4DXKA

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue, na and phosphate
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
400
structure length
364
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRAFKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue, na and phosphate
rcsb
source organism Agrobacterium tumefaciens
total genus 125
structure length 364
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dxkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dxkA01
2DW6A 3D46A 4Z17A 2ZC8A 3SBFA 3BSMA 2OZ8A 2QGYA 3FYYA 2P0IA 4IT1A 3UCCA 3GD6A 2XH4A 3ZLGA 4MKSA 3DIPA 2AL2B 1SJDA 1ELSA 3R1ZA 3D47A 3T9PA 2ZADA 1JPDX 2ONEA 4IHCA 4ZA0A 3N6JA 2PSNA 2FYMA 4GYPA 4HNLA 4FP1A 3QLDA 4HPNA 1KKRA 2AL1A 3PWGA 4A3RA 2CHRA 2GDQA 3TQPA 3CXOA 4JN8A 4A6GA 3VC6A 2PMQA 3IJLA 4MGGA 4G7FA 3TW9A 2MUCA 3I6TA 1MDLA 3MZNA 1W6TA 5FJRA 3TWAA 2HXUA 2GL5A 5BOFA 3N4FA 2GGGA 3R11A 3MSYA 2PCEA 1MUCA 3I6EA 3JZUA 3ZVHB 1F9CA 2XSXA 3SQSA 3TJIA 1SJAA 5FJUA 4Z1YA 4H1ZA 4HN8A 3DGBA 4GMEA 5IDZA 2PTZA 3TCSA 4K8GA 2PTWA 3CK5A 3QKEA 3VC5A 3SN1A 4ROPA 3EKGA 3V4BA 5J04A 3V5CA 3VA8A 1DTNA 1FHUA 3NO1A 3DERA 1JDFA 1MNSA 3DEQA 3DG6A 2QJMA 3NXLA 3IJQA 4G8TA 3Q45A 3MWCA 4DX3A 2PP1A 1SJCA 1L8PA 3OZYA 1EBGA 4KT2A 3RGTA 3S47A 3UXLA 6ENLA 4KEMA 3DDMA 4KPLA 3ES7A 3PWIA 3V5FA 1P43A 4X2PA 3U9IA 3VFCA 3QPEA 4JN7A 2PGWA 3VDGA 3H8AA 1EC9A 3CT2A 5EU9A 4K1WA 4GFIA 1R6WA 3P93A 2XGZA 3DFHA 5ENLA 3HPFA 3H12A 3BJSA 4IL2A 4HCHA 4HCDA 2HZGA 2P8CA 4A35A 3ZLFA 3KUMA 2XH7A 1E9IA 3T8QA 2QJNA 1EC7A 2OG9A 3VCCA 2OX4A 3H70A 2GGJA 2P3ZA 1KD0A 2QDDA 2OFJA 2GSHA 2HNEA 3R10A 1KKOA 2GGEA 4IP4A 3RCYA 3ENLA 1JCTA 2OZTA 2P88A 2PU0A 3EEZA 3OW1A 4J1OA 3UCDA 3I4KA 3GO2A 3QN3A 2PP3A 3K1GA 3MQTA 1PDYA 2O56A 4GGBA 3DESA 3TJ4A 3DFYA 1PDZA 4DWDA 3PK7A 3GC2A 4HYRA 3SSZA 1JPMA 1YEYA 3R0UA 3T4WA 1XPYA 4YWSA 3RO6A 2RDXA 3UJFA 3BOXA 1XS2A 3N6HA 3H7VA 1SJBA 4GISA 1BQGA 4E4UA 2AL2A 3SN0A 2FKPA 2XH0A 2GGIA 1EBHA 3NFUA 4H2HA 4DN1A 3RRAA 1TE6A 3JVAA 3PFRA 4F4RA 2QJJA 4E8GA 3B97A 2OKTA 4DYEA 3T6CA 3Q4DA 2AKZA 2PODA 3FXGA 7ENLA 4M6UA 1NU5A 4JHMA 2OQYA 2OQHA 3ZVIA 1MDRA 4ENLA 3P3BA 2OVLA 2OZ3A 4DHGA 3MY9A 3RITA 1BKHA 3OP2A 4IZGA 2QQ6A 3FCPA 3THUA 3DG3A 3UXKA 1TZZA 3R25A 3OPSA 2OPJA 3ZVHA 1IYXA 3OZMA 1ECQA 3VCNA 4J3ZA 3UJRA 2GGHA 3UJSA 2QVHA 2OLAA 1RVKA 4H83A 2MNRA 4E6MA 5FJOA 4GYPC 4HNCA 2XH2A 3RR1A 2OO6A 3N4EA 2PP0A 4MMWA 3FV9A 2QDEA 2PTYA 4IL0A 4M0XA 3TTEA 2DW7A 3TOYA 4DXKA 5FJPA 1WUEA 2P8BA 3UGVA 1KCZA 1R0MA 2PU1A 3CB3A 3CYJA 2PGEA 3UJ2A 3R0KA 3IJIA 1TKKA 4KWSA 3OTRA 5FJTA 3V3WA 3DG7A 3U4FA 3MKCA 4E4FA 2I5QA 3FVDA 3CAWA 3NZGA 2AKMA 2PTXA 2NQLA 4ZCWA 2HXTA 2PA6A 3IK4A 1NELA 3MUCA 5BOEA 4HCLA 1OEPA 3P0WA 3JW7A 2PPGA 2PS2A 3S5SA 4K2SA 2POZA 1WUFA 1EC8A 3SN4A 4H19A 3STPA 3TWBA 4GIRA 3ES8A 3FJ4A 3QTPA 4GGHA 4FI4A 3SJNA 3UJEA 4IP5A 1MRAA 1FHVA 1ONEA 3ZLHA 1P48A 4E5TA 4EWJA 3GY1A
chains in the Genus database with same CATH superfamily
1EJTC 1XSIA 4Z17A 3VPLA 1FWEC 4QJ5B 1D2KA 1U2YA 3UWQA 4HN4A 2TSYA 3IIOA 3ELFA 2GR0A 2VFDA 5ABFA 4D6IA 4RZBA 4XAZA 4O52A 3ZLGA 4MKSA 1WOAA 4WKFA 3N34A 3N6JA 4R9XA 4KFNA 1V6WA 3N9SA 2WM1A 3BVJA 1RR2A 1VDVA 1G7VA 4BWLC 5C2XA 3ZR5A 5C55A 4YNGA 1OG0A 2HNHA 2P0OA 3HQPA 3TQPA 2IKJA 4P61A 1U30A 3TN4A 2QAFA 4IICA 2QV5A 2NUXA 4MKNA 1R9ZA 5C2GA 1FWNA 4D6EA 3I65A 4IF2A 5FJRA 1CXHA 1G9HA 2PD5A 4J3WA 1BQCA 3LCGA 4Q4MA 4B5WA 1A47A 3EWZA 2YSWA 1EXPA 3WLIA 4WIWA 3IVTA 4KGLA 4MOZA 4O8AA 6TIMA 4MJ4A 2V3EA 3SADA 2Q8ZA 4BURA 4MNJA 1KWKA 4U5IA 4JQ3A 2A3CA 2A8XA 2PCQA 5MF5A 3SUVA 5HQLA 1B54A 4B92A 1H11A 5FEXA 2YDSA 1JRPA 4MY9A 2BHZA 3AZSA 4WY0B 4DWSB 4QE5A 2TYSA 4X61A 3VC5A 6CGTA 1T99A 3RM9A 3VE9A 1YPXA 1A3HA 5G5GB 2ZZ2A 3TTSA 1TCDA 3UVAA 3L5LA 4Q32A 5BYWA 4BF5A 1G6CA 3W7GA 2HK1A 1LWHA 4LAKA 4QSFA 1XD0A 1K6AA 4DX3A 2PP1A 4S3DA 2VGIA 4Q8QA 4J3SA 3HPXA 2G5WA 1R2RA 4A3UA 3LN3A 4YTRA 4KT2A 6REQA 3EWXA 1KM2A 3AIUA 2FDMA 2BVTA 3A22A 5DXYA 3EBVA 2EQ7A 1WDDA 1JGIA 4N4QA 1LLOA 2WC3A 1GVFA 3FVMA 1TQJA 1OG6A 2VEKA 4K1WA 1X6UA 5EKYA 3NDOA 1XDJA 2Z24A 3R5EA 5JIPA 2NX1A 1U1JA 2Z2BA 2X42A 3QR3A 2GSEA 5CBIA 3M5XA 3SUSA 2PF8A 1JYNA 2ZUUA 1FQ0A 3B0YA 1QXLA 1Q4WA 4MG4A 2WCSA 5AYYA 1DYSA 1HGYA 4XZWA 3FAWA 2YPIA 1VAHA 2OG9A 5I5RA 3KS6A 1XICA 1IR2A 1EYWA 4LYKA 4ZE5A 3EB4A 5G1TA 3A21A 2OFJA 5CPQA 1MYRA 1N82A 4K39A 1LWIA 4RZ4A 3ALFA 3TIMA 4UQ9A 4NZ5A 5A6AA 4WLCA 1TMQA 1PYMA 3VDHA 4P7RA 4B5SA 4EWND 2P88A 3GDMA 1V3MA 5E9AA 2QYGA 3TW7A 4Z42C 2XIQA 4M1BA 3CNYA 3QN3A 3SCRA 3RJXA 2WZIA 3LSBA 4EX4A 4LX4A 2NQ5A 2EAWA 5A6KA 3K2GA 4BKNA 1VBHA 5CSRA 5JXQA 3GVWA 4DI9A 4ZOEA 4UR7A 1RY8A 3GXNA 3R0DA 1AVAA 4ZVJA 1EO7A 3GU2A 4NX5A 4GHRA 3UPBA 3WKZA 1DL3A 1KV5A 1JPKA 4Q4OA 2WNQA 2OR2A 4IP7A 2Y89A 4O1DA 3C2YA 1S7MA 1A3WA 3VTRA 4BQ4A 3LRMA 4LVBA 1AQHA 4IUGA 5CZKA 1GG0A 3Q4DA 4IIEA 3M9YA 2AKZA 3N2MA 3U2OA 2D2HA 5CPTA 5D32A 1LQ2A 1TVNA 1B31A 2J3NA 3VNJA 3WNPA 2UWFA 4AAJA 4FB7A 4V2XA 3MWAA 4UZSA 1XFBA 1E3ZA 3JUGA 5HMSA 2YLAA 3DFOA 1DBTA 2AMGA 4GACA 2DIJA 5HR7A 3QJAA 1WZMA 3N14A 3ZVIA 2E77A 1DPMA 3WLMA 1UKSA 5LNVA 3EWDA 2BX7A 3OP2A 4AMAA 4H4TA 