4DYEA

Crystal structure of an enolase (putative sugar isomerase, target efi-502095) from streptomyces coelicolor, no mg, ordered loop
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
376
structure length
376
Chain Sequence
MMKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMWGAPVAAIVRRMAPDLIGTSPFALEAFHRKQHMVPFFYGYLGYAAIAAVDVACWDAMGKATGQSVTDLLGGAVRDEVPITALITRADAPGATPADLPKAMAEHAVRVVEEGGFDAVKLKGTTDCAGDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAGIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSGPGLGVSVDEDKLRHYAGVNERDGDLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords isomerase
publication title Crystal structure of an enolase (putative sugar isomerase, target efi-502095) from streptomyces coelicolor, no mg, ordered loop
rcsb
source organism Streptomyces coelicolor
total genus 134
structure length 376
sequence length 376
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dyeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dyeA01
2P88A 3TJ4A 3RO6A 3RCYA 1JDFA 1FHVA 2GGGA 4IHCA 3BOXA 2XSXA 2AKZA 4KT2A 1NELA 4GIRA 3CK5A 2QJNA 2ZC8A 1KKOA 3CB3A 2AL2B 2AL2A 3DG3A 4GYPC 4GFIA 1P43A 4ROPA 3ZLHA 2OQHA 2PP0A 1TZZA 2OO6A 4M6UA 3T9PA 4H19A 2HZGA 1ELSA 1KCZA 1JCTA 3H8AA 2POZA 4K1WA 1P48A 2HNEA 3DDMA 4GYPA 3SN0A 3UJSA 3ZVIA 4A6GA 1MDRA 2PP3A 3VA8A 4A35A 2O56A 3K1GA 4MKSA 3MZNA 3KUMA 4JHMA 3THUA 3OPSA 4GGHA 1KKRA 4MGGA 3FVDA 3S47A 4G7FA 4HNCA 3ZLGA 3OP2A 2PMQA 3T4WA 4DHGA 1F9CA 3V3WA 2XH0A 3UCCA 3BSMA 3U9IA 3PWGA 3UXLA 2GL5A 2GGEA 2OG9A 3NO1A 4DX3A 3ZLFA 2PCEA 2HXTA 1MRAA 3TQPA 4GGBA 4E6MA 3PFRA 4Z17A 3DERA 3FXGA 3OZMA 1SJDA 2AL1A 1EC7A 3FYYA 1TKKA 3GC2A 2OZ8A 1E9IA 2PTZA 1EC9A 3SQSA 3R0KA 1SJCA 3DG7A 3QN3A 3S5SA 1PDZA 2PGWA 2OVLA 3DFYA 3UJRA 3GY1A 2OZTA 4IZGA 3CYJA 3IK4A 4X2PA 3ENLA 3U4FA 1PDYA 2ONEA 2MNRA 3I6TA 3QTPA 4G8TA 3B97A 1JPMA 3H70A 3R0UA 3SBFA 4E8GA 1EC8A 2QQ6A 2XGZA 3DEQA 4HYRA 4GISA 3QPEA 3UGVA 3TWAA 2FKPA 3ES7A 5EU9A 3BJSA 3UXKA 3V4BA 1ECQA 4M0XA 3SN4A 3VC6A 3RGTA 2OPJA 3STPA 4IT1A 5FJRA 2XH4A 3GO2A 3UJ2A 3ES8A 3MSYA 1WUFA 2QDEA 2OX4A 3UCDA 1XPYA 3SJNA 4IP5A 4JN7A 3IJQA 2OLAA 3GD6A 3D47A 3MY9A 5FJUA 3OW1A 3R10A 2GGJA 4ZA0A 1BKHA 2OFJA 1TE6A 3TTEA 3H7VA 4E4FA 1MDLA 4DN1A 4E5TA 4HCDA 2PU0A 2PSNA 3N4FA 2PTYA 1JPDX 2ZADA 3JW7A 1MNSA 3QLDA 2OKTA 3NXLA 1WUEA 3EKGA 3MQTA 1DTNA 3NFUA 3VCNA 1R0MA 3P93A 3JVAA 3V5CA 3R25A 3VC5A 4YWSA 3DESA 3MWCA 4HCLA 4IL0A 4A3RA 3CXOA 2XH2A 1L8PA 3SN1A 2PGEA 4GMEA 4HPNA 3N6HA 3UJFA 4EWJA 4DWDA 2CHRA 4F4RA 1W6TA 3HPFA 3OTRA 3QKEA 3P0WA 3N4EA 5FJOA 2DW6A 2PU1A 3P3BA 2HXUA 3R1ZA 3JZUA 4H2HA 3TCSA 3I4KA 4H83A 4HNLA 1KD0A 3T6CA 2RDXA 2OQYA 2PPGA 2XH7A 3TOYA 1MUCA 2P0IA 2PTWA 1YEYA 3H12A 2I5QA 1FHUA 2DW7A 3DGBA 1R6WA 3VDGA 3NZGA 2GGHA 3PK7A 1XS2A 3I6EA 3R11A 2QJMA 3DIPA 3IJIA 3T8QA 3Q45A 2PA6A 3CAWA 1IYXA 4ZCWA 3VFCA 2MUCA 2FYMA 2PTXA 3Q4DA 5BOEA 1EBHA 4IP4A 3FJ4A 7ENLA 3MUCA 1SJBA 3DG6A 2GDQA 2GGIA 3N6JA 4HCHA 2GSHA 3TW9A 3TWBA 3VCCA 4HN8A 5IDZA 1RVKA 4DXKA 4H1ZA 3OZYA 3ZVHA 3ZVHB 2P8BA 3TJIA 4E4UA 2P8CA 2PODA 4JN8A 2QGYA 2PS2A 2PP1A 1BQGA 5FJPA 1OEPA 1ONEA 3RRAA 3SSZA 4K8GA 4KWSA 3CT2A 4J1OA 5FJTA 4FP1A 3FCPA 3D46A 4ENLA 4MMWA 4K2SA 3DFHA 3MKCA 5J04A 4IL2A 6ENLA 2OZ3A 3PWIA 2AKMA 3IJLA 4KPLA 4Z1YA 1SJAA 1EBGA 4FI4A 3FV9A 3UJEA 3EEZA 5BOFA 3RR1A 3RITA 2QDDA 3V5FA 1NU5A 2QVHA 4J3ZA 4KEMA 2NQLA 2QJJA 2P3ZA 5ENLA 4DYEA
chains in the Genus database with same CATH superfamily
4HOZA 1HFBA 3TSDA 3WBXA 3FG2P 1XC6A 3VDCA 1YPXA 4MZ8A 5LKYA 4O0KA 3EYPA 3PM6A 4CD8A 2QJNA 4NAEA 3UWUA 1W3TA 2VCAA 2ZDSA 2VQTA 1B3ZA 2HISA 3ZLHA 3N13A 1H3GA 1IEQA 2YL8A 3WJYA 3WQFA 4PEEA 3VAVA 4NU7A 5LSMA 1RHCA 4YYFA 3AWNA 5H2ZA 4NNCA 4S3JA 4N2YA 1WP6A 5CPLA 2D2JA 3GDBA 1Q6EA 3C52A 1XHCA 3VGHA 1XF0A 2XVGA 1HKJA 4PTMA 3M5VA 4CNOA 2XIIA 4XG1A 1W9PA 2GGEA 4L56A 4V33A 4AD5A 4PTVA 3LADA 1V0LA 3H2AA 1YW1A 1EGZA 1T6MA 3NNTA 2GQ3A 3CGTA 3BAWA 2WWDA 2BHZA 4UQEA 2X1UA 4GINA 1U22A 2R94A 3LQLA 3CWOX 4ONVA 4UTKA 1WKDA 3TQ0A 2E1DA 3UZJA 1XYMA 4W7UA 4H04A 1X6UA 5XINA 2W91A 5GNZA 4TVYA 4AH7A 1OY0A 4IMCA 1J10A 4MDOA 3HF3A 4B3LA 1DWGM 4MFEA 3M4HA 4WJEA 1GOWA 3FN9A 4HPJA 1TWWA 4PCFA 3QTPA 5KINA 3V16A 3NEVA 3KCLA 4MDPA 5F2GA 3OVPA 3RXZA 2QCFA 2YX0A 4CU7A 1O5RA 4BS0A 3GH5A 2XGZA 2E6DA 3FAWA 3H2FA 4GY7A 1XCXA 4Z2GA 1Q6DA 5A6KA 4OU1A 3ES7A 1NIUA 1S46A 4E3VA 1BRLB 2FIQA 4JTQA 3EUB3 3RM4A 1UMLA 3E2VA 3CQHA 3PHAA 2PAJA 1HUVA 4Q7BA 4CQAA 3L12A 2P76A 4FNRA 5KTLA 2OR2A 3KRSA 4LXFA 3VX0A 4QLKA 3GU1A 1W54A 2ZVIA 4P8VA 1JCLA 1EX1A 2BMBA 3NQAA 4ALDA 1KC7A 5TNVA 1IWAA 4Y9OA 4HU3A 2SFPA 4DJFA 4F0HA 4GYKA 1TTQA 4JXCA 3MY9A 4LUSA 4ML4A 1CXHA 4DUXA 3UG5A 1NH6A 2A7NA 1OX4B 4Q4KA 1GEQA 4J2MA 3LHYA 3S6TA 4KWVA 3GS6A 1MDLA 4B16A 3DHUA 2HBVA 3QOKA 1JYVA 1HGWA 4C6FA 1E0VA 5C54A 4WF7A 3PB0A 5L6UA 3LCFA 1MNSA 3AWOA 5BXTA 2QS8A 3MJYA 1Y65A 4W9TA 3W88A 3KE0A 3II4A 4TX8A 4L61A 5AVNA 3MQTA 4JKMA 3LHZA 1WKFA 2UY5A 3U2OA 1FFVC 3STEA 1OG6A 1O5KA 3MCMA 3IUDA 9XIMA 3QF0A 2WPGA 4F79A 1HJWA 2WCSA 3MWCA 2QKFA 3CHFA 1YHTA 3A12A 3S9ZA 5HXMA 2WSKA 1Q6FA 2FZ9A 3WQVA 4J7RA 3TYEA 7REQA 2NSXA 1W6TA 3W86A 3QKEA 1D3CA 3O07A 