4DN1A

Crystal structure of an enolase (mandelate racemase subgroup member) from agrobacterium tumefaciens (target efi-502088) with bound mg and formate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
389
structure length
389
Chain Sequence
HMNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal structure of an enolase (mandelate racemase subgroup member) from Agrobacterium tumefaciens (target EFI-502088) with bound mg and formate
rcsb
source organism Agrobacterium tumefaciens
total genus 132
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dn1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dn1A01
4H1ZA 2ONEA 3ZLFA 3DG6A 3BJSA 3D46A 6ENLA 2PP0A 3K1GA 3PWGA 1KKOA 3U4FA 2AL2B 1ELSA 2P0IA 1NU5A 2XSXA 3RR1A 3RCYA 2OFJA 2OQYA 3ES7A 3I4KA 2PPGA 4J1OA 4HNCA 2OVLA 2MUCA 3ZVHB 3VCNA 3V4BA 4FI4A 3SN1A 1KKRA 4HCDA 3I6EA 5BOFA 1W6TA 3FVDA 1SJDA 1MDRA 3UCCA 4E6MA 3IJIA 3FJ4A 3DFHA 1TKKA 1R0MA 1KD0A 3MWCA 4HYRA 3UJFA 3QN3A 3TQPA 3MUCA 2GGHA 3R0UA 3IJQA 2AL2A 3VDGA 4A6GA 2OZTA 3FCPA 3DGBA 1FHUA 4KWSA 1MRAA 2FKPA 4ENLA 2HZGA 4JN8A 2AL1A 2PU0A 3TOYA 4H83A 4DN1A 3STPA 3PWIA 5FJOA 2ZC8A 2OQHA 3OZYA 1MNSA 4GFIA 2OO6A 3JZUA 3THUA 2HXUA 3CYJA 3JVAA 1MUCA 3IK4A 3R1ZA 3MSYA 3QKEA 4K2SA 2PODA 3MQTA 4KEMA 2P88A 2PTYA 7ENLA 3P93A 3QLDA 2MNRA 3H8AA 4IP5A 1SJBA 4IL0A 1L8PA 4IHCA 3ZLGA 4E4FA 2AKMA 2GL5A 3P0WA 4JHMA 1SJAA 3SN4A 3KUMA 2ZADA 1P48A 3OPSA 1XPYA 4DX3A 1EC9A 4G7FA 3R0KA 2PMQA 2XH2A 5FJUA 3OW1A 3NO1A 4H2HA 3NXLA 2QJMA 4H19A 4Z17A 3VC6A 3FYYA 3OTRA 1ONEA 2PGWA 4IL2A 3BSMA 2DW6A 3DIPA 1TZZA 3CAWA 3UJRA 4K1WA 3N4EA 3QTPA 2GDQA 3T4WA 4G8TA 3CK5A 2OPJA 3UXKA 5J04A 1IYXA 1KCZA 2QDEA 3S5SA 1NELA 2PTZA 3RITA 3T6CA 2P3ZA 4GGHA 3PFRA 3GY1A 3VC5A 2QDDA 4ZA0A 3I6TA 3OZMA 4HCLA 3FXGA 4K8GA 2DW7A 1PDZA 1MDLA 3DERA 5FJPA 3UGVA 1EC8A 3V3WA 5FJTA 3CXOA 3VA8A 1BQGA 4IP4A 2PP1A 1EBHA 4FP1A 2P8BA 2GGEA 3UXLA 3DESA 3P3BA 4GIRA 1XS2A 3TTEA 1WUFA 2PA6A 4F4RA 1DTNA 3SJNA 2NQLA 3RO6A 3T8QA 3TW9A 1JPDX 3RGTA 3VCCA 2OKTA 2I5QA 3CB3A 3UJ2A 1JPMA 2GGGA 3NZGA 4X2PA 3PK7A 4HCHA 4IT1A 3NFUA 3H12A 1ECQA 2OG9A 3CT2A 2P8CA 1YEYA 4ROPA 3SSZA 3ZLHA 2OLAA 1JCTA 3HPFA 2OZ3A 4DXKA 2RDXA 4E4UA 1F9CA 4GGBA 3MZNA 2PCEA 1P43A 3DEQA 3D47A 3DFYA 2QJNA 4MKSA 5FJRA 1JDFA 4YWSA 3U9IA 3R25A 2POZA 3JW7A 2PP3A 3N6JA 3DG3A 3T9PA 3QPEA 4E5TA 4HNLA 3H70A 4KPLA 4ZCWA 5IDZA 2PSNA 3SBFA 5BOEA 1E9IA 3DG7A 2QQ6A 3BOXA 2XH0A 3UJEA 2AKZA 3TJIA 4DWDA 2PGEA 4GISA 3UJSA 3EKGA 3SQSA 4EWJA 4MMWA 3TWBA 3Q45A 2HNEA 2GGIA 3EEZA 2OZ8A 3IJLA 1OEPA 1EBGA 2PS2A 4GMEA 4Z1YA 2GSHA 3R11A 4GYPA 3UCDA 2XH7A 2QJJA 2XGZA 3N6HA 1RVKA 3B97A 2QVHA 3MY9A 4GYPC 5EU9A 3GC2A 2XH4A 3ZVHA 3SN0A 1TE6A 4E8GA 5ENLA 3TCSA 1R6WA 2GGJA 4HN8A 3GO2A 1PDYA 3RRAA 4KT2A 3ENLA 2QGYA 2HXTA 2PU1A 4A35A 4IZGA 2PTWA 3DDMA 3TJ4A 4MGGA 2OX4A 3GD6A 1FHVA 3OP2A 3VFCA 4M0XA 3ZVIA 2O56A 4JN7A 4HPNA 1SJCA 3V5FA 3V5CA 2PTXA 3Q4DA 4DYEA 3MKCA 4M6UA 3TWAA 4J3ZA 1BKHA 3R10A 3N4FA 1EC7A 3FV9A 2CHRA 4A3RA 3ES8A 4DHGA 2FYMA 3S47A 3H7VA 1WUEA
chains in the Genus database with same CATH superfamily
4ORIA 3U7BA 2ONEA 4XVDA 2B7OA 6TIMA 4MB4A 1K1DA 3L5MA 2HWGA 4IG2B 3EWUA 3VOFA 2CLEA 4H4UA 1GVEA 3U4FA 5A2AA 4HK7A 4GVIA 5CZ0A 3VIOA 2R9ZA 4XQ6A 4CQCA 1FH8A 3WLSA 3H6OA 3WQOA 1LPFA 4BCEA 1TTQA 2GH5A 4D1IA 3W81A 3RHGA 3VPLA 5AC4A 1UWTA 4AZ7A 5TAOA 1LRQA 4QS5A 2D0HA 3W3OA 3KTXA 4MOZA 1EJTC 1UZ4A 4IPJA 4DELA 5J5DA 2AQOA 5EMKA 4KCVA 1V6XA 4EP8C 3MUCA 2DUXA 3UBPC 3W7EA 3UZZA 4HMCA 5LHEA 3KL3A 3NL5A 5IXEA 1NFGA 2PGFA 3H23A 3LRKA 1UWIA 3ARYA 3SGUA 2FKPA 3P82A 1TR9A 2FZ9A 2VCCA 1PWMA 1SO6A 3DK9A 4O18A 5HBFA 1N5XA 3GSMA 3MSGA 1SZGA 1OYBA 1GUVA 2YL6A 2NV2A 1C92A 4BF5A 3BLEA 1AUSL 4ATWA 4H4VA 5KSWA 3U2ZA 3MSYA 3MA8A 3KVKA 1HKIA 4ZTYA 4GR1A 3S2JA 2PZNA 2DSVA 2FB3A 1U33A 3W6MA 4AC1X 3KHDA 4O57A 1JZ7A 3LENA 1IEIA 3T78A 4INFA 2JGYA 4F9JA 3TKFA 3FKKA 5K4XA 4GFSA 1ZFJA 2VENA 1UIOA 3T40A 2PAJA 2WXDM 2D0FA 2V3EA 4TXEA 3BAYA 1OSEA 1KM3A 3BMXA 1U2YA 1XLJA 1WP6A 3PS7A 2PMQA 1OWQA 3ARPA 4DNMA 4B5XA 2POTA 4W86A 3ECQA 3CGCA 1MI3A 4N9EA 3ITXA 1NJJA 2GQAA 3OZOA 3AXHA 3FYYA 3UW6A 3BOFA 4JX6A 1J8VA 1ICSA 3GHSA 3N17A 1GRTA 3N4AA 4H00A 1G7UA 1GPFA 1XJBA 3UJRA 1YNPA 2ICSA 4ACZA 2RABA 1M7JA 4WDTA 2VVSA 1ECEA 1YDVA 2QUTA 4WY0B 4DBSA 3B8IA 5DQPA 2PTZA 1D9EA 3HG5A 3VOGA 4C6FA 3QFEA 2YB1A 4QAIA 3DENA 3TH6A 2C91A 2J9YA 3L4YA 4UTFA 1BRLB 2UBPC 2DQWA 3GW0A 3UXDA 1TIWA 2E6FA 5HQEA 3WD1A 2GUUA 1ZP3A 5FJTA 4TTGA 3JS3A 1GYMA 2BODX 1BQGA 1U83A 4IPIA 4CCZA 1OIFA 3R43A 2HBVA 3EX3A 1JDAA 5LGZA 3T0CA 5LXEA 2PI6A 1QO5A 4LUTB 4M19A 1LOLA 3TTEA 3SRHA 5CPLA 5KZDA 4FXRA 5J5RA 3M9YA 3WLQA 4KGJA 3BC9A 4IPPA 4C1NA 4F4RA 4UCGA 1E6PA 1A5BA 3UWYA 3QJAA 2E5DA 5LHFA 3QGKC 1TRIA 1OFRA 1VFSA 1YMYA 2QPUA 5DRCA 1DHPA 1FDZA 3DI0A 1RBOB 3MUIA 3VCCA 2I5QA 1XH2A 2O9TA 6CGTA 2J9XA 4CVUA 6PTDA 4CN4A 3RAOA 2P50A 4CNSA 3NZGA 3NA8A 1E4MM 3IRDA 3LLDA 5GNZA 1DOSA 1W9XA 1TB3A 1V03A 4PODA 4FLQA 5K2ZA 4CQBA 2E09A 1FECA 4I7UA 2OLSA 4KERA 4QE5A 1JCTA 3E9AA 4LV9A 4MYXA 4QAWA 1AG1O 5DMLA 1A49A 3G0SA 4LYPA 3HV8A 2X30A 1I0BA 1F9CA 1M3UA 3K1DA 4CLMA 