3TAKA 3M5ZA 3PUDA 3QGAC 1PIIA 2X09A 5IFPA 4U2ZA 1REQB 3UZWA 1R7AA 3OVPA 4HNCA 3NZRA 4E8CA 4FA3A 2DEPA 1TV3A 3F5JA 2QDEA 3CQIA 5K2ZA 3OQEA 4M0XA 1YDOA 1BWVA 3UWWA 4P2VA 3E5BA 1XISA 2VFFA 2VTFA 1HVXA 3ANVA 3L4XA 5IHSA 1WZAA 2NQJA 5A6SA 3ATZA 2V5BA 3SRKA 1US2A 3MO4A 3R2GA 4B9ZA 3QYQA 1J9YA 3T07A 1UBPC 2CFFA 5LNRA 1RD5A 3MKCA 4XAPA 3L8KA 5D04C 2V5JA 4J57A 2CLEA 1EGMA 2BBFA 4TU1A 3E0WA 1J96A 1Y8BA 2DZTA 3EXRA 4F48A 3GFYA 1WUFA 4GQQA 5LA2A 3SR6B 4AYGA 5BRQA 4Y90A 3GTHA 1M7XA 3KVJA 3B8IA 4AX6A 3CXBA 3F5KA 3T44A 2HROA 2L5HA 2VKZG 3UCQA 3V16A 2J7HA 4QP0A 4MB3A 3ARWA 2VQTA 1VCFA 3MB9A 3AU2A 2W66A 2CFYA 1G67A 2ZBTA 5DRCA 2NQZA 4WJ8A 3OVQA 4XUGA 1UA7A 4UTKA 4ORIA 1C9WA 1ZBWA 2VC9A 4YWOA 1ZLPA 1XGZA 4QROA 1AW2A 4AEOA 2VQUA 4OOUA 1WDRA 1M03A 4YCOA 3W25A 3S1WA 1BRLB 3W7RA 1AZ1A 4NHVA 3S2LA 1VHCA 4NYUA 2OX1A 1GQJA 5CBJA 1TTJA 3S4TA 3GS6A 5HNTA 3GDKA 3PWGA 3P80A 3MI6A 4J3UA 4KS0A 2O9RA 2HS6A 3N2TA 3NO3A 1S2TA 2EQDA 5F4SA 3HIJA 1F07A 1MRQA 2UY5A 1I1XA 3A9BA 1XUUA 2NXGA 3SCWA 5BNKA 1H61A 3BJTA 3WF0A 4D8AA 3E6EA 3EA3A 1E6PA 4DNMA 3NQ8A 4GNVA 2PEVA 1CYGA 1HKMA 5ABHA 4I3GA 1C3FA 3CQKA 3PZ9A 5T9BG 4CQ8A 1QASA 3LNPA 2WC4A 4HN8A 3RFAA 4EPEC 1E6ZA 3KBVA 3S9IA 2FVMA 2NVKX 5BU6A 3LENA 3MHUA 4HNTA 4Z1DA 5DX7A 3QKEA 2GYIA 2CKRA 3OYZA 3GK0A 4AU0A 5J04A 2OOGA 3VA8A 3ARPA 3B9OA 1TWDA 4PMXA 1Y5VA 1QBAA 4TIMA 3GW0A 1TPFA 1W9UA 4WXYA 2VD9A 1UOZA 1KQYA 2CBJA 3GDTA 4RXGA 1GVEA 4UTJA 2VL4A 1OCJA 1SJCA 2WSPA 1KC7A 3AYRA 1K1DA 3M41A 3GVRA 3S3GA 1PBGA 3H2MA 3MHGA 4CQAA 3LHYA 1V0LA 3ITXA 4UC5A 3DDMA 3VVGA 4MVAA 1VFSA 5I3FA 3UR5A 1FCBA 3QPEA 2VNCA 1D3HA 1CB2A 2J24A 3H2CA 4N0RA 2FZDA 3NVDA 5EU9A 3A4JA 2E5CA 4UTHA 1OK6A 2YZRA 1L8NA 2YFNA 1RQBA 1C92A 3CH0A 4W84A 2CEQA 3U5YA 1X1NA 1OYAA 3E9AA 3VIJA 1TTIA 3UD6A 1YDVA 3WUBA 4Q7BA 1T6MA 4DAIA 3H7RA 3QQ1A 3OYXA 1NWTA 4O0ZA 4DBWA 1PCKA 3DK4A 1YADA 1VEMA 2YDAA 4QLLA 2ODOA 3DXIA 4D2JA 3LM3A 3ZYZA 2ABAA 4MPQA 3LU2A 2XUCA 4YIWA 5C5YA 2YCEA 1TG7A 4LUJA 4IGSA 2HISA 5K4XA 2ZRZA 3TFXA 3W70A 1D7YA 3IC9A 3I3EA 3W02A 1R3VA 2D3LA 2UV8G 2P10A 2XVGA 4DM1A 1OGGA 3KBJA 5C6MA 3F1QA 3DOPA 1GEHA 2PB1A 4C60A 1XLKA 2ZZ5A 3GKFA 1TCMA 1UKOA 3MYPA 1OFDA 3GKAA 4NT0A 3GNNA 3KL5A 4BQ3A 1HKWA 3N19B 2WPFA 3UG4A 1DHKA 3PK7A 5A2AA 4H4QA 2NZLA 3EB3A 1SW3A 5LXXA 4ML4A 1VIZA 4FLOA 5LGXA 2E8ZA 1BWCA 1QNVA 4G7EB 2GK1B 2IXVA 1NQ6A 3SCUA 2A4AA 4UR9A 1ZJHA 2NXHA 4MWAC 5BXPA 1KBLA 2BB0A 5HOSA 1YKWA 3HF3A 5HWNA 3KRSA 4AVNA 1G01A 3JVAA 1FKWA 2ZCGA 4UFIA 2QF7A 3B97A 3MTWA 2PWEA 2AMXA 4O1BA 1O1HA 4QISA 4HNVA 3UWZA 3TFCA 4BF7A 3VGGA 4B5UA 1XANA 4YVVA 3WFZA 3WDQA 1B0IA 3A47A 4W8AA 1UHVA 3MHFA 1PKYA 1IEWA 1ESWA 2WZTA 1IEIA 2YYTA 4HKPA 2VO5A 1AQ0A 1V79A 2CHNA 1F6KA 1KCLA 2OOFA 4F2BA 4LCRA 3PANA 5GNZA 1SZRA 4FLQA 2D22A 2V38A 4QQ3A 3T05A 4WR3A 2QMJA 1EJXC 2VUYA 3REQA 1DJNA 1SZFA 1ECQA 1R3QA 1DXIA 2QVHA 1R5YA 1J8VA 1CGWA 1JL8A 3RU6A 3ARUA 1BSIA 2OO6A 2PP0A 2ZOXA 4D6CA 1M41A 2YCLA 4REQA 1KXVA 1HFBA 3AUOA 2WHMA 3THQA 3ZR6A 4QTGA 1WUEA 2KX9A 2Z7GA 1V02E 2FGZA 3ABQA 3CGTA 3BWWA 2CBVA 1IXQA 1M9HA 2A5HA 3DKLA 4DUXA 4G56A 4JKKA 2W0HA 4TX8A 2AKMA 1HP4A 2WOQA 1AMYA 2W3SA 2HXTA 3WEMA 2VI0A 1X8CA 3UYIA 3V7PA 1NELA 1QPRA 3AUJA 3CUFA 3I10A 1LG1A 2V69A 1UZ4A 5REQA 2FZNA 1N7KA 1FFRA 1VJIA 4WRHA 4LY8A 3C0LA 1YNPA 3MKKA 1PHWA 4H19A 3STPA 5CSUA 3EXSA 1GJPA 4JNYA 1CGXA 4GGHA 1LPFA 1LWJA 2W0UA 1VFFA 4H8VA 3PULA 1P48A 2F6UA 1ZU8A 1Y0EA 3MO7A 1ADDA 2HBXA 1GRFA 1E51A 3NJ3A 1DJZA 4JQ2A 2Z7KA 4DPPA 4ZMGA 3LXCA 2DGAA 1NSJA 2ZE0A 2VEFA 3RR4A 4I7WA 3VE7A 3G1SA 2Y63A 4IOTA 3FDKA 3T08A 1G94A 4QS5A 3B04A 3V35A 3WQDA 1V7AA 1F3XA 3UWEA 3PZOA 3LGEA 4FNPA 2JE8A 4ADWA 4EPBC 1WZLA 1LLWA 4JTIA 1ALDA 3PFMA 3PTKA 3BJFA 2CXGA 3TW9A 1F8MA 4E8DA 3QEZA 4OGZA 1YIXA 1QNSA 3CTLA 1MDLA 2IQTA 4S3BA 1JEZA 1AK5A 1N60C 4QG8A 1WYGA 3OGVA 2UZ9A 1LQ0A 3VIMA 4AMCA 3E12A 1TA3B 3PNZA 4QLKA 5FESA 3VDBA 3N04A 2FZMA 3TROA 3HB9A 3L4ZA 1OIMA 1FXQA 4HU0A 2ZA1A 2F84A 4LC6A 1ISXA 2Q3OA 3SRHA 4JY8A 4RDVA 4AZCA 3QVQA 4LVGA 1CXEA 1O5QA 3ETRB 3FXYA 3TC7A 1EPVA 2BP1A 4DY1A 3SGZA 1V51A 3NYDA 6A3HA 1US0A 2W27A 1L6WA 3WH5A 4H50A 3BURA 1N62C 3ZXWA 4BK9A 1TVPA 3VD7A 4GUIA 2C1GA 1A5BA 4MJ2A 3UF9A 5JRBA 1C90A 4G8TA 4CN6A 4AVFA 3HPZA 2RKXA 3EXTA 4URIA 3WMBA 3V18A 1GTEA 4L9ZA 1ZMCA 1EYEA 1QWGA 3NNTA 4IH3A 4XO7A 4B5VA 5FJJA 1B30A 5D37A 2PDUA 2QAPA 2BDQA 2I5IA 4ILSA 1W56A 2IQ0A 4KGJA 3VDGA 2VFIA 5T26A 1E1CB 5HMFA 4C1NA 4Q4RA 3RMEA 1P6BA 1RBLA 4KWWA 1Z9AA 3AU6A 3LADA 1SO5A 4L4PA 5FMHA 4IMDA 1BEUA 1BPLB 3PTQA 4UFJA 3ITYA 1XKJA 3O6AA 1WKYA 2WHLA 1ZAIA 1SZEA 2XH7A 3AISA 4C6EA 3GXTA 2PC8A 4H7CA 4N02A 3MVTA 3PSWA 3HGSA 4O17A 2CERA 5JQ9A 3L4UA 4L6HA 1UPPA 4AXNA 1Z42A 4NAFA 2PDNA 3T0BA 1W54A 4ATDA 3A13A 3B0VC 4EXAA 1LBMA 4KQNA 4LCSA 5BMXA 2I5GA 4H6EA 3M0XA 1GRGA 4RPPA 1BXCA 5TBOA 1YNQA 4M81A 3GAKA 3WYZA 1B90A 2WVVA 2C3CA 4HSHA 3FFSA 4IWWA 3H6OA 4J1OA 2Q6ZA 1OX4B 1A4LA 3W83A 3WN6A 1B3OA 4BHYA 2NWSA 3DESA 3W24A 3A4WA 4KETA 1IWBA 4W7VA 2V3DA 1K8CA 1CLXA 3EDKA 5CSYA 4WGXA 4OU1A 3OIXA 4DLFA 4JZ5A 1JYXA 2VVSA 3R43A 1QI0A 4GISA 1YTKA 3DHUA 2G95A 4U4MA 1DJXA 2GLKA 3DFQA 