTA 5A95A 2Y88A 3T81A 3TJXA 2W92A 3VTRA 4HZ8A 1XLAA 5HPCA 3VDGA 4X63A 2V69A 4OTKA 2G97A 4S3BA 1QATA 1A47A 2WWDA 1DPMA 2NX3A 8TIMA 1CLVA 1KN0A 2C14A 1JDFA 1JZ4A 1F3WA 1ISVA 1QPOA 3M7WA 2CDUA 2W4XA 1RJQA 3THAA 2YVFA 2QUMA 4H4WA 1ZKQA 4YL2A 3R43A 1QOXA 3VDHA 2ZUSA 2GOUA 3WL0A 1TYTA 4EK7A 3W85A 3RO8A 4M3PA 3N2MA 4C6NA 2D0GA 8RUCA 2J13A 2CLPA 1D7YA 1GEHA 1SSDA 3MPGA 1NY1A 4JTGA 3VOHA 4DBSA 2Y8UA 3R79A 4MB5A 4KWVA 1E40A 5GJMA 1CGXA 2GLKA 5KEZA 1FWAC 2BOGX 1PZ3A 1GG1A 3MUXA 4C90A 2OFJA 2EQ8A 4CVWA 1G6CA 2HRWA 1GJPA 4JTJA 3NYZA 4UFLA 4REQA 3OIXA 1PKMA 2V0TA 2XWEA 4GJ1A 2QJJA 4WQ6A 4DM2A 4DUOA 5D4YA 4I7WA 2W54A 4D6EA 4L4MA 4CD6A 2C1IA 4LC8A 1GYLA 4YS1A 1F61A 2OZ8A 4HOXA 2Z7KA 2RDXA 4FA3A 1E3XA 1V8EA 3E2VA 2VT0A 1RK6A 4AZGA 4YN5A 3UPMA 3L5OA 1XYZA 1YRRA 3W87A 3I3BA 4FLOA 2V3FA 3GDKA 1PZ2A 3EPNA 4JTRA 3RJXA 2YFNA 1Q85A 4B5SA 4H9YA 3NRZB 3WQOA 1ZAJA 3R94A 5FD0A 1GTHA 1M65A 2PDNA 1G7UA 4DYJA 4DI9A 4M6PA 4NAEB 1LUCA 1XC4A 5A8OA 1XPGA 4JQAA 4R7WA 3W7IA 3T42A 5CAKA 2FVKA 4KRUA 1GRTA 4CEXC 1C8VA 3W25A 3RUBL 3BG3A 4GR1A 3TNBA 3W38A 1NF7A 4S3AA 2WXDM 5AHIA 4RDZA 2ONEA 2VEFA 2VURA 2I16A 1ZSXA 1P0NA 3PWGA 1TR9A 3IWPA 1CB2A 5G1MA 5IDIA 2PF0A 2XVGA 4O19A 5EMMA 5F4WA 3QGAC 4S38A 2RH9A 5CPLA 1NU5A 1VH7A 3EA1A 4UB9A 2X05A 3BQ6A 1SO6A 3FA4A 4NKCA 3IAQA 3QBUA 4XD3A 3CO8A 4FLRA 2E77A 3G1DA 1U2YA 1ZPTA 3PUEA 2OX4A 1JEZA 1T6MA 3FAXA 1H7RA 4U5IA 4IP4A 2GUYA 2VUNA 4MJ4A 1WCGA 4D8AA 1XX1A 1RLDA 1F3EA 4CU6A 1XUZA 5AYIA 2L5HA 4KPRA 2EAWA 3URHA 1E9LA 4CLMA 4MWAC 1X8FA 3NL3A 1DE5A 4WK9A 4WJXA 2CFFA 4HNNA 4AC7C 2V5LA 3UBPC 5AC7A 2RUSA 3I6EA 1JZ2A 1ZJBA 1Y5VA 2PDWA 3ZLGA 4PCFA 1IE7C 3NWRA 4AX6A 3W2UA 3M5ZA 3NPWA 3TV8A 2QGYA 4JBRA 3WD1A 1HUVA 1W5MA 3CPGA 3LPPA 4UTWC 1DE6A 1P0DA 4DUVA 3PTDA 3C8FA 2QS8A 2QJMA 2WZHA 2V5BA 3U2OA 4HP5A 1EJRC 3HPZA 1N7KA 2NZLA 3URBA 3BJFA 4XG1A 4Q22A 4ATLA 1IQ8A 4ZO8A 3WF4A 2YCJA 3C61A 3GYCA 2CERA 4MNJA 2WMFA 1AODA 1UR3M 4S1FA 5JIWA 1XWYA 5FF2A 3O07A 3GAYA 4B5WA 4OFCA 1CNVA 3N1AA 3P81A 4CNSA 4XIMA 3ARRA 1V97A 2D2OA 3W7RA 4IWWA 3SGGA 4C7GA 1AA1B 3CEUA 4LU0A 3MT1A 2ZZ1A 1TQJA 3WLSA 2DZSA 3T8LA 4HZMA 3SJ3A 2WBAA 1BKSA 3UG3A 3LCWA 3N2TA 3LZ3A 3UERA 1UC5A 3EX2A 4WRHA 3EWBX 4QG9A 1LJYA 1YQ2A 2XH2A 5C2GA 1W3NA 5FF0A 2QDGA 4MUPA 3BGAA 4UTJA 4AXNA 2QMKA 2RDWA 3APGA 5CJ5A 2CNCA 3WCZA 3O06A 1JYXA 1KFCA 5EMKA 4KW2A 1EUNA 2YVJA 1H41A 3KVKA 2QUUA 2ZUMA 4OHQA 3AICA 4QP0A 3M0ZA 1KKOA 2WPFA 5JRBA 3IIZA 4ZB0A 4BEUA 2VFEA 5LGXA 1WKEA 1W3JA 3VKBA 1VENA 5AHFA 2EG7A 1G0CA 4WSKA 3GD6A 4HD5A 2PDQA 2YBVA 3M07A 3NYDA 2F2KA 1R3YA 4IF2A 1Z8AA 5H91A 4MNMA 3UR7A 4N9EA 1XLIA 3NVTA 3VOFA 2AQVA 3E1F1 2W91A 4DBEA 2VCCA 3W27A 4JTAA 5C7VA 2IKIA 3TSMA 1N5WC 4RW5A 3EA2A 2PWVA 3URAA 4MB1A 2FZBA 3UXIA 1Z9AA 3LHZA 4WLCA 1PZ1A 2W3RA 4ZB2A 5BU9A 1A53A 4PTXA 5I3JA 1ONRA 4H4TA 1GKRA 5LIKX 4Z2HA 4NAFB 4NZFA 1AL7A 2WYSA 4FALA 3CQJA 4EMIA 2V3DA 1KFKA 5LXXA 3MA8A 4A3HA 3TC3A 3VZZA 3ABXA 4NZJA 1V0MA 4LAZA 5BW6A 3IV3A 2FKPA 3B9NA 3EKZA 1VBRA 4UTTC 2CBUA 2PP3A 4JTIA 4MF4A 3RYSA 2Y7FA 4W9TA 4DPPA 5HQLA 5FS6A 4PMZA 2Y7DA 1DIEA 3DKLA 4HB7A 3FW6A 3RLHA 1NDVA 4ATDA 3BMVA 3OIHA 3BAJA 3KRBA 5A6BD 5HWMA 1CXIA 3BG5A 3GIQA 1JXKA 4G56A 1TJ2A 3VKAA 1MUWA 1WXYA 1AL8A 3LHWA 3VMNA 1QI4A 4DM1A 1BG9A 2DVUA 2XH4A 4GOAA 4IFOA 3WF0A 2E0PA 3A7AA 3OPSA 4JAWA 1BYCA 3A9BA 4JQ3A 4B90A 1TV5A 1V3IA 3VIPA 4LALA 1T96A 2VR2A 4IP7A 3D47A 3PTQA 4PUWA 1UH3A 1KV8A 1OX6A 3EBVA 2X2GA 1XLGA 3WDPP 5C9WA 4V27A 5AYBA 2VFDA 5DMNA 1A3WA 1XIJA 2E28A 3OB8A 1DWFM 2PE4A 3BZJA 3EOLA 1JCYA 3DKJA 3SQMA 3CH0A 3O9NA 4PL2A 4QS6A 4UR8A 4HJWA 1UKPA 3WLLA 2IKJA 4B4HA 4NNCA 3W0KA 1SUXA 3PWAA 4D8ZA 1VBGA 2V82A 1KD0A 3KTCA 1JZ5A 2OT0A 3B05A 2J8TA 1QBAA 2PLCA 2PDFA 3TXVA 3ATZA 1X1NA 1PUDA 4AUBA 1TVNA 2DSUA 4H2CA 3VI2A 1QNVA 2GGEA 1EGVA 3FS2A 5K3VA 4ZOBA 1MVYA 2XH0A 4ZTXA 5BOFA 3M0HA 3TTEA 3IK4A 5CKSA 4FO4A 5C9XA 4NYUA 3KTXA 4E8CA 1BXBA 2XGIA 3VVGA 2GQ9A 2UBPC 1ITXA 1RCQA 2NUWA 3ZS4A 2YA2A 4AEFA 2WOQA 4HA1A 1E4IA 2JIWA 3MP3A 5KVHA 4GYPC 4IGMA 1R9YA 2VEIA 2GH5A 3TSBA 3MZ2A 3TU9A 4G6CA 3W1NA 3F2CA 2PCEA 1OGGA 4JTDA 2CZ5A 1EXBA 3E5BA 3VILA 5CSUA 4PE8A 3LBCA 3FFSA 4Y8EA 2GSJA 2VC5A 4UOQA 1RY0A 4JIIX 3L0GA 1RLCL 2BNJA 2BG5A 4A8RA 4P8VA 4JTEA 3I7QA 1M04A 4ZB5A 5AVHA 3NUKA 4AVFA 4LNCA 4BWLC 4FXSA 2IKGA 1SFTA 2WNWA 1OGSA 4OBTA 4RZ5A 4JL1A 3SUSA 1ITQA 3U8GA 2QF7A 4Z2GA 4JCLA 4R9XA 3SCPA 2F5ZA 4JZ5A 4M81A 3LHVA 2Z1KA 4N9DA 3RM9A 4PRRA 