4E8GA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
369
structure length
354
Chain Sequence
MKIAEIHVYAHDLSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 116
structure length 354
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e8gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e8gA01
3MQTA 4IL2A 1PDZA 2PP0A 4HNCA 3ZLHA 2MUCA 3D46A 2PS2A 2AL1A 3EEZA 3I4KA 4ROPA 4E8GA 3QKEA 2MNRA 1EC8A 1SJAA 1KD0A 3DIPA 2DW6A 4H2HA 2XH2A 4ENLA 4GFIA 1RVKA 3GD6A 3KUMA 2ONEA 5FJOA 1EBGA 2AL2A 4G7FA 3VC5A 4DYEA 1SJDA 1MDLA 4Z1YA 3ES8A 2PMQA 4HCHA 4IZGA 3DFYA 2GSHA 3DERA 3TWBA 2GGGA 4GGHA 1KKOA 1P43A 3FCPA 1ECQA 3FYYA 3UJSA 3TW9A 3MY9A 1SJBA 1R0MA 3CXOA 3V5FA 3CAWA 3NZGA 3B97A 5J04A 3U4FA 1NELA 3FV9A 4ZA0A 4IHCA 3I6EA 4MGGA 3I6TA 2PSNA 3RO6A 2QQ6A 1NU5A 3MWCA 4FP1A 4HNLA 3VC6A 1L8PA 4HCDA 2PGEA 3DG7A 1IYXA 3V5CA 4GYPA 3H8AA 3IJQA 3DGBA 3T4WA 3EKGA 4MKSA 3R10A 3DG6A 3RITA 3MZNA 2PTXA 3VCCA 3CK5A 4H19A 2OZTA 4HCLA 2OKTA 2PP3A 2P8CA 2QDEA 5FJTA 3GC2A 4HN8A 3OTRA 3TJ4A 3ZLFA 3OPSA 4KPLA 2AKMA 3CYJA 3ZVIA 3VFCA 3PWGA 3UXKA 2PTZA 4H83A 7ENLA 4GIRA 2NQLA 2RDXA 4J3ZA 4A6GA 3UCDA 1EC9A 3N6JA 3UJRA 2GDQA 2O56A 2GGHA 1ELSA 3UJ2A 3NFUA 4ZCWA 2XH4A 3BOXA 2PGWA 2HXTA 2QJNA 3BJSA 3R0KA 3RCYA 2P8BA 1MRAA 4H1ZA 3NO1A 3SN4A 3ENLA 4K8GA 3ZVHB 2PCEA 2AKZA 1EC7A 4E6MA 2FKPA 2GGEA 4DXKA 4K2SA 2OFJA 2QGYA 1WUEA 4A3RA 3IJIA 2CHRA 2GGJA 3OW1A 3R0UA 3TJIA 2XGZA 3OZYA 3STPA 4E4UA 3ZLGA 3SQSA 2GGIA 4MMWA 2PPGA 3T8QA 3H70A 3IJLA 4JN8A 3SBFA 3N6HA 2OPJA 3RR1A 1BKHA 3S47A 5BOFA 3R11A 2QVHA 3BSMA 2P88A 4X2PA 3JZUA 3Q4DA 3UGVA 3QPEA 1E9IA 2XH7A 3T9PA 2OG9A 3D47A 2ZADA 3ZVHA 1KKRA 3DDMA 1JCTA 3ES7A 3MSYA 3S5SA 3DEQA 3H7VA 2XSXA 1BQGA 2HXUA 1KCZA 1XPYA 1JPDX 3H12A 5IDZA 3QLDA 2PP1A 3MUCA 4M0XA 4Z17A 4GISA 2HZGA 3P3BA 3UJFA 1SJCA 2POZA 4K1WA 3GO2A 1DTNA 5EU9A 3TTEA 3TQPA 2OX4A 4GMEA 3FJ4A 4YWSA 3SN0A 4DX3A 1OEPA 1R6WA 4DWDA 1FHVA 3UXLA 2OO6A 1W6TA 1YEYA 3V3WA 3T6CA 3VDGA 6ENLA 4IP4A 2ZC8A 2OZ8A 3TOYA 3UCCA 4F4RA 3RGTA 1PDYA 3N4FA 4DHGA 2PTYA 2FYMA 1MNSA 3P93A 2OZ3A 4DN1A 3RRAA 3PWIA 2PTWA 3SSZA 2XH0A 5FJRA 3FVDA 2PU0A 2QDDA 4JHMA 3DG3A 1FHUA 3CB3A 1F9CA 3Q45A 4IL0A 2OQYA 1MDRA 1TE6A 4JN7A 1JDFA 1P48A 3P0WA 3OZMA 1JPMA 4IT1A 3QN3A 3U9IA 2PODA 4GYPC 4M6UA 5ENLA 3VA8A 4GGBA 3JW7A 4FI4A 2QJJA 4E5TA 2OVLA 1MUCA 3N4EA 3TWAA 3MKCA 3UJEA 3IK4A 3VCNA 4KWSA 3PFRA 3R1ZA 4HYRA 2HNEA 2OQHA 4HPNA 4KEMA 3OP2A 1WUFA 3FXGA 3SN1A 4IP5A 3V4BA 5FJPA 2I5QA 3DESA 3SJNA 4KT2A 3K1GA 3NXLA 4EWJA 3HPFA 3QTPA 4G8TA 4E4FA 2DW7A 3THUA 2AL2B 1TKKA 2P0IA 2PA6A 1TZZA 1XS2A 3TCSA 3DFHA 3JVAA 3PK7A 4A35A 2OLAA 1EBHA 3R25A 2GL5A 2P3ZA 3GY1A 4J1OA 2PU1A 5FJUA 3CT2A 1ONEA 2QJMA 5BOEA
chains in the Genus database with same CATH superfamily
3S42A 1CB7B 4FO4A 4HMNA 7CGTA 3L68A 3TUUA 2PS2A 2TRSA 3QJAA 1YDVA 3LSCA 5KVHA 2PDXA 2PFHA 4DLMA 5HMFA 1LL6A 1K4QA 3GS6A 1K7EA 1DWFM 2A2IA 2HE8A 1OD0A 3CQJA 4JTFA 3C8NA 1GESA 1CLXA 2QAFA 2HVNA 4JXCA 2OX1A 4QROA 1RVKA 3O0KA 1IHIA 2W4XA 4QE4A 2GH5A 4TU1A 1GYLA 4XTIA 5GJPA 3PZ9A 3NQMA 1BF6A 5BMXA 1A3WA 4XKMA 1YIXA 3U6WA 4Q7NA 2H9AA 3VDAA 1Q8JA 4QJ3B 4I7VA 3UJSA 4GUHA 2CLFA 3PTDA 2YVGA 4MUPA 2WKJA 4UTMA 3BAWA 1IR2A 1TV4A 4OECA 2PDYA 3J7HA 3L65A 2CBUA 3AALA 1KM4A 3M7SA 3OZOA 2ZUSA 4HK7A 4DO6A 2HEJA 4AH7A 3R8RA 3NVZB 5U1OA 1XRFA 2GPTA 3R8HA 1W3TA 2PGEA 2VQTA 2DUZA 1TTPA 3EWWA 1A5SA 1H7NA 1M04A 1AW1A 1W9VA 3HIJA 3WO8A 2HCVA 3PANA 3LHYA 1PYFA 4HK5A 1ZJAA 3W70A 5LGXA 2ZE0A 1EJ7L 5LHFA 3NSXA 3TU9A 4PBEA 1S3TC 1VF8A 1GVIA 1B5TA 5JUVA 1ZY8A 1QNQA 4O16A 3SR7A 3CXBA 4J9JA 1V3MA 2WMIA 1CCWB 3PAOA 4DF2A 2X41A 5EFDA 3S6DA 3QW3A 3IGSA 3NEVA 3DI0A 3VNDA 3N19B 1KA9F 4AZIA 3WLSA 3O1NA 4PCTA 4Q8NA 3QTGA 2YB1A 3CUZA 3BXWA 1QXLA 4L4PA 3REQB 4XAYA 2E6DA 2ZXQA 4PFMA 3ITTA 1ZMCA 4HTYA 4TIMA 7REQA 2ZTJA 3CB8A 4Z1DA 3M5XA 1GHRA 3W38A 3PULA 4B91A 3I68A 4EM4A 2VMFA 4L80A 3VGGA 3FA4A 2XM2A 3GG7A 4GHRA 1M7XA 4GYFA 2HQAA 4AUBA 3RLVA 3GD3A 2R6OA 2E68A 3SJ3A 1VCGA 4JN8A 1EPVA 1Z3NA 4D8AA 4DJED 4GQ0A 1QOQA 1SO4A 2VC6A 4EPBC 1TRDA 5KZDA 3JS3A 5BOFA 4P61A 4ZODA 4JKMA 3PBUA 5H1WA 5EFFA 3FX4A 1QAPA 2E1DA 1FWNA 2E28A 3AXXA 1OC5A 4ZBCA 1XD0A 4QISA 2A3EA 4S3FA 5KVIA 1VIZA 3ZT7A 1CBGA 1REQA 3QF0A 3T0DA 2VNCA 1LL4A 2G3IA 1CGTA 3CUFA 4O8RA 4G7EB 1PV8A 4C91A 3DJGX 2NX3A 3PBYA 4MAZA 3B05A 4F2BA 5GPRA 1XLIA 4QITA 4UR9A 1UMLA 5A94A 2QXWA 1US3A 5F2IA 1BHGA 3CPUA 3QR1A 5JBDA 3U8GA 4DWSB 2RDUA 1FWCC 2YXGA 1FWGC 3SUSA 5CC7A 1RR2A 4D8LA 3BOLA 1EBDA 4DBSA 2W55A 1VQZA 1YNQA 4Q22A 3APTA 4AC1X 5K4ZA 1GUVA 2DZXA 1OGBA 4AZ5A 2CPUA 3F4NA 2XWEA 3CHDA 2DVTA 2Y5JA 1Q7ZA 4UZSA 3AM9A 2FFIA 3FHQA 2P76A 5CCZA 3TEVA 4GACA 5G4HC 6ENLA 3S1XA 2HNHA 2FVMA 1E43A 1XDMA 3PAJA 2VDHA 3MHFA 2V67A 4DPPA 1OCJA 3ZT6A 1SFSA 4GJ1A 3RRAA 1QPNA 3AROA 3SSZA 1W1PA 2BXZA 3BG9A 5A5WA 2YAUA 9XIAA 1E0UA 4JCMA 3VDCA 4JHMA 5D04C 4OKDA 3VTRA 1S5WA 2INEA 2VWSA 1V59A 3M4HA 3KHJA 4KEZA 4CCDA 4HMDA 4W84A 1US2A 3OEXA 3QN3A 3N15A 4MDPA 4GYPC 1XPGA 3SIMA 1V6XA 3GAKA 1IXNA 4EVZA 2O9OA 3QZ6A 1QNPA 3VK5A 3KX6A 4JZ5A 3FG2P 2ZZCA 4XO6A 