1J9YA 2C16A 3A24A 4U10A 4BI5A 4KCUA 2ZQ0A 4PMRA 1FDYA 4TU1A 1C29A 4GE8A 1D8WA 3M0HA 3PPGA 1X8CA 1OJTA 2D2OA 4UWMA 2J75A 4LH8A 1KW1A 1K77A 1TV5A 3IVUA 2G4JA 1HVXA 4HNVA 1TYTA 1T5AA 2C71A 4MNJA 2OCZA 3CQIA 3QFBA 2W67A 1R3RA 2QCLA 3DOPA 4ZXLA 5EKYA 4CEXC 1ZLPA 1WZLA 2FH8A 3W1MA 3W2NA 3CV6A 1GOQA 2YYUA 1FEAA 1JCNA 4B4FA 3ARVA 7ENLA 3WH7A 1NSJA 2GGIA 2D0HA 3MI6A 4ZMGA 4EM3A 4TXEA 1LL7A 1A4MA 2E5AA 3THCA 3VCCA 2E9MA 4F9DA 2OGJA 3B04A 1REQA 3NURA 1CZ1A 2WM1A 4A8NA 3GU2A 3PPCA 5HDRA 1UPMB 5FMHA 1QAPA 1RQHA 3MANA 1S3HA 1EUNA 3JR2A 3SCRA 4XTIA 2ZFAA 3ECQA 2VMFA 2XFRA 3RRAA 1DIKA 2WVSA 4AY8A 2C8NA 3GH4A 1H7RA 1EJVC 3AHVA 4L4OA 3SGZA 2DZXA 1QK0A 3CXBA 3RPDA 1V3LA 3GQYA 2HK0A 1FWJC 4J3VA 3GG7A 2GVLA 4IQEA 1DWJM 1GJWA 3AHXA 1J8VA 3OG2A 2ISFA 3F2BA 4RDZA 4JDYA 1TV8A 4AY7A 3WLRA 3UZWA 3CZLA 3NL2A 1SYTA 4S23A 4U3CA 3KLJA 4U4MA 3R2GA 1F4HA 2Y8KA 3WK0A 2QVHA 3WBEA 4DEFA 3ELFA 4MWAA 2NQLA 4FOJA 3WBYA 1Y5VA 3IIVA 4QP0A 3VGGA 1UJPA 3UFYA 1WDDA 3W2LA 4DJEC 1VFMA 4QNWA 3H7UA 5E70A 4GUHA 3NAVA 2VR4A 1NHSA 3DFSA 3G1FA 3QXBA 4QITA 3STGA 5KEZA 5C9RA 1STZA 1IEIA 4K3ZA 3UT0A 4GD0A 2YXGA 3W7KA 1R8LA 3V0SA 1XDMA 5ABGA 2O0TA 1HX0A 2TRSA 1VEMA 1CXEA 1ZS2A 3BTNA 2WLYA 5E09A 4H19A 5HULA 3WLPA 1JCTA 2X7WA 5DMLA 4O13A 1P7TA 3ZS4A 3WNKA 1X2HA 4LYPA 4EF9A 4UOZA 5FEPA 4V27A 3DZ1A 2WPEA 3CAKA 1G4EA 3K1GA 1V7YA 5LYRA 4RJEA 1TIMA 1CT5A 2FZDA 2OYLA 3SJ3A 4IG2B 4X61A 2ZUTA 1G94A 2VUNA 4AHQA 4H4PA 4DWSC 1TRIA 1ECEA 1KFCA 1QHOA 1XYFA 4MM1A 4EIVA 3CQJA 1T8QA 1SPQA 3KRUA 3P14A 1PO9A 5EL1A 1YXDA 3KVLA 4B2DD 3N25A 2E09A 2HXTA 4IIEA 2AQWA 2ZX5A 4JIHA 4WIWA 4Q4PA 1RJQA 3S2MA 1EHAA 3LCIA 4AXKA 2C3DA 1GKRA 2Y7GA 1NF7A 3HQNA 4GQGA 3U7BA 3PWAA 1B3XA 3W73A 4HP5A 5D2VA 1O7AA 1M1BA 1W1IE 3HM7A 4H6KA 2QMJA 4B91A 5D9MA 5HMEA 4YTQA 2PE4A 1IEWA 5AN7A 3W1NA 4NX5A 2EXOA 3GC2A 1XSJA 3IGXA 3T2PA 3U8GA 4ZXOA 5FD0A 1FCUA 4NNAA 1OWQA 3IPWA 3NS1B 1PX3A 3DK9A 3S5SA 1PDZA 3IGUA 1JCYA 2INEA 1J5TA 2NUXA 2XM2A 3TC6A 2X0HA 1UZ4A 1BQCA 1X39A 4RZBA 4NVTA 4PEKA 3ZWSA 3TU9A 1HJUA 3B9EA 3VXGA 3IK4A 1JPIA 2Y85A 4DF0A 2QCEA 4CGTA 1KM5A 1UZHA 2W3SA 1NQKA 1H7WA 1EC8A 2DZSA 1BXCA 3ITYA 3LTYA 1PB0A 3M5YA 3AICA 4XZBA 3QPEA 4R33A 3ALGA 2OWWA 1TELA 4EMJA 3BSGA 2PD9A 1I1WA 4ICMA 4Z1AA 2WJFA 3BJSA 3EDDA 4YTRA 4O0ZA 3EOOA 7XIMA 3NQ7A 2YB1A 4AHPA 4FXSA 3HPAA 1KQZA 2YAUA 4XZLX 3SJNA 1ZKQA 3RMJA 5FJUA 4DZIA 4ILSA 5MKGA 4DF1A 3IAQA 1GRGA 5HJXA 4UFIA 1WDRA 3OQ8A 2FMOA 3QFEA 1EJXC 2V68A 4MY1A 3VNKA 2R24A 4PUWA 4KGJA 4CNTA 4ZBCA 1XIDA 4HGXA 1NWUA 4TV5A 5ER0A 2EBNA 4AZHA 4NJGA 3NQBA 3WL1A 1W3LA 3W4RA 4LJ3A 4ORIA 1ZNNA 2DT3A 2QMKA 1DTNA 5E6YA 5AYZA 4N9EA 1IE7C 4MJMA 2ZUSA 3NFUA 3VCNA 4RXGA 3AJ7A 3WEZA 4FA3A 1O95A 3G22A 2XN2A 3P93A 4B3KA 3KWXA 3CXOA 4UTTA 3BAXA 3TN3A 2V3EA 1G1YA 2V3DA 3KBWA 4GYJA 3R43A 4Q8NA 3VKKA 5I23A 3W6MA 2WZIA 2X16A 5E0CA 1ONFA 3F2CA 3QHOA 1IR1A 5TF0A 1XIMA 4M6PA 2YCLB 2GJLA 3VGBA 3HPFA 4A2RA 4V2XA 1P0NA 2PWUA 3QV7A 3W01A 4NAFB 4LB3A 4OOZA 1QHZA 3MCOA 3N19B 2CBJA 1A5CA 2YCIX 4US5A 3B9AA 3T2QA 3DI1A 3NVDA 4ZOHB 4IQDA 4DZ5A 1VFFA 1MUCA 3PTDA 4YN5A 2PWFA 3CUJA 3CTLA 4UTJA 3N2CA 3UWVA 3BZGA 2YA0A 3ZT5A 2EG7A 4DBEA 4CQCA 1VPYA 1JI1A 4DJFC 3QY6A 3UW6A 3WQGA 3UU0A 1OSEA 5JBFA 2J8GA 2G41A 1KGXA 3S5ZA 4A4AA 2C0AA 4QJ4B 3T8QA 2J24A 1ISYA 4ZCWA 1UP0A 5E9XA 4PODA 4P8XA 3EWXA 5JUVA 2X30A 3EMZA 1JDAA 3HQOA 3BGAA 2PDBA 1PEZA 1TPEA 4GX9A 4XV0A 3N12A 4D6FA 4IMEA 1A5NC 3DKJA 2BX7A 3HPXA 1L8NA 2Y89A 1OD0A 3WLJA 1TTJA 2HQMA 5KVIA 3FK4A 4OTKA 1QW9A 3T09A 2ZXQA 4Z2JA 3U6WA 5FCZA 5M3WA 1QPOA 1HKIA 5REQB 2GUBA 1GNXA 3MTWA 2QGYA 1BYCA 3VD5A 3TK7A 1UKTA 3TR2A 1H1NA 2Y2WA 5CG0A 1WOAA 1XLCA 3L21A 2ZX6A 3L4VA 3B4UA 3SSZA 1WKEA 1J96A 1GOMA 3CT2A 2XGBA 2D69A 1EQCA 1H2JA 2HV5A 3ATYA 4MMWA 3WQPA 1PX4A 5D8WA 1BLIA 3DGRA 4IL2A 4WCJA 2FVKA 3U2EA 3GXFA 2AKMA 1UHVA 1WDQA 2QR6A 2JF7A 3W84A 4WY0A 5CZKA 3RITA 1RCOB 4L1WA 3LNMA 4GBDA 2YVGA 4X60A 4AU0A 4PCSA 1F76A 4J2PA 4OUIA 1KV5A 1B3WA 3C5QA 4Q6XA 2XZ7A 3TTQA 3QEZA 4H9VA 4JQ3A 1XISA 2HS6A 4J4KA 4EX4A 4A3UA 4I9MA 1YNYA 3WLSA 3D6NA 4PTDA 1ZK7A 1KA9F 2QNEA 1L6WA 1RVGA 1JI2A 5I78A 2ISSA 4IP7A 1IGWA 3E02A 1KKOA 1B57A 3RNMA 2ZRWA 3CB3A 3OGVA 2DU2A 1EQPA 1YPFA 3VDAA 5JBDA 2GVJA 1TZ9A 3CLWA 1TYGA 3UESA 4YTTA 5BXSA 1UMYA 4Z2LA 2J47A 5ECUA 3N11A 3T9PA 3M47A 1PX8A 2XIBA 5FL1A 4EAYA 1B4KA 1F7BA 1N55A 3KBVA 4MLRA 3W1RA 2VTFA 5C9UA 3ARZA 4QTGA 3LLXA 3VIMA 4A35A 1H09A 3THUA 4AWUA 1FY6A 1CLKA 3DU0A 3O15A 4LAOA 3OLIA 1OINA 5BOOA 3AMKA 2OYKA 4QG6A 1EJUC 4CNPA 1AH3A 4MTVA 1E73M 4U33A 3UXDA 3VZYA 3DBPA 1MZHA 1O4UA 2XYLA 4Q33A 1ME8A 3MUAA 4JL1A 5TQLA 3UWZA 4F0LA 1LROA 1UWTA 3GIYA 4YHGA 5AZ0A 4FOUA 1EPXA 2A2IA 4GGBA 1JRCA 1VP5A 5HNRA 1X8FA 1VF8A 5IM51 1EIXA 3TLQA 1JZ5A 2ZUMA 2G4FA 4L9YA 3ZXWA 2ABAA 2FTPA 1E55A 3W1XA 4K8EA 5CSUA 5AHIA 1DYSA 1XQKA 1EIBA 2PWDA 3LUTA 1LQAA 4EK7A 2CLKA 5G1YA 4C60A 4HN4A 2YFOA 2ZZ6A 3NL6A 2Z6IA 1QT1A 4W84A 1JDDA 4DBDA 1DJYA 4Q8TA 4OKDA 3B97A 1WZAA 2R14A 1Y8BA 3AI0A 3CGCA 3SBFA 4E8GA 3RX3A 3PUDA 3WO8A 2WSPA 3S4TA 4O4WA 3CHCA 5CZTA 3B4YA 3VKDA 3HMJG 3TWAA 1KFBA 4UNIA 1H0IA 2UV8G 3WCZA 2YDRA 2X42A 1Q4WA 4D8ZA 1XYCA 5KMYA 3QQ1A 5TAOA 2WWCA 4NT0A 1KWKA 