2QCGA 4O0KA 4XZBA 2R14A 2YDSA 4FHAA 1M03A 2WQDA 5FACA 3K30A 4WR3A 3IVUA 2PDUA 3RX2A 3NQVA 3W86A 5A3HA 1TX0A 5FESA 2QIIA 2FZ8A 2J79A 1QK2A 3B8IA 1YE6A 3ITTA 1I4NA 2X0SA 1XISA 3STFA 4C1LA 4L9XA 4CCZA 1XIEA 5E0FA 4GMEA 4H41A 2D3NA 1VJSA 1NHSA 1FCBA 4UC5A 4LVBA 4J27A 3UY7A 1KR0A 4MWAE 4DZIA 5CPSA 3QR1A 1UCWA 3NURA 3DI0A 3B8DA 2VCBA 3B97A 1WA3A 3PUOA 1C9WA 2ZZ5A 5U7SA 5IHRA 1I2QA 4AZCB 2PFHA 2GJRA 4GVFA 4IIDA 5HQEA 3GIPA 3WN6A 3JR2A 3EWUA 1CYGA 1H1YA 1AJ0A 3WBEA 2HMCA 3ZLFA 1S2CA 2FDMA 4PBEA 3N6QA 3P67A 2Y24A 2DY3A 3N34A 3FG2P 2PDPA 1GVIA 1ECEA 5D2YA 3F2BA 4MNLA 3UT0A 4J3SA 4LX4A 4AWTA 3KAOA 4J40A 1V03A 1ENUA 4HPHA 3VCRA 5A6KA 3ECQA 3ZT7A 1HP5A 3KW3A 2HCVA 4FP1A 3AU6A 3LBOA 4D6HA 4GCAA 4GJIA 2GVLA 1IIGA 1P6WA 1SW3A 3V1HA 4YVVA 4NT0A 4K37A 5TNVA 4AEOA 4CQBA 1XH2A 1G5AA 3C0JA 2ZBTA 3SUWA 1JZ7A 1XKJA 1PKNA 1W91A 4J2PA 1KGXA 2QVHA 4O4VA 2FIQA 1BVZA 5DY3A 2OEMA 2XFWA 3F7JA 2PUZA 2WM0A 1LL7A 7ENLA 4Y90A 5E6ZA 1M6IA 4KWUA 4HYWA 2C3DA 1S5TA 4LIIA 4TO8A 1Q7MA 3JU2A 1NARA 4KERA 3EAUA 4Q4PA 4JQ1A 4ZGYA 4GGHA 3E0FA 1A5BA 3WQ8A 3N18A 4JL2A 5GNZA 1OY0A 2VYOA 1E6RA 1ZDLA 2EHHA 3REQB 4UZSA 5LNVA 4L9ZA 3VGBA 1FDZA 2CLEA 3LGEA 4PFHA 2E6DA 1WZAA 4I5UA 4Q6XA 1US0A 2HPIA 3SECA 1XIFA 3VIKA 4E5TA 2PWGA 1OBAA 4OUIA 3UWYA 3R13A 3SO7A 1Q6LA 4BF5A 3GR4A 1OCJA 1CGUA 1DJNA 3G0XA 4PODA 5EMUA 4RXGA 1UHVA 3EB3A 4MZ8A 1TRIA 3KL0A 4ZQMA 1HJXA 5XIMA 3LS9A 1HVXA 4GFIA 4UWMA 3DBNA 2GGHA 3EX6A 3ITGA 3L4TA 1M6JA 4GI4A 3UJ2A 3E9AA 4BQ3A 2NW0A 4XAPA 3HBLA 2KZHA 5K9CA 3E2QA 1KM1A 3BW2A 3CWHA 2R8WA 1JUBA 4G1NA 2R9RA 1GHSA 4ZSUA 2V2DA 1LG2A 4UQBA 4PMYA 3GHSA 4DI8A 3WFZA 3SGUA 4GY7A 2GVEA 4FNRA 3A6OA 5D9PA 1Z44A 3QGKC 2TODA 5RUBA 4DJED 2J7HA 5A8PA 4C91A 4HNOA 1VCGA 1JIBA 5HANA 3IS4A 4HSOA 1B3OA 1UMYA 3AS3A 1Z7AA 3BLLA 3H2CA 5LNRA 1U1JA 4G7EA 3M0MA 2VOTA 1YE4A 2VOMA 1WDWA 3AXXA 3WJWA 1SFJA 1TYGA 5HWNA 4Q3MA 4MOZA 2QCDA 3DHDA 4PA8A 4H8UA 3WEOA 4LY8A 2ZRUA 4AZ5A 3SCSA 4AMCA 2DUXA 4BEQA 1W9BM 3ABQA 2Q02A 5C5YA 4R27A 2E5BA 4F0HA 1EX5A 2D23A 1QR7A 2QPXA 2ATSA 3PG6A 1SZFA 2IUZA 4F9JA 4IGHA 3S6TA 3NFUA 3P8JA 3W1QA 2QNEA 1F6KA 3PN8A 3S9IA 3MBFA 1VQTA 3E6EA 3KVMA 4PUDA 4QGCA 3GR7A 3NA8A 4UMAA 1JYWA 1Q66A 1GWJA 3NZRA 4JTHA 3LPOA 3CUIA 5BXPA 5M1TA 1M68A 3VNLA 4M19A 1PIFA 4Y2WA 3DG3A 4IMCA 4W87A 1BWKA 1ADOA 4RDYA 1SJAA 4UOJA 4ROPA 4DNAA 3W7JA 2VWSA 2WPEA 1OZMA 3EOUA 2ZZCA 1H11A 1RZMA 2YJQA 1IZJA 3RO6A 3SUTA 3CPRA 3NPUA 2CHRA 3IUDA 1XLJA 2QT3A 1EO5A 2DFAA 3DK9A 3PP7A 4IMGA 3DN5A 3EMZA 3CASA 1UZ1A 1W6TA 2PZ0A 4CU8A 4S3JA 3EOEA 3LCHA 1UASA 1JFXA 1T3QC 4ALDA 1UOKA 1XG4A 5T8GA 2WBGA 5H8PA 2WSQA 1OFQA 1RQBA 3WUFA 5F2LA 3W82A 4PCSA 5HNRA 4L61A 3C2YA 1YPXA 1JF6A 2ODOA 5A8QA 4HJFA 3EKLA 3L68A 7TIMA 3FSTA 1UQZA 3DIPA 3HPAA 2GSEA 3S2MA 3AIRA 1IT7A 4EP8C 2HSAA 4GX8A 3E2RA 3OJGA 3CL8A 1W1TA 4K8HA 4WVXA 4C1NA 1UR0A 2WKLA 1JL8A 1AH0A 4QSFA 3CAQA 1EP3A 4LV4A 1KTBA 2VRQA 4QROA 5M3WA 1GONA 1IXQA 3RX3A 1TE1A 4GZ7A 2X99A 1V0LA 4GO8A 2YYUA 4BI6A 1XF0A 3EEZA 4D72A 4JGDA 1GRFA 1ADSA 2XPKA 4GISA 4BF7A 4I6KA 1EL3A 3E3HA 3LMYA 3B8WA 5I2UA 1LTDA 2XG9A 1CEOA 4CQ8A 1E73M 3F4NA 3ARPA 4FZIA 3W1LA 3CS2A 1M53A 4APNA 1GEUA 3H2MA 4A2SA 2OWXA 3M44A 4ASTA 5HWJA 4JKMA 2BP1A 4MM1A 1RK5A 3KBMA 4DWDA 4GC4A 3C8NA 3DEQA 3B0YA 3AIQA 2V81A 1V6YA 4UIOA 1EJWC 3MV01 2BLEA 1J6PA 3SUUA 4CEUC 3JZUA 2C19A 4K7VA 2DUAA 3NL5A 1TB3A 5CSYA 3TROA 4E2VA 2GQ8A 3N29A 1KWGA 2YOCA 3ARZA 2XSXA 3A9IA 3TA9A 2O4MA 2YCLB 4JHOA 1OFRA 1DIOA 1DJGA 1GVQA 3AXKA 4BS0A 5CBIA 2VM8A 5EYWA 1DWAM 2IQTA 4JIRA 1L8NA 3CM4A 1FEAA 2Z28A 3R0UA 3L4UA 4F2TA 2C15A 1GG0A 1GXFA 5E9AA 2PP0A 3FY1A 4XBSA 1XYCA 5DCBA 4GUGA 1Z41A 3Q2DA 5KZ6A 4RNFA 1QTWA 2VHLA 1M5WA 1H51A 5CC6A 3W2MA 4DYKA 4IPPA 2IMRA 3UCQA 1BKHA 1A3XA 3FEQA 3KXQA 3GDBA 3W71A 2D24A 5A1AA 1YTKA 4DJDC 3FKRA 5I3IA 3GH5A 1JCJA 4OV9A 3TFCA 1K9TA 3WLQA 3R2GA 5LNWA 3W00A 4HPNA 4LV9A 1E6PA 2QIWA 4XQ6A 3UZWA 3UZ5A 1LWHA 2C79A 3BMXA 1EHAA 2I5IA 3GK0A 1TZ9A 1W1PA 3QEZA 4JN7A 5BYWA 3B8SA 3OC4A 1YNYA 4B2DA 3IPWA 2EPOA 4IX2A 4LAUA 3H26A 1XYBA 4W85A 1EC7A 1OSEA 2E4TA 3MHUA 1E0XA 1PIGA 4RCXA 5M2FX 4N6FA 3ZSTA 1P48A 3AOFA 4QDPA 1DJXA 3KLKA 3GNOA 4Q8MA 5DXYA 1QW7A 3LGGA 2Q8LA 1YNQA 1QUMA 1E1EA 4ONVA 3WK0A 3W2JA 2A1YA 2CBVA 2XWDA 2WCSA 5LIUX 2J78A 4JDRA 2GRTA 1TPWA 5DRCA 3H2FA 4S2CA 4DQWA 2P0OA 1HO1A 3OODA 2FHBA 3UJRA 1BFNA 1XIGA 1XRFA 3A4JA 1GVEA 3AYRA 3VNZA 1DHPA 4HMEA 4L4OA 5D03A 1P1MA 1Y0EA 3EB4A 1XYLA 3QSTA 