4F2BA 1T8QA 1OT2A 2GFTA 3W6LA 4E0CA 4H4TA 3W0KA 4JTEA 2Y8VA 3C5QA 5REQB 3ZMRA 3R25A 3NL6A 2OTDA 5CSUA 4K36A 1PKMA 1P5BA 2ADAA 1VDVA 1Q8JA 1DHKA 4C90A 3FJLA 3T9PA 2QUMA 4IJCA 1IGWA 3EOSA 4Z1CA 3W7JA 3GR7A 1I9CB 4IOTA 4RDZA 2DV0A 3ONCA 1QR7A 3FHQA 3TC3A 4O1EA 4FLOA 2OYMA 4JAWA 1O5KA 4CU8A 3WFLA 4DBEA 1OFAA 1JPHA 2GVLA 4QSHA 3WK1A 1TRDA 4LGXA 1X2GA 3ITVA 4PTMA 3GIYA 2ZRXA 3KAOA 1AJ0A 3PUOA 3UYIA 2G0WA 1WPCA 4C5ZA 4HNUA 4DZHA 5IFTA 4HGXA 2ON3A 4PMRA 3O6AA 4JN6A 5CJMA 3CQJA 4GIAA 3AJ7A 3FEQA 2VOTA 4GMEA 4IMFA 1UJPA 2IKJA 3VM5A 3ARSA 4O17A 4PSRA 3KZSA 5DCBA 5I3JA 4Y2WA 1RVKA 4RE4A 1XRTA 3AM9A 1FWHC 1GV4A 4AZBA 2IKGA 3W7CA 5I3KA 5EU9A 1CGYA 3QTGA 4IIDA 1B31A 3VD7A 3P80A 3ZVHA 3RPTA 2WBAA 4LAKA 1A5AA 5HWNA 1EDGA 4OUEA 3C61A 2F6XA 1M68A 4JY9A 1DJXA 3G1SA 1F61A 2OX4A 1XCXA 1T8XA 1OD0A 2Z0IA 1EO7A 1NDYA 2O9OA 1V0KA 3ZVIA 1UW9A 4Y6GA 3O3RA 3Q4DA 3S4TA 2PWVA 4Y96A 3R94A 1FWSA 4E8DA 1T40A 3KRUA 3TWAA 4EAYA 3T0BA 3GFYA 3LCLA 5BRPA 1TVNA 3EMQA 2W0UA 4TQTA 3NSMA 1P0NA 1AH0A 1E0XA 1GVIA 3H7VA 1IT8A 3TSDA 1ONXA 3AIEA 1MMFA 4WK9A 1O60A 4PZVA 4ZB5A 3VE7A 3GXDA 1QPOA 2R1KA 5CG0A 3KWXA 3U6WA 3RR1A 1IXNA 4UMBA 1A3HA 2FGLA 2ZYFA 4OV4A 4YWIA 6XIAA 1AQFA 3L21A 4QLJA 3WQPA 4PL1A 2MUCA 5G2WA 1V77A 3WJWA 1KWKA 3CV6A 3W53A 3C0LA 3MW7A 3EWXA 3H54A 2JFEX 4NILA 3NQ7A 3TXVA 1QMLA 2XWEA 3WK0A 1D7FA 2BZNA 1MDRA 3GVWA 4Y8FA 4M1BA 5HMFA 2ZWYA 1R0MA 4JTFA 2W3ZA 4DQWA 2GQ3A 5MF5A 1EXPA 1KW1A 1UASA 5EGRA 3MV11 1XD1A 5F1UA 1ME9A 4GG9A 3BGGA 4IGHA 2AL2A 3AHTA 4D71A 3W71A 1XIFA 3WNOA 4ENLA 1JRCA 4RDWA 1EJRC 3A7RA 4WEVX 3O7UA 4JX4A 4NJKA 4GY7A 1GT8A 5FJOA 3CUIA 3B9DA 3STEA 2ZC8A 1Y8BA 2PDIA 3TC6A 5T26A 3W26A 1KB3A 1VFMA 2HXUA 2Y2WA 4WLCA 2VFIA 4RE2A 3T1GA 3FSUA 1ZNNA 2ZUMA 3PWAA 1G4SA 2HRWA 3S8HA 4PFMA 4E8CA 1TX0A 5A6TC 1E0TA 2E7FA 1HGWA 2P5NA 2YYUA 4MJ2A 4GI4A 5CPMA 2H8ZA 3EB3A 1EBDA 4U2ZA 1L0PA 3KCLA 1JNDA 1PL9A 3S1VA 2J47A 2GL5A 1V02A 1BSIA 2BVDA 3PANA 4ZEPA 4JHMA 2FMOA 4EM4A 1ONRA 4GRSA 1P48A 2DVXA 4M6QA 3VOIA 2FFCA 2FZMA 4KEVA 1R9ZA 3OGRA 1SW0A 3H2NA 4RZ5A 4C1LA 1RJPA 4CNPA 4M7TA 1TG7A 3L2MA 3VC6A 4IMCA 3REQA 4GJIA 4C6MA 1NDAA 2F61A 5GJPA 5A6LA 3GNRA 4HZ7A 3A12A 3NAVA 5D9NA 4YYFA 3MWAA 4KRZA 1W5OA 1BHGA 2E8ZA 3QQ1A 2DT1A 2Y7GA 5HQMA 3G24A 2C15A 4WY0F 2FIQA 4FO4A 3HBLA 5H6HA 1F5ZA 3TLLA 3NDYA 3EX1A 3LQGA 3GVGA 1L9WA 1SB3B 3FXGA 1VHNA 4WDUA 5E0KA 2HVMA 4WCJA 4CQAA 3AUOA 1M6JA 3RPMA 1PX8A 4C5YA 1F8WA 2WMIB 3LLXA 2HMCA 4RXFA 4FNUA 3OEXA 3B8TA 3WLNA 3AZRA 3QY8A 1KV8A 5FS6A 4EVZA 2QCDA 3C0SA 1K8CA 4BHYA 3PAJA 1E3XA 1U5HA 2C1HA 1VIWA 1W1B1 3SJNA 2NQLA 4DNHA 1ICPA 4ASTA 3UA4A 2CLPA 1N7KA 3SGGA 1J0JA 3NQVA 5HNNA 1V59A 2WWCA 4QDPA 1UHVA 4BR1A 2PURA 1V3KA 2NLIA 1TJ1A 4M1RA 2R91A 4Q8QA 2O55A 4LVBA 4U3CA 2BSLA 1H50A 2ISVA 1ECQA 2TSYA 2VWTA 2WZTA 3G1DA 5IRPA 3PUEA 1E5JA 4XX6A 2CITA 2BOGX 1H3GA 2NT1A 4XZMX 1O1ZA 1QI0A 2PGRA 5LNUA 2XISA 3QYQA 3ZSSA 4CUCA 1PXGA 5BXPA 1WO2A 1QO2A 5A8MA 3FXYA 4J2PA 2EKCA 4LALA 2X0YA 3QFAA 4RPPA 4UWMA 3AMZA 4LYKA 3CMJA 4FOKA 4S1FA 4NI3A 3H70A 1WE5A 1JFHA 2OSXA 1YTDA 4O28A 3SCNA 4U2YA 3N2OA 4D9PA 1JYXA 1GOQA 5C54A 5E6ZA 1UB3A 3AOFA 1UQYA 4M7SA 4H3DA 1XQKA 3KLJA 2X0SA 4G1NA 4GXMA 3W88A 3TX9A 1PTAA 2BVTA 2OWXA 1KTNA 3GH4A 2GJRA 1OC6A 3DFTA 3U5UA 3DKLA 4O52A 2YAUA 3W7NA 2EEXA 3GNDA 4IUOA 1J5TA 1X39A 3M41A 2G37A 3M07A 1SO5A 3GIQA 1KM4A 1WDSA 4GYPA 4MWAE 1EHNA 3BAJA 4AD3A 2XJ7A 1JPKA 1V8EA 3F4WA 3GDTA 4D6FA 3USBA 4Z1AA 5D4YA 2WC7A 1KBBA 1XC4A 1GRBA 3KBVA 3GX9A 4U4MA 4TTUA 5AHNA 2QNEA 3VABA 4MUPA 3G1HA 4XO6A 2Z1KA 4FNPA 2CPUA 1I75A 3PTMA 4MLJA 2X0HA 1M04A 4UFMA 1RHCA 2W63A 3BUVA 3L0NA 1OINA 3LV6A 4GBUA 4MGGA 3WDIA 3G8RA 5DXYA 1UP2A 4AYSA 1XIBA 3VIHA 1CWYA 1IIHA 2O56A 3P7YA 4Y9MA 3ZR5A 3TK7A 5BZAA 2X1UA 3ETRB 5HNRA 1SJCA 4Q4OA 4DYEA 2V63A 5AYZA 2J8GA 1DXFA 3CTTA 4MJZA 4OTKA 4ZZ9A 4XSLA 3OVGA 1G4EA 3AMLA 3EX2A 3LA4A 2ZZ4A 3F2CA 2ZZ5A 3YPIA 2WSRA 2J7HA 1WKDA 1YXDA 2ABAA 4A3RA 1AW1A 2PLCA 4HJWA 2E9LA 4JTTA 5A8QA 5CZKA 4ZB0A 3AI0A 2I57A 4GVGA 1F3WA 3W2KA 1E4IA 4R85A 1GZJA 4J3SA 2YW4A 4WKHA 4QRNA 4IX0A 2I9EA 1B1YA 3APYA 2PPGA 3TNOA 3K5XA 3C8FA 3S9ZA 4LAZA 4OBTA 2LLEA 4URIA 2PDNA 2WM1A 1K3UA 4H4XA 4TVUA 4RDVA 1JPIA 1F07A 2J66A 3UWQA 3OODA 1EGVA 7REQA 3TQPA 2V81A 1UZ1A 3IJQA 1JZ4A 2DT3A 3TQKA 3G18A 3HZ3A 1K70A 2V9DA 3BW4A 4K8EA 3SCTA 3EWBX 4HPJA 3MV01 1PKLA 1UWRA 4RUBA 3MUXA 3VGFA 3LNPA 4F2TA 4GX9A 5C2GA 1DBTA 4XD6A 3E12A 2DORA 4I5UA 4P5UA 3GVVA 1A5MC 1GHSA 3I7QA 1KXTA 2QT3A 3EF6A 4PUKA 3MQTA 3P8JA 4AY7A 1XLHA 4KEMA 2P3EA 1A5NC 1VQZA 3EXTA 3OBKA 3WUGA 3QLDA 4LVGA 4EXBA 3P6LA 1LZOA 4ZODA 4UTIA 1QCWA 3LM7A 3LQLA 2DPEA 4A3QA 4ECLA 4R34A 3UWEA 5HNTA 3VUSA 4XK2A 4GRTA 3AMGA 1KRAC 4JBRA 5G1TA 2QMKA 3CT7A 1EEPA 3FEMA 4ZR8A 2QR6A 4G7FA 1X97A 4XAGA 1XLKA 3K4WA 3SI9A 2YB4A 2E25A 1KO0A 3W87A 3L5LA 4US5D 1VJSA 4XWUA 3GUGA 1VLWA 5FEXA 3QF0A 2WPFA 1VBHA 4KS0A 1JGIA 3OA5A 5I3FA 1A5LC 3T2QA 4B4HA 3CH0A 2ZUNA 3MHFA 4UQCA 3FX4A 4RNIA 5FCZA 2C8NA 4GKLA 4HHLA 3TEVA 3WLIA 4LB3A 2JK2A 3B9EA 3VK5A 4TV6A 1FWJC 3AU6A 2WM0A 1LT8A 4CQ8A 4HHMA 4AHOA 1JQVA 4KCUA 3W73A 3QV8A 2AQWA 4F0RA 1QK2A 2VP8A 3QPYA 