1SU5A 3IUIA 1NWTA 3R94A 1UH3A 1IWPA 5AC7A 1E4IA 5CSRA 4N9CA 4OV9A 3Q37A 1ITQA 4ZO9A 3ES8A 1KTNA 2OOFA 3UD6A 2GR2A 2X50A 3GRIA 3O16A 5BMXA 1W37A 3MC5A 1BXNA 3GZ3A 1SR9A 3D47A 3BOFA 3OW1A 3REQA 2AGKA 2GR1A 2GGJA 4NHVA 1XLJA 5HJYA 2V0TA 1GPWA 4X0VA 1ZENA 1XIHA 3H7VA 4B9YA 5EPDA 4RKAA 5ABTA 1R2TA 1CECA 5H8MA 4KWOA 1XIIA 2C1GA 4HMCA 5CEWA 4UTMA 3T42A 3W72A 5EFFA 5HWNA 5T8GA 3SSJA 2ZADA 4QS5A 3MKVA 3HGJA 2ZDRA 3P8IA 1BWKA 5BWAA 4GHRA 3OO2A 2LLEA 4UMAA 3CUFA 4QJ5B 2Z25A 1VDVA 4UR9A 1ADSA 1UR1A 1TVNA 1TVLA 1AH0A 4BZYA 3UR7A 1XIBA 2GJNA 2YZ5A 4LRTA 4GNJA 4FNPA 4AVNA 4HA1A 3LB8A 3KTXA 3KL5A 1VJIA 1YTDA 2HS8A 1C93A 4U5IA 4LUTB 3BLDA 4XBKA 4IIGA 3RAOA 2V3GA 1KFJA 2CDUA 3F5KA 1EZWA 4A29A 2XSBA 1FWEC 3HO8A 3TCSA 4ZQOA 3BAJA 4Q8WA 2AGTA 1R2RA 1E1EA 3VKCA 3GDRA 1HN1A 5IFTA 4RDVA 1YEYA 4TUFA 5A6SA 1SMDA 4FAMA 2I5QA 3A7UA 2PUZA 2YDSA 1E1CA 3DI0A 1M7PA 2F6KA 4GY0A 4F0MA 3STCA 2DZUA 1R3SA 3S0CA 1CGXA 3WNLA 4DXVA 4Y8FA 1B90A 5HQLA 4FF5A 2PA6A 4IWWA 2QZRA 2VEIA 2A7RA 2G37A 5DMNA 1TQJA 1JZ8A 2QAFA 1P1XA 3ZT6A 3ARYA 1VFTA 2CWNA 1SGJA 5U25A 2ZZ1A 3GC4A 1O68A 4P8UA 3N29A 3BMVA 4QHRA 5JU6A 3LRKA 5HWMA 1GVYA 3ZT7A 1LRQA 5LIXX 1N2VA 1VLWA 5A6MA 4JBRA 2YLLA 2HTMA 2C18A 4CN1A 1M01A 3I6RA 3CASA 3T0AA 2JKAA 5HUOA 1G01A 1YLVA 3CT7A 1XL9A 1D2KA 4QX4A 3QJAA 3A4WA 4JFVA 3HGRA 2BDQA 4EE9A 2VWTA 3FJLA 5LIYX 3NXFA 5EYWA 5FJTA 1GRBA 1RJRA 4I7VA 2J7GA 2R1KA 3N1AA 1RCQA 1KBIA 1Q6RA 4DWSB 1TV4A 2I9EA 1RM6B 4K7YA 4MPKA 4PMXA 1GJPA 4LBUA 3LXAA 3NVVB 2JIWA 4A8RA 1SJAA 3GZAA 1CX9A 4XAGA 1XKJA 1JDCA 3QRHA 3TMLA 3GWQA 1X1NA 1WYIA 1I6NA 4TTUA 3VINA 1GVRA 2PEVA 1KR1A 1UOKA 1C90A 4PL1A 4KF1A 1GKQA 5FIPA 4D6CA 1V6WA 4Z1CA 1JROA 1QPQA 1XIGA 1F61A 2NV1A 5HR7A 3WL0A 5DMMA 2GQ9A 1UPPA 1JAEA 3C0QA 1PXGA 3WEMA 2YIHA 2V9DA 4KT2A 3LRLA 4XD4A 3AS3A 1WO2A 3SCWA 4S3GA 4NAEB 1OM0A 4DBSA 4YLWA 2V3FA 3PBGA 1BVZA 3UNTA 3AHYA 1KM3A 3SCUA 1LOLA 2I9UA 2CC0A 4H50A 1GK8A 3R79A 4Y90A 3H2EA 4MF4A 1JG9A 4L80A 2CEQA 3HBLA 4D8LA 2GQAA 3UERA 5G4WA 3ONBA 4W89A 3M0KA 1ZU8A 1M68A 1LG1A 5IXEA 5GVJA 1AFSA 4CQ8A 3LHVA 6REQA 4D6JA 4BFAA 4LYQA 2EPLX 1KNWA 5JMUA 2P10A 2F61A 2P5NA 4HA3A 4FB7A 3ZLGA 5DT7A 3ETRB 2H3BA 3OP2A 3TONA 5LXEA 3CL7A 2ISWA 4N4PA 4K37A 2H8XA 4BQ4A 1IZCA 1NHQA 3EEGA 3P74A 4M5PA 4KETA 1B3OA 1BWVA 4M51A 3TV8A 5HMDA 4F0KA 1V6UA 6PTDA 5DLCA 1PZ0A 3EDKA 3B9JB 3SQMA 1Z6KA 3F4DA 4HPGA 4HKPA 1RLCL 4O12A 2GSJA 3KS6A 3BE7A 2ZZ3A 4YHEA 3SQSA 2PGWA 2V30A 1TYPA 5GRTA 2V67A 2P0OA 2Z1VA 4JQ1A 1EWDA 5B80A 2E5DA 4O1CA 1QBBA 2OODA 4HQVA 1QVBA 3H54A 3U4FA 4J28A 4QBXA 3S9IA 4ZE4A 1ZX9A 4JKKA 1ONXA 5KZ6A 2ANUA 3AXMA 2WO5A 4JFTA 3APYA 3NRZB 3MO4A 4BQ3A 4DUOA 3U2CA 3SCSA 1AG1O 2X1RA 5C9WA 3WD0A 2FKPA 2HQAA 4OUEA 2BXZA 4PB5A 4LNCA 1QNVA 3LXDA 4IIHA 1M65A 2VWSA 1P1MA 6TAAA 4EVZA 2FQIA 3MS8A 2QCHA 3QOMA 3SZ8A 5I3JA 3GVVA 3RN6A 5JXQA 1UWRA 2Z7KA 4EMWA 3IIPA 2HROA 1PAMA 3FW6A 1NFBA 2O55A 4NUWA 1FWAC 5JCLA 4PSPA 4S3KA 4AZIA 1CXIA 1OC6A 2DV0A 4LUSB 4UR7A 4O11A 1NARA 4ZQPA 4QE1A 1MW1A 3W1QA 1L0PA 1JL8A 3MUZ1 3VIGA 3AC0A 4IPLA 5LHEA 1W3NA 1J0ZA 2E68A 3KL0A 4AVFA 2VZSA 2XTKA 4HCDA 3WD4A 2XN0A 1EUAA 4X3ZA 1UWQA 1JEZA 2PC4A 1F05A 2WBGA 5E93A 1IF2A 5DELA 3MO7A 5A8GA 4Q4SA 1V5XA 2V2HA 4MJ2A 4YTUA 3DH7A 4CCEA 8CGTA 2DZBA 3JS3A 3NA8A 1GJUA 3RJXA 5T9BG 3N34A 4JIPA 4GQRA 3AS2A 4YTSA 4KKXA 2CITA 3K2GA 2E5BA 4PMZA 1A5KC 4IIDA 1H5YA 2E6AA 1MXDA 3LCXA 2GQ8A 3LEPA 4EWJA 4GH1A 3BOLA 1YMYA 2CHRA 7REQB 4LPCA 3WDHA 5BU6A 3PSWA 3P7YA 4WK9A 3FDGA 1KD0A 3KEHA 3Q67A 1B30A 4UBPC 2PDHA 1I75A 3GNPA 3W1PA 2R91A 1K70A 1R3WA 4RZ5A 1KBJA 2PTWA 4O8AA 3R5EA 3VMNA 1VPXA 2OELA 1ZHAA 2DT0A 1G4TA 3FGCA 4DVOA 8XIAA 1XLBA 1B5TA 2HWGA 3T1GA 3UA4A 3DN5A 3CGBA 1D8CA 2ATSA 3G1XA 5HNTA 3AYRA 2XDFA 1R85A 3H4XA 1VQTA 4JYDA 2KAUC 3PZUA 1JOAA 3BVJA 3IJIA 2UZ9A 2CKRA 1XLFA 2V5CA 1W3KA 3A7AA 3S9YA 3UYIA 4LT9A 3AS0A 3L4WA 2WNNA 3WH8A 5CGTA 1NY1A 2XZ9A 2HE8A 4FX6M 1PHWA 4P61A 2NQ5A 1GTHA 1HP4A 3TIMA 5IDZA 4JY9A 1REQB 4WKAA 1P0BA 3UVIA 2C3ZA 5DMYA 2FGBA 4PA8A 3FYOA 5FF3A 2P8CA 4AD3A 2BSLA 4DPPA 1VEOA 4AC7C 1PCKA 2VJXA 4OGZA 3M44A 1JYNA 5F1UA 2W0HA 2VDIA 1S2TA 2EPMX 2H6RA 1U1UA 5DRIA 3D46A 2JALA 5XIMA 3S46A 1LBMA 1BF2A 1LUCA 4C6IA 4M6VA 2DUXA 4QDMA 5K4XA 4AB4A 3G8RA 1UKQA 1V93A 4LS1A 3WYZA 5JQ9A 3UR2A 1X1ZA 4EPDC 2PURA 4Y9AA 1IGSA 1YYAA 4AX6A 1J01A 3VNIA 3S1GA 2RH9A 5HJLA 3KP1A 3I3EA 1DWHM 4WUIA 4ZB2A 1ZMDA 4DUWA 2CBUA 4KEMA 4PL2A 3WNOA 2VX5A 3B9OA 4I9JA 4P7NA 1XSIA 5FEXA 3IRDA 5EA9A 2EG8A 3RU6A 3VNYA 5RUBA 3KS5A 3WH9A 3W83A 2EQDA 3OGRA 2J8FA 2AKZA 1UWUA 2BP1A 5C8BB 3FXYA 4O17A 5A5WA 4KEUA 3E74A 2QPXA 2OSXA 5C7HA 4HHLA 3CIVA 1CCWB 2P1FA 3SUUA 1MSSA 3CUGA 2V3AA 1GCYA 4XIMA 3MV01 3AS1A 1TZZA 4FR6A 1LP6A 4HOXA 5D38A 2E3ZA 3NQVA 1MO9A 3W1TA 4BWLA 2HPMA 2J7EA 2WVVA 5AOUA 1P7TB 4R27A 3UXAA 4NXSA 2OTDA 3LBOA 5PTDA 4XD5A 4XAPA 3BCFA 3AIUA 3WQ5A 1I45A 2G3MA 1MUMA 2UBPC 2Z1KA 8A3HA 4KIRA 4ATDA 3POCA 4ZOEA 3KX6A 3FVDA 1R46A 4HD5A 1BGGA 1GOIA 3OVRA 1F9CA 3AAMA 3BSMA 1CPUA 3UYCA 5I3FA 5DO8A 4ZFCA 1E5NA 2QUTA 1GRFA 3WMBA 3OEXA 1IXPA 1PKNA 3W71A 1WXJA 3BQ5A 2FFCA 5HUPA 1VBUA 3CZ8A 3OIHA 2NV9A 1GORA 3LN3A 2GZXA 4JIEA 3T07A 4FPSA 3GDLA 1V8EA 2YBUA 