2ZUNA 4U10A 1UH2A 5EY5A 5DEZA 1GG1A 1C29A 3U2CA 4CU8A 5AVNA 3M64A 3E38A 3HJEA 1QT1A 5ECUA 2CU0A 3WQFA 5FL1A 3ZJ7A 3W2LA 1NDZA 3BTNA 5CGQA 5JH1A 4H8NA 4O4VA 4EMWA 3W1QA 3FA3A 4JIPA 1HJVA 2GJXB 2Y7FA 1M01A 1WBJA 1BGGA 3L66A 1U1UA 4L6DA 4FIRA 2G3NA 4JHMA 4LUTB 5EMLA 5I3JA 3KS5A 4X60A 3B9EA 2OQHA 3C4UA 4FOKA 5F1UA 2E0PA 4PBFA 1QI4A 3TN6A 3A64A 3SM0A 1HQTA 1EF2A 4MNLA 2IPJA 5D03A 5A6BD 3LCIA 1GKPA 4NNBA 4HPGA 1DJIA 3ZVHA 3MZ2A 1DWAM 3OZMA 3WMCA 2XGIA 4CU7A 1KLYA 1ICQA 1ZJBA 4OWGA 4YTUA 1VR6A 4MMWA 4NQ1A 1QO5A 4APNA 3URBA 2IQDA 4TUFA 1CXIA 2C18A 5FCZA 5FD0A 1ZY8A 4X3ZA 1MW1A 2ZRWA 3NRZB 4PCFA 1DWGM 1XYCA 3WLQA 3PPHA 3T2OA 3WK2A 1ZALA 4QRNA 4DZAA 1AL7A 3V3WA 3RX3A 3LMZA 4GZ7A 1LUCB 5I7GA 3K30A 4TVYA 2JIWA 4Z08A 4V27A 3KBNA 4ZOAA 1WX0A 4HZ7A 4A8LA 4UFKA 1OEPA 1K8YA 4MB1A 1OFPA 3UXIA 2D2GA 1JUKA 2B0MA 4C6FA 3GZ3A 3PZUA 3KTCA 3IAQA 1JFXA 1W37A 4C6LA 2VC7A 1IR1A 5FEZA 2EQ9A 2X1UA 2FTWA 4XKMA 3KXQA 5JMUA 1VP5A 5JCMA 3H7UA 2RJGA 3QTPA 2ZXAA 5A8OA 1E0WA 1JGMA 1RA0A 1PCWA 2PWHA 3ARVA 3CL6A 4D6DA 4Q3MA 5ER0A 3W1RA 3N29A 4GNJA 5A2CA 3W7NA 4F0HA 5CAHA 3M6YA 2RABA 4PUWA 4O15A 5I06A 4CKQA 3UCCA 2RHGA 1EJRC 1FWBC 3ORWA 2O9PA 1UD5A 3DFPA 3QMSA 5HXMA 1J4EA 4R3UA 3B4UA 1IT7A 3ARZA 3Q2DA 4UFLA 3IV8A 1TO3A 3BL3A 1IT0A 2NT0A 2YCKX 1N5XA 2CHRA 2BSLA 3NPWA 4WY0A 2HMCA 2XIMA 3DZ1A 5A5WA 4BI5A 2XSBA 3MV01 1Z3NA 4GKTA 1OT2A 4XZHA 4O0KA 4N9DA 3S8HA 2ZZBA 2H8XA 1W6TA 5B7ZA 3D3AA 2BXYA 2X8RA 1ITUA 3CV2A 1XCXA 4CU6A 2GGGA 4R7OA 1CGYA 4W93A 3NTYA 3GXIA 4IPIA 2PCEA 1XH1A 2BNJA 3IUDA 3MV11 1UZHA 4AZBA 1R30A 3BLLA 1MO9A 1CPUA 4JY9A 4UXDA 3H26A 2WO5A 3IIVA 3GRSA 5XINA 4EF8A 1TWWA 2ZUWA 3SN1A 3ITVA 3N9KA 1ZSXA 1FDYA 2W54A 1W1VA 4B9YA 2INFA 4DZHA 3EX6A 2PD9A 2RDTA 4WOZA 1A5NC 1QK2A 3BAXA 3Q45A 3T0AA 3W1AA 1I2NA 4H01A 3W7QA 2QHAA 4HB7A 3KZSA 1QNRA 1LTDA 3FEQA 2PRMA 3P62A 1J0YA 1JXJA 3OLGA 2W4XA 4IMGA 1XLGA 2WPCA 4XZNX 3LRLA 2FH6A 3T55A 1AA1B 4GZIA 1DXEA 3VIOA 3FGCB 3DFHA 2E6YA 3VUPA 3H12A 1O5XA 4HIBA 2PWUA 2VEMA 4GPNA 3W7PA 4FR6A 2P8CA 3HM7A 5U25A 5KSWA 3CMGA 3COTA 3T8QA 1A0CA 3G2GA 2OCZA 4PMRA 3VMOA 1EZ2A 1VS1A 2ZVIA 3PUGA 3AYVA 4KRTA 3W81A 1WP6A 4HA1A 2CZ5A 5GRTA 1H7PA 3VI2A 3WMLA 3L2MA 3ZWSA 2X2GA 2Q8XA 1ZFJA 4AQLA 3G18A 4BV6A 3CHVA 2OB3A 1RP9A 4NEVA 1R7OA 4LU0A 4ZODA 3NSNA 2ZZ3A 3B8DA 3VGDA 1ADSA 2WHKA 3MQTA 1BWKA 1VQTA 1VBRA 1DIKA 3AN1A 2GRTA 1K8XA 1N5WC 3SSZA 8A3HA 3S1GA 3R13A 3VDCA 1G0CA 4U3AA 4OBTA 3GE7A 3KOXA 2FTPA 1FWRA 1RLDA 2PRLA 2XN2A 3G1FA 1FO4A 2EKCA 4X22A 3YPIA 5DT7A 1SSDA 4UTUA 4F40A 1XC6A 3ZIZA 5LIXX 1ZJIA 5I0DA 2I57A 3Q67A 2YX0A 1UD3A 2YOCA 2VX6A 4DBUA 2NV9A 3A24A 1IEXA 2DU2A 5AVHA 1MDRA 5C2CA 5LNUA 2QZRA 1HO1A 3DU0A 1CTNA 5CPNA 1H2IA 3RITA 1BKHA 4IZGA 1UWQA 5KVIA 2PAJA 3CT7A 3N3TA 4LS1A 3QQWA 2WOIA 3SRDA 1JUEA 3VCNA 3W1PA 3EDEA 3UJRA 4IQLA 4JD4A 2CXEA 1DJHA 4F0SA 3EZ4A 2VM8A 1LQAA 4IPJA 5FJOA 3A3XA 4I6VA 3RRXA 2R8WA 4DVOA 1UD6A 3V0UA 4IM4A 4IL0A 1N2VA 3FNDA 3HG5A 5IBXA 4IPPA 5C54A 3BLPX 2WB5A 2Y5EA 5I3HA 1DIEA 4K68A 1GW9A 2OT0A 3BARA 3AO0A 4NJIA 1VIWA 4GQBA 4DBSA 3UJ2A 3I6RA 3WENA 1R3RA 3GC5A 5G2IA 1TPVA 3RXZA 3VOJA 3DGRA 2Z6JA 3LPGA 3LBOA 4EAYA 1VD6A 1B5TA 2XG9A 2V6AA 3W01A 1CXKA 3AIBA 4DJDD 1SR0A 5A6BA 1W9BM 4H7ZA 3TA6A 2Y61A 1SW0A 1H5VA 3B9DA 1F61A 1WDPA 1YDNA 4H00A 5DCEA 4LT9A 4C6CA 3W1TA 3JW7A 3IRSA 3NQVA 4DM2A 4S2BA 1JIBA 5FF3A 1V3IA 1UWSA 4EMJA 1VZWA 7TAAA 5AKQA 3BICA 3HPSA 1SO3A 2VHLA 4Z1AA 1OADA 1FP9A 1YBQA 2WPBA 2R1KA 3ARYA 2E3ZA 1W5PA 3FJ4A 5KEZA 1H60A 4PUJA 3H21A 3FHAA 1V3LA 5EYWA 4WVXA 3QSTA 4UFMA 5I02A 4CD8A 1V3KA 4DPQA 1UZDA 1UC5A 2Y88A 3NL6A 4GIAA 4JNMA 2VRJA 2INZA 3QV8A 3SBFA 5HMDA 1WKDA 2PC4A 2NVDA 2PE4A 4JHZA 3NA8A 1BGAA 3FYYA 2QCNA 4EP8C 4GC4A 5AC8A 1H50A 1VB9A 3QOKA 4UTTA 1TFVA 5CG0A 3M07A 1DXFA 3R1ZA 2YGYA 3KWXA 4NXKA 2DV0A 4RDZA 4AZ5A 5K3VA 1TB3A 2H3BA 2J9ZA 2PDMA 1D3CA 1QNPA 1XYMA 3DBNA 2CDUA 3SCNA 1WCGA 3SCSA 1MWOA 4QS6A 2DSZA 4H4PA 2G96A 4ES4A 2X1IA 2GVYA 1KLZA 5A94A 2FDSA 4IFKB 2EHHA 3W71A 2FPVA 2TODA 3R8HA 1DWFM 2ZDSA 1XIDA 3SR7A 3KP1A 4U28A 2E40A 2WKGA 1CENA 2WC7A 2YL5A 2GL5A 4A8NA 1JZ4A 3DFNA 2C1HA 4U33A 1IHIA 5JCIA 2ON3A 1D8CA 1AH4A 2JBMA 4XZMX 2QJHA 2VRKA 3GNOA 4TV5A 3N1AA 1AJ2A 3NQ2A 1HKIA 1XV8A 3M0MA 3G6LA 4RR4A 5DLCA 3SECA 3OGSA 1W1A1 2BVDA 2Y6ZA 3WLTA 4ROPA 4KBXA 4GI6A 1UIPA 3VOCA 1FWIC 1FOBA 1FHUA 1XQKA 2PDHA 2C7FA 2V3BA 1EWEA 1GOIA 1PO9A 2HVNA 3F4WA 1QHPA 4LS0A 4U5KA 3UY7A 4AW7A 3QC3A 4O1AA 1Q8AA 4N9EA 3EPNA 3AS2A 3L67A 2X99A 3IAPA 1L8PA 2D69A 4B4FA 2H8ZA 1DJWA 4K8EA 3QXBA 2ZZ0A 3WNNA 4YJ5A 5U7SA 2DSKA 1LRQA 3W6LA 1W1IE 2VDGA 3QGVA 3UR2A 4X9SA 1KFBA 1OFRA 3LHZA 4YYFA 3H8AA 4KFOA 3BGJA 5KITA 3O6DA 3APGA 1NARA 2X05A 4NZCA 5C9ZA 4MB5A 4JYFA 2HVMA 5I79A 3AHVA 4IIGA 1P7TA 1R8LA 3G3MA 1I4NA 4IL2A 3TNOA 4HCDA 3VGBA 1JCNA 3TUUA 4QJ4B 1O60A 3BK0A 5HWJA 1H0GA 5JVLA 1WOBA 4WGHA 4HT3A 1U5VA 4MB4A 2J7GA 2OX4A 2C6QA 3N2CA 4PMOA 5DMYA 1KWGA 4NI3A 2WPEA 4W5ZA 4Z0JA 2FHBA 4MDOA 4LNYA 2VURA 5EMJA 2GSHA 1TRIA 2NV2A 4MLJA 4HBKA 4PMQA 2BZNA 3DHFA 3GG8A 3GX9A 3M1ZA 3VAVA 3VKBA 1SUXA 4LALA 3LYEA 3RLGA 2WJDA 1P6CA 5I24A 4G1NA 