4ZGYA 4AEOA 3IUDA 4MIMA 3ME3A 3RJXA 2VRJA 4R7WA 5KTLA 3QPZA 4RV8A 1Y5XA 1ZK7A 4EAMA 3R5EA 3O2LA 3QM3A 6A3HA 1GYNA 1I1XA 4NIRA 5FSEC 3ATZA 1DXEA 3P62A 3GTHA 4V33A 4LXFA 3HRDC 2W9MA 4DAFA 1FWNA 5CSSA 3NQFA 2ZX6A 3TQVA 4D6CA 1OX4B 1R9XA 3UJ2A 3N2BA 3UESA 4LF2A 3EOOA 3IRSA 1WOAA 3QXBA 1C91A 3QR3A 4LFYA 4O1DA 3VKDA 3URQA 5A8PA 4IT1A 5E9XA 1EUNA 4PEKA 1CECA 1KXHA 1M9HA 2QCMA 4HZ8A 3BPWA 3W7KA 4H6QA 4PUDA 2OLAA 2A3EA 2OO0A 2ZZBA 2VJXA 4B90A 2Y70A 3ARRA 3NQBA 2CERA 2DH2A 3LPOA 3IVUA 1B54A 1WXYA 4HA0A 4Y9NA 3T4CA 4XIMA 2A3HA 4OE7A 3UQNA 1TVPA 4NUWA 2GQ9A 3CM4A 3KVLA 4QNWA 3VD5A 4GI8A 1UG6A 1UOKA 3SIMA 4EF9A 1HJWA 1PCWA 3MO7A 4W4QA 1TTIA 3V0UA 3S5YA 2G95A 2RGLA 3GNNA 4QLKA 3F4DA 1R85A 5HR6A 4ZMGA 4I6KA 2J77A 4Z2LA 5KZEA 2PRHA 2GUBA 4N42A 3W27A 1TPDA 4W7UA 3W2LA 1TVLA 4DWDA 4PUWA 1XCWA 2PDYA 4I8YA 3UJSA 4DBDA 2GQ8A 3VM7A 4L4OA 5CZSA 1DNCA 1KXQA 1SSDA 3R13A 3WLLA 1RXOB 1C8QA 2YCKX 5C9XA 1D7KA 3LPPA 4ML9A 1FEAA 1DORA 2HISA 2VMFA 3PUGA 4UTWC 2NVCA 2NXIA 1KN0A 1TX2A 4JQ2A 1QOXA 3W37A 1HVQA 3PZOA 3UY7A 4NHVA 2TYSA 3S9YA 3V16A 2A3CA 2GR2A 2DIJA 3QC3A 1AJZA 4A8LA 2WLYA 4TR9A 5G2HA 5LA0A 1E56A 1XHGA 2EHHA 1P7TB 1FWRA 3HGSA 4F48A 1GREA 1UROA 1TWZA 3STFA 2RUSA 3A9BA 2BOEX 4JNYA 1B4EA 2QLYA 3XISA 4RW5A 2VGFA 4WDXA 2XIIA 4H8VA 3V0SA 3DDMA 3PBWA 3HFTA 1NDWA 4V1XA 1UPMB 2RDWA 2QAFA 4WJEA 1VJZA 1RH9A 3ABZA 3WMBA 4JFUA 1UJQA 2NUYA 3E6EA 1D3GA 2O7QA 1CDGA 4F8XA 4O8AA 2KZHA 1RY0A 2B4GA 2WVVA 2V5JA 1Z69A 1DIEA 3MMTA 3P74A 3R10A 3N18A 3N4FA 2E67A 1MZRA 2J27A 2DP3A 2BXZA 3VKCA 3VDAA 5FJIA 2WVTA 1DJZA 1UMYA 4E4PA 1JJKA 3CZ8A 2WMFA 3L4TA 2PP0A 1A47A 1V7AA 1Z89A 1DL3A 1OFQA 1YYAA 3MS8A 4MSSA 2OLHA 1FRBA 1XL9A 4WF7A 4PCPA 2Y8UA 4J1OA 2YDQA 5DX7A 3RN6A 2QZRA 2C16A 3PJTA 4PCFA 2Y62A 1DQWA 1KBJA 3C56A 2VX6A 3FVDA 5K9DA 1YBQB 1QRQA 4JDBA 4MJ4A 4TO8A 3AIRA 3DFHA 3B06A 1K6WA 4R9XA 3RLHA 1RM6B 1ODZA 1DJGA 2YL9A 3F2BA 1Q6OA 3BOLA 3H4GA 3QN3A 4ADUA 3P84A 3EANA 3WQWA 4YMZA 5C6MA 4R5EA 4WSJA 1P0DA 1G4PA 3VDGA 3QHOA 3TA6A 2XFWA 3S46A 4F9DA 1RK5A 3LERA 1XRVA 3M7WA 2AAMA 3EZ4A 3BQ5A 4DN1A 1OFOA 5KZ6A 5CAHA 3RDKA 2XDFA 4LJ3A 6ALDA 2INZA 1OJXA 4GFIA 4LNYA 3JZUA 2ISDA 2ZXBA 1TV2A 3QKEA 9XIAA 3OLIA 4N9DA 4FB7A 1XDIA 5D8ZA 3M43A 4HMDA 3WQ6A 4H4QA 3A3HA 3LHVA 4H4RA 2CBIA 3LM3A 4JTAA 3HJZA 1OX6A 3QEZA 3IARA 1L8PA 3WF0A 5JVLA 2XVLA 3E0WA 1Q6RA 2Z2AA 1FCQA 2W3RA 1EZ2A 3VZZA 3S6TA 3LTYA 3QGVA 4Q8OA 1MQPA 1HIZA 1N82A 1UD3A 2AGKA 3OW1A 4ZQOA 1NOFA 4ZE4A 3L2IA 4APNA 4C6OA 2DZBA 2GR1A 1QPRA 1TPEA 2V5CA 5HWMA 4IIFA 1D3HA 1GQIA 1FIQB 1R8LA 3QH2A 4C6JA 3W85A 1L2UA 4HPHA 1M7OA 3L67A 4DIAA 3EKZA 3L4XA 2O4QA 4PFHA 2VGBA 1KGXA 3C52A 2WZMA 1NHRA 2XHYA 3QMSA 5FF4A 2JIEA 4PC8A 5HINA 2F5ZA 3GHUA 4HCLA 1XIEA 1O4UA 2A1YA 4IGMA 4AVFA 5I06A 1X1OA 3RM8A 7TIMA 4RXGA 1VCVA 4N02A 1ZJAA 1BVWA 1TTPA 4DLFA 3QC0A 3N15A 1NH6A 4TUFA 4RNHA 1G7VA 1RP8A 2OEKA 4NNBA 3HF3A 2BG5A 2BMBA 4RE3A 1YE6A 1AH4A 1YDYA 5ABHA 1MW3A 3ONBA 4S3BA 3GYEA 1DIKA 4L1GA 3M0HA 1HF6A 1J10A 1N60C 5JUVA 3KP1A 2XM1A 4DM2A 2HSAA 5B7YA 5U7SA 5EBKA 3F5JA 3IPWA 1XLLA 4GZ7A 2OKTA 4IMEA 5JMUA 1C7TA 4ZXOA 5F4SA 5HPOA 5HDRA 3UPWA 4V1YA 2FMNA 1S1PA 5F2MA 2IQ0A 1KM5A 2D3LA 3NPVA 2D20A 1OGBA 1XG4A 2VQUA 2E6DA 5FIPA 5CC7A 4O4WA 1OGGA 3VNIA 1EH9A 1EEXA 3AWOA 3NIYA 2C0AA 3CEPA 4IPNB 2OZ3A 2C79A 3MVIA 5A6MA 4QFUA 1A80A 3AISA 1G9HA 5G1YA 4JIHA 2VR4A 4RW3A 3RLVA 1HKJA 1E0WA 2A5HA 1NDVA 3O1NA 4LUSA 2WOVA 1VFHA 3TC7A 2POZA 4PRRA 1DIOA 2NWRA 3EDJA 1RQHA 3MKVA 3QPEA 2F9RA 3CZKA 1B4KA 3LDVA 2CYGA 1W17A 4WKAA 3VIMA 3MVTA 1AH3A 4JNMA 3UZXA 1Z48A 1WNOA 3R89A 3SBFA 3M0MA 4WSHA 1J2BA 2Y8KA 3HA1A 4NQ1A 4PMQA 4DWSC 4BQ3A 1UD4A 4IJBA 2VDIA 4FHAA 4DO4A 4B15A 3A5FA 5FACA 3AQUA 4GWEA 2VFGA 3LGGA 1B3WA 3DCPA 3SY1A 5KINA 5BXSA 2W67A 1I2RA 3FHAA 3HFYA 3B0UX 2P76A 3ZJ8A 4MNMA 2O7SA 3KOXA 4FXJA 1B2YA 2V3DA 2HNEA 1WDDA 3WLPA 2ACUA 2WCSA 2ZWZA 4CCCA 4S3GA 4Z0SA 2G3FA 3STGA 4P2VA 1CYGA 1W3KA 2OZ0A 3CMGA 4GZJA 1XSJA 1QNSA 3RNDA 1DJWA 4LVAA 1HKKA 4B9YA 1ZGDA 3K8MA 4HPXA 2FH6A 1U1UA 4I90A 3PULA 1T41A 2A21A 3B9AA 1J6PA 4PMZA 1CGVA 1RLDA 1W1A1 2IUZA 3ANUA 5HMEA 4FS9A 5EFDA 2BGQA 4HNOA 4AVOA 4AX7A 3SFKA 2V67A 1ZZMA 4XVEA 4M0XA 1GONA 2OMAA 3LMYA 2O9RA 1ZAJA 2P53A 4NZ5A 3PPFA 1LG2A 4B2DA 4IXHA 3WBYA 1ITCA 5C9WA 2OWWA 4IH3A 1EPVA 5KEZA 1LYXA 4B5TA 1Z41A 4US6A 2CHRA 3V1PA 3JUGA 1WUEA 4DZAA 2BVWA 1HGYA 4JEQA 5EMYA 3MYPA 2PRLA 1KFEA 3FN9A 4UOJA 1TIMA 3WK2A 1VENA 2HQAA 1W1IE 3RNMA 1UD2A 1F3PA 3HG2A 1D3CA 1WQ5A 2Y5SA 3ZVHB 2ALRA 1H5VA 1DXIA 1NPXA 2QKFA 3KCOA 1G5AA 1XUZA 2R6OA 5LKYA 1Z6KA 3HQPA 4GUJA 1Q13A 2NV9A 4LB4A 4MWAD 4QQUA 3PPGA 1ZCCA 3II1A 3SCUA 3WDPP 3LXBA 4RE0A 4E3VA 4P7OA 3SB0A 1YTKA 1GYLA 2YR1A 3GXIA 3MCNA 2BOFX 5CPQA 5JCKA 1ITUA 4MG4A 2GGHA 3GK0A 4HU3A 5CCZA 2R94A 3UXIA 1ISXA 2WKLA 3QQWA 2A6NA 1G4TA 2GOUA 4YL2A 1LUCB 1QI5A 1Q6QA 4DO5A 4BJHA 2PU0A 2V3BA 3TOYA 4R7OA 5I3GA 4H9VA 3PWIA 3GYCA 2NVKX 4C6IA 4HNTA 4J3VA 2WNZA 4OUIA 2Y24A 3TW6A 1HXJA 5XIMA 1L8NA 1YIXA 3EOUA 4LYRA 1IGSA 3CGTA 3M0KA 3I7SA 4GVFA 3LI0A 4AD0A 1T3QC 5E0CA 3W7QA 1GKPA 3NG3A 5FL1A 5KETA 3XINA 4MY9A 4TIMA 2YXGA 3HGJA 2DZVA 1BXNA 