1PX3A 1HP4A 3CIVA 1BVNP 1VKFA 2P10A 2V6AA 2GQAA 2ZRXA 3HO8A 2O55A 1QPOA 3VD4A 4F0KA 1Q6DA 4NXSA 3P7YA 4FR1A 3FJNA 4HYRA 2OQHA 4KEMA 2A5HA 1DIEA 3SUUA 2J7HA 4UQCA 1S39A 1N8FA 1ISVA 2W9MA 1D8CA 5ABGA 4LFYA 5FACA 1G9HA 2X30A 3BZGA 4V27A 3V0SA 1OK6A 2GZXA 4L4LA 3S1VA 1TIWA 5E70A 2Q71A 3GIQA 2ZUNA 2EJ1A 4WY0B 2B7NA 3O63A 1JYXA 2OLAA 3K2GA 5REQB 4W7WA 1QBAA 2CWXA 4PGLA 2G3MA 1L9WA 1UKOA 1B4KA 1OSEA 1EJRC 3W37A 4N42A 2BY0A 3S2JA 1MW0A 1PDZA 4RNIA 4J3WA 2RAGA 1Q6GA 3H4GA 3UGRA 4J3XA 1TA3A 2C79A 3TN3A 3PZTA 1GQKA 2MNRA 2XVPA 4F8XA 3KM8A 4N6FA 3FY1A 1WB0A 3KWSA 2FDMA 1G4TA 4JNZA 1PWLA 1ONWA 3LGGA 3WQ8A 3CGTA 3BLLA 3KHDA 2GDUA 3PC0A 4ZSUA 1VFLA 4XISA 3PNUA 3EWUA 5JIPA 1C8VA 1V77A 1ZJHA 2DIKA 1EJWC 4IZGA 2WCGA 2WW5A 4H6QA 3GTXA 1K8CA 4UQ9A 3UERA 2X1UA 2VGIA 1O5QA 3IIOA 3TJXA 1NQ6A 3BW2A 3QMRA 4RE2A 3MY9A 4JX5A 4DZIA 4RNHA 4AZGA 4UQEA 2RGMA 3GVRA 5TD4A 4X61A 5D32A 1WKEA 2ATMA 4IFOA 2J6XA 2XDFA 1O1HA 4EIVA 4EQRA 3EA3A 1TB3A 3UG5A 3FEMA 2E6YA 1RCQA 3QHNA 4A2RA 3R89A 3H8AA 3RN6A 2B7OA 1PKMA 3DGBA 4NI8A 5BU9A 4FNQA 4HU0A 2ZVIA 4KRTA 3DKJA 5D2XA 3URBA 3KRZA 3H53A 3SCUA 3LY0A 3VCCA 3PZQA 3PUOA 1TWIA 4IJCA 3F4DA 1KWKA 1KQZA 5CQ1A 4AIOA 2WP5A 2QDEA 3LCWA 1BVWA 2ZZ7A 5KEZA 4I3GA 2VVNA 3LNPA 1JCLA 3H4XA 4DF1A 3PWGA 4O0ZA 4TMCA 5T26A 3LXBA 2XIMA 1JRBA 1KBKA 3T55A 4TR9A 1ZCOA 3VKAA 1IZKA 3EDFA 4NU7A 2VZVA 1H3GA 2VR2A 3FKKA 5CSSA 1R3SA 2F5ZA 2GGHA 1X8CA 2ZWYA 4ZFCA 1UC5A 5LA2A 5ECUA 3VYLA 1VFTA 3GFYA 1FKXA 4B3ZA 1YDYA 2Z1VA 5FEWA 1JI1A 1R38A 4H3DA 2HMCA 1OABA 5DBTA 1UZHA 4V1YA 5CPQA 3KS5A 2I9UA 3AIRA 1W8SA 4PTNA 1H11A 4U3AA 1JEHA 4GI4A 3OW1A 2EKCA 3S4TA 1ISZA 1YXCA 3AZSA 2WNQA 3OGSA 2YL8A 3EWBX 4PN2A 4LT9A 3A4XA 4LH8A 2CBJA 3IIVA 4Q32A 4L9XA 3Q94A 2WZTA 2OLHA 2ZE3A 1MW1A 4G6CA 1EFZA 4Y9NA 1W1IE 5T8GA 2Z4GA 3VOFA 3S9ZA 1C29A 1KCKA 1LPFA 1KXHA 4X2PA 4I5RA 1QO5A 4IQJA 1E9IA 2H3DA 2ZKMX 3RR4A 5A2AA 4W8LA 4LVAA 4AEOA 3PHAA 3EA2A 2ISDA 2V9DA 3AMLA 3N11A 1UKTA 5DMYA 4IWWA 1H60A 1W1YA 3IARA 1E71M 3AIEA 1ZTVA 2AGKA 3IGUA 5HANA 3G0SA 2EG8A 1V93A 4MY9A 1X1OA 1V0LA 1UWIA 4NEWA 4X0VA 1BZLA 3WH9A 3W1NA 1Q65A 2GFTA 3H2AA 3NPVA 2V68A 3KDOA 3VAVA 4QBXA 2VQUA 1YBQA 4V33A 2YCLA 1KCLA 1XIMA 1H51A 3BICA 1WNOA 2ZUVA 2CC0A 1V02E 1TWZA 5A6TC 6REQA 4H4IA 1TUXA 1NPXA 1B3YA 4RK8A 2JK2A 4KGJA 4DUWA 3W6MA 2PDPA 3SCQA 1W6TA 3A13A 2PLCA 4HA4A 4EMWA 3T6CA 1OG0A 1BGGA 1W1TA 3VDGA 3VD5A 1P5BA 1SYTA 2YVFA 5DRIA 4GI8A 3L21A 4DVOA 1OFPA 2OZ8A 3QGAC 4JYFA 4HPXA 3RGTA 2E09A 1BRLB 2GSJA 2FB3A 3GE7A 2Y6ZA 1KCXA 4AC7C 1UUOA 4IMDA 2QCFA 4F66A 1WDWA 1TCDA 3B8WA 1C7TA 3U4AA 1W3NA 2CLKA 2BVYA 4GZ7A 1VB9A 4PCPA 2I56A 4XTDA 5DRCA 4R88A 1J5SA 2EPMX 3MUIA 5RUBA 2FPYA 1HL8A 3WLTA 4BZYA 1E4LA 3H23A 3L8KA 1THFD 2NWRA 2DUAA 5G5GB 1YNYA 1LWIA 2FHCA 4C6EA 4RXGA 3UY7A 3EOSA 4GD0A 1MEIA 1P48A 1LORA 1WOAA 3NCOA 5AC8A 4R3UA 1RQEA 1XUUA 2R8WA 3THDA 3RNMA 2OOGA 4MFDA 2ACUA 4D8ZA 1GKPA 3LZ5A 1DORA 4Z2GA 4QM1A 3BE7A 1W1B1 3QYSA 3NYDA 3O3RA 4DJFC 2TYSA 3CWOX 1OBAA 4O1DA 3T0TA 1ZSXA 5CZTA 1I2QA 1EJSC 4HBKA 1JNEA 2NX9A 4DNAA 1DWHM 2OMAA 1EJTC 2CETA 1KNWA 4L64A 3QBUA 1DHKA 3PB0A 4I9MA 3LPGA 3VIGA 1WCGA 3NS1B 1YNPA 3HM7A 3K4DA 4UCGA 2RABA 3GHRA 2WC3A 2P0IA 1GRFA 3G1YA 3UR8A 3SR6B 5DY2A 3WF3A 3GY1A 4IISA 3AJ7A 1ZUAX 4GBUA 3CT2A 1WPCA 4ATLA 3ARUA 1E1CA 4DZ5A 4I7UA 1V08A 1T40A 1RAKA 5CJ5A 3AMGA 3CLMA 2W3ZA 4E3TA 3DXIA 2QUNA 5JH2A 4AG0A 5FL0A 3IIXA 4WLCA 4EQSA 1KV8A 3BAJA 1R8LA 2F6XA 4WOZA 1GVEA 3SCSA 2J7FA 3CUGA 1R9ZA 2J62A 3EX3A 4Z1AA 2GYIA 1G7VA 1JVNA 1YE6A 4WZHA 4KCWA 1H7PA 1BTCA 3MPGA 1K02A 3G1HA 3PJTA 3VC5A 3LI1A 3QY6A 2D2JA 2JIEA 3UF9A 3GIYA 4R7JA 2F84A 4YTUA 3T4CA 3KOZA 3HPXA 2ZZ2A 2V2DA 2V3DA 2VFIA 4S39A 5CGQA 1NF7A 3WY1A 1E9YB 4LVFA 3B9JB 1XSJA 2JBMA 2QKFA 4NJHA 1SZGA 4TUFA 2J9ZA 4OUEA 3W25A 1UA3A 2YDRA 2EXOA 3C3UA 4AZ6A 4P8WA 4TTUA 4JTAA 4UR7A 5CH9A 1GVYA 4O1CA 1L8PA 3WLNA 1FFRA 1KXQA 3PG8A 1FWWA 5I3DA 1PCWA 4LS2A 1GG1A 1XLAA 3CC1A 1DYSA 1H7WA 1FVPA 1XH0A 2EG7A 4S3KA 4C1NA 1QTWA 3OBKA 5IRPA 2V30A 4GYJA 3PTQA 2ZRZA 5HUPA 2WPEA 4TO8A 5AVNA 3PBMA 3N13A 2OKTA 4N9DA 2BODX 4OU1A 5CSYA 2HPIA 4UOZA 1ZAHA 1K70A 3ZVIA 4C6FA 1HIZA 1UUQA 4IOTA 3UXKA 1P1XA 4PUKA 4HHPA 3VNYA 4Y7EA 1ME8A 3PS7A 4QFUA 2VHLA 3AXHA 1OCBA 3GR8A 1NFGA 2CZDA 5C70A 1S5NA 1V7AA 3R4IA 3F4WA 3MCNA 4GOAA 1P6WA 4CVWA 4ZCWA 4BKNA 1CI1A 1RV8A 2V3EA 3W1PA 1W3HA 3BJSA 4GABA 1MRAA 3KCJA 3TYUA 1MYRA 1B2YA 4M6VA 1TPEA 2ODOA 4B90A 4C90A 1XUZA 3VKDA 4E6MA 2H6RA 2YDSA 3LRMA 1CDGA 3G22A 1NAL1 3GM8A 1UZ1A 1XLBA 3LX9A 1KW1A 3UEQA 3KCOA 1OCNA 1O5RA 1ZXIC 1OK4A 1PIGA 3SCTA 2J27A 4DYJA 3C2YA 2HWGA 2OODA 3SY8A 4Z1CA 2QZRA 3PZNA 4JD4A 3G3MA 2VXNA 3DZ1A 2QVHA 2OYKA 3GTIA 5CZ0A 1KLZA 2NPXA 1B31A 1FCBA 4AWTA 3BW4A 4PB4A 5D05A 2WP6A 2VUNA 3UPBA 3RIKA 3G1XA 2VT0A 3W1RA 2CLHA 3VNJA 4K8EA 1GYNA 4DNMA 3M44A 3PBVA 1JCTA 3G6MA 3G6LA 1PE1A 1RBOB 5EMYA 4M6PA 3WLIA 1JPDX 4MNLA 3WLPA 2O9RA 1F2JA 4JTCA 4BF7A 1SPQA 3QSTA 1PB0A 2V3BA 4TXEA 1QI0A 3G0UA 9CGTA 1V03A 4CNOA 4XBSA 4CQ8A 5E0FA 1OX6A 3MI6A 4UFKA 2CITA 2IMRA 2OEKA 4A29A 3HB9A 1V3JA 3NIYA 4O12A 2YL6A 