3PBVA 5CGTA 4LS0A 1EBDA 4W7VA 3PB0A 3AUJA 5U1OA 3G3MA 2R1KA 1RBAA 5AC8A 3HV8A 1JCTA 4W86A 1TQXA 3IGUA 2OTDA 4YWIA 3SIMA 3LRKA 1JI1A 3QZEA 5G2WA 1FHDA 2OEKA 1X7FA 3PZQA 1JRBA 5K2ZA 3V7PA 3N2XA 4CKQA 2R1LA 1L6GA 1I1XA 1UD3A 4LUTA 3TYUA 1ITCA 3VDBA 2QULA 2XN2A 2HE8A 4GACA 3WLRA 5AHNA 4A8IA 2WZEA 1NWUA 3NZGA 5CG7A 5CJNA 3WMSA 3L4WA 3UD6A 2AOSA 2ZX9A 3VD5A 1LF1A 4GUFA 4H04A 3B8VA 2Q01A 2D69A 3SCOA 1WKDA 4WXZA 3L23A 2EQ6A 3DC0A 4TU1A 5JU6A 1LORA 4DPQA 1ISWA 3VGEA 3QQ1A 1D3CA 4C5YA 3GH4A 4KGJA 4W7UA 4Q4RA 3NQEA 1F3TA 2E6FA 1S5NA 1AW1A 2NQJA 2ESCA 2WLYA 4ZQPA 2ZTKA 4GRSA 3MANA 1GJWA 1R3QA 4EMWA 3A3WA 3LADA 3M5VA 2X8CA 4MMWA 1QNOA 1YXDA 4C7FA 2EG6A 4LVDA 2PGEA 4YTRA 4B16A 5JH1A 4EWND 1NDAA 1O5KA 5D38A 2GFTA 3R8GA 5DY2A 2EEXA 4K8EA 1B4KA 2OO0A 1EA9C 4UQEA 1VEOA 4GGBA 3BGGA 2WHJA 1S2VA 1QXLA 3A7UA 1AQ0A 1HQTA 2ZRYA 1UW9A 4D71A 3EB2A 3BSGA 5MF5A 1WZLA 3C0SA 3NAVA 3ZWTA 2YA0A 2PTZA 4A3QA 3AMKA 2O56A 1R87A 1FIQB 5FEWA 2J4GA 3CUXA 4OOZA 3DK8A 3O7UA 3PANA 3KZSA 4DY1A 5DELA 4DX3A 2VQTA 2GR3A 5JIPA 5LHEA 1JZ8A 3TP4A 4UNIA 2DVXA 5L6UA 4V28A 5K7JA 4TOQA 4A8LA 3PULA 3S47A 2CIPA 3GM8A 3CU2A 3GE7A 4E0CA 4R7OA 3W7QA 4LQ1A 3EDFA 1P43A 4LYRA 1KRCC 4H4UA 4O12A 2YCLA 3IVSA 3L5LA 3GW3A 1XLEA 1K03A 3CWNA 4H00A 1ZB5A 3EWYA 2D73A 5F2GA 1ISZA 3JRKA 4HHHA 3AJXA 2VX4A 2CLKA 2BXVA 1NDYA 3GVVA 3ZJ8A 4E3VA 4HHMA 3OLGA 4KRZA 1RY8A 3WQPA 3DK4A 2PSNA 3OA5A 3CAVA 1H4PA 3SURA 1H2IA 2ISVA 4ZL1A 1BSLA 2ACUA 1JG9A 2DZPA 3MP4A 3KHJA 3NGFA 3GKFA 2WO5A 4PULA 4QNWA 3SW6A 1VJIA 2E09A 2UZ9A 1GW9A 1TPFA 5AB3A 4X0VA 1UG6A 1LDCA 2PDBA 1Y65A 2WZMA 4IH3A 1K8YA 4PZVA 4EXBA 4RR4A 5I07A 4AY1A 5G5HB 2UY4A 5CH9A 2ZWYA 2C13A 4EE9A 1Q6DA 2FVLA 4IJBA 3AYTA 2P1FA 3WBXA 3S1WA 1US2A 1K9DA 3VUSA 4BF9A 1Q3NA 3CQHA 3TQ0A 1UUMA 1EIXA 1W56A 4UQCA 3GHRA 3TZFA 5AHEA 3CXOA 2XN0A 3NO5A 2AKMA 5D2WA 3F5KA 4AFYA 1FHVA 1J2WA 3LMZA 2CXGA 2R24A 1W1A1 3P2VA 3GYEA 1FUYA 4TVYA 4AZ7A 2NUYA 2YXGA 5JCNA 2Z0IA 4FEZA 3DI1A 3A21A 2CLFA 4D6FA 4AD5A 5D02A 2YLAA 4JTQA 5DBTA 4GFSA 4DAFA 5JH2A 4ADWA 3UZZA 4YHGA 5J5DA 2OSXA 1ZGDA 5M17A 2DORA 1XBVA 3HGOA 1UWAA 3TZNA 1UD5A 3BANA 4AG0A 2BB0A 2C8NA 2P3EA 3QMTA 4X3ZA 1JYNA 1VAHA 2F38A 5EGRA 3LCFA 3IGSA 1PYMA 1HJQA 5B7YA 3K1GA 3II1A 4FR1A 3K8MA 4F9DA 2YDQA 4AXKA 5D09A 4WDTA 4ZBCA 3NZ1A 3THCA 1Z32X 3NZQA 2P5NA 1H62A 3DFOA 3MWAA 3CZKA 2G3FA 1ZNNA 1A5UA 2WZIA 1K1DA 2QF8A 3VA8A 1LL4A 1NM9A 1DWGM 4QCEA 5A8GA 3POHA 4N42A 2ZYFA 4HA0A 3IJQA 2OQHA 4ES4A 1OCNA 4X2RA 2FGLA 3WD4A 1W9UA 2RJGA 4HTBA 3AUOA 3SEPA 4IOTA 1UWUA 1TTIA 1GOOA 3RILA 4AD4A 1E43A 4EXQA 1UYQA 3FHQA 3UESA 2XISA 1JZ6A 1GORA 4CCCA 5KSWA 1WV2A 2JEPA 3PAJA 1ZK7A 1ZL1A 3E74A 3MV11 2YL6A 5CEWA 3AIEA 3FJNA 1EYWA 4H7CA 4QFUA 3UWUA 2NVDA 3CT2A 6PTDA 5HATA 2ZXAA 3MC5A 4O1AA 5D9MA 1T99A 3UJFA 2F2HA 3BTNA 6REQB 4GKTA 3P0WA 4W93A 4LCSA 4TV6A 3AMDA 1WOAA 1F2JA 2GGIA 4PMOA 3M46A 1LPFA 4GLEA 4FSAA 3WH7A 2A6NA 2EG8A 2PDCA 3IJ7A 4PMNA 1UJQA 2P3ZA 1U83A 5H1WA 4MB4A 3MZNA 4M6QA 4ADUA 1XM3A 2ZZ7A 2FZDA 5CXPA 2HISA 3BUVA 4XV0A 2XIQA 1O5QA 2W67A 1XICA 3ZR4A 3PBUA 4MDPA 4XUGA 3N2OA 4UBPC 4GO9A 4E8DA 2Y61A 5LGZA 4CGTA 4TR9A 1Q1RA 1JDEA 3IK2A 1ESWA 1R3VA 3NEVA 2X40A 2OG9A 4XZHA 4DRSA 1AD4A 1OX5A 4ZMGA 1IWBA 2VL4A 3SCNA 1F73A 3UZYA 1X38A 3AYSA 3TAOA 2HNEA 1JGMA 3IIVA 1PBGA 3SCTA 1H60A 2BVWA 1QDSA 3DESA 4XIAA 3TSDA 4A3UA 3ITOA 4MJZA 3UXKA 5CC5A 3H22A 3WUEA 5ABFB 3NGJA 2WOVA 4J3VA 2ZE3A 1KXQA 4KCUA 2E1DA 5REQA 2W0HA 1HXJA 3PFRA 4QCFA 1FWIC 1UR8A 1PXGA 3ZJKA 1TWSA 2VEPA 3Q4DA 3VXGA 4JQ2A 3DX5A 3R0KA 3TMQA 1RVGA 2FPTA 2AL2B 3AHXA 3BVJA 4UR9A 3IACA 3F4DA 1UB3A 5K4ZA 4AWEA 2ZUUA 4EQXA 3TUUA 2DJLA 4D6IA 4IG2B 1PO9A 4GNJA 4L80A 1KLYA 1VS1A 1TRDA 1G69A 1FH7A 5G5GB 5TF0A 1G4EA 3LOTA 2Z24A 1V3HA 5A69A 1GRGA 1FOBA 2H8ZA 1GVOA 4QJ3B 3HO8A 4DAIA 2E40A 3L5MA 5KTLA 3C2EA 3DFNA 2DGAA 3TFXA 3TYEA 2PLMA 3CLWA 3FJLA 1CIUA 2BZNA 2AQWA 4O54A 1J0YA 4KEUA 3NSNA 3FA3A 4Q8UA 2WK2A 2E5DA 1YPIA 4QM1A 4F4RA 1ZX9A 3HQPA 1OCBA 1Q13A 1B9BA 1CWYA 3ZZ1A 4GH3A 3MHGA 2WC3A 1ITUA 4PN2A 4K8GA 1ZALA 3GVRA 3GY1A 4NZ1A 1S3HA 4KPLA 5FI8A 3Q37A 3W1RA 1FP9A 3F03K 4LUIA 4U2ZA 1RQEA 2EJ1A 4FXFA 4D6JA 4HOZA 3CZEA 4AYSA 3FK4A 4P7RA 3WUBA 3SIZA 4NJIA 1XBXA 4IFKB 3SR6B 3WLMA 2E68A 1XGDA 4U3CA 2Y62A 2FFCA 5H8MA 1XQKA 3V3WA 1MO9A 4PRTA 3W24A 2CLHA 1U1UA 2ZRZA 1O5RA 3BXWA 2JEQA 3S9ZA 3T78A 4FLSA 1KBJA 3WLOA 2OZ0A 4LWWA 3W6YA 1KCKA 3RXZA 3G8EA 2B81A 3LNMA 2V5KA 3ZJ7A 5B80A 