4MY8A 5CGMA 2OT1A 3PSVA 3LHYA 3C3NA 2WC3A 4IX2A 4QG6A 2PEVA 1TWDA 4L7ZA 4GUIA 5I7GA 3V35A 1JNEA 3NSXA 1KR0A 1OC5A 3BCFA 4H19A 3TNBA 1XYLA 4MPKA 3NQGA 4QIUA 1B5TA 1V51A 4LUIA 4Q8VA 3W1RA 3A9IA 1FWGC 2CEQA 5BMXA 1R7OA 4NZCA 2IQTA 4IQEA 1WZMA 4G8TA 3VIFA 2VR2A 1JUBA 2OPJA 2GJPA 2DUZA 1WZKA 4Q8TA 5DRIA 1UP0A 4QJ1A 5CLWA 3V0TA 4IFKB 3PFRA 3QSTA 4C7GA 3VD9A 4LPCA 2VEIA 5TF0A 2DW7A 5CC3A 1VIZA 5FJPA 3BWWA 1Q6LA 1F6KA 2AMGA 4GXPA 3V3WA 4E2DA 3PAOA 4LBSA 3TYZA 3VZXA 2GGEA 1LLWA 2DZUA 4PMVA 1ZL1A 3EMCA 1QT1A 1TWWA 4HU4A 3E0IA 2WNNA 3PJWA 3WH5A 3W83A 2E5BA 3AS0A 1CLVA 1OCNA 1VYRA 3NQCA 5FS7A 2QDHA 5FEPA 3IUHA 1TYPA 2VEGA 5HUPA 3DU0A 1WXJA 2YLLA 3OQEA 3MB9A 3H4KA 3CXBA 3ZFHA 4EACA 3S2LA 3SUWA 2Z1WA 3DJJA 3IAPA 1G94A 5FS9A 2ZZ7A 1K9FA 2X1RA 1PX3A 2OG9A 4PTVA 3PZ9A 3L68A 3PSWA 2PDCA 3PZNA 2QCLA 1TMHA 2ZUWA 3LCFA 1LOSA 3QOKA 1OJTA 7CGTA 1JQXA 3EWYA 2GSJA 5A8NA 2Y6ZA 2VTFA 3DFYA 3MT1A 3JU2A 3G1YA 3R0DA 4HMEA 4H8UA 3VMOA 5TR3A 4H9ZA 4O16A 4IM4A 4GZEA 3EDDA 1U1JA 3PC0A 2Z1XA 1FWAC 1XYAA 4HNLA 3W7OA 3VE9A 4H50A 3GD3A 3C2OA 1XINA 4QDWA 2GVYA 2QCDB 2CKRA 5M17A 3W02A 4JIRA 3W7MA 3LB0A 1VLIA 3DBNA 4A3HA 2VZOA 3L7RA 2XZ7A 2XN0A 3E2VA 4P8VA 2YYTA 3F4NA 5BYWA 4DNAA 1LJYA 1VEOA 2VNCA 3M7SA 1OC7A 1GETA 3ZO9A 5A6BD 1QNQA 2ATMA 4HHHA 4IFOA 1REQB 3EEZA 1Y7VA 1OEPA 3LNMA 3PB2A 2GR3A 4L6OA 5LNRA 3B0YA 1A53A 4O0ZA 5GRTA 1FOBA 1N8IA 1JFXA 1QHPA 2QJJA 4ZQCA 2XGZA 1FDYA 4H9UA 1UMLA 3H7RA 1HJQA 3A4AA 1LRNA 4Y90A 1UR4A 1ZS2A 1VZWA 4ORMA 4LBUA 1RAKA 1PYMA 3BAXA 1K8ZA 2VX4A 4A8RA 4PTXA 1JOAA 5CKSA 4YHGA 1BWLA 1WDRA 1JDEA 4MUZA 1MXDA 1YLVA 1PZ1A 4DJED 4WQ6A 5AY7A 3OP2A 3BTNA 2H3DA 3DGRA 1KLYA 3KZPA 5DO8A 2B31A 4P8XA 3WL0A 1BTMA 2DJXA 3DYPA 2XFRA 1W2PA 4BEQA 3WLJA 1S2WA 1HO1A 2UY2A 5HK4A 3GVRA 2G3NA 4GKTA 2BY3A 3BW3A 3ZJ7A 4AF0B 4JTCA 4PTNA 4EKJA 2ESCA 3RM4A 5CPNA 1W56A 2JE8A 3D46A 3PPHA 1F76A 1KKOA 3WFZA 3OLDA 2P0IA 3NQ2A 1GOWA 1KR1A 4CGTA 4FALA 4PBFA 2DIEA 2OFJA 4ZQRA 2GVJA 3EWCA 4BK9A 4UNIA 1FWIC 1JI1A 2GJXB 5DANA 3V4BA 3SUUA 3SN1A 1BXBA 1Y5WA 5ECUA 2ACSA 3WH7A 1EB3A 4GQRA 1QWGA 2CHNA 3E49A 3EOEA 1F3XA 2DJLA 3A6OA 2PDPA 4UNKA 1JROA 2QIIA 1VAHA 4JX5A 4FNTA 2NSOA 1IEWA 3LV5A 4K7YA 3T08A 3DECA 2GRTA 5AOUA 1VD6A 1QTWA 1J18A 1R2RA 1N61C 1ADSA 3PVFA 3WUFA 5EA9A 1GOIA 4R3UA 3KDOA 4UMCA 1XV8A 4W8BA 3E5PA 4M5PA 5AECA 1D2KA 2J24A 3P60A 4C6DA 1Q1WA 1SW7A 3OZYA 1TPFA 3IS4A 3WF4A 4L65A 3RRXA 3E5BA 1JD7A 4DLMA 4UQEA 5EBAA 2BVYA 1JZ8A 1VHCA 3JVAA 4YXGA 3NVWB 2PE4A 2GVEA 1OY0A 3PHAA 4MM1A 3SR6B 9RUBA 3W25A 4XKMA 2PTYA 2Q3RA 3KWSA 4HA1A 3A13A 3OO2A 4W93A 3KBWA 1CZ1A 4DJDD 3TN3A 2EQDA 4LEQA 3QYSA 1H11A 1QJWA 1X1ZA 1FH7A 5BRBA 2NSXA 5FS8A 2AKMA 3RX3A 2XIMA 4IQLA 1EIXA 1N62C 2WZHA 1CNVA 3OYZA 4K68A 5AVHA 1KTBA 2IKHA 3E0FA 2YBUA 5EFFA 2ZC1A 5FKYA 2GJLA 3OPSA 4QISA 1H7NA 1XPYA 4YJ5A 3VI2A 4NNAA 4JIEA 4YN5A 1YPIA 2IXUA 2EJ1A 3TYDA 3NXLA 2PZ0A 5CQ1A 4J3UA 1UC5A 1L6GA 3VDCA 4JTIA 3K13A 5DCDA 1V93A 5HATA 1QFEA 1V7YA 4AHQA 4PUJA 4X61A 1AQ0A 2J7DA 1GOKA 3TW7A 4EXAA 5DMYA 3BSMA 2WMGA 2DW6A 3DIPA 3QW4B 1I8JA 1PYFA 4EF8A 3N4EA 3T09A 3RILA 4JHOA 3TUUA 3INPA 4PBGA 3TR2A 3TAKA 3FIGA 5B80A 3LADA 4FSAA 2ZTJA 2VOMA 4FNQA 1W1PA 3NJ3A 4LVDA 2P10A 1O7AA 5C7HA 3VFLA 2Y4SA 4BI7A 2A85A 2J25A 3PNZA 2VUNA 3HPZA 1QK0A 4AD2A 1FHLA 5CSYA 1ZU8A 2ZUSA 2PP1A 3P67A 2OXNA 1XG3A 1UCWA 1GJUA 1W5MA 1MFVA 2VYOA 3M46A 4GLEA 3F5KA 2B7PA 4G7EA 1XLGA 2H9AB 4MFEA 1X6LA 2D24A 1BVZA 3IV8A 1RK6A 4IWWA 2A6LA 2WCAA 4I7VA 2BHUA 4XAPA 5ECVA 5G5GB 2CCRA 2C19A 1CLKA 3PY2A 2NV1A 1BKSA 3S1UA 1CGXA 1TE1A 2D3NA 4CCEA 5LA1A 3T8QA 4FF5A 3DFPA 3TW9A 1KM0A 4I9AA 4H9XA 4UNLA 1KBKA 3P5ZA 2PDGA 4W8LA 2PD9A 3II4A 5CJ5A 3WMSA 2Q01A 4ZTXA 2X7VA 2O4MA 3ZZ1A 3CWOX 3AFBA 2C1IA 1FP9A 4KRUA 2ZXQA 5FA5A 2CFFA 3MP4A 1RLCL 3TVAA 4ZOEA 4NL1A 1MZHA 3ZLHA 1WDWA 1QPQA 3ZWTA 4QG8A 3S3GA 1UC4A 2RAGA 5GVJA 3MZNA 3B0XA 3EBVA 5L6UA 5HANA 3AIWA 5MKGB 2V2DA 3D47A 3SRKA 3GRSA 5I00A 1CGWA 2Q8XA 4GIEA 2VGGA 3WDRA 2BP1A 4JFWA 4B5VA 3RJYA 2BC0A 1UA3A 4KPRA 4JTLA 3RCMA 1PIGA 3A3WA 2G5WA 3MP5A 1IWBA 4AEEA 1ZDLA 2ANUA 2WYSA 1UR0A 3BURA 4DWSA 4XAFA 1N55A 3Q67A 4FNSA 3VAVA 4MF4A 4B3LA 3B9OA 4WGHA 4EM3A 3E2RA 3LG3A 2X1TA 1NWSA 4YVVA 3A4JA 4DYKA 1AL7A 5A95A 2OSWA 4H7ZA 4NAFB 2GQWA 4LEFA 4N4QA 3PG9A 4HYVA 2ALDA 4GISA 1CTNA 3B4YA 2OWCA 2FTYA 4J3XA 2WV8A 5HJLA 4GOAA 3THCA 1B0IA 4I6VA 1ME8A 4DM1A 4HP5A 1BF6A 4EPKA 3OLEA 4FZIA 5FF0A 2AMXA 3FW6A 4H6KA 3TROA 2OR2A 2ZZ1A 2RDUA 2RGMA 1GEQA 4UFHA 1SO3A 1W5PA 1ZUAX 2ZFAA 2ZRUA 4ZE5A 4JQ4A 3M0VA 3L4WA 1XIMA 1W31A 2XYLA 2NZLA 2B7QA 4XBSA 3KLLA 4HB7A 4O0QA 3H22A 1V3LA 3GRTA 2XWDA 5G1MA 4A21A 4XKYA 4DF2A 2W6RA 1Q1RA 2Y88A 4KRTA 3WEMA 4RV3A 3UZYA 2VX7A 3GO2A 1GSNA 3RRAA 1P0BA 2Y7EA 1PHQA 5CH9A 5ABFB 3FNDA 3GXTA 2QGHA 4PB5A 3TMQA 3G6LA 4AXKA 5AYBA 4ZB2A 3L5OA 3KTSA 3HB9A 3VFCA 4JKKA 2WHKA 5JRBA 1XKYA 3V5FA 1PS9A 4EANA 4J3TA 3C8NA 3H2CA 2IPWA 5I78A 1H5YA 5I3IA 3OGSA 2PBOA 4YTSA 3W22A 3V1HA 3ZXWA 1TPC1 5CBJA 2X8GA 4PB4A 5D05A 1YADA 2KAUC 3HU7A 4ROQA 1YDOA 3UF9A 4C60A 1CT5A 5A2CA 5JCMA 4MB1A 4K7VA 1A5UA 4D6DA 1VR6A 3FJNA 3EB4A 2VRKA 1HW6A 1W0MA 1VQTA 3POHA 