3WQWA 3STCA 4XAGA 1JFHA 1UA7A 2PLKA 1VPQA 3GKAA 3R43A 4DY1A 1R3RA 4CD4A 4IP4A 1E4NA 2QPUA 4S38A 1ITCA 1PZ1A 2I5GA 4I7WA 2FH6A 3NTYA 3P62A 2ZZBA 2BY2A 5KZEA 3F5KA 5EMJA 4ZB0A 2X16A 3TR2A 1FWJC 1KFEA 1OHLA 3IJ9A 1Q1WA 3W2KA 2XH0A 1ZFJA 1FOBA 1EA9C 3FVDA 3P5ZA 1ZALA 2EBNA 2ZX8A 1WXYA 3ISIX 4IMCA 3W2JA 1FWAC 4KEVA 3BL3A 2TODA 2VZSA 3EOUA 2D0FA 3C8FA 1FHUA 1EXBA 4DZHA 5D38A 1UIPA 5IDIA 1NTHA 3LEPA 4MOZA 4W87A 1PJ9A 1IGSA 5HJLA 1LRQA 3UETA 1PZ0A 3PG9A 5EMUA 4IGMA 2Z29A 1J96A 4Q8UA 2ZZ4A 4GH3A 1CPUA 4R9XA 2ASHA 3WUBA 5I6SA 1R3WA 4C5ZA 3L2MA 3G1FA 4QDPA 3L4UA 1H0IA 3W01A 2JFEX 4JIEA 1O66A 3VCNA 4FHAA 2VYOA 4P7NA 2NQZA 4GO8A 1A49A 1GRAA 5CSUA 1E1EA 2YOCA 3BLPX 1WUFA 3HN3A 3FW6A 4IP5A 3MBDA 3T81A 4NZ4A 4XAZA 2BXYA 3NPUA 3PBWA 4RUBA 3GVQA 3QOMA 3HPFA 4H6KA 4DAFA 4G8TA 3CUJA 4JY9A 1DIOA 1XH2A 3WK2A 2DT2A 3WD0A 1L8NA 5D8ZA 1ZNNA 4GJJA 1TJ1A 5G2HA 1Y5XA 3OLDA 1EYWA 4AWUA 1X1NA 2YFOA 3LLFA 3CIXA 1TPB1 2REQA 2ABAA 3QY8A 1EJUC 2QEZA 3TNOA 3JUGA 2H9AB 4APNA 2VEMA 3A22A 2WJZA 3NOEA 3T2OA 2XYLA 4H9YA 4EMJA 3IEBA 3BUVA 2R82A 2Z1XA 3EWXA 3OOQA 1EJVC 1PCKA 1W1ZA 2X7WA 4XVEA 4E8GA 3GW0A 3MDUA 1M3UA 2H8XA 3D9XA 4OBTA 2FTPA 3AU2A 1NOUA 2VX5A 4P8VA 1TUFA 4OGZA 5GNZA 3PJUA 3CV1A 5GQBA 3TSMA 3WQ5A 3ABRA 1DQUA 3T8LA 1N8IA 4GVIA 1O94A 2XH2A 1K7FA 4XBKA 1X98A 3NQ6A 4BK9A 2GJPA 4G7FA 2D24A 3RPDA 1TMHA 4PMNA 1MUWA 2VD8A 5AYBA 4H8HA 3TFCA 3W73A 2R1PA 2QCGA 3SUVA 2C13A 3U7VA 4A21A 4YJ5A 3M0IA 3VIMA 3MJYA 1JYVA 1SJBA 4QHRA 3HTWA 1A0DA 4UZUA 4AU0A 3TYCA 4A22A 3ALGA 1XJBA 3UD6A 1Q85A 2AAAA 3N2TA 5GRTA 1UWSA 2DDXA 1J4EA 1GVRA 4H4ZA 1LUCA 1SGJA 1UIOA 4O0QA 5CZSA 3FNDA 2HE5A 3UBPC 3M1ZA 3TAOA 4J5NA 4HU4A 4JFVA 5DT7A 3WL0A 4PCSA 5EMMA 4L61A 2C0HA 3ABQA 1BKSA 2FZ9A 4LVGA 1GNXA 4OE7A 1QR7A 5F1VA 5A6AA 1GVSA 3L4XA 3MMDA 4AZCA 2A3BA 3LCXA 3P74A 2AMXA 3POCA 3VIKA 1Y0EA 3FYOA 1ZDLA 3GDTA 5G4WA 5EBAA 4OJYA 2WQPA 4N4QA 2ZTKA 1TV3A 4H9VA 4MJ4A 4ZO6A 3RILA 3S83A 1V6TA 3WNKA 3W1QA 3TTOA 3H2NA 1EXPA 4FZIA 5C54A 3POHA 4POCA 1KFLA 4UBPC 1FH8A 1STZA 5GNYA 4RR4A 1U30A 2Y8VA 1QNVA 1ICQA 1KM0A 2O4QA 2GQWA 8RUCA 3LHWA 1OY0A 4D6CA 3VZXA 5HOSA 1R86A 3UWVA 4GRSA 1OWQA 5DEZA 3QFAA 5CEWA 3ABOA 4ZTYA 4PCNA 1FCQA 4R5EA 4A8RA 1REQB 2OFJA 1H62A 1FP9A 1S38A 2X05A 3VDHA 4HOZA 3KL0A 4BI7A 4HNNA 4DQWA 4P5UA 3VZZA 1JQXA 1UR1A 1W2VA 1XISA 1TJ2A 4O10A 4Q6JA 4L1XA 2OSWA 5E5CA 3LBCA 5M5DA 1I0DA 3ARRA 2OO0A 3KOFA 2XSBA 3ZOAA 1DBTA 1ZX9A 3GU1A 3IANA 3NM3A 4QR6A 1S1PA 3MHUA 4URIA 1VS1A 2C0AA 4O13A 4C6CA 1R9XA 3MYOA 3EDJA 4PTWA 1FWFC 2G0WA 4W88A 1S2CA 1Z44A 4NT0A 3SFKA 3H7RA 7ODCA 1XYBA 4ZSTA 3L4WA 1LG2A 4I6KA 4W93A 1JCXA 3PPFA 2Z26A 4H9MA 1P7TA 2Y4SA 3W6LA 4ICCX 4WR3A 5IDZA 1R30A 1A4MA 4HHHA 1E9ZB 1YQZA 3H4KA 3OC4A 4LANA 4BQ2A 2IXVA 1AQFA 1SO6A 4MWAA 3EXRA 2E7FA 4N6EA 3GTHA 1N82A 4JKLA 3WH7A 3CHEA 3A3XA 3M43A 4PUWA 5EU9A 3CZGA 3VVGA 3FDKA 2NLYA 3SQPA 3UWWA 2Z6IA 4WY0F 1JPKA 3W71A 1R6WA 3M0ZA 2JIWA 3C3NA 1TG7A 2OO6A 1UKSA 3DKLA 3WLHA 3V3WA 4KW2A 1JXJA 3MCMA 2GVLA 4ALDA 1IEXA 4IIHA 4DB7A 4GVHA 4UOJA 3RCNA 3NL2A 3EDEA 3PUEA 1ZK7A 1GK8A 4US5D 1SMAA 3GYCA 1KB3A 4TMBA 3WENA 3LSBA 3P61A 4YNGA 1F7BA 4Y9PA 1XGEA 2X0YA 3G1AA 3W1TA 1FEBA 1AD1A 3UA4A 3AC0A 2Z2BA 1H1YA 1KBLA 1MZHA 4R53A 2F61A 5AHEA 2HBVA 2OTDA 2OQYA 1MDRA 1TJPA 4HJWA 1OM0A 3OZMA 3RU6A 3WDRA 3NL5A 1Q4NX 2J4GA 4F0MA 4QG9A 3N29A 3NVVB 1PX8A 1Z32X 3GH7A 2VCAA 4S3BA 3FAXA 4AD5A 4PMVA 1GJUA 1XI3A 3E12A 5DMLA 2NUXA 1TA3B 3MKKA 5EBUA 1IT8A 4ZOCA 4Z0JA 2X7VA 4L9ZA 4EOUA 3OZPA 4XD3A 1RCOB 3E2VA 4EXAA 3OG3A 3GG8A 1UCWA 2R14A 4FALA 2UWFA 2WB5A 4W4QA 4AB4A 3KLLA 1WDQA 3CO8A 1EKOA 2BC0A 4XVDA 1LCOA 4GRTA 3BO9A 1KM1A 3M46A 4ZQNA 2VURA 3VNIA 1QMLA 4I90A 4UTIA 1M5WA 4KMQA 2XFRA 5EPDA 1V0NA 4PL2A 4QG6A 3AXIA 4ADWA 2A0NA 2YBUA 2PWVA 1AUSL 4IUGA 2DQXA 2Q8XA 4LBSA 3IVSA 3G8RA 2ZFAA 3I4KA 4LY8A 1LOSA 3PUGA 3QKEA 4LAZA 1WA3A 1GRBA 3HFTA 5BYWA 3G1VA 3SRKA 1UD5A 4RKAA 1NWSA 1SO5A 1VDVA 4W5ZA 3GRSA 2J8FA 4QQ3A 1W3JA 4HYWA 5K9CA 4F0RA 1EEPA 3VO0A 4D6FA 1WYIA 3TN5A 5C71A 1OG6A 1XIGA 3OLGA 4J2PA 2XWDA 3GNNA 3S5YA 3TW6A 4H4PA 4MAVA 1TMQA 4HCHA 2WM1A 1SR0A 3KL3A 1XC4A 3M5YA 1NM9A 3QZAA 4JQ4A 3WQOA 2BSLA 1C7SA 1W9BM 3WF4A 3M0VA 4J3VA 1MXSA 3Q6JA 2J75A 3ARQA 4JGDA 4P8XA 3CAVA 2Y88A 1QCWA 2IQTA 3I3EA 3FV9A 4ZA0A 4GI9A 4ATDA 3WJZA 1D7FA 1Z42A 2QAPA 5AHFA 2G3NA 4CVUA 4DO5A 3VC6A 1AG1O 3VE7A 1DE6A 3NNTA 5FMHA 2YSWA 1YDOA 2A1YA 1NDZA 2VGBA 4R7WA 4K7YA 1QWKA 1GQJA 1O7AA 1VBGA 1BWCA 1PZ2A 2INFA 4LV4A 3DYOA 2YBVA 3G3DA 4LAUA 2PTXA 3IGXA 3ATYA 1RHCA 1DWJM 1E73M 3NSMA 1UR2A 4P7OA 4F9DA 1OF8A 3GLCA 5F2MA 4KWVA 4MUZA 3II1A 3UWEA 5EL1A 3LXCA 1FWIC 3DOPA 1BXNA 4UB9A 4HU8A 4OTKA 3N14A 4GIRA 4GUJA 1ITQA 4IGSA 4J3ZA 1OCQA 3P8IA 4LV9A 1WXZA 3V36A 3AS1A 2Q09A 3NZ1A 2G5WA 3W7GA 3NZQA 1IWPA 3BSGA 4ZO8A 2W92A 2VP8A 4ZR8A 2NWSA 3S6OA 5I79A 1DJWA 1VCVA 2QJGA 2IW0A 2C3CA 4O17A 1OIMA 3Q58A 4WJXA 1KGXA 3OIXA 1YTKA 5AC7A 4F0HA 1SU5A 3UP8A 2QJNA 4G9PA 1Q8AA 4XBJA 3UT0A 2WOQA 4Q6XA 3GWQA 4UTWA 4R27A 3LZ3A 4QS6A 3V75A 5A6MA 1J6OA 4HPHA 4UNIA 3LV6A 3PR2A 4Q33A 4A3RA 2FB2A 3HGRA 3TC3A 