4E4FA

Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
405
structure length
386
Chain Sequence
SMKIVSAEVFVTCPGRNFVTLKITTDSGLTGLGDATLNGRELPVASYLNDHVCPQLIGRDAHQIEDIWQYFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASRTGVMVYCHTTGHSIDEVLDDYAKHRDQGFKAIRVQCEPATKGSLPEEQLWSTEKYLDFTPKLFEAVRDKFGFNEHLLHDMHHRLTPIEAARFGKSVEDYRLFWMEDPTPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRIADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords MANNONATE DEHYDRATASE
publication title Crystal structure of ENOLASE PC1_0802 from Pectobacterium carotovorum
rcsb
source organism Pectobacterium carotovorum subsp. carotovorum
total genus 138
structure length 386
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e4fA01
1SJCA 4HNLA 2OQYA 2QQ6A 3SSZA 3QLDA 3OP2A 3DGBA 3P0WA 2PGWA 3QN3A 2FYMA 3U4FA 4DWDA 1JCTA 3PK7A 3I4KA 3ZLHA 1IYXA 4IZGA 3VA8A 3VDGA 2O56A 2OKTA 2ZC8A 3V5FA 3RCYA 2ONEA 3ZVHA 1ELSA 3UGVA 4GIRA 3T6CA 4J3ZA 3NO1A 4E8GA 4GISA 2HXTA 3TJIA 3RGTA 1P43A 4HNCA 3HPFA 3SN1A 3CT2A 4MMWA 1JPDX 2NQLA 1E9IA 3TCSA 2XSXA 1NU5A 3DEQA 4IT1A 1TE6A 3ES8A 4M6UA 4ENLA 3MKCA 3EKGA 4DN1A 3FJ4A 1XS2A 3QKEA 3NXLA 4GYPA 3UCCA 4JN8A 3STPA 2OZTA 5FJOA 3U9IA 3EEZA 1KKRA 1MDRA 3SBFA 4H83A 1EC9A 3ZVHB 3OPSA 3R11A 3D47A 2OG9A 1MRAA 3VFCA 3DESA 1XPYA 4GYPC 4KWSA 1BKHA 3SQSA 3DDMA 2MNRA 2OLAA 3R0UA 3MZNA 4HCHA 2I5QA 2PTWA 2QJMA 3JW7A 4H2HA 3FCPA 3SN4A 3CK5A 3JZUA 2OX4A 3IJQA 4JHMA 4DX3A 1L8PA 3UJRA 3VCNA 1FHUA 3T4WA 2PU0A 3THUA 2GDQA 1R6WA 2RDXA 2AKMA 3QTPA 4X2PA 3P93A 1WUFA 1EC7A 4K1WA 2PMQA 1ECQA 3H8AA 2PSNA 2QDEA 3ES7A 2P8BA 3BJSA 2DW7A 5FJTA 2DW6A 3H70A 1PDYA 2OO6A 2PP3A 2AL2B 4K8GA 4A35A 1MDLA 2PU1A 4KEMA 5BOEA 3UCDA 4ZA0A 3S5SA 1ONEA 3Q45A 3H12A 4IL2A 3UJFA 3R0KA 1FHVA 3DG7A 2CHRA 3UJEA 1W6TA 4DHGA 3H7VA 2PTYA 2HZGA 1KKOA 2GGHA 3RRAA 3DERA 2P0IA 2OZ3A 4A3RA 2PP0A 1SJBA 3MQTA 2GL5A 4E5TA 3S47A 1EBGA 1SJAA 2FKPA 2PTXA 1TKKA 3TW9A 2HXUA 5FJPA 3N6JA 2GGIA 2MUCA 3OTRA 3UXKA 3I6EA 3TOYA 2GGJA 3ENLA 3SJNA 3T8QA 2PTZA 3DFYA 1PDZA 2HNEA 4Z1YA 4ROPA 2GGEA 4YWSA 3TWAA 6ENLA 4F4RA 3FVDA 3UXLA 3ZLFA 2XGZA 1TZZA 4IHCA 2AL2A 1DTNA 3QPEA 7ENLA 2OFJA 2QJNA 5ENLA 3IJIA 3UJ2A 5FJRA 4KT2A 3FXGA 4E6MA 3D46A 2GGGA 3N4EA 3VC6A 3TTEA 3TWBA 1WUEA 3SN0A 2QJJA 5EU9A 3MUCA 1R0MA 3GC2A 3R1ZA 1SJDA 4G7FA 4DXKA 3DG3A 2XH0A 1MNSA 2PS2A 3TJ4A 3CYJA 4HN8A 4HCDA 4K2SA 4IP5A 3V3WA 1F9CA 4GMEA 4HPNA 4M0XA 3VC5A 1EBHA 2AL1A 3BOXA 2P3ZA 4Z17A 4GGHA 1YEYA 3MSYA 3DG6A 1NELA 3V4BA 3BSMA 4GFIA 3R10A 3RITA 1OEPA 2ZADA 1RVKA 3Q4DA 1JPMA 2QGYA 3V5CA 4EWJA 3OW1A 2XH2A 3PFRA 4GGBA 3CAWA 2AKZA 4E4FA 2QDDA 3N6HA 4MGGA 3PWGA 2OZ8A 3GO2A 3KUMA 2XH7A 4JN7A 3ZVIA 2POZA 5J04A 3TQPA 2OVLA 1P48A 1EC8A 4FI4A 2GSHA 4HYRA 3RO6A 3K1GA 2XH4A 3ZLGA 2PGEA 2PPGA 4E4UA 4IP4A 1KCZA 3PWIA 4FP1A 4H19A 3VCCA 2PP1A 4HCLA 3OZMA 5BOFA 3CXOA 3IJLA 3DIPA 3MWCA 5IDZA 4DYEA 4J1OA 3MY9A 3JVAA 3NZGA 3B97A 3N4FA 2OPJA 3OZYA 3T9PA 3I6TA 2PA6A 3FV9A 2QVHA 2P8CA 4KPLA 3RR1A 1BQGA 4IL0A 1KD0A 3CB3A 4MKSA 3GY1A 2PCEA 3UJSA 3DFHA 3P3BA 2P88A 2PODA 3FYYA 4ZCWA 4H1ZA 2OQHA 5FJUA 3R25A 3IK4A 1JDFA 4A6GA 4G8TA 1MUCA 3NFUA 3GD6A
chains in the Genus database with same CATH superfamily
1XLJA 3IGHX 1L6FA 3RDKA 1B5TA 1X8CA 1M5WA 1YIXA 4O8RA 4HZMA 3SSZA 4DZIA 3P0WA 1C91A 4GIYA 1BKSA 1AMYA 4XUYA 2E1WA 2JIEA 3CIWA 4OJYA 1OFAA 2ZWYA 3D9XA 1AJ2A 1MVYA 4GYFA 2WC7A 4D6CA 5LNUA 4MDOA 1VKFA 4LNYA 2EQ9A 4JHZA 3SFWA 3WLOA 2WNZA 4JX6A 4F2UA 3W38A 2DSZA 3CQHA 4M6QA 2ZOXA 3GFXA 3WLLA 2X8HA 5LA0A 2OEKA 3APGA 4LALA 4MMWA 5IM51 3WLHA 4O1EA 1MMFA 5C2GA 1QT1A 4KEVA 4LS2A 3O6AA 1XKYA 1S5VA 3BCDA 5HWMA 3D6NA 4MY8A 3BLEA 1XS2A 4GR1A 1EF3A 3AMGA 3R8RA 4AX6A 2YYTA 4U3AA 4XKMA 1J8VA 3MHFA 3MDWA 4XB3A 5A69A 3GYEA 2YIHA 1LL6A 2OG9A 1QDSA 3FIGA 3PHAA 4DAIA 3DC8A 4HNVA 1EJ7L 5G5IA 4NP7A 4Z1AA 4OTKA 1Q65A 2YJQA 4EM3A 1A5LC 1BSLA 1VFTA 1YNPA 3DDMA 1YPFA 4LUSB 2XG9A 3AHZA 1G6CA 4MZYA 4KGLA 2OR2A 1M68A 2QJMA 2JFEX 4UTJA 1US3A 3VKAA 2DZAA 5LHFA 1JUBA 4GNJA 4LTSA 3SY8A 1JZ4A 3F2BA 4GI4A 5DCDA 1YXYA 5I78A 3N2XA 1RK5A 3BW4A 1DJYA 2D0FA 4H4IA 1MQRA 3SW6A 3ORWA 4O54A 1XLGA 1XLLA 4H8UA 4PA8A 1EFZA 1B3WA 5DN1A 3N25A 1DIDA 4N4PA 4GZIA 3REQB 4H4QA 2GK1A 4PBGA 5AHLA 5K9DA 2NVDA 4AD3A 4Q8WA 2ZX7A 1LORA 1DQUA 4EPKA 2A7RA 2PP3A 4L6DA 4NSBA 4Y9MA 3WBEA 3OHMB 2PU1A 3GRIA 3G0XA 4NU7A 2ZX8A 4UC5A 4AZ7A 3ZO9A 3WX7A 5FJIA 2W6RA 3SO7A 4F0MA 1TCDA 3LBMA 3WNNA 4KRZA 4ZQRA 4JQ9A 1M03A 3G22A 4C1NA 3IIXA 2CESA 4PN2A 4RPQA 1R86A 3WQPA 1OFEA 3A4AA 2YB4A 3WQFA 2ZUWA 3WLIA 4QGCA 2DORA 1PYMA 4ZOHB 3FG2P 2XZ7A 3RNDA 2WBAA 3OODA 4MAVA 4CU8A 2BGSA 4IJCA 1NDVA 2V5BA 3APYA 1YDOA 3JZEA 3SUSA 1BLIA 3GUWA 1NQ6A 4O1AA 1FP9A 1XD0A 3IIPA 4HK6A 4HVXA 3U6WA 1QNPA 3I6EA 3IC9A 1CI1A 3DJJA 1JCMP 3WQGA 3AWOA 1Z41A 2PDBA 3UYCA 3CS2A 4G9PA 4Q4PA 3DFYA 1OK6A 1X6LA 5M17A 1KGWA 4DXVA 1DXLA 1KRAC 3FVDA 2JEPA 4U2YA 2CBJA 3FFSA 4GQ0A 3BTNA 4Y7EA 3ANUA 3F4DA 3UYIA 5DMYA 2QPSA 3H2CA 3RX3A 1RBOB 3C3NA 4PMQA 5I03A 3L2IA 2DT3A 3AHYA 4GWEA 4UFKA 1SZNA 3ZS4A 2GOUA 2D2JA 3MKKA 3FGCB 3QHMA 1HL9A 2RABA 1YDNA 3TA9A 9XIMA 1OD0A 4UUIA 1NQKA 3MUCA 1GXFA 2J7FA 