1GRFA 3L0GA 4TX6A 1V5XA 4FI4A 4H4YA 4BV6A 4H7VA 1KKRA 3WF3A 1UKSA 2F8QA 2WP5A 3NYZA 4YVXA 1DJNA 4P7QA 3IACA 4E6MA 3IJIA 3BMVA 1NFBA 3GZ3A 4HNVA 3WZ0E 3W76A 1LBLA 5KZMA 1S2TA 3CZJA 4Q8MA 4XV0A 1JDCA 3QRHA 2BHZA 4DXXA 3HG3A 3R0UA 4IG2A 4J40A 3FGCA 1OBAA 3PJXA 4HTYA 1NFPA 4LS2A 2FHFA 4M51A 3DGBA 3W24A 4LCRA 4KWSA 2WVVB 3VGDA 3HURA 2YL5A 3PNUA 4JN8A 3EDKA 1ZMDA 5M1TA 4OOUA 1WOBA 5AHEA 1A5KC 3S2MA 1NF7A 4NYUA 1AK5A 1U22A 2DFAA 3LLFA 3FAXA 2OQHA 5A3HA 3K8KA 4LT9A 4EK7A 3TE9A 3W1LA 4NAEB 4UR8A 3CYJA 1W37A 3SSJA 5JCIA 3IJ7A 2J6VA 3FLUA 3QZEA 3W74A 1H7PA 4JY8A 3UEQA 2PODA 2QF8A 5DFAA 3R6IA 3B40A 1SQ7A 3UWWA 1EF3A 2V2HA 1QDSA 2XFYA 2ATSA 4Q22A 3W2NA 1DE5A 2J74A 3ABXA 1GKRA 2V5KA 4IP5A 4IL0A 1XRFA 4CEUC 3G3DA 3LCWA 1F73A 2EPKX 1EJUC 3UG5A 4XZBA 3AIBA 3PM6A 4HBKA 3SAZA 1XWYA 3GU2A 3O0KA 1R38A 3LS9A 1XQLA 1YDNA 4TV5A 2FVKA 1E40A 2AAAA 2Q71A 3CUFA 1V6WA 5IOBA 2QJMA 2HV5A 1A0CA 4F0MA 3LHZA 2X40A 1TA3B 3B0VC 3CAKA 5IFPA 2PGWA 1TJPA 1FWWA 3ARZA 1A5OC 4KFNA 3KVMA 5U25A 3T4WA 3G1FA 4EQSA 3KL0A 2C6QA 4HVXA 5J04A 1J0KA 2XINA 3EPOA 2G41A 2EXOA 2NPXA 1JZ2A 1C7SA 3UG8A 1B9ZA 1IQ8A 1ALDA 3I6TA 1OADA 1A50A 1BYDA 3RPDA 1F4AA 2PWGA 2QMJA 2WVSA 1CB2A 4HA3A 3C4UA 3N11A 2F6UA 1W1YA 4BA0A 3TN6A 4IP4A 3SW6A 4XD5A 4Q7NA 3KS6A 1BYBA 1TV7A 1XS2A 3LUTA 3WMCA 1XBYA 3GG8A 3W1NA 4LRTA 4R88A 1R2SA 1P4CA 1UUQA 2J7FA 2DZPA 2DU2A 2J3NA 5I2UA 4NT0A 5A6KA 2R14A 1XRSA 2XIOA 4ONVA 1LG1A 1BRLA 1LROA 5CPSA 4U5IA 3HGOA 2R1NA 1JPMA 1EYEA 2GGGA 4CCDA 4L1WA 5C2CA 2JF7A 2REQB 3PK7A 4Y7EA 4NJJA 2GLKA 2ZZ6A 4M52A 3C2RA 3WJSA 4EXQA 2XZ9A 3W07A 4BI5A 3SSZA 4LUTA 3AHYA 3VGEA 4B9ZA 3GW3A 4ICMA 3GXPA 4Y9PA 1K7FA 1NEYA 4JFTA 4Z2GA 1H7WA 1QI2A 1C3FA 1PE1A 1AOGA 3GC5A 2OSYA 1RD6A 4P8WA 1DEDA 1WAWA 4XTIA 3WBAA 1ITQA 4P61A 1T5AA 3PF3A 3BMWA 2X8RA 3WD2A 4E5TA 4Z08A 2ZBTA 3EMZA 4KKXA 4KPLA 4QITA 4HD5A 3BGJA 1O95A 5IDZA 3ZOAA 1TPB1 1VFFA 5HAOA 3DG7A 2NQ5A 1BPLB 3HN3A 3R07C 1OYCA 3BOXA 2HDJA 1H41A 1UKTA 1KM1A 1K8YA 3A64A 5E09A 2BB0A 4C6BA 1XDMA 1E6SM 4DJFC 5BWAA 1VBRA 3HM7A 4TOQA 4PUNA 4EWJA 6REQA 4DI9A 4HK5A 4M29A 3AICA 3NO5A 3GTIA 2X50A 2ZRYA 4QBXA 2Z26A 3EA3A 4JYFA 1JZ6A 3H2AA 4OKDA 2W27A 1O68A 4ERAA 2EPMX 3JRKA 3KLKA 4FX7A 4S3KA 2I7GA 1SUXA 3W1AA 3FA3A 2BY1A 4KCTA 2PFHA 4RJEA 4L4PA 9CGTA 4V2XA 4LWWA 1LDCA 4RCXA 4M6VA 3S5NA 3W1PA 1I1WA 1EJVC 1H62A 1FP8A 3W7DA 1XGDA 3GHRA 2ISSA 4UB9A 3URAA 1V3JA 4H41A 4DJEC 1E71M 3QZAA 3QFBA 3SR7A 5H8MA 4L61A 1X2HA 1GG0A 5BOOA 1HJSA 3KTCA 1KFBA 2JIWA 3RX2A 2YSWA 2OQLA 3CZLA 1W9VA 3WQCA 4HT3A 1QASA 2PTDA 1XSKA 4JIPA 3C6CA 3EAUA 4W7WA 5E1QA 1ADOA 1H0IA 4YTRA 4I9MA 5HQLA 3LHWA 1YXCA 3I4KA 1TPH1 4LC8A 1KRCC 4IJRA 1CENA 3UY8A 1JXJA 1LORA 1TJRA 1MRQA 2EG7A 2Q09A 1B3OA 2TPSA 3CLMA 2HS8A 3VIIA 1S3HA 2RHGA 3NQ6A 5CPTA 1M41A 3SDOA 4YYCA 3MWCA 2VFHA 4PRWA 5KITA 2VKZG 2DSZA 3UJFA 3EA1A 5I77A 2CBUA 2HEJA 3RM9A 3VILA 4GUHA 1V3MA 3ARTA 4HZ6A 1V0NA 5T9CE 1XH0A 1S5TA 3G1XA 3LRLA 3IV3A 1TV8A 2OZTA 1A3XA 5C9UA 1I2OA 3OHIA 1YKWA 2DUAA 1GRGA 1FXQA 2OKOA 1PZ2A 1MEWA 2D2GA 1EJWC 4BF7A 2X41A 3BAKA 5F4XA 5A94A 1CBGA 3UZWA 1F8MA 5EB8A 4X9SA 3SRFA 3WH8A 4JCMA 2WNWA 1UKOA 1E6QM 3O16A 1MUCA 3W1UA 5JU6A 1DJYA 1W9PA 1US3A 4K2SA 1EIBA 3ANYA 4K8HA 2C7FA 3PBMA 3ZYZA 1Z8AA 2O9PA 3VO0A 1PV8A 1TYGA 1NOWA 2MNRA 3H21A 2Z6JA 1E72M 1OCQA 3SZ8A 3NNTA 3FYOA 4DJDC 3SJ3A 1GEHA 2J6XA 3LSCA 3UR8A 3Q94A 3NQAA 3QY6A 4BFAA 4GUGA 1WB0A 4RK8A 3TN5A 4QE1A 3CJPA 1DE6A 3B9JB 1SFTA 1ZJBA 3M5YA 5C9ZA 3OLGA 5FL0A 4DX3A 1YPFA 1IXOA 3OBAA 1MQQA 3WEOA 3BLKA 2V3AA 3TOPA 3UR2A 4W5ZA 3O07A 1RALA 1VYPX 1U30A 3KRBA 3TIMA 2YDSA 3T07A 3TYEA 4NZ1A 4H4SA 1SVDA 4GH1A 1Q5MA 4XB3A 3HOJA 4JIIX 1RCOB 1UP3A 4W89A 3VOCA 5GJNA 1E9ZB 1PSCA 4LRSA 1DV7A 2PB1A 2GZXA 4UFKA 1HKWA 1GTHA 3IGXA 4F0KA 4AZGA 4GNVA 2WPCA 3IGSA 1W9UA 2P3ZA 5GJMA 3RMEA 3O6CA 4WSKA 3AJXA 4K1GA 3B8UA 1TV3A 1JEZA 3GS6A 2H6RA 4IICA 2VDGA 1JUKA 3ZWSA 3NVYB 4FXFA 4NYYA 3OIHA 2G97A 3W2JA 1C8YA 3QSRA 3GVQA 5E93A 4IMDA 1DQUA 3GU9A 4KW2A 3IGUA 1ONFA 1EGMA 4POCA 2P8BA 3UR5A 3BZJA 3UXLA 4Z2JA 3M5ZA 1EKOA 1LT7A 1TQXA 1UUOA 4C1KA 4H4PA 3RXZA 4MZYA 3M0ZA 4XO7A 2PWUA 1AMYA 2CZFA 3FG2P 5BMWA 1PX4A 2INEA 1N5WC 3CLWA 3GDRA 4Y8EA 5IHSA 1ZSXA 3CUHA 4HCHA 3ATYA 2GVGA 4RZ4A 2WQPA 3G0XA 3W2UA 2IMRA 3T0DA 1GZ1A 4AD1A 4PUMA 5LIKX 3C86A 3MYOA 2YBTA 4ROPA 3W7LA 2CWNA 2GSEA 3HQ1A 2RDXA 3O0FA 3N14A 3DEQA 3SRDA 3ZT6A 2VQTA 1VGAA 4PCNA 4ZXLA 4MNJA 2CWXA 4DY1A 2TMDA 4PMOA 3N3MA 2ZOXA 4GQBA 1XF0A 3U5YA 1JRPA 2IPGA 2CFYA 1JRBA 1R86A 3QBUA 3AC0A 3ZS4A 2XN2A 3GZAA 4JL2A 1GVOA 3O9NA 3W6YA 5H8PA 4F79A 4NRRA 3ITTA 1P1XA 3KE0A 3S83A 4KH2A 2GK1A 1HT6A 3ARQA 3GTXA 1LWIA 1Q7MA 3GNOA 4YU1A 3MP3A 2YVGA 4GYKA 3SECA 1PO9A 3EEGA 4IUGA 1H4PA 3DKJA 3I4EA 3PZGA 5DELA 3H2FA 3I68A 3WYZA 1J9YA 3D3FA 2V5LA 4MMWA 4DUVA 5I3HA 3MUZ1 1QW7A 4PE8A 1OHLA 3WQDA 3CO8A 1OZQA 4BWLA 3VNZA 3MSRA 1UWUA 2R1PA 1ZENA 3B97A 3BG5A 2EKGA 4GUFA 3VYLA 5BCAA 4KWVA 4JTQA 1R3VA 1KA9F 1KFKA 5DXXA 2VGIA 5AYYA 5EKYA 1KFJA 1XR2A 3K8LA 3GDBA 1R6WA 2Z1SA 1RV8A 4A05A 3G3MA 3FKRA 4U33A 1E1CB 1EA9C 5HOSA 4GA8A 2WHMA 3GD6A 1VF8A 1A4MA 1VRDA 1AQMA 1JGMA 4LAOA 3DHDA 