2CHRA 3DGZA 1G67A 2JE8A 3EAOA 1US0A 1JGMA 3TP4A 2QAEA 1YBQB 2YCLB 4LF1A 3G0XA 4AHPA 3MI2A 2B4GA 3GDRA 1VLIA 1BD0A 4NZ5A 3GX9A 1ITUA 4HNUA 1VGAA 2PRHA 2QIIA 3CASA 3P6LA 2V5JA 6REQB 3UYCA 3L0GA 4YU1A 3TSBA 2WWDA 3AHTA 1I9CB 1SZRA 4AIUA 1K9TA 1XINA 2E1WA 3OYXA 3GKFA 4C1LA 1M7JA 3PJXA 1OX4A 4GYKA 4M19A 2CESA 4RZBA 3QMSA 4H9ZA 3T40A 4U33A 1ONFA 3E2QA 3MZ2A 3IIPA 1QW7A 3N25A 1JR1A 3VIFA 3SO7A 3AIVA 3M47A 4GR1A 2ZXBA 2GR0A 1UWTA 5JQ9A 4PBGA 2HXUA 3B40A 3FIGA 1RK6A 1TREA 1P0KA 1W3LA 2R1LA 4K38A 5FD0A 2PURA 2BGSA 2XZ7A 3WUFA 3GFZA 5DMNA 1G01A 3CV7A 1Q6FA 4PMXA 3A4WA 3TTEA 1IF2A 4NJIA 1W9XA 4JQ2A 5CPNA 1Q6LA 1L2UA 1V0MA 2FJKA 1NEYA 2X1RA 4HZ8A 2PDQA 3AU6A 3CQIA 4EANA 1A80A 3VNKA 4QLJA 3W02A 4FIQA 5LNWA 3ECQA 3I4EA 4X60A 5AOUA 1H6VA 2Z1BA 3AS3A 1K3UA 2WMGA 4NAEA 4D6IA 1J5TA 1OIFA 2QVNA 1C3FA 1FHDA 3KL5A 1SW0A 3BV7A 3AUOA 8XIMA 2BG5A 3PWIA 4N9EA 4NILA 1OGGA 4OVXA 3EOEA 5HPCA 5CC3A 3WNLA 2O7SA 3NL6A 4C6MA 1KV5A 1RA5A 1D7KA 5A6BA 3W7CA 3ARSA 3MSGA 3AIBA 3DG3A 4M3PA 3BARA 3R8GA 3QVQA 1SW3A 2HK0A 2PDHA 4F79A 3LPOA 2Z28A 5ABHA 5BW6A 4JBRA 1LF1A 1EL3A 5LHEA 1BSLA 1RK5A 3GG1A 1R2TA 3TYDA 4Q8VA 1LTDA 3H2EA 4GGBA 2ZX6A 4FI4A 4QX4A 4A8IA 4IQLA 3U0HA 3QKZA 4AAJA 3WK3A 1DKWA 1E1CB 3HG2A 3KVKA 2ZZ5A 2HVOA 1YQ2A 3S1WA 2OB3A 3V1HA 4ERAA 3B8UA 1ONXA 6CGTA 1F6KA 4W9TA 1U22A 1W3IA 1J18A 1VHCA 3QV8A 1RALA 4ML9A 5LNVA 2J7BA 2YCIX 1OC6A 1BWKA 1NSJA 2BVDA 3O05A 4EWJA 2A7NA 4O28A 3W75A 1G0CA 4ZQPA 4BWLA 2WJDA 2YJQA 3GC5A 2ACSA 1D2KA 4U10A 3WLOA 3PZGA 1XANA 1H5VA 2XISA 4V15A 2CDUA 4JDRA 3R58A 1TVPA 1MOKA 3EDDA 4I5XA 4HB7A 2WHKA 1UOZA 3CEPA 3BLOA 1GOIA 4HNCA 4E2BA 4L7ZA 2BWGA 2XFYA 4IPPA 4A8NA 2IPGA 2ZRWA 1F4HA 1X38A 4Q8WA 1XQLA 1J6PA 2DFAA 3EEZA 2ZIDA 4CQAA 4X0NA 1WE5A 4ZEPA 2NLIA 2O0TA 4N4PA 4HT3A 2ZZ1A 5DMMA 4U2ZA 4K7ZA 3TONA 1XLGA 2A4AA 1KXVA 4WOQA 1GKRA 2YGYA 1R2RA 4GFIA 4C1NB 3N2CA 3ANUA 3OIHA 3GNXA 3A3HA 2QCLA 3UG4A 5IBXC 5HAOA 2BC1A 4B5WA 3N34A 5AYZA 4HZ6A 3DFYA 5U4NA 1RPKA 3TYAA 4PSRA 2QIWA 5IOBA 3NPXA 1P43A 4RE4A 2CLLA 3CHCA 3ZZ1A 4H50A 5J04A 4NUWA 3U4FA 2W0HA 5FEZA 4IHCA 1ZHAA 3SY5A 3K5XA 4LAKA 3TYEA 1OT1A 1XYFA 3A3WA 1WZAA 4CNSA 1EQPA 2PWEA 1N5XA 1SW7A 3IS4A 2AAQA 3NQ8A 4M29A 4Q8PA 1G69A 1JF6A 3BVJA 2QT3A 1EP1A 3E0WA 4JHOA 3ZS4A 1R3VA 3UWZA 2R94A 1KO0A 3VPLA 4OFCA 1QPKA 1PTDA 2Y1HA 3CK5A 1ZP3A 3DHDA 1KFWA 4I9AA 4LS1A 4ZQRA 4ADTA 3BAIA 1XRTA 3GDMA 4NAFA 1KGWA 4H4UA 3VFCA 5F2GA 5EKYA 1R2SA 3WH6A 3F2DA 1UUMA 4D6DA 2BHYA 5I23A 4UUIA 2NQJA 4QLKA 1BG4A 1JZ8A 2NQ9A 4EWND 4JTJA 2V69A 4X9YA 4ZQMA 4NZJA 3CAKA 2H3BA 2WANA 4OBRA 4O1FA 2WSYA 1L6YA 1M65A 1OFAA 2PGWA 4UFHA 5E0KA 2ZYFA 3U5UA 4GY7A 1XLDA 3S9IA 1F3EA 4Q4KA 2KX9A 3IAPA 2DSWA 4RDVA 1DV7A 4JIRA 3NR0A 4CU6A 2GGEA 4KIRA 1TYPA 1K8YA 3NPWA 1O6IA 1UOKA 2XINA 2OLSA 1U5HA 3T42A 4ACYA 2P0OA 2TMDA 3QLLA 2XGZA 9RUBA 1N8WA 1V8EA 2PPGA 1O60A 3WF2A 5K9DA 2P3EA 3N6HA 5J5RA 1XV8A 1W5QA 4CLMA 3L23A 3LG3A 2YIHA 3RR1A 1UR4A 1UR8A 3K8LA 3ITCA 5XIMA 4X63A 4UTTC 3E49A 1S5TA 4H2CA 3BLEA 3NQ2A 1J79A 3I7RA 4AEFA 4CD6A 3T9PA 3LERA 2ANUA 3P67A 3TIMA 1GSNA 2EQ6A 4U5IA 4S3AA 4PCFA 1IEQA 4Q8TA 4D6JA 4QG8A 2QJHA 4Y8FA 4LTSA 1E9LA 3EMZA 4OBSA 1HKMA 3RRXA 5FS9A 2YCKX 5BMWA 3UZZA 4H04A 3VDBA 4BI5A 1JD9A 1X8FA 3S5OA 4DXXA 1YX1A 1ADDA 3KLKA 1MQQA 1XIDA 2XTKA 5MF5A 3UZ5A 4IG2A 3CMGA 3KTCA 3PPCA 4GMEA 2A7RA 4YWSA 3WL1A 1XLEA 3WBWA 4O50A 1XG4A 4D71A 2FPVA 4KCVA 3LCIA 3T1GA 4NI3A 2C91A 3LNMA 3CH9A 3S5ZA 2OGYA 1SB3B 4GQBA 1KBIA 1E51A 3DBPA 2Q01A 4KWWA 2FYMA 1NDWA 3SQMA 1YKWA 4C5YA 3GUGA 2YXXA 3QPYA 4LCRA 1PEZA 5HXMA 3RM8A 3THQA 2JKAA 2WOWA 3ID7A 1J0IA 4B3KA 4O14A 4IL0A 3GB6A 1B1YA 1NARA 1SFTA 3F5JA 4MNJA 3E6EA 3KFTA 1PS9A 2C1HA 2E5BA 3ZJ6A 1UP3A 2REQB 2Q6ZA 4FNTA 3LCLA 5BXPA 3FFSA 1NQKA 3JW7A 3W29A 3LYEA 2Y70A 2E8ZA 3LCFA 1EZ2A 4OIFA 2ISSA 3O15A 1ZCCA 2EPNA 2VL4A 4UQBA 1I4NA 4K68A 1XYZA 2X42A 4XSLA 3S2NA 3IK4A 1B3ZA 2HPMA 4PRTA 1YXYA 1HX0A 5C9UA 3USZA 1X97A 1E5NA 4PULA 4LUSB 4EXQA 2E9BA 4JL2A 4XUYA 3SN1A 3QHMA 2BV9A 3PY2A 4KT2A 4FXJA 4GZJA 3DHUA 2HBXA 2V5KA 2DZAA 1GKQA 4J4KA 3APGA 3IWPA 3V18A 1LVLA 2DW7A 1LQ2A 3KZSA 4GIEA 5HINA 3THUA 1LG1A 4XD4A 3AI0A 3W1UA 3AO0A 1U1JA 5CPSA 1MQRA 5GJNA 5FF0A 2E9LA 3WFAA 2QS8A 3R25A 4RE3A 2PBGA 4NZCA 2B0MA 1X1ZA 5IHRA 1HJUA 3FJLA 3V35A 4DRSA 2D0GA 1N5WC 4PB3A 3BPWA 1YPXA 4IL2A 4CEXC 3O6AA 1NFPA 4Q4PA 4ECLA 2CHNA 3ITGA 4TX9A 1XLJA 3HG4A 1PXGA 4PRRA 3KTSA 3RYSA 1G94A 4WJ8A 5G4EA 1LQAA 3CL7A 1TPUA 3TYBA 3GNRA 1A50A 5ER0A 1D3CA 1LUCB 1XD1A 1CNVA 1K03A 4US6A 1FY6A 1V7YA 2RGLA 3CWNA 3EANA 1HNYA 1N55A 3S8HA 1ML1A 3TROA 2I57A 2DW6A 4H2HA 4JQ9A 3HGSA 3CTTA 3NA8A 1XCXA 1OZMA 4GKLA 3KUMA 1FWTA 3KRUA 3SRHA 4M24A 3EPNA 2XJ7A 3TSDA 4Z1YA 2Q02A 3AWNA 4UTUA 1H1NA 5G1MA 1D9EA 2GGGA 4UWMA 3CPRA 1B57A 2QJIA 4RNFA 4F3HA 1BWLA 1C8XA 3T2QA 2ZICA 1UROA 2WZIA 3CXOA 3H24A 4EM3A 4S3GA 5CPMA 2AOSA 3EWZA 4QNEA 1J0KA 2BB0A 2X1SA 4EAMA 4HKPA 4OV4A 1ODUA 1X2GA 1FQ0A 1Q66A 4TV6A 1LRNA 2Y62A 1HL9A 2XGBA 4AIEA 3GDKA 3FN9A 4KESA 3LADA 1YHTA 2NZLA 3MWCA 4FP1A 2PAJA 3LM7A 1SM9A 1XFBA 3EMCA 1C93A 4L6OA 5CBBA 4CN4A 