4UNLA 1BVWA 1JNDA 1ONXA 1MNSA 3WK0A 3WDPP 3GVQA 3KVMA 1QPNA 1GCYA 1DQWA 1PAMA 1VYSX 3GVVA 5A5WA 5JU6A 3W1UA 1EWDA 1XYZA 4XZBA 4NJHA 3VGFA 3T4CA 5FEXA 3NQAA 4PUKA 2DQWA 2DIKA 3PFMA 3MKVA 1QCWA 4Z17A 3AUOA 1UC5A 4D6HA 1QR7A 3P7YA 4Q22A 1OFBA 1RVKA 2YCKX 3G18A 3WKZA 1F6KA 1CGVA 3QGKC 4AF0B 1L6GA 2E28A 3BAIA 4AD4A 4R27A 1IZKA 2NLIA 2XH2A 4IGHA 3TZNA 1SO4A 4J27A 1M1BA 4KETA 3OLEA 1HXJA 4NKCA 4XIMA 2OZ8A 1P6WA 4A2SA 4NY2A 1G67A 3E74A 1XCXA 5FS8A 1OC7A 1KM0A 1SU5A 4H04A 3PULA 2XIQA 2OVLA 2VEIA 3ZLGA 3B9AA 3ITOA 3HGSA 1BWCA 3W70A 1M6JA 5HNUA 4AD5A 1H7PA 3SURA 1F07A 2CXEA 3PM6A 4H9YA 2NWRA 1UCWA 1LUCB 2E8YA 5DMNA 3WF4A 3EPNA 3A64A 3B8WA 5EBAA 5F4XA 3CHEA 1LRTA 2VFFA 4JIHA 1X1NA 2QV5A 4TX6A 4MWAD 3T0BA 5G4HC 2OKOA 1VFMA 1SSDA 4F79A 2HRWA 3TMLA 1W3TA 3LD5A 2Y61A 3NOEA 4KPLA 4Q3MA 4D2JA 4C5YA 1QPQA 8RUCA 4JN6A 1CLVA 3E38A 1Q8JA 3O0KA 2QS8A 1A5UA 5LIYX 1M04A 3VIMA 4JXCA 3SGGA 1Q85A 1P0BA 3LGEA 5T26A 2VT0A 4M19A 4HNTA 1SJCA 3MCMA 1QI5A 1O5KA 1EDQA 4RE3A 4Z0SA 4DWDA 4BV6A 2Z1VA 4US6A 1IYXA 3B4YA 4ZQNA 2P53A 3UG8A 4LC6A 1XF0A 4HB7A 4DWSB 4GABA 3ITTA 3NG3A 2XFRA 1WBHA 1XCWA 5AYIA 4QM1A 2OELA 1ZJHA 1PSCA 5A95A 3BMVA 2CLLA 3CT2A 1BF6A 5HJYA 4K38A 1F3WA 1KM5A 3DI0A 4O11A 4X0VA 3EWWA 4E8DA 3GNOA 3KP1A 4P7RA 3W29A 2O9OA 5HR7A 2OODA 2PDPA 1DJWA 4M1BA 3SADA 1ZCCA 1BXCA 3W1PA 1P0NA 4XBJA 1Q1RA 4GX9A 1LROA 1KKRA 1TTJA 3UR2A 3W7JA 4FALA 1W9UA 4LA1A 1RK6A 4N9DA 4V1YA 4UQ9A 2BXZA 4J56A 1EC9A 1GUVA 3F2DA 3UA4A 1FCVA 3V1PA 1B54A 2B7PA 1VYPX 3GE7A 2GFTA 1X98A 3MBFA 2OEJA 2YA1A 1BKHA 1D3CA 3TR2A 9CGTA 4B5TA 2ISFA 3K4DA 2H9AA 4IIDA 1V97A 2E5AA 4FF5A 4RZ6A 1WQ5A 3P5ZA 1QASA 3AICA 3R5EA 3RMJA 4XAYA 4NASA 3MZ2A 2GQ8A 2Z2AA 1HP5A 3PTQA 4JQ3A 2H6RA 2WHJA 3P8IA 1EJVC 2QXWA 3GNXA 1TPEA 4HHMA 4MWAC 3OLIA 4EPBC 4QX4A 1ZGDA 4XK2A 3FSTA 2WHLA 3MP3A 3F4CA 1OM0A 4O0KA 5U4NA 3WUGA 3RCMA 1YADA 3AXKA 1V6WA 1ITQA 1QHOA 1IE7C 1FH8A 1NTHA 4ZL1A 4DXXA 1PCKA 3MO4A 3ABSA 2CBUA 4XG1A 4KWVA 2PDHA 4K7ZA 1JZ2A 3DX5A 1HW6A 4AVNA 2A3HA 1I2RA 2E9MA 3AUJA 3BCFA 3C0JA 3UZ5A 1SMDA 4WHBA 4FXSA 4HPGA 3N2MA 1Q2SA 4WDXA 4DEFA 2ZRUA 1FFUC 3GIPA 1J0KA 1QW9A 2V0TA 1JGMA 1HFBA 3UT0A 4BQ2A 2YFOA 2V3DA 2QNEA 4DI8A 1KRBC 1UA7A 1ZAHA 5C5YA 1W54A 3S5YA 2D3LA 2Z7KA 5EGRA 2WZEA 1OG6A 3S47A 3WNMA 2Y1HA 5I3DA 3TYEA 5JBEA 4AZ6A 4NXKA 1PXGA 1FHLA 1TPDA 4YIWA 2E09A 2RGMA 4ZOAA 4CQBA 4GXPA 1GRAA 1SPQA 3GFZA 4LH8A 3VNLA 4MFDA 4UOJA 5D32A 4H6RA 1TJ1A 4JX5A 4YVPA 1FTXA 1FXPA 4M29A 2V3EA 4RDYA 4QJ5B 1PEZA 2QCNA 4CNPA 2Q6ZA 4RV8A 2A2IA 4MM1A 3SGZA 3WQDA 1FBAA 5EBKA 1RVGA 4PCTA 2ZA2A 3ZJ8A 2XTKA 2YXXA 2VTFA 3ARVA 1NY1A 1ONRA 1QI0A 4ZENA 4FXJA 3ZXWA 3GHUA 4Y9AA 1XQLA 3N04A 1RA5A 2VC5A 3VZYA 1OABA 1BVNP 1IXPA 5D9OA 1K9EA 1WDRA 2VJXA 4GACA 3IJ7A 3SCSA 3MANA 2QJJA 1PB0A 1UP0A 4GIEA 4I90A 3GAYA 4CN6A 1H60A 1TV3A 2QUTA 4AC1X 4KCVA 3UGRA 4KQNA 2WMIA 3U7VA 3MHUA 3DHFA 3W00A 1HVQA 5AC8A 4O57A 1CIUA 2GVYA 3ONCA 2FZ9A 4AAJA 2YDQA 1C8VA 1P0KA 4H8HA 2V81A 1UMYA 1M7XA 5HOSA 4Q6XA 4NF7A 5IFTA 4H00A 3LCFA 3TP4A 3EDDA 2FGZA 3OYZA 4CQAA 2FZNA 3L21A 3CGCA 4GGHA 1QBBA 1XIMA 4JTRA 4U5IA 5LA2A 1OWQA 4HK5A 3WNOA 2GQAA 2NX9A 2FPTA 4A22A 3V5CA 1PZ2A 3S9YA 4U4MA 3O0FA 4AWUA 3WEZA 2WMHA 3NQBA 1EWEA 3UBPC 4GQQA 1EA9C 1V59A 3V0TA 2B0MA 1C29A 1VQTA 3MI6A 3TTQA 3V7PA 2OYMA 4ZTXA 4K8DA 2F6XA 1U33A 5FKYA 1O94A 1HTIA 4JR5A 1J0JA 1OIFA 3GB6A 3ZT7A 1YDYA 3W7NA 1HKKA 4PUDA 1KM4A 4DBWA 2PGEA 2R1MA 1N8FA 3H54A 3CEPA 4HN4A 1IGWA 1BWVA 3KBVA 4REQB 3DFTA 3U5UA 3KDNA 2CBVA 1EIBA 3VVGA 3OGRA 1FWHC 4Q32A 1E43A 6TAAA 2NW0A 5DLCA 2CKSA 3CV1A 2D73A 1UD6A 3BOFA 5BCAA 5GQBA 1H09A 4RE4A 1UKSA 4FX6M 1NWTA 3N11A 4P8VA 5AZ0A 1OC6A 1ZB5A 3N4FA 1ZBKA 1DL3A 1ZBWA 2GR2A 4UTLA 2FZBA 2QVHA 2QZRA 5JIPA 4IL0A 3S1VA 1PVNA 1V93A 2ZZ5A 1XL9A 3VIJA 1FFVC 4PUUA 3OOQA 3IIOA 3QV6A 1F74A 3GBEA 1UUMA 2ZTJA 5FD0A 4QDPA 1TTQA 1RQEA 4WDWA 1IZCA 1DHKA 5G1TA 4WEVX 1FWDC 1HJWA 4B9YA 2BVDA 1MUCA 5LHEA 3RN6A 4AUBA 3OGVA 5TD4A 1K9TA 3T2OA 3AYSA 1FVPA 1B3VA 2VRKA 3QR1A 3UR5A 3HG3A 4FK9A 4B92A 4FOUA 3G1XA 3N73A 3ZR4A 1UJQA 4GOAA 4DYJA 2X0HA 1XH2A 3GHSA 3AXMA 2A1YA 3SJ3A 3Q94A 1W9XA 1P5BA 3E12A 5IDIA 3S6TA 5IBXC 1XH0A 4JFWA 4UTWA 4GISA 2ABAA 2JIWA 2QCFA 4DO6A 3IVSA 3F4NA 5JXQA 4GXWA 1Q6CA 3GUGA 4E3VA 4IQDA 2NQLA 4RXFA 1R30A 1NU5A 1LYXA 4BR1A 1K03A 2QKFA 4JDBA 4Y96A 3EKGA 3E49A 1JYWA 2GUYA 3S9IA 1HJQA 3QKZA 5FJOA 3EEZA 2XVLA 4AVOA 2YVFA 4H83A 1O5RA 3KXQA 5G1YA 4L61A 2ZQ0A 1UBPC 3D47A 1QHPA 3EB2A 3LLXA 4IMGA 1J10A 2D1ZA 3KAOA 2QCLA 3QQWA 1FWNA 1JCJA 2HWGA 5I6SA 2PLJA 3DKLA 1KBLA 3IUDA 1R2RA 2X2GA 4ADWA 2EQ7A 3CUFA 4TQTA 4B5UA 3IS4A 3FCPA 1H63A 2Y7EA 3QZAA 5DBUA 5I24A 4P61A 2Q3OA 3LM7A 4PBFA 4KFOA 1T99A 1TV8A 5DY3A 2UZ9A 2C3DA 5A6TC 4EF9A 4WQ6A 1N5WC 3N2BA 4CD8A 3EWXA 4GY7A 1BQCA 1XQKA 3NM1A 5C7HA 5REQA 4ZB5A 2PSNA 3PG6A 1KCLA 3MB9A 3MHGA 1GJPA 3ARSA 2CC0A 1GPWA 3TSBA 2VZVA 4W5ZA 2Z0IA 3FA3A 1JRPA 1MW1A 2A3AA 3LI1A 3GG7A 4KF1A 3STCA 2VR4A 1E6XM 1QMLA 4LS0A 5A2AA 1NDYA 5CZ0A 3WMBA 1H1YA 1ONEA 4AEFA 3LQLA 1UJPA 4DI9A 7TIMA 2DT1A 5BRPA 3TSDA 1TRDA 9XIAA 2IKJA 2IUZA 1B3OA 4KBXA 3RNMA 1EKOA 1UA3A 3VIKA 4Q33A 2DT2A 1W31A 