3N12A 1XRSA 3T0TA 1E4MM 3TJ4A 3DFYA 1GRAA 2IW0A 1S5WA 3UT0A 3TSDA 4KIEA 2OJPA 3VABA 3DENA 2DZBA 3O63A 1CLKA 3APTA 5FAGA 3RCNA 4Y9AA 2ZRYA 4JTUA 4JEQA 1TRDA 3A3HA 1P0KA 3PTDA 3QY8A 3QW4B 2A7RA 4JFWA 4PC8A 3O16A 2QJGA 4HHLA 2WNZA 4MADA 1W3HA 3M0JA 1NF7A 2J75A 4GRSA 2YAUA 4K7VA 2CKSA 3MSRA 4JYEA 4HK5A 2B7QA 1WAWA 3UG8A 4GCAA 3SUWA 3GYCA 4DRSA 5AZ1A 2PZ0A 3GXMA 5D9OA 2RDUA 2QNEA 4EM3A 1FVPA 2VFHA 1MZHA 1N55A 2W55A 4TVWA 2VX5A 5AC6A 3NDZA 4BQ5A 2YL9A 3WLHA 6PTDA 1F6YA 1V0KA 5I3GA 1T8XA 2QUMA 1NTHA 1M6JA 1I0BA 2EGZA 3W73A 4QX4A 1K02A 1FUYA 2GWGA 3AFBA 1JRBA 4PL2A 3DG3A 4PEKA 4IISA 1XIJA 1MW0A 3P14A 1XHGA 1R87A 3QHNA 3EWCA 3VIFA 3C61A 3GQYA 1QOQA 3N4EA 2Y2WA 2EJ1A 4WSJA 3EPOA 1TE1A 3G1HA 4Y9PA 4FXRA 1EEXA 3L68A 4JPGA 4B2DD 3R4IA 1TV4A 4OVXA 1KCZA 5GNYA 3P60A 1F6PA 2E6AA 5A1AA 3I68A 4Z2KA 4O11A 2H3DA 1PB0A 4LBUA 4ZQRA 5D2XA 1TV8A 3AWNA 5CAKA 4O4WA 1KM3A 3PZMA 3KLLA 1UMLA 1POJA 3NZGA 1XYBA 3VX1A 4B16A 5C70A 2G50A 4MDPA 2VP8A 1Q1RA 4JFVA 4ROQA 2A0NA 3HFTA 2OSYA 1EA9C 1LF1A 1QOXA 2W63A 4S3EA 2J8FA 3P0WA 3ZR4A 3G1RA 1Q3NA 4EQSA 4LUSB 3BXWA 5AHEA 3O1NA 1HJWA 4IX0A 4NVTA 3SN4A 2HV5A 1OZMA 1UP2A 1XRVA 3UZXA 2VENA 4H4XA 3CHDA 7A3HA 1XLMA 1JCXA 1WB0A 4RUBA 1GJUA 4PEEA 2J9YA 4S3CA 4M8UA 1SYTA 2Y8UA 1BYCA 3P5YA 1ONEA 4J2PA 3VX0A 3CZLA 2B7OA 2W5FA 2OODA 1PS9A 2VCBA 3C2RA 3BO9A 2D1ZA 5AY7A 3CWNA 2R1NA 5IXEA 1Q6LA 4CNSA 1J2BA 1AW1A 3CZKA 4AD4A 2Z28A 5T91A 1P5BA 2HSAA 2P0IA 8CGTA 1Y65A 2A7PA 4IQDA 4M7SA 2PLKA 4DJDA 3TYCA 4CVWA 2ONEA 1XHCA 2AQWA 1S1PA 2BTMA 4N7QA 3EOSA 3NS1B 4NNAA 5I00A 3NO5A 1KKRA 5EL1A 2FIQA 2YL8A 5CG7A 3UESA 3BGAA 4AHPA 1MI3A 2A79A 3FKKA 1PJ9A 4CCZA 3PJXA 4JX4A 4H7VA 3M44A 2VR2A 1CBGA 4GK8A 4C65A 1EWDA 3PAOA 3II1A 3U7BA 4PUUA 3W74A 5BOFA 3WQPA 5GVJA 1V6YA 1PV8A 1GEUA 4H04A 1HVQA 2R6OA 1JAEA 3BDKA 4MNKA 2EO7A 3GIQA 4S39A 1EEPA 1R3SA 2XSXA 1VFTA 3LY0A 3SQSA 4QNEA 4A3HA 5AYIA 1J12A 4WF7A 4KKXA 3LTPA 3TYDA 5CLWA 5IDZA 4J3VA 4UTFA 4LPCA 1MXSA 1J11A 4KEZA 2PWDA 3HU7A 3N15A 4UQCA 2ZX6A 3M0ZA 5FL0A 3V5CA 1DTNA 4WKAA 3MMUA 4DXVA 3HGJA 4IQJA 4JTEA 4JR5A 1BAGA 1TWSA 1DWHM 4HZ8A 3WBAA 2CLIA 1JZ6A 3KRZA 2ZA2A 3BMVA 4AHOA 3G0XA 4GQ0A 3T81A 1KXQA 2V82A 4ADTA 4GBDA 5KTLA 7TIMA 1H7RA 3O0KA 1V7YA 1PSCA 2D23A 4OTKA 2ZRXA 3MPGA 3PBYA 2OSWA 1S2CA 3RU8X 1CDGA 1CW2A 1A49A 1CB7B 3PS7A 5AB3A 3SIMA 3L2IA 4YPJA 2YXOA 4J3TA 3CGCA 1L6FA 2BC1A 1G5AA 3HOJA 3AC0A 1VGAA 2GVEA 4H9YA 4IFOA 4HCHA 4NXSA 3UWYA 4R33A 5HINA 4LOCA 3WZ0E 2ZZCA 2O4QA 4HA3A 4PTWA 2Y0FA 3WUGA 1TJRA 3AHXA 4O1EA 1EC7A 4MWAD 3N6QA 5I3DA 3FG2P 2GGJA 3UR7A 4GKLA 2V2HA 2QCLA 5D9PA 2WVUA 4W8LA 2WKJA 4Y9NA 4UIOA 3ONBA 2WMIA 2VGFA 1Z44A 2QVNA 3ENLA 2E28A 4HYVA 3TQKA 4NAEB 3CEPA 3EDFA 4RZ5A 3WFLA 3GR8A 1DNCA 1OFBA 3USZA 3PJWA 5IBXC 4LEQA 5EMYA 1LBFA 1S2UA 2PDYA 4QG9A 1QW7A 5DQPA 5E5CA 2PP3A 2EG8A 1JEHA 4POCA 1UA3A 3NVTA 1EDGA 3LV5A 1CXFA 4OV4A 2G4JA 1YEYA 3NM1A 3H55A 4JKLA 3R0UA 3W6YA 1F2JA 1LROA 4L6OA 3CWOX 1E9YB 3UFYA 2XZ9A 5LIYX 4C7DA 1XYFA 2FZBA 5JCLA 2OWXA 3I7SA 1NM9A 3W7DA 2Y70A 3S46A 2YW4A 1UWTA 4NKCA 3KRBA 3CLWA 2AL2A 1GVYA 1IGSA 2JF6A 4V15A 5C9UA 2BMBA 3LNMA 3BAYA 4DN1A 3E49A 1X97A 3PFRA 1JOAA 2WAGA 4PTMA 2BC0A 5KVHA 2R1MA 3UZYA 4WEVX 3RUBL 1CCWB 4M6QA 3W22A 1P6WA 7REQB 2I56A 2IKGA 1ODUA 1JDEA 2VX4A 2OO0A 4FDCB 3CUXA 3UXAA 3FXGA 2JALA 2Y85A 1US3A 1EKOA 2C1IA 4PBEA 3B05A 4FMVA 3AHTA 3LZ3A 1R3TA 2ADAA 1IZCA 4GUGA 1UJQA 1XIHA 3O0HA 1MVYA 1GCYA 1NWRA 4HTBA 3CLMA 3E3HA 2PDPA 4L1GA 4UTTC 3THUA 4YCPA 3UXKA 4CQBA 4CUCA 3OPSA 1JRCA 2CLOA 2NW0A 2Z1WA 4JTRA 2GGHA 2RDWA 4JX6A 2E1WA 5CJ5A 4MTVA 3STFA 4GI8A 1S38A 4I5RA 1XH2A 2OMAA 3LQGA 2NQHA 5F2MA 3W86A 4W5UA 3RX4A 1H0IA 1Z8AA 3M0YA 4TOQA 4XVEA 2AAMA 1B3VA 5DBTA 1QVBA 2P8BA 2YR1A 5AOUA 7ODCA 4FX9A 1QW9A 2HDJA 1R0MA 4PN2A 4NJHA 3L0KA 4AHQA 4FHAA 4XO6A 2GVLA 4E0CA 4HSOA 2IPFA 1Q8JA 1A80A 3B4YA 1LL7A 2QCDB 1JI1A 1NFBA 4PYSA 4GI4A 2Y4SA 3XINA 3WQ5A 2E9LA 1YW1A 1HJXA 2PTXA 4XWUA 3C0JA 2NQLA 3ITCA 4H4YA 2O9TA 1H7XA 3JS3A 1M7OA 2PPGA 1CXLA 3ARQA 2BOEX 3WD2A 1F5ZA 3KAOA 4AUBA 4YN5A 1S5VA 4Q7IA 2GR2A 2VX7A 3EPMA 3LDVA 1EIBA 1Q6DA 1TREA 2YA2A 1AH3A 1ICPA 1XRTA 3KRUA 4XAGA 4FI4A 1OIFA 3VUSA 1MRAA 4EF9A 4F9JA 3GFXA 4IPNB 4B2DA 2D0GA 2C19A 4WZHA 4IIDA 3OZPA 4H6KA 2PDFA 4CEXC 2RGMA 4OIFA 4DF0A 1DQWA 1X2HA 4H9MA 3LG3A 4GUJA 1YDYA 5FS9A 3T2QA 4FS9A 4JTKA 4IT1A 1ZBCA 2V2DA 3WL1A 1ADOA 2ZX9A 4XZ9A 4DNAA 4FEZA 1KR1A 2R82A 3NWRA 2QS8A 5CJNA 3FA4A 1JPDX 2WLZA 2B7PA 3C0SA 1HTIA 3KL3A 2INEA 3P82A 3WJZA 2FYMA 5D2TA 4L4OA 5AYZA 5BOOA 3DJGX 4FP1A 4NF7A 1JZ7A 1YYAA 3LGDA 1OYCA 2UY3A 3TQVA 1F05A 4I5XA 4HA4A 2JGYA 1E4IA 2F2KA 1QMLA 4MGGA 4GINA 1U5HA 4JFTA 4ZO8A 1OFQA 1K4HA 2VMFA 1OK4A 4RDYA 5EA9A 3GG1A 4GWEA 1O66A 1KFWA 1SFLA 4RCXA 5HULA 3SQLA 2VUNA 3HQNA 3UPWA 3QF0A 1ZY9A 2F6KA 1EA0A 2NLYA 4K8GA 5E0FA 2DJLA 2PTWA 5CPOA 3JR2A 3LOTA 1LT7A 2WOWA 3FS2A 4ZEPA 1M3UA 2ZRUA 1V08A 3W6MA 5IOBA 2D24A 4A05A 4JXCA 1JAKA 1I6NA 5E6ZA 5M2FX 5JBFA 1MNSA 1L9WA 4AWTA 3WD1A 1PE1A 3H24A 3AXHA 4KEUA 3GR7A 5EBAA 2WCAA 2JK2A 2GWNA 3NUKA 4KERA 2EPOA 1Q63A 4N42A 2A85A 4GQGA 1A0EA 1V77A 3I7QA 3A5VA 