1SZEA 4IJRA 2NUXA 3E12A 3VO0A 1XH0A 4QHRA 1HJUA 4F2BA 3TYZA 1YXCA 2E67A 1MEHA 2GUUA 1CXKA 3QPEA 1YX1A 3NPXA 2ISWA 4F40A 5F2MA 3UA4A 4H6KA 2EQ9A 2PRHA 1OQFA 1R9XA 1K4HA 5FF4A 2CLOA 1VDVA 3L12A 1W2PA 4O1BA 5DQPA 2ZQ0A 2J9ZA 4RV3A 1NEYA 4WGXA 3T0TA 1ZJAA 3VFLA 2GQAA 1LYXA 3O15A 2P10A 4C6PA 2FZ9A 1LLWA 4KMQA 4RW3A 3T07A 3H4GA 1G4SA 2QKFA 1IEQA 1ZLPA 1YHTA 4HA3A 2FGBA 4GHRA 4J2MA 3CV7A 1TV4A 5DCDA 2VZTA 3S4TA 4PCNA 1OD0A 1TE6A 3P60A 3F2DA 1KFEA 1ME7A 4IIGA 4KESA 3AALA 4BK9A 3SAZA 3PWIA 1IEIA 4RE4A 3P14A 3NVZB 3AMCA 3DXIA 4W7WA 1MQQA 1EZWA 4ROQA 3M9YA 3GH7A 1UWSA 3HFYA 3P62A 5FJUA 2ZWZA 1KM2A 3T7VA 2Q3RA 2O55A 3UVAA 3LI1A 1CENA 3T55A 2I9EA 1GW1A 3IIXA 1VBJA 1UZHA 3WMCA 1EPXA 4TXEA 2A3CA 1UUOA 3V18A 3MDWA 1LOLA 1QPRA 4JDBA 3W7OA 3GRIA 2GQWA 2YB4A 2OB3A 4GNKB 2CZDA 3TN4A 4JY9A 4OV4A 5TBOA 3WLJA 6REQA 2G4JA 3L0KA 3FNDA 2R9ZA 5I02A 2EGZA 1ZP4A 3UG4A 3TQPA 5FCZA 3UJEA 2ALRA 2GZXA 4AVNA 1QRQA 3KVLA 4K7ZA 2ZE0A 2R1MA 1TIMA 3QYSA 2A2IA 4Z08A 3JW7A 1QHPA 4XK2A 1FH9A 1H7PA 1FA2A 5ECUA 3D9XA 3ZM8A 2C71A 3QF0A 3MUCA 4HK6A 2VXNA 4L1WA 3WH6A 4J35A 4RDVA 3MMWA 4FB7A 1EX1A 4E4UA 1BTMA 2OELA 3M43A 3QPZA 1OFAA 4V15A 4RDWA 4IPNB 3RPMA 7A3HA 1LOQA 3LQLA 4H9MA 3LTYA 3NOEA 1HKKA 4NEVA 3RRXA 3N12A 1L6YA 4XWUA 1BSIA 4F0SA 3SR7A 3AQUA 5D2VA 2UV8G 3W1AA 1ODZA 4ZQNA 4TX6A 2W6RA 1XINA 1F4AA 4NP7A 1V5XA 4UFIA 2QCEA 4BZYA 2G3MA 2RGMA 3C3NA 3L9CA 4L1XA 1OEPA 2WJDA 3EGJA 1YTDA 2HNHA 3SSZA 5BZAA 2J7BA 2WCGA 4W8BA 1FWHC 3R10A 1DJZA 1BVNP 3FYOA 3NCOA 1LLZA 4GXMA 4BQ2A 4H4PA 4EIVA 4B2DD 4XSLA 3SCQA 1NHQA 1SYTA 5U4NA 3LPGA 4B92A 4MAZA 2QXWA 3A13A 4Q8PA 3R1ZA 2G3NA 2DZUA 1PE1A 1P0EA 3HJZA 3W22A 1PZ0A 2WJEA 1K8ZA 2DH2A 2Q09A 3OU8A 2AL2A 1DJQA 4WY0F 1QFEA 1OFDA 4P7OA 5K9XA 3T1GA 2J66A 3MCNA 3LBMA 3QH2A 2FJKA 2OX1A 1S38A 1CZ1A 3EPMA 1KV5A 3I6TA 3DERA 3C3UA 3TWAA 5FJTA 3F4CA 2X8HA 3NQ2A 1RP8A 3FGCA 5HMSA 3Q45A 1QOQA 2HK0A 3B0VC 1K4GA 4JTSA 4I9JA 3ELFA 5DXXA 2ZX6A 3B9EA 5A6LA 3NDYA 3N04A 5E09A 3CAKA 1W31A 3GKAA 2QCNA 2ZC1A 1LP6A 4TMCA 3S6OA 1D2KA 5J8LA 4J28A 3ARVA 3UG8A 1OM0A 1HKJA 1NVMA 1JQXA 2BOEX 1TTQA 3G6MA 4FNUA 3VOJA 3OZMA 4CCDA 2CC0A 3ARUA 1WNOA 4WCJA 4GUHA 4WJEA 3UW6A 4YU1A 3W2LA 4NZ5A 1KCZA 1YPFA 4Z1BA 5HJLA 1DBTA 4IM4A 5IXEA 4IFKA 2ZVRA 5C7HA 1ZMDA 1TKKA 4YYFA 1TZ7A 2DUZA 3E0IA 3IJ9A 4L9YA 4K68A 3CLMA 1W1ZA 4QDMA 4NJHA 1KRBC 4JTTA 1WP6A 3O1NA 1NOUA 4FXRA 3L4XA 3TIMA 3VX1A 2X30A 2YBUA 4WX2A 2HDJA 5KVIA 3EMQA 2EPHA 4M7TA 1K02A 4WKAA 3UWVA 5U25A 3V16A 1QNQA 1BRLB 3K4WA 4NIRA 1VFLA 2G8ZA 5HULA 3VABA 2ZOXA 3NVVB 5D2TA 1XV8A 1FXQA 3A12A 1YIXA 3TTQA 2YW4A 4C65A 1F8WA 1Q63A 4M1BA 3FEMA 1FFRA 4PUUA 4HMDA 2WANA 5CSSA 1XLHA 3C0QA 3C0LA 4GIRA 3GG1A 2VELA 3KS6A 4HVXA 5JCMA 4F3HA 3LDVA 3F1QA 5A8NA 2RFGA 1VD6A 4FI4A 4DNMA 2PTDA 3L2IA 1MWOA 3HV9A 1KKRA 1V59A 2B7QA 1QAPA 1XBZA 4PCTA 3OZYA 1RXOB 2P88A 5M03A 4PSRA 4ADTA 3P5YA 3PBWA 3PSWA 3AZRA 2CEQA 3MVIA 4H4RA 4IGSA 3JZEA 1W3KA 3HG2A 3SCWA 2DVTA 4ZE5A 1MQRA 1P6CA 1GHRA 2AAMA 5AZ1A 4FF5A 1EXPA 1W9VA 2HQAA 3LERA 3LB0A 5G4WA 3KBSA 2I9UA 4C6BA 1JD7A 2JGQA 2DSWA 4XTDA 4KGLA 1LBLA 2OXNA 4P61A 1TJ0A 3EWWA 1SJBA 1MRQA 3HU7A 4OU1A 3VMPA 1C8YA 4O0ZA 3KRZA 1WQ5A 2NXHA 4ZR8A 4F0KA 4IZGA 1HGWA 1GNXA 5CPTA 3C2FA 2PAJA 1WUEA 1LROA 4Q33A 4AX7A 2PTWA 1GSNA 3Q94A 3J7HA 4IISA 3B4UA 4GBDA 3GAKA 3MS8A 4U4MA 2A7NA 1RR2A 4YIWA 1WDDA 2J7FA 2DH3A 1CTNA 5T26A 4H6QA 5EMLA 3QTPA 3WL1A 3SN4A 1QASA 3C6CA 1NIUA 2X41A 2CHNA 3BMWA 3GC4A 4N0RA 1JYVA 1TWWA 3QQWA 6ALDA 8CGTA 3W6MA 1SZGA 7ODCA 4G5DA 2H9AB 4UXDA 3T44A 3MYPA 3TTYA 5LA1A 4KEVA 1JCMP 1XXXA 4R7JA 1FFQA 3GBEA 3KVJA 3S42A 1SJCA 5CQ1A 3URNA 3TTOA 1GKQA 1R3TA 4NI3A 5K9DA 1HJSA 1E6XM 4PMQA 3RPTA 3WFAA 1G9HA 1A5KC 2A3EA 1VIWA 3QC0A 4I3GA 4QQ3A 4DO5A 5G1YA 1XLBA 3BAWA 4L4PA 1H0IA 1MNZA 3P3BA 1UMLA 3GDMA 1OADA 1ZZMA 3MQTA 4I90A 1EFZA 3IEBA 1H1ZA 1IEVA 2VMFA 3B9DA 4R5EA 5G5IA 3MTWA 3DFTA 5HXMA 3LEPA 1UA3A 4QG8A 5F4XA 4PB3A 4DF0A 2D2GA 2PF8A 4DWSA 2DP3A 3OQEA 3UPWA 2C1GA 3LLFA 2OSYA 1NFGA 1OB0A 4YPJA 3FCPA 3D46A 4GQ0A 4PC8A 2W27A 4WKFA 1GVYA 4C7DA 3TCSA 4EPDC 2JBMA 3NQDA 4XO6A 2VGIA 3OP2A 1UWRA 3AIBA 2ISDA 3KM8A 3H4WA 2ANUA 1Q2SA 1E4LA 2TYSA 3L0NA 2HZGA 4KFPA 4MAVA 2O9PA 1CGVA 3TLLA 4WZHA 1BD0A 4ORIA 1J93A 1SSGA 1JGIA 1W1B1 3B04A 1IF2A 5C70A 2QZRA 2WP6A 2J7EA 9RUBA 1BWLA 2WMHA 4IQLA 4YCOA 1JF5A 4LS1A 4Q8NA 3AFBA 4HHLA 2PODA 2E6YA 1EC8A 4LF1A 2GJXA 4Z1CA 3TN5A 1DORA 2ZTJA 1J79A 4O1FA 2GR0A 4R33A 