3S9YA 3RO8A 1BG9A 1XLLA 3VUSA 4GZIA 2I1OA 5GJMA 3TQKA 3HQPA 1P0EA 2F2HA 3CMJA 3DC8A 4NASA 1AL7A 4H9XA 2IKHA 2OZTA 2FPTA 3GC2A 3TE9A 1AH3A 5MKGA 3WJSA 2VDGA 3BG5A 4M7SA 4U2YA 3ZLFA 2F9RA 4B4FA 7PTDA 5FKYA 5HQLA 1R85A 4PC8A 2GQ8A 1TWWA 1AJ2A 1TPC1 2DORA 3TA9A 4HZ7A 2C15A 2NQLA 3MBFA 5FA5A 1FH9A 1QWGA 3DHFA 2WQDA 4ADSA 4G1NA 2TSYA 1WBJA 3M0MA 1JQVA 4DYKA 3UJRA 3NO3A 4B9ZA 2YLAA 2EG6A 4GC3A 4ZENA 3LRKA 1DWGM 1P4CA 2XH4A 3BOXA 4F40A 1UMYA 4PUNA 3T09A 1WP6A 3SW6A 4FLQA 3G77A 3NO1A 4IQDA 3K4WA 2CZ5A 1L6WA 3PPHA 1MO0A 3CGDA 2OXNA 1EP2A 3KCLA 4CN6A 3WLRA 1VYPX 1FCVA 4W7UA 5B7YA 2OWXA 1T96A 4X9SA 1P7TB 4LX4A 3TQVA 3L12A 4O52A 5I5RA 5T9CE 3E96A 3CQKA 4LCSA 3FK4A 3ZLGA 4WCJA 4DXVA 2PDUA 3SBFA 2BVWA 1HFBA 4MWAB 3AHVA 3S47A 3VX0A 1LLWA 1JDAA 3L5AA 3UZWA 4M5PA 4KH2A 3KS6A 2BFGA 3IV3A 3BSMA 3VGEA 1H61A 3NDOA 1KLYA 4GQGA 2DSUA 5CG0A 4AD2A 2PD5A 2YDAA 2NVDA 4H4TA 3PPGA 1CWYA 4WDWA 3RLGA 3QW4B 4AEEA 3IUIA 3M5VA 1X2HA 1VD6A 1KRBC 2GDVA 3MSYA 4MKVA 4CD5A 1J0HA 3N2OA 1RXOB 1IEVA 5BCAA 5A69A 2CBIA 3AIQA 1T8QA 2IKIA 2Q8ZA 2HSAA 3ONBA 4LPCA 2X09A 3B06A 3VXGA 1TELA 3SADA 1WDPA 2Y63A 4X22A 1QHOA 3INPA 2AAMA 1DJHA 4M0XA 1QNRA 1K77A 2HZGA 3HW2A 1CXIA 3VGDA 4QXIA 2ESCA 1DL3A 1KRMA 1E6NA 3R12A 2NV2A 5U25A 1H09A 4S1FA 3RPMA 5E1QA 3FAWA 1SO3A 4IM4A 1G5AA 5AYIA 5FF2A 4XB3A 1J2WA 3UXLA 1VPYA 4WF7A 1UWRA 1E4MM 5J8LA 2VELA 4JTRA 1HO4A 3B0VC 1TSIA 3EMQA 3UXIA 3TOYA 3EAUA 1RD5A 3LS9A 3N4FA 4DBDA 3NQCA 1YXDA 3W4RA 4ZOHB 3URQA 3S5NA 1W1A1 4JNMA 1ME7A 1WZKA 4FIRA 1JRPA 4XZNX 2XVKA 4XZLX 4RW3A 3U7BA 3T0CA 3WUGA 3SCWA 3TKFA 1S3HA 3RLHA 4NF7A 3T44A 4WD0A 4V28A 3XISA 4JIHA 1VBHA 3GH4A 4O19A 4EQXA 2DQWA 1P0NA 3W7DA 3BC9A 2QF8A 1W8GA 5DCBA 3WD2A 3B0PA 1ZKQA 4JR5A 2PODA 4JTTA 3NJ3A 4WSKA 4IJBA 3D5HA 1P1MA 5DBUA 3BQ5A 4UC5A 4GPNA 1L2QA 3NGFA 4Q4SA 2ZQ0A 4YTTA 8XIAA 3T05A 5A6BD 2QUMA 4B4HA 3ZSSA 3TNBA 2X40A 1EUAA 3R1ZA 1LQ0A 1KC7A 1A5NC 4Q8MA 3CZLA 2E77A 2BBFA 3ITOA 5FJPA 3PTKA 2J74A 3G8EA 4LOCA 2WSRA 1XLMA 3SY1A 1PTGA 2W27A 3C61A 1NWTA 2BOGX 5HBFA 4XAPA 2FHBA 3RXZA 1JDDA 3L2IA 4O0KA 1XCFA 4NYUA 4H9UA 5LYRA 4EAYA 4RZ6A 1UBPC 4YVVA 2E4TA 3B8TA 3P80A 1FDYA 1K8XA 2QJMA 3WBEA 5BOEA 3CNYA 3TFXA 1PX4A 1I1XA 3TCEA 3PJWA 1C8QA 3VU2A 1R7OA 5I3JA 3DBNA 2D2OA 4KBXA 4YWOA 4CU8A 1QO2A 1EJXC 1VYRA 4MVAA 1DXEA 1F3PA 2A3LA 2BXVA 3UESA 1V79A 3MHGA 3WBYA 3JU2A 2GWGA 3MANA 1VFFA 1FEAA 3OBEA 4EXBA 1JPHA 3WH8A 1DEDA 2NVKX 4GE8A 2YX0A 5M3WA 3LRLA 4HNOA 2VFEA 3NZPA 4A2SA 3OA3A 2J79A 3NDYA 3G1DA 1NDAA 3FCPA 2V5DA 3ZR6A 3PP7A 3EGJA 5HWJA 4UXDA 1SUXA 2E8YA 1W37A 2F38A 1UP0A 1KWGA 2WCSA 1AQMA 1WDSA 1AZ2A 1TX0A 3RF9A 4LCQA 4R85A 3I6TA 1HG3A 1W3KA 3C5QA 1DJNA 2QQ6A 4HNLA 2ISFA 1V02A 3GHSA 3W72A 4HCDA 1X39A 3VMNA 4E2DA 1G4PA 3V0UA 4Y9OA 2QNEA 4GYPA 1QU4A 3WEZA 4JDYA 3E9AA 1FP8A 3EKGA 3QHOA 2VC9A 4B5SA 4H7ZA 1WV2A 5E9XA 1DQXA 2WC4A 4XD6A 3N18A 5I0DA 3NOYA 2V5LA 4EE9A 3RDKA 4UMCA 4K8HA 4QJ4B 1XLKA 3G1RA 1KM3A 2O7QA 3CYVA 4H7VA 3LB8A 1XX1A 2XZ9A 4HMEA 4CUCA 1Q6CA 4LC8A 2E5CA 1RD6A 3LHVA 4K8DA 5C5YA 1TX2A 2VC5A 4L5ZA 4DJDC 3AJXA 2WM0A 4MKNA 4ZFMA 4UMAA 2V82A 2WVVA 2ZUTA 4EP8C 3VOIA 2QULA 4N0RA 1E0VA 2YKKA 3WLJA 1HW6A 3W7IA 3H22A 4LAOA 4AQLA 4LUYA 3W7LA 4N02A 4FNRA 3AZRA 4IPNB 4AIBA 3ERPA 2QUTA 2GDQA 3P2VA 3EWYA 3E02A 7XIMA 1F5ZA 3MDWA 1B3OA 3NFUA 4W8BA 5DFAA 4DWSC 3DFPA 2DVUA 1J12A 2XIQA 4EPEC 4F0SA 5C0QA 3L2LA 3HPZA 4CN1A 1OX4B 3U3HA 3HV9A 1VP5A 1Q1RA 1DJGA 1JZ7A 1U83A 4NJJA 3MSRA 2EPHA 4WY0A 3R07C 3UYIA 5D9NA 1KFBA 2OWWA 1XP3A 3LQGA 1KXTA 4NNBA 3ITLA 3DK9A 2WAGA 2EAWA 4P8UA 4PUJA 1N63C 3ONCA 2OT0A 1G7UA 5DY3A 3SQSA 3TA6A 1A5KC 2W63A 3T8QA 1ADOA 4IX0A 4TQTA 5TBOA 5D37A 5F1UA 4B5XA 2CXGA 3F5LA 3P14A 2GUUA 4YVPA 3ME3A 5FF3A 1IIHA 2ZZ3A 2XH7A 4W89A 3KOWA 1GZ1A 5A3HA 4JOMA 3QC3A 1B30A 3E0IA 4TVUA 3CO4A 1TYGA 3RFAA 1TJRA 3IK2A 1KM5A 1VFMA 1K8ZA 4GUFA 4OHQA 1TYTA 4NAEB 2D3NA 4W85A 2HISA 3W1LA 4PRWA 3M07A 3WK0A 2VM8A 3GTFA 4PUDA 5DT5A 3W22A 1M41A 1OFQA 2PP1A 1G6CA 1SQ7A 4IQEA 1GRTA 3W6YA 5KMYA 1OFRA 2A3AA 1VC4A 4G2DA 1SJCA 3Q37A 2IKJA 4LRTA 3A21A 4DZAA 3WZ0E 3TQPA 4MNMA 3LPPA 2QCEA 3LD5A 3WDPP 4W5UA 3SN0A 4BURA 1GJWA 3TTYA 4JTIA 4AVNA 3O6DA 4DIAA 4ZB2A 3WJWA 3L66A 2FZMA 5BOOA 5A8PA 1JCMP 5I3FA 2WYSA 3NM1A 1CT5A 3MP4A 2V5BA 2WVSA 4D1IA 3F2CA 1J0JA 4P7QA 3GFXA 2POTA 1GOMA 4XD5A 3MYPA 1TV8A 4FPSA 4C7DA 5ABTA 2C1GA 5HWNA 3AS2A 3WQFA 1EP3A 3HG5A 1F3WA 1CXKA 2NT1A 2OT1A 2UY5A 1OT2A 4A3UA 4YYCA 4KF1A 1T5AA 4CEUC 4JFSA 1S46A 5FESA 5HJYA 3IVTA 1EX5A 4WQ6A 5LIWX 4LUTA 4IT1A 1JPMA 5EB8A 3W84A 2FVKA 4YWIA 1K4GA 1T7LA 4AMCA 4WSJA 3UXAA 3MTWA 4GY1A 3BANA 2YZRA 3LI0A 4V1XA 3N04A 5D8WA 3PSWA 1RBAA 3C2EA 3KRSA 2CYGA 2Y7EA 4P7LA 4M6QA 2NQHA 2ZX9A 3KP1A 3L9CA 2ZZ6A 3OP2A 4K1GA 2GJXB 5JIWA 3CV2A 5LA0A 2NW0A 2BMBA 4J56A 3DESA 4UTKA 3W2LA 1JOAA 2NVAA 4E4FA 3TC6A 1MW2A 3E74A 1OYBA 4LNCA 4JFUA 3ABXA 3RCMA 2FGLA 1Y7VA 3C0QA 5AHMA 3DFHA 2FDSA 3BJTA 3KBNA 3W87A 4DJEC 1XFCA 2PU1A 2VRQA 5FJUA 3QM3A 2D2HA 4HZMA 1C91A 1EIBA 3LTPA 1OFBA 3NQDA 2PCQA 2BOFX 3BMWA 4U4MA 3LENA 4JS3A 3MUAA 5A2CA 2XFFA 3GZ3A 4LVDA 