4A29A 3CC1A 4UC5A 1J79A 2VZVA 4M6UA 3KVJA 1AZ1A 1HVXA 1JL8A 1FWDC 3LX9A 4JFSA 4P8UA 2IPJA 1EJXC 4KFOA 3UYCA 1RVGA 3TN4A 1I45A 4C7FA 3BCDA 3THDA 3C2EA 1DWIM 3NXFA 1GVQA 1ZBCA 4REQB 2BBFA 1X98A 5C70A 1YX1A 4GC4A 3ZR6A 5D2TA 3MI3A 4PMXA 5F1VA 3U0HA 4CD4A 1EP1A 2HCVA 1MW1A 1ME7A 3RLGA 4TX9A 2JGQA 1Q65A 1DJIA 1EDTA 3GFZA 1S5MA 1V3HA 4AIEA 1HKMA 3OGVA 3M6DA 3GD4A 4LCSA 2NXHA 1MEIA 1W6TA 4HU8A 3IIVA 1VPYA 4Q8UA 1GW1A 3AN1A 1O5XA 4MLRA 4NF7A 3O63A 2DZAA 4QCFA 5JQ9A 3FS2A 3TYAA 2J75A 3T2PA 3FA5A 3VVGA 4L80A 4JTHA 5DCEA 1IF2A 4N0RA 4ATDA 2F38A 2J7CA 3WQ5A 3AIVA 1GVYA 4XZWA 1V3IA 3GE7A 4M81A 1FWFC 4DB7A 1SGJA 1WBJA 4S23A 3T05A 4AIBA 4QP0A 1P6BA 2PRMA 3H4WA 1GJWA 4KWUA 1RP9A 3BARA 4H6EA 1LL4A 5C2XA 4IFRA 3MCMA 2BGNE 4GNJA 1PJ9A 4IIBA 4YTUA 4FR6A 1Q6DA 3WKZA 3L4VA 1QBAA 4N6FA 5DT5A 1EYWA 5A69A 1PVNA 4B5SA 3CQIA 1RZMA 5I07A 1A3WA 3BLIA 3AALA 1E3ZA 3EDEA 2Z7KA 2CC0A 2NVAA 3CPGA 1FFQA 3H8AA 2I5IA 4GO9A 1XYCA 2PDMA 4YIWA 5C8BB 4XSMA 1G01A 3URHA 3DN5A 4AIUA 4NZ3A 4V28A 5A8GA 4DZIA 2FGBA 1E4LA 4V27A 2RH9A 3W23A 1O5QA 1PAMA 3HG4A 3LK6A 4W7VA 1S39A 5A1AA 1Q7ZA 4ADSA 3R0KA 2HPMA 4FPSA 3WBEA 1GEUA 1DWJM 4CNUA 1NF0A 4MZ8A 1F4HA 3UERA 1I6NA 3OTRA 3RK8A 2HBXA 2I17A 3TTYA 1AA1B 3CWHA 4Q8PA 3QHMA 2O92A 4Q4MA 3Q6JA 1TQJA 1EOKA 3H24A 3WNKA 1UPPA 4M8UA 5G4EA 1FEBA 3CEUA 4XUYA 3PZUA 2HNHA 3GTFA 3O15A 3T8LA 3RITA 1NAL1 3OG2A 3GH7A 2E8YA 4O19A 2JEQA 3DGZA 4WOQA 4Z2KA 4LAUA 3S1WA 2Y5EA 1PZ3A 1QUMA 4WXZA 2VHLA 4DAIA 1SYTA 1PDZA 4AY8A 2F7FA 3CQHA 1QBBA 3W84A 4U5KA 3VA8A 5HA7A 4LUYA 3AIUA 3CPUA 2HPIA 4PMNA 4AVNA 3IUIA 1W3NA 4W88A 3TYUA 5FD0A 3TTOA 2XSBA 4FEZA 4GBDA 3H55A 3LN3A 4G56A 3CQKA 1XP3A 4S2BA 4QE4A 3Q65A 2Y7FA 1HG3A 5I09A 3CUGA 3H4XA 1E6ZA 4GI6A 1THFD 3RIKA 2CZDA 1SFSA 1L6YA 2A4AA 4WXYA 4S39A 3K4DA 3TFXA 4O10A 3ITYA 3MMUA 5F2LA 2QCCA 2ZA2A 4S2CA 1BYAA 1GERA 2XPKA 3TLQA 3V7PA 2CETA 4PB3A 1PTDA 2VL4A 2R9RA 5K7JA 1EQCA 1SO4A 1FO4A 4AD5A 1OG0A 1S2UA 2QHAA 1F6YA 3GIPA 4GYFA 4J35A 4LVFA 2YDAA 4C91A 4PCSA 4GGBA 3BG3A 4GHRA 2J13A 4WHBA 3DH7A 4AZ6A 4MKNA 1OD8A 1O66A 4YTTA 4MWAB 1XYZA 3CL6A 4DF0A 4W8AA 2WP6A 5I0DA 5C9RA 3W38A 1OX4A 3JW7A 1HP4A 3CU2A 4UR7A 1ZTVA 1ZKQA 4GQQA 4A8NA 3M64A 3NDOA 3KS5A 1W91A 2R82A 4I8DA 4B3ZA 2EJAA 4AFYA 5F7UA 3RG6A 1XHCA 2ZRWA 1Q6CA 5D37A 4K39A 1AW2A 4DJFA 3A7UA 1JIBA 3GG0A 1BG4A 4PMDA 4CU6A 2ZCGA 3BO9A 4FX6M 2P1FA 5I5RA 1TR1A 3C3UA 2A0NA 5EMJA 2C18A 1T6MA 1QAPA 3Q37A 3AAMA 2C3CA 3ZJKA 3VIKA 4NP7A 3G1VA 2QXWA 2BNJA 5D30A 2IXVA 2W0HA 2E3ZA 2XH7A 4A8IA 3T2OA 2PBGA 3GH5A 3ID7A 3UP8A 4D2JA 4JXCA 3FJ6A 4P7RA 3UR7A 1E0UA 2XH4A 3H53A 1O1HA 1PPIA 2D23A 2WOQA 4WJ8A 5RUBA 4ILSA 4UCFA 1Q6FA 1XBZA 2FZNA 3ZM8A 1POJA 2HXTA 4A35A 1OT1A 3NOEA 4KBXA 1XCFA 3W7IA 3C2FA 2WJFA 4L56A 2E1DA 4LU0A 3A5VA 1JG9A 4MDOA 4Q6JA 5D04C 3RF9A 4DBWA 3GB6A 1VCFA 1X7FA 2PTXA 1MO0A 4QG9A 1M03A 1AVAA 4KMQA 4A2RA 2OX1A 3AS2A 2VRQA 3R79A 3O06A 3EDFA 3WQ8A 2ABBA 3VNDA 3LXDA 1P7TA 1B30A 4XZNX 1CGTA 4DHGA 3ES8A 4B4FA 1ICQA 4O11A 3GU1A 3R8GA 5E9AA 5F2GA 3FY1A 4QQ3A 3H26A 3MSDA 3AXXA 1IEVA 1EF2A 4GH3A 2H8XA 4MJMA 3T44A 1J6OA 3PWGA 1XBXA 4PRTA 3N13A 4FOJA 5T91A 4NEVA 1UH2A 1T96A 1GKQA 1HJUA 4MNKA 4HMNA 1PB0A 2YIHA 3LOTA 1EWEA 1XXXA 3KX6A 2I14A 3RU8X 3I6EA 1K4GA 5BOFA 1GOXA 2A79A 3VZYA 1EO5A 2ZRVA 4WRHA 4LA1A 3LGEA 3E96A 3FJ4A 1JZ5A 4XZHA 4UTJA 2QJHA 5EPDA 4GI9A 1KD0A 2J7BA 2ZXDA 1XYFA 4H6RA 1C29A 1V97A 2CKSA 4Q32A 3I3DA 1FFVC 1GZGA 3R58A 1NWTA 1VP5A 1XLDA 4JEJA 1RCXB 3MO4A 1KNWA 2PDLA 1ODUA 2PLKA 2G4JA 1FHUA 3NQEA 4H9MA 3QOMA 4L9XA 4R27A 3VMNA 2YVJA 5HPCA 5HUOA 4EX4A 2HZGA 2YA0A 1Z32X 2AL1A 2ZQ0A 4JICA 3HIJA 4M82A 2NQHA 4HOZA 2V38A 3CGBA 2WSKA 4KETA 5LYRA 1CB7B 1PIIA 3CTLA 1MW2A 3LEPA 2TODA 4NZFA 1IHIA 2CBJA 4F0SA 1J4EA 4Q8WA 3RR4A 3BANA 3AZTA 1XFBA 2NQZA 4Q4RA 3LPGA 4RKAA 1ZALA 8XIMA 4GX8A 3U4AA 1VBJA 2OODA 1FCBA 2ZICA 4B2DD 1S46A 4EE9A 4GD0A 3W75A 1B90A 1VBUA 2PLJA 3P81A 5I02A 5AN7A 3P0WA 4EWND 1F6PA 4UMAA 1AD1A 2VI0A 2YFNA 3IWPA 5KVIA 2OEMA 1NOUA 3NUKA 1NWUA 4PCTA 2VFDA 1MSSA 1DP0A 4C6EA 3N73A 2JF6A 4LY8A 2A3AA 3BZGA 3FGCB 3OVQA 3OQ8A 5JBEA 1H0GA 3G5EA 4FOUA 4ZSTA 4XZ9A 3GRIA 4G5DA 1QHZA 1VBGA 1DIDA 3CZGA 4AZHA 5A2BA 1CXIA 3EA2A 1XLEA 1LCOA 3NYDA 5D32A 3MCOA 3SEPA 4WJXA 3KM8A 1JD9A 5CLTA 4JIQA 2X1SA 1JAKA 3MTWA 3UU0A 1C93A 2QDEA 4PSPA 4Q7BA 2TPRA 2YX0A 1BEUA 4W85A 3CAQA 1Q2SA 5AC5A 5LXXA 1EP2A 4WKFA 3BV4A 1Q45A 3WJXA 2E5AA 4HKPA 4JCLA 1S3TC 1TPUA 1X96A 3AMKA 3SGZA 3L4UA 3QHNA 1AQHA 4UR9A 5LIYX 3V75A 1H6VA 1TWIA 3CXOA 3ITCA 1EBHA 1WYIA 5M5DA 1TUXA 1Q66A 2QAEA 5CSRA 3IJ9A 2PA6A 2DZWA 3WQVA 5CC5A 2PDHA 4X60A 3F1QA 4LANA 4I3GA 1TCDA 3M1ZA 4PN2A 3K4AA 3KRSA 2V5DA 1E51A 4RNFA 4CNOA 4UQBA 4IIHA 1E73M 4PUEA 1RR2A 4MAZA 1R46A 4XIAA 1NHPA 2NVDA 4TMCA 4X2PA 2ZVIA 2ZX7A 2C0HA 1EXBA 2GDUA 3AU2A 3IEBA 2YDRA 2GPTA 3LBMA 4GIYA 3VIPA 3WF1A 3APGA 1W8SA 1JF5A 3T0AA 4E4UA 3EAOA 2BX7A 2PCEA 4DUOA 3GNXA 3HGRA 3UNTA 2H90A 3LTPA 1ESWA 4JKLA 2R1MA 4O15A 3MMDA 5FJRA 2X42A 2YCIX 1HL8A 2FHBA 2PWEA 2PP3A 3DHPA 2AOSA 1NIUA 3ANVA 2WC4A 1XKJA 4E2BA 3P14A 4LQ1A 1S7MA 2D22A 3WBXA 2PDQA 4XG1A 4ZCWA 2PSNA 5BOEA 1UR2A 3ARVA 