3MTWA 2PC8A 1NOFA 1DP0A 1V7YA 3W25A 1V0KA 3VOFA 2DIEA 1M3UA 3SRKA 2PTXA 1QK0A 3KLLA 4XV0A 1WDSA 3BJTA 2ISSA 4R33A 3RX2A 3A5FA 1PX8A 1XXXA 5CSUA 3SCOA 2J6XA 3IGXA 3NO5A 3N2CA 2NT0A 1VR6A 3GK0A 2YR1A 2VZOA 2ZX5A 4TV6A 5HXMA 3BCJA 2W5FA 2WZHA 3W2KA 5C2CA 4BS0A 2CZDA 1GVYA 3M1ZA 1FH7A 3IJ9A 2F7FA 3AHTA 4LYPA 1HP4A 1GVRA 2R1PA 3UXLA 2VM8A 3ZLFA 4IX0A 2W0HA 1Q7QA 1W1TA 4YPJA 5ENLA 1XFBA 4QJ4B 4O13A 3HFTA 4NUWA 2J7BA 1CEOA 3FXGA 4POCA 3N3MA 3NJ3A 1POKA 3HMCA 1NFPA 1KM1A 3M47A 3WF2A 4FIRA 2WXDM 4XQ6A 1KO0A 4MLRA 5EU9A 3IIZA 4JDYA 2YKKA 3WQ4A 4X3ZA 2CHOA 3GFYA 3K5XA 4HOZA 2D0GA 1W9PA 2EKCA 4K2SA 1NHRA 5I3HA 2NX1A 4OGZA 2FMNA 3OVQA 1TIWA 4Y9NA 4OBSA 3W1MA 4RKAA 2WPBA 3WLRA 2J78A 3H2NA 3CTLA 1EBHA 2AGTA 3KWSA 5T91A 4Q8NA 3FJ6A 4H4UA 1R85A 1X38A 1GORA 2CLHA 2O55A 4RPPA 4W8AA 1GZ1A 3BSMA 4CNUA 5IRPA 2HBVA 3B9OA 4CNNA 5FACA 4ZFMA 6REQA 1JNEA 4N9CA 2W27A 3KVLA 3HURA 1UPPA 4KGJA 5CBJA 3NDOA 1LLZA 1K7FA 1E56A 4Z2JA 4BJHA 5BW6A 3LX9A 5MKGB 4LFYA 4C7GA 4E3TA 3QW3A 2HSAA 1W9BM 1EJSC 4HTBA 5DY2A 1DJIA 1XLHA 4JNMA 1JOAA 3RLVA 1CGTA 4XVEA 4QJ1A 4L6HA 2E5CA 2G37A 4PMOA 3K1GA 3VD4A 1M7OA 1C9DA 1QI3A 1V6TA 2REQA 1MEWA 4L1WA 2WWDA 5C55A 4PRRA 3WF1A 4GO8A 1FWRA 4HCLA 3BLOA 5BOFA 2NXHA 1SFLA 4LT9A 3THDA 3PF3A 1BPLB 4LVDA 1SFJA 4HU4A 3FA5A 3QRHA 4GVFA 5LZLA 3CC1A 1GQNA 4EM4A 2XFWA 1W56A 5BXTA 1X2HA 1XIEA 5AN7A 1UWTA 3S6OA 4I9TA 3GS6A 2VCCA 1DJXA 2GVJA 3UWYA 4KFPA 4DZAA 1QHZA 3ZZ1A 2PODA 3FXYA 1E71M 3K2GA 1VGAA 5TF0A 4IFKB 3NVDA 1XSIA 2H90A 3HV8A 3EUB3 2NUYA 1HUVA 1J01A 2C19A 4FLOA 4LVFA 3TN5A 1LP6A 1T8QA 4U3CA 1YBQA 3VCRA 3G24A 1EO5A 2GDUA 3AYRA 4IZGA 5HQMA 1UIOA 3AC0A 3LY0A 3MU7A 3G8RA 1JXJA 1PKNA 4LUTA 4W7WA 4XD4A 3I68A 3G1FA 4WY0F 2Z29A 5TBOA 5ABEA 4MJ4A 4PMRA 3O05A 2HVMA 2FJKA 4J9JA 3S0CA 1F2JA 3SN1A 1IEVA 4O0QA 4MZ1A 2A5HA 3GC4A 1R2SA 2QCDB 1V6UA 3W3OA 4RZ5A 3WUEA 4QIUA 3KBWA 4B2DD 3EWUA 4A8IA 2E4TA 1GNXA 2D2OA 2VEGA 3LXAA 3SSJA 2YA0A 4W89A 3L8KA 5HULA 4O10A 1A4LA 4ZOCA 4A29A 4GG9A 5M03A 2YPIA 3F03K 1CCWB 2XU2A 3DESA 4EKJA 4XAFA 1XANA 3AM9A 3RMEA 3NVTA 1XIBA 4AG0A 1ONFA 4OHQA 1UR9A 4C6DA 3EXSA 3GBDA 4XD6A 1YYAA 3BAYA 4X9SA 3CK5A 3ITGA 1HZYA 2OX4A 4P7NA 1G7VA 3EWYA 1TJ0A 1H4PA 5E93A 3IRSA 1Q66A 4JHMA 5DCEA 2JE8A 1PTGA 2CIPA 3W75A 1F7BA 4QTGA 2GJPA 3I7SA 4FOKA 3R89A 3NQ8A 5F7UA 4K37A 1E9LA 3TXVA 2VD8A 5I3FA 1R7AA 1GRGA 1ZCOA 1IT8A 4E2DA 1K8CA 4DRSA 1ZNNA 4CD7A 1I1WA 3ES7A 1NFBA 2WVUA 4NNBA 1XSKA 1C92A 5G2HA 4NAFA 3QH2A 3VYLA 1IR2A 2NV1A 1EX5A 3ME3A 2R24A 3GTFA 1RPKA 5HNNA 3TYZA 1PKMA 1HVXA 5BOEA 2HROA 2OEMA 4IL2A 3UJFA 4W88A 4GKLA 3E96A 3SRFA 3UETA 4D6IA 4TVUA 4GFSA 1CW2A 1HKMA 3NZRA 2J7CA 1UH3A 4Y6GA 4ZTYA 2FMOA 4JFSA 1LWHA 3W2MA 3GSMA 3O8AA 3UQNA 4ZR8A 4V28A 2DH2A 1DWJM 3MQTA 5FEWA 2R8WA 1DWIM 1R7OA 3RJYA 1X1OA 1X6NA 2VEKA 3OVRA 2FKPA 1OY0A 3QBUA 1TPUA 4FLSA 2X99A 4JL2A 2ZXDA 3B0XA 2OX1A 3SY1A 3I10A 4ZVJA 4BI7A 1XV8A 2GVLA 1I2NA 3CEUA 1F4HA 2PWEA 2IW0A 4MF4A 5I7GA 1QI2A 1GRHA 1GQLA 1FWIC 1AL8A 5EYWA 2GGEA 1Q8AA 4H7ZA 1ISWA 1TVPA 1Q7MA 3QY8A 3M0IA 1TV5A 1RPXA 4O1DA 3RM9A 1VBJA 1TMHA 2X30A 1X7FA 4YWIA 3DCPA 3CUJA 4LIIA 3SQLA 2KAUC 3E2QA 1QNOA 4AD1A 4YHEA 2QEZA 5GJPA 3R58A 3IJ6A 4NJJA 3OC4A 2BY1A 1GONA 3TNOA 3WH5A 2CPUA 2RDWA 3UG3A 1E4NA 3W26A 4HSNA 1QFEA 3PP7A 4S3DA 4IGMA 1W1B1 1FWCC 2BLEA 4ZXLA 4R3UA 5M1TA 1GVIA 1V08A 3HV9A 4JY9A 4O16A 3RK8A 1E1FA 4MWAB 2YDAA 2YVJA 3B9DA 4M7SA 1NM9A 1A53A 4APNA 4JHOA 1X97A 4LAMA 3V4BA 2WSQA 5FI8A 4HPHA 3CGDA 3WD3A 3MSRA 1J0HA 1GVSA 1Z32X 3L0NA 4AIUA 4IG2A 3A5VA 1YKWA 1TWDA 1AW2A 3VGEA 2YL8A 1TJRA 3EDEA 4NT0A 2QDDA 1H2IA 4AY7A 3LCLA 4DLMA 4IXXA 1J6PA 3IJDA 1CXEA 4QP0A 1G9HA 1D8WA 1EF2A 3M5XA 2YXGA 3T55A 3WDQA 1EPVA 5HQLA 3CUIA 3TQPA 2WB5A 1DWHM 3TA6A 2J9ZA 4X60A 3DOPA 3B8IA 1JYVA 4X61A 1EC8A 3QR0A 2P50A 4LV9A 1XRTA 2UY4A 3MYPA 4H7VA 1DPMA 5AYZA 3KDOA 5U25A 2F38A 3MMTA 3HPXA 1YXCA 1Z44A 3W1NA 4UTTC 4JGDA 3TAOA 2DH3A 3CASA 1A3HA 3CLWA 4LAUA 1EP3A 3DIPA 1SZRA 1XLIA 5IDZA 4DM1A 3MY9A 4NILA 5C70A 2YGYA 2PDJA 1MO9A 1DHPA 2O9TA 1UWUA 3VIIA 3R07C 4Z42C 4JYDA 3E9AA 1JCYA 4QQ3A 2HS8A 4UTIA 5CLTA 1Q6EA 3UZXA 4LUIA 5KITA 1HJSA 2WV8A 3WQ5A 2WMJA 2VD9A 2QDHA 3WENA 5DX7A 3UF9A 1XYFA 2VGFA 4ERIA 2PI6A 4AHPA 3EOSA 1L6YA 3D0CA 1E73M 1HG3A 1RJQA 1HKJA 1W1ZA 4ADTA 4KH2A 1OYCA 4HHPA 2Z1XA 3P81A 5CAKA 3VDGA 3TSMA 3VNDA 1ISYA 4O53A 2QCGA 2WM1A 4MIMA 4FDCB 3ATZA 5LYRA 4EK7A 5BZAA 2QCMA 3W6MA 3TN3A 3VU2A 3NR0A 4N02A 1QU4A 3BVJA 4W7UA 1B90A 5CSYA 3GZ3A 4XZMX 1WV2A 1OFRA 2WP6A 1KGUA 1YQ2A 4GH1A 4KRTA 1E9IA 1TPWA 2XSXA 4GJJA 3W85A 1QPOA 1GOWA 3G8EA 4WSJA 4WDTA 4TX9A 3PNUA 1ISZA 2IKGA 4MWAE 2OZTA 2ICSA 4U28A 3GR7A 1RXOB 1MDRA 3VD5A 4FA3A 3CUZA 1IIGA 1QNVA 3R11A 5MHBA 4GC4A 3GXNA 2GH5A 1FWJC 3PBYA 4XAPA 2BZNA 4KIRA 2FH6A 3MJMA 4HCHA 4WJ8A 3OIXA 4XZWA 1TPFA 3M16A 3B8TA 4EX4A 3QR3A 3G1YA 3IJQA 3NYZA 3G1AA 1XRVA 1A4MA 2W55A 5BNKA 4ZOEA 3KL0A 4DJDC 1I0DA 3T4WA 2PU0A 3XIMA 4S2CA 1W1PA 5HQEA 3FYOA 3PZVA 2JKPA 1CT5A 3W53A 2Z6JA 1A5BA 4O52A 1GRBA 5FJTA 2HE5A 1F8MA 2E6FA 4BF7A 1L6WA 4LRSA 1KC7A 4H4WA 4GQBA 1GQIA 4H8NA 1WE5A 4K7YA 2WNNA 4FR1A 2E40A 2X09A 3A23A 2ACQA 1K8YA 4H6QA 