3L4UA 4O1EA 1GOOA 1PTDA 1TKKA 3TTYA 2NQ9A 1H6VA 4R34A 3E2RA 3XINA 3HGSA 3PJUA 4N42A 3T44A 1QK2A 4POCA 3W29A 3CZEA 3VZZA 4X2PA 2PWGA 1DWAM 1TFVA 3I6TA 4GNKB 3H70A 2WCAA 2VD8A 2QJHA 5CKSA 1CLXA 1FBAA 2Z29A 4E2OA 3VIKA 3AALA 5CPQA 3AYSA 5I3KA 3UY8A 2DH3A 3WLIA 4UTWC 2QT3A 3VD3A 1DJNA 1O6IA 5GPRA 3VOJA 1XD0A 2QIWA 1BVWA 4I8DA 5GQBA 3SUWA 1UWIA 2Z6JA 1O12A 3T81A 3HZ3A 3A3WA 4KCTA 4CU8A 1UBPC 1ZY9A 2CXEA 1HF6A 1KBLA 3C8NA 5I06A 1X96A 1MZRA 4HNOA 4FXFA 1OFDA 3MSDA 1UD4A 1QMLA 3L5AA 2HJPA 1PSCA 4JZ5A 1TE6A 4W86A 4MWAD 1E6QM 3QZEA 1ZQ5A 4R7OA 1K6WA 2ZUNA 2R82A 1UR9A 3WJZA 1C7SA 1DIEA 3N4FA 3GTNA 3OU8A 5JCNA 1VFSA 3SRDA 3BDKA 1X38A 1EO5A 1FWIC 5D9OA 4QLJA 1F3TA 1IT8A 3I4EA 2RFGA 1TREA 2VFEA 3B8DA 3VMPA 4FEZA 1UQYA 3M46A 5C70A 4WD0A 1QNSA 2VVSA 3VKAA 1ZL1A 3CJPA 1G5AA 1H2IA 1L8PA 4HK5A 1XI3A 3CIWA 1WXZA 4HPNA 4GQ0A 4HNTA 5K7JA 4Y9MA 3UJFA 3KOFA 4F4RA 3WKZA 2NWSA 3OTRA 3GTIA 4HIBA 1MEWA 2GVEA 3CWNA 4UZUA 2F9RA 4QG8A 1EBDA 4HYWA 3T6CA 3GFYA 3H2CA 2C15A 3TMQA 3TOYA 2FJUB 2W9MA 1L9WA 1NOWA 4WSJA 3GXDA 2OX1A 4D6HA 1LYXA 3HB9A 4GK8A 3QGVA 1J93A 3EX1A 3DGHA 1QW8A 4AWSA 1OC5A 3PG9A 1FECA 1KB3A 4BCEA 2GOUA 3V18A 1MMFA 1VYSX 1KCLA 3SQLA 3GH7A 1KM0A 4JX4A 2QJMA 5BRBA 1A80A 3L5OA 3LI0A 2YL6A 5AHLA 3W02A 2ALDA 3BLLA 3GYEA 3MP4A 3WFZA 3I3DA 3D3AA 3ARTA 4AIOA 5ABFA 5F1VA 2VX4A 1ESWA 1UCWA 1S5NA 3W7DA 2BODX 1HKWA 2WB5A 2PLCA 3N6JA 4GIYA 4MY8A 4EANA 3TW9A 5FSEC 3HTWA 5EB8A 2E8YA 4CN6A 1FDZA 3U2ZA 4QCEA 1IIHA 1PS9A 5M03A 4J40A 3MKKA 4J3WA 4KFOA 3D9XA 3AMGA 3J7HA 2NXHA 3BV7A 2BY0A 3OODA 2OGYA 2VCBA 3Q2DA 2CLMA 3GR4A 5SWUA 3FEMA 2PDKA 1ONRA 4FP1A 1RR2A 1KFEA 1GW9A 4EPKA 4OJYA 1HJXA 1ONWA 3AJXA 4F66A 4MVAA 4QGCA 1H50A 4LFYA 2RAGA 3ABOA 1JCMP 1PTGA 1UBSA 4EXAA 3FV9A 1M3UA 4BA0A 4MJ4A 2DSWA 3EEZA 1SQ7A 4WY0B 5G2IA 4YMZA 3GFXA 2QJGA 1QI3A 3NL5A 2DZPA 2BTMA 1TWDA 1SZFA 3GKFA 1U83A 1DIOA 4WX2A 3P8JA 1K8CA 5C2CA 4C6JA 5EGRA 4TOQA 1CB7B 3AMZA 2CFFA 4A05A 4JX5A 1U5HA 2FTYA 4JQAA 1D7YA 3BG5A 3HURA 4DUVA 3KTSA 2XSXA 2C3CA 2CESA 3I7SA 1NELA 3AISA 3TLLA 1LQ2A 1ZJBA 4GYPC 1RH9A 4F8XA 4I5RA 4M8UA 3K5XA 1MXSA 1US3A 3G1DA 4NYUA 1DXLA 5JCIA 1OFOA 3IVTA 3SIZA 4PTWA 1OG0A 1XLEA 3NPVA 4PMYA 3S1UA 5AZ1A 3XISA 3OG3A 1RY8A 1QO2A 1XIFA 3PTQA 3UJSA 1Z48A 2Q02A 1UKPA 2QEZA 3W7PA 4X0NA 1T40A 1JFHA 1TV3A 2L5HA 4GVFA 1QNPA 2VYOA 2FPVA 4C7GA 1UC4A 2BY1A 4AZCA 3BSHA 4XBJA 1S2VA 1UWAA 3V35A 3PWGA 3EOLA 3WD2A 1W9UA 3UGRA 4DX3A 1NF0A 1A5SA 1ZGDA 2W92A 5B7YA 3L8KA 3W85A 3TCEA 2VGFA 4QEHA 2VVNA 3PAOA 2OT1A 4NNBA 1K8ZA 2Y6ZA 1E0UA 3TN5A 4BQ2A 2BY2A 3VZXA 4Z2IA 2VEMA 1YKWA 2CLIA 1T99A 2VEFA 1T96A 4LUYA 1SJCA 3ZZ1A 4J9JA 1C8XA 2WKJA 3BJFA 1GRTA 5K3VA 5M5DA 3P61A 4RPPA 2G3FA 1EP3A 3E5PA 2DQXA 5CQ1A 3WUGA 4I6VA 2X8HA 1JPMA 1TVPA 1QOXA 4HNUA 3R0UA 1I2QA 4ERIA 1XLDA 5HQEA 3NM1A 5I3IA 1J79A 3Q94A 1EOMA 3H2NA 2XUCA 5I07A 2WPBA 1CGYA 2C79A 1GQIA 1V6VA 1P0EA 3B03A 1DJZA 3G24A 4KIEA 3HU7A 1YX1A 4BWLC 4B5WA 3L9CA 2Q71A 1OCJA 3SEPA 1LLOA 5CG7A 4C6KA 1G6CA 1NDYA 3PSVA 3UXKA 1XH0A 4P7OA 4JTSA 3TTOA 2WQPA 1N62C 1V6YA 1TTIA 4D6GA 2POTA 4Z0JA 3SDOA 4JIRA 2DSZA 3W7CA 4LU0A 3IIXA 1P5BA 2VC5A 5HINA 4C6DA 3MSYA 3SCNA 5EMYA 1XICA 2UWFA 2WC7A 4LEFA 2PDCA 2UY2A 1XPYA 5HWJA 1TPH1 3TDFA 2GSEA 2DIJA 2PDXA 3REQB 2ABBA 4PB3A 1F6KA 4ZA0A 3URAA 2Z1BA 1HO4A 3IGHX 2ICSA 2IQDA 3UF9A 3C8FA 1S5MA 4R88A 5I5RA 3K8KA 4DO7A 3HGOA 4TVWA 3PN8A 2EPOA 1HW6A 1K4QA 4ERGA 5G2HA 1EJWC 1KTCA 3IJ7A 1ICQA 3QW3A 3BLKA 2PZNA 5F4WA 3TW6A 4WOQA 3OVQA 4QRNA 3LG3A 2EJ1A 4HMNA 1AVAA 1RPXA 5IHRA 4IXHA 4GI9A 2Z2UA 1OIFA 2B7PA 1R0MA 2A79A 1QI2A 3LPOA 3W1AA 3LBCA 1POKA 4GRTA 4HPXA 3L66A 3GG0A 3MA8A 2V5BA 4HNNA 1KFKA 2WSQA 2VP8A 4ATWA 3APTA 4TVUA 5E0KA 5I24A 1CI1A 3P0WA 3WX7A 1E0WA 3N4EA 3NZQA 1WCGA 3AXXA 4AX7A 2E7FA 3R12A 2RDXA 4PUNA 1TJ2A 4M24A 3DECA 1Q7ZA 4CQDA 3UR8A 1UH4A 4AEOA 4HVXA 1O1HA 1L6YA 4AAJA 4FHAA 3VIHA 3W7HA 2QCDA 3T4CA 2DW7A 4LX4A 2YB4A 3T05A 2PGFA 3R8HA 1E1CB 2VNCA 3HFTA 2WKLA 2NX9A 1MI3A 3OBKA 4F2BA 3NSMA 2YW3A 3WJSA 3CM4A 3I6EA 2EKCA 4ZOCA 2FHBA 3AYVA 1EGMA 3F5LA 4EACA 4QAIA 3N2XA 3M5ZA 4IJRA 4R9XA 4DJDA 3TC7A 4EOUA 2ZWZA 3BWWA 4HSHA 5CBIA 3L0GA 3EMQA 4WEVX 1TX2A 4K39A 1EBHA 1XH2A 1VYRA 2GDQA 3F7JA 2XVKA 2HK1A 2IKGA 4F40A 4HN8A 2OJPA 4LS2A 4LBRA 4XBSA 2WOVA 4UR8A 2O4MA 3LPGA 2CLHA 3KRZA 4PUDA 3PZVA 1L2QA 3H2OA 3WFAA 4M81A 3L23A 2Y62A 3SUTA 4B4HA 4IUGA 1GVFA 3S2JA 5D2WA 3EZ4A 1E0XA 1DJGA 4KWSA 4DJED 5EBUA 3EWDA 2V5DA 3BLOA 4IOTA 4RR4A 4XB3A 3BXWA 4KQNA 3IRSA 3DFHA 1VCFA 4NG3A 3KZPA 3DFNA 3STFA 1BTCA 4IFOA 3QV9A 1LRTA 2A3AA 1AH4A 2VR2A 3LPFA 4RNHA 1ZJHA 3WQOA 3HRDC 5A8QA 1B9BA 4O1FA 4GCAA 4JFWA 5BOFA 3IJ8A 1BFNA 1FTXA 4OBSA 2R9RA 4O14A 3S6OA 4RW3A 4MKVA 3K13A 2YPIA 4GG9A 3LDVA 1B1YA 2J79A 2ZXDA 4N9DA 1WBHA 1BF6A 2WMJA 2E67A 1QOPA 2ZX7A 1GT8A 4PYSA 2YQUA 2GGGA 4GCXA 4OBRA 3ARUA 3GDTA 2Y63A 2VKZG 4GIRA 2WNZA 1J12A 1J0JA 3ZOAA 3NOEA 3SRFA 4C1LA 3CH9A 3VIPA 3B0PA 2D73A 2AAQA 5G5IA 4GFIA 4ASTA 4RPQA 5A2BA 2F8QA 1P43A 4QXIA 3DFOA 4L4LA 4K1GA 4FOKA 1EFZA 1A3HA 3KM8A 4UTIA 3P84A 4C91A 4GI4A 3WZ0E 4M6UA 4JTKA 3ZM8A 1NP0A 1V08A 4GXWA 2E0PA 4JS3A 1GYNA 2JK2A 1SZEA 3DDMA 6A3HA 4HSOA 3SGUA 2DVUA 4LUIA 