9RUBA 3KHDA 4NI8A 5C71A 4WDWA 1F8IA 1CT5A 2EPHA 4KWVA 3SDOA 2V9DA 5FJIA 1UWIA 3AIWA 3WLKX 3P8JA 4DJFA 1J2WA 4JN7A 3L0NA 5D4YA 2DORA 1EC9A 3IPWA 4RL3A 3C2VA 2WM0A 4JBRA 1PAMA 1O94A 3ZJKA 4XIAA 1HKKA 3P61A 2I1OA 4RV3A 4GZEA 2Z2UA 7PTDA 2HZGA 3DYOA 3WQGA 2O7SA 2A6NA 1XGEA 1GKRA 1XLFA 3W2KA 1J5SA 4C1LA 4NJGA 3TZFA 4PMDA 2YDRA 4KCUA 3L4TA 4O54A 4JTLA 3H70A 3VZXA 2YYUA 1KD0A 1KFCA 3POCA 1R85A 3M0KA 2QDDA 4O1CA 1QHOA 3NQGA 1HL8A 3H22A 3SFWA 4MSSA 1CGTA 4WJXA 2HNEA 4AG0A 1YXYA 1KKOA 2QIWA 5ABFB 4R27A 4M56A 3OG3A 5GNXA 4MJMA 4HMEA 4ZQNA 3E96A 3K4DA 3NEHA 2WMFA 1H41A 2W92A 2YW3A 4LAMA 4A3QA 1V5XA 3LMYA 3U2EA 2HVOA 1FH8A 3RNDA 5DCBA 2QUNA 2YIHA 3EWBX 1KN0A 4IMFA 2DSVA 1L0PA 3H2OA 1C9DA 1DEDA 4O12A 3S6OA 4YWSA 4KRZA 4LTSA 4PH6A 5M03A 1F4AA 2IUZA 2WNNA 2GOUA 1N61C 2VZTA 1UZ1A 3CU2A 1BD0A 3P8IA 3VZYA 1A5UA 3BOXA 3KOYA 1E0TA 3AHZA 3IRDA 8XIAA 3ZFHA 2BOFX 4GXMA 3SN0A 1EJVC 1IF2A 1E0VA 4J56A 3VM7A 5BU9A 3UG5A 5DCDA 3L12A 4DYEA 1XLBA 3TU9A 2PLCA 3CB8A 2R1LA 2PBGA 1HL9A 2J78A 4WSKA 3GWQA 4JX5A 3OLDA 4DQWA 4LJ3A 4XZBA 5A8MA 3UEQA 1JR1A 1K7EA 1KFJA 4M80A 4GRTA 1GRTA 1LLZA 3MU7A 3CM4A 3T8LA 2J74A 4ENLA 1KR0A 3RN6A 2X16A 3A7UA 4GCXA 1GQKA 4LB4A 1ZS2A 3PAJA 4DHGA 5M5DA 2VC6A 4OBRA 2J6VA 2WOVA 5F2GA 2O92A 1DORA 5H2ZA 5BW6A 1P1MA 1V02A 3VNMA 1KM5A 4DJDC 4CD5A 1TTPA 3C2FA 1NQKA 2X8CA 3SCQA 3W1LA 3W3OA 6REQB 4NZJA 2WSKA 1NJJA 2V5LA 4TTGA 4AFYA 5FI8A 5H8UA 3W82A 3G0UA 1NDWA 4J35A 5AHMA 3UGVA 3ZT6A 5D9NA 3TE9A 3DCPA 2CIPA 1D3GA 1W3LA 4KWSA 1QU4A 3AXMA 4PRRA 4O57A 1ZDLA 3U4FA 5XIAA 2CC0A 3B0PA 1XINA 4GNKB 1W1TA 2A3BA 4B3ZA 3S5ZA 1RJRA 4DZ5A 3VIIA 3WBYA 2C3DA 2MANA 2X1RA 1EHNA 1CX9A 1W9VA 4UB9A 3GUGA 3P0XA 3NSXA 1TSIA 4MM1A 2V5KA 3NQBA 4WXZA 1UH4A 3PP7A 4MUZA 1E70M 1M7JA 3PBVA 4ACZA 4C5ZA 3MJYA 1F74A 2Y7EA 1V0NA 3AXIA 2WSQA 1K70A 3TX9A 3THDA 3ABXA 3EEGA 3GG0A 1W17A 1P0BA 1O6IA 3L9CA 3C56A 3W84A 1DXLA 1IEQA 4ZQPA 3QFBA 4JL1A 4UOJA 2XVPA 4Y9MA 4AIUA 4IUOA 2QGYA 1ML1A 2GPTA 1MQPA 3VOIA 4JICA 4HJWA 1EOMA 3ERPA 1E6XM 1SJDA 3NGFA 1GQNA 3UG3A 2YVJA 3CWHA 4OFCA 4FSAA 3QPZA 1XM3A 1JUBA 1YPIA 3L5OA 3QC0A 1PZ1A 1NOUA 2E09A 3G1YA 3QLDA 1QTWA 1HGWA 1GRBA 4LVAA 1NIUA 2HE5A 4HK7A 2HEJA 2RAGA 2CLMA 3HGOA 3IJLA 4E3VA 3QLLA 3IGHX 3GM8A 2Z4GA 5D02A 3WLLA 2V5CA 2QDHA 4XIMA 3S9ZA 3EAUA 4GJIA 3RM4A 2HXUA 3S5NA 4ZENA 2R24A 1TZ9A 4QJ3B 1QPKA 2R1PA 2QUUA 4AZHA 5F1VA 1JVNA 3PJUA 5AHFA 2YKKA 3AM9A 4BJHA 1TV5A 1QK0A 4BA0A 1ISWA 3IUHA 1I75A 1KQZA 3LQLA 1UD2A 5FJUA 3NIYA 1PUDA 5CPSA 1OD0A 1JG9A 5GJPA 2XSAA 3DGBA 4GMEA 4TX6A 3NQ7A 4JN6A 4GVIA 1UD4A 1W2PA 4M19A 3VOGA 3FEMA 4BY3A 1CGVA 4I5UA 1OX5A 3GYEA 4LGXA 4TXEA 1FY6A 2D3NA 1FWDC 1RLCL 4X63A 3DERA 4Q4PA 3C3NA 4ZO7A 5LYRA 5EBUA 4RE4A 2NVCA 2DZVA 1KTNA 4YU1A 3EOOA 4OKDA 3KCJA 3BV7A 4Y7EA 3RILA 1KGXA 1A50A 3F2DA 1X38A 4N6FA 3OZYA 3CQJA 2ZUMA 4BEUA 3PF3A 2VYOA 3RGTA 3GAYA 1HT6A 3L5AA 1B9BA 3ZSTA 5CCZA 2WZHA 4B5XA 4CNUA 2YXXA 3OO2A 5HATA 4J40A 2E6FA 2C91A 4Z2LA 4MAZA 2IKIA 4LB3A 4IJRA 2E4TA 1N8IA 4Q8VA 2GUUA 3CGEA 3P93A 3SCTA 5ENLA 2C15A 3HPFA 3WD4A 4GO8A 3AS0A 1CECA 3M0HA 2ZX8A 3DK9A 1YQZA 3AMZA 4CQCA 4QNWA 3SAZA 3VIGA 1J01A 4ZFMA 1VH7A 4Q4KA 4M29A 3GD4A 3L5MA 4MIMA 4UTLA 4CNNA 1UWRA 3C3UA 4NU7A 3R94A 4MYAA 3MUY1 3OJGA 4XX6A 5E93A 4GO9A 2GGEA 1BF6A 2ZZ7A 4ZXLA 2V3AA 1C7SA 1X1ZA 1W3TA 2ZYFA 4XQ6A 4AIOA 5D30A 1E1EA 4FOUA 3GH4A 4LS2A 3FKRA 1TPC1 3NQDA 3SZ8A 2PGRA 1NVMA 1Q45A 4DBEA 1O95A 2BXZA 3KX6A 4FNRA 1IT8A 1Q85A 2OT1A 1MOKA 3CEUA 1XLCA 3FOKA 2ZE3A 3J7HA 5KINA 1QO2A 2JKPA 5C7HA 3WLPA 3WK0A 4C6IA 1GZ1A 4UWMA 4I9AA 5D8WA 3GTFA 2P50A 1SFSA 3GNDA 3IVUA 4QBXA 4EPDC 1S5TA 2PDKA 3BC9A 5TNVA 3T6CA 2O0TA 4AWUA 1DE5A 1MQRA 2RGLA 4ZSUA 4LV4A 2FHCA 2DY3A 2ATSA 3DAQA 3PUEA 4GX9A 3W87A 3WH9A 2HRWA 1NU5A 4X0NA 5FF4A 3S5OA 4U3CA 5KZDA 3K5XA 4GXWA 4GABA 1X96A 2W79A 3WLJA 1GNXA 2QQ6A 1E0XA 5CZSA 3R25A 8TIMA 1UR9A 1W1YA 3VKAA 3UJSA 1W3IA 2Q3RA 5BCAA 3KVKA 3CO8A 2PDGA 3MT1A 2NXIA 1QDSA 2NT1A 1QFEA 4FPSA 4MKVA 1ZAJA 3KOWA 4FLRA 3TA9A 1UPMB 3EUB3 4LUSA 1FWSA 1AFSA 3EMCA 4S3FA 1EFZA 3OEXA 1W9DM 4GJ1A 3MDWA 1F7BA 5HMEA 2PU1A 1WZKA 3W29A 3CYJA 3K8MA 3EDJA 3U3HA 3II4A 3IJIA 3TSBA 1TKKA 3NZ1A 3PZIA 3TTOA 4OV9A 3AYTA 4G9PA 1V6VA 3L4VA 4E4FA 3IIXA 4ORMA 4C6DA 3MBDA 4FZIA 2P3EA 1NDYA 5JH2A 2POTA 5I3IA 3FA5A 1YXDA 5CZJA 4YYCA 3VINA 2JK6A 1IXPA 1UROA 3L4WA 4EMIA 4JCLA 3WY1A 3CHCA 4K2SA 1E6NA 1BVZA 1EC8A 2SFPA 2J7EA 1XLDA 1FXPA 3S1VA 1GREA 2WJEA 4INFA 1QPNA 3JU2A 1U1HA 3G3DA 1HUVA 3N2BA 5I09A 3LXAA 1FHVA 5HNUA 2NSOA 3VGEA 1X2GA 3WQCA 3WD0A 3W28A 3H23A 3HJZA 3SIZA 4EE9A 4OT7A 5DANA 4D72A 3CASA 4M6VA 3U48A 4P8VA 4XISA 2ISSA 4LAUA 3BSMA 4DJFC 2IPWA 4K1GA 3PZGA 1UUMA 2JKEA 4L65A 1IWAA 1PIFA 4P7NA 4QEHA 3G5EA 1ELSA 1EGZA 4H41A 5ABEA 5LNWA 2QR6A 3OZOA 3T9PA 3W75A 3RMJA 3I3DA 4GC3A 2X41A 4IHCA 2PWFA 2JF7A 1XBXA 2CZVA 4O16A 4RZ6A 4Z2JA 2VFGA 3LPOA 4WJEA 2AL1A 4PUDA 1VF8A 1XYAA 5AYXA 1VBJA 2OEKA 2VCCA 2NQ9A 3URNA 3L2LA 3DGZA 3MA8A 3CXOA 4IXHA 4FALA 3B8SA 4J5NA 4CNPA 4NP7A 1C8VA 3MC5A 1POKA 3PSVA 1GVRA 1BLIA 3L21A 1EDTA 1FWAC 3NZQA 3E0FA 4PSRA 3NVZB 1BYBA 1SQ7A 1NH6A 2WXDM 3SUTA 