5HJXA 2WBKA 3ARTA 4KCTA 2INZA 1MO9A 3ITVA 3MCOA 1PYMA 5BWFA 3CMFA 1RJPA 4BEQA 1VYSX 3ALFA 5LIYX 1UHVA 4KWUA 3TDFA 3EX2A 1Q4WA 2BOEX 3PZOA 1Q6RA 1YYAA 4XKYB 1AZ1A 2GQ3A 2CZEA 4MPKA 2PWDA 1XYMA 2OEMA 3QGKC 1LYXA 3WJXA 2NSXA 3W0KA 3EYPA 1GV4A 1MXGA 3MP5A 2OKOA 2DZSA 1GEUA 4H4YA 3VI2A 4XZIA 1EQCA 3GH5A 1BLIA 1FFUC 1UB3A 4NAFB 5I2UA 3TZFA 3FA5A 3BV4A 2J6VA 3TW9A 5C2GA 3RPTA 4Q7IA 2VDIA 4NRRA 1IV8A 3RX2A 3CU2A 3H2CA 1F8WA 1V6WA 4JTQA 1LBMA 4RNJA 4IICA 1KM6A 1UASA 4TX6A 1E1FA 4HQVA 4GQQA 4H4RA 5AB3A 3QZEA 2ZRVA 3GU9A 1AQHA 2EQDA 3ITXA 5MHBA 4ZO9A 2Z27A 3GR7A 2FGBA 2WSQA 1EB3A 4WKFA 1GERA 4UMBA 4UQAA 4FNPA 2XM1A 5D2WA 1EGVA 5H8UA 2WMHA 3F1QA 2DT1A 3CLWA 4V2XA 1HT6A 2G4FA 1QFEA 4DJFA 6TAAA 1LBFA 3W7HA 4JAWA 1JFXA 2X1IA 2P8CA 5FJTA 2X0SA 3RMEA 2YW4A 1HJVA 2WNWA 3PZVA 3QQ1A 4Y9MA 3N12A 4US5A 4LUIA 1U1HA 1TJ0A 4YCOA 4MB4A 1Q5MA 4MHBA 3M5ZA 3ARYA 3GD4A 3MUZ1 1T8XA 5U7SA 4J40A 1YPFA 3WQPA 1RLCL 3WDIA 3OU8A 5A8MA 1J11A 3VM7A 3L4ZA 4MY1A 3WMBA 3QFBA 4EACA 2F6KA 1ELSA 4GVFA 4QJ5B 3G1SA 2Z1KA 3C2FA 4HNTA 2IUZA 1B0IA 3RCYA 3AHZA 4MZ8A 1A0CA 1XM3A 2VI0A 3ZO9A 1Y8BA 2AKZA 1UZ4A 1EC7A 3VFLA 3NURA 3B9AA 1E6SM 5HMDA 1HZYA 5FIPA 4DO7A 1RVGA 3GXNA 1V3HA 3R0UA 2YYTA 2JF6A 2PGRA 1OGSA 1QJWA 4PA8A 3WBAA 1QHZA 3EOOA 2EPLX 1KM2A 3BK0A 2GVYA 3A64A 1IZJA 5D9OA 1DQWA 4L4MA 3RK8A 3UCQA 2NSOA 3W2UA 3LB0A 4GK8A 5CGMA 4GVGA 5AHLA 2J13A 1E5JA 5TAOA 2PDBA 5G2IA 2W79A 3FSTA 1GZJA 2ZX7A 4M56A 1V6UA 4UNKA 3TN6A 3PNZA 3TMLA 2DUXA 3D47A 1KKRA 1LROA 2OELA 3USBA 3MO4A 3MJMA 3S5SA 4MB5A 3DEQA 2QV4A 3UFYA 4Y96A 2J7GA 1L6GA 2B7QA 5BNKA 2MANA 1FH7A 2UY2A 1EDTA 1TQXA 2RHGA 2NXIA 1PO9A 2I7GA 2HV5A 3EZ4A 3P3BA 2VCCA 4O57A 4AZBA 3UJFA 5AY7A 5XIAA 4YMZA 2DPEA 4K1WA 4C6BA 2DV0A 4LC6A 4RDZA 1RSCA 4WGHA 3NUKA 3ZFHA 1UPMB 2CCRA 3TTQA 1FHVA 1PPIA 5EA9A 3LK6A 2VFFA 2QMKA 4YCPA 1AA1B 4E38A 3GR4A 1R3YA 5HUOA 1X7FA 2ZC8A 3R7MA 3UCCA 4W86A 3FS2A 3MI3A 1VBJA 3VGBA 3WQGA 1P0BA 1TCMA 3TN4A 1XIFA 1EOMA 2I9EA 4O1EA 1MQPA 4M52A 2J9YA 5K7JA 2C6QA 2VR4A 2VD9A 2QCDA 1V0KA 1DP0A 1ZU8A 2ZX5A 1O4UA 5JH1A 1GWJA 1ISXA 1Z48A 1UC4A 4YTSA 4RJEA 3WMSA 2L5HA 3WH5A 1E3ZA 1SVDA 1M7OA 5DXXA 1QW8A 1SFJA 3GXMA 3SRFA 1ZQ5A 3SSJA 4DM2A 2KZHA 3HA1A 6A3HA 1YDNA 1FKWA 3GNDA 5ABFA 1XSKA 2WO5A 3GW3A 4MLRA 4PMJA 1MW3A 3URNA 2DP3A 2HRWA 3TWAA 3KP0A 3CL6A 1FTXA 5JBEA 4Q4OA 1E40A 3UJEA 3VUPA 1CW2A 3CUXA 4HYVA 3B8DA 4QDWA 4GCXA 1QNOA 3STEA 2PDIA 3K46A 5IXEA 3W3OA 5I24A 3LHZA 1IEIA 2Z7KA 3R2GA 4DLFA 3U2ZA 4L9YA 4H6RA 4A3YA 2JQXA 3QTPA 4DELA 2WZEA 4Z0SA 3A7RA 3E5BA 3WQ6A 1V3IA 4U31A 2V5CA 1DJXA 1B90A 2C8NA 2YFNA 2R9ZA 2OSYA 3N9RA 1VFHA 3WG6A 3AYVA 3G2GA 4GIYA 5CPLA 2P3ZA 1LLZA 5K3VA 3AZTA 1NHSA 3HOJA 2JGYA 3HJZA 1IXPA 4YPJA 4Y8EA 2Y8UA 3NRZB 2WPGA 4MNKA 3W53A 3KAOA 2HVMA 3SEPA 5L9FA 5KTLA 4PFHA 3D46A 3O6YX 1SSDA 1ALDA 3SFWA 3WCZA 3I65A 2NXHA 4RXFA 4ML4A 5A8QA 4JDBA 4UR8A 3T07A 3AXKA 4KFOA 4H7CA 3DECA 2CBVA 2VEIA 4F0LA 3W7JA 1F8IA 3KTXA 2XHYA 1MMFA 1GQNA 1AVAA 3OHMB 4QQUA 1QPQA 1XW8A 1TPFA 3WNPA 1X96A 4B16A 1A47A 2E3ZA 3WSUA 3M6YA 1GOOA 1KGUA 1H7XA 1AODA 3CM4A 4DJDD 2DSZA 1E70M 2A6LA 3KEHA 3A7AA 1A3HA 4LAMA 3TLLA 4YIWA 4KRUA 2YPIA 4KWOA 1KRCC 5MKGB 3W76A 4J3SA 2W6RA 1I60A 1KBBA 4LJ3A 4S23A 3W7KA 3MW7A 3NZGA 1TO3A 3OQEA 4YL2A 1H5YA 2X8HA 4REQA 4IJRA 1T41A 1D8WA 2WVTA 4TTGA 2VRKA 4E2OA 4AY8A 5AC4A 1J0YA 2A85A 1UQYA 1D7YA 1JULA 1T6MA 2PDFA 2QGHA 2WVUA 1GREA 5SWUA 5E6YA 3SM0A 3IJQA 3B8SA 1QHPA 3AISA 2E5AA 1BXBA 1HKKA 4O18A 5FS8A 2FIQA 4X2RA 1R3QA 2PWGA 4W7VA 2QPXA 2WLYA 2WLZA 3P60A 3TJ4A 2CKSA 4PZVA 3ZWSA 3H21A 4MZ1A 1UD6A 4HMCA 2W3SA 4J3UA 4KCUA 4L1GA 5FOOA 3CL8A 3W26A 1F05A 7ENLA 4AYSA 3K1DA 2F8QA 4PMQA 4TVWA 2HROA 4K3ZA 4C65A 3QFEA 7TIMA 1ESWA 2VJXA 3AAMA 1NY1A 2ICSA 1ISYA 2Z00A 4I8DA 3UCDA 1SFLA 2D22A 3UR7A 1GOQA 1UG6A 3ZYZA 1I2PA 4MG4A 3A5FA 1ONRA 4PEKA 1XIEA 3IV8A 3N3TA 1N61C 3CZKA 3DX5A 4ZQCA 4ICNA 3QOKA 3U57A 1UP2A 3DH9A 4ZE5A 6ALDA 2GOUA 2WWCA 3SN4A 3ENLA 3TXZA 3VGFA 5A8OA 4O53A 1IXOA 3DCPA 5H8PA 3QY7A 1JUEA 1WOBA 2FKPA 5IFTA 4K2SA 3W7QA 3RHGA 3HMCA 4XZHA 1BAGA 1ZLPA 5CLWA 1AJ0A 3OGRA 4YS1A 2V63A 1XYAA 3C2VA 1NDYA 1WAWA 4QDMA 3STPA 3NWRA 1JNDA 3MS8A 1JEZA 2W3RA 5G5IA 1YRRA 1V3LA 1TE1A 4JPGA 4AISA 3E1F1 1H7OA 1XGDA 1H49A 4NYYA 1A5OC 5H91A 4ZZ9A 3NVYB 2CNCA 3W83A 3A9BA 1XYLA 4GA8A 4IMGA 5EMLA 2GQ9A 2X50A 3MUXA 4RV8A 3WDJA 3CEUA 3K8KA 3VMOA 1A4LA 1FX6A 3TW7A 3NVWB 4D2JA 1TZ9A 1HJSA 2FJUB 4HP5A 4IIBA 3FJ6A 1GOWA 1FHLA 1TMLA 4JCLA 1E0XA 2W61A 1K6AA 2JK6A 3HBLA 1W56A 5AHNA 5CAHA 1UPPA 4JQ3A 2ZWZA 1DE5A 3M0LA 3W7OA 3SGGA 4HJFA 4DBEA 2PZNA 3QLDA 3H55A 6PTDA 4JYDA 3AMDA 4ZOBA 1A5AA 1UH3A 2WBGA 4LNYA 4NJGA 2NT0A 1DTNA 4BCEA 1HVXA 5TQLA 1HTIA 2CU0A 1KFKA 1GG0A 3FJ4A 4RZ4A 1OEPA 1E56A 4I6VA 4C6NA 4C6LA 4EPDC 4OQVA 5LGZA 5IHSA 1QNSA 2VEKA 4BY3A 2IPFA 1U5JA 3KW3A 1OINA 3WJYA 4O11A 2DIEA 1PDYA 2W5FA 3W88A 2PTYA 1F61A 1Q63A 2QDGA 4LUJA 4OWGA 2OZ3A 1TQJA 3N3MA 2ZRYA 2P1FA 2R1MA 2Y2WA 3W07A 4L4OA 1Q6QA 4BA0A 1YMYA 3LHUA 3SQLA 4FOUA 6TIMA 4DI9A 1S5VA 4BHYA 2AMGA 2V3AA 1HJWA 2VX4A 3NO5A 1N7KA 3EB4A 1J01A 3B9EA 