5HR6A 4A6GA 1OB0A 3RX4A 1ZTVA 3MZNA 5FF0A 3SUSA 6REQB 1VZWA 5DRCA 2OWXA 3KZSA 4GBUA 4UNLA 2FTWA 3EX2A 4JTIA 1ADDA 2DP3A 4OBTA 4H4WA 4I8YA 1W8SA 5AECA 4PMOA 4AD1A 4G1NA 1RP9A 3EXSA 3UZXA 3NQEA 3UG4A 3MDUA 3NPUA 4TV6A 3VNJA 1VJZA 2A85A 3GXPA 4M1BA 2A21A 3TP4A 3SB0A 4WJXA 2E25A 1AODA 2QDGA 4EMIA 1W1PA 3RG6A 1TMLA 1TJ1A 2D23A 3KRBA 4Z17A 3TAOA 3DERA 1F74A 3CV2A 3M0MA 4JDBA 3SFKA 5C9XA 1TG7A 4H9MA 1PIFA 1OC7A 4NZ5A 4AIBA 3PUGA 3GKAA 1UB3A 3TTSA 1K8XA 4YNGA 3RPMA 5JVLA 1ZP3A 4GVGA 4FO4A 2GVYA 3GNDA 1YQZA 4IPIA 1I4NA 1H0GA 1K7XA 2ONEA 4PRWA 3ZJ8A 3AMDA 1IIGA 3G0SA 2X99A 4L9ZA 3NYZA 1J6PA 3W7EA 1YNPA 3TJXA 1NHPA 3WLQA 1VKFA 4NQ1A 2VRQA 3E0FA 3EX4A 3E0LA 5C2XA 4ZEPA 1RSCA 2EQ7A 3GTXA 4JYFA 2GYIA 4PFMA 3VYLA 1VYPX 3DJJA 3V4BA 3OZPA 1ISZA 3B0VC 5D33A 2X0SA 1HG3A 1OX6A 2DDXA 3SN4A 1JYWA 4J3UA 4EQWA 1XRFA 3GB6A 2NLYA 1XBXA 2XFFA 1H41A 4C6OA 1F2JA 4H4YA 3HV8A 4LCQA 3ARPA 1VIZA 2W63A 1FWHC 4PN2A 3BC9A 3H7RA 3VGEA 4A3HA 4QLLA 5DY3A 3PZ9A 2V69A 2OKOA 2AQOA 2FGLA 5JCMA 4M56A 2OLAA 6XIAA 2WANA 1OYBA 2EPKX 3B9NA 3RK8A 2W54A 1IZKA 3L68A 4NZFA 4Q32A 3WF0A 1VFUA 5CZ0A 3QSRA 2ZX9A 1OCQA 3GR7A 1TPC1 3E12A 1VHNA 3DYMA 3S1WA 1VBGA 5AC4A 5IHSA 4UXDA 4GFSA 3EAOA 1DJQA 1JRBA 2PSNA 2WM0A 1JPDX 2VEPA 4BEQA 1A4LA 3C2FA 3NXLA 4LVAA 4GI6A 3RDKA 1FO4A 4TVCA 1BHGA 3SADA 1GRHA 3WELA 3VC5A 2PF0A 3DESA 1TIWA 4A3RA 3PF3A 2CU0A 3O6YX 4N7QA 4RCXA 2YCKX 1VQZA 3N6HA 3EDJA 3KLKA 2FB2A 3O6CA 4UOJA 3EWYA 1F6PA 2EO7A 4LW7A 1UWSA 4ORMA 4W85A 5FS9A 2WJEA 4FLOA 1IQ8A 5FJOA 3HV9A 3WNPA 2PU1A 5TBOA 4MJZA 4H2HA 4FXJA 2HMCA 5JRBA 3CEUA 4E38A 4BEUA 1WBJA 4I90A 2VELA 2RUSA 2CIPA 3QMTA 3V1PA 4AWTA 4B92A 1BRLA 4XUYA 3UZZA 5HNUA 2CW6A 2EHHA 2VC7A 3M41A 3VABA 3NQDA 3UY7A 1XS2A 3S5NA 2GUUA 1YTKA 5BROA 1SSGA 3DIPA 5TD4A 2QUVA 1PZ2A 3PAJA 4DLMA 4UFJA 3TROA 1EEPA 4GPNA 4PULA 5DBUA 2H9AA 2FFIA 1FA2A 2J7BA 1GYMA 1ZUAX 1XPGA 4CN4A 5D02A 2GOKA 2JBMA 4TO8A 3EANA 4WDWA 3ISIX 4XVDA 2ZCGA 3B0YA 3N2OA 4I7UA 4P7RA 1GERA 3S83A 3ZSSA 2YDAA 2QAPA 2PDPA 3BLEA 4EF8A 4L6DA 3QPYA 3PTMA 4HMEA 3H4KA 4H9YA 1KFLA 4MY9A 1Y0EA 1ONEA 2BG5A 3M7WA 2CKSA 1V0NA 4C1NA 2QDHA 1RK6A 3NSNA 1LUCB 1MVYA 3RCNA 3V1HA 4X9SA 1GONA 4FK9A 1Q63A 1OZMA 6ENLA 2YDQA 1QHPA 2RDUA 5A8MA 2V2CA 1PTAA 2Q3RA 4X63A 3VOHA 1I2RA 2NWRA 3QGKC 1UR4A 4J5NA 1E9ZB 4KEVA 3LXBA 4TTGA 4MYAA 4O1AA 3KBNA 2BGNE 1D7FA 4ZSTA 4S39A 5EBAA 5HAOA 1NU5A 3AHTA 3HJZA 1LTDA 3UWEA 5LNSA 5H6HA 5D05A 3S2LA 1BEUA 1KO0A 2ZRUA 4JIIX 3ABRA 4L4MA 2Y5SA 5F2IA 5FJJA 2Y70A 4IGMA 1KQYA 3GE7A 3APGA 4G6CA 1AW2A 1K4HA 1QPRA 2AL2A 3T40A 4C65A 4B15A 2KZHA 1VRXA 4CNUA 5J8LA 3E38A 3W6YA 2W6RA 5CSYA 1FDJA 1YADA 3EX3A 4BQ5A 4DRSA 5KZDA 3NVWB 3RMEA 3M9YA 2RDWA 2XIOA 4AZBA 3OPSA 5CZSA 1NTHA 3BLIA 1E0TA 3PZQA 4NJJA 3S1VA 1H1ZA 4MGGA 4AZ6A 2I5IA 1NWRA 1HQTA 4G7FA 1F8WA 1WQ5A 3UCCA 1LDCA 2IXVA 2CZEA 1SM9A 2WW5A 3VPLA 3UXLA 2QCMA 4UMCA 1UASA 1K9DA 1FKXA 1PUDA 1R38A 3D3FA 3TQVA 3W87A 2V81A 5DXYA 4U2YA 1NVMA 2JIEA 1JULA 3A6OA 3VD9A 1RP8A 3GNRA 1XCWA 1JZ3A 1LWIA 3O1NA 4CVUA 1GRAA 2VOTA 1ADOA 1W9BM 1EC9A 3WEOA 2E40A 4MB1A 3R0KA 3DG7A 1TUFA 2QULA 3VM5A 2VRJA 3K4DA 1BG4A 2AMGA 5C0QA 4H6RA 1XYBA 2I5GA 3CZJA 4F0SA 3OYXA 2VO5A 1PDYA 4DLFA 4GJIA 3IACA 3VIIA 4ZODA 1GQJA 1K1DA 2DH2A 1GPFA 1I0DA 2VC6A 2X1TA 2VFHA 3FOKA 3INPA 3IWPA 3TAKA 2PC8A 2QCGA 1NWSA 3UGVA 2Y88A 4Q4QA 3W7NA 4JIQA 2VZUA 1GV4A 1O60A 1N5WC 4GRSA 2D20A 1GSNA 1F8IA 3NQMA 2A3BA 3OB8A 4OQVA 3VNDA 4H4RA 2QJIA 3PUOA 5HPOA 1HJVA 3W75A 3LTPA 3NQ6A 3ANVA 1DE5A 3UJ2A 3LYEA 3F4CA 1HIZA 1Q1RA 3WDRA 1W9DM 1IWBA 5F4SA 3M0LA 2P50A 3OJGA 5DX7A 5FESA 3PR2A 1PBGA 4NRSA 1V0KA 1GXFA 1VB9A 2CZFA 4YU1A 2GQWA 3VOIA 2X2GA 4Y7EA 1QI4A 3CMJA 9CGTA 4YS1A 1FWBC 4E4FA 2Y61A 4JX6A 2XVPA 1SO6A 1A0CA 1W1A1 3KHDA 4QDPA 1PL9A 1E6ZA 1WAUA 3S8HA 3KOWA 4ZR8A 3VUPA 3OBEA 1W5PA 4GACA 3RLVA 2V5JA 3GU9A 1XSKA 1QCWA 1W2PA 3PJTA 3QYQA 3H26A 3HG4A 3GX9A 1SMAA 3EKGA 3N17A 1S5VA 1W3JA 4JL2A 3QQ0A 3BAIA 2D1ZA 2BOEX 5A6AA 2NQZA 3T78A 4CD7A 2Y8VA 3IV8A 3ZWTA 4IL0A 1GVEA 4RZ6A 4H4XA 3HIJA 3ORWA 4FX9A 3DC8A 2GRTA 4YWOA 5I02A 4NXKA 4DWDA 2ESCA 5AYIA 3NDOA 4DNAA 3MUIA 2BVTA 7CGTA 2ZZ7A 1GW1A 3BG3A 4MAVA 1A50A 2IUZA 4GO8A 5DBTA 3VVGA 4E0CA 4L9XA 4Y2WA 4NZ3A 4PBGA 3G6LA 3H2MA 2C7FA 2C13A 4E2BA 3KOZA 4H4TA 2Z2BA 3N4AA 3NPXA 1J0KA 1IEXA 4P7LA 3T0CA 3WBAA 4LEQA 4JHOA 4LB4A 4LY4A 1RA5A 3U7VA 1FHUA 4X22A 5FS6A 1LCOA 3CHDA 1FEBA 1XYLA 1V3IA 2OXNA 3WDPP 5J5DA 4D1IA 2WOQA 3R6IA 4HK7A 4H9UA 3ME3A 4EQSA 3K8MA 2W3ZA 1PKYA 3CAWA 4KPRA 4FLRA 4MAZA 3T2OA 5ABFB 4LSBA 1BAGA 1H1YA 1Z8AA 2VURA 4S2BA 3Q4DA 5KITA 5AHFA 2QV4A 1E1FA 2QF8A 1SJBA 1EKOA 3WQ6A 2O4QA 4HCHA 5AVHA 2GSHA 3MSRA 1YDYA 2G97A 2B31A 1ZSXA 1GKPA 3ITCA 3TJLA 3P62A 4W8LA 1OFBA 1P6CA 4JR5A 2QIIA 4ROQA 2Z1XA 5BZAA 4JTJA 4GZ7A 3C56A 1CGUA 2PS2A 1R30A 6CGTA 1XM3A 3PZNA 2XINA 1BQGA 2B7NA 4ACZA 3WQ4A 1EJTC 1OEPA 4G1KA 1R9YA 3VMOA 4GYFA 2YSWA 1RLDA 2WC4A 3IIZA 3ZJ7A 1FXQA 1G7UA 4ENLA 1YNQA 1E43A 4K38A 4K2SA 2VGBA 1QBAA 2WP6A 4K6AA 3KOXA 2J74A 3W6LA 1ISVA 2HVOA 3TQKA 3GW0A 5JIPA 3AYTA 3GBEA 2OZ0A 1YDVA 4H7VA 1W9VA 3B8UA 4DXXA 2YCLA 3GIPA 1K02A 1NDVA 2PGRA 4MADA 4QE5A 5CJNA 2R1MA 4O53A 3UJEA 4KCWA 2V38A 4FX7A 