3WH8A 2EPLX 3OLEA 3LM7A 3M0LA 1EB3A 2IMRA 1Q6GA 1S3HA 1HZYA 3REQB 2XM1A 4Q8PA 3M5VA 1EOKA 1H5YA 3U4AA 1VENA 1GOOA 5I2UA 4B5NA 2F7FA 4H1ZA 4L9YA 1ITXA 2VWTA 1OC5A 1S5NA 1LM1A 2FLIA 3VOHA 3OBKA 3ANUA 2YCLB 4LYRA 4OBSA 3W53A 3N13A 4QAIA 1SMAA 3QZEA 4LYQA 3U7VA 1XLLA 2G41A 3CMFA 3M4HA 4IGHA 2ANUA 4AIEA 4F2TA 2QGHA 1Q7ZA 4AYSA 1KCKA 3R12A 4WSHA 4EVZA 4L7ZA 2NV1A 1PKMA 1I2QA 1EJUC 1Z7AA 3K46A 1ZCCA 5M17A 1QAPA 2V2CA 5CBBA 3IJ7A 4JTDA 4OJYA 3ITLA 3GLCA 2QPXA 3G8RA 3PG9A 5CSSA 2QPUA 3ES7A 4A2RA 1P43A 1XSKA 4DF1A 3EWYA 1A5AA 3LBCA 4KW2A 4YL2A 5REQB 2XWDA 6XIMA 4FO4A 5CC3A 1A5OC 3DGHA 3BPWA 1G1YA 3WFAA 3V1PA 1JI2A 4MY8A 3W88A 2BGSA 3GHRA 1RK5A 3AWOA 2XGBA 4JTAA 3H2FA 3WEZA 3BMXA 4US5D 5BROA 4A2SA 3C0QA 5AYBA 2TPSA 3ZLFA 4HU4A 1BWLA 3G1XA 1FWGC 3GRIA 1LJYA 2Z6IA 4JCMA 4GY0A 2BCPA 2DZXA 4G6CA 3DJJA 1GYLA 1GZJA 1XQLA 3BLFA 5M3WA 1WBHA 1QHZA 2DUZA 1DTUA 5TR3A 5TF0A 1C91A 3W7JA 3MANA 1XIIA 3CHEA 4H4WA 4C6KA 1NP2A 2XN0A 2A7NA 3KFTA 1TYTA 3GO2A 2GDUA 4S1FA 5IFTA 3SSJA 5L6UA 4ASTA 5DFAA 4GVFA 3Q65A 3HV8A 3RHGA 2G0WA 7REQA 4XSLA 3O07A 3U5UA 1IZKA 3GTNA 3G8EA 3S2MA 5C0QA 1TJ1A 4O18A 5FF0A 3LLFA 1OT1A 3F4DA 4EK7A 1OGBA 5H91A 5HUPA 7CGTA 2C16A 3MP5A 3N6HA 3VFLA 3KEHA 1F3PA 2VEIA 4H4ZA 1BQGA 4E4UA 1UC4A 1UUQA 3T0CA 2X8HA 2V8ZA 3NQEA 3A4XA 1JPIA 3F4CA 2RH9A 5E0CA 1O7AA 1TJ2A 3WDHA 1E9ZB 2EJAA 1E6QM 1TV2A 4DUOA 3DECA 1VQZA 1XF0A 4N4PA 2YQUA 3BLKA 3TXZA 1F76A 2O55A 4AZCB 2J47A 1TELA 1V03A 3NL5A 1XC4A 1FHLA 2X0YA 3HV9A 3AIQA 3APYA 4N6EA 1MW3A 1TJ0A 2PFHA 2R91A 3IJ8A 3P2VA 3M16A 4A4AA 1UR4A 2OQYA 1H1NA 3UR8A 1Y5XA 2FGLA 3Q6JA 3GTXA 3FY1A 2FVLA 1GVOA 2YCJA 3UW6A 1T5AA 4ZZ9A 3WH7A 4GH3A 4XKYA 2QCDA 3BAIA 4JTCA 5D2YA 4GVHA 5DN1A 1GK8A 4A22A 3IWPA 2ATMA 2OPJA 2G8ZA 1X6NA 1RHCA 1H49A 3TP4A 3WLOA 1FFVC 1RVKA 4E6MA 4C6NA 4PMVA 1GOMA 1EJSC 2W67A 4UQAA 1H7OA 4P8UA 1AJZA 4QE1A 3K4WA 4F0MA 1FECA 1BG4A 2HWGA 3A4AA 3I4EA 1WYIA 2PDCA 4C1NB 1E6SM 1TYGA 2I17A 3CUJA 4UFHA 1UIOA 3MCNA 1J10A 3KBMA 4CN1A 5HNRA 1KXTA 4IGNA 2ZIDA 1UR3M 3VD4A 2F2HA 3R0KA 3UNDA 5JCNA 4G5DA 4BI6A 3S42A 4JIEA 1NDAA 4V33A 5KMYA 1QCWA 3KP0A 1NAL1 4Q22A 1OJTA 1QOPA 2HK0A 3OC4A 3W1UA 1XH0A 4CD4A 2OGYA 2PDWA 3VU2A 4CGTA 4AF0A 1YQ2A 1XD1A 4D6FA 2V63A 1PX3A 3M43A 3U6WA 3ARTA 1JDDA 1NWSA 5EPDA 3E74A 4NL1A 4UCFA 2OSXA 1QNQA 1NHRA 3DKJA 2WVVB 2X30A 3ZWTA 4QQUA 3FJNA 3BG9A 3VMNA 1OHLA 1UKTA 2JIEA 3QV7A 4DYKA 1YE4A 3IS4A 1WDWA 1JCLA 3CMJA 3QW3A 1UW9A 3AICA 3W7MA 5I78A 3O05A 3ZLHA 3LZ5A 3W7OA 2OXNA 4KWOA 1L2QA 1SM9A 1V6TA 3IV3A 3VCRA 5F4XA 3IJ9A 4PBGA 2XISA 5EMKA 3AJ7A 4MJZA 3CIWA 3LPPA 3V0SA 2QUVA 4L56A 1UP3A 4JIIX 2HJPA 3VGFA 3FYPA 3GUWA 3THCA 1AODA 3G77A 3DIPA 1PPIA 4M1RA 1L2UA 2ZADA 3GC4A 2ZC1A 1E40A 4J3XA 4C7FA 1TZ7A 3TQ0A 2R94A 5PTDA 4GYPA 2VJXA 3VNZA 1HF6A 3NGJA 3TC6A 2G3MA 2PBOA 2Y1HA 3E1F1 4JQ1A 3D3FA 3QBUA 5FSEC 5MKGA 2WP5A 2QAEA 4TVCA 2DZSA 2QW5A 5DT5A 2G3JA 2WQDA 4UQDA 5K9CA 3FHQA 2E5BA 1FCVA 2V67A 3KHJA 5KZEA 1Q7MA 4EM4A 3TR9A 2Q02A 1H6VA 1RH9A 4RE2A 1MUCA 1TPEA 1H4PA 1VCVA 1CI1A 3WQVA 1RUSA 3ZVHB 3AIEA 3SEPA 5BMWA 1OB0A 1RK6A 1TWIA 3WQEA 4MHBA 4K6AA 4H9VA 3M6DA 3RG6A 1GZGA 4UQEA 4WKHA 4QITA 4BR1A 2JGQA 3TYBA 3V4BA 1TPH1 4QFUA 3EX3A 1JF5A 1WQ5A 2JKAA 1AW5A 3NO1A 1NFGA 4IG2A 3LCHA 2CCRA 4ZB5A 2DT3A 3IIPA 3PHAA 4I6KA 1J0ZA 3WL0A 2DZAA 1T96A 4Y8EA 3HPAA 3ABRA 4LBSA 3N73A 1AZ2A 1DIDA 3EKLA 4ADSA 3FIGA 5CEWA 1PVNA 2J88A 2Z1KA 5DMMA 5D9MA 2AGKA 4UR8A 3ZS4A 1J0KA 4H4VA 4TVDA 4NASA 2ZQ0A 3W72A 1OF8A 6ENLA 2B31A 8XIMA 2A2IA 3V5FA 4X2PA 1UKQA 4N9CA 1W9XA 2DVTA 5T8GA 1ZL1A 1T8QA 3NDYA 2AAAA 4MZYA 4LBRA 5ABTA 1KO0A 4OHQA 3CZEA 3SY5A 2EKGA 4S3KA 4ATLA 4CEUC 4AIBA 3DC8A 3W38A 3O3RA 4U31A 5ABGA 4JL2A 5DO8A 3UERA 1GVQA 1W0MA 2ZXQA 1BVWA 1KRAC 3ZSSA 3EDDA 3DH7A 1NDVA 4UBPC 2FZ8A 4NIRA 3RLVA 2FMNA 2YL6A 3W4RA 1E4NA 3LB8A 3CBWA 2P3ZA 4UMCA 3EANA 2XJ7A 4B90A 4UZUA 3CAKA 1W8SA 5AC5A 4S38A 1PIGA 5E9XA 5SWUA 1TR9A 1PWMA 1J79A 1S2VA 1EXBA 1OYBA 2WCGA 3E0IA 3K4AA 3H54A 1Z32X 2H9AA 2FB3A 2A3AA 2C71A 3RF9A 1MZRA 2PU0A 2REQA 1GONA 2VD8A 3MDUA 2CPUA 4Z1BA 3IVSA 2P76A 4NYYA 1AD4A 1M1BA 2DDXA 3ISIX 5I77A 1JPMA 1VEPA 3C2EA 1Z48A 3O06A 2CLFA 3T4WA 1XPYA 2ACRA 1YXCA 4F66A 4US5A 1IXNA 5A6TC 3ZM8A 1LOSA 2QPSA 4PL1A 3QR1A 3H7VA 1BZLA 1SO4A 1V4YA 2CESA 2FKPA 3SUUA 1IZJA 1RVGA 2OWCA 2V30A 2CBIA 3GW3A 2DUAA 3GDBA 4H4UA 2OELA 3TMQA 4DELA 5EGRA 5G2WA 3ARRA 1ISVA 1UCWA 1XKYA 4FF7A 4JTTA 1R86A 5HQMA 4EQRA 3P67A 2HTMA 1VYSX 3D5HA 3ID7A 1NP0A 1I0DA 1VFMA 4HHHA 2DT1A 5D38A 2R14A 2BFGA 5K9XA 5G4WA 4M6UA 5GJMA 4F0KA 3WDRA 4FNTA 5A6LA 3CIVA 1ECEA 3MKVA 3CTTA 1KBBA 3DX5A 3P3BA 4NG3A 1OFOA 2ZFAA 2QCGA 4Z2GA 3LLDA 3B0XA 2X1TA 3QZAA 3WUFA 1FX6A 4AZIA 4DB7A 3VXGA 4B3KA 1TZZA 1ZTVA 3EOEA 3VZZA 1W91A 2OYMA 1RBOB 2OLAA 1XIFA 4IFRA 2VWSA 2D2JA 2WV8A 1B9ZA 1Q13A 4JTHA 2A3EA 4N9BA 1LDCA 4DWSA 2KZHA 4HD5A 1R46A 1W1ZA 1X7IA 2GVGA 4MNMA 3WJWA 3AS3A 2Y8VA 2VC5A 3KBSA 2PGFA 1GGOA 1VYRA 4ZTXA 3WQWA 3KZPA 3ATYA 2DH2A 3ABZA 1MSSA 1S2AA 3VMPA 1A5CA 3XIMA 5D09A 4O50A 1LCOA 1BXBA 3TTQA 3P81A 5RUBA 4BEQA 2VRQA 3TV8A 4QHRA 3S9YA 5FJTA 4L5ZA 2E9MA 3N17A 3NPUA 