3VGGA 1P7TA 4DBDA 1VYPX 3M4HA 3C2OA 4AZIA 1E6SM 3MI2A 2IQ0A 3TEVA 4GD0A 1A50A 1OFPA 1GJUA 4ACZB 3BAKA 2CBJA 1E6ZA 3C2VA 5D8WA 3VNIA 4AD3A 3WNOA 4PL1A 1R0MA 2F9RA 2HK1A 2HTMA 4INFA 3Q6JA 4E3TA 2Y4SA 4B5VA 1V79A 3KBWA 2EXOA 2DSKA 1OD8A 4MKVA 5A8MA 1UH4A 4PMDA 1Q5MA 3SY8A 2OGJA 2ZC8A 4MSSA 4QEEA 4LCQA 2A7PA 1VFMA 2NV9A 3OGVA 4ZZ9A 1TMQA 3M7SA 4IJCA 3IC9A 1OF6A 3NVDA 1F6PA 1TVLA 3M47A 3TOPA 3KEHA 3U2ZA 1HP4A 1UP0A 1CPUA 1DTNA 5KZEA 4QAIA 3NPVA 2C6QA 5DMMA 3P61A 1VFOA 3VNYA 2BGNE 1XS2A 1I2OA 2XGBA 2OCZA 5CGQA 4PUJA 1CLKA 3E38A 3WQEA 4LH8A 1YMYA 3XISA 4M80A 5AZ0A 5C6MA 3OYXA 1J2BA 3UXDA 2NWRA 1GQLA 1H7NA 2WPBA 3K46A 2D20A 1JUEA 3CGCA 3G1HA 4HU8A 2I7GA 3ITYA 4BI5A 4GH1A 2FZNA 2DSZA 1GRBA 3A64A 2HEJA 3OVPA 4GXWA 1PKLA 1W8GA 1MW0A 1LRQA 2OVLA 5I0DA 1DQWA 1N62C 3GNNA 5DFAA 1TTPA 1VCVA 2FB3A 2DIKA 4FX6M 5HBFA 2OEJA 4V1XA 5CLWA 2HROA 4BI7A 1NDWA 4WKHA 4XVDA 1ZRQA 5KINA 1KGUA 2F6XA 1KFJA 2EPLX 4MZ1A 4AF0B 4ENLA 3ENLA 1LM1A 1BG4A 5DF0A 1GK8A 4DN1A 4AIBA 2FYMA 3OO2A 1FCQA 1RV8A 4PH6A 2ZRWA 2VFHA 1XYMA 4WOQA 1ZBVA 5FS7A 3R6IA 3BAYA 2FZMA 1LQ0A 2FPYA 1MI3A 2WC7A 3L4ZA 3O0FA 4GX9A 2WV8A 2R1PA 4FNTA 5I7GA 1S46A 2VZSA 3I3EA 1FWBC 3BZGA 2V6OA 2GWGA 3N17A 3Q65A 2IPFA 4JHZA 2O9OA 2RKXA 4Q7IA 3FXYA 3T2QA 4RX0A 3CYVA 1I1WA 2NX9A 2VZUA 2ZDRA 1O6IA 1CXHA 1KFWA 1LWIA 1THFD 4LS2A 1E9ZB 1NF0A 5CZKA 1G4TA 1UWTA 1AFSA 4LOCA 5JCKA 1I0BA 5HNTA 4LAOA 4HKPA 2VDHA 3PSVA 2QCHA 1REQB 3SSJA 4ZO9A 1NWRA 5KMYA 3OQ8A 2EKGA 3N4AA 3NVWB 3FYPA 3S1GA 5DMYA 2OYMA 3QGVA 3UWQA 2QLYA 5FL0A 3W84A 4I8YA 2NSXA 3RDKA 5CC7A 3BLKA 1J0IA 1TO3A 1IT8A 4LANA 4WDWA 4GCXA 3A5FA 2Z27A 3G22A 5HMEA 3FSUA 2E3ZA 4WOZA 4NU7A 1F9CA 1Q4WA 4MWAA 4GQBA 3TN3A 3NM1A 4IQDA 3GFXA 3AHVA 3R25A 3B9JB 4QRNA 4EAYA 2HXUA 4F66A 1VFSA 3WY1A 1UR9A 4XZMX 5GJPA 3ALGA 4LB3A 4Q32A 3ITLA 5E93A 2QAPA 4UTWA 1I6NA 1A5CA 2FPVA 4NRRA 2ACQA 3GXMA 4JIPA 5AVNA 1FFVC 4D1IA 1Q6OA 1TPH1 3VE9A 1OFBA 3ZT6A 4NL1A 3UCDA 2PD5A 1YDVA 3BE7A 5J04A 2IPJA 3GNPA 3KL5A 3OZOA 2JK2A 3RAOA 5I06A 1ZXIC 2E3TA 3V4BA 4HIBA 1XIDA 3PR2A 4F2UA 1TR1A 1TV3A 4GPNA 2XZ7A 2E9LA 4LBUA 2VO5A 4JXCA 5HK4A 2QGHA 3EF6A 1EJVC 4YHEA 5HQMA 1MUMA 1I2RA 4AMAA 4ZFMA 4EANA 2VP8A 4GK8A 1AK5A 4UFHA 2OZTA 1HL8A 5C2CA 1J5TA 1ZENA 3QMRA 7XIMA 3W81A 5A94A 5ABTA 3GRTA 1M7OA 3M64A 4QLJA 3W7GA 2C0HA 1ZCOA 1YW1A 3RNDA 5C9UA 4ICMA 4ZSTA 3W75A 3TOYA 2G37A 5HOSA 3WH9A 3VGHA 4JIEA 3CUFA 2GUBA 2VFIA 2Y5EA 4MYAA 4LAKA 4ACZA 1PWLA 1EIBA 1ELSA 4FIQA 4TQTA 2RJHA 1UJPA 3L8KA 1LBMA 3W1TA 1Q7QA 4BV6A 3QN3A 4GWEA 4AHQA 1XGZA 1VEMA 4UFMA 3RU6A 2FH8A 2BHUA 7TAAA 1RA5A 4QX4A 2W79A 3AHTA 3CIXA 3A24A 4ZQRA 2ZXDA 3VCNA 4M56A 4CUCA 1OFOA 3GC5A 3AC0A 5BRQA 4C6EA 2XVNA 3CIWA 5C55A 5AHMA 2OLHA 1HKIA 3W1MA 2OOFA 3TONA 4H9ZA 4QXIA 2OKTA 1YEYA 2NLYA 2PBOA 1E1CB 1H5VA 7REQB 3WBWA 2OLSA 2JFEX 2YA1A 2WJZA 1SFLA 3BWWA 3K5XA 1GOQA 4H7ZA 3LA4A 4BFAA 5AC6A 1UOZA 3MUY1 2A3LA 4Q4QA 6CGTA 3WQ4A 2VZVA 4LUSB 4NX5A 3DYOA 1AMYA 3T05A 3GWQA 3MMDA 1VBHA 2V9DA 5D30A 3HG3A 5LNUA 3RF9A 4B3KA 2ZIDA 1WYGA 1HG3A 1XCWA 1OGBA 1KXVA 1AD1A 1W2VA 4UQDA 1O5XA 1OG6A 3H12A 1TWDA 4UTTA 1GZGA 5E0KA 4HCHA 1KM5A 3K2GA 3TR2A 3ONBA 4JOMA 3WENA 2BX7A 2QJNA 2XIBA 1MW2A 4GYJA 4JS3A 3W74A 1YTEA 1IWAA 2QPSA 4CN1A 2ACSA 4WF7A 3LG3A 5JMUA 5BWAA 4KWWA 4RNJA 1YBQB 3VNDA 4HYVA 4FNQA 2PLJA 3UP8A 2W3SA 3TA6A 1W1YA 1E6NA 3GNDA 4XAFA 4Q4KA 5AC4A 3B40A 2ZZ4A 1CBGA 2WPGA 3AIWA 4PTNA 2FLIA 2Y89A 3VC5A 2HS8A 4NZ3A 5T9CE 1EZ2A 4B5NA 2J27A 4H4QA 2CZVA 2Z2UA 4MZYA 2RDTA 1R6WA 5CZ0A 4N02A 3OLDA 3GS6A 3WZ0E 4DELA 4GC3A 2V68A 2QW5A 2KAUC 3N73A 1NP0A 3W6LA 4QAWA 4FX9A 1ZAIA 3FVDA 1WE5A 2XSAA 3PPHA 4XO7A 2GVJA 4WSJA 1QBBA 4C6QA 5CBBA 1H1NA 1O68A 1BGGA 3AU2A 1ICQA 3ID7A 5E6YA 1W1VA 1EKOA 5TD4A 2GPTA 2Y2WA 3D3FA 3VNMA 1HKVA 3EKGA 3MKCA 4K3ZA 4XAZA 1DJWA 2B7NA 4UTIA 2OYKA 4ERIA 1M1BA 2REQB 3EOOA 3ETRB 4ZE4A 3H6OA 3ITXA 1K77A 1AZ2A 2XIOA 1R3RA 6TAAA 4J3WA 3TQVA 3NOYA 4ZVJA 3FVMA 2Z29A 4NQ1A 3W2NA 2G3IA 2ZA3A 3CT7A 1UZ4A 1AG1O 3P8IA 5HNUA 1V02E 1T8XA 1PCKA 3LXAA 3H2NA 2FQIA 3GG8A 2PWEA 2INFA 4NAEA 2YSWA 3UGVA 3CZ8A 5FAGA 4EMJA 3W70A 1B4EA 3HGJA 2VC6A 2DV0A 2GJPA 4HSHA 3PBGA 4C6MA 1R2TA 2GK1B 1N55A 1E4MM 1ISYA 2GVGA 2NXIA 3GTNA 3QKZA 4GYPA 5FKYA 3OLEA 4Q8TA 1OJXA 1BTCA 3USBA 1UR4A 3N2BA 2BXZA 3QV8A 1E71M 1XD1A 3IJIA 3K1DA 2OJPA 3MMTA 5JUVA 4U10A 3GFZA 3UCCA 1QHZA 2WNZA 4Z1DA 2PBGA 1DIKA 4CQDA 1J8VA 1U5VA 2F6KA 3CV2A 1LWJA 2Y1HA 1HL2A 4UFJA 