2VC9A 2CERA 4QEEA 2OO0A 4E2DA 1E6SM 2QDDA 1WB0A 4TMBA 4NAFA 2GJRA 1S5WA 3GLCA 3LNPA 2PDFA 4DNHA 2X8RA 4H9TA 4BI6A 5FS7A 2BOFX 5CPOA 5LNUA 2TMDA 1XWYA 1ITXA 4XK2A 3RUBL 4FNQA 1LOQA 4MPQA 2O9PA 4YYCA 4H4SA 1RCXB 4IHCA 2J4GA 2XN1A 3QZAA 4JDRA 3UVAA 3LXCA 1QWKA 1VGAA 2ZC8A 4Q8VA 1V02A 2PF8A 4PZVA 4EPBC 1HZYA 1PIIA 3POHA 1KCKA 4DYKA 5D2TA 1YXYA 5G5GB 2POZA 3VGFA 3W53A 5CGQA 5EMLA 1JUKA 1EDQA 1EA9C 9RUBA 3AZTA 3ZVIA 3VI2A 4FIQA 2IKHA 1W8GA 1CIUA 5I6SA 3AHZA 3T55A 3D5HA 1MQQA 1O5QA 4JEQA 3LGEA 2WBAA 3C3NA 5E0FA 4PCPA 1AD1A 1PIGA 3GG1A 1N8FA 3O0HA 1FH9A 2Z0IA 4AZCB 4HNCA 2E1WA 5ABEA 1BZLA 4DHGA 2A3LA 1EO7A 2JKEA 3MCNA 3BH4A 1V7AA 4IUOA 2Q8XA 3NO1A 4MYXA 2BVDA 1JD7A 1RK5A 1OGBA 3QHNA 2XIMA 1W5OA 4ZQNA 4C6MA 3WH6A 5D2YA 1XG3A 3PP7A 4WLCA 4LVFA 1M03A 3HMCA 3USZA 3OC4A 5TIMA 4JAWA 4E6MA 1I8JA 1JEHA 3MVTA 4ES4A 3CV7A 1UH2A 4R7WA 3VIFA 3OZMA 4WQ6A 4R9OA 2WOIA 1V6XA 2J9YA 2OOGA 1DEDA 3F03K 4AUBA 3FAXA 4RNIA 3H55A 2CLOA 3I3BA 2FMNA 3FKRA 1MFUA 1MRQA 1R47A 1RD5A 1UJQA 4ZO7A 3U57A 1JXKA 4GI8A 1A5MC 3N6QA 3MBDA 1J2WA 1F73A 5D04C 3LLDA 2O92A 4HYRA 3VNLA 3VDHA 3BURA 2GPTA 2B7OA 1A5UA 1O1ZA 2H90A 1JCJA 3NZRA 1GETA 3L4ZA 4AC1X 2GJPA 3FDKA 5EBKA 4NKCA 1QJWA 3PC0A 2OPJA 4LUJA 3STPA 3KHJA 4K8HA 3PZGA 1CTNA 5FJRA 2XH4A 3S1XA 3BGJA 3MMUA 4PMUA 3AQUA 4ICNA 3P5ZA 2OX4A 2MANA 3BLFA 3QR3A 1EEXA 3IJQA 4M7TA 4UFHA 1ZY8A 1GZGA 3USBA 1XUUA 4QQ3A 3SAZA 1MNZA 4FX8A 1NDAA 1CYGA 1AZ2A 5CJMA 1DORA 4EWND 1TPDA 4ICCX 3TH6A 2H3DA 2PU0A 2G3NA 3PBUA 3V5OA 1F4AA 1XH1A 5H8UA 2YA2A 5EMMA 1Q65A 4CCCA 5GNYA 5K4ZA 1QUMA 3GTHA 3MT1A 4HPHA 2ZOXA 1Z32X 3IAPA 3CB8A 3UETA 1VEPA 4JTEA 2A0NA 5HATA 4EXBA 4H4VA 4B5TA 4YWSA 4X2RA 3MHUA 3N9SA 1N63C 2V8ZA 2WP5A 5I79A 2FDSA 1X1OA 1A5OC 3VO0A 1HO1A 4IGNA 2VX7A 5FF2A 1SFTA 4DI9A 2HE5A 3TZFA 2B81A 3W7JA 4MUZA 3II1A 2D3NA 1OT2A 3R7MA 4D8AA 1XRTA 2IPGA 1E70M 2QV5A 4AMCA 4MZ1A 1A0DA 2ZE3A 4JNYA 4JNZA 4QSFA 1GTEA 3M43A 3IJ9A 4W88A 2RGLA 2YLAA 1DVJA 3SY5A 2HBXA 1U2YA 1VBRA 4PGLA 1J5SA 2ZRZA 3O06A 3EKZA 2F6XA 2QCDB 3H12A 3CNYA 2CLFA 3MP3A 4LAKA 3NVTA 1HNYA 4MFDA 3EKLA 1MXGA 1GZJA 2GJXA 4IPNB 3PK7A 2EQ8A 1JF6A 2YFNA 4RE2A 5FAGA 4F3HA 5EMKA 4LVGA 4MG4A 2BZNA 1AJ2A 3DYOA 3HN3A 4H7ZA 3VFCA 3JRKA 3WD3A 1ZXIC 2EPNA 1PE1A 4B9ZA 1SVDA 3GHRA 3GXNA 1VENA 4DM1A 3NVYB 5A8PA 3NSXA 3T08A 4DPQA 1OYAA 1B31A 2IPJA 1RVKA 3WDJA 2NXIA 4QROA 1PYFA 5C55A 5G1MA 1AL8A 3ZVHA 4REQA 4WGXA 2ZYFA 5C9ZA 2WMFA 4JN8A 5BMWA 2BB0A 2F2HA 1CW2A 2PP1A 4GZEA 3SCTA 2C1IA 1WYGA 1MFVA 5E6ZA 1WA3A 5I3HA 1GG1A 4H3DA 4J1OA 5I3GA 4A8IA 3O05A 3F4WA 4QAWA 2PD5A 4BKNA 5LNWA 2HCVA 4O52A 3DFTA 3MI3A 1RBLA 4DZAA 2VEGA 1JCXA 3ITGA 2QUUA 4A3YA 4PUKA 3PWIA 2DIEA 4LUTA 1EJRC 4HSNA 1EBGA 4MWAC 4UCGA 2J77A 1H7OA 1EJSC 1UR0A 3C0SA 3UCQA 1K3UA 1Q4NX 2NLIA 4JQ2A 2D22A 4JY8A 3FEQA 2VUYA 5AYXA 4KWUA 3V5FA 1LJYA 2A7PA 3GC5A 2X41A 1AD4A 2CXGA 2WLZA 1EZ2A 3RHGA 4JOMA 3WUEA 4F2UA 4K36A 4RW5A 4C5YA 2CLEA 4MHBA 1X6LA 3FIGA 4GZJA 5HA7A 1THFD 5CZJA 4O19A 1TPFA 2XVNA 3THDA 2CBVA 2DT2A 3RCYA 1JDFA 4WDUA 2YA1A 4W4QA 4DAFA 1FHVA 3A64A 2EEXA 1H7NA 5CPTA 1XLIA 1W31A 3WLMA 1GVOA 1RJPA 4V1YA 2EJAA 1K7FA 1XCFA 4DJEA 4NL1A 2PP0A 3EA3A 1KXQA 2ZRYA 2A6NA 3LZ3A 2WMIB 1XDLA 2VENA 2OO6A 3TN4A 5JH1A 1KGUA 4DF2A 3ARSA 2DT1A 2WJZA 5K2ZA 3GAKA 3CGDA 1P48A 3URBA 4UMBA 3N9RA 4RDWA 4P5UA 1HKVA 1OYCA 3VNZA 1JRPA 1ODUA 4O10A 4JFSA 4MKSA 2BWGA 3AOFA 1JFXA 2DVXA 2Y7DA 4OWGA 4IIFA 1KKRA 1FWSA 3LENA 1NHRA 2VDHA 2FZBA 3S47A 4CCDA 2OSWA 1DWFM 4M80A 3AIBA 3O6DA 1V3KA 3UWWA 4NEWA 5DFAA 3LHWA 2OG9A 4H8HA 3LY0A 1UR2A 3M0VA 2PCEA 3RFAA 1DE6A 5A69A 4IQJA 2CZVA 1MRAA 4DWSA 4PSRA 2HVMA 2O7QA 2E8ZA 4XX6A 4YL2A 1PZ3A 1EXPA 1KRAC 5CBBA 3W3OA 5HMFA 1P6WA 4DJDD 2VOMA 1VH7A 3EWCA 2OZ8A 3EGJA 3W9ZA 2E9BA 1GHRA 2NZLA 3VE7A 2Q09A 4AG0A 3QN3A 4N6FA 1Z44A 4HHPA 3LSBA 3UNDA 3ARXA 3GY1A 3OQEA 4NILA 3QMRA 5AHMA 4DBWA 1CWYA 1G69A 3PZIA 2MNRA 3BO9A 3PANA 2WOWA 4BV6A 2ZZCA 3S5YA 4OECA 2JF6A 2QQ6A 2A3CA 1NDWA 1YBQA 1N61C 4UQDA 4WSHA 4WZHA 1V59A 4S3BA 4BF7A 3C61A 3GVRA 5DQPA 2CLLA 3NCOA 1AZ1A 1SR0A 1E4MM 1ECQA 2IW0A 1X98A 3QY8A 2CETA 1QNRA 1SZGA 3WLOA 2O9RA 3VC6A 2YBVA 3PNUA 3E5BA 1C3FA 3PY2A 2WZHA 2BS9A 1GVIA 3BARA 3QR1A 1WUFA 1LT7A 3G6MA 2ZRXA 1QDSA 2QDEA 3VK5A 1B4EA 4RNFA 1QOQA 4FALA 3MYOA 3ARRA 2VR5A 3UZ5A 1XD1A 4LC8A 3TYBA 4HA4A 1N8IA 3R13A 2QCCA 3W82A 1KM2A 4E5TA 5IFPA 2WVUA 3MSGA 1LM1A 5BCAA 4JTFA 3B8VA 1KFWA 3PTKA 3RCMA 1DJWA 1CNVA 4DO4A 1W1YA 2ACSA 3E0VA 4UTTC 4R53A 1ZBCA 3RF9A 3WK3A 1M9HA 1S1PA 1W5QA 3G0XA 1QO5A 3TNOA 1FCQA 4PMDA 4NJKA 4JICA 1SO4A 3HPSA 3THAA 4Q3MA 4UZSA 4OV4A 3JVAA 5I7GA 4CEUC 3R25A 3OHIA 1J2BA 4CLMA 1JZ7A 3OYZA 1JVNA 5BW6A 3VIJA 2WZTA 1OCBA 3FFSA 2Y5EA 4W93A 1MEIA 1OT1A 1R3QA 2QHAA 1VHCA 1PVNA 5F2LA 5D32A 4PRTA 2Z28A 1F6YA 4E2VA 4GVHA 4UTLA 3WFLA 3PULA 4PR4A 1UZDA 3ZIZA 4YVPA 3AUOA 4JEJA 3NIYA 1Y7VA 2R1PA 3L0KA 1CB2A 4EQXA 4GQBA 4KCVA 4H8UA 3GW3A 2EQ6A 1E51A 2OMAA 3JUGA 5HBFA 3BW3A 3QMSA 4J57A 1QXLA 3M07A 1Q7MA 2X05A 1V97A 1H4PA 4KW2A 4AIUA 4GNVA 3TR9A 5XIAA 2J7FA 4PUEA 3EDFA 3G1SA 3GSMA 2NX3A 3BCDA 4ML9A 2DSUA 3RJYA 3DXIA 1X7IA 1GVSA 2NVCA 4UUIA 5A2AA 2QYGA 3H21A 3NO5A 2NPXA 4IX0A 4LYKA 1NFPA 4IJBA 