2YJQA 3MU7A 1R9YA 2RJGA 5I24A 2HVOA 3DK8A 1QNOA 2JK6A 3WNMA 1F2JA 3IIOA 4JS3A 2EG8A 3WEZA 2VZSA 5FF7A 5A6AA 3NQ8A 2ZE3A 2XH0A 3S9IA 3E2QA 5BU6A 1E43A 1CX9A 2CXGA 1RQEA 2YOCA 1FXPA 2YVFA 2QS8A 1XFCA 4LSBA 1OK4A 1XDJA 1GESA 1KTCA 3NOYA 2E1WA 3L0KA 3S1GA 1E9YB 1JVNA 4GABA 2CU0A 2Z00A 4NJGA 3LHUA 4O1BA 2V6OA 1K9TA 2ZTKA 2OZ8A 3IAQA 1L6FA 3KOWA 2WSPA 3O8AA 4BEUA 3N29A 3OBEA 5AHMA 3IVTA 4NI8A 3RCNA 4JTRA 1H7XA 3HV9A 1TPWA 3RU6A 4PTDA 1P1MA 3MJYA 3IGHX 2Z2UA 3PBYA 1TELA 3HO8A 4I5RA 1W2VA 5B7ZA 2CZEA 2VEKA 3FK4A 2DVUA 1J2WA 1R87A 4HYWA 2NXGA 2Y85A 5E5CA 4LX4A 3NL3A 2PU1A 2W3SA 4XBJA 4EQWA 2QCGA 3UVIA 1MW0A 3U2EA 1FHVA 4EOUA 1W3IA 4WZHA 1EL3A 2WW5A 3WN6A 2NLYA 3O6YX 3LBCA 3PN8A 3LCGA 4DPPA 2L5HA 3V5CA 4HJFA 2WSYA 3E2SA 3N2TA 2CLFA 4IMGA 4J3ZA 4XAZA 1BKHA 3LU2A 3FV9A 1KFWA 6REQB 1J93A 2HQMA 3GNPA 1F74A 1F3TA 3RFAA 2WO5A 4FXSA 2B7NA 3K1GA 2OYLA 1S5NA 2G50A 4W87A 2J9ZA 4Q4SA 4ZBCA 1YQZA 3ES7A 3H2EA 1ZBWA 1KBLA 1MXSA 5G4WA 4EPDC 3VCNA 2ISWA 1CEOA 1ZRQA 3K46A 5BRQA 4MZ1A 2XVKA 5D2YA 1J01A 4J2MA 2ZUVA 2YCLA 3P61A 4Z2IA 3VKJA 1P6CA 2ZDSA 3M6YA 3T42A 4X63A 5FMHA 4RL3A 4BZYA 3A4XA 1G0CA 3LZ5A 2EQ7A 2PWDA 2X2GA 2XM2A 3DH9A 3G8EA 1EA0A 2VD9A 3GAKA 5IDIA 1RQBA 3SY8A 2YCEA 3GDMA 2QV5A 3TXZA 1ZBKA 4ML4A 2WANA 3I65A 4Q4PA 4O14A 2ACRA 2HTMA 1ZMCA 1YQ2A 3AYRA 2YZRA 2XIQA 5KVHA 3TSBA 1H2IA 2Z1VA 4PR4A 4P7NA 4OIFA 3LZ3A 5K9CA 3TQ0A 4HTBA 2FHCA 2NT0A 2BHYA 4JQ9A 4H4ZA 3EWZA 2X09A 1JULA 4HHPA 2Z24A 2NX1A 1OQFA 4QEEA 7ENLA 3DK4A 2CLLA 1DWAM 1GTEA 3P93A 4UTLA 1WX0A 1PTGA 1BYCA 4KGLA 4AW7A 3SQPA 4ACZB 4J3WA 4E4FA 1LUCA 3TR9A 3VNLA 3WQFA 3KOYA 4YLWA 4ZFCA 1SJAA 2D0GA 2WQDA 1J0ZA 5JH2A 3WDJA 2FPTA 2EGZA 4AWUA 3M5XA 2ZZCA 3UG4A 1Z42A 2WZEA 4Z0JA 3LXCA 3EX4A 2W91A 4H2HA 1RUSA 3WD4A 3SURA 1H1NA 5FSDC 4UTKA 3TYBA 4J5NA 1BSLA 2VFFA 4IPLA 5D2WA 3W01A 1POKA 3HMCA 2YXOA 3SY5A 1QATA 3GR4A 2C71A 3KDNA 4CVWA 1S38A 4G2DA 3GM8A 4CD7A 1TZZA 5AHFA 4K38A 3KEHA 5BNKA 1GGOA 1YTEA 1QNVA 3L5AA 4C1NB 3KW3A 3FSTA 4J28A 3S5SA 1N8WA 4NSBA 3WIJA 1V6TA 2CW6A 3W1MA 3B8WA 1H7OA 2D73A 3PG6A 2INFA 1RPKA 3VNMA 4ZA0A 1MO9A 1YNYA 4FA3A 4ZO6A 1FCVA 1R3RA 4NRSA 3TZFA 1CXLA 4F0LA 2WAGA 1EC8A 4CD8A 4AQLA 4DYJA 2E5CA 3CV1A 1U5JA 3H7UA 2WHJA 4OOZA 2FH8A 2GOKA 1VFTA 4LTSA 1AJ2A 2ZDRA 2JKPA 3STCA 4EMJA 1OFEA 4W5UA 1MXGA 1SMDA 4IFKA 1QHOA 4IP7A 4DUWA 4ZOHB 3CB3A 1I2PA 1PZ0A 2VD8A 1UUMA 2VVNA 2EPNA 3UVAA 2W79A 2A7NA 4GYJA 4D6JA 1Q8AA 3R2GA 5LNWA 2UZ9A 3NFUA 1DWFM 3AO0A 1LM1A 3GBDA 2DGAA 1KM6A 1SR0A 2VEMA 1I2NA 3F5LA 1YEYA 4Q8NA 5LIUX 5DY3A 4DPQA 3VGGA 1X8FA 3OU8A 3WBWA 3OB8A 4XZLX 3FA4A 1IR2A 2FGZA 3U2CA 1DKWA 2ZUUA 3AYSA 4NX5A 3SM0A 2DT0A 4YWSA 2FZDA 4WDWA 4D6GA 4DBUA 4J7RA 2E68A 1TV4A 3WUEA 4JQ1A 3QLLA 3UG3A 3W86A 5I03A 3Q58A 4O53A 3GXMA 3SQLA 3RUBL 2QQ6A 1XISA 2J8TA 4GNKB 2AKZA 3C0JA 1Y5VA 5AYXA 3EB2A 1CLXA 3VX1A 1WXZA 3P5YA 4WIWA 3QY7A 1NSJA 4HN4A 5C7VA 1BGAA 1ITXA 3NGJA 4R9OA 3OIXA 4DVOA 3BLFA 4KIEA 4XTDA 5JXQA 3WJZA 3NZQA 1ISVA 2ACQA 4LUJA 4FAMA 3C0QA 1RA0A 1EX5A 5D2VA 2YLAA 1V6YA 1LF1A 4QHRA 1JXKA 1UD8A 1IT0A 2JKAA 4E8GA 4ERIA 2NX9A 2ZX8A 3CIWA 2WNQA 3NGFA 3G6MA 3QFWA 4B3KA 3ENLA 2QGYA 5L9FA 2PTWA 4ZVJA 2YW3A 4AYGA 1REQA 4XISA 4C65A 2GK1B 1KXVA 4F3HA 3L23A 1UKPA 3E3HA 4N9BA 3T55A 4JN7A 1XD0A 4GJ1A 2ZE0A 4LOCA 3LY0A 3BQ6A 4MAVA 5D8WA 4LAMA 1SMAA 1M1BA 3S1XA 3MKCA 3QQ0A 4JYEA 1ADDA 1W54A 3N1AA 3UETA 1Q63A 1R3YA 1RY8A 1W1VA 2BWGA 3WLHA 2D2JA 3EKLA 4G1KA 1UR9A 2C3ZA 4OFCA 1FKWA 1DJHA 3B05A 3OC4A 1W5NA 1GQKA 3ZLFA 4Q7IA 4WD0A 4EQRA 2AL2B 4S3JA 4CD5A 3ABRA 3L66A 4DWSD 1NU5A 2YGYA 3P8IA 3H2OA 3WNNA 3OOQA 2E0PA 1RBLA 2PDWA 1O5RA 2Q6ZA 1OCBA 4B5NA 3BLDA 5K4ZA 1N8FA 1EJ7L 1SFLA 1TCMA 2Z6IA 3KBJA 4HNCA 5AB3A 3LCHA 1G6CA 4QNEA 7A3HA 3VX0A 1CI1A 1FHDA 4O54A 3KOFA 3QV9A 4RNJA 2RDTA 4M56A 2PCQA 1NHQA 4EQXA 1KBIA 4M3PA 5EMUA 3WUBA 1M65A 4AF0A 1S1RA 5FOOA 1NTHA 1CXKA 4RPQA 1FWTA 1XSIA 5AYIA 2QPSA 3BSGA 4WX2A 3DXIA 2Y7DA 3F03K 4D1JA 1GW9A 4B5WA 2QV4A 1U5VA 5EL1A 3SUTA 4L64A 4IF2A 4MADA 3GHTA 1WDQA 2QCFA 3OG3A 2QIWA 1AD4A 3GG7A 3AUJA 2GJXA 4PGLA 4H83A 3NQMA 2UY4A 1R3QA 2VX5A 1ZY8A 2YKKA 3CBWA 3BJFA 4QM1A 1EZWA 3KBNA 4F0HA 2VUYA 4KWWA 3ITGA 4GACA 1D8CA 5TQLA 3S6OA 1QW9A 3WD0A 4PUUA 1KM2A 2OGJA 1ZQ5A 2VT0A 4AZCA 1K02A 1IT7A 1XLAA 5CJNA 3REQB 3PUDA 1UQZA 2PDUA 4DO6A 4NVTA 5D09A 2D69A 3PZMA 2WVUA 4PH6A 1CGUA 4B91A 1W3LA 4QGCA 4PL2A 3U3HA 2WLZA 3DUGA 3WH9A 1BGGA 2PDKA 5BXRA 2EF9A 2WHLA 4F2UA 4QROA 1F3EA 4UOZA 4QDMA 5FJUA 3LGDA 4CQ9A 1I60A 5JCNA 1ML1A 3CIXA 4Z17A 1E4NA 3G0UA 3BDKA 4ICCX 3VKBA 1DPMA 3SCRA 4GK8A 1LP6A 3CQ0A 3E0LA 3M4HA 4WUIA 3N6QA 4NJIA 4D8AA 4N6EA 3PTQA 4PBEA 4K7ZA 2GDQA 4JHZA 1VFUA 3MBDA 3MI2A 3BAIA 1GRHA 1J12A 3CO4A 1F8IA 1V79A 4U3AA 4RX0A 4GGHA 4H2CA 1R3WA 3W2MA 3S42A 4FNRA 1OGSA 3BK0A 5HJXA 4Z1DA 1JAEA 3F7JA 4UTWA 3WD3A 1TPVA 1EX1A 2G4FA 3UGVA 2QVNA 5GNXA 2EPLX 1XGZA 4TVCA 4FP1A 1UWSA 3DESA 3P3BA 3QMRA 1MUWA 4MYAA 5AKQA 3E02A 4LIIA 1OK6A 2PC4A 2EPHA 4D8ZA 1DTNA 4K6AA 3BCJA 3NVVB 1EUAA 1GHRA 4EPEC 3LMZA 5GQBA 4OJYA 2VEFA 4AB4A 5HNUA 1EOMA 3I6RA 1JPDX 3OJGA 3VDBA 3GXNA 3BH4A 4UFIA 5CPOA 1UWQA 1JYVA 2SFPA 2AAQA 