4O15A 4HOWA 3CWNA 5CBBA 2B81A 2GJLA 3Q45A 4K3ZA 4KPRA 3KBNA 3CL8A 1UR0A 2VL4A 3IACA 4O14A 1M7JA 2PTYA 4OU1A 4HGXA 3GDRA 4BI5A 3ZJKA 2GK1B 3MMUA 1JPHA 1UUQA 3JS3A 2OZ3A 1XD1A 4ZO6A 3RLUA 4HSOA 1RY8A 5FF3A 5FAGA 3EKZA 3S6DA 3HIJA 1K4GA 1TKKA 2PRMA 3SIZA 3EOLA 1TB3A 4MTVA 1HJUA 2ZXBA 1B3YA 3EPOA 1I9CB 4C1NB 1DTUA 4IPIA 3ENLA 3B06A 4DVOA 3HW2A 3VNMA 1A3XA 2XWDA 2ESCA 4MADA 5F2IA 2ZZCA 4HZ8A 1FCUA 1LLOA 2BOGX 5A8QA 3U2EA 3WH6A 3NPUA 2GOKA 2XZ9A 1AZ1A 5CXPA 3CZ8A 3S1GA 3IJIA 2GJXB 2VX4A 3H21A 3GRSA 3W87A 4MJ2A 5HWJA 4OQVA 1NFGA 4P7QA 3B04A 2V5LA 4UFHA 2C91A 3D46A 4B5XA 1VFLA 3KHJA 3TTEA 3H2EA 1PHWA 1E0XA 3NNTA 3Q2DA 3TK7A 2E77A 4GHRA 1EJTC 4I9MA 4DJFA 2VZUA 1V5XA 2B7QA 3BUVA 2ACSA 1TV4A 2YL5A 4LAKA 4PTDA 2PRLA 1DE5A 3T2PA 5BXPA 4KWOA 4PFMA 1JPIA 3QFEA 1LT7A 1ZBVA 4NZCA 3MVIA 2EPMX 3AIEA 1UPMB 3VD9A 1BSIA 4MSSA 5CZTA 2O9RA 4J5NA 5M3WA 1EGZA 2A8XA 1XINA 3VFLA 1BHGA 2WOIA 3H7UA 5CZKA 3ICJA 5C9XA 4JAWA 3VD3A 3C0SA 5BMXA 5HBFA 5CAHA 5D2XA 1A5MC 3PAOA 1WP6A 2WMFA 5DO8A 2H3BA 3QSRA 1SYTA 2WJFA 4MGGA 3GR4A 2G95A 1TREA 5FS7A 4N7QA 3S83A 3T78A 2Z7GA 2VI0A 2YW4A 2IPJA 2IPFA 4UTMA 3ZVIA 2UY2A 3S2JA 3Q37A 4HYRA 3EGJA 1IGSA 4FP1A 1XPGA 1TPVA 3H2MA 4LW7A 2ZZ6A 4C65A 3VXGA 1BYCA 1K70A 1FP8A 5F4WA 2J75A 1U2YA 3ELFA 3LERA 4J3SA 1I8JA 2ZFAA 2QIWA 1V0MA 1ZJAA 1HKVA 2WO5A 3HO8A 3GXPA 3VIFA 2NQ9A 3C6CA 3I6TA 1O95A 5AHNA 1G4EA 5FJJA 1LF1A 4PEEA 4OOUA 4EQSA 3N19B 3CXBA 1KD0A 1E4MM 2ZUVA 4PTNA 1CNVA 4WY0A 3M41A 4IJRA 3ABQA 5ABGA 4QEHA 3DFHA 1W1IE 3HQOA 3EOOA 3PR2A 1EJUC 1SW7A 5A8NA 3DK8A 2EO7A 3GG1A 2FHFA 3CV2A 1WDQA 3AAMA 4K6AA 4D6DA 3QM3A 4KWWA 3A12A 4IIGA 2PZNA 1VFUA 5DELA 4IQEA 1E1CA 1PZ3A 4BQ5A 4GPNA 3OP2A 1GOOA 1P7TA 3WSUA 1YMYA 4LC8A 3CWHA 4MPQA 5KVHA 1ZK7A 1QVBA 2XDFA 3RFAA 4DB7A 1F73A 2VZTA 1OGGA 1WDDA 2ZC8A 2EG8A 4BWLA 3RCYA 1XDLA 1EGVA 3QOKA 1JAKA 2PGRA 3APTA 3DFNA 4GIRA 4J3ZA 3LCHA 4PBEA 4E8GA 1J0YA 4DBSA 4MUPA 3TJIA 2X1SA 4QEEA 4CVWA 4E38A 2ACRA 4P7LA 3EOUA 3GZAA 2A79A 2J8GA 4NAEA 4M6VA 4IT1A 1KRCC 1W3LA 3RHGA 3B8DA 3U4AA 4XKYB 2WSYA 3TW7A 4PMUA 1T6MA 4CD6A 5E9XA 3OBAA 3LRLA 2JK6A 2XIBA 4ALDA 3QHOA 1V8EA 3O15A 1XIHA 4A8LA 2NXIA 3THQA 3GW3A 5EKYA 2WOWA 1WZKA 4KWSA 3T44A 4DJDA 5C71A 1JFHA 3E0IA 1JR1A 1PIFA 1KV5A 2XN2A 1CXFA 4H2HA 2WCAA 3SCPA 4TOQA 3VABA 2OWXA 3DH9A 4GUIA 2Z24A 4UB9A 3TJXA 4IISA 3VM7A 2DIJA 3KBMA 3VILA 4C60A 2ZICA 2QAEA 4MHBA 1EA0A 1J2WA 2BNJA 2J7GA 3UWVA 4WR3A 2OLHA 3UWZA 3VTRA 2RFGA 3R79A 3PZMA 5DRIA 5EMYA 1ECQA 1H41A 3T07A 4AZHA 3H8AA 1IXQA 1TWZA 3BJSA 3WUFA 2F61A 3NVYB 4XIAA 4WIWA 2IMRA 3L5AA 3DHPA 2VKZG 3CHFA 4UR8A 3O9NA 4YTTA 4UQAA 3VD7A 4FNUA 3T05A 2PGFA 5F1VA 2EQ6A 1UYQA 3GVGA 4ZA0A 3W72A 2ZRVA 1K9FA 1W5MA 1VC4A 4JBRA 3L2MA 3HB9A 5K4ZA 3U2ZA 3WLQA 4CGTA 4HQVA 3W1QA 1TZ7A 1UP3A 4Y8FA 1XC6A 3KZSA 2NVKX 3PJTA 4LUSA 3MP5A 2P0IA 3GDMA 2HJPA 2HPMA 2AQWA 2ZZBA 1AH3A 3VKBA 4PTMA 2GL5A 1KWGA 3PSWA 4EANA 3CWOX 1E0UA 3SDOA 2XSBA 3TR9A 4AISA 1OF6A 1A0CA 1EDTA 3A24A 1OD8A 2HS6A 2WP5A 1R9YA 2OOFA 4NHVA 3DU0A 4ZEPA 1R47A 6TIMA 4P8XA 4K8EA 2E5DA 4CD5A 1KQYA 3EWDA 3REQA 3T8QA 2GSEA 3PZGA 1TWSA 5G2IA 2G4JA 2W3RA 5HAOA 1SW0A 1PDZA 2HNEA 3FW6A 4UQCA 1THFD 6ENLA 2GPTA 4IWWA 4H8VA 1S2TA 4IHCA 4C6KA 1Y5WA 1RQBA 4LB4A 3VIPA 4MNLA 7ENLA 2ZUUA 3SCUA 4ZODA 1FUYA 3VKKA 5LNWA 3LBCA 2R94A 5T8GA 1C7TA 1AQ0A 3H4WA 1MUWA 2WSKA 4A05A 3KTCA 2ZUMA 4AD2A 2X16A 4JQ4A 2POTA 3W7EA 1TCMA 4GLEA 3GH4A 1UZ4A 3VIGA 3KL5A 5DFAA 3OZOA 4Q8VA 4GCXA 2CDUA 3T0CA 1OYAA 2WC4A 5CPNA 5KZ6A 4JEJA 5H8PA 1PE1A 4NZ3A 4S3JA 5F2LA 1XH1A 2BVYA 2QUMA 4C6JA 1NP2A 4ZQCA 1FWSA 1W9DM 1S5MA 4M0XA 4BZYA 3VC5A 4UIOA 3LEPA 3D3AA 1H5VA 2W9MA 3IANA 3TQ0A 4RW3A 3E0VA 3N9RA 3H4XA 3TUUA 1E6NA 2SFPA 2Y5EA 2PDXA 2ZADA 3LNPA 3DK9A 2G50A 1S46A 1ISXA 2YBVA 2QGYA 3BANA 4TTUA 4ROQA 1MEIA 3GKFA 4V27A 1PZ0A 1WKYA 3CZGA 3AYTA 3GIQA 5C54A 3HU7A 1CGXA 5AECA 2DT0A 1XLMA 4KWUA 2J25A 3EA2A 4TR9A 2IXVA 5J04A 4AH7A 1DJHA 1J96A 4EXQA 2ABBA 1IXOA 4NG3A 3OLDA 2PPGA 4PODA 1ISVA 1LDCA 1UBSA 2NQJA 3WELA 3W1TA 3ZWTA 2PZ0A 3GWQA 4F0HA 3GLCA 2PFHA 1LVLA 4GY1A 4A3QA 1MZRA 3WBWA 2ATSA 1VENA 2BC1A 1N2VA 2VEMA 1DXFA 3MUIA 1IWPA 4DYEA 4J1OA 4CD4A 3GAKA 3QVQA 3T9PA 1LQ2A 1SFTA 1UQZA 1A47A 4JTQA 4S3EA 3GW0A 5FOOA 2P8CA 2Y5JA 2FFIA 1T40A 3WIJA 4QCEA 2R91A 1Y65A 3B40A 1MNZA 3A4WA 3TFCA 4RW5A 4MNJA 1XLCA 2V2DA 1LRQA 2B31A 3FSUA 5FJUA 5DF0A 1UROA 4PTWA 3WMLA 1KM3A 2VWSA 4OBTA 4YU1A 3ECQA 2ZUSA 4HNLA 2C18A 2ZTKA 2VRJA 3TN6A 4GKTA 1HT6A 1P1XA 3M5VA 4TV5A 4F3HA 4ATDA 1J5SA 2FTWA 4UMAA 4B3LA 1X39A 1NHQA 3OVGA 4N9BA 4DM2A 1VFFA 4G56A 1K4HA 2ZCGA 3WFZA 1SUXA 3KRZA 5CC7A 1E72M 3GX9A 2Q09A 3WQCA 1V3LA 1JROA 1OFQA 1C8QA 3CUXA 4EWND 4MB4A 1YPIA 5AC6A 3FVMA 3CIXA 4MYAA 3TJLA 2PDIA 1LM1A 3N12A 4HSHA 2VGGA 3W4RA 5KEZA 1RLDA 3SI9A 2DZBA 5CBIA 2VQUA 1K6AA 3AALA 1TJPA 4QDWA 3ITXA 1DYSA 2J7DA 4M6UA 4XSMA 1W9VA 1YDVA 5BRQA 4A8RA 3WD1A 2EQ8A 4PYSA 3O06A 1Q5MA 2WVSA 2I7GA 4Q8MA 4HHHA 2DP3A 1AH0A 2HCVA 1MRAA 5C9UA 2VHLA 3IK2A 1KCXA 3UPMA 1XPYA 3EYPA 1B31A 4NRSA 4CQCA 3AN1A 1JD7A 3SQSA 4M5PA 2D20A 4N2YA 5H2ZA 4Q4SA 1O60A 5A3HA 3ITLA 4GRSA 3KCLA 2I1OA 1VCVA 5A8OA 2QULA 5D37A 