2X8CA 2H9AB 1SO5A 3WG6A 4BHYA 5LIKX 2DFAA 2BNJA 3DKLA 4QJ1A 2IPWA 3A23A 3GR8A 4BJHA 4IGHA 4GJJA 5F4XA 1R7AA 2XFWA 4JTTA 1EJ7L 3TFCA 3KCOA 1ZZMA 3B40A 3NZPA 4KMQA 2I14A 2ADAA 5HPCA 3P5YA 1KRMA 2QUNA 4XZNX 5LNVA 4L1XA 3ATZA 5CJ5A 5HNNA 1D7KA 2Q8ZA 3UPMA 4GR1A 4C1NB 3K1DA 1BXBA 4NEVA 1RXOB 3GUGA 3SURA 3CWHA 4LTSA 3LERA 2R1LA 5DT5A 3S5OA 3A13A 4YVVA 1KTBA 5EMJA 5AC6A 3SCPA 3BQ6A 4KPLA 4RV8A 4H01A 3R4IA 1IHIA 1DWIM 1DXFA 2PLMA 2WSRA 3CQ0A 1TE1A 4AHOA 1C7TA 1E71M 4GX8A 5D03A 4S3DA 3R89A 1G4SA 1J11A 3CZGA 2JGQA 1ZDLA 4ZGYA 3KBMA 3SY8A 5ENLA 4ZTYA 4DYEA 3SR6B 4MNKA 3TYZA 1XGEA 2BXVA 2ZUWA 1ENUA 1ZJAA 3IK2A 4RL3A 4UB9A 1GQLA 1WDWA 3NL3A 5K9CA 3HJEA 1E6RA 4NYYA 4FNUA 2QXWA 4LF1A 4ZFMA 1F3EA 3DK4A 1Y5WA 2AL2B 3QKZA 3WQ8A 2G3JA 1TCMA 4UFMA 1L6FA 3BW4A 4LVDA 3WDIA 2VZOA 3H4GA 1ELSA 5GJMA 3P80A 1GOKA 4WHBA 1TA3A 3H23A 3SN0A 3VA8A 5GJNA 3KUMA 1JPKA 4P7QA 2FHFA 1R9ZA 2WCGA 1XYAA 5T26A 4PC8A 4GGHA 4LAUA 1CXKA 1KGWA 2ZA2A 1VCVA 2WHKA 1VR6A 1X7FA 3K30A 2BGSA 4TIMA 3CO4A 3EWWA 1DQWA 4LCSA 1JQXA 4GY1A 6TIMA 3FKKA 3CL6A 3JZEA 3DAQA 3M6DA 3QHMA 1EOKA 5C7VA 4GLEA 4HTBA 1K9FA 1XG4A 1QWGA 4CNNA 1ME7A 2BXYA 1E9YB 2GK1A 1ZAJA 3ABSA 2DY3A 4L64A 5AC5A 3PFRA 3WF1A 2TSYA 2EPHA 3G1YA 2VZTA 1KXHA 2CLPA 2Z24A 3CHVA 2Y4SA 2AL1A 3KVKA 1A3WA 3E3HA 3GNNA 3MV11 1GVQA 1R3VA 4OVXA 2TPRA 3U5UA 5M2FX 3ANYA 2IQ0A 3PS7A 1OFQA 1DXEA 5T91A 2E6YA 2R8WA 4WR3A 4U2ZA 2WVTA 1MYRA 1PWMA 2XFYA 4JTLA 5A3HA 2PLJA 1TWZA 5K9DA 1FP8A 1KR0A 1O94A 3DUGA 1XXXA 2NUYA 4J35A 4H6EA 2V6OA 1MQPA 2ZZBA 3IJDA 1XJBA 4PMNA 4H4UA 5FKYA 2GWNA 4HB7A 3VIOA 4MUPA 2NVAA 4A21A 1Q13A 4J3TA 2PWVA 1XFCA 1C9WA 3NVZB 4UQ9A 4HMDA 1CXLA 2JE8A 4NF7A 1W1B1 2FVLA 1W5MA 1GUVA 2W3RA 4IT1A 1XGDA 3A3HA 1EHNA 3A9BA 1VPQA 2XM1A 3IVSA 2WPFA 1GQNA 5A2CA 1R9XA 3QY7A 1XDJA 3CIXA 1EF3A 1VRDA 3MBFA 3UCDA 2CCRA 3GD6A 3QYSA 3D0CA 1RALA 3R10A 4HZ7A 5D2XA 1Q2RA 1S2CA 5H91A 1FX6A 1OK4A 2PBOA 1W2VA 3PG6A 4CCZA 1Q66A 3EB4A 1XR2A 1T8XA 1D3HA 4RE4A 4ATLA 4H6QA 1E4LA 1R3YA 4Q22A 3EWBX 4QCFA 3SIMA 3KL3A 3R0DA 4JQ9A 3PNZA 2NW0A 3FA5A 3QLDA 1PZ1A 3NM3A 4MLJA 2OKTA 4HYVA 1W1VA 3KBSA 3RU8X 3UA3A 4ZTXA 5LA0A 2W62A 4LS0A 1FIQB 3GBDA 2F38A 4JPGA 4F2TA 3H6OA 5A6TC 3TA9A 2Q6ZA 3E0IA 4YPJA 1C91A 2DIKA 2PCQA 2EGZA 3LZ5A 5H1WA 1H11A 4O28A 1GYLA 3SN1A 4HBKA 4ZVJA 3W81A 3TEVA 3W7QA 2FDMA 4RXFA 1JGIA 2ZBTA 3PZTA 4G7EA 5DY2A 4KERA 3E1F1 1Z89A 3G77A 5CCZA 3DENA 1KM4A 1IXNA 3N15A 3B06A 1FWNA 1CDGA 1TO3A 1V77A 3AMCA 3B0XA 2EAWA 2CBIA 4XUGA 2NSOA 1KRBC 2PPGA 4PRRA 1S39A 4MWAB 3AIEA 3CBWA 3KCJA 2P0IA 4W7VA 3RM9A 4XZMX 3VM7A 4ERAA 3TSMA 4JTHA 1U5JA 1QW7A 1UC5A 3W1UA 3KP0A 3U0HA 4PUUA 2EKGA 1W1TA 1WZMA 1ZMCA 4M3PA 1AQMA 3UZYA 1KLZA 1FUYA 3MZ2A 1SSDA 4S3EA 3VFLA 2GLKA 4MNMA 2FVMA 2O9TA 1UKOA 1L6GA 4INFA 4AXNA 5BYWA 4XVEA 1LG2A 5GJPA 3F4NA 4WGHA 2FPYA 1EP1A 4AQLA 3FJ4A 4AZ7A 2IXUA 1GG0A 5HMSA 4E8CA 5E5CA 2ACQA 1FKWA 2I1OA 3L4XA 1BGAA 1N8WA 1S2UA 4D6EA 1M6JA 2WMGA 4H1ZA 3P81A 4AW7A 4GKLA 1DJHA 1XX1A 3G1HA 3L2LA 5BWFA 8TIMA 1IV8A 1QNOA 3C0LA 1FCVA 2G95A 4D71A 2FZ8A 4APNA 3IV3A 1XQLA 3UWQA 4XO6A 2OEJA 1WZKA 1QASA 3NEHA 2PDGA 4KFNA 4EXQA 3QC3A 4ACZB 1OABA 1RBOB 2ZZ2A 3G8EA 4MSSA 3VTRA 1N60C 2BVYA 5I09A 1Q7QA 1AMKA 1IZJA 4W87A 1OX5A 3OBAA 4JTAA 4HHMA 3LLFA 5BU9A 3PG8A 3FLUA 1VBJA 3C2OA 1RY0A 1XKYA 3F5JA 3WF4A 3LB0A 4FI4A 4RDYA 3A4XA 3MW7A 2WSYA 1BG9A 3ZSTA 1SFSA 3BUVA 3BMXA 4XZWA 3VDBA 2WYSA 3GM8A 1VJSA 4M19A 1UD6A 1WNOA 2CNCA 3M0YA 4TVDA 3CPRA 2J66A 3C2RA 3ZYZA 5A6JA 1HTIA 1XUZA 1JAKA 1XGZA 3NQFA 4KRUA 1FOBA 4GH3A 3GDMA 5FF4A 1KBKA 4J3ZA 4LAMA 3WK2A 2VCCA 4P8WA 3DFPA 4O15A 4DO5A 4DYJA 3QSTA 4JTUA 2D2GA 4OT7A 2JK6A 4AZ5A 2I16A 3ICJA 1VCGA 2Y1HA 4N9BA 1YPIA 3C86A 4D1JA 1R3TA 2VQUA 6ALDA 3BOXA 3IJ6A 3WMCA 4KS0A 3TXZA 4LANA 2J9XA 4NRRA 3QC0A 2RHGA 2ZA1A 3VOFA 2IMRA 1G0CA 3NG3A 3SCOA 3RNDA 3UXIA 1TPB1 4AD0A 1TMQA 1ZPTA 1T7LA 4B3ZA 2OQHA 2EG6A 2VRKA 1VBHA 4C7DA 2YVFA 1OCNA 2YZRA 4GUJA 3KVMA 1HKKA 2I17A 4FZIA 4OHQA 5FOOA 2WZMA 1Z3NA 1QTWA 1ZRQA 4RUBA 4UNKA 3C2YA 2O56A 4JHMA 1B3VA 2E28A 5G4HC 5CBJA 4K8DA 4XAZA 4GXMA 3GK0A 2DSVA 5MKGB 3AMLA 2HPIA 4CUCA 3N73A 3B8SA 4MZYA 3GXIA 4WSKA 3EBVA 3MP5A 4C90A 1EH9A 3W70A 3U9IA 2OYMA 1FQ0A 1H60A 1P4CA 3RX2A 1JXJA 3ZLFA 2W61A 3BAKA 4V1XA 4KWWA 5F2MA 4EM4A 3O0KA 5JH2A 3FVMA 4W8BA 3U4AA 2NVDA 2P3EA 1FWFC 3QW4B 3FYYA 1UUMA 5JIWA 2PDIA 5EY5A 1UIPA 3TVAA 1HKMA 4RLIA 3CO8A 4FF7A 3MI2A 2GUYA 4Z0SA 1AJZA 4GUFA 4DO6A 4IZGA 3TSBA 3CYJA 1W32A 5A6LA 5I0DA 2F5ZA 2BC0A 1QPKA 5AYBA 1XLGA 4CQBA 3WLLA 3CS2A 1JIBA 4KBXA 4XQ6A 3E6EA 4IMGA 4AD4A 3VU2A 2E4TA 3TYCA 4Q8MA 3M1ZA 3DBNA 4UTHA 4WRHA 3O8AA 1GEUA 2GDVA 2X09A 2FGZA 4HK6A 2WHJA 1P0DA 4RE3A 3OOQA 2ZXAA 1C92A 4AYGA 4DELA 1AW1A 4H9XA 3H4WA 4AIEA 3TXVA 2D0FA 2Q8LA 1YXCA 2Z00A 1EX5A 4FLQA 3GRTA 4ADWA 4PMJA 3UP8A 5GNXA 4IP5A 4RK8A 4UCFA 3GVWA 4Y9PA 3SY1A 5CH9A 3CL8A 3E49A 4XO7A 1EDTA 3IS4A 2Z27A 4JTDA 3N2TA 3P2VA 3E96A 5LIWX 2PDMA 1GQKA 1E6PA 1NOUA 3U48A 4A8LA 3DYPA 1DKWA 1QU4A 5LGZA 2VDGA 2YGYA 1LOSA 1DQXA 2JKPA 4HHHA 4LV9A 2DQWA 3W74A 4YCPA 1EGVA 1ZB5A 1UUQA 3VNMA 1OGSA 1OBAA 1FWCC 4W8AA 4H7CA 3BZJA 1MW0A 1ZALA 4NP7A 3MVIA 5FF7A 4U5KA 3HQ1A 1U30A 2RJHA 3RIKA 