3VNKA 1W5MA 3CUZA 4HU8A 1I1WA 3QRHA 3BH4A 3FW6A 5KETA 3IK4A 3VOFA 1FBAA 5HPCA 5EFFA 3WJYA 3N4AA 5BRPA 2PS2A 1IGWA 3EF6A 1RSCA 4XZIA 1EJWC 1M5WA 3B9NA 3PZQA 3RLHA 5D05A 3OODA 1YPFA 4RNHA 2I16A 4GY7A 4XZLX 1W5OA 5E70A 3SJNA 2ZRVA 2J66A 1YRRA 4DBDA 3GY1A 3HW2A 1W1B1 1T3QC 2ZZ4A 1QW8A 2QDGA 2Y5SA 4IGMA 2J79A 4I9TA 4S3AA 1QATA 3EMZA 2J6XA 2VELA 3GXDA 1Q6EA 4ZO9A 4C5YA 3UA3A 4JKMA 2RUSA 3W9ZA 3K8KA 1WXZA 5FIPA 1AMKA 3CAQA 1XLAA 1H7WA 1GVSA 2W6RA 3OU8A 4HNLA 3TYEA 1DWJM 4HPNA 3NVVB 3HURA 1AOGA 1CLVA 1I60A 1LRTA 4RW3A 2G4FA 1RAKA 3KLJA 4US6A 1PYFA 4XUYA 3VC6A 1WE5A 3WNKA 3DHPA 1PWLA 4KCWA 4E4PA 1VRDA 4JTFA 3SURA 5G4HC 3POHA 3TSMA 3LERA 1MNZA 3MP4A 2VEGA 2WSRA 5HA7A 3GR4A 1FIQB 3DH9A 1TYPA 2X1SA 3AIVA 3LCLA 3SY8A 3NURA 1THFD 1ZJAA 2OYKA 4W89A 4TX9A 4DIAA 5J5RA 3B06A 4M82A 1LOLA 3VO0A 4HYWA 3M5YA 3F4NA 2I14A 1XDLA 2BGQA 4E38A 1GRHA 3N3MA 1IXOA 3TYUA 5G5IA 2D0HA 4W85A 4EQXA 4HGXA 2GFTA 3PY2A 2QCFA 3HG3A 1SFJA 3QZ6A 1NHPA 2YBTA 1WXJA 1EUAA 1XYZA 3MUIA 3VNIA 2QCEA 5JCKA 4KH2A 1IIGA 2KAUC 1RA5A 4PUNA 1B3WA 4FAMA 1MEWA 2GQ3A 4RNIA 3MMDA 1REQA 1EBGA 1W9PA 3LHTA 2OTDA 4R88A 4XD4A 3M0VA 1J6PA 2WVTA 1FRBA 3FLUA 3OA3A 1DKWA 3GBEA 1NY1A 4H4SA 4CQDA 1BYAA 1R47A 4KF1A 3GFZA 2QLYA 4XSMA 2XIBA 1EIXA 4C90A 6XIAA 3AMKA 5EFDA 3HQ1A 3MVIA 2HQMA 4NILA 2A3HA 4EKJA 1YBQB 2BHUA 4HPHA 3VIPA 4WUIA 4A35A 2NLIA 2YDQA 3P7YA 1JROA 1W3NA 4YWIA 5U1OA 3VCCA 1OCBA 4UTWA 2F8QA 4AISA 2ZVRA 4ZE4A 2PDBA 4UNKA 4ZSTA 3RCYA 1MMFA 3PB0A 3WQOA 1XYLA 4QJ1A 1S1RA 3WDPP 4H6QA 1BKSA 3C8NA 3BSGA 3GU1A 2BVYA 1P4CA 3M47A 2OZTA 4FXSA 2CLLA 5F7UA 4M3PA 2WMKA 1MQQA 2WQPA 4OE7A 2NWRA 3F2CA 3EOLA 1AUSL 1VBUA 1GOWA 4PCTA 1PDZA 4DWDA 1SR9A 1FWTA 1XSJA 3PM6A 2J7CA 1ZRQA 2NPXA 1X39A 4ICNA 4ONVA 2FMOA 1MFVA 3ITGA 3W2JA 1FEBA 4R7JA 3CPGA 4XB3A 1FKXA 1GETA 3KTSA 3HGRA 1R3YA 3WO8A 1O5KA 2DVXA 1XIMA 2WMJA 1BRLA 4DXXA 3GXFA 2GGIA 3G1VA 4IJCA 1RPXA 1WKFA 1GSNA 5EBKA 3DBPA 3H2EA 1W3KA 4AH7A 4ZQMA 3QQ0A 1RQHA 4F79A 1KRMA 1ME9A 3U2ZA 4PUKA 2G37A 1I9CB 4V1YA 2YBUA 1K03A 1VCGA 1BTCA 4GYFA 2PODA 4Z0SA 1B2YA 1XCWA 1GQIA 4LUYA 2ZWYA 2YZ5A 2GJPA 4M52A 4BCEA 1H63A 1MO0A 1DOSA 1EX5A 2GQAA 5D8ZA 1W1PA 2LLEA 3W1MA 1KBJA 2YXGA 1VLIA 2W3ZA 4RX0A 4H4RA 2OVLA 3IGSA 1K9EA 4O13A 5TAOA 3CUGA 3QY7A 1I45A 2DT0A 4IIFA 1NHSA 3T42A 2QF8A 1A53A 3GTIA 2ZUTA 3WBXA 4K37A 1C93A 4K38A 5A8PA 4ZQOA 4K7ZA 5G1MA 1TUXA 4GYPC 3V1HA 3RR1A 3W7KA 5CZTA 4LIIA 3GBDA 4PB4A 2AQVA 2ICSA 1XR2A 3VNYA 3TOYA 1RJQA 5I03A 5FJPA 4PMUA 3VD3A 1Q2RA 5HK4A 4DUVA 2CLKA 3CC1A 5LSMA 4UNIA 1P7TB 2Z1BA 3VKKA 4F0RA 3T09A 4IQEA 3GDLA 4AWSA 4MPKA 1M68A 1ZK7A 1JD7A 2Y62A 3LGGA 4W86A 2QIIA 1P0DA 2C79A 4XBSA 3B9JB 3DG7A 5LZLA 3BLDA 3P5ZA 4UMBA 4LXFA 2WJZA 3UZ5A 3A12A 2QV4A 3CV6A 2WYSA 3AALA 3BLOA 1EJ7L 3NOEA 3AMGA 1L6YA 2Y7GA 2ZX5A 4Q8OA 3OG2A 1GTHA 4H9TA 2VZOA 5AZ0A 4DZIA 4GIRA 3ES8A 4JDYA 4KIRA 5DY2A 1KGUA 3BOFA 3QGKC 4C6OA 4G1KA 4K7YA 1VJSA 3OBAA 2ZX7A 2WSYA 4LQ1A 1VKFA 1ISYA 3D9XA 1ZP4A 1P1XA 4MWAE 2YA0A 1UOKA 3NPXA 1KNWA 1MW2A 3VIHA 1G4SA 1JCMP 3KOFA 1NWUA 3DC0A 3ECQA 3DI1A 2FTYA 2ALRA 1ZUAX 3ANYA 3UPMA 3TYZA 1MUWA 3BW4A 4HHMA 1O68A 4ZA0A 3TJLA 1MFUA 2ZTJA 5DRIA 4M51A 2WWCA 3HG2A 1VPQA 3PPFA 1A5SA 4DO6A 3V75A 2XPKA 3R89A 4KPRA 2ZXBA 3ALGA 3H4GA 1J93A 2GDQA 1NOFA 2QCHA 2XFRA 3WK1A 4L4MA 4NZ1A 1A5LC 2HS8A 2AQOA 1M04A 4EXBA 4PB3A 1I8JA 2D0FA 3HG4A 1ITQA 1DHPA 5CQ1A 5I3KA 4G7EA 4HOWA 2GK1A 1YHTA 4LF1A 4R53A 3MZNA 3TWAA 2RJHA 5G5HB 3BG3A 3N25A 3N4FA 1HL2A 3EA1A 3R11A 3A6OA 4Z2IA 4L1WA 1Z69A 3NEVA 4RDWA 4CD7A 5CPLA 3JZUA 2DPEA 3WEOA 1I2PA 4GBUA 1C8XA 1XIEA 3LD5A 3IGUA 4NNCA 1GJWA 5B7YA 4JIRA 4H9XA 1EGVA 3EAOA 1IQ8A 4H6RA 2C3ZA 3PZNA 2GZXA 5AC4A 3GIPA 1R9YA 4UQBA 3FDGA 3CGBA 2TMDA 4XAFA 1A0DA 1KM6A 1XG3A 1XP3A 3EX2A 2E25A 4CD6A 3MWCA 3T0DA 4MFEA 3KCLA 3WG6A 1D8WA 1DP0A 4LAZA 4FNSA 3USBA 4BS0A 1LORA 4GA8A 1EP1A 1UMYA 1VPYA 4S3GA 3HMJG 2GR3A 4OECA 3QM3A 1JPHA 1RCOB 1J5TA 1ZQ5A 4CNTA 2ACQA 2OYLA 4O53A 2CETA 1V3HA 4W88A 2Z1VA 3TZNA 2BY2A 1FFQA 4TVUA 4YS1A 5D2VA 1F8WA 2B4GA 4RLIA 5FACA 2OGJA 4Y9OA 3CGDA 2G3IA 3S83A 4P7QA 2BWGA 2E5DA 1ZBVA 3EKZA 1EO5A 2A21A 2BLEA 1H7NA 3TN3A 2PTDA 3A3WA 3GDRA 3E0LA 4XBJA 1Q6RA 4W8BA 4D8ZA 6ALDA 3W7EA 2PRHA 3DI0A 1L6GA 3BLEA 1F3WA 3LTSA 1TV7A 1M53A 3WBWA 4MF4A 3WD3A 4DWSC 3MUXA 3CPUA 4ZBCA 1JCTA 1E73M 4F3HA 1WKEA 3EEZA 2NX9A 3OW1A 1HJSA 1Q7QA 4M6PA 3ZMRA 3B0UX 3W2MA 3G0SA 4J2MA 1OX6A 4S2CA 2F9RA 1PDYA 1S46A 2UBPC 3PJTA 3BZGA 1UASA 4MY1A 1LOQA 1VRXA 3STCA 1PXGA 1EH9A 3RO8A 1QWKA 2B81A 2EQ6A 4HMNA 4JEJA 2BS9A 2C8NA 2YA1A 1S5MA 1FH7A 3OVRA 3B40A 1SJBA 1M7PA 3T2PA 1V3JA 4F9DA 1JDAA 1K4QA 2XFYA 4H2HA 1GERA 1TE6A 4F4RA 5G2HA 3LI0A 3LXDA 5CC5A 1JNDA 2Q8LA 2Q09A 4CN4A 2E3TA 3TN5A 1EP3A 1EQCA 2ISDA 3O15A 3FJ6A 4KMQA 1R9XA 4NUWA 3KDOA 4PMZA 4H3DA 1HW6A 3JZEA 4Q8UA 4XD6A 3WX7A 4JDRA 2YB4A 4I90A 5KZ6A 1GUVA 2YLLA 5JBEA 4H8HA 4UTIA 2I7GA 4PZVA 3AQUA 4V28A 4IPLA 5AC7A 1TA3A 5TQLA 1V6XA 1YTDA 4GJJA 3EWWA 4JOMA 3W7IA 1FFUC 1X6LA 4GLEA 3QR0A 4PTNA 2DVUA 1E15A 1OD8A 4O10A 5I6SA 4PFHA 3IJ6A 2ZWZA 1KXHA 5A3HA 9XIAA 4O0QA 3HZ3A 2AOSA 2X2YA 5LKYA 2YB1A 5A6JA 