4DZHA 7XIMA 1UD4A 1MI3A 2MANA 7TAAA 3O6CA 2YYUA 4Z0JA 4TVDA 4DWSA 1V3KA 4WGXA 3NTYA 3CMJA 1CX9A 4W84A 2Z28A 3OJGA 1VEMA 1ITCA 3NVWB 1E5NA 4E2VA 4LY8A 3IGSA 3T2QA 1XCFA 2V2CA 1E0VA 2FTYA 3QC0A 3M07A 3MSDA 2AOSA 2GWGA 3B0PA 4NI8A 1ICSA 4JTHA 4BA0A 1N82A 3KP0A 3POCA 3EA1A 3BG3A 1AK5A 4GI8A 3UXIA 3VK5A 4LF1A 2INFA 1VPQA 2ZZ1A 3H12A 3BK0A 1GKRA 1O1ZA 2PEVA 1FWTA 1ML1A 4GUHA 4GNVA 2ZUTA 4XZNX 1F8WA 4RL3A 5REQB 1L2QA 3ARZA 1UB3A 2DZXA 3LYEA 3N13A 1V6VA 8CGTA 4WJEA 1WNOA 1B4EA 4A3RA 5AYXA 5DMMA 1YHTA 3JRKA 1PO9A 5AOUA 3VAVA 4E5TA 3II4A 4A21A 4ERGA 2FLIA 1R8LA 2YDSA 1JF5A 4JYEA 3B9EA 2AMXA 3BZGA 1S5NA 4C6QA 5FJPA 1E55A 3NEHA 3L5OA 5DXXA 4M80A 1KB3A 4ORMA 3TIMA 4EPDC 5AYBA 2F9RA 1GYNA 2J7EA 3T1GA 1NWSA 3H23A 1MO0A 4GVGA 5C0QA 1CDGA 4PULA 2PBOA 3UD6A 4QSHA 1FEBA 1ADDA 5FA5A 2ADAA 1C90A 4CNOA 1BRLB 1TZZA 1TE1A 2ZIDA 2FFCA 1BZLA 4QFUA 4ZQPA 3W2JA 2J66A 3SCWA 4GUFA 5J8LA 1NF7A 2WVVB 2ZRYA 5DQPA 3N34A 4Z1CA 2X41A 1TX0A 4LEQA 4OIFA 2IPGA 1BWKA 4R7WA 3GHRA 5HATA 4EAYA 3Q65A 2ZVIA 2DV0A 3R1ZA 1SJDA 4QR6A 4OKDA 1NF0A 4HMDA 3LLFA 3W83A 4KKXA 3KRUA 4CQDA 4IMDA 5BRBA 1H11A 4NIRA 5BXRA 3DH7A 3WDJA 3WLPA 1A0EA 4G6CA 3HM7A 1MQPA 4DJEA 1F9CA 4HMNA 2CHNA 3LMZA 5A6BD 3WG6A 4M6PA 2EGZA 5BXSA 3BQ6A 3F1QA 2P3ZA 4UR9A 4RE0A 2Z1BA 2OSYA 2WANA 3NDYA 2FVMA 2G4FA 1F8IA 1NELA 1BYAA 1O66A 3JUGA 3IWPA 3BAXA 2ZXAA 2VC9A 3R10A 1OQFA 3ARYA 4ZQMA 3ZR6A 1FXQA 5CH9A 1UHVA 3S3GA 1OX6A 2HMCA 4KCUA 1HL2A 1GVEA 2NLYA 3L66A 1TA3B 1Y8BA 3W22A 4XX6A 4U2ZA 1RBAA 2ZVRA 4JNYA 2XM2A 3CQ0A 2VDHA 2J7HA 3M0HA 2FGLA 1ZTVA 1VZWA 4UMCA 1YE4A 4E4UA 4AWTA 2QMJA 4AX7A 4H19A 2P3EA 4I6KA 1AMKA 1JI2A 2EG7A 3AO0A 3LCXA 1W37A 3EA3A 3CXOA 3WLKX 3PBMA 2XGIA 3RU6A 3ZQ9A 3RF9A 3HG5A 3TEVA 4C1KA 1J0IA 1PPIA 3M44A 1FDYA 3DFQA 5FESA 2YSWA 4GIAA 2A3LA 2OPJA 5BWAA 3PJXA 3UY7A 1K9DA 4GINA 4K8HA 4JFVA 1ZY9A 2Q8LA 3LBOA 3AMDA 1DBTA 3QFWA 4H9TA 3M0MA 3L5LA 2E0PA 4H7CA 3I7QA 4W86A 3UJSA 4DAFA 3UXAA 1PKYA 3A22A 3P3BA 4WK9A 3MBDA 3QYQA 5E1QA 3SUTA 4GE8A 1ZQ5A 2OO0A 1RR2A 3BSGA 2RGLA 3MA8A 3LCIA 1R9ZA 3T40A 3KLJA 3CV6A 3HTWA 4PUJA 4W8LA 2EPHA 4J3TA 1SGJA 3PZ9A 2HE8A 4A3HA 1ZFJA 2OU4A 3AHVA 4DNAA 4PCNA 3LLDA 3IAQA 4RX0A 3LADA 2QF8A 1JL8A 1ELSA 3ANYA 1HNYA 1NJJA 5KETA 2AAMA 4S38A 3OG3A 4RNJA 2IS7A 4Q4OA 3ZSTA 3GDTA 3NZQA 4ZOBA 3DAQA 3KM8A 4F48A 4RNIA 1L9WA 4JL1A 1A50A 1U1HA 1OF8A 4MYXA 1QW7A 2PWVA 4O12A 1K8XA 1OSEA 8TIMA 2HQMA 1GWJA 4GRTA 3HZ3A 2PDFA 3P84A 2CLOA 3GVWA 3EEGA 3VOHA 1QATA 1U5VA 3E0FA 2YVGA 2VX7A 4RV3A 3L4VA 4JTDA 3G1HA 3MI2A 6XIMA 1N8WA 3B05A 4PCPA 3CO4A 2ASHA 1K1DA 4QLKA 3DECA 3WLSA 1WO2A 3O0HA 1QPKA 3U2CA 5E9AA 3BL3A 3L9CA 5A6LA 3ARWA 4IF2A 3QXBA 1GQKA 3VIOA 9RUBA 1PZ1A 3ABOA 1CPUA 5E6ZA 3UVAA 5LKYA 1ZUAX 3T0AA 4RDZA 4QROA 4R34A 4D6EA 4UCGA 1O6IA 1W3JA 1KLZA 2E3TA 3V0UA 2E9BA 1GKPA 1NH6A 3FDGA 4YVXA 1BF2A 3OEXA 2NV9A 1DQXA 1Z48A 1H62A 3II1A 2QCHA 1JULA 2WBGA 5CC6A 1UD5A 3UXDA 3NVZB 3KZPA 5D4YA 2X2YA 1W1A1 1IHIA 1S3TC 5C2XA 1RLCL 4IQLA 3CUHA 4L5ZA 4P7OA 1XLBA 2FB2A 1IWBA 3NQ6A 1RH9A 1T5AA 2NQHA 3KE0A 4M7TA 4G1KA 2EHHA 1W8GA 1MDLA 3P6LA 3M46A 1KTCA 2EPNA 1GEQA 2HISA 3L4TA 2J74A 1S7MA 3QJAA 3HG2A 1G94A 4F9JA 3LU2A 3KS5A 1XRFA 3UJEA 2F6KA 4C6OA 4PMVA 2VOMA 1VHNA 4Y2WA 1K02A 2W91A 5HMFA 3IUHA 2CLMA 3AISA 1VB9A 3RRAA 1VIZA 5C9ZA 4NAFB 3VIHA 4MVAA 2PP0A 3FHQA 3ZFHA 4L7ZA 4KESA 3VX0A 2YL6A 3AHXA 1TQXA 1XISA 1E5JA 5JH2A 4KS0A 1IR1A 4UOQA 1XG4A 3KWXA 2OQLA 4ZO7A 1FDJA 1WKDA 3C2FA 1NSJA 4MY1A 1AODA 3BARA 1VBGA 1QXLA 1T0OA 3VX1A 4HJWA 1A5CA 2W3SA 3S2CA 2P1FA 3W23A 3AMZA 2IKHA 5HNRA 4LBSA 5D05A 1GPFA 4M1RA 4G7EA 3AWNA 1R3YA 3P14A 2QAFA 4US5D 1J79A 4AEOA 1EL3A 1RUSA 1TPB1 3HG4A 1V0LA 2HTMA 4XZLX 3SIMA 2FZDA 2A3EA 4QJ3B 3TWBA 4JTFA 2GRTA 5D2VA 4R53A 4IP7A 3L65A 1R2TA 4KEZA 3E2RA 3KOFA 5U7SA 4AYSA 2PS2A 4CKQA 1D3GA 3ATYA 1TV7A 3JU2A 4HCDA 3N17A 3E3HA 3HGOA 3CHCA 4H4PA 4HTYA 4O18A 2PLMA 5H8MA 1VAHA 2CCRA 2EJAA 4AZGA 1KN0A 3WFLA 1D2KA 2ZYFA 4GVIA 1UKPA 4J3UA 1W32A 2OT0A 4FXFA 4O8AA 2AL1A 1NDWA 1XGDA 2YB1A 4BCEA 1Z8AA 4OECA 2A21A 4QLJA 3P0XA 2Z4GA 5I06A 1Q1WA 4WRHA 4EWJA 1VBUA 5D8ZA 3NQ7A 5D9MA 1W2PA 4LU0A 2PDCA 1CXIA 2BCPA 1XYMA 5A1AA 4H4TA 1EZ2A 3MS8A 4IM4A 1DORA 3SFKA 3QF0A 3LZ5A 4LS1A 5BROA 3HPZA 1RV8A 1FKXA 1XIDA 5LXXA 3G0UA 3CMGA 3F4WA 1Q2RA 1TWWA 3QQ1A 4FI4A 3ITVA 3W81A 1KM6A 3PBVA 3DUGA 4JTEA 3C4UA 5EBUA 4XBKA 3AFBA 1KXVA 3LHWA 3QC3A 1US2A 3BV7A 4RR4A 1RHCA 4M8UA 3IJLA 5FIPA 4FX7A 2BC0A 1F6YA 1A5NC 3LCGA 3C2EA 4Y9OA 5JVLA 4B5SA 3TC7A 3CGBA 1WOAA 1WXYA 1P0EA 1WDPA 4MJMA 1R3VA 1Z9AA 3R8HA 2J9XA 1BQGA 4WJXA 3QPYA 4P8UA 2QVNA 3VDCA 1DIKA 4OFCA 3H2AA 1NARA 2BGQA 4O17A 4U33A 7A3HA 2GJNA 3O7UA 3TLQA 1EYEA 2G3FA 4L56A 3GTXA 2GYIA 4YYCA 2VR2A 3LG3A 1J0ZA 3VKJA 5AHEA 5MKGA 3KRBA 4NI3A 2OQYA 4ATLA 1XIIA 1ZP4A 3BG5A 3GXFA 3LRKA 5BU6A 3URBA 3QFAA 3NL2A 2A3CA 2INZA 1M65A 1Q6DA 4JICA 1ME7A 3NYDA 1PX3A 3SAZA 1VLIA 3INPA 3EDKA 5D02A 1N63C 5G5GB 3W2LA 5HPCA 1EQPA 5TAOA 4D71A 2CLPA 5DANA 2WPCA 1GKQA 4E8CA 3N29A 4RDWA 1NAL1 3NO1A 4DPQA 1BGGA 2ZA3A 2HXTA 2YCIX 3MUY1 3RGTA 3S46A 4GZEA 2WM0A 4IMEA 3G2GA 3KL3A 4GZ7A 1VBHA 3GM8A 4LCQA 3ARRA 2J62A 5I07A 