2WSYA 3ZFHA 2NQHA 3DUGA 3DGHA 3P74A 1XSKA 1YYAA 1ECQA 4HZ7A 4BCEA 4BWLA 3W4RA 2C7FA 3W7LA 3NJ3A 1HGYA 5CZTA 4MIMA 5KETA 1GRAA 1ISXA 3AJ7A 1U22A 2CCRA 2VDIA 5IOBA 4MYXA 2D0FA 1MZRA 1H0GA 4HMNA 1TPVA 4JQ9A 1NHRA 1QK0A 4P7NA 3W83A 3BPWA 5I77A 4WXYA 4KH2A 1AMKA 1QVBA 2FMNA 5BRPA 5IHSA 1BEUA 3ONCA 1W0MA 3NDOA 5EB8A 3LI0A 4M6VA 5AFDA 3SCRA 4BHYA 5BXRA 1WPCA 2G5WA 3U57A 5LSMA 3KUMA 3TTSA 3DJGX 2DT1A 3WD0A 1F8IA 2ALDA 1B3WA 4WY0B 3H8AA 4UOZA 1DJHA 5C9ZA 3SY5A 2VD9A 4W5UA 3WLNA 3G1AA 3GB6A 1ZBKA 3VD9A 3UY8A 2VC7A 3GDLA 4O1CA 1JR1A 3H70A 2YB1A 3S83A 1R46A 3U4FA 1GV4A 3A3HA 4L6DA 5HR6A 3LCGA 4F79A 3VIGA 1FRBA 2P50A 2WW5A 1V08A 1UZDA 1SB3B 1OHLA 4H9UA 3GXIA 3QR3A 4ZFCA 4HPJA 3FX4A 4XD6A 3VKDA 1JCNA 1SO3A 3FYYA 3FOKA 2O9RA 3MUIA 3DJJA 4S3DA 2V6AA 4UNLA 1OX4B 2VR5A 3T4WA 2VJXA 1PS9A 1H7XA 4HNLA 4ZXLA 3CYJA 2QAEA 1PHWA 2EQ7A 4US5A 5E70A 4KRTA 1OIMA 1UD6A 5EBKA 3EDEA 1KB3A 4C6JA 3B8UA 2VTFA 4LVFA 1ZFJA 3BAXA 2VX6A 7REQA 2Z4GA 4KEMA 1JULA 4X22A 2FDSA 1OC5A 1KGWA 5FS8A 4PBGA 3EA3A 2ATMA 4IMAA 1CGTA 2WSPA 1Q8AA 3EOSA 1ZBWA 3SCUA 1UKQA 3U4AA 1V6WA 1VLWA 3URQA 4D9PA 4HZ6A 1UROA 4ECLA 1Q8JA 1TUFA 4XB3A 1MQPA 1K6WA 1UR2A 1KM0A 3MP5A 1KQZA 5BWFA 1S7MA 1BAGA 4R88A 1FECA 2AQOA 4QE1A 1LG1A 1JZ3A 3AS2A 4JX4A 2EF9A 2J7DA 5T9BG 3SQSA 1TPB1 4G1KA 1ZCCA 3EX1A 3QZAA 4CQ9A 2J6VA 1S39A 1IEWA 4NNAA 3EWDA 3EXRA 1ZJHA 1TFVA 1GESA 3PJWA 1D7KA 3PM6A 2GSHA 1T0OA 4IL0A 1CXFA 4JEQA 1VFTA 3EDJA 1DTUA 3DENA 1DWJM 3OEXA 1K6AA 3ARTA 4RZ4A 2RGLA 2X0YA 2XINA 4GI8A 4HGXA 4NJKA 4IQJA 1JROA 3KOYA 3I68A 3PZOA 4OKDA 5LHFA 4GBUA 4S39A 1XDLA 4EF8A 1VFUA 1G94A 4AVOA 4J3TA 4DWSD 4AD2A 2ABAA 1IXPA 2PDXA 1EWEA 5A2CA 2JF7A 5A6AA 3MKKA 3S5ZA 3U6WA 3R58A 3B4YA 4J5NA 5HINA 2P0IA 4JX6A 1K7XA 3MY9A 3PZGA 4FF7A 4YWSA 3H21A 3LLDA 2BV9A 2BASA 1EWDA 1K7FA 2YCIX 3MCMA 4FDCB 1BXNA 1PX8A 2HV5A 4DF1A 1GREA 3NVYB 3QV6A 5CCZA 6XIAA 4A21A 1LVLA 3VZXA 1UC4A 3L66A 4NAFA 2INEA 3HN3A 4PYSA 2J9XA 4PTWA 3TR9A 4KF1A 3ARWA 3TJIA 2X09A 1VR6A 1FWWA 5JCLA 3AISA 4JIQA 2REQA 2FVMA 1SW7A 1RPXA 2PTYA 2YR1A 5AN7A 2ZUNA 2YX0A 4YYCA 3TAKA 4CNTA 5FEPA 2A0NA 3I7RA 3SZ8A 4K2SA 3HTWA 4YVXA 2SFPA 3U7BA 3R89A 1MUCA 2MANA 3ES8A 4JEJA 1E72M 3NQMA 1W3IA 4B9YA 1E0TA 2DW7A 4OT7A 4H9TA 1B1YA 1QMLA 1M3UA 4S3CA 1QU4A 1QOPA 1N82A 3N11A 2J75A 2XDFA 3WNLA 4NJJA 1OABA 4LAMA 3MSRA 4AD0A 3RRAA 2Y7GA 1AZ1A 2A21A 1EQCA 3BG9A 2IXUA 2ZZ3A 1ZY9A 1J10A 3DHFA 1XLKA 4J3XA 4JNMA 1M41A 4D6GA 2X50A 1JCXA 3KE0A 3LU2A 5E9XA 3WF1A 4WUIA 2JKAA 3CO4A 2INZA 2GK1A 3CGDA 2HWGA 4UR7A 4JTLA 1AQHA 1NP2A 3KZPA 5I6SA 3AHYA 3LM3A 3R7MA 2R94A 3GUWA 3APTA 2OODA 3GU9A 5H6HA 2RHGA 2C91A 2NLIA 1MEIA 2O4QA 2GJNA 3CQKA 1U5HA 3WEZA 3W23A 1XQLA 1I8JA 1KFLA 3WDIA 4O53A 4KCWA 5I09A 3CGTA 3P5ZA 3DCPA 3PC0A 1WZMA 3WO8A 2J8FA 4U28A 1N61C 2DT3A 3UJSA 5ABGA 2JK6A 1LL6A 1K7EA 2WVVB 1XUUA 4W89A 4POCA 1ZP3A 1E6QM 5DANA 3A47A 4CQCA 3R0DA 2I5QA 2AMXA 3W37A 1B2YA 2PU0A 2PDHA 2I1OA 3HURA 5ER0A 3II4A 2AGKA 2EPKX 1J9YA 3L2LA 1H09A 3P0XA 4CNUA 3B9AA 1E9YB 3TH6A 3NG3A 1T40A 4JIHA 4JHMA 5AKQA 2A5HA 4E6MA 1NHPA 1ZJIA 3WF2A 5BOOA 4W8AA 3WLTA 3WK1A 1BQGA 3C56A 4Z1YA 1M9HA 5M5DA 3N6JA 4WY0A 1WZKA 3WQCA 3VU2A 4S3EA 4GXPA 1SPQA 3M41A 5JQ9A 4O0QA 1XSIA 3E49A 4AH7A 2VEMA 1EJXC 3WQWA 4MY1A 4Y9PA 3T0BA 1E0VA 4NY2A 2BXYA 2X1SA 1PTGA 4HK5A 5DRIA 1J0HA 5D8ZA 2OPJA 3S5YA 3K13A 1DWHM 2OKOA 4PMJA 2VWTA 3CHVA 3M16A 5G4EA 3D5HA 3W7MA 3DFSA 3B9OA 3GG7A 1QI5A 1S3TC 1DWIM 2PDLA 4LYQA 1TV8A 2WMIB 2WB5A 2VGBA 1IXOA 1W54A 1F76A 3OBEA 1V3KA 2KX9A 4DNHA 3GIYA 3H4XA 3WDHA 3STEA 1OX4A 2ZA1A 3DFPA 2CXEA 1KR1A 3OVGA 3QW4B 3ITVA 4H9VA 3AN1A 4EACA 4P8WA 1MO0A 4HCDA 2XZ9A 1R8LA 1AJZA 4LVAA 4QS5A 2JF6A 3CWOX 3KRSA 3GQYA 4MGGA 4MG4A 3QMSA 4MPQA 1UP2A 4KIEA 5G1TA 3SM0A 2DZBA 4DLFA 3U3HA 2GJLA 1K4QA 1LOSA 1VHNA 3WQ5A 3H23A 5A5WA 2PDJA 2PGRA 4O8AA 1TJ1A 3A4AA 2ZZ0A 4J3UA 4Q4OA 4O18A 3S2LA 1W37A 3R12A 1UA7A 3QR0A 4HYRA 1PTDA 2YXOA 1DV7A 2BMBA 3NO1A 3QFEA 3VDCA 1KXHA 1NPXA 4RNIA 4QEHA 1FEBA 3QM3A 2B7OA 4IMEA 4IL2A 1OVDA 5CPOA 4O8RA 4FIRA 4MWAD 2Y85A 2E8YA 3AIVA 4HU0A 2OQLA 2ZZ6A 1RBLA 1TWZA 3VK5A 1HX0A 2QR6A 4YNGA 3KP1A 1UPPA 2NT0A 5BROA 4AZCA 4G2DA 2Z6IA 3MSYA 4R34A 5D2XA 3CAWA 3THQA 4LFYA 1NFBA 5D32A 3VPLA 1CGYA 1R5YA 4DUWA 3H24A 2VEKA 4H6RA 1H63A 1UPMB 2DZWA 4F0RA 4I5XA 3WK3A 3VCCA 3GXDA 3UG5A 2GOKA 3DBPA 3WQGA 3WSUA 1C7SA 1FH8A 2WSKA 1KC7A 4DJDA 1KTNA 2VR4A 3NR0A 4O1EA 1EGMA 4HNVA 2J74A 1FKWA 1A0EA 1XYFA 