2FPVA 1QWKA 2VC6A 4ZL1A 5LSMA 4KESA 3NZ1A 3FOKA 2FTPA 2QUUA 3D3AA 3UZ5A 3VKAA 5TIMA 2V30A 3L8KA 1OVDA 2H9AA 1FCUA 4A3YA 3H2MA 2QJIA 4MB3A 2CIPA 3WJYA 4L6DA 4JTDA 2GWGA 4KQNA 3QGAC 1DWGM 5EYWA 1CCWB 2J8FA 2WMJA 1JDFA 3ARUA 5T9BG 1VEMA 2WPEA 1M01A 3HW2A 1ZXIC 3NWRA 3DYOA 1JCNA 2FLIA 1YPXA 3HQNA 3BL3A 1BD0A 1HFBA 4PTWA 2V69A 3DBPA 2BDQA 1GK8A 1NVMA 1IV8A 5SWUA 3TAOA 1FFUC 1OFBA 1HJXA 1XX1A 4R33A 1JUEA 1KQZA 2EPOA 1YRRA 4QS6A 5ABEA 3D9XA 3VOJA 1VEPA 2GUYA 3USZA 2PF8A 5MKGA 1H1YA 1X38A 1TTJA 3GXFA 4JFVA 1E1EA 4DUXA 1U1HA 2YA1A 3VUPA 1F05A 2V6AA 5HR7A 1VB9A 3QVQA 4MNLA 1MFUA 2PLMA 4LCQA 5BXTA 1ZX9A 1V6UA 1XICA 4JQ3A 1YNQA 2XSAA 3QR0A 3AZSA 3R11A 4M24A 1HZYA 3B4UA 4CU7A 3VGHA 3A22A 5CGTA 1VPQA 2DVTA 2QVHA 2X1IA 1K6AA 2IQDA 5CG7A 3GC2A 3PR2A 4I5XA 4FK9A 4NAFA 3SN0A 3WX7A 3DX5A 3CL8A 1FFRA 1A0DA 1NY1A 4YCPA 4Q4QA 1K4HA 4NASA 1PDYA 1GOOA 4IZGA 3EPMA 4QR6A 1IZCA 2YL8A 3LRMA 2BY0A 4X0NA 2W92A 2WMHA 1UZDA 3NPUA 3IANA 1A0EA 1I4NA 2HE5A 4O1CA 1BG9A 4JYDA 2Z4GA 1J5SA 4ZOBA 1XUUA 2A8XA 1M7XA 4HA4A 1UOZA 2X2YA 3D5HA 1ENUA 4AHPA 2W4XA 1Z3NA 3CZEA 4U31A 1XH1A 7REQB 4J56A 4RZ6A 3BG9A 1F7BA 2G3IA 2PDJA 2XVNA 1RSCA 4H1ZA 1DQXA 3DG6A 3CHCA 5ABFA 2QCHA 4FMVA 2EO7A 2YFOA 3CUJA 1XI3A 1ONWA 3HMJG 1XIGA 3ELFA 5IBXC 5JIWA 3CNYA 2BXVA 4P7LA 5AHLA 3HPXA 3T0TA 3W7GA 2Z7GA 4KEZA 3I3EA 3CV7A 4HCDA 1G67A 3UCQA 4XZIA 2OGYA 2OJPA 1BF2A 4JD4A 1BFNA 1O6IA 3NVDA 3N25A 1SJDA 4OGZA 5EY5A 5AZ1A 1KCXA 1WV2A 7TAAA 5D02A 1XYBA 1X7IA 3WL1A 1XM3A 1GQLA 4FX8A 1HJVA 3A4WA 3N2MA 5CZJA 5DN1A 4GO8A 2GJNA 4BQ5A 2OOGA 4BQ4A 2I5GA 3VXGA 1A5CA 2A3LA 3MUY1 4UOQA 1IE7C 2CBVA 4A3UA 1MRAA 2Y63A 3N04A 3EWWA 2OEJA 1PKNA 3TA9A 1GORA 4O1FA 2BASA 2ZXAA 2DT2A 2QCEA 1FH9A 1M7PA 3QKZA 3R8HA 1MNSA 1TZ9A 2OO6A 3TTQA 4GJJA 3S5ZA 3TU9A 1MVYA 4C6KA 4DXVA 2HK1A 1IEQA 3N9RA 5BU9A 1S5VA 1TFVA 5GNYA 4AWEA 1GWJA 3AMDA 1TSIA 2X16A 5AC8A 4QJ4B 5LIWX 4UQAA 3DFNA 2ZX9A 8A3HA 4N2YA 1WZAA 1GVFA 4IISA 4YWOA 1KLZA 3QZ6A 1FVPA 3VD3A 4X2RA 1M53A 4AISA 4O50A 2DQXA 5K9XA 3N9KA 2NUWA 4QCEA 5M03A 1E6NA 3TDFA 1W1ZA 3HJEA 4ZENA 4D6IA 1LBFA 4AH7A 4R7JA 4NAEA 7XIMA 2VCBA 4NJHA 5AC7A 5DY2A 4D72A 5LA2A 2ZIDA 3ITLA 3VKKA 4WGXA 3PZVA 1N63C 1WKYA 2WZIA 3NPWA 3AHVA 1ONEA 2BV9A 4YVPA 3NL2A 3QTPA 4B5UA 2RKXA 2R8WA 4G6CA 4X9YA 5D2XA 2V8ZA 3VNKA 3UXKA 4X3ZA 4I9TA 1K4QA 3TFCA 3M0JA 3MI6A 2D2OA 4AMCA 2EQ8A 2WK2A 1HO4A 3THAA 1W9BM 2JALA 4GVHA 3KFTA 3PBGA 2D2HA 2PWHA 5C55A 4OT7A 2CLOA 2PC8A 4IIGA 3HTWA 3UA3A 1TA3A 1UYQA 4HQVA 3WSUA 2OCZA 3RMJA 1HP5A 4PULA 2TAAA 3TJXA 1H49A 1W1TA 1AODA 1H7RA 5FF3A 4NEWA 1V6VA 3APTA 3PZIA 2EQ9A 3SCPA 3RLUA 3TONA 3WLOA 3WFAA 3RO6A 3TSMA 5CC6A 5CXPA 4JDRA 3BVJA 4UFLA 4MHBA 2QEZA 4IQDA 4LS1A 4A2SA 4HK6A 2ZKMX 1H2JA 1RBAA 2QAPA 2F84A 3KRZA 4HPGA 3WF2A 5EBUA 1E6RA 4XD4A 4L1XA 5HULA 3SQMA 1H63A 5XIAA 1PHWA 2HVNA 2BFGA 3VCRA 4FIRA 4HU0A 1MQRA 4D6HA 4Q4KA 1BWVA 3G22A 4UZSA 4E2VA 2F2KA 2VWSA 5EMLA 3AS1A 6TAAA 4O13A 1I0DA 5C5YA 5CEWA 3U8GA 3XIMA 2WBGA 4J27A 4L4MA 2DEPA 3SCVA 4GCAA 3CHVA 1FQ0A 3POCA 3N2CA 4LV4A 4PMYA 3T81A 3DG3A 4FF7A 1ZCOA 1XANA 1ISWA 5J8LA 2REQA 1QW8A 2WJDA 3ZT7A 3KBMA 1DWHM 1PUDA 4HOWA 3DC0A 1IIGA 2W54A 3CASA 1C9WA 3KBSA 3OYXA 3Q2DA 1VFOA 2G3MA 3NDZA 2UY5A 4NXSA 2Z29A 3BLLA 1XIJA 4MPQA 2GR0A 3B9NA 4XD3A 4AUBA 3UD6A 2JQXA 5LGXA 1HTIA 3PZQA 1JCJA 1JYWA 3V36A 1E5NA 3B03A 4X22A 4JNZA 3DAQA 4MWAC 1TUFA 4QXIA 1QOQA 3PFMA 1UZHA 1TREA 3NM1A 4ALDA 1JF6A 3URNA 3R12A 2PDBA 5KMYA 3VGBA 1KGUA 3QV6A 4Z1YA 3UCDA 4UTMA 3ALGA 5LZLA 1EHAA 1PIFA 3GDLA 1ZPTA 4NX0A 1D7YA 5ENLA 2A3BA 4PEEA 3N19B 4FLSA 2GGJA 2WPGA 4LW7A 3SUVA 4KT2A 1Q6EA 4CN6A 1IXQA 4IMAA 1UR1A 3TCEA 4UIOA 5FJJA 2J7GA 4H8HA 3DHFA 3IIXA 1L2QA 4A22A 2WOWA 3QMTA 1UR8A 4OBRA 3L12A 2QUVA 4D8LA 5H91A 1LL6A 4N7QA 1CXFA 3MANA 5HXMA 4N9CA 3M0YA 4JTJA 6XIMA 4ZQPA 1QPNA 2VC5A 4LNCA 2Q3OA 3WLRA 2CXEA 1LVLA 2ZRZA 3GKAA 1HUVA 3R4IA 2AGTA 1AFSA 1WZLA 3TMLA 3GQYA 4GC3A 1K8XA 1IEXA 2Q8ZA 3BJSA 1DYSA 3KCJA 2C14A 3MMWA 3WQEA 4US5A 3BGAA 3NEVA 2XSXA 2W5FA 3RCYA 8TIMA 3K30A 1CXEA 1HL9A 2OQYA 4AZIA 3GKFA 1SPQA 1LBMA 4C6CA 4S3CA 4CNTA 2CHOA 3VU2A 4GCXA 3PJUA 1JZ3A 1DTUA 2WJZA 4GY1A 2OOFA 3UCCA 5DMMA 2CZ5A 1WKEA 1FA2A 1SZFA 2E9BA 2AQVA 2CZVA 1DJQA 1RA5A 1FDJA 4OECA 3SCQA 3B04A 4MY1A 3MHGA 4S3DA 1R5YA 1Q2RA 5DLCA 1OABA 4A6GA 1KGWA 4AU0A 2BGSA 2CESA 1GQNA 1VRXA 3DGHA 1JDDA 2VELA 1V08A 4E38A 2FPYA 1K03A 2EAWA 2HE8A 3VD4A 3S6DA 3ALFA 4JL1A 3W4RA 3EPNA 3N34A 4AAJA 1T99A 3UT0A 3IJ8A 3WQ4A 5BWFA 3DYMA 4R53A 4WY0A 4GZIA 5E70A 2JKEA 3MDUA 5FF2A 3FVMA 5EMMA 2DH3A 3SO7A 3RX4A 3S2NA 4UBPC 3GWQA 5HMDA 4NZJA 1XC6A 1WCGA 2PD5A 2Y89A 3TV8A 1SJBA 4BQ2A 1H09A 4EPBC 1B3XA 3TZNA 3URBA 8XIAA 3M16A 4IHCA 3CUXA 4UXDA 1HX0A 2YCLB 3ITOA 3NSNA 4H9TA 1UBSA 1SSGA 1B9BA 1Q85A 2J79A 3OA3A 2BCPA 1UD6A 3DZ1A 4Z42C 1NHSA 3EXRA 4JZ5A 3M0LA 3QW3A 2ZZ0A 1KRBC 3NURA 2Y1HA 2HK0A 3AHZA 3UGRA 1YHTA 1IXPA 4L4LA 4W84A 2B81A 1EQPA 1LLOA 3WO8A 2YZ5A 5H2ZA 3PBVA 3O05A 3W7RA 2QYGA 2WPBA 2Q02A 4AMAA 3FAWA 1MWOA 3SIZA 3CAWA 1SR9A 3ERPA 4S3FA 5M3WA 2FB2A 3CL7A 4TMBA 1A5SA 1IYXA 4Z2HA 1KCZA 1AZ2A 1J96A 4OV9A 1W3JA 4H4WA 2FVLA 3GTNA