3TCSA 1JZ6A 2QPUA 1E6SM 1V6YA 1G1YA 1XM3A 1WCGA 2C16A 2ZRWA 2OYKA 4KIEA 1J11A 3FHAA 4L4PA 4S3FA 4F0SA 1CECA 2BX7A 1XGZA 3GDBA 3I3BA 4M51A 1JDEA 2P76A 1EXPA 3EDJA 1JUKA 2L5HA 2VGIA 2DUZA 2R82A 1NIUA 3FNDA 4BY3A 3LTYA 3RM8A 1N7KA 1QW8A 4PUWA 3N4AA 4D8ZA 2QR6A 5D03A 3VOIA 4Q8TA 1HJXA 5JCNA 1HGWA 3R0UA 2C13A 1FX6A 2G97A 1JAEA 1KFWA 2ZX6A 2PTWA 3AS3A 3OGSA 4XTIA 4EXBA 2DSVA 4J3XA 1BG4A 2C79A 1KW1A 3LXCA 2PDLA 2CBIA 3ZMRA 3S1WA 2V68A 3T0DA 3FX4A 3IGUA 2EEXA 4K39A 1NOUA 2PLCA 1T8XA 2GDQA 1LBMA 1S2CA 3SCQA 4AXNA 4L9YA 4B4FA 2TPRA 1WUFA 3AXXA 3BPWA 1EC7A 1FFRA 2WMKA 3W7MA 2NX3A 4F66A 1GVFA 1UR8A 5HMDA 4S3AA 1PKLA 3VUSA 3W02A 3TNBA 3KCJA 2Y5SA 5U1OA 2HK1A 5HMEA 5HUOA 1EB3A 3QQ0A 4C6FA 4H50A 3W7IA 2GR3A 4GNKB 2QLYA 4I8DA 1GYLA 4PRWA 1A0DA 2Y62A 5FAJA 1AFSA 1FHVA 1EDGA 2OLSA 4QCFA 1RD5A 4JIIX 4A3YA 4L1XA 2HZGA 3VOGA 3GQYA 3DERA 3NQFA 4XAGA 2VFIA 1GOKA 2I56A 4QRNA 2IQTA 4H4ZA 1XX1A 2X1RA 4UZSA 1OK4A 3RLGA 5M2FX 3HBLA 4R9OA 4MNMA 4CCEA 5CC5A 1XUUA 1OJXA 3KVJA 3FS2A 4CQ8A 2HXUA 1L8NA 1ZU8A 1YX1A 2OSXA 3RU8X 1A80A 3N6JA 4ICNA 4IJBA 2BHYA 2LLEA 4JY8A 3PZIA 4Z2LA 4H9MA 1F76A 3FYPA 1CBGA 3M0LA 3S8HA 3GD4A 3V1HA 1DKWA 3TOYA 2GGJA 2PURA 1SZGA 2TAAA 2PTZA 1MZHA 3E5PA 1TVLA 3A4XA 4MUZA 1ZX9A 5DT5A 3EB4A 1GSNA 1N62C 4Z1YA 4ROPA 3PPHA 4HA4A 3FJNA 1QWGA 3KCOA 4D1JA 2AGKA 4MPKA 1CB7B 4LVGA 4ZZ9A 3WF0A 2QJNA 3WNLA 3LHYA 2AAAA 2DGAA 1LQ0A 3OO2A 4ASTA 4YTSA 3N3TA 4NZ4A 4R7OA 1YRRA 4LX4A 2I17A 3GKAA 4DLFA 1G4TA 4XBSA 1UWSA 1UWQA 1JZ5A 4DY1A 3NDZA 2XUCA 1G69A 4Q8OA 1EBDA 3PUEA 4L9XA 2XH0A 3WBYA 2CERA 2E67A 3EPMA 1LG1A 1L6SA 2PDUA 2GLKA 1OX4B 4E2BA 3GH5A 4IIHA 3TMQA 3A47A 1GGOA 2Y24A 2FDSA 3UFYA 2BV9A 3V3WA 4PRTA 5I5RA 2DZVA 4GUGA 3PN8A 2Z1WA 3ZM8A 4LWWA 1IT7A 1F3EA 2XFYA 2Q8ZA 5XIAA 2WCGA 4HZ6A 4IICA 3DG6A 4YWOA 2YBUA 3N2TA 3BAJA 1W0MA 1G0CA 4JTLA 4G1NA 3E6EA 3DKJA 1XGEA 1E1EA 4HNNA 5EB8A 4GA8A 3F5LA 1GW1A 3ZWSA 2AKZA 1W5NA 1IF2A 3WYZA 1EX1A 4DBDA 3DK4A 1KFCA 4PSRA 1GW9A 2Q8XA 2W63A 4I5RA 4JTSA 3CZJA 3K1DA 4LBRA 5KINA 1XYBA 2VNCA 1XDIA 4TMCA 1TR9A 1WA3A 1YE6A 1YW1A 3PTDA 1OHLA 1UG6A 1R3RA 2VCAA 1PBGA 1YPXA 2C0AA 1P4CA 1E6PA 2XISA 1B3XA 3UPWA 1Q63A 4YHGA 3CAVA 1O68A 3BLKA 4PB3A 3WJZA 2VENA 3DFPA 3WDRA 2HK0A 1PL9A 1GRTA 3GDLA 3VO0A 3K8KA 1JCNA 1QNSA 1LOSA 2CXGA 3TH6A 2DZUA 3PTKA 4ICMA 3P74A 2RAGA 5CJ5A 1DWGM 3NQCA 1UASA 4GBUA 3SUUA 3JVAA 3XINA 4AIOA 4JTTA 4MWAA 3CHVA 3FV9A 4JFTA 2X42A 2VVSA 3RR1A 3CYVA 3AMLA 5FS9A 1FH9A 3DENA 3UR8A 3NQMA 3W7QA 3WJYA 3TYUA 3UVIA 4WKAA 1YTKA 1X1ZA 2PCEA 2VX6A 1W5PA 2Y4SA 1BGAA 5KZMA 5I02A 2CLKA 3WD2A 1ZHAA 2UY3A 2W62A 4KMQA 1R38A 3VGDA 3AIRA 2ZDSA 4QE1A 4GYKA 4B90A 1ZZMA 3W07A 2VFDA 4KFNA 2YCLB 4IFOA 1QBAA 3AIBA 2QQ6A 3IPWA 5EA9A 5GPRA 5EMKA 4WXZA 4TVWA 3ZLHA 3NA8A 2ZBTA 3CGEA 2O92A 4FO4A 1KV8A 2J8FA 1EEPA 5GJMA 4C6CA 4CQ9A 3BOLA 5FMHA 1OADA 5C9RA 2YW3A 5C7VA 2CFYA 4NX0A 4NJIA 3FN9A 2GWNA 1PIGA 2VYOA 3SQMA 5DT7A 5CZSA 4W5UA 2GQ3A 3QV9A 4RZBA 4JTGA 3S1UA 3G1RA 3L5MA 3NPWA 1TV2A 5A8PA 1E4IA 2VEFA 3SB0A 4NYUA 3RPDA 3NZPA 4H3DA 2X05A 2CNCA 5SWUA 5IXEA 5CG7A 2PCQA 1P7TB 1GVOA 3CHDA 4HU8A 4JX4A 2WNWA 3WDIA 3QKEA 3LPOA 1KCKA 1H7NA 1H50A 3EWBX 3UNTA 1ZS2A 3PG9A 1K7EA 2E8ZA 2DVTA 1WPCA 3W6YA 5AY7A 4JTIA 4AVFA 2J88A 2QV4A 1Y5VA 3VFCA 2VQTA 1V6XA 1ODZA 1YNYA 1KFEA 3H2FA 4TXEA 2C0HA 1P0DA 3AJ7A 2X0YA 3PB0A 4MG4A 5F2MA 4B16A 4B4HA 4AXKA 3CMFA 1H2JA 2DZWA 4GUJA 4ZXOA 2ATMA 1UD3A 3LUTA 2F2KA 1S2AA 3GTNA 4XO7A 4JYFA 2OT1A 1FHUA 4RZ4A 2RHGA 5LA1A 2XIOA 5H8UA 3H6OA 5K3VA 4AZCB 3LENA 2XM1A 4LVBA 5KTLA 4NNCA 4O50A 4C5ZA 3J7HA 3AZSA 4NZFA 1I2QA 5EMLA 2C7FA 2QAPA 3G1SA 2WNQA 1AQHA 4Z1DA 4MB3A 3KX6A 2DW6A 3WEOA 3B03A 4JD4A 2F5ZA 3M0XA 3PY2A 3O6DA 4QS6A 1QI4A 4TO8A 4GZJA 3TAKA 4AD0A 1JCLA 3KTXA 3IIVA 3UCDA 1GTHA 4RLIA 3WJWA 3BJFA 3O16A 1B57A 1A3WA 4WD0A 1VLWA 1ZJBA 1W6TA 1XW8A 2WKGA 1CTNA 4JZ5A 1C93A 2XPKA 3SUWA 3A7AA 3NQDA 5CGTA 4DHGA 3WQ8A 2DSKA 2NUWA 1XP3A 1KKOA 4RDVA 3W82A 4IPNB 4HJFA 1LLWA 4ZFCA 1UR2A 1HJVA 2Q02A 1GJUA 2TYSA 1K3UA 5LNVA 2C71A 2AQVA 3M7SA 1O5QA 2WJEA 4J57A 1DXIA 4N6EA 2Z2UA 1GEUA 5CSRA 2WOVA 1ZPTA 2A85A 2F2HA 3AIVA 1D7FA 1MRQA 1WOBA 3CT7A 3GU2A 4RE2A 2V63A 1QTWA 2IPWA 4Y8EA 4YLWA 3W6LA 5LIWX 5DRCA 4DZ5A 3OTRA 2V2HA 1NEYA 4AZIA 4YCPA 1R46A 5F4SA 4PMJA 4O28A 3PZQA 2OB3A 1YQZA 3GXTA 2YOCA 1EZWA 1AQFA 4K68A 3LXDA 2WKLA 3PUGA 4NYYA 2RDUA 4ADSA 2BODX 4DBEA 3RILA 2X7WA 2R14A 5HDRA 3MP4A 3DGHA 3N1AA 3W1LA 2OFJA 8XIAA 4D6FA 1LQAA 4XUGA 1CENA 1AD1A 3WLNA 4KT2A 3TTOA 2VELA 4IIBA 4UR7A 3N4EA 3O6YX 4EQRA 3RXZA 2UBPC 3W7PA 3P8JA 2A7PA 1XIGA 4Z08A 1CYGA 1OFDA 1WKEA 1OCNA 1E3XA 3LDVA 4HPXA 3RX4A 5CSSA 3U0HA 2CW6A 4I9JA 3CYJA 5C9WA 4MY9A 2DZTA 4IUGA 2TRSA 5I79A 4JKKA 4I5UA 1N5XA 2XVNA 4QLLA 1XFCA 1I1XA 3MSGA 3VKCA 4HPNA 3BMWA 5EMJA 3PWAA 3WL0A 4S3CA 1H3GA 1MWOA 5IBXA 5CEWA 4I5XA 1EGMA 3UZJA 3V5OA 3NPXA 4O4WA 2NT1A 1QUMA 3L0GA 2Y7DA 2XSAA 1DJZA 2E6AA 1OEPA 3N14A 4HT3A 3EXRA 1TUXA 3SRHA 4L9ZA 3GNDA 3ZYZA 4EPEC 3H2OA 1VPYA 4I9AA 2WKJA 4XD5A 4QG8A 1IEXA 2O7QA 4AQLA 1V02E 1TYPA 3URAA 2YZRA 5J5RA 3BO9A 4F40A 1NDZA 2GJXA 5AC4A 3NGJA 3NCOA 2I14A 1QWKA 3N9SA 4C6NA 4LANA 2POZA 