3WNPA 2F6UA 4RPQA 4AW7A 3ISIX 1O95A 4DZHA 1R38A 1MW3A 2JGYA 1KLZA 3BV4A 4DJEC 1DJIA 3TYCA 1PJ9A 5HA7A 1RD6A 4PB5A 3DGZA 3TJ4A 3QXBA 2Z1BA 3PJUA 1B54A 4YVPA 1G7VA 3BARA 3W73A 3U5YA 2NSOA 1XRVA 4YLWA 3STGA 3QFWA 3VIOA 2WKJA 1RA0A 2WMKA 3KRUA 4V1YA 2BBFA 2ZX5A 3W1PA 3REQA 1U33A 1WKFA 2LLEA 1V0KA 4IUGA 3U5UA 3W26A 1JJKA 4H2HA 4BY3A 2XJ7A 4DLMA 4ERAA 4FXJA 4Q7NA 5L9FA 1CXLA 1A5OC 1X98A 2I56A 2XIIA 3RR1A 2OZ3A 2FHCA 4JKKA 4Q6JA 4AIUA 1TJRA 3R07C 1GT8A 4UTUA 1A5SA 1EUAA 1XRSA 2A3AA 1HFBA 5F2IA 3V5CA 2X7VA 1PWMA 2V30A 1P0BA 5D9OA 3U7VA 1AH3A 4JN6A 4LVGA 3GXTA 1YXYA 2CYGA 2WZTA 4BJHA 3WFLA 1ONXA 3LRLA 3VOCA 1XJBA 4AIOA 3OTRA 3V5FA 1JDDA 1E70M 3V1PA 5JCIA 1JQVA 5HAOA 1XIHA 3FHAA 3EEGA 1P1XA 2DEPA 4U5KA 5XIAA 1H61A 1SJDA 4H8NA 5LA0A 3DG6A 1ALDA 1CCWB 2DJXA 2BVDA 4XTIA 4ZQOA 3E96A 3UYIA 4TVCA 3G1VA 2XM2A 3R8HA 4QLLA 2X16A 4JN8A 4NUWA 2ABBA 2WVVA 1DQXA 2J77A 3CQIA 4MJMA 1B90A 4LYKA 3M1ZA 2WOIA 1F6YA 4N9BA 1PPIA 4G9PA 4IMDA 3WQFA 5A6JA 5I5RA 2BVTA 3UYCA 1G67A 1ZS2A 2Y63A 5IDZA 4I5RA 1DP0A 1VPXA 4HT3A 4PUMA 2WMGA 3U48A 4PEEA 3CJPA 1MXSA 1XLCA 4TVUA 5E0CA 3ZT5A 3UETA 1JDAA 1X1OA 2OWCA 2O0TA 3UA3A 1V7AA 2CU0A 4MVAA 2WC4A 1RHCA 4DXVA 4M51A 3VGFA 4TVWA 1I9CB 2WOWA 3DU0A 2CWXA 4H4IA 2E1WA 3S2JA 4KCVA 2QPUA 4LF2A 4BQ5A 2IKHA 1FWJC 1A5LC 3RHGA 4CD8A 5E5CA 2EBNA 1S2UA 1FDJA 1SO4A 3MYOA 4ICCX 3CMFA 3DHPA 4WD0A 1XHGA 2H3DA 1OYAA 3A4XA 4KCTA 3QLDA 5FMHA 5DEZA 1XLDA 3BO9A 3QZ6A 3STPA 4PTMA 1RCOB 2W63A 1UWIA 3ZMRA 3IAPA 4D6CA 1WKYA 3TC7A 1YNPA 2WMIA 2NPXA 2CKRA 1RCXB 3XIMA 3RGTA 2WBKA 4JCMA 3UZXA 3PUDA 4RL3A 3HGRA 3WD3A 3WQVA 4M7SA 4LXFA 1UBSA 4UNKA 1BF2A 4LY4A 4Y9NA 1GOKA 2A85A 1JOAA 2E6AA 3AIUA 3M6DA 2E7FA 3ABSA 3CZGA 3FLUA 3OG2A 1X96A 3N2CA 3W88A 1EOKA 4ZODA 4K8DA 1PVNA 2ISSA 1GVFA 1OZQA 3C52A 4LBSA 4GVGA 3F5JA 3TN6A 4RE3A 4AWUA 3UU0A 4DF2A 2NWSA 3ARYA 2HS6A 1IYXA 4P7QA 5D04C 2V5DA 3EYPA 3U9IA 5EFDA 5I23A 4M5PA 3USZA 1FHUA 1S2AA 3F5LA 5LZLA 2OQYA 4WSHA 1VZWA 1WXJA 4NASA 3VM5A 1SZRA 4OUEA 1EPVA 3VE7A 1CW2A 3AXMA 2V3AA 2TSYA 1QNSA 1JNEA 3N15A 3MCOA 2IPGA 2ASHA 1UUQA 4DO4A 3LCLA 4I7VA 4H4VA 4AD1A 4KWOA 1TPDA 3WBYA 1H3GA 4TX8A 1X8CA 1V6UA 3GVQA 4GI6A 4LPCA 3W7KA 4R85A 1DNCA 3ORWA 1B3XA 4N9CA 1VF8A 4FLQA 4Q8WA 4OJYA 1W3TA 5HNNA 3ANVA 4IICA 3DYMA 1VIZA 2V3GA 3MO7A 3V0SA 4CCEA 3NSMA 1RVKA 4WIWA 3G6LA 1QWKA 3SFWA 2IXVA 5C54A 1EHNA 1R7OA 2PEVA 3LGDA 2NQLA 3MUZ1 3ZLHA 3RCYA 3DG7A 1ZMCA 1DJYA 1MMFA 2BFGA 2G50A 2WHMA 3TDFA 3GVWA 3AZSA 4PSPA 4IPLA 1L2QA 1I60A 4LBRA 2W0UA 3CHEA 3R8RA 2IQDA 1PYFA 1KO0A 3QFBA 3CC1A 1AJ2A 3HRDC 4XD4A 2V2CA 5CZJA 1QW9A 1IV8A 1XI3A 4OOUA 3LYEA 3WLPA 3WG6A 3GHUA 1WOBA 3KS5A 3TX9A 4H8VA 1JNDA 3BJSA 5F1VA 5EMJA 2TRSA 1SFSA 1RH9A 3S8HA 2Z1XA 5G2IA 4LT9A 3GFYA 4GRTA 1NSJA 3NQFA 3N3MA 4E8GA 2NVKX 3P84A 2RAGA 4FK9A 1GVRA 2ZUTA 1JI2A 4CVUA 2DW6A 3CZLA 3HJEA 2B7PA 4LJ3A 1W9DM 3AMGA 3TYAA 4B5XA 2WMJA 1KQYA 5BRBA 5CG0A 3AI0A 1R3WA 5IRPA 4US5D 4JKLA 4XKYB 2Y8VA 2NQ9A 3SJNA 3A23A 3DH9A 3DYPA 3TW6A 1VFFA 1B5TA 4E2BA 1Y5WA 1RALA 3G1XA 1KXTA 3KOWA 3RLVA 2YPIA 4EVZA 3BLIA 1EBHA 5TQLA 4ML4A 1OC7A 4PGLA 1P5BA 4LNYA 4UMBA 2QCMA 3NQ7A 3GO2A 1C7TA 4I9AA 2X8RA 4RE0A 2AKZA 4GZIA 3DDMA 5XINA 3M0VA 1HN1A 4QQUA 3SRKA 4G7EB 3EX4A 4QSHA 1FWGC 4UUIA 1U1HA 2QAFA 3VKJA 2XIMA 3VKKA 2X0HA 3O2LA 5FSEC 3GR8A 2WSRA 3GG0A 2QCDB 4K6AA 1RPKA 4UCFA 1E0UA 5AYXA 3ZO9A 4BR1A 3IGHX 1JPIA 5LXEA 5CBJA 2G3JA 3AO0A 1R2RA 3HQOA 4LEQA 4O16A 4OWGA 4TTGA 2PP1A 2Y0FA 4LSBA 1NFPA 1ADDA 4ZO7A 1E15A 2BSLA 3IRSA 2BDQA 5LIWX 1WAUA 4XZ9A 3RCNA 1Q6CA 3KX6A 4MB3A 5DT7A 5JBEA 3MUAA 2BCPA 2V38A 1H50A 3HPSA 1X6UA 1ZBCA 1O7AA 2YCKX 2BS9A 3IGXA 3N9RA 3LPFA 1J12A 3CEPA 4IPIA 1A4LA 2HBVA 5EPDA 1J5SA 4K1WA 2PB1A 1V3MA 3KCJA 4IGNA 5CC3A 1F3XA 1DOSA 1W3HA 2FTYA 1WAWA 4MTVA 4O28A 4B3LA 1GQIA 5IBXA 4ILSA 2FMOA 3SDOA 1I2PA 1L6WA 3QYQA 5FJPA 3GU1A 3RMEA 3DFYA 1TV7A 4J7RA 1AVAA 3OVQA 1H6VA 3C2RA 1Q6QA 2ZADA 1CGWA 1QPKA 1GPFA 3W7CA 3CIVA 4OVXA 4JTFA 1Z48A 3AMLA 2CZEA 4ACYA 4EAMA 3IVTA 3M0JA 4NILA 3HIJA 3THDA 3GRSA 4JD4A 3NL2A 1VFHA 3BLDA 1XDJA 2PDGA 3IIPA 4O4WA 1ICSA 1W8SA 3D0CA 3RLGA 1X6NA 2YDAA 1L9WA 4M82A 1B3YA 2XVPA 4PUNA 1NQKA 1V77A 4K38A 4O14A 4QBXA 1G1YA 4RK8A 1W5NA 2CWNA 3SQPA 3QHMA 4M52A 4HNUA 1W9PA 4H4YA 1C29A 3OBKA 2ACRA 1W5QA 4DUXA 2ZUVA 1F74A 1FBAA 2I14A 4AHOA 4C1NB 4A29A 3TW7A 1Q7ZA 1E56A 3QV7A 2OGYA 3LXBA 4DEFA 4G8TA 1V7YA 2QVNA 4KQNA 2EO7A 2CBIA 4RKAA 4A3YA 3CTLA 4XZWA 