3VIOA 3WD1A 1GQLA 1L6SA 1GQIA 3HQ1A 5AZ0A 5CBIA 1I2RA 3TAKA 5JCKA 3R0DA 1B54A 4NNCA 2WMIB 4XIMA 2PI6A 4E5TA 2XIOA 2IQDA 3FDGA 1KQYA 1MWOA 5LSMA 2FH8A 3SCOA 9XIMA 3U2CA 1DXIA 1NDVA 1AK5A 4JTLA 3OVRA 3NDZA 4WDXA 2AGTA 5CPOA 2C71A 1S2UA 1CGWA 2G3JA 3NL3A 1RM6B 1XHGA 1BXCA 5G1YA 3UWUA 6XIMA 3AOFA 3FXGA 1Q2SA 3IUDA 2C19A 3V4BA 1JUKA 1O95A 2Q3RA 3DAQA 3UG8A 1TTIA 3QRHA 4LYRA 3NXLA 3NVDA 3ZM8A 3HURA 1BTMA 2VX6A 2E67A 3IC9A 2HK1A 5HK4A 7REQB 1UD4A 3COTA 2UV8G 1VZWA 3W2MA 2DJLA 3FHAA 2Y7FA 2GL5A 1HKIA 4ROQA 4KS0A 4E8DA 3TOPA 3MVTA 5LIKX 5HA7A 3B0XA 2FZNA 1NP0A 4A8LA 1CXEA 3S2CA 2Y89A 1RZMA 1ZGDA 3BURA 1PIFA 3C0SA 3AFBA 4LVBA 3RLUA 4QAIA 4ROPA 1AFSA 3URHA 3QPZA 4CCEA 1VEMA 2XIJA 3PM6A 2C18A 4H4QA 3O6CA 4CD8A 4A3HA 1W32A 2I5IA 1I2NA 2B31A 2D2GA 3H2FA 4QCEA 5HMEA 1H2JA 5CKSA 1SJDA 1QRQA 1MDLA 3XIMA 1AOGA 1EZWA 1ITXA 3JR2A 3GRTA 1ECQA 1OZQA 1VFOA 3D0CA 1I45A 4M1BA 5I07A 3Q67A 3OVQA 2AQWA 3ARXA 3S6TA 5D2YA 2WVVB 3T0AA 4D72A 2VZUA 3DYMA 4RX0A 4AW7A 3LHTA 4AYGA 3T78A 2PSNA 5T9BG 4C6IA 1NU5A 4FA3A 4ES4A 1A5BA 1I75A 2VTFA 1EIXA 5A6SA 3DG7A 1IYXA 4Z2HA 1GTHA 3WQDA 5JCMA 3B8VA 1QI5A 4L6DA 5BRQA 2EQ8A 3O2LA 3RITA 1VRXA 3VIIA 4LIIA 1FO4A 2WJFA 4UQDA 1GW9A 1W5NA 3F7JA 4PMZA 4EPKA 1XBYA 1PZ3A 3NQBA 4XZBA 3STFA 1MVYA 4MJMA 4NZFA 1JCYA 3OJGA 1XG3A 3VNLA 1TWSA 4DPQA 2X0HA 3LBOA 1NH6A 2W0UA 5I3GA 4NEVA 4LBUA 2YA2A 3AIUA 2QCMA 3AN1A 3D3AA 4EF8A 1TZ7A 1P6CA 2J7DA 2VFGA 2E6FA 4A6GA 1A5MC 3DH7A 3EEGA 3UVAA 3MV01 4WRHA 2CEQA 4AD3A 5D30A 5FF4A 2VX7A 1IT0A 4DJFD 2J24A 2OOFA 1JZ6A 1JYNA 2A8XA 2VGGA 2X8GA 1VQTA 4G1KA 2HJPA 3DJJA 3GIPA 3URAA 3VKCA 4DXKA 2GVGA 4WKHA 1EWEA 3IJIA 3RG6A 2V3FA 3S0CA 3F2BA 4BQ5A 1Q7QA 1AD4A 1JAKA 3SCNA 3N9SA 4TV5A 4W8AA 2WJEA 3IRSA 4RE0A 5K4XA 1Q45A 2XSAA 3WYZA 3IUHA 4NIRA 2B7PA 4DUXA 4BV6A 3WK1A 4XZWA 1MEWA 4AXNA 3OYZA 4MYXA 2G97A 1HJQA 4RDWA 3VMPA 4B15A 5LA1A 3B0UX 1VLWA 3FA3A 4D6HA 3QPEA 4C6DA 3LCGA 1ISWA 2XVNA 1YADA 2VGFA 3W00A 2OG9A 4MM1A 2ACRA 4ZOAA 1XDIA 5CLTA 3VOGA 3W27A 2DGAA 3ZVHA 1UW9A 3DDMA 4GX9A 3FYPA 1GJPA 1M7PA 1NF0A 2GWNA 1VIWA 3ES7A 4JL1A 1F4AA 2OJPA 2CKRA 1BQGA 4NHVA 5D9PA 1KCZA 1XPYA 4K6AA 1DVJA 3W81A 2XFWA 4GISA 1PL9A 3N2MA 5FJJA 5AC5A 2ZVRA 3W1XA 4GXWA 3TLQA 2ZOXA 5DXYA 1LWHA 1WDDA 3GHUA 4LUTB 3KBVA 1M03A 3WMCA 4DWDA 2VKZG 1JDEA 1YEYA 2JKEA 2BS9A 3VD3A 2QV5A 3R79A 3BAKA 2NV9A 3VIJA 2DJXA 2PD9A 1CLKA 3QSRA 1AW2A 5LXEA 4TVYA 1JG9A 1KTCA 3Q2DA 3QC0A 3WQ4A 2BY1A 3MT1A 3CUIA 1WQ5A 3P93A 4FOJA 4FX6M 4A4AA 3DGRA 2CW6A 5AECA 3ZWTA 3GVWA 5EYWA 4BI6A 5JCNA 3RJYA 2ALRA 2WNNA 1J93A 3VKJA 4HPJA 1KFJA 1YPIA 2WHLA 1MRQA 4E8CA 4QAWA 1UH2A 3BLDA 5C6MA 1F3TA 3TH6A 1UD3A 2J25A 2HDJA 3Q45A 3VIHA 3P81A 4OT7A 4HVXA 2FHFA 1GONA 3ZR4A 3N1AA 4L1WA 1JROA 3PZUA 4JKKA 3B9OA 3FGCA 1FBAA 1I1WA 5D2TA 4Q4RA 2DZVA 1OF6A 4QJ1A 1MUCA 3BOFA 4MJ2A 4BF9A 2WHMA 2PF0A 4HNVA 2BHZA 4XZ9A 1DJYA 5HNTA 2RDWA 1FXQA 3WLKX 2KAUC 4HOXA 1EDGA 4CNTA 4KWSA 3EF6A 4KQNA 4CNPA 5CPTA 2V81A 4A05A 1K4HA 1FIQB 4GZEA 1ICSA 1LT8A 3IGHX 1LLOA 3OA5A 4GI6A 2Y61A 3RJXA 4CNNA 1TR9A 4QSFA 1XXXA 2Y85A 3L4VA 3LTYA 3TZNA 3II4A 1P0DA 1SZFA 3HGOA 3O06A 4GIAA 3AQUA 4S3CA 2QR6A 1XCWA 3PN8A 1J2BA 1MSSA 3HPSA 3OQ8A 2XU2A 4E3VA 3VNZA 1GTEA 1UD8A 2WCAA 4JICA 3EB3A 2D20A 4LQ1A 3U2OA 2PP0A 4CKQA 1RP9A 2NUYA 3WLMA 4YLWA 1EEXA 1UWQA 3W7EA 4AD4A 3PUDA 2Y8KA 4AZHA 4JNYA 3WEMA 3OHIA 1ZENA 1JZ4A 1W5OA 5IM51 5D02A 5FCZA 4MB3A 1WKYA 2CFYA 2F7FA 4KETA 2CHOA 5DO8A 4AWSA 3GD6A 3ARPA 3GBDA 4QSHA 3W7PA 4DF0A 5FJOA 4NXKA 3W24A 2AL2A 3LUTA 1XDJA 4UNLA 4QTGA 2PC4A 5KINA 1LWJA 3NQEA 1H2IA 1S1RA 2R91A 4M1RA 2V8ZA 3HQNA 1W9PA 1XBXA 3W74A 4EF9A 3VX1A 4B5UA 1G4SA 1DOSA 1NOFA 2R24A 4KKXA 3DUGA 3DK8A 3B04A 3EBVA 2IS7A 2Z1WA 2IPWA 3DI1A 4FX7A 1A0EA 1S2VA 3CIWA 4O15A 1NELA 1XQKA 2RUSA 3E2SA 1P6BA 2WOIA 5F7UA 2HS8A 5A8NA 1Q3NA 4ZVJA 3QH2A 3E0FA 4H00A 4MYAA 4WXZA 5FS6A 3BWWA 3WEOA 4DUOA 1JCJA 1Y65A 3ANVA 3LGDA 1MXDA 4GCAA 3M6DA 3MZNA 4D6EA 1VAHA 1CGUA 1PHQA 3D6NA 1M01A 4B9YA 3WQCA 2Q8LA 3OPSA 5AVHA 5C2CA 3MB9A 4CQDA 2QUUA 2PDLA 3GXFA 2PTZA 4IH3A 3R6IA 5DN1A 1BYDA 2D3LA 2D23A 1DXFA 4AD1A 1Y5WA 1QBBA 5I3KA 3MWAA 2Z0IA 4JYEA 2WMJA 4MLJA 1EC9A 4GY0A 3N6JA 1IE7C 2VOTA 1UKQA 3WNMA 4ERIA 1GYMA 1I8JA 3FXYA 3IJ7A 1F74A 1VCFA 3MSDA 1VFUA 1K9EA 2W67A 3UXDA 1W2PA 1QOPA 3R0KA 3V0TA 1JAEA 4M82A 1LOLA 3O9NA 3MU7A 1OQFA 4K8GA 1H50A 5TR3A 3I3DA 1Q13A 2PDWA 2HTMA 1FDJA 3S3GA 4ZO7A 5JMUA 4B5TA 1EYEA 2GUBA 5BROA 4C6OA 2QGYA 1WUEA 3THCA 3VD7A 5TNVA 4U28A 1FDZA 1R47A 4AF0A 4K7VA 2EHHA 3AYSA 4AY7A 4MMWA 3LA4A 7TAAA 3IJLA 1LOQA 2H8ZA 2OPJA 2VENA 3C0LA 1MNZA 5IBXA 1BYAA 3A23A 4HTBA 2BLEA 3BDKA 1RJQA 4H9TA 1RQHA 1WYGA 1UD2A 4JTEA 3CT7A 4GUGA 3T08A 4LEQA 4QNWA 3W28A 5CXPA 3JZUA 4XV0A 1IWAA 3CV6A 1U2YA 1UJPA 3IJ8A 1Q6EA 1EH9A 1A5LC 2Z1SA 1JCNA 3A24A 3E0VA 1NFBA 4LRSA 1WDRA 2CLIA 1TR1A 2FTWA 2WC7A 3FLUA 3LN3A 5AYYA 5FAJA 5B80A 2V6OA 3L0NA 1KRAC 2NX1A 4WDTA 1NHRA 3I7QA 3SGZA 3AMKA 3GAYA 3QQ0A 2GLKA 1ZBKA 2PE4A 2BASA 1E72M 4MADA 1WBHA 3M64A 3WDHA 4ACZA 3WLLA 4U3CA 1FCUA 5EBKA 2QCDB 1XH1A 2ADAA 2GVEA 4HSHA 2JEQA 4LYKA 