3LK6A 3UW6A 1OCJA 4X9YA 3G77A 3VMNA 4WX2A 3KS6A 1P48A 1ME9A 3FOKA 1REQA 2H3DA 2ISVA 2ZC1A 4X22A 1U30A 2GSHA 3SUVA 2OCZA 2R9ZA 2V9DA 3PWIA 3M0JA 1UZHA 4J2MA 4LRTA 1EEXA 4D6GA 2JGYA 4LB3A 3KRSA 1SVDA 3POHA 4GVHA 4NX5A 3LSBA 3IAPA 4RNFA 3B9NA 2OTDA 3S4TA 3L0KA 3EDFA 5A8MA 3KOWA 4ML9A 4PMYA 4PTVA 3LHZA 5I00A 1GHRA 3VZZA 2G5WA 2V67A 1EH9A 2WWCA 4C6LA 1RALA 4YL2A 3TYBA 2ZZ0A 2QYGA 1OFOA 3F4VA 2GQ9A 4QAIA 3W37A 4O4VA 4LAZA 1X7IA 2BSLA 3M7WA 1EUNA 4UNIA 2D24A 4WCJA 5B80A 4PH6A 3T7VA 3TYAA 1DWAM 3LGGA 2XIMA 3F5KA 3FYYA 4ZCWA 4ZB0A 4H1ZA 3RR4A 1M7PA 3FEQA 4D1IA 4NEWA 3EBVA 1TPC1 3I3DA 1VRXA 2VXNA 3GU9A 2E5BA 1VCGA 1IWAA 3DBPA 4PB4A 4B9ZA 2YX0A 2Y85A 4DF0A 2J9YA 4H01A 3U4FA 3U2OA 4ONVA 5H1WA 4ACZB 5CGMA 2R6OA 3LM3A 3M0YA 2WPFA 4V1XA 5I77A 1XICA 2O56A 3CBWA 4FLRA 4I7VA 3H55A 1D3HA 4FSAA 1GQJA 4N0RA 1JG9A 4NVTA 5I2UA 3MUZ1 2NPXA 2FHCA 3A4JA 3C52A 3T6CA 3FAXA 2DZSA 3VGBA 3DZ1A 3NQEA 4BQ4A 4JOMA 3PUDA 3LSCA 2Y0FA 2QCCA 4IXHA 2ZKMX 2RKXA 2CLFA 3VOCA 3NL3A 1BD0A 1LL7A 4AHQA 2WVTA 2FDMA 1TE6A 3LV6A 3WH9A 1FRBA 5AKQA 3E0WA 2Y63A 1H7OA 4PMNA 5A6KA 3CQJA 4JN8A 3M9YA 1EOKA 2OSWA 4BFAA 3PPFA 4BEQA 3SBFA 5DEZA 6ALDA 5K7JA 1E9ZB 3D3FA 3B8SA 4Q8UA 3S2NA 3LOTA 5E6YA 3A7UA 5ABFB 1XBZA 3DC0A 5JCMA 2JQXA 4IPPA 4Q4MA 4U31A 2VC7A 2AMGA 4J3VA 4HK7A 2X8RA 1OZQA 5AHIA 3MZNA 3U7BA 5KMYA 3C2VA 1N61C 4NEVA 1C7SA 2P5NA 2BB0A 5L9FA 3JZUA 1H1NA 1O1HA 4XISA 5JCIA 1RJRA 3URQA 1J2BA 4GX8A 4IIEA 3QY7A 2RDTA 2YL9A 4PR4A 1M41A 3WQVA 3MUAA 3TONA 5GNXA 1LWJA 2YFNA 3K13A 1KNWA 2RDXA 4CU7A 3GVRA 2AKMA 3E5BA 3WQOA 3P93A 5CGQA 4WF7A 1BYBA 2QDEA 4HYVA 3K4WA 3UEQA 3T0TA 3M6DA 1FKWA 2GDVA 1YLVA 4ES4A 3W86A 3P82A 2TMDA 4LEFA 4ML4A 3BQ5A 1XWYA 4DUXA 3JR2A 1ZENA 2OO6A 5TR3A 1ZKQA 4XKYA 4JTUA 5FS6A 2AL2B 4K8GA 2V3FA 1QO2A 1EHAA 2FH8A 3OU8A 4E4PA 2Y2WA 2ZZ3A 1EOMA 3GXMA 5JQ9A 1PCWA 5G4WA 3TTSA 3DG7A 3EMZA 3EX4A 3L4UA 3LS9A 1OFPA 4H4YA 1ONWA 4M56A 1EJWC 3GH7A 3AIUA 3Q58A 4YTUA 1OB0A 2GZXA 4N42A 3MV11 1C3FA 3RRXA 3O1NA 4Y90A 1RD6A 5LSMA 4UTWC 1F61A 2NUXA 3CZEA 2QPXA 4A8NA 4W93A 5HR6A 1GOIA 3O07A 5CG0A 3MT1A 4EMIA 1E0WA 4XO6A 2Z00A 3XISA 1DJNA 1Z69A 3CZKA 1WYGA 3GDKA 1ENUA 2HDJA 5LGZA 5E0FA 4WLCA 1BXBA 4JTAA 4AFYA 1S2WA 2QUUA 5I3IA 4HP5A 4YWSA 3TWAA 5FSDC 5I3KA 2XGZA 3HFYA 3OYXA 1LG2A 1KBBA 1CXHA 5FL1A 1A5SA 3G6LA 4RJEA 3WLTA 1Q7ZA 2PTDA 1GT8A 5JCLA 1KA9F 4URIA 3W7OA 4H41A 4PEKA 3SGUA 2BTMA 4FHAA 3NQ2A 4XSLA 2EPKX 5G4EA 3BDKA 1KR1A 2WSRA 3A7RA 3OZPA 3ID7A 1ZJIA 4LXFA 2E25A 3ALGA 3BE7A 1H0GA 1V7AA 1WAUA 4PZVA 3GHTA 3W7DA 7REQB 3PZUA 3PS7A 2W61A 3BLPX 1SO3A 2B4GA 8XIMA 4PMXA 2NXGA 4ZO9A 3RUBL 2V82A 4B5WA 4Z2KA 4ZSTA 1FFQA 3ZR5A 3W0KA 1B3ZA 1DEDA 3N2OA 4D8AA 3W24A 3UWQA 3U57A 4GQGA 1YEYA 3MJYA 5HUPA 1ZRQA 4UNKA 5E70A 3ABRA 2BASA 1E3ZA 1KFBA 4JTCA 3Q4DA 3SZ8A 3TU9A 4DNHA 1WKFA 2BHUA 4V15A 6XIAA 3PFRA 4C91A 1MUMA 1QAPA 4E4FA 3QFBA 1GRFA 2VZSA 3SR7A 1U5HA 2D23A 3RO8A 4QITA 4QHRA 5TIMA 3MV01 5M5DA 1L2UA 2VP8A 1E9YB 1PHQA 4BK9A 2OGJA 3NL5A 4I6VA 4JDRA 3K46A 4IP4A 1F3XA 4CEUC 4UOZA 3VCCA 1S39A 1XDJA 2V5JA 4G2DA 5E0CA 4I3GA 3GU1A 5B7YA 3E2VA 3IRDA 4MB1A 4D6JA 4YCOA 4AMCA 4YYFA 1MW0A 4LSBA 5IHSA 3GNPA 2J79A 1I2PA 2YLLA 4TMBA 1ODUA 3P60A 3CNYA 1UZDA 1JRCA 4EQWA 4U5KA 1RP9A 5KZDA 4FNTA 3Q67A 3H53A 1U83A 2FGBA 3C86A 3DI1A 3EANA 1JDCA 4A3UA 4Q7IA 3QHNA 3GY1A 4W85A 2HNHA 2EG6A 2ON3A 5I3GA 2QIIA 1JFXA 1XJBA 2BGNE 2C1GA 3CAKA 3RPMA 1GEHA 2J27A 4JEQA 2NWSA 3BZJA 1JDFA 1QPRA 3NQVA 4B91A 4KERA 3W28A 4UWMA 4P5UA 2EQDA 1I2OA 2C3CA 1B1YA 4A2RA 1E51A 1A5OC 3F7JA 2CZFA 1UUOA 4L4MA 5AYYA 3GRTA 1R3TA 1M53A 5DXYA 1UMLA 3QOMA 4L80A 2PWFA 3NWRA 4YTQA 2OKTA 2VWTA 4DNMA 3V5FA 1Q45A 4QE4A 3ZVHA 3QW4B 4O19A 1P1MA 2E68A 1Q6QA 2YLAA 5FCZA 1SO5A 1A5AA 1VHCA 1B9BA 1OT1A 3OG2A 1P43A 4WKHA 3GIYA 1T41A 1W91A 1RCXB 1UKOA 3BLFA 2Y8KA 1HGYA 1DIOA 3PAJA 2HQAA 2ZE0A 4GK8A 4PMZA 2PDNA 2DUXA 4P2VA 3M4HA 1WDWA 1G01A 3P5YA 3MKCA 5FEPA 4Q4RA 5CC3A 4NJGA 4B2DA 2EXOA 1E6ZA 4O0ZA 3VM5A 4YJ5A 4LV4A 4D72A 4PUMA 1LZOA 3VE7A 2PDGA 2PRHA 3AYVA 5I0DA 4R85A 1RCOB 4B15A 5EMMA 1AG1O 3W73A 3TC6A 3M0VA 3GR8A 2FVLA 4YTRA 3WEMA 5EFDA 1KXHA 4GH3A 4JQAA 2CKRA 1NDAA 3I4EA 5KSWA 3CB8A 3VINA 5FL0A 5K9CA 6PTDA 5HINA 3DJGX 3CQKA 1H7RA 3GC5A 1BVZA 4FX9A 3RLHA 3HGRA 5GJNA 5J5DA 2JF7A 3THUA 1QOQA 1R87A 1YTDA 5I09A 3W27A 1ICPA 1W3NA 1KRMA 3AIWA 4YVVA 4UTUA 3WJXA 1ZXIC 4UCFA 4FX8A 2DJXA 2X1IA 1NVMA 3NS1B 5HA7A 4LF2A 2BG5A 1VFSA 3NOYA 1HL8A 4ORIA 2UWFA 3H22A 3ERPA 5IOBA 5A8GA 4MOZA 2Y89A 4UTFA 5D33A 3B0VC 1UD2A 2CHRA 2OOGA 4Q8QA 2V6OA 3H7VA 3HA1A 1XYLA 4GD0A 4EVZA 4ADUA 3RCNA 3TX9A 2BMBA 2PDKA 4LY4A 2FIQA 3D5HA 1JJKA 2E9LA 4UFJA 5K9XA 3M5ZA 2J4GA 3R7MA 6CGTA 1NWRA 1R9XA 3R43A 4BURA 3I6RA 1TQJA 3AI0A 2QDGA 2GGIA 3VNKA 2HVOA 4OE7A 1BYDA 3B0UX 4S1FA 4UTTA 1OZMA 3WQEA 4Q7NA 4ACYA 4IGSA 4NZJA 4FF7A 1GTEA 1SMAA 1S2VA 5GRTA 4HZ7A 3BV4A 4E0CA 2I16A 1IEWA 3WBXA 2WMGA 3W7KA 1AOGA 2PDMA 1Q3NA 3NSXA 1OCQA 4TTGA 1VJZA 4FEZA 5LGXA 1EYWA 5HANA 4B3KA 1H7XA 2RH9A 4M81A 2V6AA 2G96A 4MKNA 3OQ8A 3LB0A 3TZFA 5ABTA 4TX8A 1V3HA 5DCBA 4KW2A 1WUEA 3SM0A 1O4UA 4N4QA 4HNOA 4M3PA 4TVYA 1TPH1 4MFEA 4PCSA 2DVUA 3W71A 