1SR9A 1QT1A 2H6RA 4XZIA 4CN4A 5FOOA 3G1RA 4O17A 4GY1A 5IBXC 1IR1A 2XSBA 4HHPA 3STCA 3FV9A 1XC6A 1YQZA 1A4MA 4M6UA 1ML1A 4BQ4A 5G2HA 3T2OA 3PTMA 1JFHA 1H5YA 5I3KA 3LHTA 4Z2IA 3AS0A 1EO7A 2TPRA 1QWGA 1PB0A 3PVFA 1W3LA 1TV2A 2I17A 1UIOA 1BWCA 1X39A 2Y8KA 3DOPA 3L7RA 1V6VA 5IFTA 3N14A 5BXSA 5E1QA 3O3RA 1TIWA 4AWSA 1VQZA 2GVYA 4N4QA 2J7CA 4CD4A 2YZ5A 3G1SA 3B3DA 1FWDC 1QNRA 1MFVA 1L0PA 3P80A 2FFIA 4HU3A 2YAUA 3CQ0A 2PWHA 4PTVA 4FX7A 4FX8A 4DJFA 4K39A 3CXBA 2H8XA 3H2OA 2EKCA 4D2JA 4EQWA 3QLLA 2PS2A 4AYGA 3W9ZA 4ZOAA 1NJJA 3WIJA 5KITA 3F4VA 2A3HA 3PS7A 3WYZA 2PC4A 1OWQA 3U2CA 1V4YA 4KWSA 4O50A 4Q8OA 4ADSA 1E9IA 3LM7A 3LV5A 4Z42C 2VUYA 4A2RA 1EYEA 1VC4A 3LXCA 3EDDA 4JFUA 3JS3A 4Q8QA 1BWVA 3BLPX 3WK2A 5LIXX 1SR0A 4PMVA 1DXLA 3QHNA 2WNQA 3L21A 2Z1VA 3BK0A 3U2EA 3SQLA 3T40A 2BGQA 3KP0A 2QUVA 3LHYA 4HA4A 1WBJA 4UTMA 4YTQA 2CPUA 1R30A 2XUCA 3GZAA 1UR1A 3EUB3 2UY2A 2YBTA 1PIIA 4FOKA 4L64A 2ZRXA 1JXJA 6TIMA 4BKNA 2PTXA 1TELA 4Z1AA 4GQRA 4XKYA 4S3KA 3VAVA 4C6FA 3O6YX 3TJLA 3FIGA 3PUGA 1RJRA 4GABA 2A3BA 4DJFC 2OLAA 5DN1A 2DQWA 2XFFA 2BY1A 1X7IA 3EWCA 5EMYA 4IFRA 2ISFA 4W5ZA 1OIFA 1YADA 1FWEC 2V5JA 2YGYA 3I65A 4EPBC 2BC1A 5EY5A 1QO2A 5D33A 3DZ1A 4LUYA 1W5PA 1FWFC 3QQ0A 4MFDA 2AMGA 1Q6EA 4YJ5A 3CV6A 4NG3A 1WYIA 3WQDA 1L2UA 1R2SA 3O0HA 5EKYA 3TLQA 3PBMA 2MNRA 4CN6A 3IV8A 3W01A 5TIMA 5I3GA 5GNYA 4L65A 5I24A 5LKYA 1MDRA 3IARA 3L5AA 4GI9A 5AY7A 3NQ6A 1AW5A 2AAAA 3VNKA 3AHZA 1OYCA 5HDRA 1KBBA 3MU7A 2HJPA 3S5SA 2VFGA 4QDWA 3EWZA 1OG0A 2HE5A 3PZTA 4IX0A 4QE5A 1GZ1A 3LK6A 1TREA 3VIJA 4UMCA 3QY7A 4UTKA 1ONEA 4C1KA 1M7XA 3GZ3A 3PZ9A 5DBUA 3LRMA 4EKJA 4Z0SA 6ENLA 3W29A 2QCCA 1SU5A 4MY8A 1XIIA 3W76A 1GRHA 4DJDD 2XH7A 1US3A 1JVNA 3QC3A 3RPDA 1FX6A 3S1VA 3KTSA 4YWOA 2XGZA 2HPMA 1ZUAX 5C71A 3CUJA 4U2YA 1WDSA 3ALFA 1CB7B 4PCPA 3L65A 3VUPA 1AW2A 4LUTB 1C90A 2FJUB 1JRPA 3WJXA 3LTPA 5A6SA 4GYKA 2BVYA 3PG9A 2QJGA 3PFMA 3VYLA 4JNYA 3NZPA 4ZENA 3VD7A 4AU0A 3TYBA 4I9TA 1GQNA 1EJTC 1B30A 2MUCA 5F4SA 4AZHA 1R3SA 3ZYZA 1A80A 3QV9A 6A3HA 5FJJA 4H8HA 4AIEA 3PZUA 1WUFA 2D2HA 1KCXA 4HPXA 2WCAA 2H3BA 2GDQA 1OK6A 5C2XA 1GTEA 2DQXA 2GYIA 2VKZG 3WQ6A 3T0DA 2QYGA 4JFSA 3EX3A 1JPKA 4NF7A 1QJWA 3ARQA 2I5GA 3SY1A 1T41A 4EPEC 1A0DA 3SN0A 1Q6RA 3I4EA 3AAMA 3KLLA 2F8QA 3BSMA 3W1UA 4H4ZA 1QPNA 2HQMA 2PZNA 2J88A 3ES7A 1NQ6A 3CB3A 4LGXA 3VOGA 1D8WA 1O60A 2Y5JA 3F4WA 1K9FA 1FDYA 5GNXA 1GETA 3NQBA 3N4FA 2ZX8A 4V33A 4IIEA 5ABFA 2XU2A 1E1FA 5I3DA 3TXZA 1N8IA 4TX9A 3NS1B 4S23A 5CPQA 2ZCGA 2NV1A 5HMDA 4XVEA 3QW3A 1KM3A 1RUSA 1T8QA 4P5UA 3BLOA 3VKCA 3A22A 3N9KA 5GPRA 4LB4A 1DYSA 4RNHA 3K8KA 1UQYA 3SUVA 4QR6A 2YL9A 2PWDA 5G4HC 4B5TA 3FN9A 2OSWA 3QY6A 4E4PA 2V8ZA 3KLJA 3M6YA 2G4FA 2J7GA 2PD9A 4RZBA 4QISA 3ME3A 1H7OA 4Q4MA 4AB4A 2X7WA 1EP2A 3HMCA 1XG3A 3H7RA 4GYFA 2DIJA 1MXGA 4IG2A 1X97A 4CD7A 3G5EA 3NXLA 1Q4NX 5JBDA 2Z2BA 4B3ZA 1CDGA 2Z1SA 4EWJA 4OECA 3ZJ6A 1IGWA 1VJZA 4KT2A 4QJ1A 4UQAA 3UXLA 2XN1A 2CFYA 1GQKA 1J96A 3WH8A 4A05A 2V67A 3LD5A 5JBFA 2QJIA 3IJDA 1F3PA 2DU2A 4DBUA 3TCEA 4FMVA 2J62A 3KCLA 3UQNA 3CBWA 4EM4A 2ZUWA 4I7UA 5MHBA 4JICA 3ANUA 1L6FA 1G4PA 3N3TA 3OBAA 1XW8A 1XHCA 1FHLA 3A5VA 3BSHA 3CMJA 1PCWA 3WJYA 5ECVA 1CXEA 3O6CA 1EDGA 4PFMA 3BJTA 3WELA 4IIBA 1KNWA 2P8BA 3VIIA 1QCWA 3BH4A 4L5ZA 2VD8A 1RJPA 3OHIA 5A2AA 1LQAA 1PKYA 3NQAA 3QPYA 4PEKA 2PDYA 4ZCWA 4K36A 3ZR6A 1SMDA 3I6RA 3LY0A 5FIPA 1XYAA 2Z2AA 3KL3A 2J24A 3NDZA 3EWXA 1J6OA 3RMJA 5BMXA 4DXKA 4Y9AA 1UD2A 1OCQA 3BOLA 2XTKA 3GXNA 2J25A 3THUA 1UWQA 3LNPA 1XR2A 2Q8ZA 3CMGA 3W7HA 3JUGA 4O57A 3UNDA 1WB0A 2QCLA 4EX4A 5FL1A 4R9OA 3SI9A 4X60A 3W72A 3PG8A 4CU7A 1MOKA 4LW7A 3WNMA 2A4AA 3BLFA 3PF3A 1VYSX 3GDTA 4AISA 3V36A 3FAWA 1O1ZA 5HMFA 4GUJA 1NTHA 1R7AA 3OW1A 2F61A 1O4UA 1B3ZA 2PU1A 2Q6ZA 3ZSSA 1UKOA 2DT2A 3OVRA 5ABHA 1BQCA 4YMZA 2FH6A 3WLKX 5F7UA 4GG9A 2AAQA 2O9TA 1TPEA 3RJYA 4CD5A 3I3DA 5CAHA 3ZWSA 4ZTYA 4TMBA 4ML9A 1GKPA 4P8XA 4XISA 1V0NA 1A5NC 2ZZBA 3CUGA 4P2VA 3SFKA 3ABZA 4NZCA 1PX3A 4Z2KA 1MZHA 1GYMA 3Q67A 4J1OA 3RCMA 3HOJA 3INPA 4YTSA 2QDDA 4H7VA 4I9MA 3SGZA 3RM4A 3PJTA 4B91A 1DXIA 3WF3A 3WEMA 3BCJA 4IXXA 1EDTA 2ADAA 2CLLA 1I2NA 2NVCA 1M7PA 4HTYA 3LHUA 3MHFA 4UFKA 1R9ZA 2FGZA 2E5CA 3KDOA 4Y96A 4FNSA 3RNMA 5CPMA 2ZXBA 3JVAA 4LYPA 1JPHA 3M0IA 4LRTA 4EQRA 5AOUA 2CESA 1W9XA 3DFHA 3KHDA 3SRHA 3S9YA 1CI1A 3BW3A 3H55A 1PL9A 4CNNA 4PRWA 3CNYA 5ENLA 1B0IA 2CW6A 3ZXWA 4C6KA 2GDUA 1FWRA 4NX0A 1NOFA 2QHAA 1EP1A 4WHBA 1XL9A