4AYSA 3AUJA 2BBFA 4C6PA 4LCRA 4NI3A 1ICSA 2DGAA 4Q8OA 4Y9NA 2DJXA 4GMEA 4Y96A 4JQ4A 4ZO6A 4DZHA 2WKGA 2ZXBA 3B3DA 4UOQA 1CGWA 5DCDA 2BOGX 2ZICA 2HXUA 3O3RA 2J7HA 3I4KA 4G5DA 1YIXA 4RNJA 3QV8A 1PHQA 3LHTA 1GEHA 1FWDC 4GKTA 4B5SA 5B7ZA 1CENA 4PH6A 4L6OA 1UD8A 4ZZ9A 4H4QA 3UQNA 1Q6GA 4LF2A 3G3DA 1R6WA 1ZCCA 2GJXB 1A0EA 4O8RA 2ISDA 2NT1A 1CLVA 3LMYA 3R11A 4GXPA 5FJIA 3AN1A 4HZMA 1NPXA 4GJ1A 2H8ZA 3A5VA 4DB7A 1IYXA 1UG6A 3URQA 1E40A 1NQ6A 1XLMA 2VGIA 3RLGA 1W56A 8RUCA 1EPVA 1TV7A 3OZOA 2PTXA 3BJTA 5BOEA 4IP4A 3W25A 1LRNA 3DG6A 3CHEA 8XIMA 4US6A 3EF6A 1DQUA 3SI9A 2VXNA 2V5KA 3QVQA 3AROA 3OZYA 1F8MA 3ZVHB 4REQB 3TJIA 4E4UA 4HZ6A 1SB3B 1QNQA 3TKFA 4CNSA 1N7KA 2AAAA 2E77A 4A22A 3EOEA 4Z2KA 3NQ8A 2NT0A 3PJXA 5DEZA 1ALDA 4H8NA 1V6TA 2ODOA 1XHGA 4Q4OA 3BV4A 3EDEA 2GR0A 3HW2A 1DXIA 3K46A 2VEKA 3MUY1 3WF2A 2FB3A 4QG9A 1LQ0A 1LL4A 4MB5A 1MW3A 3UG3A 4QQUA 5KZEA 4Q8UA 3PPFA 4AY1A 1P6BA 4MOZA 3NO3A 5J04A 3MHGA 1X6NA 2PZ0A 1UR8A 2CFYA 5F7UA 1IR2A 3ZFHA 5I00A 1A3XA 3IJLA 1JYXA 1LZOA 3WK1A 1HJQA 3WJXA 2VFIA 2OT0A 2RGMA 1M6IA 3WF3A 4DY1A 2G3IA 3RR1A 2TODA 4QIUA 3WDQA 3HA1A 3IC9A 1C8VA 2WK2A 1OIMA 5CPMA 1RV8A 5AKQA 4AMAA 1XP3A 4C7FA 3VUSA 5JBEA 3M6YA 2QGHA 1H51A 4NX0A 4S3AA 1E72M 2FHCA 5BRPA 1XIEA 2NVKX 3W24A 4XAYA 2BLEA 2DSKA 2P88A 2GVGA 1H62A 1SUXA 4R85A 3KOYA 4IPJA 1RUSA 1BYAA 1UIOA 2DPEA 3CK5A 5H8PA 3S42A 3THQA 1I0BA 4N0RA 3ERPA 3DG3A 4IMAA 4YWIA 1E15A 4HJFA 4ROPA 3YPIA 1US0A 2ACUA 3EXTA 2HZGA 1C8YA 4N6EA 1F07A 4K1WA 1M04A 2HNEA 1XC4A 5FAJA 1NP2A 3L2MA 4Q4RA 4OOUA 1ICPA 3WMLA 3PFMA 2GR3A 3LCHA 4H4IA 1HGYA 1A5LC 4JKLA 3LK6A 2PMQA 1TX0A 5A6BD 1ZBWA 4WKFA 2FZNA 2GL5A 5BNKA 2CHOA 3WBWA 2ZIDA 4FIRA 3RYSA 1WPCA 1R86A 4QDWA 4D6IA 4UFLA 4U31A 3OHMB 4H9ZA 3P0XA 3GXMA 5A95A 3WENA 3TYDA 4PBEA 5FEZA 3EXRA 4PMVA 3OA3A 2YVJA 2J9ZA 1DL3A 1SZRA 2WHMA 2A8XA 4IFKA 1SJDA 4S3CA 2W4XA 4Q4MA 2PTZA 2ZWYA 4PCTA 5A8OA 4ZOBA 1KXVA 3O2LA 1XANA 1XLAA 3UJRA 3WSUA 2YL5A 3O63A 4KRTA 2Z2AA 5IDIA 2IKIA 1RQEA 2OZTA 1KM6A 1S38A 2NQJA 4IH3A 3T0TA 4KESA 2PTDA 3NPWA 3LCGA 2ACRA 3QGAC 3IGSA 1BVNP 3K4WA 2P53A 3JU2A 4R3UA 1YBQB 4N4QA 1JNDA 3UBPC 2XWDA 3DEQA 1FWGC 3CUHA 4LQ1A 1J6OA 1FHDA 1XLHA 3RLHA 3M0ZA 2DZWA 3AIVA 1TTPA 3W7OA 3N3TA 1H49A 3G0UA 3NDZA 3LX9A 4M0XA 4TQTA 1MUWA 4Q8QA 1BYBA 4LAZA 4C5ZA 3O7UA 3VKJA 3RGTA 2FLIA 3DCPA 1SFJA 4Q6JA 2Y24A 4UTWA 1X2GA 5ECVA 2RKXA 3AM9A 4H00A 3CH0A 3B0UX 4CD6A 2ASHA 2ZUUA 1QI5A 3FS2A 3H53A 4LOCA 3GXTA 2V6AA 4JN7A 4MNLA 4AF0A 3QPZA 1Z9AA 1H5VA 1HP5A 4MB4A 3C3UA 4NIRA 2OFJA 5D9PA 2RDTA 1HVQA 4E4PA 4UQBA 4DN1A 2ON3A 2V5LA 4XISA 1AQFA 2CZDA 1OFAA 1DBTA 3C6CA 3AO0A 5M1TA 1MQRA 2PTYA 3Q58A 3JW7A 3CLMA 2YKKA 1RAKA 4IGSA 2DZAA 3P82A 5LIUX 1XW8A 3NR0A 3VX1A 1VC4A 4O54A 3I68A 3AZSA 3EAUA 5CSSA 3A5FA 4GOAA 2OB3A 4J3XA 4CQ9A 3O6AA 4Z08A 3V75A 1BWCA 3OLGA 3PJWA 1WKYA 1POJA 5I3DA 5AYYA 1W91A 4O50A 1PPIA 1R5YA 2OEKA 4IX2A 2C14A 2IQTA 2VGGA 2GWGA 3AIQA 5HANA 2C19A 3QZ6A 1NEYA 3N2BA 5U4NA 1ZP4A 4O4VA 4XD6A 5LA2A 5FA5A 1TQXA 1FH8A 4AISA 3JZUA 1U1JA 3E2QA 3ALFA 3L4TA 3UR5A 2WXDM 1A53A 1K9TA 2XJ7A 3T0BA 3W7GA 5JCKA 2OQYA 1R2SA 3M64A 2WPCA 1L6SA 3N3MA 1UA7A 2XH7A 3S3GA 1E6NA 1UP3A 1PYMA 4NY2A 1OD8A 2J8TA 3W2JA 4DWSD 3GTFA 3KDOA 2AQVA 2J7CA 3E9AA 2BHYA 1NFGA 2BGQA 3NTYA 1ZJIA 3SUVA 3H24A 2J6VA 1ZBVA 4S3FA 1YTEA 3Q45A 4QS6A 1BYDA 4JTCA 2J6XA 1OK6A 5C5YA 1ITUA 1HL9A 2FYMA 4YCOA 1JGMA 2A5HA 4M7SA 1J0HA 2WAGA 2ZUVA 3T8LA 2YOCA 3TWBA 4WDTA 4UIOA 1M7JA 4LYRA 3GYCA 1QFEA 1DHPA 5G1TA 3ZJ6A 4GZIA 1ZCOA 1WAWA 1Q6OA 3L67A 2YJQA 3G5EA 4D6DA 3VE9A 3TYAA 4HTYA 3PBMA 2A6LA 4X9YA 2EF9A 1AQHA 1FRBA 3FCPA 5BRQA 1I2NA 3LOTA 4F48A 4XWUA 1FHLA 3B05A 2WNQA 2HNHA 3KXQA 1TJRA 3VD4A 2UY4A 1AA1B 2I56A 1OHLA 4XKYA 3PPHA 4CD5A 2AAMA 2Y7FA 5D9NA 4NJHA 5LXXA 2G96A 3PBYA 1AOGA 1KWGA 1YE6A 2E3TA 3F1QA 1E3ZA 2ZKMX 4GIAA 3G1RA 3FX4A 4M52A 3BLPX 4QSHA 1LORA 3CUIA 4M1RA 4MIMA 5G5HB 3LBMA 4KFPA 4BF5A 3AIWA 3QH2A 2XHYA 3SRHA 2REQA 1TPVA 1P0KA 5AFDA 1C8QA 4Y6GA 2VI0A 7PTDA 4ZOAA 1KCXA 2J13A 4ECLA 1KLYA 4WY0F 4S2CA 1IT0A 4LY8A 5KVHA 2V63A 3LM7A 1VFLA 1KBBA 5ABHA 3RRXA 2Z26A 1UQZA 4HU4A 1LL6A 3LPPA 1HL8A 3IUHA 2BY3A 1OFRA 2R6OA 4JHZA 2HSAA 1YQ2A 3E2SA 3W2MA 1JPHA 3WMSA 4IQLA 4R5EA 4GC4A 1F5ZA 2YL9A 1KN0A 4XAFA 2F2KA 1TA3B 2PDQA 4GYPA 1NM9A 1XBYA 2X40A 3ONCA 4ADTA 3V0TA 2DZVA 2OLSA 1XINA 4KH2A 3VILA 4EPEC 5D30A 3V3WA 1JZ2A 3FYPA 3WLHA 4O57A 4PMQA 1OJXA 3AU2A 4BR1A 1UD2A 4N02A 5I2UA 3NZ1A 3GD4A 1MW2A 2J3NA 4FMVA 1G4PA 3TQPA 7ODCA 3W7IA 2GK1B 3DHPA 2YCJA 3COTA 5D8ZA 5KSWA 5L9FA 3LRMA 4DJFD 2E9LA 1OFPA 2J7DA 3FHQA 1E9IA 3PBWA 1K9EA 5CLWA 4IPPA 5I03A 3FHAA 2OVLA 3VKBA 3EMCA 2V2DA 4IFRA 3UG8A 4ZO8A 5HK4A 1UKSA 3BG9A 1SW3A 4OE7A 1JZ4A 4LALA 1PKLA 2G50A 2ZE0A 3QFAA 4MWAE 3S2NA 2I57A 1O66A 3B8IA 2J27A 1MO0A 3V0UA 1W3IA 1JQVA 1VIWA 2FZMA 4UTUA 1DHKA 1QR7A 3PZMA 4GA8A 3AU6A 4WDXA 3MWAA 4XZIA 1KV8A 3UEQA 3UPBA 4HA0A 1E9LA 1YE4A 1DPMA 1AQ0A 2BV9A 3SECA 1M53A 3TN6A 5D4YA 3FGCB 3ABXA 4CKQA 3QTGA 1EDGA 5D37A 3C0JA 1N5XA 1QPNA 3HPZA 2PRHA 3GHUA 2DJLA 1Q3NA 4I7WA 4WKHA 3MB9A 2BCPA 3NWRA 3ZR5A 2FJKA 3WJWA 3GIQA 3WLTA 1Z69A 3BMWA 5A94A 4FNSA 2NV2A 4O1BA 3W76A 4DBUA 2INZA 2R9ZA 1VFHA