5HBFA 3BMWA 3R8GA 5FKYA 3LCWA 4JFUA 2CLHA 2OEJA 4H4IA 5FEWA 2ESCA 1A4MA 1WDQA 3NSMA 4KRUA 4GY1A 2FPYA 3M7WA 1SVDA 1ZAHA 3SCVA 2GUBA 1JF6A 1ZB5A 2IXUA 2XWEA 3ABOA 4ZOCA 4O28A 1F3TA 2HPIA 4DJFD 2Y7DA 4PFMA 3E5PA 4LSBA 1FWJC 3CYVA 1UR2A 3LUTA 1MEHA 2BODX 3CAWA 4ZOBA 4Y8FA 4ZCWA 4CCCA 2G97A 1H51A 5LIUX 4ZR8A 2WKLA 2PDJA 3CQ0A 2PWVA 4RK8A 4V1XA 2VFEA 3D6NA 3R7MA 3T78A 4O14A 2WMIB 4CCEA 4WY0F 1VEOA 1E1CA 3ABSA 1OCQA 2UY4A 1GOXA 4MFDA 2J7BA 3WELA 3TYAA 1OSEA 5JBDA 4ZB2A 1YE6A 4MZ8A 5CH9A 5H1WA 5FAJA 4FIQA 3BANA 4DO4A 3E2VA 3L0GA 3IACA 3VILA 2Z2AA 1O4UA 3H2NA 3C2OA 3VKCA 1X8FA 1ENUA 1GHRA 2EBNA 1D9EA 5DXXA 2XVNA 4NZ4A 4H9UA 4DEFA 3PPCA 3WJSA 1RM6B 2J25A 5HAOA 4KCTA 5FA5A 2WZMA 1VHNA 2AL2B 3BW3A 4AWEA 4GUFA 4PCNA 2VT0A 4JAWA 3D47A 4O1FA 2PDXA 1XW8A 5HDRA 3BLIA 2X50A 1OX4A 4O8RA 1VYPX 3BSHA 1H1ZA 1XUZA 3BAJA 3GHUA 1QUMA 1JQVA 3N9RA 1BXNA 5K7JA 1NOWA 1UB3A 3WDJA 4ZFCA 1Q65A 2V3GA 3EX1A 4JN8A 3GXPA 3WJXA 4A6GA 2BHYA 4I8DA 1JYVA 4UTWC 2MUCA 3R58A 4J9JA 4PODA 3F2BA 5HANA 3NVWB 1WPCA 3QMTA 3EGJA 3BQ5A 4D8LA 5F2LA 2XTKA 3G1DA 4HNOA 3SQPA 2P5NA 3QFWA 5A8QA 1V97A 1XLEA 4QAWA 5FEPA 3BAKA 4JGDA 2IPGA 3LCFA 4XAYA 3W37A 2HQAA 4C91A 3I6EA 2EPKX 4ML9A 3SY1A 4AVOA 2ISFA 4RV8A 3URAA 2IS7A 4ICMA 4L9XA 1E43A 1ODZA 3TJIA 1RCQA 3LCXA 4Z1YA 3AMLA 4AY7A 3QV9A 3B8WA 3KCOA 1KFKA 2GJXA 1E0UA 2X40A 1HXJA 3TOPA 3WQ4A 3EKGA 4D6JA 2J7FA 4LUTA 3ZT5A 4Q8NA 4TMCA 4UNLA 1XRFA 1GVIA 9CGTA 1LL4A 2NX3A 5A6MA 2QJMA 2WANA 3H4XA 2ZICA 4NZ3A 5FS6A 3TCEA 2W61A 2Y5JA 1F3EA 3QKZA 2F5ZA 4FOJA 1OM0A 1JULA 2OWWA 4DJED 1XBZA 5MHBA 4GZJA 2F61A 1BSLA 1FP8A 3S47A 2YCIX 1A3XA 4IXXA 1YTEA 4PSPA 3LI1A 2TPRA 1DWIM 5F2IA 1RQEA 3E0VA 1Z89A 4F8XA 1LVLA 4HNNA 5C8BB 3BAWA 4O19A 3LBMA 2H90A 2YBVA 1QBBA 2XGZA 4ACYA 4YTSA 5C9XA 4K36A 3RYSA 5BXTA 2OLSA 4Y6GA 3F4VA 4JYDA 3UWVA 1FA2A 3SI9A 2I9UA 3NXFA 4AZ6A 4PGLA 3RX2A 1UKPA 1IV8A 1E9IA 4PULA 1ITCA 1SZGA 2FH8A 4HHPA 4A21A 1K77A 3GVVA 4D1IA 3MSDA 1LUCA 2OQLA 4X9YA 4ATWA 3LTYA 1X98A 1SSGA 4XTIA 1J18A 3OB8A 2Z0IA 3H4KA 4RNFA 1XDIA 3C52A 1CGUA 1SFTA 2BY3A 3LV6A 1T0OA 4XTDA 1JDCA 4I9JA 3PBMA 4H9ZA 4W4QA 3GH5A 3UCDA 1B3YA 4ZQCA 3URQA 2E1DA 2GR1A 4GOAA 3CZJA 4GGBA 2E68A 4FX7A 1WO2A 2TAAA 3U0HA 2ZA3A 5A69A 3OGRA 3RO6A 2PDLA 2RDXA 1TPUA 1MXGA 1CNVA 1XS2A 4LNCA 4ZOHB 2W62A 3GVQA 5HJYA 3FAXA 2X0HA 3S2JA 4E2BA 2FJUB 5HJLA 2J77A 2PURA 3PUOA 3RPTA 1TPWA 2BY1A 3PZVA 5HNNA 3NFUA 1GPFA 1KW1A 2JFEX 3RPMA 4H2CA 2WZEA 5BZAA 2J13A 4E8GA 3WLRA 5JUVA 3H4WA 3GHSA 3OHMB 2XFWA 3ARSA 3GSMA 1K4GA 4FF5A 4MUPA 1T40A 4HMDA 1JFHA 4RXFA 4QEEA 4J7RA 2Z1SA 1W31A 2QEZA 4QE4A 2E7FA 5C7VA 1YNYA 2AAQA 1XLHA 2EPNA 3SB0A 8RUCA 1R3WA 1AG1O 1LRNA 4YMZA 3PTMA 1ZX9A 7XIMA 1E71M 1KBKA 3H2AA 5C9WA 3O7UA 5C9RA 3IUIA 4ADUA 4EOUA 2R9RA 3AMDA 4JIQA 3EYPA 4D71A 1IYXA 1FH9A 4YLWA 3ZO9A 3V0TA 1EX1A 4C6MA 3KVMA 1OY0A 3AXKA 4LAOA 4A8IA 4GYJA 3TLLA 2IKHA 2ACSA 1B3ZA 3FV9A 4GFSA 2PTYA 4A3YA 3IK2A 3FJLA 3LB0A 4LW7A 1E3XA 4HU3A 1XX1A 3B3DA 3QH2A 4M7TA 3FK4A 4QGCA 3WF2A 1FTXA 3HO8A 1QJWA 2FB2A 2ZUSA 1OC7A 3TVAA 5AFDA 3P74A 4FR1A 5FF7A 1PX4A 3NQCA 2I5QA 1K8ZA 4AD5A 3FVDA 3L65A 1BVNP 2DUXA 3PR2A 4LFYA 2GVJA 3CV7A 2XIJA 4HCLA 1E6RA 1QRQA 5BRBA 3SRFA 1VLWA 3UNTA 3UY8A 5XIMA 1OC6A 5I07A 3S5SA 3KOZA 1RY0A 3OQ8A 4ALDA 3KW3A 2WMGA 3OBEA 3UGRA 4GH1A 3FGCA 3O9NA 4C6JA 3RLUA 2Z26A 1J0JA 3OA5A 4L61A 1PTDA 3OVGA 3DYPA 1XIBA 4M5PA 4OOZA 1C7TA 1KM4A 5CC6A 4I9MA 4PCSA 3ONCA 4ZO6A 5HR6A 3GNPA 4C6QA 1SU5A 2NSXA 1EQPA 2FJKA 1MUMA 3D46A 5J5DA 4C1KA 1KM1A 2BASA 2XZ7A 2E6DA 1F73A 3TONA 3EB2A 2OKOA 5EMMA 4QDPA 2A6LA 2Q71A 3QY6A 5FS8A 1ICSA 4MWAB 3GD6A 4OZOA 1PTGA 1HIZA 5A8NA 1TMHA 3PC0A 2E8YA 4MYXA 3ZQ9A 3GVGA 4ZGYA 4RKAA 1GKQA 1PEZA 2VZSA 2PSNA 3MJMA 1KBIA 4AX7A 5JU6A 2I9EA 3PG8A 3HTWA 1XDMA 3W27A 3FSUA 4K8DA 4NEWA 3MCMA 3W26A 3PWAA 4GE8A 1LL6A 3L4YA 4GYKA 2PMQA 3ZZ1A 4ZB0A 4ZTYA 1E72M 2BOGX 3IEBA 5B80A 5LHFA 2XHYA 1A5KC 1H2JA 5AECA 1JZ2A 3F7JA 2UY2A 3TJXA 3AMCA 3NQ6A 1PZ3A 3TNBA 3ME3A 1FCUA 1O5RA 4GIEA 3VKJA 4EAMA 1Q4NX 1B4EA 3MMWA 3SGGA 3HBLA 1AQFA 5GQBA 3UZZA 1SO6A 3KBWA 1SJAA 1ZPTA 2ISVA 5F4WA 3ZOAA 5HWMA 4R34A 3O0FA 2FGBA 3CUIA 1JJKA 1UQYA 4AC1X 2JEPA 5BXSA 4L4LA 3CAVA 1UBSA 2YVFA 4W87A 2W3RA 3LPFA 1JXKA 3G22A 2WK2A 1DJYA 2V0TA 1XJBA 2DQWA 4AD3A 2QUTA 4PB5A 1SPQA 4RPQA 1UUOA 3NQAA 3NXLA 3IJQA 3ARXA 5E1QA 5CPMA 3T7VA 1XPGA 1UJPA 2OU4A 3WK3A 2VXNA 1NHQA 3QSRA 3VNLA 4EPKA 2A1YA 4F0LA 1Z6KA 3WSUA 4D1JA 1VFLA 1RD6A 2J8TA 5LIKX 3PG6A 1E56A 3UXLA 4AZ7A 1UWUA 3E02A 1QPQA 1ZXIC 1CZ1A 3C8FA 1Q6OA 2PGWA 2FVKA 2W91A 2WLYA 2ISWA 2ZZ1A 4JTQA 1UP0A 1FWCC 3MW7A 1BHGA 1RP8A 5AHNA 4OUIA 3CHFA 4WDXA 2P1FA 4ACZB 3SO7A 4NRSA 2GJRA 1UR0A 1R38A 1AQMA 3A9IA 3DYMA 4DAFA 1ZENA 3EWUA 3SFKA 4DYJA 1ONXA 4QM1A 4X2RA 3KUMA 5G4EA 1DVJA 3UP8A 2YFOA 3BGGA 3CL7A 2QJNA 3VD9A 4E2VA 1UR8A 1TIWA 1IWPA 1R2SA 2QJIA 2ABBA 4RW5A 4DO5A 1TVLA 1LP6A 3R10A 3N11A 3TXVA 3LLXA 4IP4A 3W1XA 1E55A 1KCXA 3IGXA 1W3JA 4DJEA 3M7SA 2C13A 3H53A 4GX8A 4LH8A 4F2UA 1K9FA 4LANA 3KM8A 2DP3A 5D2WA 3I4KA 4LUIA 3K1GA 3DK8A 4W7UA 3BUVA 3VDAA 1NPXA 3TW6A 2WBGA 2XDFA 3STGA 3WNOA 3CV1A<