4ICMA 1CB2A 3AICA 3ZIZA 5KETA 1NWUA 2POZA 5JCLA 2VWTA 3ABSA 3RX4A 2XGIA 2OX4A 4FNSA 3NAVA 2XPKA 3N2BA 3NYZA 4NSBA 4M80A 8TIMA 5ABFB 1E6PA 3BTNA 1VJSA 1OADA 3JRKA 1MI3A 3O7UA 3HMJG 1T0OA 2XG9A 1ZBCA 3H6OA 3ARVA 4N9BA 2I17A 4WIWA 1VR6A 4NG3A 5AN7A 3KZPA 3TC7A 1C9DA 4DN1A 1BYBA 2Z7GA 2GR1A 4I8YA 4LGXA 4CCZA 3WBXA 1H7RA 1NJJA 4N7QA 4UOQA 1LL7A 1XLHA 1M6JA 1XL9A 5C2XA 1SMDA 4FNUA 5EGRA 2A79A 1GEHA 4XO7A 2QDDA 1UZDA 2FMOA 4INFA 1F9CA 1E6QM 3PB2A 4UTJA 2PDMA 3P0WA 1B3XA 4EK7A 3UU0A 3UPWA 1CENA 1EDQA 1NOWA 5BRPA 2Y5SA 1E3XA 3SGUA 4RLIA 4GXPA 4NKCA 2YW3A 4YYFA 3NQFA 1QDSA 3GG0A 3I10A 2W62A 1E4IA 1C92A 2DSKA 3ETRB 4KIEA 4BF5A 2CLEA 1SR9A 2X8CA 2VR5A 4K39A 1H1ZA 1Z41A 3WF1A 2X8RA 4HPNA 4WGXA 1J10A 1O12A 2ABBA 3UR2A 2RH9A 2DY3A 5E09A 1ZP4A 4UTTA 3GYEA 4LWWA 3DFSA 5LXXA 3S1GA 4QS5A 3BLKA 4ERGA 3K4AA 3P82A 4DBUA 1JDCA 3C56A 4WX2A 2E9MA 5BXSA 1UKPA 4FOKA 4DO4A 2WPCA 4QEHA 2F6UA 1YW1A 1POKA 4S3JA 3EWCA 3A7UA 4NP7A 1H0GA 4CGTA 3QYQA 3B4YA 4XAFA 4FX9A 1HXJA 1JRCA 4PL1A 3UWQA 3B4UA 1PBGA 2VEFA 1ZPTA 3L5LA 1DJQA 2Y5EA 1OFOA 5F4SA 1B3WA 3EB2A 4NJKA 1B3VA 3DENA 5A6KA 3K8MA 4REQB 1EUNA 1MEHA 5C9WA 1LT7A 3OBAA 2WKLA 2X99A 3EX6A 5LNSA 1EPXA 3N2XA 8CGTA 1FXPA 2VUYA 2LLEA 3LGEA 5PTDA 4PMOA 3NQVA 5AHIA 1SZEA 1FWBC 4ZB5A 4IXXA 3E5PA 3OODA 3R13A 4ENLA 1LRTA 3AHXA 2ONEA 1EBGA 2D69A 3DFTA 8A3HA 5I03A 3W82A 2PDCA 1FA2A 3K13A 3WKZA 4Z2IA 3VINA 3DC0A 3KE0A 3TWBA 4PMUA 1X7IA 4GGHA 1KKOA 3A47A 3W85A 4YHGA 1FWDC 1UWAA 1O1ZA 1CLVA 1RPXA 3WF0A 2W91A 3B97A 1F6PA 4YN5A 2WMFA 5A2BA 3DGHA 4MGGA 3RO6A 2O92A 3DN5A 2VFDA 5FEXA 1R87A 3AWOA 3SRDA 1PWMA 3H54A 4FXFA 4NL1A 3IAQA 3V5CA 1B9BA 1K9DA 3PG6A 4H4SA 2NVCA 4FEZA 4QIUA 2QF7A 3P84A 1HGYA 1FFVC 2Z25A 2R1KA 3DU0A 5LNRA 4H19A 2GJRA 4HCLA 4IMEA 3CGEA 5TIMA 4KFPA 5DX7A 3BCFA 5JVLA 4HN4A 2YL5A 4IMAA 2WZMA 3W2NA 1GCYA 1AH0A 3CYJA 2G95A 3SUWA 3SUTA 1CX9A 2JKPA 5BXTA 1X6UA 1FFQA 5C9RA 1JXKA 1TFVA 4XSMA 3HV8A 2YCJA 1HUVA 2VOMA 3ORWA 5GVJA 1QW9A 3IIZA 3LOTA 2Y24A 4RPPA 2EEXA 2BGQA 2DEPA 4LUSA 3EUB3 4HU3A 2TPSA 3W1AA 3V16A 4GH1A 2O56A 1WKFA 3N17A 1JJKA 2PB1A 1GETA 4GG9A 2YCEA 3GDLA 2HXTA 5M2FX 2P8BA 3SECA 4H1ZA 1N60C 1PIIA 2PCEA 5BWAA 1FRBA 1S2AA 3TX9A 1GW1A 1MUMA 4JTDA 3NQ7A 2C1IA 2YB4A 5DQPA 5CJNA 1YTEA 1PHWA 2ZUWA 2GGJA 2PDKA 4FF7A 3N6QA 1A53A 3FVMA 3OZYA 3CHFA 1DIKA 3GVGA 4UTFA 2GGIA 2IPJA 4PTMA 1V3KA 3H70A 5DCEA 3TV8A 1DJIA 4LYQA 1YTDA 2PDGA 4LBRA 5FI8A 3TJLA 1PVNA 5AYXA 4QE5A 1JL8A 4LYPA 3VIPA 2J8TA 2X1TA 1TIMA 4KEUA 3BLIA 1TV5A 1OJXA 2NXGA 2D1ZA 2QYGA 4FF5A 5HQMA 2D0HA 4FS9A 2WOVA 4YTRA 3UZXA 2PEVA 2WHJA 2ZCGA 2GUYA 3LLXA 1K7XA 1FWHC 3EPMA 4UFLA 5KZ6A 4NX5A 4B5VA 2ZADA 5C7VA 2PWFA 3HGJA 1EHNA 5A95A 2PWHA 5ABEA 1I0BA 3F4VA 1MFUA 1PTAA 4EX4A 3SCVA 1Z8AA 5M17A 2WMKA 2QCHA 4GQRA 3VZYA 1TVLA 2DH3A 3OVPA 4CCCA 5G2WA 3WUEA 3M16A 4IIFA 2W54A 2WKGA 3KDNA 4IUOA 1UJQA 3M0YA 4IFKA 1HQTA 4Y9AA 3CZEA 4DX3A 4Q4MA 1V97A 3BGGA 4BR1A 1K9FA 1NVMA 2GJLA 3CUHA 2QHAA 2FLIA 4ZTXA 3MUY1 4HGXA 4M7TA 4PODA 3M7WA 2CLOA 1WXJA 4H41A 3V5OA 2Y7GA 4UIOA 5EY5A 3SCPA 1VPXA 4JIPA 3HZ3A 2BP1A 2PBOA 4XIAA 4DHGA 4KRZA 2YXOA 4OOUA 2JGQA 5HR6A 2E5DA 1U1UA 1Y5VA 1J0ZA 2PTWA 1FUYA 1O68A 4C6PA 3QEZA 5FJRA 3RAOA 2QMJA 3O0FA 1IEWA 5BRBA 5H6HA 4GO9A 4GNKB 2F2KA 1H41A 4IP7A 4O4WA 3DYPA 5GNXA 1Q6OA 1UR9A 5LIXX 3CB3A 4AZCB 3XINA 2B81A 3GNPA 1PKNA 2G50A 3VKKA 4R34A 4HA0A 3NXFA 3TR9A 3U9IA 1VFSA 3CQHA 4O1BA 1S2TA 4L65A 4M6UA 1EO5A 3U2EA 2FZDA 1IXQA 3NQGA 5E93A 3VGHA 2QCNA 4N9CA 2OWCA 3OB8A 3CJPA 5I3IA 4RL3A 2OVLA 1Z6KA 2O4MA 3I6RA 1E6RA 1TPH1 4YTQA 4B5NA 1S7MA 4ORIA 5DELA 5E9AA 5DANA 1AJZA 2ALDA 5C7HA 3KWXA 2EF9A 3MKCA 3B03A 4FXSA 3CGCA 5IFPA 1JGIA 3O16A 5CSRA 3TVAA 1ECEA 2DIJA 1QOXA 1RP8A 2PLJA 4Y90A 4GJIA 2I5QA 1OFEA 4PB5A 1ZBWA 4EQWA 1HKWA 3ZJ7A 1L6FA 1V6VA 4FAMA 2I16A 1GVOA 4H8VA 2E0PA 3BQ6A 3SAZA 2R1NA 1XS2A 1JYWA 1V6YA 3NQAA 4GWEA 3HU7A 5I00A 1EA0A 1DXLA 1VJZA 4J1OA 5JRBA 3DK4A 1F07A 3AMZA 4JY8A 2BGNE 3ZLHA 1BVZA 1C90A 2Z6JA 1XIJA 2J8GA 5JXQA 5FSEC 3A12A 4D6GA 4Z2KA 2DU2A 3QGVA 5K9XA 4I5UA 2V2HA 4H8NA 1OYAA 5K2ZA 2RKXA 2FZBA 1ZAIA 4G56A 3NZRA 3Q65A 4HIBA 5C9XA 4YHEA 1T99A 3MO7A 4DNHA 3ZXWA 4LU0A 2Z2UA 1YLVA 3MMTA 1W1VA 3BCDA 4E2VA 3QV6A 4F2TA 4AMAA 4Z2JA 4GKTA 4E4PA 3ES8A 1GVQA 1O5XA 3WQEA 4F9JA 3DERA 3SCRA 3AUJA 3ICJA 2GK1A 1H4PA 1QK2A 4GNJA 3P0XA 4HOWA 2CWNA 3GZAA 4D9PA 2PRLA 1TPVA 3CAWA 1XYCA 1HL2A 2QDHA 4TOQA 4ZXOA 7A3HA 3EKLA 2P50A 1I2OA 2DH2A 2EPOA 1JI2A 4PTXA 1UH4A 3N9KA 3H2OA 1E15A 3KVMA 2C3DA 1EO7A 2W66A 3BAYA 4QRNA 1M6IA 4WK9A 2NQ5A 2XVGA 4MWAC 3EX1A 4QEEA 1TV2A 2X2YA 4PUMA 3C52A 4ADUA 4LB4A 4XUGA 1WKDA 5F4XA 3EWDA 2UZ9A 1TVNA 1NP2A 4H01A 1V4YA 2J47A 4TX8A 3B8IA 1EF3A 1R9YA 2YDQA 3OTRA 3KBWA 2JF7A 4YVXA 4RDYA 3VILA 3KOYA 5EMKA 5A1AA 3B9DA 3CPGA 1KR1A 1DHPA 3CAQA 3G5EA 4PE8A 2A3CA 4JX6A 2BTMA 4NZ1A 2YBTA 1WX0A 2Z24A 3L4TA 4JTKA 3PSVA 3ABZA 2VEGA 2YYUA 1OD8A 3H7UA 4R33A 4CQ9A 1XLCA 1XKJA 3M0XA 4O4VA 3CH0A 1W91A 5FSDC 2OZ0A 2BDQA 1EHAA 5LKYA 3P8JA 1BQCA 3A6OA 4FX8A 3OO2A 4Q8QA 2VC7A 5HQEA 4HHLA 4RPQA 4RCXA 4JTSA 1LJYA 3ZVHB 2AQVA