4G7FA 4Z2IA 3VKDA 1TFVA 2UY5A 1FECA 3STGA 4G7EB 5HJLA 3F5JA 1ZALA 4C1LA 1UC4A 4Z1BA 4O1FA 3TE9A 4DBUA 5GNYA 4IP5A 4ZGYA 1WZMA 4FNRA 1AL7A 4N6FA 4MDPA 3NO3A 4GMEA 1DXEA 3KOZA 5E5CA 4NNAA 4J35A 1OGBA 4CNTA 2Y8UA 3MSYA 1O5XA 4GFIA 1C8XA 1H61A 2QJIA 3W1RA 4HYWA 3USBA 1IZJA 3B8VA 4W9TA 1S5WA 1AW5A 2EF9A 3OW1A 3VZXA 4D9PA 3WBAA 4R88A 1BRLA 4GGBA 3OQEA 5EFFA 4DO4A 3GNRA 1XR2A 1ESWA 3KUMA 1XYAA 1EJRC 4OOZA 1AH4A 1L0PA 2WVVA 3M0ZA 4ZB2A 1B9ZA 1W5QA 2V3BA 3PBGA 5FF2A 2XH4A 4D8LA 4LCSA 2X40A 1KCZA 1E6RA 2V3AA 1EQCA 2QUNA 1KFLA 1Z3NA 3TV8A 2CZEA 4LUJA 2PP1A 1MOKA 4HU3A 4X2RA 1H49A 1TUFA 4C6IA 1ZAJA 2ACUA 3C0LA 3ZOAA 2BVTA 1YXDA 2HV5A 1W17A 3S5OA 2O9PA 2NSOA 3PG8A 4AMAA 5AC5A 1VBRA 3ABXA 1OJTA 1JI1A 2QUVA 4N9EA 3NEVA 4J2PA 3AMKA 5HMSA 4HD5A 1GHSA 3G0SA 3CB3A 3VUPA 5E0KA 2Y7FA 2OXNA 3O3RA 3UZWA 1V51A 3EMQA 2GR0A 5D9NA 1Y7VA 3G5EA 4HKPA 3PVFA 1S2UA 2KX9A 3WD0A 3QSTA 1FWBC 4Z2GA 2EBNA 1XBVA 2DPEA 5H6HA 1TA3A 3PC0A 2IQ0A 1JYNA 2H9AB 3WMSA 3NZ1A 2C6QA 3EAOA 4I7UA 5CJNA 3DGBA 2QHAA 3W88A 1JCTA 4IH3A 3I4KA 1MFUA 4B5NA 2BFGA 3VA8A 3TLLA 3MCNA 3GTIA 1RCQA 1TYGA 5GVJA 3UGVA 1JEZA 4DQWA 4H9XA 2VMFA 4PUNA 4CNSA 3QMRA 4X0NA 1JPDX 5TQLA 1G7UA 3I3EA 5ABHA 3VDAA 1FWWA 3PTMA 4DN1A 2H8XA 1HX0A 1SW3A 2Q3RA 1M01A 3UCCA 2BVWA 1TJ2A 3W84A 3STPA 3U9IA 3UWWA 5AZ1A 1AUSL 3IVUA 1GOQA 3DFSA 4UZUA 1F6PA 3MCOA 3N15A 1J9YA 1PIIA 2BBFA 2CZVA 3KEHA 3MDUA 2O4MA 4H2CA 2X8GA 1IEIA 1NWUA 3VDHA 1GK8A 3A6OA 1YNQA 4B3ZA 1EUAA 5CQ1A 2OJPA 1EIXA 3WFAA 1OYBA 1S1RA 4IPLA 3C8NA 2A3BA 4EE9A 4EP8C 1DJGA 4TIMA 1NHSA 4HA0A 3NXFA 1GJWA 3H7RA 3RAOA 2RJHA 3UPBA 1J18A 3CLMA 1CXKA 3WJSA 1L8PA 3UJRA 3S9ZA 5XIMA 4WUIA 3NL6A 4UQDA 3AIQA 1JZ7A 2FZMA 2WJZA 3HQPA 3W1XA 3GG0A 2CWNA 1R6WA 1IEQA 3DBNA 3KW3A 3HQ1A 2J47A 7PTDA 1XLDA 4XZHA 2HEJA 5JIWA 1RJPA 3M0KA 1OC5A 2P8BA 2GQWA 2F84A 3C56A 3P2VA 4YN5A 1JPKA 1QNQA 2PWGA 4GXMA 4HOXA 1KWKA 1XLFA 1FEAA 2E6DA 2E3ZA 1DVJA 1SB3B 3TFXA 2BY0A 4A35A 4NJKA 4QBXA 4ZE5A 1UWIA 4QDMA 3S42A 2J3NA 5GNZA 3OA5A 1KFJA 1H6VA 2A7NA 1PYFA 2DJLA 1STZA 1R5YA 3LMYA 3G3MA 1UOKA 4B5VA 3QV7A 2PDWA 1BAGA 3NIYA 3QV8A 1ICQA 2DDXA 4I8YA 5JMUA 4EACA 5CPLA 2GSJA 3SR6B 1V4YA 1JRBA 2KZHA 2P0OA 2A0NA 3NURA 5AFDA 2YBTA 5D04C 3UG5A 5AVHA 1T96A 3TW6A 4QE5A 2WMIB 1LOQA 2GVGA 2JBMA 1EBGA 2QT3A 1JIBA 4R7JA 3TW9A 1HO4A 2XJ7A 3PPGA 4QSFA 1H1ZA 2MUCA 3GD3A 1LOLA 3FGCA 4YNGA 4CN1A 1R3SA 1WAWA 3UXKA 1WZLA 1SO6A 1KXTA 3ARQA 5L6UA 1Z6KA 2XN0A 1E15A 5ECVA 1TTIA 3SJNA 4UFLA 3EAUA 1W5OA 3MMDA 4UFMA 4UQBA 2XVKA 2PLKA 1LJYA 3WK2A 4HMEA 4S3GA 4EMJA 4ERAA 1UWRA 3LTSA 5A2BA 3IJ8A 1DTNA 2R1LA 4MJZA 1IQ8A 2ZRZA 2V5KA 3W7HA 1KM2A 4FOJA 3L4WA 1FWGC 1GZJA 3OBKA 2V30A 5BWFA 2GJRA 1FDZA 4LYKA 3M5YA 1JYXA 1W3IA 4MAZA 1ECEA 3VC6A 3EB3A 4FNSA 1LCOA 4DJFD 4K36A 4LVAA 3UCQA 1RP8A 2E6YA 4F2TA 2QJGA 4DXKA 4J3WA 3C2RA 3GNNA 4JQ1A 4JQ2A 4AF0A 5DBTA 3AS0A 1OG0A 3C5QA 1XYCA 4RUBA 3QMTA 3CO8A 2ZZ4A 3EX3A 5D2WA 2GR1A 2C1IA 3LA4A 3CH9A 4AIBA 1JF6A 4W87A 5CKSA 4GJ1A 1SZEA 3NQGA 4GY0A 2PDQA 1IIHA 3LHTA 2WW5A 3AXIA 1KTNA 1RZMA 1F4AA 3FKRA 1ALDA 3LHVA 3CPGA 2J77A 2XIJA 4CLMA 4CCCA 4UXDA 3BSHA 1GG1A 1JZ3A 2YDRA 3WD4A 3PZOA 1CWYA 1J4EA 2YCEA 4NZ1A 4YMZA 1LUCA 3CAWA 3PSVA 1KTBA 4Q7BA 2VX5A 3N6HA 5BOOA 5MF5A 4DO5A 2XH7A 3A3XA 2W3ZA 2CITA 5JH1A 3GG8A 4FZIA 4AZ5A 1K77A 4J40A 4JIPA 2ALRA 3CQIA 2WOQA 3ZJ6A 3AZTA 4WOQA 3SRDA 5DMLA 5D2TA 2CWXA 1MW2A 3BLIA 2W79A 1GERA 1N60C 4ECLA 1KBJA 4GI6A 4OV9A 2WBKA 2I9EA 1Q4WA 3BGJA 4H9ZA 2V3GA 1CGYA 1JCXA 5ER0A 4PSPA 2W92A 3BAWA 1UOZA 4IOTA 1AZ2A 2VFGA 3W2UA 1GREA 3DXIA 2PAJA 1HQTA 1VH7A 3WO8A 2WYSA 1TYTA 4M82A 1OIMA 2O7SA 4JCLA 1CLXA 3BC9A 4AWSA 2XN1A 2XWEA 3P80A 3LNMA 4C6BA 2DQXA 3H24A 3WQWA 1LTDA 4L4LA 1TTPA 4OUIA 5C8BB 4PB5A 4K7VA 3V36A 3IK4A 4GYJA 1SZFA 3MI3A 4G8TA 1UKTA 4JTJA 3LI0A 3FJLA 4DJFC 3NSMA 2WQPA 3FAWA 1XLKA 1R3WA 2HVNA 1FCBA 4X63A 4KRUA 3UERA 4PC8A 3QN3A 3PZNA 4H9VA 3ARXA 4WSHA 4DPPA 5TNVA 4EOUA 3V18A 1UH4A 3CTTA 2VURA 4QNWA 1W3HA 3IEBA 3MVTA 3S5NA 5F2GA 3IUIA 3WF3A 2HPIA 5G5HB 1DNCA 4CEXC 3WCZA 3L4ZA 1I60A 3E2SA 3HPFA 3R13A 2VRQA 2ZXQA 4L65A 1LBLA 4LGXA 1OX5A 3U3HA 3Q6JA 3TCEA 2W4XA 4WOZA 1U22A 4LJ3A 4LPCA 4Z2HA 3N9KA 3ES8A 4AB4A 5K4XA 3R2GA 3E0LA 3SCNA 3PUOA 3ETRB 2VDIA 3BWWA 4F0LA 5A6MA 3VNYA 1X6UA 4F0RA 3E02A 3UNDA 4F9DA 4LCRA 1OT2A 5F1UA 3RPTA 5A6SA 1PX4A 1ITXA 5I23A 3SECA 1AVAA 4GYPC 4CCDA 2C14A 4DJDD 1XLEA 1JDAA 2JF6A 3CL7A 3W7CA 2RUSA 3W7RA 3M64A 2PD5A 5EPDA 3S2LA 3WDHA 3NPVA 1EO7A 1TVNA 1JEHA 3TROA 2E1DA 2CLEA 3G6MA 1GOMA 5T9CE 3ARTA 2FTPA 3NAVA 3WNPA 3CIVA 1BWLA 2W66A 1IXNA 4ICCX 3RYSA 2PMQA 2CETA 1A49A 2VO5A 3H4GA 2G3JA 2DW7A 2D0HA 3OVPA 2PD9A 1RY0A 1SR9A 4RCXA 3W1AA 1P6CA 3K8LA 1SFSA 3VOJA 3UWUA 2NVCA 1VD6A 5KZEA 4BKNA 1XC4A 2BP1A 1M9HA 3K8MA 3LPPA 3QTGA 1HF6A 1XHCA 2OMAA 4L1GA 3AU2A 2QCEA 4IX2A 3G1VA 4Y9PA 4HA3A 5LXEA 2WZTA 2PC4A 1UR3M 2D2GA 1T3QC 4UQEA 3UZZA 4IMFA 3MUXA 3MW7A 4S39A 2NVAA 1ITUA 2GVEA 2TSYA 4FNQA 4BWLC 2PWUA 2TODA 3L4XA 3THCA 3OB8A 1U1UA 1SJBA 1HKIA 1W8SA 3LCWA 4DIAA 4AYGA 1TMLA 2OZ0A 4XD3A 2VFEA 3H4KA 1XDMA 2EJ1A 2Z1SA 2HBXA 2AAQA 4H4VA 1YTEA 1UR1A 2VUNA 1OGSA 3BLLA 3LHUA 3WZ0E